Welcome to Scribd, the world's digital library. Read, publish, and share books and documents. See more
Download
Standard view
Full view
of .
Look up keyword
Like this
6Activity
0 of .
Results for:
No results containing your search query
P. 1
Matrik Maping HAM PDF

Matrik Maping HAM PDF

Ratings: (0)|Views: 524|Likes:
Published by Hamim Mustafa

More info:

Published by: Hamim Mustafa on Apr 03, 2011
Copyright:Attribution Non-commercial

Availability:

Read on Scribd mobile: iPhone, iPad and Android.
download as PDF, TXT or read online from Scribd
See more
See less

01/14/2012

pdf

text

original

 
BABI
PENDAHULUANdanGAMBARANUMUM
PENDAHULUAN
PujisyukurkamipanjatkankehadiratTuhanYangMahaKuasa,karenaberkatrahmat-NyakamitelahberhasilmenyelesaikanPenelitianPemetaanDaerahKonflikPelanggaranHAMdiPapuapadalimakabupaten,yakniJayapura,Biak,Manokwari,JayawijayadanMerauke.Penelitiandimaksuduntukmelakukanpemetaanterhadappelaku,motif,danmodusdarikonflikyangmenyebabkanterjadinyapelanggaranHAMdiPapuaselamakurunwaktu1995-2001.Penelitianiniberangkatdari
3
pertanyaanpokok.
Pertama
siapa,
kedua
motifnyaapadanketigamodusyangdigunakandarijawabaninidapatdijabarkanlebihlanjutmengenaivariabelyangberpengaruhterhadapterjadinyakonflikpelanggaranHAM,mengetahuipotensikonflikdanperspektifkedepanuntukmembangunPapuabaruyanglebihadildandemokratis.
.
MaksuddanTujuanPenelitian
UntukmemperolehdatayangobyektifmenganimotifdanpelanggaranHAM.Untukmengetahuijenis-jenispelanggaranHAMUntukmengetahuivariabledominanpenyebabterjadinyaPelanggaranHAMUntukmemberikanmasukankepadasemuapihakmengenaipotensipotensisumberkonflikyangmenyebabkanterjadinyaPelanggaranHAM.UntukmenggagasmodelpenguatanaksesmasyarakatdalamrangkamencegahkonflikPelanggranHAM.Penelitianinimenghasilkanpemetaandaritujuantersebutdiatassehinggabukanuntukmenunjukkansiapayangsalahdansiapayangbenarkarenahaltersebutmerupakankewenanganyuridiksidarilembagaperadilan.Olehkarenaitu,makamenjadisangatlahpentingmembawakasus-kasustersebutkeproseshukummelaluimekanismehukumyangadildanbenar-memprosessemuapihakyangterlibatsecaratransparandanjujur.Dengandemikian,adapertanggungjawabanhukumdarisemuapihak.
B.
Target
Yang
diharapkan
Teridentifikasinya:Modus,Motif,PelakudanJenis-jenisPelanggaranHAMselamakurunwaktu1995-2001pada5(lima)daerahpenelitian.
C.
MethodePenelitian
Jenispenelitianbersifateksploratifdandeskriptifdengansasaranpenelitianmelaluipendekatanproposionaldanrepresentatif.Tehnikpengumpulandatadilakukandenganpendekatanempirik:Observasidanwawancara.Tehnikpengelolaandatadilakukandengan:Editing,codingdanTabulasi.SedangkantehnikanalisadatamelaluiKualitatifdanKuantitatif.Dalamupayamenjawabpertanyaan-pertanyaantersebut,datadiperolehdaridokumentasitertulisbaikberupabuku,majalah,koran,sertadokumen-dokumenyangtidakditerbitkan(untukkalanganterbatas).Selainitudatajugadiperolehmelaluiwawancaramendalam,diskusikelompokterfokussertadiskusikritisdenganpakar/tokohinformanyangdiwawancaraiyangmerupakanrepresentasidarimasyarakat,yaknitokohmasyarakat,tokohagama,tokohadat,tokohperempuan,LSM,aktifisHAM,jurnalis,Pemerintah,Militer,Cendikiawandankelompoksipilbersenjata.
 
Secaratehnis,tahapanpemetaaninidilakukansebagaiberikut:TahapIPenelitiandiawalidenganTrainingmethodelogiselama2hariTahapIIPenelitiankemasing-masingdaerahselama70hariTahaplllPerumusanhasilpenelitianselama15hariTahaplVPresentasehasilpenelitian
I
daerahselama5hariTahapVPerbaikanhasilpenelitianselama10hariTahapVIDiskusiterfokusbersamapakarselama4hariTahapVIIPerbaikandanpersiapanseminarselama14hariTahapVIIISeminarselama1hariTahapIXPerbaikanhasilsecarakeseluruhan
I
finalselama14hari.
D.LokasiPenelitian
Ketikamenentukan510kasidaerahpenelitiantentangPemetaanDaerahKonflikPelanggaranHAM,nampaknyasangatsulitdipilihsecaraacak,disebabkansetiapdaerahdiPapuaberpotensikonflikyangdapatmengakibatkanterjadiPelanggaranHAM.Karenanyakamimencobamemilihdenganmempertimbanganalasangeografis:Utara-Selatan,Laut-gunung,dalamdanperbatasan,sehinggamenghasilkan5lokasidari5lokasitersebutkamimengadakanpenelitianpadaKecamatan,Kelurahan/desadenganpertimbangangeografis(iurnlahkecamatandankelurahan/desa),demografis(heterogenitaspenduduk)dankecenderungankonflikyangterjadiberdasarkandataawalyangkamihimpun.Kabupaten/KodyaJayapuradenganwilayahyangsangatluaskarenameliputi2wilayahadmintsrasiterdiriatas24kecamatan6Kelurahandan225Desa.Makapenelitiandilakukanpada11Kecamatandan22Kelurahan/Desa.1.Kec.DemtaDesaMuriskecilDesaAmbora2.Kec.GenyemKel.PobaimKel.TabriDesaBesumDesaKaryaBumi
3.
Kec.KemtukGresiDesaSabronSamon4.Kec.SentaniKel.Inakombe
 
Kel.SentaniKota5.Kec.AbepuraKel.HedamKel.Asano6.Kec.Jayapura7.Kec.SarmiJayapuraKotaKel.SarmiKotaKel.Mararena8.Kec.TorAtasDesaSamanenteDesaSafron9.Kec.PantaiTimurBetafKuefa10.Kec.BonggoSPVIISPVIII11.Kec.ArsoArsoKotaArso
PIRIV
KabupatenBiakNumforSecaraadminstrasiBiakNumformembawahi12Kecamatan11kelurahandan142Desa.Makapenelitiandilakukanpada5Kecamatandan26kelurahan/desa.1.Kec.BiakSelatanKel.WaufnorKel.BurokupDesaSumberkerDesaAmbrobenDesaMandala2.Kec.BiakTimurDesaMnurwarDesaWonigi

Activity (6)

You've already reviewed this. Edit your review.
1 thousand reads
1 hundred reads
Siti Chotimah C liked this
Al_Muzaini_57 liked this
Jams Ahmady liked this
wenagy liked this

You're Reading a Free Preview

Download
scribd
/*********** DO NOT ALTER ANYTHING BELOW THIS LINE ! ************/ var s_code=s.t();if(s_code)document.write(s_code)//-->