ByIsmail,S.Kep,Ns. M.KesFISIOLOGISISTEMENDOKRIN1FISIOLOGISISTEMENDOKRIN ByIsmail,S.Kep,Ns. M.

KesFISIOLOGISISTEMENDOKRIN2STRUKTURKELENJARENDOKRIN Sistemendokrinterdiridarikel enjar-kelenjarendokrin Kelenjarendokrinmerupakansekelompoksusunanselyangmempunyais usunanmikroskopissangatsederhana Kelompokiniterdiridarideretansel-sel, lempenganataugumpalanseldisokongolehjaringanikathalusyangbanyakmengandungpembulu hkapiler Kelenjarendokrinmensekresisubstansikimiayanglangsungdikeluarkankedalampem buluhdarah.Sekresinyadisebut:hormonhormonhormonhormon ByIsmail,S.Kep,Ns. M.KesFISIOLOGISISTEMENDOKRIN3STRUKTURKELENJARENDOKRIN Hormonyaitupenghantar(transm itter) kimiawiyangdilepasdarisel-selkhususkedalamalirandarah Selanjutnyahormontersebutdib awakesel-seltarget(responsivecells)tempatterjadinyaefekhormon.

STRUKTUR DASAR HORMON SECARA KIMIAWI

Derivat asam amino. dikeluarkan oleh sel kelenjar buntu yang berasal dari jaringan nervus medulla supra renal dan neurohipofise, contoh epinefrin dan norepinefrin Petide /derivat peptide. dibuat oleh kelenjar buntu yang berasal dari jaringan alat pencernaan Steroiddibuat oleh kelenjar buntu yang berasal dari mesotelium, contoh hormon testes, ovarium dan korteks

. contoh hormon prostaglandin ByIsmail.Kep. Hormon ini dihasilkan oleh kelenjar gonad Hormon metabolismeproses homeostasis glukosa dalam tubuh diatur oleh bermacammacam hormon. contoh glukokortikoid. glukagon. Ns.Kes klasifikasi HORMON Hormon perkembanganhormon yang memegang peranan di dalam perkembangan dan pertumbuhan. Ns. Asam lemak. merupakan biosintesis dari dua FA. FISIOLOGI SISTEM ENDOKRIN M.S.suprarenal. dan katekolamin ByIsmail.S.Kep.

FISIOLOGI SISTEM ENDOKRIN M.S.Kes .FISIOLOGI SISTEM ENDOKRIN M. Ns.Kep.Kes klasifikasi HORMON Hormon tropikdihasilkan oleh struktur khusus dalam pengaturan fungsi endokrin yakni kelenjar hipofise sebagai hormon perangsang pertumbuhan folikel (FSH) pada ovarium dan proses spermatogenesis (LH) Hormon pengatur metabolisme air dan mineral kalsitonin dihasilkan oleh kelenjar tiroid untuk mengatur metabolisme kalsium dan fosfor. ByIsmail.

.

Kes struktur SISTEM ENDOKRIN Kelenjar eksokrin melepaskan sekresinya ke dalam duktus pada permukaan tubuh. ByIsmail. Ns. Kedua sistem ini bersama-sama bekerja untuk mempertahankan homeostasis tubuh. mengontrol dan memadukan fungsi tubuh.Kep. dalam kaitannya dengan sistem saraf.S. seperti lapisan traktus .Sistem endokrin Sistem endokrin. atau organ internal. seperti kulit. FISIOLOGI SISTEM ENDOKRIN M.

Kelenjar endokrin termasuk hepar. payudara. kelenjar endokrin melepaskan sekresinya langsung ke dalam darah ByIsmail. FISIOLOGI SISTEM ENDOKRIN M. pankreas (kelenjar eksokrin dan endokrin). Ns.S. Sebaliknya.Kes FUNGSI SISTEM ENDOKRIN Membedakan sistem saraf dan sistem reproduktif pd janin yang sedang berkbg Menstimulasi urutan perkembangan Mengkoordinasi sistem reproduktif . dan kelenjar lakrimalis untuk air mata.intestinal.Kep.

FISIOLOGI SISTEM ENDOKRIN M.Memelihara lingkungan internal optimal ByIsmail. Ns.Kes .S.Kep.

Kes karakteristik SISTEM ENDOKRIN Sekresi .. hormon adrenokortikotropik (ACTH).. epinefrin) Hormon yang larut dalam lemak termasuk steroid (mis. testosteron. dopamin. norepinefrin.. ByIsmail. insulin.S. glukokortikoid. aldosteron) dan tironin (mis. gastrin) dan katekolamin (mis. glukagon.. FISIOLOGI SISTEM ENDOKRIN M. progesteron.klasifikasi SISTEM ENDOKRIN Hormon yang larut dalam air termasuk polipeptida (mis. tiroksin).Kep. Ns. estrogen.

Tipe sekresi hormonal yang ketiga adalah variabel .diurnal adalah pola yang naik dan turun dalam periode 24 jam. Kortisol adalah contoh hormon diurnal. Estrogen adalah non siklik dengan puncak dan lembahnya menyebabkan siklus menstruasi. seperti bulanan. Kadar kortisol meningkat pada pagi hari dan turun pada malam hari. Pola sekresi hormonal pulsatif dan siklik naik turun sepanjang waktu tertentu.

yang memungkinkan tubuh untuk dipertahankan dalam situasi lingkungan optimal.Kes karakteristik SISTEM ENDOKRIN Hormon bekerja dalam sistem umpan balik. Hormon mengontrol laju aktivitas selular.S. ByIsmail. FISIOLOGI SISTEM ENDOKRIN M.dan tergantung pada kadar subtrat lainnya. Hormon tidak mengawali perubahan biokimia. hormon hanya mempengaruhi sel-sel . Ns.Kep. Hormon paratiroid disekresi dalam berespons terhadap kadar kalsium serum.

Kep. ByIsmail.S. yang melakukan fungsi spesifik. FISIOLOGI SISTEM ENDOKRIN M. Ns.yang mengandung reseptor yang sesuai.Kes .

ByIsmail.karakteristik SISTEM ENDOKRIN Hormon mempunyai fungsi dependen dan interdependen. Pelepasan hormon dari satu kelenjar sering merangsang pelepasan hormon dari kelenjar lainnya.S.Kep. Ns. FISIOLOGI SISTEM ENDOKRIN M. Hormon secara konstan di reactivated oleh hepar atau mekanisme lain dan diekskresi oleh ginjal.Kes Peran hipotalamus & kelenjar hipofise Aktivitas endokrin dikontrol secara .

Dalam berespons terhadap input dari area lain dalam otak dan dari hormon dalam dalam darah. Hipofise anterior dikontrol oleh kerja hormonal sedang bagian posterior .langsung dan tak langsung oleh hipotalamus. neuron dalam hipotalamus mensekresi beberapa hormon realising dan inhibiting. yang menghubungkan sistem persarafan dengan sistem endokrin. Hipotalamus sebagai bagian dari sistem endokrin mengontrol sintesa dan sekresi hormon-hormon hipofise.

menyebabkan kontraksi uterus. Ns.Kes Peran hipotalamus & kelenjar hipofise Hormon yang disekresi dari setiap kelenjar endokrin dan kerja dari masing-masing hormon.dikontrol melalui kerja saraf.Kep.S. FISIOLOGI SISTEM ENDOKRIN M. Setiap hormon yang mempengaruhi organ dan jaringan terletak jauh dari tempat kelenjar induknya. yang dilepaskan dari lobus posterior kelenjar hipofise. ByIsmail. Hormon hipofise yang . Misalnya oksitosin.

Kelenjar yang dipengaruhi oleh hormon disebut kelenjar target.Kes .S. FISIOLOGI SISTEM ENDOKRIN M.mengatur sekresi hormon dari kelenjar lain disebut hormon tropik.Kep. Ns. ByIsmail.

pe. sekresi ACTH dari kelenjar pituitari anterior merangsang pe.Sistem umpan balik Kadar hormon dalam darah juga dikontrol oleh umpan balik negatif manakala kadar hormon telah mencukupi untuk menghasilkan efek yang dimaksudkan. kenaikan kadar hormon lebih jauh dicegah oleh umpan balik negatif. pelepasan kortisol . Mis. Peningkatan kadar hormon mengurangi perubahan awal yang memicu pelepasan hormon.

Ns. ByIsmail. Ns.Kes Sistem umpan balik Kadar substansi dalam darah selain hormon juga memicu pelepasan hormon dan dikontrol melalui Sistem umpan balik.Kes . menyebabkan penurunan pelepasan ACTH lebih banyak. FISIOLOGI SISTEM ENDOKRIN M. ByIsmail.S. Pelepasan insulin dari pulau Langerhans di pankreas didorong oleh kadar glukosa darah. FISIOLOGI SISTEM ENDOKRIN M.dari korteks adrenal.Kep.Kep.S.

Kep. yang berikatan dengan permukaan dalam dari membran sel. Ns. hormon akan mempengaruhi cara sel berfungsi dengan satu atau dua metoda : Pertama melalui penggunaan mediator intraselular dan .S.AKTIVASI SEL-SEL TARGET Manakala hormon mencapai sel target. Kedua mengaktifkan gen-gen di dalam sel. FISIOLOGI SISTEM . Salah satu mediator intraselular adalah cyclic adenosine monophosphate (cAMP). ByIsmail.

Kes .ENDOKRIN M.

kerja sel akan mengalami sedikit perubahan. steroid). enzim.AKTIVASI SEL-SEL TARGET Ketika hormon melekat pada sel. Substansi ini mempengaruhi . kenaikan kadar AMP meningkatkan pemecahan glikogen menjadi glukosa. Jika hormon mengaktifkan sel dengan berinteraksi dengan gen. Misalnya. ketika hormon pankreatik glukagon berikatan dengan sel-sel hepar.. gen akan mensitesa mesenger RNA (mRNA) dan pada akhirnya protein (mis.

ByIsmail. lekukan os spenoidalis basis cranii.S. Ns.reaksi dan proses selular. FISIOLOGI SISTEM ENDOKRIN M. Lobus anterior ini . Berbentuk oval dengan diameter kira-kira 1 cm dan dibagi atas dua lobus. merupakan bagian terbesar dari hipofise kira-kira 2/3 bagian dari hipofise. yaitu : Lobus anterior.Kep.Kes STRuktur dan fungsi hipofise Hipofise terletak di sella tursika.

S.Kep. merupakan 1/3 bagian hipofise dan terdiri dari jaringan saraf sehingga disebut juga neurohipofise. FISIOLOGI SISTEM ENDOKRIN M.Kep.Kes STRuktur dan fungsi hipofise Lobus posterior. Struktur ini merupakan jaringan saraf. Hipofise stalk adalah struktur yang menghubungkan lobus posterior hipofise dengan hipotalamus. Ns. Ns.S. ByIsmail.juga disebut adenohipofise. FISIOLOGI SISTEM ENDOKRIN M.Kes . ByIsmail.

Hormon tropik akan mengontrol sintesa dan sekresi hormon kelenjar sasaran sedangkan Hormon nontropik akan bekerja langsung pada organ sasaran.Kep. Ns.S. FISIOLOGI SISTEM ENDOKRIN M. Kemampuan hipofise dalam mempengaruhi atau mengontrol langsung aktivitas kelenjar endokrin lain menjadikan hipofise dijuluki master of gland.Kes .STRuktur dan fungsi hipofise Hipofise menghasilkan hormon tropik dan nontropik. ByIsmail.

Sign up to vote on this title
UsefulNot useful