Welcome to Scribd, the world's digital library. Read, publish, and share books and documents. See more
Download
Standard view
Full view
of .
Save to My Library
Look up keyword
Like this
462Activity
0 of .
Results for:
No results containing your search query
P. 1
Biofarmasetika

Biofarmasetika

Ratings:

4.0

(1)
|Views: 45,857|Likes:
Banan ajar untuk Farmasi
Banan ajar untuk Farmasi

More info:

Categories:Types, Resumes & CVs
Published by: Dr. I Made Agus Gelgel Wirasuta, M.Sc. on Mar 08, 2010
Copyright:Attribution Non-commercial

Availability:

Read on Scribd mobile: iPhone, iPad and Android.
download as PDF, TXT or read online from Scribd
See more
See less

03/24/2014

pdf

text

original

 
BIOFARMASETIKA
I M A GelgelWirasutaRasmaya NiruriDewa Ayu
TIU:
SetelahmengikutikuliahBiofarmasiini, Mahasiswasemester IV JurusanFarmasiFMIPA UNUDdapatmenerapkanteoridasarBiofarmasidalammerancangsediaanfarmasidenganbenar. (C3)1. Menjelaskan pengantar biofarmasi dan farmakokinetika (C2)4. Menjelaskan biofarmasi sediaan yang diberikan melalui oral, rektum, kulit,mata, paru-paru dan parenteral (C2)
Farmaseutika Dasar Toksikologi UmumKimia Fisik Farmasi  Anatomi fisiologi manusia
„Entry Behavior“ 
2. Menjelaskan parameter yang berpengaruhterhadappenyerapanobat(C2)3. Menjelaskan teori pelarutan dan transpor trasmembran. (C2)5. Menerapkan evaluasi ketersediaan hayati sediaan farmasi (C3)
JADWAL PERKULIAHAN BIOFARMASI SEMESTER GENAP2006/2007
TeamMateri pertemuan 1 s/d 6UTS I26-3-0771.Berbagaifaktoryang mempengaruhiLDA obatpadapemberiansecaraoral2.Evaluasi biofarmasetik sediaan obat yangdiberikan secara oral12-3-0761.Anatomifisiologisalurancerna, pembuluhdarahyang melewatisalurancerna2.Komponen dan karakteristik cairan salurancerna3.Gerakan saluran cerna dan waktu transitBiofarmasisediaanyangdiberikanmelaluioral5-3-0751.Aspek teori transpor transmembran26-2-0741.Teori umum pelarutan sediaan padatTeori pelarutandan transpor trasmembran19-2-0731.Menjelaskan berbagai faktor yangberpengaruh terhadap LDA obat2.Menjelaskan berbagai faktor yangberpengaruh terhadap keterserapan dankarakter fisiko-kimia zat aktif Parameter yangberpengaruhterhadappenyerapanobat12-2-0721.Obat dan respons klinik2.Dasar fisiologik perjalanan dan nasib obatdalam tubuh3.Penelitian biofarmasetikPendahuluan5-2-071DosenPengampuSub PokokBahasanPokokBahasanTanggalPertemuanNO
JADWAL PERKULIAHAN BIOFARMASI SEMESTER GENAP2006/2007
1.Berbagaifaktoryang mempengaruhiprosesLDA obatpadapemberianmelaluiparu-paru2.Evaluasi biofarmasetik sediaan obat yang diberikan melaluiparu-paru30-4-07121.Anatomidanfisiologi salurannafas2.PembuluhdarahyangmelaluisalurannafasBiofarmasisediaanyang diberikanmelaluiparu-paru23-4-07111.Anatomi dan fisiologi mata2.Pembuluh darah yang melewati mata3.Karakteristik tiap lapisan mata4.Berbagai faktor yang mempengaruhi proses LDA obat padapemberian melalui mata5.Evaluasi biofarmasetik sediaan yang diberikan melalui mataBiofarmasi sediaanyang diberikanmelalui mata16-4-07101.Anatomi dan fisiologi kulit, pembuluh darah yang melewatikulit2.Komponen dan karakteristik tiap lapisan kulit3.Berbagai faktor yang mempengaruhi LDA obat pada pemberiansecara kutan4.Evaluasi biofarmasetik sediaan yang diberikan secara perkutanBiofarmasi sediaanyang diberikanmelalui kulit9-4-0791.Anatomi dan fisiologi rektum,2.Pembuluh darah yang melewati rektum,3.Komponen dan karakteristik cairan rektum,4.Gerakanrektumdanwaktutransit,5.BerbagaifaktoryangmempengaruhiprosesLDA obatpadapemberiansecararektal,6.EvalusaibiofarmasetiksedianobatyangdiberikansecararektalBiofarmasisediaanyang diberikanmelaluirektum2-4-078DosenPengampuSub PokokBahasanPokokBahasanTanggalPertemuanNOTeamMateri pertemuan 1 s/d 15UASJadwalMIPA17TeamMateri pertemuan 7 s/d 15UTS II28-5-0716 1.Protokol pelaksanaan uji ketersediaan hayati2.Perhitungan parameter ketersediaan hayati3.Penetapan bioekivalen21-5-07151.Metode uji ketersediaan hayati2.Disain percobaan3.Pemilihan subjek uji dan jenis sampel yang akan dikumpulkanEvaluasiketersediaan hayatisediaan farmasi14-5-07141.Anatomi dan fisiologi daerah penyuntikan2.Pembuluh darah yang melalui daerah penyuntikan3.Berbagai faktor yang mempengaruhi proses LDA obat padapemberian secara parenteral4.Evaluasi bifarmasetik sedian obat yang diberikan secaranparenteralBiofarmasi sediaanyang diberikanmelalui parenteral7-5-0713DosenPengampuSub PokokBahasanPokokBahasanTanggalPertemuanNO
JADWAL PERKULIAHAN BIOFARMASI SEMESTER GENAP2006/2007
 
Pendahuluan
I M. A. GelgelWirasuta
Pokok Bahasan
Batasan dan kegunaan biofarmasi dalam farmasi
Perjalanan dan nasib obat dalam tubuh ”sejak darisediaan sampai tereliminasi dari dalam tubuh”
Faktor penentu aktivitas terapetik (Fase Biofarmasetik,Fase Farmakokinetik, fase farmakodinamik)
teori umum pelepasan ”
li 
beration” 
, pelarutan
isolution
, dan difusi/absorpsi ”
a
bsorption” 
(LDA)
Faktor fisio-patologik yang mengubah aktivitas obat
Perjalanan dan nasib obat dalam tubuh
Kontak / PenggunaanBentuk farmaseutik hancur Zat aktif melarut
Fase eksposisi
zat aktif tersedia untuk di absorpsi(ketersidaan farmeseutika)
Fase toksokinetik/Farmakokinetik
AbsorpsiDistribusiBiotransformasiEskresiDeposisizat aktif tersedia untuk memberikan efek(ketersidaan biologik)Efek FarmakologisEfek KlinisEfek Toksik
Fase toksodinamik /Fase Farmakodinamik
terjadi interaksi
tokson -resepto
dalam organefektor 
IntensitasEfekObat
 jumlahobataktifyangmencapaisistemsistemiklajuabsorpsidanfaktorformulasi
Obat=ZatAktif+PembawaDispersipadatanzataktif Dispersimolekular zataktif 
Darah
pelepasan
(liberasi)
pelarutan
(disolusi)
penyerapan
(absorpsi)
ASPEK TELAAH BIOFARMASETIKA
Biofarmasetika
ilmu yang mempelajari hubungan antarasifat fisikokimia formulasi obat terhadapbioavailabilitas obat
bioavailabilitas menyatakan kecepatandan jumlah obat aktif yang mencapaisirkulasi sistemik
Ilmu yang mempelajari masuknya zataktif obat ke dalam tubuh „
Science of input“ (BANNET)
 
Bioavailabilitas obat:
mempengaruhi daya terapetik
aktivitas klinik, dan
aktivitas toksik
Pentingnya biofarmasetika adalah
untuk mengatur pelepasan obatsedemikian rupa ke sirkulasi sistemik agar diperoleh pengobatan yang optimal padakondisi klinik tertentu
Parameter fasebiofarmsetikyangberpengaruhlangsungpadakerjaobatsertafaktorfisiologikyangberperanpadaprosesdisposisiobat
(WAGNER)
Pre-disposisiObatNasibObat
in vivo
Liberasi
Disolusi
•Jalur pemberian obat•oral, rektal, topikal, atau parenteral•Cara pemasukan obat•Dosis dan ritme pemberian obat•Pengaruh bentuk sediaan obat•sifat fisiko-kimia bahan aktif •Teknologi pembuatan
AbsorpsiInteraksi•Kimia tempat pemasukan obat•aliran darah di tempat pemasukan obat•mekanika tempat pemasukan obat „gerak peristaltik“
Fase eksposisi
Terjadi kontak (pejanan/paparan)organisme oleh toksikan, dapat melalui:
kulit
saluran pernafasan (inhalasi)
saluran cerna (oral)
injeksi (penyampaian xenobiotika langsungke dalam tubuh organisme)
Prememory (Fase Kerja Toksik)
Fase kerjaeksposisi:
 
Toksikan
-
selkulit
-
seldidingsal. pencernaan-selepitelalveoliparu-paru
LapisanbarierabsorpsiKemampuanterabsorpsiditentukanoleh:
-
sifatfisikokimatoksikan
-
bentukfisiksediaanfarmaseutikdanformulasi(padatan, semisolid larutan, gas)
-
tempatpejanan(sifatmembrandanalirandarah)
-
sifatdinding/ barierabsorpsi
Toksikansiapdiabsorpsimenujusistemperedarandarah(
ketersediaanfarmaseutika
).
Prememory (Fase Kerja Toksik)
Faktor Farmaseutika
Formulasi- bentuk sediaan- bahan tambahanformulasi- parameter formulasiSifat fisikokimia zat aktif - bentuk kristal- kelarutan- konstanta disosiasi
Prememory (Fase Kerja Toksik)
Sebelum melintasi membranbiologik, zat aktif harus terlarutterlebih dahulu di dalam cairandi sekitar membran.
(sebelum terserap zat aktif harus terlepas dari sediaan,terdifusi, dan kemudianterdispersi molekular)
 
Diagram sistematis membran biologi.
protein integralprotein periferallapisan lemak bimolekul
Bulatan menggambarkan kelompok kepala lipid (fosfatidilkolin), dan baris zig-zagmenunjukkan bagian ekornya. Bulatan hitam, putih, dan berbintil menunjukkan jenislipid yang berbeda. Benda-benda besar menggabarkan protein, yang sebagian terletakdi permukaan, dan sebagian lain di dalam membran. (Disadur dari Siger danNicholson (1972)

You're Reading a Free Preview

Download
/*********** DO NOT ALTER ANYTHING BELOW THIS LINE ! ************/ var s_code=s.t();if(s_code)document.write(s_code)//-->