Welcome to Scribd, the world's digital library. Read, publish, and share books and documents. See more
Download
Standard view
Full view
of .
Look up keyword
Like this
1Activity
0 of .
Results for:
No results containing your search query
P. 1
Upaya Pemanfaatan Umbitalas Sebagai Sumber Pati Pada Pengembangan Teknologi Pembuatan Dextrin

Upaya Pemanfaatan Umbitalas Sebagai Sumber Pati Pada Pengembangan Teknologi Pembuatan Dextrin

Ratings: (0)|Views: 9 |Likes:
Published by tulus

More info:

Published by: tulus on Jul 29, 2012
Copyright:Attribution Non-commercial

Availability:

Read on Scribd mobile: iPhone, iPad and Android.
download as PDF, TXT or read online from Scribd
See more
See less

05/13/2014

pdf

text

original

 
ProsidingSeminarNasionalIptekSolusiKemandirianBangsaYcgyakarta,
2-3
Agustus2006ISBN
9793688599
UPAYAMEMANFAATKANUMBITALAS
(Colocasiaesculenta)
SEBAGAISUMBERBAHANPATIPADAPENGEMBANGANTEKNOLOGIPEMBUATANDEKSTRINAgusTriyono8alai8esarPengembanganTeknologiTepatGuna-L1P[Subang
41211,
Telp:
0260-411478,412878,
Fax:
0260-411239
ABSTRAKPenelitianinibertujuanuntukmempelajaripemanfaatanumbitalasdalampembuatandekstrin.Manfaatdaripenelitianiniada/ahsebagaisalahsatua/ternalifpemanfaatanumbita/asmenjadikeanekaragamanproduk,dandiharapkandapatmemberikaninformasibagaimanameningkatkannitaiekonomisumbilalasyangadadiIndonesia.Metodepercobaandiawalidenganpercobaanpembuatanpatidaribeberapavarietasta/as,penentuankonsentrasisubstratdanlamadekstrinasi,kemudiandilanjutkandenganpercobaanutama.Adapunvariabelperiakuandengankonsentrasienzima-amilaseadalah
a1
(0,3
%),
a2
(0,4%),dan
a3
(0,5%).Analisiskimiayangdilakukanadafahpenentuankadarair
(%),
kadarabu(%),dankadardekstrosa
(%).
Ana/isisfisikyangdilakukan,yaitukekenta/an(cp)danrendemendekstrin
(%).
HasilpercobaanmenunjukkanbahwahasHanalisisyangterbaikadafahperlakuan
a1
(konsentrasienzim0,3%)denganI{adarabu
1,29%;
kadarair
7,65%;
kadardekstrosa6,42%;kekentafan
1,18
cpdanrendemenyangdihasilkansebesar77,23%.Katakunci:Ta/as,pati,dekstrin,enzim,dekstrosaABSTRACTTheaim
of
thisresearchisstudytechnology
of
dextrinproducedfromTarostarchbyusinga-amylaseenzyme.Theadvantage
is
one
of
severalalternatives
of
diversificationproductofTaroprossesing,andhopesthatgiveinformationofaddedvaluebyTaro
in
Indonesian.Themethodisconductedhowtomaketarostarchfromseveralcultivar,determination
of
substractconsen/rationanddextrination.time.Andthemainofresearchistreatmentofvariableenzymeconsenirationsuch
asa1
(0,3
%),
a2
(0,4
%),
a3
(0,5
%).
Thephysicalandchemicalanalisisareviscosity(cp),yield
(%),
watercontent
(%),
ashcontent
(%),
anddextrosecontent
(%).
TheresultshowedthattheTaroisApucultivarhadyield
19,57
%,
withstarchcontent
74,34
%,
watercontent15,01
%,
ashcontent
1,19
%,
andviscosity
1,3
cp.Dextrinaliontimeis120minutesatsubstrateconsentration
20
%.
Theresultofdextrinshowedthatthebesttreatmentis
a1
(0,3
%
ofa-amilaseenzyme)withwatercontent
7,65
%,
ashcontent
1,29
%,
dextrosecontent
6,42
%,
viscosity1,18cpanddextrinyied
77,23
%.
Keywords:Taro,starch,dextrin,enzyme,dextrose
PENDAHULUANIndonesiasebagainegarayangberiklimtropismembuatberanekaragamtanamandapattumbuhsuburdiIndonesia.Salahsatukomoditasumbi-umblanyangselamainikurangmendapattempat,danmemilikipotensiekonomiyangcukuptinggiadatahumbitalas.PadahalkelompoktanamantalashampirbisaditemuidisetlapkepulauanIndonesia.Salahsatusifatkekuranganpadapatipadaumumnyaadalahtidaklarutdalamairdingin.Sehinggaberpengaruhdalampengg~naanpati,.selainpemasakannyamemakanwaktuyangcukuplama,pastayangterbentukjugacukup'keras,karenaitupatk,tersebutperludilakukanmodifikasiagardiperolehsifat-sifatyangcocokuntukaplikasitertentu,dengandemikianpatidapatditingkatkankegunaanyanglebihluaspadaindustrimakanan.Duniaindustrimakanansudahmulaimenggunakanpatitermodifikasiinisebagaibahanpenolongbagiprosesproduksimakanantertentu.Salahsatuprodukmodifikasipatiadalahdalambentukdekstrin.Kebutuhandekstrindalamindustri,balkdaJamindustripanganmaupunnonpangandaritahunketahunsemakinmeningkat.Sebagianbesardekstrinyangdibutuhkanmasihdiimpordarituarnegeri.Tujuandaripenelitian
tm
adalahmengembangkanteknologipengolahandekstrindarisumberbahanpatiumbitalasdanmeningkatkanpemanfaatansumberbahanpatidankeanekaragamanprodukolahandariumbitalas,sertaDiperolehnyateknologipembuatan
Bldanglndustri
97
 
PresidingSeminarNasionalIplek
Solusi
KemandirianBangsa
Yogyakarta,
2-3
Agustus2006
dekstrindenganbantuanbahanpenolong(enzim)prosesyangefisien.
lSBN
9793688599
METODOLOGI
PenelitianinimenggunakanbahanumbitalasdarijenisApuberasaldarlKabupatenSumedang.PadakegiatanpendahuluandicobacarapembuatanpatidaribeberapajenisTalas,danpenentuanlamaprosesdektrinasidaribeberapakonsentrasisubstrat
pafi,
Penelitianutamaataupenelitianlanjutaniniditujukanuntukmempelajarikensentrasienzimc-amllaseterhadapmutudekstrinumbitalas.Rancanganperlakuaniniterdiridarisatufaktordengantigataraf.yaitukonsentrasienzimo-amilase(A)terdiridan:al
=
0.3%;
a2
=
0,4%;
aa
=
0,5%.
PengolahandatayangdiperolehpadapenelitianutamahasilanalisisdiolahdenganmenggunakanRancanganAcakKelompok(RAK)satuarah,dengan9kaliulangan.
HASILDANPEMBAHASAN
Pembuatanpatitalas,terlebihdahuludilakukanpemilihanumbitalasyangbaik.Setelahitudilakukanpengupasan,pernarutandanekstraksi.Pemisahanpatidilakukandengancarapengendapan.airbagianatastersebutdibuangdandilakukanpengeringanuntukmengurangiairyangterkandungdalampatitalas.Tabel1.HasilProsesPembuatanPatiDariBeberapaVarietasUmbiTalasVarietasWarnaKeadaanEkstrakPengendapanHasilTalasTalasTepungTerpisahTidakDapatTidakPatiOapat
(%)
Bogor-TalasketanPutihburamTidakLama
10,50
-TalaslomaAgakunguTidakLama
10,58
Sumedang-TalasApuPutihabuTerpisahAgaklama19,57Rendementepungpatitalasyangdihasilkandaripercobaaniniadalahsebesar19,57
%.
MenurutTjiptadi(1985)didalamRidal
(2003),
bahwabesarnyaumbibelumtentudapatdigunakansebagaisuatutandabahwaumbitersebutmempunyaikadarpatiyangtinggi.Tetapi,padaumumnyakadarpatiyangtinggiterdapatpadaumbiyangbesardantuaoptimum.Dalamhalininilairendemenlebihberkaitandenganumurpanenumbidankadarpatiumbi.Umbiyangberumur
12
bulandapatmengandungpatilebihdari
20%.
Analisiskimiapatitalasmeliputikadarabu,kadarairdankadar
patl,
Hasilanalisisbahanpatitalasyangdigunakanpadapembuatandekstrinadalahsebagaiberikut:Tabel
2.
Hasilanalisiskimiatepungpatitalas
No.
KomposisiSatuanKandungan
1
KadarAir
%15,012
KadarAbu
%1,193
KadarPati
%74,344
KadarProtein
%0,44
5KadarLemak
%0,41
6KadarSerat
%0.23
7
Kekentalan
c~_
3,5
MenurutWinamo
(2002),
airrnerupaksnkomponenyangpentingdalambahanmakanankarenaairdapatmempengaruhipenampakan,dantekstur.Kandunganairdalambahanmakananikutmenentukan
acceptability,
kesegaran,dandayatahanbahantersebut.Abuadalahzatanorganiksisahasilpembakaransuatubahanorganik.PenentuankadarabudilakukanuntukmengetahuiadatidaknyS""perubahankandungananorganiksetelahproses,sebabselamaprosesberlangsungadapenambahanbasaatauasamuntukpengaturanpH.
BidangIndustri
98
 
PresidingSeminarNasionalIptekSolusiKemandirianBangsaYogyakarta,
2~3
Agustus2006ISBN
9793688599
Kadarabuyangterkandungpadatalasadalah1,19%.TingginyakandunganabuinldisebabkanolehkesulitanpadaprosespengendapanpatLEndapanyangdihasilkanmasihberupakoloidsehinggaperluadanyaperlakuantambahan.Hallnljugadisebabkanolehkandungansenyawaglikomananpadatalasyangmengakibatkanpatisulftuntukmengendap.Serdasarkananalisisdiketahuibahwakadarpatitalascukuptinggiyaitu74,34%.Halinlmenunjukkanbahwapatitalassangatberpotensidijadikanbahanbakuuntukpembuatandekstrin.Patiakanmembentukkomplekswarnabiruapabiladitetesidenganpereaksiyodium.MenurutWinamo(1995),dekstrinakanmenghasilkankomplekswarnacoklatjikaditetesipereaksiyodium.Dalampenentuanlamaprosesdekstrinasimenggunakanenzima-amilasejenisfungamyl(enzimdarifungi),dilakukanpadakonsentrasisubstratpati(20
%;
25
%;
30
%),
suhuproses40°CdanpH6,dengankonsentrasienzimaamilase0,3%.Serdasarkanujiyodiumyangdilakukanterlihatbahwapereaksiyodiumlarutandekstrinmembentukwarnacoklatsetelahwaktuproses120menit,padakonsentraslsubstrat20%dankonsentrasienzim0,3%.Halinimenunjukkanbahwapatisudahteruraidandekstrinterbentuk.Penelitianutamainidilakukanpengamatanterhadappengaruhkonsentrasienzima-amilaseterhadapmutudekstrindariumbitalas.Hasilanalisispadapenelitianutamainimeliputikadarair,kadarabu,kadardekstrosa,kekentalandanrendemen.Kadarabuadahubungannyadenganmineralsuatubahan,danmineralyangterdapatdalamsuatubahan(Gambar1)dapatmerupakanduamacamgaramyaitugaramorganikdangaramanorganik(Sudarmadji,1996)Nilaikadarabupatiasaladalah1,19%.Apabilanilaiinidibandingkandengankadarabudekstrinyangdihasilkan,makanilaikadarabudekstrinlebihbesardarinilaipatiasalnya.Tabel3.HasilPenentuanLamaDekstrinasolehenzimaamilasejenisfungamylWaktu(menit)Konsentrasilarutanpati20%25%30%0SiTUtuaBirutuaSirutua
5
BirutuaBirutuaSirutua15BirutuaBirutuaSirutua20BirutuaSirutuaSirutua
25
BiTUtuaBirutuaSirutua30SirutuaSirutuaSirutua35SiTUtuaBiTUtuaSirutua
40
SirutuaBirutuaSirutua
45
SiruSirutuaSirutua
50
SiruSirutuaSirutua55SiruSiruSirutua60SiruSiruSirutua70SiruSiruSiru80SiruSiruSiru
90
SiruBiruSiru100SiruSiruSiru110Siru
.
SiruSiru120CoklatSiruSiru
-.
BidangIndustri
99

You're Reading a Free Preview

Download
/*********** DO NOT ALTER ANYTHING BELOW THIS LINE ! ************/ var s_code=s.t();if(s_code)document.write(s_code)//-->