You are on page 1of 84

D

2
,
8


A

2
,
8
0


N
L

2
,
8
0


L

2
,
8
0


B
G

2
,
8
0


S

4
0
,
0
0

S
E
K


C
H

4
,
0
0

C
H
F


D
K

2
7
,
0
0

D
K
K


H

1
4

K
N


1
0
0

D
I
N
BR. 827 // SARAJEVO // GODINA XVI // 02. JANUAR/SIJEANJ 2013. // 2 KM // IZLAZI SRIJEDOM
KERKICA BLANKA
I SVADBA U MAJU
2
,
8
0

L

2
,
8
0


B
G

2
,
8
0

S

4
0
,
0
0

S
E
K


C
H

4
,
0
0

C
H
F


D
K

2
7
,
0
0

D
K
K

H
1
4
K
N


1
0
0

D
I
N
BR. 82 8277 // SARAJEEVO VO // GOODINA NA XXVI VI // 02 0 . JANUUUAR AR/S /S /SIJ IJ JEAAN ANJJ JJ 20 20113 1 . // 22 K KMM / // // IIZL ZL ZLAZZI II SSSSSR SR RR SSSSR SSSRR SSSRRIJ IJJ IIJ IJ IJJ IIJJJED EED ED ED ED ED EEDDDDDDOOOOOM OM OM M OMM OOM OM OM O /
Asmir
Begovi
TREBINJE
JE UVIJEK
BLIZU MOG
SRCA
Berina
Spahali
NOVI
POSAO
I NOVA
LJUBAV
Tajno vjenanje Anabele i
Andreja Atijasa
Izdava: AVAZ-ROTO PRESS
Glavna i odgovorna urednica
Elameri KRGI-MIKULI
Uredniki kolegij
Lejla LOJO
Amela KESEROVI
(OYHGLQD'$.0,
Zana KOLO-MULABDI
Novinari i saradnici
Kenan BELIJA
Hedija MEHMEDI
Indira KUUK-SORGU
Emira GLUMAC
Adnan DEDI
Aida BARUIJA
Taib DELI
Jasmina DIZDAREVI
Lektorica
,QGLUD3,1'2
Grafika dizajnerica
Sanja KULENOVI
)RWRVOXED
AVAZ-ROTO PRESS
Grafiki urednik
Fikret TIRO
Direktorica Drutva
Hasena HAJRI
Fotoagencije:
JLP i Shutterstock
DTP studio
AVAZ-ROTO PRESS
Organizacija tampe
RADIN PRINT d.o.o.
Zmaja od Bosne 4
71000 Sarajevo
Adresa redakcije
TEANJSKA 24 b
Telefoni
281-426 i 281-444
e-mail: azra@avaz.ba
ZZZD]UDPDJED
Marketing
281-356, fax:281-441
mail: marketing@avaz.ba
Transakcijski rauni
UNICREDIT ZAGREBAKA
BANKA, TRN
br.3383202266402293
DEV.RN.br.338320489324435
5 NLB TUZLANSKA BANKA
TRN br.132731001313169
SWIFT CODE:TBTUBA22
HYPO ALPE ADRIA BANK
TRN.br. 3060510000030742
DEV.RN.br. 71004200934630002
BBI Bosna Bank International
TRN br. 1410010000001620
SWIFT CODE: BBIBBA22
Identifikacioni br.
4200934630002
PDV br.200934630002
Porezni broj: 01357333
Magazin za
cijelu porodicu
AZRA
26
22
28
64
38
22 NINA BADRI
Preivjet u ova uta,
tabloidna vremena
26 ALEKSANDAR MILI
MILI I ALEN ADEMOVI
Savreni "Miligram"
spoj
28 DAMIR EHANOVI
Slatko-gorki okus
slave u naunom
djelu
38 VELIDA SKAKA
Zimska kolekcija koju
ete voljeti
64 BRAA GRIMM
Njihov ivot nije bio
bajka
AZRA 2013. 3
Potovani itatelji, i dalje vam ostavljamo
mogunost da se pretplatite na izdanje magazina
Azra. Nove pretplatnike darivat emo jednim od
parfema s potpisom kua Dior i Givenchy.
Godinja pretplata na magazin Azra je 104 KM.
Da biste postali na godinji pretplatnik, popunite
kupon i poaljite na adresu: Teanjska 24b.
)L]LNLPOLFLPDNRMDQDwPDJD]LQHOHGRELYDWL
na kunu adresu cijena pretplate umanjena je za
deset posto. Za dodatne informacije kontaktirajte
nas putem telefona: 033 281-364, 281-361
Kupon za pretplatu
Ime i prezime: ..................................
Adresa stanovanja:.............................
Br. LK: ..............................................
Broj telefona: ....................................
Pozivamo itatelje koji su kupon za
pretplatu poslali mailom da se jave
na navedene brojeve telefona, radi
daljih uputa.
AZRANagrade
D
2,8 A 2,80 N
L 2,80 L 2,80 BG
2,80 S 40,00 SEK C
H
4,00 C
H
F D
K 27,00 D
KK H
14 KN
100 D
IN
BR. 827 // SARAJEVO // GODINA XVI // 02. JANUAR/SIJEANJ 2013. // 2 KM// IZLAZI SRIJEDOM
KERKICA BLANKA
I SVADBA U MAJU
2,80

L 2,80

BG
2,80

S 40,00 SEK C
H
4,00 C
H
F
D
K 27,00 D
KK
H
14 KN
100 D
IN
BR. 827 // SARAJEVO // GODINA XVI // 02. JANUAR/SIJEANJ 2013. 2013. // 2 KM 2 KM / // IZLAZI ZLAZI SS IZ ZLAZI ZLAZ SSS SRRIIJE ED DO EDOMM RRI ED DOOM M R ED /
Asmir
Begovi
TREBINJE
JE UVIJEK
BLIZUMOG
SRCA
Berina
Spahali
NOVI
POSAO
I NOVA
LJUBAV
Tajno vjenanje Anabele i
Andreja Atijasa
6YHSRNORQHPRHWHGRELWLVDPRX
QDUHGQLKVHGDPGDQDRGL]ODVNDEURMD
AZRANagrade
Modna kua "Mona" obradovala je nae tri itateljke: Eminu Mai (Sarajevo), Meliku Karabegovi
(Sarajevo) i Lejlu Alihodi (Gorade).
"Himalaya Herbals" poklone dobili su: Deneta Ali (Ilija), Ajla Oprai (Sarajevo), Suzana Krstanovi
(Tuzla), Belma Alihodi (Sarajevo) i Munevera Smajlagi (Maglaj).
"I Love..." kozmetikim preparatima obradovali smo: Fadilu Kremo (Sarajevo), Dragicu Gruji (Sarajevo) i
Sanju Ragu (Stolac).
"Avon City Rush for Him" parfem i kupku dobila je Emina Burek iz Sarajeva.
Mjesenu lanarinu u fitnes centru "Fitness Universe" dobili su: Sanjin Imamovi (Sarajevo), Armin Mehi
(Sarajevo) i Edib Huski (Sarajevo).
Fabrika duhana Sarajevo darovala je sljedee itatelje: Jasminka Hurlov (Sarajevo), Armin Avdi (Gorade),
ulizara Gani (Kakanj), Sadija Redi (Vitez), Selma Svraka (Gorade), Azra Muhi (Sarajevo), Samira
Solak (Sarajevo), Munira esti (Zenica), Enver Debo (Sarajevo), Jasmina Paali (Sanski Most), Amir
Ibrahimovi (Tuzla), Fadila Kremo (Sarajevo), Edita Kosti (Bijeljina), Ljubica Suboti (apljina), Jasminka
Dobojli (Sarajevo), Nera Vlajki (Prijedor), Selma Buatlija (Hadii), Nina Krepala (Doboj), Sanela Gliba
(Mostar) i Esma Tokmak (Jablanica).
Molimo sretne dobitnice da se jave u redakciju radi daljih informacija o preuzimanju poklona.
Poklone su dobili:
4 AZRA 2013.
827mariah
1 = Azra cafe
2 =
7 = Carey: Teki dani zbog bolesti
supruga su iza nje #mariah carey
novo1 folder
Poetak prole godine nije bio dobar za
Mariah Carey. Njen suprug Nick Cannon
je hospitaliziran u Aspenu, gdje je bio
na odmoru, zbog problema s bubrezima.
Pjevaica je tom prilikom i putem svog
Twitter profla zamolila fanove da mole
za njegovo zdravlje, koje je bilo ozbiljno
ugroeno.
- Ovo je ozbiljan i jako teak trenutak za
sve nas pa vas molim da imate nas uz vau
porodicu u molitvama - napisala je pjevaica,
koja s Cannonom ima blizance, kerku
Monroe i sina Moroccana.
Meutim, posljednje mjesece 2012. Mariah
je ispratila u suzama radosnicama. Suprug se
oporavio i ona je mirnog srca mogla snimiti
boine pjesme i spotove.
Sa TV voditeljem Jimmyjem Fallonom i
etiri preslatke djevojice snimila je novi spot
za staru pesmu All I Want For Christmas Is
You" (Sve to elim za Boi si ti). Pomogao
im je i bend Te Roots".
A, da vie ne mora da brine o suprugovom
zdravlju, potvrdio je i sam Nick u intervjuu
amerikom asopisu "Life &Style", kada je
u aljivom tonu komentirao njihov brani
ivot.
- Nema vie izlazaka, a i Mariah me
zanemaruje, jer se samo brine o blizancima -
rekao je Cannon i dodao da nemaju planove
za prinovu.
- Jo djece? Ma ni sluajno! Ovo dvoje nam
je dosta i previe - rekao je Nick kroz smijeh.
MARIAH
CAREY
SRETNA
DOEKALA
2013.
GODINU
AZRA Cafe
Carey: Teki dani zbog
bolesti supruga su iza nje
AZRA Cafe
Vrijedni tim RSG radija i Antene Sarajevo ovu godinu
pamtit e samo po poslovnim uspjesima. A radost zbog
dobre poslovne godine podijelili su i sa svojim kolegama,
te brojnim sluateljima na prednovogodinjem partyju,
koji je prole sedmice odran u sarajevskom Holiday
Pubu. Gosti, meu kojima je bio veliki broj bh. javnih
linosti, odlino su se zabavaljali uz svirku uivo, te
numere Berina Buturovia i Aide Muanovi. Odlinu
zabavu je svojim dolaskom uveliao i Goran Bregovi.
/LEJLA LOJO/FUAD FOO/
SVIRKA UIVO
NA RSG
I ANTENA
NOVOGODINJOJ
ZABAVI
Glumac
Mirza
7DQRYL
dolazi na
zabavu
6HQND.XUWMHGRHNDOD6HOPX5LDQRYL.HQRYL
I ekipa TV PINK BH je bila tu
Ovakvu zabavu nije propustio ni
Mirsad Purivatra
6 AZRA 2013.
Kate Winslet trei brak je sklopila u strogoj tajnosti. Ceremoniji u New
Yorku, na kojoj je postala supruga Neda RocknRolla, prisustvovalo je
samo 12 zvanica i dvoje Kateine djece, Mia i Joe. Zatita privatnosti bila
je toliko jaka da ak ni roditelji para nisu znali to se dogaa. Winslet je za
kuma odabrala glumca Leonarda DiCaprija, dok je Nedu kum bio njegov
brat Jack. Vjenanje je obiljeio nesvakidanji poklon Nedovog ujaka, Sir
Richarda Bransona - let u svemir.
- Na se sin rodio, oboje smo presretni. Hvala svima za lijepe elje - napisao
je Shakirin deko Gerard Pique na svom Twitter proflu.
Vijest da e postati roditelji kolumbijska pjevaica i fudbaler "Barcelone"
objavili su u septembru. Od tada su javnost putem drutvenih mrea
konstantno obavjetavali o tome kako protie trudnoa, a s fanovima su ak
podijelili i snimak ultrazvuka.
Iako je obdukcija pokazala da se Whitney
Houston utopila u kadi u hotelu "Beverley
Hilton" nakon to je uzela smrtonosni koktel
droga, postoje i oni koji ne misle tako. Privatni
holivudski istraitelj Paul Huebl tvrdi da ima
dokaze da su slavnu pjevaicu ubili dileri.
Postoji, kae, i snimka koja govori u prilog
tome.
Predao ju je FBI-u. Na njoj se vide dvojica
mukaraca koji su vie puta ulazili u "Beverly
Hilton" i predstavljali se kao dio njene pratnje.
Huebl tvrdi da je najvjerovatniji povod ubistva
pjevaicin dug od 1,5 miliona dolara, koji su
dileri doli naplatiti.
WHITNEY
HOUSTON
JE RTVA
NARKO
DILERA?
NAKON TAJNOG
VJENANJA LET
U SVEMIR
.DWHL1HG1MRMMHRYRWUHLD
njemu drugi brak
SHAKIRA
PIQUEU
RODILA SINA
AZRA 2013. 7
AZRA Cafe
MALA
BLANKA
NAM
STIE U
MAJU
Tajno
vjenanje
Anabele
i Andreja
Atijasa
$QGUHMHYDPDPD-DGUDQND-HOLJOHGDNDNYRSUVWHQMHVXNXPRYLL]DEUDOL]DPODGHQFH
8 AZRA 2013.
Anabela i Andrej su zvanino mu i ena.
Prole sedmice u tajnosti je obavljeno
vjenanje, ali "Azra" je dobila ekskluzivitet
objavljivanja fotografja s ove skromne
ceremonije.
- Zbog velikog medijskog pritiska, kao i
injenice da je ovo samo na dan, odluili
smo se za intimno vjenanje. Iz tog razloga
ceremonija je bila obavljena kod kumova na
privatnom posjedu. Takoer, ovom za nas
vanom inu prisustvovali su i nai roditelji te
sestre i braa - rekao nam je Andrej.
Kumovi su bili njihovi dugogodinji prijatelji,
koji su ih zamolili da se njihova imena ne
spominju u medijima.
- Naravno, ovu priliku u iskoristiti da im se
zahvalim za najljepe organizirano vjenanje
ikad! ast je imati takve kumove - dodaje
novopeeni mladoenja.
Za vjenano prstenje bili su zadueni kumovi,
naravno u dogovoru s mladencima. Burme su
pravljene po narudbi u jednoj staroj arijskoj
zlatarskoj radnji.

- Svadbu smo planirali praviti nekad na
proljee, gdje emo ujedno da proslavimo
roenje naeg najmlaeg anela. Za lokaciju
jo nismo sigurni, ali emo se potruditi da to
bude Botanika bata Zemaljskog muzeja BiH.
Jo nije defnirano mjesto medenog mjeseca.
Najvjerovatnije e to biti neka egzotina
destinacija. Pitali smo Andreja gdje su odluili
ivjeti.

- Kad ivite s osobom koju volite, geografska
lokacija postane nebitna. Naravno, Sarajevo
jeste grad od kojeg se tee odvojiti, pa mislim
da e nam to i ostati mjesto boravka.

Anabela je u petom mjesecu trudnoe. Kako
kae Andrej, proivljava je s osmijehom na
licu.
- Toliko se radujemo dolasku nae male
Blankice Atijas, da ne mogu da vam opiem.
Mislim da e to biti najljepi maj u naim
ivotima - kae sretni tata.
1DNRQIRUPDOQHSURFHGXUHPODGHQFLVXUD]PLMHQLOLVODWNH]DORJDMH
$QDEHODWUXGQRXSRGQRVLVDVPLMHNRPQDOLFX
-RQLVXRGOXLOLJGMHHQDPHGHQLPMHVHF
AZRA 2013. 9
P
I

E
:

K
E
N
A
N

B
E

L
I
J
A
Zlatan Ibrahimovi:
POD SLOVOM, POD
SLOVOM
"Postoje ljudi koji su dobri u onome to rade,
postoje oni koji su izuzetni u onome ime se
bave, a postoje oni tek rijetki koji se pamte.
Pamti se i odolijeva vremenu i zaboravu samo
ono to je zapisano", istina je koju je davno
napisao M.M. Baeskija. Pamtit e se i Zlatan
Ibrahimovi. Ljudi od njegovog zanata vrlo
esto ulaze u aut, esnaesterac ili of side, ali
rijetko u debele rjenike fraza i pojmova.
Ipak, veani odnedavno mogu koristiti i rije
zlataner", nazvanu po ovom krnom momku
porijeklom iz okolice Bijeljine.
AZRALupus in fabula
Balaevi:
NEKI NOVI KLINCI,
NEKI NOVI PANONSKI
MORNARI
Svijet nije nestao 21. decembra, niti ima
namjeru da to uradi u bliskoj budunosti.
Sunce i dalje izlazi gdje je izlazilo proteklih pet
milijardi godina, ptice cvrkuu, a sarajevski
gradski prijevoz kasni. Ipak, na dan kada su
prodavai magle najavili opu kataklizmu,
u Novom Sadu se rodio novi ivot. ore
Balaevi, ovjek koji je, ni kriv ni duan,
postao sinonim za citate na Facebooku, postao
je i djed djevojice Simone. Ne znamo da li e
mala Simona za svoj dolazak dobiti posaen
orah, par mandarina i "Malog belog zeca" i da
li e je djed ole uiti da peca, ali neki novi
klinci su uvijek vesela realnost.
Palf:
PREGAA, LAI I
VIDEOTRAKE
Svi znamo ili bar slutimo da je televizija jedna
velika arena laa, jeftin trik za oi gledatelja,
iza ije se uminkane scenografje krije tek zid
od cigle i radijator. Da je zaista tako, svojski se
potrudila Nova TV u blamu decenije koji su
priredili na kraju sezone svog showa realnosti
Masterchef" u kojem anonimi kuhari kuhaju
anonimna jela pred anonimnim irijem za
poznatu svotu novca. Finale je imalo sve
to je trebalo, scenografju, iri, takmiare,
jela koja niko nikada ne pravi i dva razliita
pobjednika, u dvije razliite drave i na dvije
razliite TV stanice, spomenutoj Novoj TV
i Federalnoj TV. U Hrvatskoj se radovao
izvjesni Nikola Lesar, a pred oima gledatelja
FTV-a ampanjac je toio izvjesni Marko Palf.
Uzalud objanjenja TV kua i prebacivanje
krivice, uzalud tvrdnja spomenutog Lesara
da Bosanci ne znaju koristiti tehnologiju",
uzalud pria da je sve snimljeno i izreirano jo
u aprilu. Uzalud im sve.
7
0
,
2
BROJ U FOKUSU
I ovjek poput Silvija Berlusconija mora
ponekad da u ivotu izgubi poneto, re-
cimo brakorazvodnu parnicu. Silvio se
oduvijek trudio da bude poseban, te je
tako bilo i ovog puta, na njegovu tetu
i tetu njegovog debelog novanika.
Veronica Lario, biva glumica, biva
supruga, te jedna od bezbroj ena koje
su prole kroz ivot i krevet Silvija Ber-
lusconija, ubudue e na ime alimen-
tacije dnevno primati 100.000 eura,
odnosno tri miliona eura mjeseno,
odnosno 70,2 miliona maraka godinje.
Skupo je biti Silvio Berlusconi.
10 AZRA 2013.
R
E

E
N
I
C
A

S
E
D
M
I
C
E

I ISUS
BI IMAO
PROFILE NA
FACEBOOKU
I TWITTERU",
Robert Zollitsc,
njemaki nadbiskup, o
drutvenim mreama
Kate Upton:
OKO SRCA KAD JE
TOPLO
U opisu onoga ime ona zarauje za ivot
stoji da Kate Upton, glumica i model. U
konkurenciji modela, Kate je ove godine
proglaena estim najseksepilnijim modelom
na svijetu, te treom napoeljnijom enom,
u izboru uglednog mukog portala askmen.
com. Unuci osnivaa frme "Whirpool" i
kerki amerikog visokog politiara, nekada
su preporuivali karijeru profesionalne
plivaice, ali ona odluila za mnogo
unosniji i mnogo prominentniji posao,
za koji je spremna uiniti sve. ak se i u
minijaturnim krpicama slikati za naslovnicu
asopoisa "Sports Ilustrated" na ledenih
minus 35, negdje u divljinama Antarktika.
Njenu posveenost poslu pozdravlja muka
publika irom svijeta.
KLJOC SEDMICE
6KRSSLQJSUD]QLQROXGLORXORQGRQVNLP
SDUPHULMDPDIRWR5HXWHUV
Britney Spears:
BILA JEDNOM JEDNA PRINCEZA
Jednom davno u jednoj dalekoj carevini, ivjela je princeza Britney. Princeza je
bila lijepa, pametna i bogata, ali ju je jednog dana oteo i zatoio strani demon
poroka, koji joj je prijateljski ponudio smotak marihuane i au estine, a njoj
sve to nije smetalo. U to vrijeme svijetom je moda i hodala poneka princeza,
ali prineva nije bilo ni za lijeka. Nije ih bilo ak mogue ni napraviti, kao to je
Britney pokuala s Kevinom Federlineom, plesaam i zabavljaem, te navodnim
ocem njeno dvoje djece. Navodnim", jer je prerano potroena, podbuhla
Britney morala na sud kada ju je tuio Kevinov brat, Christopher, tvrdei da mi
je nekadanja Princeza" ukrala kreditnu krticu, da se rugala njegovoj mukosti,
ali i tvrdei da je on otac njenog sina, a ne njegov brat. Takav je ivot modernih,
potroenih princeza.
AZRA 2013. 11
AZRANovi poeci
BERINA SPAHALI
MIRAN JE
POSEBAN PO
TOME TO JE
...SAMO MOJ
3,j((/9(',1$'$.0,
12 AZRA 2013.
Velike ivotne promjene nekad nam se dese
posve neplanirano i iznenada, ma koliko se
mi trudili da sve bude onako kao to smo
zamislili. Berina Spahali protekle godine nije
planirala da se povue iz voditeljskog posla
i pone baviti PR-om, kao ni da se razvede
i pronae novu ljubav, ali desilo se i jedno
i drugo. Krenimo redom. Televiziju OBN,
na kojoj je s Feom Fetahagiem radila kao
urednica i voditeljica "In Magazina", napustila
je prije nekoliko mjeseci. Zato?
- Moram priznati da me za TV OBN veu
jako lijepe uspomene, drage kolege i dobri
prijatelji. U etverogodinjem radu imala sam
priliku usavriti se kroz nekoliko urednikih
projekata, nauiti mnogo korisnih stvari od
starijih kolega, kao i upoznati ljude koji e
mi ostati dragi cijelog ivota. Prirodno je da
nakon nekog vremena ovjek osjeti potrebu
da promijeni posao i okolinu. Tako sam i
ja osjetila potrebu da smanjim nivo stresa
u ivotu, malo se vie posvetim stvarima i
osobama do kojih mi je stalo, te se usavrim na
polju PR-a - kae Berina.
PRAVO NA
OBRAZOVANJE
Novinarstvo je, dodaje, njena velika ljubav.
I bilo joj je teko oprostiti se od ovog posla
punog izazova, adrenalina, nenajavljenih
situacija, za koje je potrebno mnogo strpljenja,
volje, ljubavi i snalaljivosti.
- Sada je zaista teko navii se na posao koji
je mnogo smireniji. Ipak, ast mi je nakon
TV OBN pridruiti se timu korporacije
"International Health". Moja pozicija PR
managera neto je to me ispunjava, to volim
raditi... S druge strane, zaista mogu mnogo
doprinijeti i samoj kompaniji. U pitanju je
proizvod koji pomae ljudima da ouvaju
zdravlje, a znamo da je ono svima na prvom
mjestu.
Poto i ovaj posao podrazumijeva konstantno
prenoenje informacija graanima, i to upravo
putem medija, Berini, barem za poetak, nee
nedostajati kamere. Takoer, s nestrpljenjem
iekuje poetak rada na projektu koji ima cilj
poboljanje uslova obrazovanja djece u BIH,
ali i na cijeloj Planeti.
- Svako dijete ima pravo na odgovarajue
obrazovanje. Naalost, realnost je mnogo
drugaija. Pogotovo kad je rije o djevojicama
i djevojkama. Vie od 90 miliona djevojica
irom Planete ne idu u kolu, to je gotovo
70 posto od ukupnog broja mladih koji
ne idu u kolu. Kampanja upravo ima cilj
pomoi tim djevojicama i zaista mi je
nevjerovatno zadovoljstvo uestvovati u njoj.
I graani e imati priliku uestvovati, a na
koji nain, saznat ete uskoro - najavljuje naa
sagovornica.
Osim na poslovnom, kod Berine je tokom
2012. bilo mnogo promjena i na ljubavnom
planu. Pronala je novu ljubav.
ROMANTINI
ISTANBUL
- Jo kada sam bila djevojica, jedna meni
veoma draga osoba mi je rekla: Obrati panju
kada ide i do prodavnice, moda e ljubav
svog ivota sresti na putu do nje." Nikada
ne znate kada i gdje e se dogoditi, ali ono
to mogu potvrditi jeste da se najvee ljubavi
uvijek dogode kada najmanje oekujete, na
mjestu na kojem najmanje oekujete, ali
sigurno u vrijeme kada vam je najpotrebnija.
Upravo to se dogodilo i meni. Kada sam
najmanje oekivala, pojavio se Miran. I ostao.
Zanimalo nas je ta ju je to privuklo njemu, po
emu je poseban?
- Ne znam zato me privukao... Mislim da je
to onaj osjeaj koji ne moete opisati rijeima,
a koji se pojavi u trenutku kada nekoga
pogledate. A poseban? Meni je poseban po
osmijehu. Nikada nisam vidjela tako iskren
osmijeh. On je jedna od onih osoba to sve
situacije u ivotu, bile sretne ili tune, prikae
kroz osmijeh. Uvijek je pun pozitivne energije,
jako njean na svoj nain, ali i pravi macho
mukarac. Poseban je po tome to je samo
MOJ.
U svojoj ljubavi nedavno su uivali i u jednom
od najljepih i najromantinijih gradova na
svijetu - Istanbulu.
- Hladni decembar odluili smo zainiti
strastvenom istanbulskom bukom. Turska je
specifna zemlja sama po sebi, a Istanbul kao
grad posebno. Oboje smo imali elju posjetiti
ga i to smo i uinili. Nekoliko dana nije nam
bilo dovoljno bez obzira to smo obilazili grad
po osam sati dnevno. Ono to mi je bilo bitno
jeste osjetiti tu ar samog sredita Istanbula, tu
buku ljudi, automobila, turista, prodavaa...
Kapali arija ima svoju dra, cjenkanje
prodavaa i odnos prema turistima, taj amor
i posebno ki, koji itekako ima smisla. S druge
strane, kada putujete Bosforom, imate priliku
vidjeti desetke vila, ogromnih kua bogataa...
Potpuno drugaija slika Istanbula. U svakom
sluaju, zaista smo uivali i ve pripremamo
odlazak na neku novu destinaciju.
Nakon viegodinjeg angamana, Berina je napustila TV OBN i poela raditi
kao PR manager korporacije "International Health". Osim na poslovnom, kod
Berine je tokom 2012. bilo mnogo promjena i na ljubavnom planu. Pronala je,
kae, ovjeka svog ivota
NE ZNAM ZATO
ME PRIVUKAO...
MISLIM DA JE TO ONAJ
OSJEAJ KOJI NE
MOETE OPISATI
RIJEIMA, A
KOJI SE POJAVI
U TRENUTKU
KADA NEKOGA
POGLEDATE
AZRA 2013. 13
14 AZRA 2013.
ASMIR
BEGOVI
AZRA Intervju
5$=*29$5$/$$0(/$.(6(529,
AZRA 2013. 15
Prolu godinu Asmir Begovi e pamtiti
po lijepom. Nekoliko puta je u Engleskoj
proglaen najboljim golmanom, potom
uvrten na listu idealnih jedanaest igraa, a
cijelu priu na kraju su zaokruili Amerikaci,
nazvavi Begovia kamenim zidom odbrane
"Stoke Cityja".
- Sve ovo ne znai mnogo, ukoliko se dobre
igre ne nastave i u 2013. godini. Ali, da, bila
je ovo jedna od najboljih godina kad je rije o
karijeri. Privatno sam veoma sretan, svi smo
zdravi i meni je to ve mnogo - kae Begovi
u prvom ovogodinjem intervjuu za magazin
"Azra".
Tek se bio vratio iz Londona. Engleska
prijestolnica je, kae, magina i puna
bljetavila krajem godine, ali on, ipak, radno
ispraa staru i doekuje novu godinu.
- Jeste li barem mogli birati neko bolje
zanimanje, koje Vas u ovo praznino vrijeme
nee odvajati od porodice, supruge Nicolle i
kerkice Taylor - pitam ga.
- Ah, da sam znao...(smijeh). U Engleskoj
je takva tradicija, utakmice se igraju ve 1.
januara. Trideset i prvog smo u hotelu i na
pripremama. Nema pauze - govori.
TREBINJE JE
UVIJEK BLIZU
MOG SRCA
Za Vas tvrde da ste u ovom trenutku najbolji
golman u Engleskoj. Prija li Vam to?
- Kako ne. Prija, naravno. Ali, takoer, znam
da, kako ima dobre, da e tako isto moda
biti i loih trenutaka. Treba se drati sredine.
Ne radovati se mnogo kada je sve super,
niti tugovati mnogo ako ne ide sve kako
ste zamislili u glavi. To je moja flozofja. U
svakom sluaju, treba pozitivno razmiljati.
Gdje ivite s porodicom?
- Izmeu Berminghema i Manchestera. Mi
smo deset, petnaest minuta od grada. Supruga
se bavi jahanjem, uklopili smo se ovdje, lijepo
se osjeamo, imamo prijatelje.
Znai li to da adresu ne biste mijenjali ni da
Vas eventualno pozovu da branite u Italiji?
- Prija mi Engleska. Teko bih se preseljavao
negdje drugdje. I kada bih mijenjao klub,
ostao bih ovdje. A, ako se mora u inozemstvo,
mora, ali opet bih se volio vratiti i ivjeti
ovdje.
Na koji nain je supruga ukljuena u Vau
karijeru. Ima ena koje kau: "To je tvoj posao
i ja se ne mijeam u odluke", dok ima i onih
bez kojih se nijedna vana odluka ne moe
donijeti?
- Sve zajedno dogovaramo. To je normalno
kada ima familiju. Bitno mi je da su sretni
supruga i moje dijete. Ne bih nikada odluio
neto to meni, naprimjer, odgovara, a da se
familija nikako ne moe uklopiti u to. Ako
emo neto raditi, onda emo svi biti ukljueni
u to, ili neemo nikako.
Gdje su Vam roditelji?
- U Njemakoj. U Heilbronnu kraj Stuttgarta.
Vratili su se tamo gdje sam prije ivio kada
sam doao iz Bosne.

Spominjete odlazak iz Bosne. Peti roendan
niste proslavili u rodnom Trebinju ve u
izbjeglitvu u Makedoniji, potom ste ivjeli u
Turskoj, Njemakoj, Edmontonu u Kanadi,
gdje Vas je otac Amir, prijeratni uvar mree
"Leotara", i uio kako se postaje golman.
Dakle, djetinjstvo su obiljeili koferi, i ivot na
razliitim adresama. Koliko su sve te selidbe
utjecale na vae sazrijevanje?
- Ovakve situacije vas ovrsnu, postanete
zreliji, ali imao sam sreu da je uz mene
uvijek bila i porodica. Gdje god smo ili, bili
smo zajedno. Meni je to i pomoglo, nauio
sam mnogo. I, kada smo se selili, uvijek sam
se znao snai u novoj sredini. Stekao sam
mnogo prijatelja u Njemakoj, Kanadi, i danas
kontaktiram s njima. Adrese su se mijenjale, ali
ne i prijatelji. Oni su ostali za cijeli ivot.
Jedan od najboljih golmana danas, roeni Trebinjac, s adresom na razmeu
Berminghema i Manchestera, u intervjuu za na magazin govori o uspjesima
u proloj godini, supruzi Nicolle, vjernim navijaima, Zlatanovom golu,
povratku Ronalda na Otok, odgoju kerkice Taylor i otkriva zato bi nakon
Engleske stao jo jedino na "Bayernov" gol
16 AZRA 2013.
U POETKU MI
JE BILO TEKO
UKLOPITI SE U
REPREZENTACIJU. BIO
SAM MLAD, NISAM
DOBRO GOVORIO
NA JEZIK. SADA
JE DRUGAIJE,
SRETAN SAM, MOJ
BOSANSKI SE ITEKAKO
POBOLJAO, AK
RAZUMIJEM I ALE
AZRA Intervju
Asmir i Nicolle su se upoznali prije est godina
7DWLQDVUHDLSRQRVMHWURJRGLQMD
NHUNLFD7D\ORU
AZRA 2013. 17
Kakve emocije osjeate kada neko spomene
Trebinje?
- Jo jedino tetka ivi dolje. U kontaktu smo.
Trebinje mi je bitno, bez obzira na to to
dvadeset godina ne ivim tamo. Dolje sam
se rodio i to niko ne moe promijeniti. Ono
je uvijek blizu moga srca i uvijek me zanima
ta se deava dolje. Iz Trebinja sam krenuo u
svijet.
O supruzi Nicolle jako malo znamo...
- Roena je u Americi. Nakon deset godina
ivota s roditeljima se preselila u Englesku i
tu je ve 17 godina. U Engleskoj joj je roena
majka. Upoznali smo se prije est godina, i od
tada smo zajedno. Ona mi je mnogo pomogla
u karijeri, uvijek je bila uz mene. Nicolle ima
svoje interese, karijeru... Bavi se jahanjem,
odnosno dresurom konja, i ima velike
ambicije.
U jednom trenutku je morala odluiti da
li e studirati ili nastaviti s jahanjem. U
meuvremenu smo se upoznali, dobili dijete, i
onda se situacija promijenila.
Kad ste znali da e ona biti Vaa supruga? Jeste
li to mogli rei ve pri prvom susretu?
- Svako lae kada kae: znao sam ovo ili ono,
jer takve stvari nikad ne zna u ivotu. To
zna kako vrijeme prolazi. Ali, moe znati
osjea li neto posebno prema osobi koju si
upoznao. Ba to neto posebno sam osjetio
kada sam prvi put vidio Nicolle. Odmah smo
se povezali. Nakon prvog izlaska sam znao da
je mnogo toga mogue meu nama.
Gdje ste se upoznali?
- U Portsmuthu. S prijateljem sam se
dogovorio da izaemo u jedan kaf na pie.
Tu sam vidio Nicolle. Sve dalje je historija...
ta je Nicolle nauila o Bosni?
- Bila je u Bosni nekoliko puta. Lijepo joj je
uvijek bilo. Probala je da ui bosanski jezik,
ali ide teko. Meutim, razumijem kako joj
je, jer kada jezik ne koristi esto, onda je i
uenje tee. Meutim, mnoge bosanske rijei
razumije.
Va radni tempo je teak, Engleska prva liga je
prezahtjevna..., na koji nain pravite balans
kada je rije o privatnom ivotu? Da li Vaa
porodica ikada trpi zbog fudbala?
- Istina, karijera jeste zahtjevna, teko mi
padaju dani kada trebam ostaviti porodicu.
Ali, kad sam kui, ja sam onda samo njihov.
Ovdje je naporno, nema mnogo pauza, stalno
su utakmice. Meutim, navikli smo se, posao
je posao, i kada imamo slobodnog vremena,
stalno smo zajedno. Kada me je upoznala,
supruga je znala da ivim za fudbal.
Jeste li Vi u znak kompromisa onda nauili
jahati konje?
- Ne, nisam ni sjeo na konja (smijeh). Imam
respekt prema supruzi i onome kako ona
dresira te ivotinje, to je ekstra. Naroito se to
moe vidjeti kada nastupaju na olimpijadi i
takmienjima. Ne znam je li to strah, ali nisam
jahao. Kada se karijera zavri, vidjet emo.
Moda se okuam.
Na koji nain uestvujete u odgoju kerke
Taylor?
- Taylor ima tri godine. Kada sam kui,
brinem se o njoj. Pravim jelo, kupam je,
ispraam na spavanje. U potpunosti sam
ukljuen u njen odgoj. To mi je super odmak
od fudbala. Divno se osjeam kada sam s
kerkicom. Razumijemo se nas dvoje. Drago
mi je da imam jednu curu, jer sam odrastao
s dvojicom brae. Kod mene su uvijek u
kui bili mukarci. Ovo je prava promjena.
Naprimjer, subotom ujutro je vodimo na
asove baleta, i to mi je divna stvar, divno
iskustvo, koje nikad prije nisam doivio.
Kako Vam je u Fudbalskoj reprezentaciji BiH?
Mogu da itam da ste i u dravnom timu postali
nezamjenjiva karika?
- Ljubav prema Bosni je uvijek bila. I kada
nisam branio, ba kao i danas kada branim.
U poetku mi se bilo teko uklopiti u ekipu,
bio sam mlad, jezik nisam dobro znao... Sada
je ve drugaije i mnogo lake. Bosanski mi je
puno bolji, ak se uklapam i u alu s drugim
igraima. Reprezentacija je velika stvar, i
igra na nivou kakav ona prua, mnogo mi je
pomogla u fudbalskoj karijeri. Sretan sam u
dravnom dresu.
Gdje se vidite nakon Engleske?
- Vrlo teko pitanje. Uvijek sam sanjao da
igram za "Bayern". Jedan od ciljeva bi mi
moda bio da odigram nekoliko sezona u
Njemakoj, jer sam pratio tu ligu. Meutim,
ja sam deset godina i u najboljoj ligi na svijetu,
u Engleskoj, i to je, takoer, teko napustiti.
Cristiano Ronaldo je izrazio elju da se iz "Real
Madrida" vrati u "Manchester United". ta bi
njegov povratak znaio za premiership?
- Pa, on je jedan od najboljih igraa svijeta.
Znaio bi mnogo, naravno. Moda, kada si u
Engleskoj, ne razumije tu ljubav prema ovoj
igri i navijanje, ali kada ode u drugu zemlju,
tada su ti stvari jasnije. Ronaldo je otiao u
Madrid i vidio je ta je ostavio. Kao to rekoh,
teko je iz Engleske otii bilo gdje drugdje.
Biste li Vi mogli odbraniti trei gol Zlatana
Ibrahimovia koji je u dresu vedske fudbalske
reprezentacije dao Engleskoj?
- (smijeh)... Dobro, to se ne zna. Takav gol se
vie nee ponoviti, a ako to nekome i uspije,
onda mu svaka ast. To je teko odbraniti.
Kada bi se ponovo desila ista situacija,
drugaije bi se sigurno i branilo.
Kada biste mogli usvojiti jednu vjetinu od
nekog kolege golmana, ija bi to bila?
- Kada sam bio mlai, onda sam gledao druge
golmane i analizirao kako da unaprijedim
svoje vjetine..., ali danas je situacija drugaija.
Treba biti svoj. Jer, na kraju dana vi ipak
imate samo svoj stil. Uradi kako misli da je
najbolje i onda gledaj ta se tu moe popraviti.
To je moje miljenje i govorim ga s najveim
respektom prema svim svojim kolegama
golmanima.
Za one koji nemaju priliku vidjeti Va svijet
i nain ivota, otkrijte mi, ima li u Vaoj
svakodnevici privatnih aviona, jahti, gala
zabava? Kako ivite?
- Skroz normalno, bez mnogo stvari koje
sada spominjete. Volim da ivim bez puno
problema, bez puno atrakcija, volim da budem
s normalnim svijetom. Nekada se moe
uklopiti i u ovaj drugi svijet, koji nije realan,
ali ta e kada se prestane baviti fudbalom?
Svakog jutra volim proetati po gradu, popiti
kafu, dakle, nita posebno...
ta svojim navijaima elite poruiti?
- elim im sretnu Novu godinu. Hvala im za
podrku koju mi daju sve ove godine, mnogo
mi znai. Volim ih, kao to i oni vole mene. I
elim da se naa ljubav nastavi i u godinama
koje su pred nama.
DRAGO MI JE DA
IMAM KERKU, JER
SAM ODRASTAO S
DVOJICOM BRAE. U
KUI SU NAM UVIJEK
BILI MUKARCI.
TAYLOR JE UNIJELA
PROMJENU.
SUBOTOM JE VODIM
NA ASOVE BALETA,
I TO MI JE DIVNO
ISKUSTVO KOJE
NIKAD PRIJE NISAM
DOIVIO
AZRA Zvjezdana praina
ROMAN ABRAMOVI
18 AZRA 2013.
Ilja, Arina, Sofja, Arkadija, Ana i Aron
Aleksander Abramovi na proljee e dobiti
jo jednog brata ili sestru, a Roman Abramovi
sedmo dijete. Rodit e mu ga njegova
djevojka Dasha Zhukova, s kojom ve ima
etverogodinjeg sina. Potvrdila je to i PR sluba
ovog ruskog milijardera i vlasnika "Chelsea".
Tridesetjednogodinja Ruskinja porodit e
se na proljee. Mediji su jo jesenas poeli
pisati da je trudna, ali s obzirom na Dainu
vitku liniju stomai nije bio primjetan. Sve
donedavno, kada se u pripijenoj haljini uputila
na izlet brodom oko ostrva St. Barts.
SEDMA
SREA
NAJVEEG
BOGATAA
35,5(',/$(/9(',1$'$.0,
Par se upoznao 2006. godine na proslavi
Nove godine iji je domain bio Darijin otac,
takoer ruski milijarder Aleksander Zhukov.
Petnaest godina mlaa Dasha, urednica modnog
magazina i vlasnica umjetnike galerije u Moskvi,
osvojila je Abramovia na prvu. Zbog nje je
odluio okonati naizgled idilini 16-godinji
brak s Irinom Vyacheslavovnom Malandinom,
koja mu je rodila dva sina i tri kerke.
Kako se moglo oekivati, nije je ostavio bez
sredstava za ivot. Razvod je Irini donio
izmeu 150 miliona i 3,9 milijardi funti,
ukljuujui i kue u Londonu.
Kada je imao
godinu i po, majka
mu je umrla u
pokuaju ilegalnog
abortusa, dok mu
je otac poginuo na
graevini kada je
imao etiri godine.
Nije imao brata ili
sestru, osobu na
koju bi se oslonio.
Kroz ivot se borio
sam, pa stoga
nije isto elio za
svoju djecu. Osim
basnoslovnog
bogatstva, u
nasljedstvo im
ostavlja i veliku
porodicu
5XVNLPLOLMDUGHUYHLPDHVWHURGMHFH
AZRA 2013. 19
AZRA
Nakon razvoda Irina se u intervjuima nije
bavila suprugovim preljubom. Isticala je
samo to da su raspadu njihovog braka uveliko
doprinijele stroge bezbjednosne mjere.
Poduzeo ih je njen suprug, kako bi zatitio
porodicu od otmiara koji su ih stalno vrebali,
elei se lako dokopati njihovog bogatstva.
VOJSKA
TJELOHRANITELJA
Roman Abramovi, navodno, zapoljava ak 40
linih tjelohranitelja koji prate svaki njegov korak
i plaa ih 1,2 milion funti godinje. Deseterica su
stacionirana u Romanovom domu u Belgraviji
u Londonu, a trojica u njegovoj seoskoj kui u
Zapadnom Saseksu. Ostali su ratrkani irom
svijeta i angaira ih prema potrebi.
U stopu su pratili i njegovu suprugu i djecu,
to je njoj smetalo.
- On i ja smo razumjeli da ne moemo kriti
djecu, jer to nije ivot, pa smo zato ili u pozorie
i muzeje, ali s "gomilom" tjelohranitelja. Moj
mu je to prihvatao smireno, ali za mene je bilo
sve tee. Brojeve mobitela mijenjali smo svake
sedmice, tako da niko ne bi mogao otkriti gdje se
nalazimo - kazala je Irina.
Ona je Abramovia upoznala dok je radila
kao stjuardesa "Aerofota" nakon raspada
Sovjetskog Saveza. Dok pria o Romanu, Irina
ne zvui ogoreno niti ljutito:
- Odrasla sam bez oca i zato mi je bilo veoma
vano da mojoj djeci u ivotu nikada nita ne
nedostaje. Roman mi je obeao da e tako biti, a
obeanje ispunjava i nakon razvoda - kazala je za
britanske medije.
NESRETNO
DJETINJSTVO

I istina je da je Roman bezbroj puta dokazao da
je brian otac. Rijetko koji bogata se odluio da
ima tako veliku porodicu kao on. Razloge tome
moda treba traiti i u njegovom djetinjstvu. On
je, naime, veoma rano ostao bez oba roditelja.
Kada je imao godinu i po majka, mu je umrla
u pokuaju ilegalnog abortusa, dok mu je otac
poginuo na graevini kada je imao etiri godine.
Brigu o Romanu preuzeo je stric, a kasnije djed
i baka. Nije imao brata ili sestru, osobu na koju
bi se oslonio. Kroz ivot se borio sam, pa stoga
nije isto elio za svoju djecu. Osim basnoslovnog
bogatstva, u nasljedstvo im ostavlja i veliku
porodicu. Ima li ta ljepe od toga?!
1MHJRYDELYDVXSUXJD,ULQDWHNRMHSRGQRVLODLYRWSRGEXGQLPRNRPWMHORKUDQLWHOMD
Dasha je ured
nica modnog
DVRSLVDLYODV
QLFDXPMHWQLNH
JDOHULMHDQMHQ
otac je jedan od
QDMERJDWLMLK5XVD
Zvjezdana praina
20 AZRA 2013.
AZRA Cocktail
AZRA HALILOVI
Na Azrinom novom singlu radili su Hari
9DUHDQRYLL1LKDG9RORGHU
PIE: LEJLA LOJO
)272%(5-$0,11,=,,9$1j(%$/-
"Kad zlato posivi" naziv je novog singla pop
pjevaice Azre Halilovi, koja je za svoju
novu numeru, kako kae, okupila najbolji
tim - Harija Vareanovia, Nihada Volodera,
a za spot Harisa Dubicu. Talentirana
Sanjanka, koja ivi i radi u Beu, novi singl
promovirala je prole sedmice u sarajevskom
"Kriterionu". Nije skrivala oduevljenje zbog
obavljenog posla.
- Velika mi je ast to sam okupila ekipu ija
imena govore dovoljno za sebe. Prezadovoljna
sam, jer sam ispunila jo jednu svoju elju.
Pjesmu "Kad zlato posivi" lino doivljavam.
Dok sam je pjevala, na trenutke sam imala
suze u oima, jer svi mi u sebi nosimo bol
zbog neuspjelih ljubavnih veza.
Koliko melodijom i tekstom, Azra je
zadovoljna i spotom, koji potpisuje Haris
Dubica. Ovo je njihova prva saradnja,
ali sigurno nee biti i posljednja. Spot su
snimali u vicarskim Alpama. Iako im
vremenski uvjeti nisu ili naruku, uspjeli su
dobiti ono to su eljeli.
- Harisu ideje dolaze spontano, tako sam
morala stajati u vodi, iako je bilo uasno
hladno. Sreom, nisam se prehladila. Alpski
zrak mi je itekako godio i svjeija sam se
vratila kui. Spot je veoma profesionalan i
jako sam sretna to sam izabrala njega kao
saradnika. Mnogo mi je pomogao i izaao
ususret - kae Azra, koja u Beu radi kao
tv-novinar i urednica.
Graditi muziku karijeru u BiH, a raditi u
Austriji za sada je jedini nain koji joj se ini
realnim za opstanak.
- Nije lako. U Beu ureujem i vodim
muziku emisiju. esto putam spotove naih
izvoaa, jer elim da Austrijanci upoznaju
nae muziko naslijee. Znam im pustiti
sevdah, naprimjer, "Divanhanu". I reakcije su
uvijek pozitivne, dopada im se sevdalinka. A,
koordinirati izmeu Bea i Sarajeva je veoma
teko, jer je kod nas situacija na muzikoj
sceni takva kakva jeste. A, ja nisam osoba
koja e pjevati u kafanama do pet ujutro.
Vie se vidim na nekim klupskim nastupima,
kulturnijeg karaktera. Hvala Bogu pa imam
taj izbor. Neko nema. Neki mi zamjeraju to
nisam ovdje, ali onda uope ne bih mogla
egzistirati kao umjetnik i fnansijski ne
bih mogla izdrati. Sav novac koji utedim
ulaem u muziku. Nemam skupocjenih auta
ni garderobe. A, ta e od toga biti na kraju,
ne znam - iskreno e Azra.
SVE TO IMAM
ULAEM U MUZIKU
HARIS DUBICA
$]UDLMDVPRRERMHL]6DQVNRJ0RVWDL
ELORMHVDPRSLWDQMHGDQDNDGDHVHQDD
VDUDGQMDGHVLWL3MHVPDPLVHGRSDODL
RGPDKVDPSULVWDRVQLPLWLVSRW6QLPDOL
VPRXYLFDUVNRMQDMHGQRPVNLMDOLWX
1DDORVWQLVPRLPDOLGREUHYUHPHQVNH
XYMHWHQHJRNLXPDJOXLEODWRDOL]DGR
YROMQLVPRUH]XOWDWRP$]UDMHYHOLNLUDGQLN
LQLWDMRMQLMHELORPUVNRXUDGLODMHVYHWR
VDPWUDLR
AZRA 2013. 21
22 AZRA 2013.
AZRA Region
NINA
BADRI
Ova godina mi je
bila jako teka,
jako naporna
i intenzivna.
Pripreme za
"Eurosong",
svata se
izdeavalo
oko toga, pa
operacija
glasnica - ba
sve se desilo u
najnezgodnijem
trenutku. Ali
preivjela sam,
i to vrsto na
nogama
AZRA 2013. 23
U Novu godinu svi ulazimo s nadom da nas
oekuje bolje, uspjenije razdoblje, pogotovo ako
je ono iza nas bilo toliko teko da smo jedva ekali
da proe. Ni Nina Badri nije izuzetak u ovom
smislu. Iako je, kae, doivjela mnogo lijepih
trenutaka, loih je bilo vie. Posljednji u nizu je
bio razvod od Bernarda Krasnia. Odmah su
uslijedili i novinski napisi o navodnoj Bernardo-
voj, ali i Nininoj nevjeri. Njega su povezivali s
"neafrmiranom pjevaicom i studenticom", a
nju s glumcem Leonom Luevim, te voditeljem
Ivanom Ivanoviem. Sve je to demantirala. Kraj
godine, ipak, nije doekala sama, ve u dobrom
drutvu, snimajui novogodinji program za
Hayat TV u Sarajevu.
- U 2012. kao da sam preivjela pet godina.
Ova godina mi je bila jako teka, jako naporna
i intenzivna. Pripreme za "Eurosong", svata se
izdeavalo oko toga, pa operacija glasnica - ba
sve se desilo u najnezgodnijem trenutku. Ali,
preivjela sam, i to vrsto na nogama.
ta se, zapravo, deavalo na "Eurosongu"? Jeste
li zaalili to ste otili tamo?
- Radim stvari iskreno. Bila sam prvi hrvatski
muziar koji je pozvan direktno da predstavlja
svoju zemlju, tako da je to meni bila velika ast.
Mada sam rekla jo 2003. godine, kada sam s
"arobnim jutrom" konkurirala i kada su mi
skinuli neke glasove, da neu nikada otii, ipak
sam pristala. Sada mi je ao zbog toga, jer to nije
takmienje pjesama, ve takmienje lobija.
U sluaju hrvatske delegacije desilo se da sam
ja dola tamo, a tamo nije bilo nikakvog reda i
onda shvati da je pola toga ve odigrano, da je 95
PREIVJET
U OVA UTA,
TABLOIDNA
VREMENA
posto stvari unaprijed zavreno. Ja kakva jesam,
tvrdoglava i inatljiva, da sam znala da se to tako
igra, i ja bih tako igrala. Nala bih ekipu koja zna
igrati i to sponzorski znala zavriti. udila sam
se svaki put kad bi Ksenija Urlii govorila da
tamo neu dobro proi i da je odraivala posao
za hrvatske muziare mjesecima ranije. Pitala sam
se ta ta ena pria, a ustvari se to odraivalo. I to
nije nikakva tajna. Nama u Hrvatskoj znai samo
biti prvi, nita drugo. BiH ima najvee uspjehe u
posljednjih nekoliko godina. Hrvatska trenutno
nije spremna da organizira Eurosong, iako je to
najbolji nain za promociju svoje zemlje.
Vi ste prva osoba koja o tome pria. Svi obino
kau da je to jedno divno iskustvo...
-To jeste iskustvo. U mom sluaju to ba nije bilo
tako divno iskustvo. Upoznala sam neke divne
ljude, to da. Ali ja dam 100 posto sebe, izgorim
u tome i onda ne mogu shvatiti ljude koji dou
negdje se zezati, a plaeni su za to to ine. Dosta
linog novca sam izgubila, jer sam htjela da to,
ipak, na neto lii. Kreatorka moje haljine me
doekala u Hrvatskoj i napala kako sam loe
iznijela njenu haljinu, i da sam i za to kriva. Ipak,
to je bila jedna velika kola u ivotu: ne idi tamo
gdje nisu tvoji "ljudi iz kolskih klupa". Meni
defnitivno nije mjesto na "Eurosongu", ja previe
potujem muziku da bih je svela na raunicu.
ta to takmienje uope nama znai? U Hrvat-
skoj ljudi gladuju, situacija je veoma nezgodna i
alosno ti bude kad vidi neke ljekare, profesore,
ljude koji su do juer ivjeli prosjenim ivotom.
Ali eto, "Eurosong" je bitan.
Gdje je muzika u svemu tome? Danas u Vaem,
kao i mnogim drugim javnim poslovima, stvar-
no ima svega..
- Ima, ali to je dobro. Voljela bih da toga bude jo
vie, da se svima da prilika da pjevaju. Bolje je da
je konkurencija vea, zdravija. Ljudi u Sarajevu
kau: kod nas ima jako puno folka. A ja kaem:
i kod nas, samo nema ga javno. Kod nas se u
klubovima slua folk. Nek' ljudi sluaju ta im
je volja. Opet, kad okrene cijeli krug Balkana,
ima tek desetak ljudi ija karijera traje godinama.
Publika im jednostavno vjeruje. U muzici mora
neto dati da bi dobio. Muzika je dar od Boga.
Ima puno ljudi koji ele pjevati, uspjeti, trude se
na neki poten nain pa nikako da im se dogodi
taj uspjeh.
A izdvaja li se neko meu njima, u pozitivnom
smislu?
- Da, evo recimo Mirza oljanin. Rekla sam mu:
ti ne samo da si zgodan, ve i lijepo pjeva (smi-
jeh). Ima neto u tebi, vidi se da pripada negdje
i da se iskreno smije, a to e ljudi prepoznati ve
sigurno. On se zbunio.
Kako je dolo do dueta s njim?
- Nije bilo lako odluiti se za duet sada, a pogo-
tovo s nekim ko je jo novi. Mirza mi je rekao da
ima dobru pjesmu, donio mi je u Zagreb i zaista
mi se svidjela. Rekla sam "moe" i nali smo se
jednog poslijepodneva u studiju, dan prije mog
velikog koncerta i snimili pjesmu "Due su se
srele". Zaista je lijepo ispala i jedva ekam da je
ljudi uju.
Imali ste velike koncerte u Zagrebu i Beogradu.
Na red dolazi i Sarajevo, Zetra..
- Mi smo pokuali Sarajevo ugurati u 2012. god-
inu, ali kasnije se otvorio prekrasan datum - 14.
februar - Valentinovo. Mislim da nema ljepeg
datuma za Sarajlije i mene, mi smo, ipak, ljudi od
ljubavi. Ovog puta e se dogoditi velika produk-
cija, veliki koncert s gostima, s plesaima. Onako
kako me sarajevska publika nije nikad vidjela, a
to im dugujem jako dugo.
Gdje je najbolje nastupati?
- Jo me ekaju Skoplje, Varadin i puno toga. U
muzici ti je dom tamo gdje ljudi vole tvoj glas.
Gdje god si dobrodoao, tu ti je najbolje. Ljudi se
jednostavno veu uz tvoju muziku i uvijek slini
ljudi dou na moj koncert.
Koga od gostiju moemo oekivati na Vaem
koncertu?
- To bi mogao biti Tony Cetinski, kad god sam
ga zvala, uvijek je doao. Petar Grao je, takoer,
sjajan tip. Bila sam gost na njegovom koncertu
u Splitu, i to je super ispalo. To su lijepe saradnje
koje se dese neplanirano, ima tih sluajeva jo.
Osim koncerata, ta nas to eka u 2013. godini?
- Svata. Puno novih pjesama, novih koncerata...
Zaista svata lijepo.
Piete li sami?
- Da, veinu pjesama piem sama.
Kako to izgleda?
- Ne znam, doe mi. Jednostavno se desi. Nikad
ne sjednem ba da piem, nego se jednostavno
desi neka pjesma. Moj saradnik Ante Gelo i ja
smo napisali krasnu pjesmu koja se zove "enja"
i ko god ju je uo, svia mu se. Bit e novih
pjesama uskoro.
Kad je najbolja inspiracija?
- Unutra se deavaju stvari i uvijek kad napiem
pjesmu koja je emotivnija, ljudi se pitaju: A jesi li
je posvetila nekome? Jednostavno, veina pjesama
koje sam napisala su iz nekih davnih vremena.
Neke najemotivnije pjesme sam napisala u najs-
retnijim trenucima zapravo, kao to su: "Nek' ti
bude kao meni", "Moja ljubav"...
Kada gledate spotove i svoje promjene u izgledu,
alite li za nekim momentima?
- esto sam se mijenjala i rado sam to inila, a
ovo je neki najdui momenat kad se nisam mijen-
jala. Ba sam sklona transformacijama i zaista to
volim. Bit e promjena uskoro sigurno.
Imate li neku neostvarenu elju?
- Imam ih mnogo.
Koliko trpe Vama dragi ljudi zbog posla koji
radite?
- Mislim da ne trpe nita. Oni ljudi koji te vole, koji
su sretni zbog tebe, uestvuju u tvom ivotu. Jer,
kako trpjeti kada dijeli s nekim sretne i lijepe mo-
mente? Ali onda mora podijeliti i one manje lijepe,
jer nije fer da neko dijeli samo one sretne trenutke.
Jeste li u ljubavi sebini?
- To ne znam, ali vjerujem da nisam sebina.
Znam da puno dajem i onda jednostavno i puno
traim. Zna, due se sretnu. Ili ne.
Je li teko nai srodnu duu?
- U ivotu su mi se dogodili takvi susreti. Jed-
nostavno se dese. ivi ivot i dese se susreti, neki
su za ivotnu kolu, a neki zaista i jesu ljubav. Vje-
rujem da svako od nas osjeti onaj svoj "unutranji
glas" kada je to - to. Pogotovo mi ene, mislim
da odmah poelimo biti majke. Jednostavno se
neto dogodi i ti zna da je to taj frajer, osoba tvog
ivota. E, sad, propustiti trenutak zbog straha
je najgore. U ivotu bih radije bila sama nego s
nekim ko nije moja ljubav.
Svaka ast. Nismo svi ba takvi, treba hrabro-
sti...
- Najfascinantnija ljubavna pria za mene je
pria Josipe Lisac. Ta ena me fascinirala. Kada
ti se dogodi ljubav, onda druga ne moe zauzeti
to mjesto. Sve drugo se zove skrasimo se da ne
ostanemo sami. Ljudi nemaju strpljenja ekati, ali
due se zaista sretnu.
Poznati ste twitera. Ide li sve na Twitter?
- Ne ide. Koliko god da je fantastian medij, za
neke tabloide je postao glavni izvor informacija.
Mnogo ljudi ne zna ta je Twitter i veliki broj
ljudi je izmanipuliralo moj twit nedavno.
Kada ste poeljeli dobrodolicu kui hrvatskim
generalima Anti Gotovini i Mladenu Markau?
- Da. Ali ja nekako vjerujem da istina uvijek doe
na svoje i nemam straha ni od koga, samo od
Boga. Oni koji misle da su bogovi na zemlji, sami
sebe nekako spetljaju. Svojim ivotom svjedoim
ko sam. Za 20 godina nikad se nisam bavila
politikom i nikada ne bih uspjela varati tako dugo,
toliko ljudi. Prie lanih tabloida i pokuaja stavl-
janja politike u moja usta jednostavno nee proi.
U Hrvatskoj postoji malo utila, nemamo takvo
neto poput Srbije. To da se u naslovnici objavi la
i da niko za to ne odgovara i nakon toga vas isti
ljudi zovu da im date intervju. Obraza nema.
Jeste li pristali na taj intervju?
- Ni sad, ni ikada. Raditi od javnih ljudi budale i
majmune, to je uvredljivo. Nisam ja svoju karijeru
sagradila ni na skandalima, ni na tabloidima i ne
pristajem biti uvuena u bilo kakav skandal. Ja
sam njima dosadna, vodim dosadan ivot. Valjda
bih trebala plesati na stolu svaku veer ili biti is-
pod stola da bih bila zanimljiva, ali ja tako nisam
krenula ni kao klinka u svoju karijeru. Krenula
sam na jedan drugi nain i stojim iza njega i dan-
danas. Preivjet u ova uta, tabloidna vremena.
24 AZRA 2013.
AZRA Region
AZRA O svemu pomalo
ALEKSANDAR MILI MILI I ALEN ADEMOVI
SAVRENI
"MILIGRAM"
SPOJ
S osnivaem jednog od trenutno
najpopularnijih bendova "Miligram"
Milijem i njegovim pjevaem Alenom
razgovarali smo o karijeri, odnosima
meu lanovima benda, turnejama,
razdvojenosti od porodice i njihovim
susretima, novim planovima, a otkrili su
nam i svoje najvee poroke
RAZGOVARALA: LEJLA LOJO
26 AZRA 2013.
Razgovarati s liderom benda "Miligram"
Aleksandrom Miliem i pjevaem Alenom
Ademoviem podjednako je zanimljivo kao i
prisustvovati njihovim svirkama uivo na kojima,
osim svojih pjesama, sviraju i pjevaju najvee
hitove bive Jugoslavije. Jedna takva desila se
prije dva mjeseca u Sarajevu, a za njihov nastup
traeno je mjesto vie. Ni sami, kau, nisu
oekivali takvu posjeenost i odlian provod.
Nedavno su u naoj prijestolnici boravili drugi
put, kako bi promovirali kompilaciju hitova s
albuma "Miligram I" i "Miligram II". Nakon
pressice, s Milijem, producentom, kompozito-
rom i aranerom, te Alenom, koji je donedavno
bio glavni pjeva u Bregovievom "Orkestru za
svadbe i sahrane", vodili smo oputen razgovor o
karijeri, ali i svakodnevnim deavanjima.
S obzirom na to da smo Vas zatekli uz cigarete
i vinjevau na stolu, kaite nam jesu li Vam
cigarete i alkohol jedini poroci?
Mili: Da suzimo krug na jedno 200...(smijeh),
mislim da mi je puenje najvei problem, ali to
rjeavam tako to se klin klinom izbija, i onda
puim jo vie...(smijeh). Problem je to ne
znam da puim i da sviram, uvijek iskrsne neki
problem ili mi dim ue u oko ili se opeem, pa
ratimam gitaru i tako...
Alene, Vi vjerovatno uvate glas, pa ne puite?
- Puio sam 15 godina, ali sam ostavio cigarete
prije etiri. Ve dva tri puta pokuavam da
prestanem. Ne znam koliko u izdrati ovog
puta. Sad puim one elektrine cigarete.
Mili: Alen je nikakav pua im mu kutija
traje tri dana.
Alen: Dva dana.
Alene, kradete li Milijeve cigarete?
- Ne, ne volim da se grebem, kada nemam
svoje, onda ne puim.
Mili: Ja ispuim sve svoje, a onda i od cijelog
benda....(hahahahah). Zezamo se, nije tako
strano. Sad sam se, naprimjer, vratio iz Aus-
tralije i nisam puio 29 sati.
Dobro, kako objanjavate uspjeh benda "Mili-
gram"?
Mili: Iza naeg posla stoji ogroman rad. Zaista
se satiremo od posla. Ako se moe rei da smo
neto uspjeli, onda je to nastalo kao rezultat
tekog rada. Nae porodice to jako dobro
osjeaju. Ali, nemamo puno izbora i sami smo
izabrali da se bavimo ovim poslom. Sviramo
od 12 do 15 koncerata mjeseno.
Lepoj Breni ste napravili odlian povratniki
album. Hoete li ponovo saraivati?
- Neu, to je za mene bio samo jedan izlet, jer me
zanimalo kako izgleda da ona pjeva moje kom-
pozicije. Album je odlino proao i poslije toga
smo prekinuli saradnju, jer nije to moj target.
Kada moemo oekivati "Miligram III"?
- Trei album bi trebao biti gotov u decembru
2013. godine.
Isplati li se vie danas raditi za sebe, tj. za
"Miligram" ili za druge izvoae?
- Nikada u ivotu nisam radio ni za koga.
Jednostavno, pjevai koji sa mnom sarauju se
orijentiraju prema meni. Ja odluujem je li mi
to interesantno ili nije, ali fnansije nikada nisu
u tome presudne, nego kakva mi je energija
u tom trenutku. Ponekad, kada mi ostane
pjesma vika, volim je dati drugima. Ali, u
sutini, volim da radim projekte u kojima sam
involviran od poetka do kraja i samim tim
odgovoran od njegovog poetka, pa do kraja.
Spomenuli ste saradnju s Cecom, kojoj stvarate
albume ve 18 godina. Ko je kome vie doprinio
u karijeri, ona Vama ili Vi njoj?
- Pa, ne znam... ja sam nekako osoba koja je
nauila kroz taj svoj ivotni put da ne gleda ni-
kada unazad. Sve vrijeme ispod mene stoji tabula
raza. Izbriem sve to sam do sada radio i kreem
ispoetka u novi album i projekt. Ali, vrhunski
pjeva ne moe bez pjesme, pjesma jako teko
moe bez vrhunskog pjevaa, tako da kad se to
sklopi, to je to, to je ono ime se bavim.
Od svih moguih pjevaa s kojima ste saraivali,
je li ostao neko s kim biste poeljeli saradnju?
- Ne postoji nijedan izvoa s Balkana koji
me nije zvao i kazao kako bi volio da neto
radimo, ali meni je problem to sve to ne
mogu fziki da postignem. I onda ih odbijam
u startu, jer jednostavno nemam vremena.
Odluili ste da na "Miligramu II" sve pjesme
pjeva Alen. Je li ga bilo teko "oteti" Goranu
Bregoviu?
- Ma ne... ja sam mu samo rekao: "Sluaj, pali
odatle!"... i on je doao...(ahahahahaha).
Alen: I ja sam ga posluao...(ahahahhaah).
Mili: alim se, Alen je bio odabir na "Mili-
gramu 1", on po meni ima neto svjetsko,
neobino i njegov glas je dirketno povezan s
njegovim emotivnim stanjem. To se veoma
rijetko kod pjevaa nalazi. To je, zapravo,
ono najrjee to pjevai imaju. A, Alenu je to
uroeno. On je na prvi "Miligram" uao kao
prilino nepoznat izvoa u odnosu na sve os-
tale. A, onda je pogazio sve, njegova "Kruka"
se prva izdvojila i napravila lom. Tako se sarad-
nja na drugom "Miligramu" sama desila. Neko
gore je to sve udesio da se tako desi.
Alen: Niko se nije svaao, ni Brega sa mnom,
ni ja s Milijem...
Mili: Jednostavno je sve vodilo tome i Alen je
sada lan "Miligram" benda, frontmen, pjeva i
ono to je najvanije kod nas jeste to smo bend
koji je kompaktan. Privatno se drimo jedni
drugih isto kao i na bini. To je to nae koncerte
ini tako burnim i posjeenim. Pozitivnu ener-
giju prenosimo kao sopstvenu potrebu.
Alene, je li Vas Mili uvijek ovako hvali?
- Da. Nisam ga uo nikada da me kudi.
Mili: Nemam razloga, deko je savren....
(hahahahaha)
Alene, kakva je to tetovaa na desnoj ruci?
- Imam samo jednu i razmiljam da jo
uradim. To mi je prva i uopte nije mala.
Osmi trei je datum kad smo se supruga i ja
upoznali, Toni ili Antonio je ime moga sina,
Natalija ili Nata je ime moje supruge i tu je
vrijeme kada se moj klinac rodio.
A, kakav ste tata?
- ena mi kae da sam dobar, a im mi ona
kae, onda je to tako.
Ko koga vie slua u kui?
- Sve je stvar dogovora, nema tu da ona slua
mene ili ja nju, nego se sve zajedno dogo-
vorimo.
Mili, Vi due od Alena balansirate izmeu po-
rodice i karijere, kako uspijevate?
- Kad ima ovoliko obaveza, nije ba lako, ali
mora da ima osobu koja razumije prirodu
ovog posla. Imam sreu da imama suprugu
koja me podrava u svemu i onda je mnogo
lake. Pogotovo kad sam na turneji, u redu je
kada svira dva-tri dana. etvrti ve poinje
da se zabrinjava, a ostatak turneje pati. Ali,
nekako to publika kompenzuje.
- Alen: Ja patim u startu...(smijeh).
A, kakvi su susreti?
Mili: A, susreti su kao na flmovima, trimo
jedni prema drugima sa 30 metara... (hahaha-
hah).
Kupujete li poklone djeci kad se vraate s
turneje?
Mili: Da, to mi je uvijek vadiona.
Nismo djeca i ne vjerujemo u Djeda Mraza, ali
da on postoji, ta biste mu zatraili?
Mili: Naravno, zdravlje, i da "Miligram" ove
godine ostvari velike koncerte, nadam se da e
prvi veliki koncet biti ba u Sarajevu. Planiramo
da ove godine idemo na neki veliki prostor. To
bi mi profesionalno bila najvea elja.
Alen: to se tie posla, saglasan sam s Milijem,
a privatno bih savjetovao svima da se vie vole,
potuju i cijene, a ne da gledaju ko e kome da
zabije no u lea.
AZRA 2013. 27
M
A
D
E
I
N
B
I
H
DAMIR EHANOVI
SLATKO-
GORKI
OKUS
SLAVE U
NAUNOM
DJELU
3,j(=$1$.2/2j08/$%',)2720,+$708-.,
AZRA
28 AZRA 2013.
Poetkom decembra poznati televizijski voditelj
i urednik Damir ehanovi na Filozofskom
fakultetu u Tuzli odbranio je magistarski rad
"Strategije i tehnike celebrity odnosa s javnostima
u ex-jugoslavenskom kulturolokom prostoru".
Odabir teme bio je, kae, logian slijed nakon
dvadeset godina rada u novinarstvu.
- Bio sam prvi iz BiH koji je odmah nakon rata
radio razgovore s poznatim linostima u Hrvat-
skoj, Srbiji i Sloveniji, pronalazio sam nekadanje
zvijezde i susretao se s onima koje su tek bile u
nastanku. Mnoge od njih danas poznajem veoma
dobro i privatno, pa mi se inilo prirodnim da
piem rad o tome i defniram strategije i tehnike,
koje su ih dovele na mjesta gdje se danas nalaze.
Sve to u jednom svijetu, koji se mnogima ini
aroban i sladak, a iznutra nije ni priblino takav.
Nekako mi se ini da je svijet slavnih zanimljiv
samo onima koji mu ne pripadaju. Drugima,
koji su njegov sastavni dio, to je samo poslovno
okruenje, u kojem djeluju s manje ili vie uspjeha.
NAJVEE ZVIJEZDE
Nakon to je poloio gotovo sve ispite na mag-
istarskom studiju, u dogovoru s mentorom prof.
dr. Najilom Kurtiem, prijavio je temu, koja je
ubrzo bila i odobrena. Od tog momenta do dana
odbrane prole su dvije godine.
- Moram biti iskren i rei da nisam sve vrijeme
radio na tome. U mom istraivanju uestvovale su
najvee zvijezde nekadanjeg jugoslavenskog pros-
tora iz vie sfera: pjevai, producenti, muziari,
novinari, sportisti, glumci i drugi. Dakle, svi oni
koji imaju dodira sa svijetom estrade. Kako sam
elio imati to potpuniju sliku, pokuao sam
analizirati karijere onih koji su u tom svijetu ve
tridesetak godina, ali i osoba koje se tek bore da
okuse komadi slave.
Kako je i oekivao, sa "zvjezdicama" je bilo teko
ili nemogue uspostaviti kontakte i zavriti posao
jer su "zauzeti", "nemaju vremena" ili "imaju
previe obaveza"...
- Oni koji su zduno podrali moju elju da nap-
ravim kvalitetan rad, koji su odvojili svoje vrijeme
i prenijeli dio iskustava, jer su valjda slobodni i
besposleni bili su: Lepa Brena, Severina, Zdravko
oli, Goran Mili, Edin Deko, Moamer
Kasumovi, Zana Marjanovi, Nina Badri, Saa
Loi, Zrinsko Tuti, Emilija Koki, Vukain
Braji ... i mnogi drugi. Hvala im.
Jedna od pomonih hipoteza, koja je u
konanici i potvrena, jeste da zbog specifnosti
kulturnoantropolokih karakteristika ovog
prostora pojedine strategije i tehnike uspjeha
poznatih, koje se primjenjuju u SAD-u i Evropi,
kod nas jednostavno nisu primjenjive.
- Defnirao sam nekoliko kljunih strategija i
tehnika kojima se slue poznati ili oni koji to ele
biti, meu kojima su najbitniji dogaaj i preusm-
jeravanje panje. S mentorom sam dogovorio da
u narednoj godini rad pretoim u knjigu. Objavit
u je kad odvojim vrijeme i naem sponzora i
izdavaa.
Iako je danas novinarstvo, naalost, kao profesija
devalvirano i svi se bave njim, Damir je jedan od
rijetkih odluio na edukaciju. Pitamo ga kako je
doao na tu odluku?
- Priznajem da nisam bio neki pretjerani ljubitelj
kole. Bavio sam se iskljuivo stvarima koje me
zanimaju i predmetima za koje sam procijenio da
bi mi mogli trebati u ivotu. Matematiku, hemiju
i fziku ostavljao sam onima iji je to interes bio.
Oito da sam se pronaao u novinarstvu i odnosu
s javnou, pa su mi fakultet i postdiplomski
studij ili veoma dobro. Nikada do sada, ni za
jedan posao, nisam bio uslovljen diplomom oso-
bito ne titulom magistra nauka, ali jednostavno,
neke stvari su se poredale.
O doktoratu ili akademskoj karijeri ne razmilja,
jer ima druge ambicije. Ali, nikad se ne zna...
- Sada obavljam poslove konsultanta za ko-
munikacije i rad s interesnim skupinama u
meunarodnoj fnansijskoj instituciji. Veoma sam
zadovoljan poslom koji radim. Sve mi je izazov
i svakog dana nauim neto novo. Posebno se
ponosim timom kojem pripadam, jer su puni
razumijevanja za moj period adaptacije. Od ovog
posla oekujem mnogo, a dat u svoj maksimum.
PROLAZNA
KATEGORIJA
Televizijsko novinarstvo je i dalje njegova velika
ljubav, a bilo je ak i nekih dogovora s pojedinim
urednicima i direktorima.
- U elektronskim medijima BiH trenutno je
najgora situacija ikad. Programi su bazirani na jef-
tinim serijama, reality programima te sadrajima
za koje ne treba znanje, niti se iz njih neto moe
nauiti. Trudio sam se da moje emisije, osim
zabavnog, imaju i edukativni sadraj. Polusvijet
danas odluuje o tome ta e se proizvoditi, sklon
je korupcijima najnieg ranga, posebno na javnim
servisima i ne eli ljude koji znaju raditi svoj
posao i imaju miljenje. Nikada ne reci nikad, ali
ako me i vidite negdje na televiziji, to e biti neko
gostovanje ili neto iz arhiva. Toliko sam se nara-
dio da bi mjesecima iz arhiva mogli prikazivati
moja djela. To je jedino to se pamti i ostaje. Ljudi
koji vode televizije prolazna su kategorija.
Kae da se na emotivnom planu nita znaajno ne
dogaa. Bar ne transparentno...
- Ne deava se nita to bi trebalo izai iz moja
etiri topla zida. ene su divna stvorenja, ali jo
nismo nali odgovore na pitanja ta sam ja tebi" i
dokle emo mi ovako".
Za novogodinje praznike planirao je odlazak u
Austriju, ali je zbog posla sve otkazao.
- Moda skoknem do nekih toplica ili odem na
dva-tri dana u Zagreb, a moda vam se na kraju i
javim iz Austrije. Moji koferi su uvijek spremni za
putovanje. Godina koja je iza mene bila je sjajna.
Novi posao, titula magistra nauka, lijepa druenja,
mnogo vremena provedenog sa sestriem
Rijadom i prelijepo ljeto na moru. Najbitnije od
svega, svi moji najdrai su zdravi i ivi. Neka tako
ostane i u ovoj, bit u prezadovoljan.
Za poznatog
televizijskog voditelja
i urednika protekla
godina bila je sjajna. Uz
novi posao, obiljeila
su je lijepa druenja,
mnogo vremena
provedenog sa sestriem
Rijadom i prelijepo
ljeto na moru. No, titula
magistra nauka Damiru
je dala krila, a on je
kao temu rada izabrao
ono emu je pripadao
posljednjih 20 godina,
analizirao je tajne
uspjeha zvijezda u Regiji
ENE SU DIVNA
STVORENJA, ALI
JO NISMO NALI
ODGOVORE NA
PITANJA TA SAM JA
TEBI" I DOKLE
EMO MI OVAKO"
AZRA 2013. 29
U AFGANISTANU SAM
ZARADILA 60 HILJADA KM
I IZGUBILA SVE OSTALO
AZRA
Htjeli smo priu o mladim ljudima koji trbuhom za kruhom odu ak
u daleki Afganistan, najveu vojnu bazu Kandahar. Dobili smo sagu o
(neunitivoj) bosanskoj eni koja e za dobrobit djeteta uraditi uda.
Poslije ovog teksta zatomite poriv da nekom slomite nos, radije joj
pomozimo da nae posao dostojan njene veliine
Nai tabui
5$=*29$5$/$(/$0(5,j.5*,0,.8/,
30 AZRA 2013.
"Ne moe se desiti velika katastrofa. Ne moe.
Nee propasti ni materijalno, niti kao ovjek
dok god neto pokuava. Bilo ta", dio nekog
flmskog dijaloga mi se vrtio po glavi dok sam
ila na sastanak s Dinom.
"Azra" je nedavno objavila prilog "Kako do
posla" i dio vodia se odnosio na poslove u
inozemstvu. Najvie upita, koji su nakon toga
doli u nau redakciju, odnosili su se na rad
u Afganistanu. Davali smo tehnike upute,
ali i traili nekog ko je tamo radio. Sjetih se
Dine. Rodica moje rodice, kominica moje
prijateljice... ne znam tano od kada pamtim
to veselo djevoje. Priali su mi kako je otila
raditi u Afganistan. Nije se vie moglo. Mu
ne radi, a ona "gine" za 500 KM. ta ovjek
danas moe za te pare?
Njoj su 33 godine, majka je osmogodinje
djevojice i sad ve niija supruga. Po povratku
iz Afganistana - razvela se. Ali, krenimo
redom.
- Moja kerka, sad ve bivi mu i ja ivjeli
smo kao podstanari i uvijek imali fnansijskih
problema. Primanja od 500-tinjak KM nisu
mogla podmiriti sve nae potrebe. Imam
prijatelja koji godinama radi tamo i s vremena
na vrijeme smo kontaktirali putem e-maila ili
skypea. Znao je za nae probleme i ponudio
mi da doem. Na poetku sam rekla da nema
anse, ali smjesta sam poela razmiljati o
tome. Do tada sam sve pokuala u BiH i nisam
vidjela izlaza.
ta si radila ovdje?
- Radim od svoje 16. godine i bilo je svega.
Prodavala sam srebro, radila kao stomatoloka
sestra, bila komercijalist u marketinkim
agencijama, prodavaica u buticima,
konobarisala, radila u tampariji... Uvijek su to
bili honorarni poslovi ili na odreeno vrijeme.
Nikad se nisam mogla dovoljno isfnansirati.
Tad mi je prijatelj javio da je raspisan
konkurs za radno mjesto za koje sam savreno
odgovarala. Mogu poslati molbu, kao rezervu,
ne moram ii - tako sam mislila o tome. Prola
sam prvi krug, organizirali su mi conference
call intervju. Radilo se o jednoj kanadskoj
frmi. Bili su zadovoljni sa mnom i poslali su
mi pismo ponude.
Jesi li u prvoj fazi prijavljivanja za posao u
Afganistanu neto morala plaati?
- Ne, nita. Barem je tako za ovu frmu. Dakle,
poslali si mi ponudu, pitali jesam li zadovoljna
novcem. Nudili su mi 5000 KM, to je je za
mene bila premija, pogotovo ako uporedim sa
onih 500 KM s koliko smo plaali stan i reije,
hranu... kao to znate, bila je to nemogua
misija. Mislila sam da u radom u Afganistanu
est mjeseci ili godinu, kupiti sebi malo
vremena da drugaije posloim stvari u svom
ivotu. Bilo mi je teko tih nekoliko dana,
koliko mi je trebalo da se izjasnim. Na kraju
sam pristala. U BiH sam morala obaviti sve
ljekarske preglede, primiti vakcine. I to je bilo
to. Imala sam zakazan let.
Kako si letjela?
- Iz Sarajeva za Istanbul, pa Dubai i na koncu
Afganistan.
U kojem gradu u Afganistanu si bila smjetena?
- U Kandaharu. To jeste najvea NATO baza u
Afganistanu. Do Istanbula sam plakala, a kad
sam stigla u Dubai, htjela sam nazad. Ipak,
vie nije bilo nazad.
Kakav je bio prvi susret s tom zemljom?
- Apsolutni ok. Iz Sarajeva sam otila 03.
marta, jo je bio snijeg, a kad sam sletjela u
Kandahar, ujutro je ve bilo 30 ili 40 stepeni
Celzija. Pustinja, vojska, pravi tenkovi, pravo
oruje, pravi rat... Prvih dana nisam imala
interneta, nikakve veze s porodicom. Na
posao sam se brzo navikla, s tim nisam imala
problema.
ta si tano tamo radila?
- Bila sam glavni nabavlja za bazu, od fltera
za vodu, guma, ventila, dijelova za automobil,
kancelarijskog materijala... I tako, prvi mjesec
se nekako izvukao, drugi mi je bilo totalno
teko... dan nema kraja. Ujutro u sedam sati
ve je 30 stepeni, u osam je 40, vojska, granate
fakat padaju, fakat je to rat.
Koliko je baza, gdje si bila smjetena, bila
udaljena od prve linije borbe?
- Bila sam smjetena ba u bazi, moj radijus
kretanja sveo se na 300 metara. Posao, stan,
shop i to je to. Imali smo pet kantina gdje smo
svi jeli, tano je odreeno vrijeme za doruak,
ruak, veeru, nakon toga nema jela. Tipina
vojna organizacija.
Jesi li tamo viala domicilno stanovnitvo?
- Da, bilo ih je i uposlenih u bazi. U augustu
dnevna temperatura tamo see do 70 stepeni.
U kontejneru ne moe biti due od pet
minuta. To je bila ansa za njih, jer Evropljani
na tim temperaturama padaju u nesvijest. Oni
su mogli dobiti zadatke koje zapadnjaci nee
raditi. istili su kanalizaciju, kopali rovove i
sve to za pet dolara dnevno. Iz nae perspektive
oni nisu nimalo civilizirani.
Je li bilo diskriminacije?
- O da! Na poetku to nisam znala, jer sam
radila s Filipincima, kojima je njihova vlada
zabranila da rade u Afganistanu, ali oni
iznalaze ilegalne kanale i dolaze do baza, a
poslije sam shvatila da smo svi razliito plaeni
za iste poslove koje obavljamo. Naime, postoje
grupe 1, 2 i 3. Istonoevropljani su grupa
2, grupa 1 su Filipinci, Pakistanci, Indijci, a
grupa 3 su Amerikanci, Kanaani i Britanci.
Dakle, u jednoj kancelariji rade pripadnici svih
triju grupa, Filipinci ne mogu kui 11 mjeseci,
i plaa im je 1000 dolara, rade 11 sati dnevno.
Mi, kao grupa 2, imamo veu plau od njih,
idemo kui svakih est mjeseci i radimo osam
sati dnevno, a Amerikanci, Britanci i Kanaani
rade po osam sati dnevno, idu kui svaka tri
mjeseca i imaju plau od 15.000 do 20.000
dolara. Apsolutna diskriminacija.
Priaj mi jo malo o Afganistancima...
- Ne znam, ne mogu se pravilno izraziti a da
nekog ne uvrijedim. Uglavnom su nepismeni,
ne znaju itati ni na svom jeziku, Talibani
njima itaju Kur'an i tumae kako oni ele.
Imali su unutar baze svoje pijune koji su
ONI SU USPJELI
UNIJETI ELEMENTE
OD KOJIH NAPRAVE
EKSPLOZIV. NE
ZNAM KAKO
IM JE TO POLO ZA
RUKOM, JER NA
KONTROLNOM PUNKTU
SU POLJACI, KOJI SU
KRAJNJE RIGIDNA
KONTROLA. OD 150
AFGANISTANACA, KOLIKO
IH JE RADILO U
BAZI, VJEROVATNO NJIH
50 SU BILI PIJUNI
SEKS I ALKOHOL
SU POTPUNO
ZABRANJENI
AZRA 2013. 31
AZRA Nai tabui
Britanka "dobre
GXHNDNR
'LQDNDH
napravila je
kolu za lokalnu
GMHFX2YRMH
njihov prvi dan
u novoj koli
'MHFDVHHVWR
etaju oko baze
XQDGLGDH
im vojnici dati
neto za jelo ili
igranje
+LMHQDMHWDPRGRPDD
LYRWLQMD
Balkanci su se
i u Kandaharu
GUDOL]DMHGQR
32 AZRA 2013.
crtali gdje se ta nalazi. esto smo imali
razliite treninge, na jednom je predava bio
Kanaanin, koji nas je uputio da se ponaamo
lijepo prema domicilnom stanovnitvu, ali da
imamo na umu da: "...oni iste gov.. da mi to
ne bismo morali raditi". Ja sam radila s jednim
Afganistancem, zove se Admal i on je iz
Kabula. Admal je bio pristojan prema meni,
zaraivao je za svoju porodicu.
Osam sati si radila, osam spavala, kako si
provodila preostalih osam sati?
- Spavali smo u takozvanim kontejnerima,
po dvije djevojke u jednom. Poslije posla na
jednom mjestu sastali bi se Bosanci, najvie
ih ima s podruja opine Lukavac, pili bismo
kafu. Imali smo odlian odnos s dvojicom
Hrvata, koji bi nam, takoer, pomagali
u svakodnevnim poslovima. Naprimjer,
nedjeljom bismo svi bili slobodni, deki iz
Zagreba bi nas vozili autom do veeraja, gdje
smo svi prali rublje. Imali smo na raspolaganju
teretane, salsu... Svega toga sam se prvih est
mjeseci uvala.
Kako misli "uvala"?
- U bazi je tokom mog boravka bilo
registrirano 46 silovanja. Dio baze u kojoj su
bili smjeteni Amerikanci nazvan je South
Park, i tu su se desila sva silovanja. eni, u
principu, nije bilo preporueno hodati samoj.
Ko su silovatelji, najee?
- Amerikanci. Amerika vojska je sebi
naruila imid zbog injenice da su dopustili
da u njihovim redovima budu silovatelji,
ubice i razni kriminalci. Najrunije slike
iz Afganistana, koje ste svi imali priliku
vidjeti, dole su od takvih ljudi. ao mi je,
jer sam imala priliku sjediti s amerikim
generalnom, zapovjednikom kampa, koji je
veliki profesionalac i odlian ovjek. Pitao me
ta, kao muslimanka i Evropljanka, mislim
o Amerikancima. Bila sam iskrena. Svjesna
sam da meu njihovim redovima ima pravih
vojnika, koji su svoj ivot posvetili profesiji...
ali, njihova je greka to su ih mijeali sa
svakojakim oloem.

Koliko ljudi je bilo u bazi Kandahar, dok si ti
tamo boravila?
- Izmeu 60.000 i 70.000. Bilo je tu ilegalnih
abortusa.
Ilegalnih? Dakle, seks je zabranjen u bazi?
- Seks i alkohol su potpuno zabranjeni.
Pa kako su raeni ilegalni abortusi?
- U mojoj frmi radio je ljekar Afrikanac,
koji je bio potpuno zaljubljen u BiH, a
medicinska sestra koja ga je pratila u radu bila
je Ljilja, Banjaluanka. Njihova radni dan bio
je u vojnoj bolnici, znam da im je posebno
teko bilo kada bi dolazili ranjenici. Sve tee
sluajeve prebacivala bi hitno za Njemaku.
Dakle, ta bolnica je trebala biti prostor gdje su
se obavljali ti abortusi.
Jeste li imali organizirana neka zajednika
druenja?
- Pa u vrijeme Boia organiziran je rotilj,
odobravana su dva piva po osobi ili dvije ae
vina. Ma sve u svemu... odlazak u Afganistan
bila je moja najvea greka.
Pa zato?
- Dan nema kraja. Meni je bilo tee, jer sam
u Sarajevu ostavila mua i dijete. Ustajala sam
sa suzama i lijegala uplakana. Za mene nije
bilo oputanja. Samo sam ekala da proe
radni dan, da doem u sobicu i na skypeu
piem zadau sa svojim djetetom. Nakon toga
plaem.
Koliko vremena si ukupno provela tamo?
- Godinu.
Koliko si zaradila za to vrijeme?
- Neto vie od 60.000 KM.
Misli li da si kao majka propustila neto kod
svog djeteta za tu godinu?
- Skroz. Iznenadila sam je kad sam dola
nakon est mjeseci. Rekla sam joj da u doi
dan kasnije. Kad sam izala iz taksija, na
trenutak me nije prepoznala. Promijenila je
svoje ponaanje... i sad je veoma posesivna
kad sam ja u pitanju. Kad sam otila, ona
je krenula u prvi razred. Nisam vidjela prve
ocjene, bila na prvim testovima...
Rekla si da su se, tokom tvog boravka, neki
Afganistanci raznijeli bombom u bazi. Kako se
to desilo?
- Oni su uspjeli unijeti elemente od kojih
naprave eksploziv. Ne znam kako im je to
polo za rukom, jer na kontrolnom punktu su
Poljaci, koji su krajnje rigidna kontrola. Od
150 Afganistanaca, koliko ih je radilo u bazi,
vjerovatno njih 50 su bili pijuni. Crtali su
raspored u bazi, javljali kad su koncerti.
Kakve koncerte ste imali tamo?
- Pa pjevao nam je Robie Wiliams, dolazili su
protagonosti serije "Sopranosi"... i jo mnogi
drugi.
Rekla si da je odlazak u Afganistan bio tvoja
najvea greka. Ima li to veze s razvodom?
- Da. U Afganistan sam otila jer sam postala
sama sebi jadna zbog hronine neimatine.
Kao majci, bilo mi je teko to ne mogu
ispuniti ni najskromnije elje svoje djevojice.
Odluku da odem u Afganistan nikad nisam
donijela do kraja, samo sam u jednom
trenutku dobila avionske karte. Svakoj majci je
muna pomisao da se odvoji od svog djeteta.
Organizirala sam njihov ivot ovdje u smislu
da sam nala enu koja e im dolaziti i istiti
kuu, prati i peglati ve. U mua sam imala
bezgranino povjerenje. Ipak, kad sam se
vratila, bila sam jo jadnija.
ta se desilo?
- Plau koja se zaradi u Afganistanu niko ne
dobija "na ruke". Tako je i moja lijegala na
konto. Pristup mom kontu imao je, naravno,
mu. Trebao mu je novac za dijete, njega...
ivot. Kad sam se vratila, htjela sam da sve
troje otputujemo u Dubrovnik i pitala sam
mua koliko jo novca imamo na raunu.
Rekao je da nemamo gotovo nita.
Kako to?
- To ne znam ni ja. Potroio ih je. Kako, ne
znam ni ja. Da bi se potroilo tako mnogo
novca, treba truda. On je uspio. Kocka,
alkohol... ili sve zajedno. Kad sam se vratila,
nisam imala novca da posjetim svoju majku,
a kamoli ta drugo. Izgubila sam godinu sa
svojim djetetom, a da na kraju nisam dobila
nita. Iskustvo Afganistana mi nije trebalo.
Nita dobro i lijepo nisam tamo nauila. Svaki
rat je ruan, taj tamo je i nepravedan, meu
60.000 ljudi iz raznih krajeva svijeta dobro
spozna ta znai biti Bosanac... Razvela sam
se, naravno... i ta sad? ivim sa kerkom kao
podstanar, radim neki smijeni posao i opet
nemam nita.
Pa ta e sada?
- Ne znam (pla). Moda sam rodila velikog
ovjeka, moda e ovo moje dijete biti po
neem vano, moda je u njemu saeta sva
moja srea. ta da mislim poslije svega?
U BAZI JE TOKOM
MOG BORAVKA BILO
REGISTRIRANO
46 SILOVANJA.
DIO BAZE U KOJOJ
SU BILI SMJETENI
AMERIKANCI
NAZVAN JE SOUTH
PARK, I TU SU
SE DESILA SVA
SILOVANJA
AZRA 2013. 33
udna jada od
Mostara grada
Prsten i zlatni lanac dat e ti Bosanac, samo da
te jednom... I Bosanac, a, bome, i Hercegovac.
Doslovce sve, samo da je, makar jednom...
Nema na ta nisu spremni da dobiju one stvari.
Nekad u tim nakanama stvarno prekardae.
A ene k'o ene. Romantika e im dohakat'
k'o haker web stranici ili Hakala ljubiteljima
klasinih partitura!
Helem, mostarski privatnik, radi i na istonoj i
na zapadnoj strani. Moete misliti kakva je liska,
ta liska - lisica, arka, poskok(!), kad uspijeva sa
svima dobar biti.
E, on takav, na zalasku valerske karijere, s dva
propala braka iza sebe i more neslavno zavrenih
veza, ko zna koliko nepriznate djece, zaorio za
jednom curom iz malog hercegovakog mjesta.
Moe mu kerka biti, ali to je danas moderno,
da je narod u dilemi ko je enska do uturuma -
unuka, kerka, cura, ena?
A i ona mudrica, ne bi njoj bilo mrsko uvalit' mu
se. Da mu bude posljednja.
Znala je ona dobro koje je zlatno pravilo - samo
mu ne daj. I nije mu dala. Mjesec, pola godine,
godinu, godinu i po. A stalno mu pred oima
u kafu njegovog glavnog pajdaa. Dovoljno
otkrivena da mu padne mrak na oi, a opet i
dovoljno zakopana da je ozbiljno shvati.
On poludio. Stalno joj za petama. Muntaj ovako,
muntaj onako, ne pomae. Obigrava oko nje k'o
narodnjak oko Bazena, pravi budalu od sebe,
pokuava sve fnte... al' odgovor vazda isti:
- Nita prije braka.
- Jes' to rekla nita prije mraka, ljepoto moja.
Ona se poluuvrijeeno, a opet eretski nasmije,
odmahne rukom i:
- De, ne budali, nisam ti ja od otih. Svia se
ti meni. Nisi lo. A ni meni nita ne fali. Ili
potpisuj, ili se makni od mene da moe ko
ozbiljan prii.
On se nije odmico. Nakon godinu i po, kad je
vie potroio sve fore i fazone, dolo je dotle da ju
je poeo ak i mrziti. Hej, nije ala, itav se narod
smije njegovom bezuspjenom oblijetanju onako
multinacionalno. I na desnoj i na lijevoj obali.
Poludio on totalno i odluio odigrat' najprljavije
to moe. Prije nego to je izloio ovaj pakleni
plan svojim priljepcima od jarana, opravd'o
se, iako se ono to e uinit' nikako ne moe
opravdat'.
- I ona igra prljavo. Mae mi pred nosom, a
ne da. Hakom tribunalu bi je trebalo predat'
kad moe onako gledat' a ne dat' (propjeva
onaj poznati stih velikog samoproklamirajueg
estradnog seksualnog manijaka Mie
Vukainovia). Samo da joj se uvalit' pa da mi jo
komanduje na mom. E, dosta je bilo. Nisam ni ja
levat i papak.
Kako smislili, tako i uradili. Pozv'o nju i njenu
najbolju prijateljicu na ruak u najbolji restoran,
a da sve dovoljno uozbilji, poveo ovu dvojicu
svojih kao svjedoke.
I sve odradio k'o s televizije. U po ruka kleknuo,
izvadio prsten (bez zlatnog lanca), izgovorio sve
to se treba izgovorit':
- Ljubavi, uini me najsretnijim ovjekom na
svijetu. Budi mi ena. Ljubav moja u dobru i zlu.
I ona suzu pustila, pristala odmah uz pitanje:
- Hoe li mi biti dobar?
On se rastopio, k'o onaj lisac iz crtanih flmova.
- Naravno, ljubavi. Sve druge su bile broj. Srce
spava sve do asa kad se javi prava (nastavio je
citirat omiljene mu note).
Prijateljica i jarani diskretno se povukli da ostave
nasamo tek "vjerene" golubove.
Malo-pomalo, odvede on nju sebi da ona vidi
dvore u kojima e kraljica biti. I pade ona i prije
mraka i prije braka.
Taman se istuirali, a ona za telefon da zove
mater i javi joj da se vjerila, eto i udala, da se
nee kui vraati.
A on za slualicu:
- Nemoj jo, ljubavi, hajde ti kui. Moram jo
pozavravat' neke stvari u ivotu da tebe to ne
sekira poslije. A nije ni vrijeme sad nikako. Vano
je da si moja, da smo se obeali jedno drugom.
I tako je vrijeme svadbe pomjerano. Prvo zato to
je izmeu dva bajrama. Pa do Nove godine. Pa
dok on kredit vrati. Pa dok mu dijete u srednju
krene. Helem, skoro godinu.
Njoj puk'o flm i dola mu na vrata s koferom.
On vie nije imao kud, nego je fakinski, na
najgori nain otkaio. Rekao da je glupaa koja je
pala na romantiku. Da joj je bolje bilo da je uila
nego toliko gledala serije, koje su joj dohakale.
Ona vritala na njega, a i on na nju, da je itav
komiluk iza'o.
Na koncu, nije imala druge nego se okrenuti i
otii.
Dok je odlazila, on joj vikao da mu vrati prsten.
Pokazala mu srednji prst i bacila prsten u
Neretvu.
A kako se sve sazna, naroito u Mostaru, tako se
i proulo kako je ovaj poduzetnik prevario curu,
zdravu-pravu, i jo joj traio da mu prsten vrati.
udna jada od Mostara grada.
I krenuo je bojkot. Onako kako to ve Mostarci
znaju. Samo mu se zatvaraju vrata. Jedna za
drugim.
U lice mu se smiju i kau:
- Braca, najjai si...
A onda se okrenu i poslove s drugim prave.
Znamo svi na ta su mukarci sve spremni da
dobiju one stvari.
Ali i tu mora biti granica.
Makar onolika kol'ka je Neretva.
AZRA Kolumna
Malo-pomalo, odvede on nju sebi da ona vidi dvore u kojima e kraljica biti. I pade
ona i prije mraka i prije braka. Taman se istuirali, a ona za telefon da zove mater i
javi joj da se vjerila, eto i udala, da se nee kui vraati. A on za slualicu:
- Nemoj jo, ljubavi, hajde ti kui
3,j(,1',5$.88.625*8
34 AZRA 2013.
S
t
y
l
i
s
s
i
m
o
I jo:
Svi su poludjeli
za novom
kolekcijom Velide
Skake -provjerite
zato
Day after: Maske
koje e vam vratiti
ivot na lice
Tibetanski
recepti za srce i
dugovjenost
Recepti za
junaku hranu -
grah
Bili smo u
Indoneziji
i tamo nali mir
za tople dempere
Stylissimo
Moda
Znate li kako, prema modnim strunjacima "Vouga", izgleda va vikend outft?
Kombinirajte ekstra dug vuneni demper i veliki kaput i spremni ste za etnju
gradom. ini se da oputeni vikend izgled prolazi kroz svojevrsnu renesansu.
Bilo kako bilo, kombinirajte pletene dempere s elegantnim detaljima. Bilo koji
model hlaa uih nogavica savren je odabir uz veliki pulover kao protutea
volumenu. U prodavnicama pronaite komade koji e vas odueviti bojama, ali i
teksturom s razliitim motivima. Favorit u svijetu uzoraka je klasina pletenica
VRIJEME JE
MICHAEL
KORS
REED
KRAKOFF
J.W.ANDRESON
MARC
JACOBS
36 AZRA 2013.
F
A
S
H
IO
N
B
L
O
G
E
R
H
TTP://ELZAN
APJEVIC
.BLO
G
SPO
T.C
O
M
S
m
iz
lic
a
z
a
z
a
's
b
lo
g

H
T
H
T
SIBIRSKA ZIMA
Pozitivna strana zime je ta to mogu nositi ovako
divne kapice. Dva dana zaredom, sva uzbuena,
nosila sam ovu ubaricu. Treeg nikako nisam smjela.
Pono je prola i kod nas je poeo padati snijeg. Divan
je to prizor. Nije da ne volim zimu, koliko volim da
dramatiziram i kukam. Takva sam.
Ostaje mi samo jo da zaelim da kad se ujutro
probudim i pogledam kroz prozor, ugledam sve bijelo,
a ne sivo i prljavo. Dobro nam dola zimo i molim te,
potedi nas maksimalno :D
EMILIO
PUCCI
PRINGLE OF
SCOTLAND
CARVEN
RODARTE
AZRA 2013. 37
Stylissimo
Moda
VELIDA SKAKA,
MODNA
DIZAJNERICA
Bh. dizajnerica Velida Skaka jedna je od ri-
jetkih u naoj zemlji, koja u ovim izuzetno
tekim vremenima biljei sve veu prodaju
svojih kolekcija. Naime, njeni novi mod-
eli namijenjeni za sezonu jesen/ zima 2012-
2013. veinom su rasprodati. Jedan dio
kolekcije dizajnerica je sauvala kako bi se
predstavila na Nivea Bh. Fashion Weeku,
koji je prije nekoliko dana odran u Tuzli.
Kao i uvijek, njeni modeli pozdravljeni su
aplauzom.
- Pri dizajniranju zimske kolekcije usmjerila
sam se u dva pravca - nosivo i klasino. Rije
je, dakle, o modelima koji su enstveni, a
damama koje ih nose daju elegantni look,
koji istie liniju tijela - naglaava Velida.
Svojim klijentima ponudila je aroliku lepezu
boja - od onih neutralnih, poput crne i be
do ruiaste, ljubiaste, crvene, kojima ete
pobijediti sivilo. Na kompletnoj kolekciji
radila je etiri mjeseca, a modeli su u prodaji
ve dva mjeseca. Stalne muterije uvijek joj se
rado vraaju.
Uspjena
prezentacija
na Nivea
Fashion
Weeku u
Tuzli
Zimska
kolekcija
KOJU
ETE
VOLJETI
1DUDQGDVWD]DYHGURUDVSRORHQMH
Military jaknica i
VXNQMDNODVLQHOLQLMH
Kimono jaknice garantiraju elegantan look
38 AZRA 2013.
- Veliki dio kolekcije ve je na ulicama.
Prvi put sam odluila da radim cijele serije.
Od kaputa do jakni, kompleta, koulja te
haljine. Moje haljine su one koje moete
nositi tokom cijelog dana, a uz birane detalje
moete zablistati tokom veernjeg izlaska.
Zimska kolekcija je, dakle, konfekcijska. Ako
je postoji neki poseban zahtjev, moemo i to
uraditi po mjeri i u eljenoj boji. Klijent je
uvijek na prvom mjestu.
Naglaava kako je pokuavala da napravi za-
nimljive kombinacije uz pomo kojih ete
pobjei od uniformiranosti.
- Jaknu military linija kombinirala sam s el-
egantnim hlaama, a uz haljine zanimljive
helanke i slino. Moji modeli izuzetno su
enstveni, ali namijenjeni su jakim enama,
onim koje znaju ta ele. Takoer, ni gen-
eracijski granice ne postoje. Svako zaista
moe pronai neto za sebe - kae Velida,
potcrtavajui kako joj je posebno vana este-
tika, ali su jednako bitni i kvalitetni materi-
jali, te struna izrada.
.RDLWHNVWLOJODYQDNRPELQDFLMDRYHVH]RQH
Elegancija bez granica
&UQRELMHOLVYLMHW
AZRA 2013. 39
Stylissimo
Moj neseser
Lijepa glumica "Larinog izbora" i roena
Mostarka otkriva nam tajne svoje ljepote
i sadraj njene beauty torbice u kojoj se,
kae, nalazi minka za svaku priliku
uvam boice
potroenih parfema
O
R
N
E
L
A

V
I

T
I
C
A
Volite li se minkati poput veine ena
ili...?
- Iskreno, u posljednje vrijeme najvie
volim biti bez minke, ali inae se
volim prepustiti profesionalnim
vizaistima, jer oni uvijek naprave
pravi posao. Vjerujem im i volim kada
me iznenade svaki put u nekoj novoj
varijanti.
Jeste li, moda, kao djevojica krali
maminu minku?
- Jesam i vjerujem da su to sve
djevojice radile. To je jedna faza
odrastanja, kada se djevojice poinju
interesirati za maminu minku i tikle.
I ja sam bila u toj fazi i vrlo rano sam
poela isprobavati rueve i maskare. To
mi je bilo ba zanimljivo.
Kojoj kozmetikoj kui ste najvjerniji?
- Uglavnom je to "L'Oreal", odline su
mi njihove sjene za oi, i to u zlatnim
nijansama, zatim "True Match" puder,
koji je uvijek dobro imati uz sebe.
Neutralan je i izgleda prirodno kada se
nanese na lice. U mojoj beauty torbici
ima mnogo minke koja se moe
iskoristiti u raznim situacijama.
Koristite li samo provjerene beauty
preparate?
- Volim sve raditi po preporuci. to
mi prijateljice preporue, onda to i
kupim. Nisam neki veliki fanatik,
pa da sam opinjena nekim novim
proizvodima i da ih moram imati
po svaku cijenu. Ali, trudim se
biti upuena u sve to izlazi na
trite, kako bih izabrala najbolje i
najkvalitetnije. Dok me minkaju,
upijam savjete vizaista.
A, najvredniji njihov savjet je...
- Da nikada sa minkom ne treba
pretjerati, da je najbitnije naglasiti
konture lica, staviti dobru podlogu i
onda se sve drugo lake iskombinira.
Je li Vam se ikada desilo da se
okrenete za nekom enom zbog njenog
parfema?
- Da, a inae parfemi imaju za mene
posebnu simboliku. I uvijek uvam
prazne boice od svih parfema, jer
me podsjeaju na odreena ivotna
razdoblja, osobe, situacije kada sam
mirisala na taj parfem.
A, najdrai Vam je...?
- "Versace Crystal" i "Bvlagri" su mi
podjednako dobri.
40 AZRA 2013.
8
,
5
0

K
M

"
A
v
o
n

D
a
n
c
i
n
g

w
i
t
h

t
h
e

S
t
a
r
s

D
a
n
c
e
f
l
o
o
r
"

s
j
a
j
i
l
o

z
a

u
s
n
e
8,50 KM "Avon
supershock"
podloga za sjenu
3
,
9
0

K
M

"
A
v
o
n

C
o
l
o
r

T
r
e
n
d

.
L
V
V

*
R

U
X

]
D

X
V
Q
H
14,50 KM
"Avon Planet
Spa" krema
za tijelo s
afrikim shea
maslacem i
okoladom
24,90 KM
"Avon Full Speed
EDT i Avon Full
Speed Intense"
6,90 KM
"Avon Senses
Tropics" piling
za tijelo
5,90 KM
"Avon Mosaic
Effects" zavrni
lak za nokte
26,90
KM "Avon
Balroom"
parfem
4,90 KM "Avon Color trend Eye
Contact Duo" sjene za oi
17,90 KM
"Avon Little
White Dress"
EDP ( 50 ml)
AZRA 2013. 41
Stylissimo
Kako
"oivjeti"
lice
44 AZRA 2013.
Ako ste protekle blagdane proveli jedui "zabranjenu" hranu, pritom spavali
malo, a slavili previe, postoji dobra ansa da vam ten izgleda "potroeno", a
lice umorno, nateeno i starije. Sigurno se neete dopasti sami sebi, a tako ni
drugima. No, nemojte brinuti. Za sve postoji lijek i uz samo malo napora i nekoliko
namirnica iz kuhinje, va ten zablistat e za nekoliko minuta. Evo naih preporuka
Maska od jaja
Kako biste smanjili crvenilo koe, osvjeili
i zategli lice u samo nekoliko minuta, sve
to trebate jeste uzeti dva bjelanjca, istui
ih u pjenu i nanijeti na lice. Priekajte 20
minuta, a zatim njeno operite lice u toploj
vodi. Bit ete oduevljene rezultatom.
Maska od
banane
Svi znamo koliko su banane zdrave i
krcate razliitim vitaminima, mineralima
i drugim hranjivim sastojcima. Zbog toga
ne zauuje da banana moe biti i idealna
maska za lice koja e vau kou uiniti
svjeijom i hidratiziranom, pa e izgledati
mlae, odmornije, zdravije i ljepe.
Izgnjeite bananu i dodajte kaiicu meda.
Smjesu nanesite na lice i drite pola sata.
Ova maska puna je vitaminima A, B, C i E.
Revitalizirajui
tonik
Narande su pune vitamina C, pa e vam
sigurno pomoi u osvjeavanju vae koe.
Sve to treba da napravite jeste da dodate
dvije kaike soka od narande u au hladne
vode i promijeate. Uzmite pamunu
blaznicu, umoite u pripravak i lagano
ispirite lice. Pripravak e zatvoriti vae pore,
uvrstiti lice, te e dati koi toliko potreban
vitamin C za sjaj i podatnost.
Aromatina
sauna
Strunjaci preporuuju da jednom mjeseno
izloite svoje lice pari, kako bi se pore na koi
otvorile i oistile od nakupljenjih prljavtina
i minke. Sve to treba da uinite jeste da
zagrijete vodu u loncu, prekrijete glavu
pekirom i stavite lice nad lonac iz kojeg izlazi
para. U vodu moete dodati nekoliko kapi
esecijalnog ulja od ajevca i kaiku
mente.
ajevac e vam dezinfcirati
i ublaiti eventualne upalne
procese na koi, dok e menta
pomoi u ienju vaih pora.
Tretman za
podruje oko
oiju
Krompir je izuzetno bogat katalazom,
enzimom koji e vam pomoi u smanjenju
tamnih krugova oko oiju.
Izgnjeite ohlaeni sirovi krompir
(oguljeni), dodajte malo morske soli i
jednu kaiku obinog jogurta i dobro
promijeajte, smjesu podijelite u dvije gaze,
stavite na oi, te drite pola sata. Rezultat
e biti oaravajui.
Piling maska
Veliki krastavac i avokado nareite i stavite
u blender te mijeajte tako dugo dok ne
dobijete gustu i jednolinu smjesu. U
sve to dodajte malo zobene kae, prvo
stavite na lice neka odstoji 10 minuta, a
potom dobro istrljajte i isperite, te obriite
lice istim pekirom. Avokado je pun C
vitamina, veliki krastavac i avokado dobri
su protiv konih upala, hidratiziraju i
osvjeavaju kou, te e pomoi zobenoj
kai ukloniti mrtve elije koe.
Maska od kivija
Ova domaa maska savrena je za
ienje masne koe. Ogulite kivi i
nareite na kockice, stavite dvije kaike
obinog jogurta, jednu kaiku meda i
kap esencijalnog ulja od narande. Sve
sastojke dobro izmiksajte, tako da dobijete
kremastu smjesu i nanesite je na mokro
lice, dobro utrljajte, isperite, te osuite
istim pekirom. Kivi je krcat vitaminom C
i djeluje kao prirodni sapun za lice, njeno
istei masnoe s povrine koe.
Zobena kaa
revitalizira kou
Ovaj recept je savren za uklanjanje mrtvih
elija koe i revitaliziranje tena. Pomijeajte
kaiku zobene kae s obinim jogurtom i
nekoliko kapi meda. Nanesite smjesu na lice
i drite 10 minuta. Isperite toplom vodom.
AndeIikina
instant maska
.0
"ImmorteIIe" maska
za bIistavu put
.0
Preporuujemo
AZRA 2013. 45
Stylissimo
Moja4zida
SVE ZA
DOBAR
SAN
Jednu treinu ivota
provodimo spavajui, a
ostatak ivota i kako emo
funkcionirati, izmeu
ostalog, ovisi i o zdravom
snu. Dobro prospavana no
vrlo je vana za normalan rad
mozga. Najvaniji faktori za
dobar san su udoban duek,
jastuci i posteljina. Kako ih
izabrati i odravati
46 AZRA 2013.
KUPUJETE
JASTUK?
SLIJEDITE
PRAVILA
Funkcija jastuka je da omogui oputanje
miia gornjeg dijela lea i vrata tokom
spavanja. Kako u snu esto mijenjamo
poloaje - spavamo na boku, leima i
stomaku, i pritom smo "razliitih dimenzija"
(obim glave, irina ramena, veliina trupa),
nije lako da se napravi dobar jastuk. Da
bismo dobro spavali, kimeni stub treba da
zauzima horizontalan poloaj, s prisutnim
fziolokim krivinama isto kao i u stojeem
poloaju. Kada leimo na leima, s jastukom
ispod glave, ne bi trebalo da vidimo svoje
prste na nogama (ako ih vidimo, jastuk je
previsok). U poloaju na boku, glava treba da
bude ravno u produetku kimenog stuba.
Tokom leanja, miii vrata i lea trebaju
da budu oputeni - svaka napetost govori da
jastuk nije odgovarajui.
KADA DJECI
MIJENJATI
JASTUK
Bebama do devet mjeseci jastuk nije
potreban, dovoljno je da im se stavi pelena
ili prazna jastunica ispod glave. Prvi jastuk
koji moe da se koristi do navrene druge
godine treba da bude tanak, kako ne bi
doveo do nepravilnog poloaja kimenog
stuba. Ovo je jako vano, jer se djeca raaju s
potpuno ravnom kimom, a fzioloke krivine
se formiraju u ovom najranijem uzrastu.
Povrina jastuka treba da bude tolika da glava
ne sklizne kada se dijete okrene na jednu
ili drugu stranu. U periodu izmeu druge i
pete godine djeca intenzivno rastu, pa tada
moe da se koristi malo deblji jastuk. Do
pete godine djeca rastu srazmjerno, a od pete
do puberteta rastu samo u visinu, pa je ovo
trei period za promjenu jastuka. Poto je u
pitanju uzrast kada polaze u kolu i sve vie
su mentalno aktivna, izuzetno je vano da
njihov san bude to zdraviji. Birajte jastuke s
oznakom - antialergijski.
IZBOR MADRACA
Pravilan ortopedski madrac mora ispunjavati
nekoliko uvjeta: pravilno podupirati tijelo,
pruati udobnost i mora biti dovoljno
prostran. Obavezno ga isprobajte u
prodavnici. On mora podupirati tijelo -
posebno kimu. ak i kada je oputena,
kima mora zadrati prirodan poloaj. Idealan
madrac bi se trebao oblikovati prema vaem
tijelu, ali i pruati odgovarajuu potporu
donjem dijelu kime.
Ako traite madrac za brani krevet, bitno je
da se: laki partner ne otkotrlja prema sredini
kad oboje leite. Kada jedan partner ustane iz
kreveta, drugi ne smije osjetiti da se madrac
pomaknuo.
ODRAVANJE
Svakog mjeseca usisajte duek, a svakih est
mjeseci obrnite ga, kako bi se ravnomjerno
slegao. Takoer, moete jednom mjeseno
da poprskate madrac, jastuke i jorgan
sredstvom za dezinfekciju tkanina, kako biste
uklonili grinje i spore. Dokle god se redovno
pere, posteljina ne bi trebalo da predstavlja
problem. Promijenite je kad pone da izgleda
dotrajalo.
ROK TRAJANJA
JASTUKA I
JORGANA
Ako imate sintetiki jastuk, idealno je da ga
zamijenite nakon godinu do dvije, dok jastuk
od perja moe da traje i do sedam godina.
Jastunice perite na visokoj temperaturi koja
unitava grinje, a jastuk moete da provjetrite
i istresete svakodnevno. Slina je situacija
s posteljinom i prekrivaima. arafe treba
prati svake sedmice na temperaturi iznad
60 stepeni Celzijusa, a jorgane svakih est
mjeseci.
BOLE VAS LEA
- MIJENJAJTE
DUEK
Dueci obino traju izmeu pet i 10 godina,
u zavisnosti od kvaliteta. Ulegnut ili iskrivljen
madrac, kao i bolovi u leima nakon buenja
mogu biti znak da je vrijeme za kupovinu novog.
AZRA 2013. 47
Stylissimo
Djeca
Kvalitetno ispunite
vrijeme malianima
tokom raspusta
Kad je djeci dosadno, sklonija su zanovijetanju, to dovodi u iskuenje i najstrpljivije
roditelje. Da biste sprijeili neeljene nuspojave tokom zimskih praznika, to prije
stavite u pogon efkasne "istjerivae dosade"
48 AZRA 2013.
Kad je jedno dijete
starije od drugog,
esto je vaa dnevna
soba prostor stalne
arbitrae. Djeca
moraju shvatiti da
je suivot proces
i da su ona njegov
dio. I nisu samo dio
procesa, ve i dio svih
rjeenja. A vaa
uloga je da ih nauite
kako da rjeavaju
probleme
Zimski kolski praznici mogu djeci biti izuzetno
dosadni ako su njihovi slobodni dani bez sadraja.
Roditeljima je esto najpraktinije ukljuiti
televizor i pustiti da dijete satima gleda crtane
flmove, no strunjaci upozoravaju da je televizija
loa "dadilja".
Kad je takva situacija, djeca su sklonija zanovi-
jetanju i nestalucima, to dovodi u iskuenje i
najstrpljivije roditelje.
Da biste sprijeili neeljene nuspojave zimskih
praznika, to prije stavite u pogon efkasne
"istjerivae dosade".
Prvi korak su ideje. Od staklene tegle napravite
"arobnu teglu", koju, prema elji, moete ukrasiti
trakama i dekorativnim papirom, te nalijepite
etiketu na kojoj ste krupnim slovima ispisali "Su-
per istjerivai dosade".
U nju ubacite to vie raznobojnih papiria na
kojima su zapisane ideje ime bi se dijete toga
dana moglo zabaviti.
To moe biti slikanje, bojenje ili itanje zanimljive
knjige, a meu prijedloge moete uvrstiti i neko-
liko stvari koje va malian, inae, izbjegava, poput
pospremanja svoje sobe i polica s knjigama. Stavite
je na vidljivo mjesto, gdje je dijete moe dohvatiti.
Nakon to vam sljedei put kae: "Mama, meni
je dosadno", stavite pred njega "arobnu teglu" i
recite neka iz nje izvadi jedan papiri, te zajedno
pogledajte koji je prijedlog izvukao.
KUHAJTE ZAJEDNO
Djeca uivaju u mjerenju, vaganju, mijeanju i
matovitom oblikovanju kolaa. Bit e posebno
oduevljena kad probaju slatki plod svog rada.
Ako dio kolaa nosite baki ili darujete u do-
brotvorne svrhe, zajedno zapakujte darove i
ukrasite ih.
ITANJE JE LIJEK
Vano je da dijete tokom praznika, kad ne ide
u kolu, svakog dana ita. Predloite mu da ita
bar 15 minuta i iznenadit ete se kad mu panju
zaokupi zanimljiva knjiga, itanje e potrajati
mnogo due.
POKLANJANJE
OPLEMENJUJE
Predloite malianu da pregleda svoj ormar i
kutiju s igrakama, te da daruje sve ono to
mu vie ne treba.
Ouvane igrake i slikovnice, odjea, obua,
kaputi, kape, alovi i rukavice nekim e
malianima uljepati djetinjstvo, a plemenita
e gesta vae dijete usmjeriti na pravi put.
DRUTVENE IGRE
Opskrbite se zabavnim drutvenim igrama
prilagoenim uzrastu djeteta, one su as iz
rukava koji moete izvui uvijek kad djetetu
postane dosadno.
NA SNIJEGU
Iako su temperature niske, dijete i tokom
zimskih mjeseci treba biti aktivno, te to vie
boraviti na svjeem zraku.
Djeca vole zimske igre, stoga se za porodino
uivanje u sanjkanju, skijanju, klizanju na
ledu, ali i nizu matovitih zimskih igara. Nap-
ravite Snjeka zajedno.
RAUNAR I
KREATIVNOST
im je dijete sposobno utipkati ime na tastat-
uri, vrijeme je da pone savladavati pisanje
teksta na raunaru.
Neka se zabavi mijenjanjem vrste, boje i
veliine slova te boja podloge. Pokaite mu
kako tekstu moe dodati crtee.
SPREMANJE SOBE
Potaknite dijete da vam pospremanjem vlastite
sobe pomogne u spremanju doma. Vjerovatno
e pronai i neku zaboravljenu igraku ili
knjige koje e mu ponovno biti zanimljive. Ne
zaboravite mu zahvaliti za pomo.
IZAITE U ETNJU
Moete zajedno otii u kino, na kuglanje ili
proetajte parkom i razgovarajte. Posjetite muzej ili
knjiaru, koji tokom kolskih praznika u ponudi
imaju i mnogo zanimljivih sadraja.
AZRA 2013. 49
Stylissimo
Recepti
Grah je udo od hrane. On sniava
holesterol, regulira eer u krvi i
proizvodnju inzulina, dobar je za
zdravlje probavnog trakta i titi od raka.
On nudi vlakna, proteine i antioksidante
u jednom paketu. Stari Kinezi koristili
su ga za lijeenje alkoholizma, trovanja
hranom, edema, visokog krvnog
pritiska, proljeva, upala grla, bubrenih
kamenaca, reume... Italijanski knjievnik
Umberto Eco proglasio je grah izumom
vanijim od automobila i penicilina.
Dolaskom graha u Evropu u 16. stoljeu
ljudi su postali zdraviji i snaniji. To je,
smatra Eco, izvuklo Evropu iz mranog
srednjeg vijeka
IZ MRANOG
SREDNJEG
VIJEKA
EVROPU JE
IZVUKAO
GRAH
50 AZRA 2013.
Paprike punjene tetovcem
Sastojci: JJUDKDWHWRYFDNJFUYHQHSDSULNHDMYDUNHJODY
LFHFUQRJOXNDHKQDELMHORJOXNDNDLNHXOMDNDLNDFUYHQH
VLWQHSDSULNH]DLQLYHJHWDVRELEHUSHUXQ
Priprema:*UDKSRWRSLWHXKODGQXYRGXLRVWDYLWHSUHNRQRLGD
RGVWRML3UYXYRGXXNRMRMVWHNXKDOLJUDKEDFLWH8GUXJXYRGXGRGDMWH
MHGQXJODYLFXVLWQRQDVMHFNDQRJFUQRJOXNDPDORYHJHWHLNXKDMWHQD
WLKRMYDWULGDVH]UQDQHUDVSDGQX3URFLMHGLWHJUDKLYRGXVDXYDMWH1D
PDORXOMDL]GLQVWDMWHVLWQRVMHHQHJODYLFHFUQRJOXNDGRGDMWHELMHOLOXN
LVLWQHFUYHQHSDSULNH1DWRVWDYLWHSURFLMHHQLJUDKSURSULWHJDGRGD
MWHVRELEHULSHUXQRYOLVW'ROLMWHPDORYRGHXNRMRMVHJUDKNXKDR
VDPRPDORGDVHUD]ULMHGL7DNRSULSUHPOMHQLPJUDKRPSXQLWHRLHQH
SDSULNHNRMHWUHEDPDORSRVROLWLL]QXWUD6WDYOMDMWHSDSULNHXYHLSHND
LOLYDWURVWDOQXSRVXGX$NRYDPMHRVWDORMRJUDKDVWDYLWHJDL]PHX
SDSULNDSUHOLMWHVMRPDORWHQRVWLLPDORXOMD3HLXUHUQLQD
VWHSHQLRNRVDW.DGMHJRWRYRSRVSLWHSHUXQRYLPOLHP
nicle od graha
Sastojci:JNXKDQRJJUDKDEH]YRGHVRELEHUMDMHROMD
SUH]OLPDORVXKRJERVLOMNDSHUXQDRULJDQDJODYLFHOXNDVLWQR
LVMHFNDQRJNDLLFHPDVOLQRYRJXOMD
Za umak:NDLNDVYMHHJNRSUDNDLNDYUKQMDNDLND]UQDVWRJ
VLUDLOLIHWDVLUDNDLNDMRJXUWDPDORVROLHKQRVYMHHJELMHORJ
luka
Priprema: .XKDQLJUDKL]JQMHLWHLGRGDMWHPXVYHVDVWRMNHRVLPXOMD
2EOLNXMWHRNUXJOHQLFOH=DJULMWHWDYXVPDVOLQRYLPXOMHP
3HFLWHQLFOHVREMHVWUDQHGRNQHSRSULPHQXKUVNDYXNRULFXRNR
PLQXWD=DXPDNSRPLMHDMWHVYHVDVWRMNH
Hladna salata od graha i
junetine
Sastojci:JVXKRJJUDKDJMXQHWLQHRGEXWDJNLVHOLK
NUDVWDYDFDJODYLFDFUYHQRJOXNDXOMHYLQVNRVLUHVRELEHU
WDEDVFRSHUXQRYOLVWORYRU
Priprema.XKDQXMXQHWLQXLNLVHOHNUDVWDYFHQDUHLWHQDNRFNLFH
GRGDMWHOXNVMHFNDQQDOLVWLHLNXKDQLJUDKSURNXKDQXVODQRMYRGLV
ORYRURYLPOLVWRP6YH]DMHGQR]DLQLWHVYMHHVMHFNDQLPSHUXQRP
VROMXELEHURPYLQVNLPVLUHWRPXOMHPLOMXWLPXPDNRPQSUWDEDVFR
SRHOML
orba od graha i jema
Sastojci:JMHPHQHNDHJELMHORJJUDKDL]NRQ]HUYH
JODYLFDOXNDHKQDELMHORJOXNDJPUNYHJNRULMHQDFHOHUD
SRULOXNJVXKRJPHVDOLVWDVYMHHNDGXOMHPDVOLQRYRXOMHVR
Priprema: -HDPSUHOLMWHKODGQRPYRGRPLRVWDYLWHGDVWRMLSUHNRQRL
6XKRPHVRRLHQXPUNYXLNRULMHQFHOHUDQDUHLWHQDNRFNLFHSRULOXN
QDWUDNLFHDOXNQDVMHFNDMWHVLWQR8ORQDFQDNDLNHXJULMDQRJ
PDVOLQRYRJXOMDGRGDMWHVMHFNDQLOXNNRFNLFHPUNYHLFHOHUDWUDNLFH
SRULOXNDSURWLVQLWHELMHOLOXNSRVROLWHSURPLMHDMWHLGLQVWDMWHQDVUHGQMH
MDNRMYDWUL1DNRQPLQXWHXOLMWHOYUXHYRGHLNDG]DYULNXKDMWH
DNPLQXWD=DWLPVXSXL]PLNVDMWHGRGDMWHRFLMHHQLMHDPPHVROLVWRYH
NDGXOMHSURPLMHDMWHLNXKDMWHMRPLQXWD3RWRPGRGDMWHRFLMHHQL
JUDKL]NRQ]HUYHSURPLMHDMWHLNXKDMWHMRPLQXWD
AZRA 2013. 51
Francuska salata i
sarma su najbolje
poslije nekoliko dana
ta je doek Nove, bez francuske ili ruske salate? Kao da i nije nova
godina, vala.
Kada sam ja bio mali, onda je cijela familija dva-tri dana prije Nove
godine bila u kuhinji i pripremala salatu. Odnosno, gulio se i kuhao
krompir, kuhala se mrkva, graak i jaja. Pa je sve to trebalo lijepo
nasitno narezati i pomijeati i eto salate, ali nije to ba tako lako bilo za
napraviti. Zato mi i jeste francuska salata asocijacija na Novu godinu.
Uvijek se pravio lavor salate, da ne zafali. Preporuka je bila da se jede
dan kasnije, tad je, navodno, bila najbolja.
Danas se francuska salata moe napraviti za 10 minuta. Naravno,
kupite zaleenu mjeavinu povra za francusku salatu. Usput originalna
francuska salata uope ne potjee iz Francuske nego iz Rusije. Evo moje
verzije.
Potrebni sastojci: mjeavina povra za francusku salatu, jabuka, limun, 3
jaja, so, biber
majoneza, senf i kisela pavlaka
Mjeavinu povra stavite u kljualu vodu i kuhajte prema uputama s
pakiranja. Jaja skuhajte u tvrdo kuhana, jabuku ogulite i izreite na
kockice. U jednu manju zdjelu stavite majonezu, senf, limunov sok,
sol, biber i pavlaku. Sve sastojke dobro izmijeajte. Nakon to se povre
skuhalo, ocijedite ga i premjestite u veliku zdjelu u kojoj ete drati
salatu. Dodajte jabuku izrezanu na kockice, te sos koji ste pomijeali u
manjoj zdjeli, sve zajedno njeno izmijeajte i stavite u friider da se
hladi. Prema potrebi dodajte soli i bibera.
R
A
Z
G
O
V
O
R

U
Z

Z
A
L
O
G
A
J
BLOGER:
Gastroeksualac
"B
ila
sa
m
n
a
d
ijeti d
vije

sed
m
ice i sve to
sa
m

izg
u
b
ila
b
ile su
te d
vije

sed
m
ice"
A
M
E
R
I
K
A

K
O
M
I
A
R
K
A
T
O
T
IE
FIE
L
D
S
"

iv
o
t je
n
e
iz
v
je
s
ta
n
.
Z
a
to
p
r
v
o
je
d
ite
d
e
s
e
r
t"

E
R
N
E
S
T
IN
E
U
L
M
E
R
t
"V
o
lim

u
rk
e
n
a
D
a
n

z
a
h
v
a
ln
o
s
ti... to
je
je
d
in
i
d
a
n
k
a
d
a
u
L
o
s
A
n
g
e
le
s
u

m
o

e
te
v
id
je
ti
p
riro
d
n
e
g
ru
d
i"

A
R
N
O
L
D

S
C
H
W
A
R
Z
E
N
E
G
G
E
R
Stylissimo
Gastro
52 AZRA 2013.
Ovan 21.III - 20.IV
/MXEDYPred vama je uzbudljiva i dinamina sed-
mica. Ljubav je u vama, svuda oko vas, a vi ste,
jednostavno, neodoljivi.
Posao: Obuzdajte poriv za troenjem. Bar dio
QRYFDXORLWHXUHDOL]LUDQMHGDYQHHOMH3RJRWRYR
ako je u vezi s umjetnou ili trgovinom.
Zdravlje: Puni ste poleta.
Bik 21.IV - 22.V
/MXEDYSve vie cijenite sebe i vlastite vrijednosti.
I voljena osoba polako shvata kako izuzetno bie
ima pored sebe.
Posao: Finansijski plodovi vaeg naina rada
i razmiljanja poinju da se naziru. Tu je i
obeavajui razgovor.
Zdravlje: Forma se vidno poboljava.
Blizanci 23.V - 22.VI
/MXEDY Opet ste sretni, vjerovatno i puno zalju-
bljeni. Manje je bitno radi li se o staroj vezi ili o
sasvim novom partneru.
Posao: Mogui su neoekivani problemi, pa budite
oprezniji. Ne oekujte bitniju pomo i podrku
prijatelja ili kolega.
Zdravlje: Pokuajte se malo odmoriti.
Rak 23.VI - 22.VII
/MXEDY9HVHOLVWHLUD]GUDJDQLDOMXEDYQLLYRW
na zavidnom je nivou. Ako ste slobodni, izlazite u
drutvo, tamo vas eka ljubav.
Posao: Ne dajte se smesti i krenite hrabro
zacrtanim putem. Nije vrijeme za posustajanje,
pasivnost i nerad. Naprotiv!
Zdravlje: Sve je dobro.
Lav 23.VII - 22.VIII
/MXEDY Ako imate novog partnera, mogu je mali
nesporazum. U stalnoj vezi ili braku, nasreu, nema
ni traga dosadi.
Posao: Dolaze uvjeti koji donose mogunost za
lijepu zaradu. Otvaraju se dobre, ma sjajne prilike,
prepoznajte najbolju.
Zdravlje:3ULOLQRVWHVWDORHQL
Djevica 23.VIII - 22.IX
/MXEDY Ako ste usamljeni, osvrnite se, u vaoj
blizini je neko veoma zanimljiv. U dugoj vezi, sve je
predvidivo, pa ipak...
Posao:0RUDWHXORLWLGRGDWQXVQDJX0RJXHMH
irenje posla ili vae odgovornosti. I to je neto to
vama veoma odgovara.
Zdravlje: Dosta dobro.
Vaga 23.IX - 22.X
/MXEDY Razmiljate o prolosti, preispitujete i svoje
i partnerove postupke. Rezultati nisu nimalo loi,
ak su zadovoljavajui.
Posao: Slobodno raunajte na finansijsku podrku
bliske osobe. Meutim, ni to vas nee uiniti
prezadovoljnima?!
Zdravlje: Rekreacija je prava stvar.
korpija 23.X - 22.XI
/MXEDYXGLWH]DOMXEDYOMXDOLHOMHMRwQLVX
ostvarive. Barem ne na nain koji bi vas mogao
zadovoljiti i usreiti.
Posao:9HRPDVWHVHXLYMHOLXSRVDRGDMHWHVYH
od sebe. Ipak, ini vam se da to, gotovo niko vama
bitan, dovoljno ne cijeni.
Zdravlje: Pomalo ste iscrpljeni.
Strijelac 23.XI-22.XII
/MXEDYU svom ste elementu, armantni i
zavodljivi. I pored mnogo obaveza, obavezno
prihvatite poziv za izlazak.
Posao: Ako ste se i namuili dokazujui kako su
vae ideje prave, pobjeda e zbog toga biti slaa.
8LYDMWHRSXVWLWHVH
Zdravlje: Izbjegavajte zadimljene prostorije.
Jarac 23.XII-21.I
/MXEDY-DYOMDVHHOMD]DELMHJRPLRGPRURPRG
svega i svih. Ukljuujui i osobu koju beskrajno
volite. Nasreu, to je kratkotrajno.
Posao: I finansijska situacija je bolja. To vam je
poticaj i dodatno ubjeenje da ste dobro izabrali
svoj poslovni put.
Zdravlje: Osjeate zamor.
Vodolija 22.I-19.II
/MXEDYPuno razmiljate o emocijama, pogotovo
ako niste zadovoljni u vezi. Ne brinite, ipak, dolaze
pozitivne promjene.
Posao: Pustite da se sve razvija bez vaeg prev-
HOLNRJDQJDPDQD7DNRHLUH]XOWDWLELWLPQRJR
bolji od oekivanih.
Zdravlje: Opustite se malo.
Ribe 20.II-20.III
/MXEDY1HPRMWHSUHQDJOLWLVYDQRPRGOXNRPX
vezi s partnerom. Pogotovo,
ako vladate situacijom i malo realnije razmiljate.
Posao: Mnoge stvari rjeavaju se na vae veliko
zadovoljstvo. Dovoljno je jo
da budete strpljivi i spremni na kompromis.
Zdravlje: Blistate punim sjajem.
VRIJEME JE
ZA JARCE
SVE ZA KARIJERU
Za osobe roene u znaku Jarca esto se kae da
su pravi "manijaci" kada je rije o poslu. Zato,
obino, imaju tekoa da, tu i tamo, okrenu lea
obavezama i opuste se, a to bi svakako trebali
uiniti.
Dragi Jarci, naite vremena i za igru! Naime, u
mlaim danima, toliko ste opsjednuti usponom u
karijeri, da zaboravljate na sve drugo. Meutim,
kada zaete u zrelije doba, postajete mnogo
drutveniji i vie se okreete ljudima i zabavi.
Kao da elite nadoknaditi proputeno. Za vas je
va posao neto neobino vano i zato vas svaka
nepravda na poslu duboko povrijedi.
Jo neto kod vas moe izazvati stres - vaa krtost.
Teko se odluujete da troite imovinu. Morali
biste se odluiti da jednom uivate u plodovima
svoga rada i da ih velikoduno podijelite s drugima.
Dareljivost je osobina koja se kod Jarca teko
nalazi, naroito u mladosti.
injenica da previe vremena provodite na poslu,
moe kod vas izazvati melanholina i depresivna
stanja. Teret odgovornosti koji preuzimate na
sebe moe vam postati preteak i izazvati pravi
raspad sistema". Previe naglaavate autoritet, a
nedovoljno vrijednosti humanog.
Ponekad teite nadmonosti kao neemu to je
svrha sama po sebi. I zato je tako teko objasniti
vae motive drugima, koji usvajaju potpuno
drugu skalu vrijednosti. Jarac je usamljenik koji
teko moe da komunicira s drugima na emocion-
alnom nivou. Zbog toga ste, tako esto, sami i
neshvaen. I zato, potrudite se da sasluate druge i
njihove probleme.
Izbjegavajte zadimljene prostore i nabavite udoban
namjetaj u svom radnom prostoru punom svjetla.
Bilo bi dobro da se bavite tjelesnim vjebama. Tako
biste poboljali, ne samo kondiciju, nego i cirku-
laciju. Vjebajte iz zabave, a ne da biste se takmiili
s drugima.
Pripremila:
HEDIJA MEHMEDI
Stylissimo
Horoskop
AZRA 2013. 53
Stylissimo
Zdravlje
3 drevna tibetanska
recepta
ZA ZDRAVLJE SRCA
I DUGO
VJENO
ST
54 AZRA 2013.
Tibetanski medicinski sistem spada u najstarije
na svijetu. U lijeenju se, prije svega, oslanja
na bogatu biljnu apoteku. Pri branju plodova
od kojih e biti nainjeni pazi se na sve -
poevi od mjesta na kojem biljka raste pa do
rasporeda zvijezda u odreeno doba godine.
Lijekovi smiljeni u drevnoj tibetanskoj kulturi
katkad sadre i vie od stotinu sastojaka.
Ipak, tibetanski pripravci koje emo ovdje
navesti sadre samo nekolicinu uobiajenih
sastojaka, poput bijelog luka, limuna, umbira
i meda. Ovi pripravci slue za ienje krvnih
sudova, oputanje i pomlaivanje organizma.
ZA ZDRAVLJE
SRCA I KRVNIH
SUDOVA
Pripravak slui za postupno ienje krvnih
sudova od masnih naslaga te prevenciju
sranog i modanog udara. Takoer spreava
nastanak tumora, poboljava vid i pomlauje
organizam.
Sastojci
1 kg organski uzgojenog limuna
300 grama bijelog luka
Priprema
Sameljite limun (zajedno s korom) i bijeli
luk. Smjesu stavite u 1,5 l kipue vode i u
poklopljenoj posudi kuhajte na laganoj vatri
tano 15 minuta.
Ohlaeni pripravak naspite u staklenku i
zatvorite je poklopcem. Pripravak uzimajte
natate, u razdoblju od 25 dana, po pola dcl
na dan. Nakon toga napravite stanku od 10
dana, pa ponovite kuru. Radi preventive, kuru
moete provesti jednom do dvaput godinje,
svakih est mjeseci.
S ciljem lijeenja, kuru provodite do
poboljanja zdravstvenog stanja, uz
obavezno potivanje protokola od 10 dana
pauze prije poetka nove kure.
TIBETANSKI AJ
ZA OPUTANJE
Ovaj pripravak slui za oputanje i ublaavanje
stresa, a tradicionalno se vjeruje da produava
ivotni vijek.
Sastojci
5 g naribanog umbira
2 kasiice soka limuna
2 kasiice meda
prstohvat ljute paprike
prstohvat anisa
Priprema
Zakuhajte dvije litre vode i ostavite je da
kljua pet minuta.
U ohlaenu vodu dodajte naribani umbir,
sok od limuna, dvije kaiice meda, te
prstohvat ljute papriice i anisa. aj moete
pijuckati tokom dana ili piti jednu oljicu
prije svakog obroka. Navedena koliina aja
predviena je za tri ili etiri osobe.
ELIKSIR ZA
POMLAIVANJE
ORGANIZMA
Ova mjeavina bijelog luka, meda i limuna u
tibetanskoj medicini poznata je kao prirodni
eliksir koji uspjeno usporava proces starenja.
Sastojci
10 glavica bijelog luka
sok od 10 limuna
1 kg meda
Priprema
Sitno nasjeckajte 10 glavica bijelog luka i
pomijeajte ih s jednim kilogramom meda
i sokom od 10 limuna. Smjesu ulijte u
staklenku, poklopite i ostavite je da stoji osam
do deset dana. Nakon toga, uzimajte po licu
ovog prirodnog eliksira dvaput na dan, ujutro
natate i uveer prije posljednjeg obroka.
ZATO SU OVI
RECEPTI TOLIKO
DJELOTVORNI
Ovi recepti sadre tri najbolja sastojka - med,
limun i bijeli luk. Svaki od njih ima viestruke
dobrobiti za zdravlje
Bijeli luk
Bijeli luk titi krvne sudove, sniava krvni
pritisak i nivo holesterola u krvi te smanjuje
rizik od sranih i modanih udara.
Izmeu ostalog, koristan je u prevenciji
tumora, a titi i od mnogih hroninih bolesti.
Ublaava prehladu i gripu, unitava crijevne
parazite, lijei gljivine i bakterijske infekcije,
jaa imunitet, usporava staranje te otklanja
umor i napetost.
Limun
Limun posjeduje snana antioksidativna i
antibiotska svojstva. Zahvaljujui vrhunskoj
bioefkasnosti - sposobnosti da se u krvi zadri
i do 24 sata - djelotvoran je u prevenciji
tumora i njegovom irenju na okolne organe.
Uz ostala blagotvorna svojstva, spreava
nakupljanje holesterola na stijenci arterije i
doprinosi njegovom sniavanju, ime nas u
konanici titi od modanog i sranog udara.
Osim to uva zdravlje, limun kao snaan
antioksidans takoer usporava starenje.
Med
Med je takoer antioksidans koji posjeduje i
antibiotska svojstva. titi organizam od tetnih
tvari, a uzima li se u kombinaciji s ljekovitim
biljem, poveat e njihovu efkasnost. Iz
navedenog, nije teko zakljuiti zato su
sastojci poput bijelog luka, limuna i meda
dobitna kombinacija pri lijeenju mnogih
bolesti i tegoba.
Ipak, tibetanski
pripravci koje emo
ovdje navesti sadre
samo nekolicinu
uobiajenih
sastojaka, poput
bijelog luka, limuna,
umbira i meda.
Ovi pripravci slue
za ienje krvnih
sudova, oputanje
i pomlaivanje
organizma
AZRA 2013. 55
Stylissimo
D R
ta je to terapija ozonom?
Ozon je plin, koji se jo naziva i aktivirani kisik. On se normalno nalazi u pri-
rodi i nastaje u vrijeme gmljavine i sijevanja. U stomatologiji ima vrlo korisnu
primjenu kako na tvrdim, tako i na mekim tkivima usne upljine. Ima efkasno
antibakterijsko djelovanje, a njegova primjena je lokalna. Prilikom aplikacije
ozona, on trenutno unitava bakterije, gljivice i viruse na tretiranom mjestu,
te moe doi do izljeenja nakon samo jednog tretmana.Terapija traje 30-ak
sekundi i potpuno je bezbolna. Poetni karijes se vrlo uspjeno moe lijeiti
ozonom. Takoer, ima dobre rezultate u lijeenju afti. Ozon na mjestu prim-
jene eliminira do 98 posto bakterija, virusa i gljivica, te na taj nain znaajno
smanjuje mogunost pojave postoperativne infekcije i boli. Zbog toga je nje-
gova primjena nakon vaenja zuba vrlo korisna i efkasna.
Treba li djetetu kojem ispadaju mljeni zubi davati neke vitaminske
dodatke kako bi imalo zdravije trajne zube?
Smjena zuba kod djece je normalni, fzioloki proces. Ishrana djeteta treba
da bude normalna za taj uzrast (mnogo mlijenih proizvoda, voa) ili onako
kako je savjetovao pedijatar. Osim normalne ishrane, jako je vano pravilno
odravanje oralne higijene, kako mlijenih tako i izniklih stalnih zuba. Djetetu
se to ranije moraju poeti stvarati navike redovnog pranja zuba. Takoer, u
periodu smjene zuba potrebno je dijete ee voditi stomatologu na pregled,
da se prati tok smjene zuba i intervenira ako je to potrebno.
Dr. Adnan
Dedi,
stomatolog
Dr. Taib Deli,
ginekolog
3LWDQMDOMHNDULPDL]QDHRUGLQDFLMHPRHWHSRVODWLQDHPDLOD]UD#DYD]EDLOL606RPQDEURMWHOHIRQDXSRUXFLXSLLWHNRPH
Prije menstruacije esto imam jake greve u nogama, ak i tokom
najobinijih pokreta, naprimjer, obuvanja cipela. Uzimala sam
magnezij, ali ne dugo i nisam primijetila da mi je to mnogo pomo-
glo. ta da radim?
Nema naunih dokaza o tome ta uzrokuje greve za vrijeme (i oko) men-
struacije. Vjeruje se da dehidratacija, vjebe i zamor, te nedostatak bitnih
hranjivih materija mogu dovesti do greva. Neravnotea kljunih elektrol-
ita (natrij, kalij, eljezo, kloridi i fosfati) u tom osjetljivom periodu mogu
biti uzrok greva. Dovoljno tenosti, te konzumiranje namirnica bogatih
mineralima: paradajz, mrkva, banana - kalij; jeam, grah, mineralne vode
bogate magnezijem, bademi - magnezij; mlijeko, sir, jogurt su odlini iz-
vori kalcija. Jedan od razloga mogu biti prostaglandini (spojevi ija je kon-
centracija vea za vrijeme menstruacije), a ti bolovi prestaju odmah nakon
uzimanja, naprimjer, ibuprofena ili lijekova iz skupine tzv. nesteroidnih
antireumatika (NSAR). Ukoliko su grevi ei, ne poputaju, razgovarajte
sa svojim ljekarom da se pod tom slikom ne krije neko drugo oboljenje
vena i miia.
Imam 37 godina i cijeli ivot menstruacije su mi obilne i traju
sedam dana. Rodila sam dvoje djece, ali i poslije poroda je sve
bilo kao i obino. Posljednjih nekoliko mjeseci menstruacija mi je
manje obilna i traje 5 dana. Imam li razloga za brigu?
Prema navedenom, imate razloga da budete "veseli", jer ste dobili 30 dana
godinje bez menstruacije i "tedite" krv oskudnim menstruacijama, to e
umnogome popraviti vae ope zdravstveno stanje.
56 AZRA 2013.
Stylissimo
D
Sin od 15 godina, koji je donedavno bio uzorno dijete i ak,
poeo je od nas kriom uzimati novac iz torbi i novanika. Nisu
to velike svote, ali ipak - on krade, iako mu dajemo deparac.
Kada traimo objanjenje, ne eli da pria o tome. Priznaje da je
pogrijeio i opet to nakon nekoliko dana uini.
Motivi krae koju vre djeca mogu da se svrstaju u dvije osnovne kategorije:
1. Djeca koja kradu- trae panju. Osjeaju se nevoljeno, misle da ih
roditelji ne razumiju, ne prihvataju takve kakvi su, iako odaju utisak
da im roditeljsko miljenje ili podrka uope nisu vani, podsvjesno se
nadaju da e biti uhvaena u krai, jer vjeruju da e tada roditelji vie
panje obratiti na njih.
2. elja da se bude dio odreene vrnjake grupe, tj. drutva koje inicira i
podstie ovakva ponaanja. U pubertetu razlog za krau moe biti i elja
da djeca sama sebi i svojim vrnjacima dokau da neto mogu. Ne odusta-
jte od razgovora, shvatite ovo kao poziv upomo ili dokazivanje hrabro-
sti. Suoite se s problemom, kako kraa ne bi postala navika i uobiajeno
ponaanje vaeg djeteta, ali ne zaboravite da ak i tada ono ima drugih
dobrih i znaajnih kvaliteta. Ukoliko ovi simptomi potraju due vremena,
potrebno je potraiti psiholoku pomo.
Udala sam se veoma mlada. Nekako sam sa sinom i odrastala.
Razveli smo se. Suprug je uvijek imao ena, provoda, odlazaka. Ja
sam sada zaljubljena i prvi put se osjeam kao ena u zagrljaju
mlaeg mukarca. Ne mislim se udavati, ali elim ivjeti i disati
punim pluima.
Imate pravo na izbor. Dok god Vam je lijepo uivajte. Samo ne zaborav-
ite dvije stvari: neka mlai mukarac ne bude osveta i revan muu. Bu-
dite spremni i na to da taj mlai nekada i ode. Ako to poeli, nemojte ga
zadravati, jer i on je vjerovatno s razlogom uao u tu vezu.
Nakon deset godina braka, suprug mi je saopio da ga vie ne
uzbuujem, jer on ima prijatelja s kojim seksualno opi. To me tako
ponizilo. Predloio mi je da na brak odravamo formalno, radi oko-
line i djece. ta da radim, da li da djeci kaem ko im je otac?
Svi smo mi kao linosti razliiti, pa su nam i stavovi razliiti. Znam da Vam
je ovo saznanje promijenilo ivot u potpunosti, ali zamislite kako e to tek
djelovati na Vau djecu. Moda je nekada bolje da ih potedimo onoga
to moemo. Znam da je jako teko dijeliti supruga sa enom, a kamoli
s mukarcem. Ono to moete i morate odluiti to je da li elite biti u
formalnom braku koji Vam mu nudi ili ne. Moda je "bezbolan" razvod
najbolje rjeenje.
Dr. Jasmina
Dizdarevi,
kliniki psiholog
Aida Baruija,
kolska psihologinja, getalt
psihoterapeutkinja
MHSLWDQMHQDPLMHQMHQRJLQHNRORJVWRPDWRORJSVLKRORJGMSVLKRORJRVWDYLWHMHGQRSUD]QRPMHVWRUD]PDNSDSRWRPQDSLLWHSLWDQMH
AZRA 2013. 57
GLOBALIZACIJSKE PRIE
POTRAGA ZA
DUHOVNIM
MIROM
ZAVRAVA U...
INDONEZIJI
U Indoneziji smo, najveem
arhipelagu na Planeti, zemlji
najbrojnije muslimanske
populacije, domu Komodo zmajeva,
dvjesto razliitih jezika, predjelu
prirodnih ljepota i katastrofa,
zemlji riinih terasa, batika,
ekonomskog buma, podneblju
egzotinih ljepotica i najboljeg
surfanja na opasnim valovima
Indijskog okeana, u zemlji raznih
kultura i obiaja...
Stylissimo
58 AZRA 2013.
Tek nekoliko mjesta na zemaljskoj kugli
posjeduje takve kulturne razliitosti i
geografske ekstreme, tri vremenske zone, tako
da i ne udi to je za mnoge jo ovo duboko
enigmatska zemlja, obavijena velom tajni i
legendi. Prirodne ljepote su posebna pria,
skrivene lagune, tropske ume, planine i brojni
vulkanski vrhovi ine Indoneziju jednom
od najljepih zemalja svijeta. Mnogi su je
pokuavali prisvojiti, pokoriti, od Portugalaca,
Holanana, pa onda i susjednih im Japanaca,
a najzad 1950. proglaava se Republika
Indonezija, koja je od tada promijenila
nekoliko predsjednika, ali je imala i enu za
predsjednicu drave.
PRETJERUJEMO LI
SA SMJEKANJEM
U Indoneziji ne znaju nego za dva godinja
doba - jesen i proljee, a na aerodromu e
vas doekati prijatna temperatura i sladunjav,
drugaiji zrak. Drugo to primijetite jesu
ljudi, topli pogledi, neizostavan osmijeh, na
ta mi s brdovitih balkanskih predjela ba i
nismo naviknuti. Treba nam nekoliko dana
prilagodbe da na toplinu i osmijeh uzvratimo
toplinom i osmijehom, ak se i nakon tih
nekoliko dana pitamo da ne pretjerujemo s
tim smjekanjem.
Kako nas obino upozore da putujemo u
najmnogobrojniju muslimansku zemlju,
tako veina, pogotovo ene, prilagode svoj
izgled skladno vjerovanju da e sletjeti u neku
radikalnu zemlju principa i naela, to zapravo
i nije sluaj, jer upravo je Indonezija zemlja
koja bi mogla svima da poslui za primjer
kako religijske i kulturne razliitosti mogu da
budu u skladu i harmoniji, gdje jedni druge
nemaju potrebu osuivati zbog razliitosti,
iako se u posljednje vrijeme mnogo pria o
radikalnim pojedincima i jo ne zaboravljenom
teroristikom napadu na otoku Bali. To je
zemlja sa demokratskim ureenjem u kojem
vjera zauzima znaajno mjesto, a injenica da
u dravnom ureenju postoji Ministarstvo
religije dovoljno govori, iako su krajem
devedesetih godina radi nepremostivog jaza
izmeu centralnih vlasti u Jakarti te udaljenih
provincija rezultirali nevienim talasima
demonstracija i nasilja, nama najpoznatiji onaj
u Istonom Timoru.
Od gotovo 220 miliona stanovnika blizu 180
miliona je islamske vjere. Korijeni islama
datiraju jo od poslanika Muhammeda, a.s., a
islam na ovim prostorima se irio s dolaskom
arapskih trgovaca. Pripadnici ostalih naroda
su hindusi, budisti i kriani. Du cijele
3,j($0(/$(1*,
Indonezije brojni su hramovi i vjerski objekti
koji podsjeaju na postojanje ovih religija.
Nedaleko od Yogyakarte, na otoku Java, nalazi
se jedan od najljepih budistikih hramova -
Borobudur, arhitektonsko remek-djelo, koji je
vijekovima bio skriven u gustoj praumi dok
ga nisu pronali, iskrili, renovirali i pretvorili
u najveu turistiku atrakciju Indonezije,
a predstavlja budistiko vienje kosmosa i
puta koji osoba mora proi da bi dosegla
prosvjetljenje. Okruen je s etiri vulkana,
graen je od vulkanskog kamenja punih
osamdeset godina i svjedoi o fascinantnoj
historiji Indonezije. Jogyakarta, iako malo
poznato, ima status posebnog regiona unutar
Indonezije. U principu, rije je o nekadanjem
sultanatu koji ima vei stepen autonomije u
poreenju s ostalim provincijama.
U vrijeme indoneanskog rata za nezavisnost
od Holandije, ovdje je privremeno bio
izmjeten i glavni grad, jer su Holanani
okupirali Jakartu. ak i danas sultan ima veliki
politiki presti, a ljudi vole sultana, koji se
bez ustezanja eta po gradskoj pijaci. Zabrinuti
su ko e ga naslijediti, jer sultan nije osigurao
mukog naslijednika, ali je i odbio da se oeni
s vie ena, ostavi s voljenom suprugom u
monogamnom braku. Jogyakarta se nalazi
nadomak mistinog Indijskog okeana, doma
Loro Kidul - kraljice junih mora, a samo srce
ini sultanova palaa, poznatija kao Kraton, i
grad se, svojevremeno, poeo razvijati upravo
od ove take. Palaa sa svojim dvoritima,
sauvanim umjetninama i historijskim
dokumentima svjedoi o burnoj epohi jednog
vremena.
NEMA DOKONIH
A kad ve spominjemo Borobudur, ne
moemo da ne spomenemo i najvei i najljepi
Hindu hram u Indoneziji - Prambanan,
fascinantnu i pomalo zastraujuu graevinu sa
iljcima hramova uprtih ka nebu. Ime je dobio
po selu u ijoj je blizini sagraen, a posveen je
Hindu bogu Shiwi.
U Indoneziji postoji sedam znamenitosti koje
su pod zatitom UNESCO-a. To su hram
Borobudur, Nacionalni park Komodo, hram
Prambanan, Nacionalni park Ujung Kulon,
nalazite praovjeka Sangiran, Nacionalni
park Lorentz i kine tropske ume Sumatre.
Naalost, ova predivna zemlja izloena je
prirodnim nepogodama, zemljotresima i
fenomenu cunamija. Katastrofalni cunami koji
je pogodio otoke u decembru 2004. godine
unesreio je gotovo dva miliona stanovnika i
proces oporavka jo traje. Yogyakarta je poznata
kao indoneanski centar visokog obrazovanja te
klasine, fne umjetnosti otoka Jave. Upravo je
najkarakteristinija proizvodnja batika - voskom
bojene tkanine, raene posebnom tehnikom.
Ovaj starinski proces je ouvan i do danas. Sve
poinje od obinog komada bijele tkanine po
kojoj vjet majstor iscrtava budue ukrasne
detalje. Strpljivo i s velikom preciznou to
rade vrijedne ene, koristei specijalnu lulu.
Rastopljeni vosak se nanosi na oznaena mjesta.
PRVA ASOCIJACIJA
NA BALI JE KNJIGA
I FILM JEDI, MOLI,
VOLI", U KOJEM
GLAVNA JUNAKINJA
ODLAZI NA BALI
DA PRONAE SVOJ
MIR, SAMU SEBE,
BALANS DUHA I
TIJELA
AZRA 2013. 59
etnikog rata, doivjeli su veliki ekonomski
rast. Sad je zovu azijskom vicarskom, a
BDP je s prologodinjeg 4,5 skoio na
6,4 posto uz rekordnih 5,9 milijardi dolara
direktnih stranih investicija u treem kvartalu
ove godine. Jedni su od rijetkih koji nisu
osjetili teret recesije i svjetske ekonomske
krize. Bogata je to zemlja sirovinama, poput
palminog ulja, bakra, drveta, kafe, gasa,
robama za kojima postoji snana potranja,
pogotovo iz Kine. Indonezija, za razliku od
tipinih azijskih tigar" privreda, raste kao
posljedica vlastite potronje, a ne samo izvoza i
proizvodnje. Oni su sami sebi trite. Procjene
su da bi privreda Indonezije do 2030. godine
mogla biti sedma po veliini u svijetu pretei
ekonomije Njemake i Velike Britanije. Ovi
ambiciozni planovi, kako svi ekonomski
parametri ukazuju, sasvim su opravdani.
Potencijal Indonezije prepoznale su i nae
istone komije, pa se zadnju godinu vrlo
intenzivno pregovara izmeu Privredne
komore Srbije i Privredne komore Indonezije
o ideji da centar za privredu Indonezije za
jugoistonu Evropu bude upravo u Beogradu.
Srbija, prema ocjeni indoneanskih poslovnih
ljudi, pogodna je zbog geostratekog poloaja,
te kao lanica Cefta sporazuma i zemlja koja
ima reim slobodne trgovine s Rusijom,
Bjelorusijom, Turskom i Kazahstanom. A
najavila su se i indoneanska ulaganja u Srbiju
u poljoprivrednom sekteru, prehrambenoj
industriji i vojno-ekonomskoj oblasti.
Nadati se da e i nai privrednici prepoznati
interese za uvezivanjem s privrednicima
Indonezije, a takve prilike se nude i na
velikim meunarodnim sajmovima koji se
odravaju u Jakarti kao odlina platforma
ponude i potranje na meunarodnoj sceni.
Nae proputovanje Indonezijom zavravamo
na malom, tropskom otoku smjetenom
na obodu Indijskog okeana - Baliju. Prvi
utisci se ovdje ve gomilaju prilikom samog
slijetanja, topao prijatan zrak, miris jasmina
i frangipanija, ive boje nacionalnih nonji,
ushienost turista koji slijeu na mjesto o
kojem se toliko mata.
Zanimljivo je kako mnogi stranci vjeruju
da je Bali zasebna drava. Stoga je i pria o
Indoneziji neizbjeno pria o Baliju i - ostatku
zemlje, ali Bali je samo jedna od trideset i tri
indoneanske provincije s glavnim gradom
Denpasarom.
Ovaj otok gostoljubivih hindu domaina,
relativno male populacije od nekoliko miliona
stanovnika, idealno je mjesto za odmor
i upoznavanje sa specifnom kulturom
Balija. Za razliku od ostatka Indonezije,
Potom se prekrivaju dijelovi koji trebaju
izgledati bijelo. U principu, voskom se
prekrivaju dijelovi platna svaki put kada
se eli izraditi ili doraditi nova boja. Sve
do konanog otkuhavanja, kada se vosak
uklanja vruom vodom. A presti meu
Indoneankama je imati kvalitetan komad
batik svile na sebi.
Prije ili kasnije put nas je morao dovesti i do
prijestolnice - Jakarte, uurbane metropole,
sredita ekonomskog i politikog ivota
Indonezije. Dom je to za vie od osam
miliona stanovnika Indonezije. Glavna
obiljeja grada su Dravni spomenik i
damija Istiqlal - prostrana, poploana
najkvalitetnijim mermerom, esto utoite
za mnoge koji nemaju gdje prespavati u
tom velikom gradu. Drugaija je to damija
od svih koje se mogu vidjeti po islamskim
zemljama. Za sve navikle na neku toplinu
damijskih prostora i oekivanu kitnjavost
koju takvi prostori nose, led ekrani kojih
je Istiqlal prepun djeluju pomalo hladno.
Prekoputa ulaza u damiju nalazi se
rimokatolika katedrala koju su izgradili
Britanci, a smjetena upravo tu da podsjea
na religijsku harmoniju.
ISLAM DOMINIRA
Grad je prepun ljudi koji negdje ure, koji
neto rade, zapravo, u Indoneziji neete
vidjeti dokonih ljudi. Oni su vrijedni i
od inicijative. Ako nita, treba toliki broj
ljudi nahraniti, pa su im vrlo popularni
i pokretni, inprovizirani, restoranii u
malim automobilima na tri toka. Na
stomak, sasvim sigurno, to ne bi mogao
podnijeti, iako je indoneanska kuhinja
zdrava, raznolika, prepuna nama malo
poznatih sastojaka, mirisa i kombinacija.
Kao i svaki glavni grad u regionu,
Jakarta vam nudi apsolutno sve to jedna
metropola moe sadravati. Grad je to sa
dva lica, ono dnevno, uurbano, pretvara
se u nono obasjano neonskim svjetlima,
pomalo opasno. to se Jave tie, ovdje je
koncentrirana sva politika i ekonomska mo
i od mnogih Indoneana se uje kako ne vole
Javaneze. Naime, prevladava miljenje kako
Java s glavnim gradom Jakartom otima teko
steene plodove rada ostalih provincija pri
emu se bogati samo uska politika elita i
njihova najblia rodbina.
Prije dvadesetak godina Indoneziji su
predviali raspad, kao i Jugoslaviji. Na svu
sreu, raspali se nisu, a umjesto velikog
7DQDK/RW%DOL
3UDPEDQDQ+LQGXKUDP
HQDXWUDGLFLRQDOQRMQRQMLVRWRND%DOL
60 AZRA 2013.
gdje dominira islam, ovdje prevladava hindu
kultura i religija. Mnogima, pogotovo
enskoj populaciju, prva asocijacija na Bali
je knjiga i flm Jedi, moli, voli", u kojem
glavna junakinja odlazi na Bali da pronae
svoj mir, samu sebe, balans duha i tijela. Oni
koji su dovoljno ambiciozni da se okuaju
u spiritualnim iskuenjima i pronalascima o
kojima je Gilbertova pisala, mogu pronai
istog uitelja, Ketuta Liyera, kojeg je posjetila
i spisateljica. I zaista, ima neto udno na tom
dalekom otoku, emocije vas ovladaju, postajete
svjesni svoje nemoi nasparam silovitog
i nemilosrdnog okena, vulkana koji vas
okruuju, prirode, ali u isto vrijeme i svjesnji
same ljepote ivljenja.
BALI MASAE
STOPALA
Surferi iz cijelog svijeta dolaze na ovaj otok,
cijela svita hedonista koji e na ovom otoku
iskusiti posebne vrste masaa u hotelskim
salonima ili spa centrima koji se nalaze du
cijelog grada, uvene Bali masae stopala uz
elemente refeksologije, ili mladi u potrazi za
nonim provodom. Moni Indijski okean ovdje
ima nepredvidljivu ud pa stoga ne udi to
domaini na plaama esto pobadaju crvene
zastavice, znak opasnosti. Oni koji ele da osjete
taj mir koji otok prua odluit e se za sela u
brdima koja gledaju na prekrasne zelene riine
terase ili uivanje u spektakularnom zalasku
sunca na Tanah Lotu. Ne moete da se ne
pitate da li ovi divni stanovnici Balija, koji su
u potpunom balansu, uope znaju za svjetska
deavanja, ratove, ekonomsku krizu i ostale
nedae. Njihov vas mir i sklad postidi, natjera
da postanete bolji ljudi.
Svaki otok Indonezije posebna je pria, kao
to je i sama Indonezija, i njen narod. Njihov
put bio je mukotrpan, od perioda ropstva i
ugnjetavanja u vlastitoj dravi, do ekonomski
mone sile vrijedne potovanja. Mnogima su
bili meta, a na kraju, ipak, ostali samo svoji sa
svim razliitostima koje ih nadopunjavaju.
LJUDI U INDONEZIJI
SE STALNO
SMJEKAJU NA
TO MI, S BRDOVITIH
BALKANSKIH
PREDJELA BA
I NISMO
NAVIKNUTI
Treba da znate da se sva sjedita u okviru
HNRQRPVNHNODVHQHSURGDMXSRLVWRMFLMHQL
Ona su podijeljena u potklase i ne razlikuju
VHSRNYDOLWHWXXVOXJHYHSRFLMHQLLXVORYLPD
SXWRYDQMDWRUHVWULNWLYQLMLXVORYLSXWRYDQMDWR
MHIWLQLMDNDUWD
1DSULPMHUNDUWDVPDNVLPDOQLPRVWDQNRPGR
PMHVHFGDQDVWDQRRGUHHQLPGDWXPLPDL
RGODVNDLSRYUDWNDMHIWLQLMDMHRGNDUWHLMDMH
PDNVLPDOQDYDQRVWGRWULPMHVHFDLGR]YROMD
YDRWYRUHQGDWXPSRYUDWND=DWRXYLMHNWUDLWH
GDYDPVHSUHGRHYDULMDQWHLVW]YNVQLP
datumima odlaska i povratka i one s otvoren
LPGDWXPRP]DSRYUDWDN8SRUHGLWHFLMHQH
1DMHHVXRWYRUHQHNDUWHPQRJRVNXSOMHRG
NVQLKVWLPWRXQDMYHHPEURMXVOXDMHYD
NVQHNDUWHLPDMXPRJXQRVWSURPMHQH
GDWXPDSRYUDWNDX]QDGRSODWX,SDNWUHED
]QDWLGDSURPRWLYQHRGQRVQRQDMMHIWLQLMHNDUWH
QDMHHQHWUSHQLNDNYHSURPMHQH'DNOHWR
VXUHVWULNWLYQLMLXVORYLSXWRYDQMDWRMHNDUWD
MHIWLQLMD.DNRMHEURMPMHVWDXDYLRQXNRMDVH
SURGDMXSRSRYROMQLPFLMHQDPDRJUDQLHQ
savjetujemo vam da rezervacije pravite unap
ULMHGQDURLWR]ERJWRJDWRMHUH]HUYDFLMD
EHVSODWQDLQHREDYH]XMXD]DYDV
$YLRNRPSDQLMHVXQHGDYQRQDQDHPWULWX
XYHOHQRYRSUDYLORNRMHQLMH]JRGQR]DSXW
QLNHDRQRSRGUD]XPLMHYDGDUH]HUYDFLMDYDL
QDMHHWULGRVHGDPGDQDRGPRPHQWDQMH
QRJSUDYOMHQMD.DGDVXXSLWDQMXSURPRWLYQH
FLMHQHURNYDQRVWLQDSUDYOMHQHUH]HUYDFLMHMH
XJODYQRPVDPRVDWD
9RGLWHUDXQDRVH]RQDPDMHUMHLWRMHGDQ
RGIDNWRUDNRMLXWMHHQDFLMHQXNDUWH8
DYLRVDREUDDMXVHPRJXXWLL]UD]LYLVRND
LQLVNDVH]RQD9LVRNDVH]RQDSRVWRMLX
]LPVNRPLXOMHWQRPSHULRGXVWLPWRMH]LPL
Rigorozni vizni reim, koji je
donedavno bio na snazi za
graane BiH, i nizak standard
su meu glavnim razlozima to
rijetko putujemo. To neiskustvo"
i dodatni strah od sve stroijih
pravila u aviosaobraaju,
esto rezultira pronalaenjem
izgovora da ne odemo na put.
Kako bismo razbili predrasude i
putnicima olakali snalaenje na
aerodromima, konsultirali smo se
sa IATA akreditiranim agentima
Turistike agencije "Viator".
Kreemo od rezervacije aviokarte
YH]DQD]DQRYRJRGLQMHLERLQHSUD]QLNH
LWUDMHXJODYQRPRGGRGHFHPEUDD
ljetna sezona je vezana za period kolskih
raspusta i godinjih odmora i traje uglavnom
RGMXQDGRDXJXVWDDYLRNRPSDQLMH
SRPMHUDMXRYHURNRYHQHNHQDGXHQHNH
QDNUDH1DUDYQRXYLVRNRMVH]RQLNDUWHVX
VNXSOMHQHJRXQLVNRMVH]RQL
.DGDVWHQDSUDYLOLUH]HUYDFLMXDJHQWH
YDPUHLNRMLMHSRVOMHGQMLURN]DNXSRYLQX
DYLRNDUWH5H]HUYDFLMDYDPXYDPMHVWRX
DYLRQXDOLYDVQHWLWLRGSURPMHQHFLMHQD
DYLRNDUDWD$NRSRVOLMHSUDYOMHQMDUH]HUYDFLMH
DSULMHNXSRYLQHNDUWHGRHGRSURPMHQHFL
MHQDWRMHGLVNUHFLRQRSUDYRVYDNHDYLRNRP
SDQLMHGXQLVWHGDSODWLWHNDUWXSRQRYLP
FLMHQDPD7HNNDGDNXSLWHNDUWX]DWLHQLVWH
od bilo kakve naknadne promjene u cijeni ili
XVORYLPDSXWRYDQMD
Ne zaboravite da se raspitate o raznim vrsta
PDVHUYLVDLXVOXJDNRMHSUHYR]QLFLSUXDMX
0RHWHL]DEUDWLPMHVWRXDYLRQXLOLKUDQXNRMX
HOLWH0RHWHWUDLWLSRPRQDDHURGURPX
DNRQLVWHVLJXUQLGDHWHVHVQDL0RHWH
VHXODQLWLXSURJUDPVDNXSOMDQMDPLOMDNRG
MHGQHDYLRNRPSDQLMHNRMLYDPRPRJXDYD
GDSRVOLMHRGUHHQRJEURMDRVWYDUHQLKOHWRYD
GRELMHWHEHVSODWQXNDUWXLWG
8,$7$DNUHGLWLUDQRMDJHQFLML9LDWRUHWH
QDLOMXED]QRSURIHVLRQDOQRLHGXFLUDQR
RVREOMH9D9LDWRU7UDYHO6DOHV&RQVXOW
DQWHXLQLWLVYHGDRVWYDULWHVYRMDSUDYD
GRELMHWHQDMEROMHPRJXHXVORYHSXWRYDQMD
sigurno i sa zadovoljstvom odete i vratite se
VDHOMHQHGHVWLQDFLMH9LHR9LDWRUXPRHWH
QDLQDZZZYLDWRUEDWHXSRVORYQLFDPD
QD0HXQDURGQRPDHURGURPXX6DUDMHYXL
]JUDGL8QLRQNRPHUFD
'VIATOR' VODI O LETENJU
KAKO I KADA
REZERVIRATI
AVIOKARTU
AZRA 2013. 61
Stylissimo
VOZILI SMO NOVU TOYOTU AURIS
SAVREN UITAK
U ELEGANTNOJ I
SIGURNOJ DAMI
Proizvesti privlaniji, dinamiki napredniji automobil i ostati dostojni
ugledu za kvalitet, postojanost i pouzdanost bio je cilj prilikom proizvodnje
nove generacije automobila C klase kue Toyota. Auris nas je oarao, a u
narednim redovima provjerite zato...
3,j(=$1$.2/2j08/$%',
62 AZRA 2013.
Kad sam krajem prolog mjeseca krenula na
zadatak, koji je daleko od mog dosadanjeg rada
u oblasti kulture ili mode, bio je to zaista pravi
izazov - testirati iz enskog ugla novu Toyotu Auris
u dalekom Portugalu.
Dvodnevno putovanje bilo je ispunjeno
uzbuenjima. Kad smo sletjeli na aerodrom u
Lisabonu, bila sam puna treme kako e se ovaj
automobil ponaati u rukama ene koja je due
od godine uglavnom ljuljala bebu ili kucala na
tastaturi. Iskreno, imala sam leptirie u stomaku.
No, kad sam je konano vidjela na parkingu
aerodoroma, ostala sam "paf". Lijepa Toyota
Auris kao da je s naslovne strane nekog modnog
asopisa.
Upadljiva, s kosim farovima i LED dnevnim
svjetlima, odmah mi je namignula. Skontala
sam da sam, ipak, "na svom terenu". Oslukivala
sam miljenja kolega novinara iz automagazina,
kako ne bih ponavljala ono nae ensko u stilu
"ba je mona i lijepa". I oni su, na prvu, bili
impresionirani vanjtinom elegantne i mone
maine.
POTPUNA
KONTROLA
Dakle, verzija koja me doekala druga je generacija
Toyote Auris. Prva je javnosti predstavljena 2007.
godine. I opet uzdahnem dok ulazimo na prvu test
vonju. Ba je elegantna. Od te, prve Toyote Auris
do danas prolo je pet godina, no prema dizajnu
i tehnologiji, koju su godinama usavravali, a ko
drugi nego Japanci, ini se da je prolo mnogo
vie. U prtljanik od 360 litara stali su nai veliki
koferi i ostalo je jo mjesta. Jo jedan veliki plus.
I dok je za upravljaem prvog dana sjedila moja
kolegica iz magazina "Ljepota i zdravlje", takoer
iskusna u promo vonjama (:D), ja sam analizirala
unutranjost i armaturnu plou presvuenu
koom na kojoj se nalazi sve to moete poeljeti.
Na zadnjem sjeditu bilo je dovoljno prostora
za noge, ak i da ih prekriim. Kau mi da je to
zbog toga to su dodali jo dva centimetra. Inae,
u Portugalu na ulicama moete vidjeti mnogo
"Toyotinih" automobila, jer se ovdje ve dugo i
proizvode, pa su u domenu "domaeg auta".
A sutra je bio dan "D". I sama sam sjela za
volan, vozei po zelenoj okolici Lisabona prema
najzapadnijoj taki zapadne Evrope, rtu Cabo da
Roca, gdje moe kupiti i potvrdu da ste posjetili to
mjesto. Padala je kia, a ja sam imala pametnijeg
posla od certifkata. Okuke, uz okean, bili su za
mene neto sasvim novo. Iskustvo vonje, vidim,
nije nestalo, a uitak zbog osjeaja je rastao.
Sjedite je postavljeno etiri centimetra nie nego
u ranijoj verziji. Volan i ruica mjenjaa te none
pedale postavljene su savreno, pa imate dojam
sportske vonje, to se meni naroito dopalo,
kao i osjeaj potpune kontrole. Kau da je ova
generacija Toyote Auris neto nia nego ranije, pa
mi se inilo da se prosto zalijepi za cestu.
Nije mi trebalo dugo da shvatim za ta slue svi
instrumenti. Jasne su grafke, izuzetno vidljive,
oznaene i nalaze se na dostupnim mjestima.
Nema puno protezanja, sve savreno jasno i
najveem laiku. Posebno mi se dopao jedan
arobni dugmi, koji se na tabli lijevo od volana.
Dakle, kad se pravilno postavite za parkiranje,
dovoljan je jedan klik i automobil sam rjeava
najvei enski problem u gradu - parkiranje.
Vi samo gledate, trepete, parfemiete se ili
provjeravate kako ste nanijeli posljednji sloj
maskare u retrovizoru, a vaa pametna prijateljica
Toyota Auris sve sama radi.
Naa novinarka
za volanom nove
Toyote
A ako ste ba odluile da se sami uhvatite u kotac
s parkiranjem na ekranu, na kojem inae imate
navigaciju, ukazat e vam se slika zadnjeg dijela
vae auta. Uz zvuno upozorenje, ako ste blizu da
udarite nekog ili u zid. Neete s ovom Toyotom,
nema anse.
SAVREN
MJENJA
Meni se posebno dopao i mjenja. Lagan je
i precizan, nema nepotrebne "etnje". Uz
mjenjae sa est stepeni prenosa, Toyota nudi i
robotizirani manuelni MultiMode bez pedale
kvaila (uz 1.4 D).
U razgovoru s Damirom Vioeviem, direktorom
Toyota Adria D.O.O. BiH, saznajemo da osim
dizela, koju sam upravo vozila, i benzinca, koji je
dan ranije testirala moja kolegica, veliku panju
ova frma poklanja ekologiji i promovira hibridne
modele (op.a. vozila koja koriste i standardni
motor s unutarnjim izgaranjem i elektrini motor.)
Prednost hibrida je prvenstveno u relativno
maloj prosjenoj potronji benzina i niskoj
emisiji tetnog CO2 u atmosferu. Najvee
utede ostvaruju se u gradskoj vonji. U
mnogim ureenim zemljama kupci Toyotinih
hibridnih automobila dobivaju niz pogodnosti
poput besplatnog parkinga, raznih olakica
kod kupovine, niih trokova osiguranja i
registracije itd.
Takoer, vozilo se zbog "start-stop" sistema samo
gasi na semaforu radi smanjenja emisije CO2 i
utede u gorivu, te se ubacivanjem mjenjaa u
prvu brzinu automatski pali i moete nastaviti
vonju. Ma, kaem vam, savrenstvo. Nakon
vonje i iskrenog uitka mogu slobodno rei
da stoji teza Toyotinih strunjaka da su uspjeli
proizvesti privlaan, dinamiki napredan
automobil i ostali dostojni svog ugleda za kvalitet,
postojanost i pouzdanost. Oprema osnovnog
modela, koja donosi devet zranih jastuka, sistem
Hill asist i LED dnevna svjetla me oarala, a
vjerujem da e i vas.
ZATO IZABRATI
NOVU TOYOTU
AURIS?
Ime Auris odabrano je iz marketinkih
UD]ORJDLDNRVH]DSUDYRUDGLORR
JHQHUDFLMLOHJHQGDUQH&RUROOHNRMDMH
QDMSURGDYDQLMLDXWRPRELOVYLKYUHPHQD
Dimenzije karoserije nove Toyote Auris
VXLULQDPPYLVLQDPPL
PHXRVRYLQVNLUD]PDNPP1DUD
YQRVLJXUQRVWMHNRG7R\RWHQDWUHQXWQR
QDMYLHPQLYRX8SRWUHERPVSHFLMDOQRJ
HOLNDWRU]LRQRXYLMDQMHNDURVHULMHVPDQ
MHQRMH]DSRVWRDQLVX]DQHPDUOMLYHQL
XWHGHQDXNXSQRMPDVL
.RHFLMHQWRWSRUD]UDNDRGQDMEROML
XNODVLX&VHJPHQWXWRYRGLGRPDQMH
SRWURQMHEHQ]LQDDOLLGRQRVLYHXVWD
ELOQRVWQDFHVWL8SURGDMLHVHXVNRUR
KLEULGQLPRWRUGL]HOVNLPRWRULL
EHQ]LQVNLPRWRUL
AZRA 2013. 63
AZRAVjenici
BRAA GRIMM:
NJIHOV IVOT
NIJE BIO BAJKA
64 AZRA 2013.
NISU MOGLI JEDAN
BEZ DRUGOG
Godine 1825. mlai brat, Wilhelm Grimm,
oenio se Henriettom Dorotheom Wild, kerkom
uglednog apotekara i kunog prijatelja porodice
Grimm. Jacob Grimm nikada se nee oeniti i
cijelog svog ivota ivjet e s mlaim bratom i
njegovom porodicom. Iako su braa tokom ivota
i kroz posao bila nerazdvojna, radei "kao jedan",
privatno su se veoma razlikovali. Stariji Jacob
bio je introvertan, povuen u sebe i apsolutno
posveen poslu, ne obraajui panju mnogo na
svijet oko sebe. Na drugoj strani, Wilhelm Grimm
je bio mnogo drutveniji, armantniji i prodorniji i
nije bio sklon konfiktu.
- Wilhelm je zamiljen, Jacob grabljiv. U
naunim pitanjima bili su kao i u svakodnevnom
ivotu... Jedan od njih je boleljiv, drugi marljiv.
Jedan sklon Goetheu, drugi Schilleru. Jedan tiho
prolazi kroz istraivanja, drugi nadahnut po-
rivom da otkrije neto gotovo Faustovsko - kae
njihov biograf, Stefen Martus.
Prema njemu, braa su bila tako emotivno poveza-
na, da su godinama, ak i u odrasloj dobi, dijelila
isti radni sto. itajui njihova pisma, zabiljeke,
Martus prema njihovom tonu razgovora
zakljuuje da je Jacob Grimm bio "intelektualniji"
tip, to ne znai da je mlai Wilhelm bio manje
inteligentan. Naprotiv. Prema Stefenu Martusu,
profesoru njemake knjievnosti iz Kiela, mlai
Grimm bio je meu njima neka vrsta strunjaka
za marketing. On je taj koji je putem svoje mree
poznanstava i kontakata sakupljao materijal za
njihova djela, posebno bajke. Wilhelm Grimm,
vie domainski tip ovjeka, brinuo se za njihove
uvijek problematine fnansije, te je bio taj koji je
u javnosti pripremao teren za njihove projekte.
jenih germanskih dravica u sutini jedan narod.
I danas pojedini njemaki lingvistiari jezike kao
to su holandski, engleski, danski ili norveki ne
smatraju posebnim jezicima, nego dijalektima
njemakog. Jedna od prvih knjiga koju su izdali
braa Grimm zvala se "Danske junake pjesme,
balade i bajke". Ipak, 1812., kada izae prva
edicija njihovih "Bajki za kui i djecu", mnogo
toga vie nee biti isto.
Izmeu poetka studija i objavljivanja svoje
kapitalne knjige, ivot brae Grimm nije bio
pretjerano sjajan. U meuvremenu su im umrli
roditelji, te su morali preuzeti brigu o mlaoj
brai i sestrama, te je tako Jacob Grimm silom
prilika morao postati "glava porodice". Jacob
Grimm je u jednom trenutku morao napustiti i
studije, kako bi uzdravao porodicu. Ipak, braa
e 1808. dobiti posao u kraljevskoj biblioteci kod
vladara Hessena. Plaa koju e tu dobivati, nee
biti pretjerano velika, ali e Grimmovima pruiti
kakvu takvu sigurnost i prostor u kojem e se
moi posvetiti radu, istraivanju i prikupljanju
narodnih umotvorina.

- elja s kojom smo prouavali staronjemaki
jezik pomogla nam je da prevaziemo duhovnu
depresiju tih dana - pisao je kasnije Wilhelm
Grimm u svojim memoarima, biljeei da je u
njihovoj kui "pet ljudi jelo tri porcije jednom
dnevno".
Iako su napisali vie od 200 djela, i to nekih s ka-
pitalnom vanou, bez obzira na to to su radili
kao profesori, predavai i istraivai na uglednim
univerzitetima, braa su cijelog svog ivota bila u
fnansijskim problemima i teko da bi preivjeli
da nije bilo njihovih prijatelja. Cijeli ivot braa
su se drala zajedno, dijelei iste radne stolove,
kue i tanjire s hranom.
Milioni roditelja irom svijeta veeras e svojim najmilijim malianima itati
neku od bajki brae Grimm. Ova dvojica Nijemaca, Wilhelm i Jacob, ve due od
150 godina nisu s nama, ali njihovo djelo je uvijek aktuelno. Svijet je ovih dana
obiljeio 200 godina otkako je u Kasselu izalo prvo izdanje njihovih bajki.
Jubilej kojim se Nijemci ponose ukazao se i kao prilika da se baci neko novo
svjetlo na ove prie, vrijeme i okolnosti kada su nastale. Ono to je sasvim sigurno
jeste da bajke brae Grimm u svom prvobitnom obliku nisu bile prie za djecu.
Naprotiv. Bile su to prie pune nasilja, krvi, seksa, pa ak i rasizma
PIE: KENAN BELIJA
Godine 1785. u njemakom gradu Hannau,
u porodici dravnog slubenika, rodio se Jacob
Grimm. Tano godinu poslije na svijet je doao
i njegov brat Wilhelm. O njihovom djetinjstvu
se malo zna, ali se zna da su svoje prve godine
proveli relativno sretno i bezbrino. Godine
1798. stariji brat Jakob odlazi na kolovanje u
grad Kassel, po elji njihovih roditelja, da bi oko
1802. upisao studij prava u Marburgu. S tano
godinu razlike, uvijek ga je slijedio i mlai brat.
Ovu dvojicu bistrookih mladia brzo je primi-
jetio profesor Friedrich Carl von Savigny. On je
brai otvorio vrata svoje privatne biblioteke, iji
je sadraj ispunjen djelima Schillera i Goethea,
te primjerima njemakih narodnih umotvorina,
kao to su srednjovjekovni junaki epovi i
narodne pjesme.
BAJKE KOJE TO
NISU BILE
Vrijeme u kojem su odrastali Grimmovi bilo je
posebno virovito, vrijeme Napoleona, revolucija
i buenja nacionalne svijesti. Njemaka nije bila
ni kulturno, lingvistiki niti politiki jedin-
stvena. Bila je podijeljena u mnogo manjih, esto
zavaenih dravica, Bavarske na jugu, do Hanno-
vera na sjeveru, od militantne Pruske na istoku,
do Hessena na zapadu. Politiki e Njemaku
tek "vatrom i topovima" ujediniti Otto von
Bismarck, dok e braa Grimm praktino stvoriti
njemaki jezik kao jedinstven lingvistiki prostor.
Danas, 200 godina nakon to su izdali svoje prvo
i kapitalno djelo, braa Grimm se oznaavaju
kao utemeljitelji njemake flologije i lingvistike.
Naciju ne ine ni teritorija ni religija, nego up-
ravo jezik. Da nije bilo brae Grimm, Njemaka,
kakvu danas poznajemo, moda ne bi postojala.
Upravo su nauni radovi brae Grimm dali krila
onima koji su tvrdili da su stanovnici razjedin-
AZRA 2013. 65
AZRAVjenici
"HOPA-CUPA" U
KULI ZLATOKOSE
=QDDMQHVHNVXDOQHDOX]LMHQXGLODMHLSULD
R=ODWRNRVRMRGQRVQR5DSXQ]HOSUHOLMH
poj djevojci plave kose koju otme vjetica
L]DWRLMHXYLVRNRMNXOLXVUHGJXVWHXPH
7RNRPJRGLQDNRVDOLMHSH5DSXQ]HOQDUDVW
HGRGLYRYVNLKUD]PMHUDWDNRYHOLNLKGD
HVH]DOXWDOLSOHPLX]SRPRQMHXVSLQ
MDWLX]]LGRYHNXOH7DPRPX=ODWRNRVD
QHHSUXDWLVDPRNRVXQHJRLQHWR
GUXJR8SUYRELWRMQHFHQ]XULUDQRMYHU]LML
SULH=ODWRNRVDVHDOLYMHWLFLGDMRMUDVWH
WUEXKLGDVHQHWRXQMHPXPLH1DNUDMX
SULH=ODWRNRVDUDDEOL]DQFHDOLEUDD
Grimm nikada nisu objasnila ta se zaista
GHDYDORXPUDNXNXOH]OHYMHWLFHL]PHX
SULQFDLOLMHSH]ODWRNRVH5DSXQ]HO
"ELJA S
KOJOM SMO
PROUAVALI
STARONJEMAKI
JEZIK POMOGLA
NAM JE DA
PREVAZIEMO
DUHOVNU
DEPRESIJU TIH
DANA", PISAO
JE WILHELM
GRIMM U SVOJIM
MEMOARIMA
Grimmove bajke smatraju se svjetskom kulturnom batinom
-DFRE*ULPPELRMHLQWHOHNWXDOQLMLWLSWRQH
]QDLGDMHPODL:LOKHOPELRPDQMHLQWHOLJHQWDQ
:LOKHOP*ULPPMHELRPQRJRGUXWYHQLMLDUPDQWQLMLLSURGRUQLMLLQLMH
ELRVNORQNRQLNWX
66 AZRA 2013.
Grimmovi su, kako smo rekli, utemeljili
njemaku savremenu nauku o jeziku i uinili
mnogo na standardizaciji njemakog, koja
ima mnogo razliitih i meusobno teko
razumljivih dijalekata. Takvi njihovi napori
nisu imali samo etnoloku vrijednost, nego i
veliku politiku dimenziju. Braa su, naime,
sanjala o velikoj zajednikoj njemakoj dravi,
to je bilo neto potpuno novo u to doba. Prvi
koji je ikada spomenuo jedinstvenu njemaku
dravu bio je niko drugi do Jacob Grimm, i to
na Svenjemakom kongresu u Frakfurtu 1848.
Devet decenija kasnije, Grimmove bajke e
rado itati i nacistike voe i ideolozi, koji e
u ovim priama nalaziti i potvrdu njemakog
narodnog duha, ali i inspiracije za kasnije
zloine, kako tvrde mnogi Jevreji.
Prvo izdanje "Bajki" iz 1812. izazvalo je otre
kritike kod publike, koja je mnoge "bajke"
smatrala neprimjerenim, s obzirom na koliinu
nasilja i opscenosti u njima. U prvom izdanju
"Bajki" Ivicu i Maricu u umi ostavi niko dru-
gi nego njihova majka. U drugom preraenom
izdanju iz 1817. zloesta majka Ivice i Marice
postaje njihova maeha. Duhu tog vremena
bilo je neprihvatljivo da jedna majka ubija
vlastitu djecu. Maeha je nekako bila priklad-
nija za taj monstruozni zloin. Svijet iz bajki
brae Grimm bio je, naprosto, svijet 18. vijeka
u kojem dananji pojmovi ljudskih prava,
prava na ivot i socijalnu pravdu, te jednakost
svih nisu postojali. Nije postojao niti princip u
kojem "dobro uvijek pobjeuje zlo". Za ljude
iz 18. vijeka nije bilo nita udno u tome da
vuk pojede Crvenkapicu. Takoer, praksa u
kojoj roditelji ostavljaju svoju djecu u umi, jer
ih vie ne mogu hraniti, tada nije bila nikakva
nepoznanica. To je bilo neto to se podrazum-
ijevalo. Ipak, braa Grimm su meu prvima
uveli spomenuti princip gdje pravda uvijek
dolazi posljednja.
PRVI NJEMAKI
NACIONALISTI
Braa Grimm nikada sebe nisu nazivali
sakupljaima bajki za djecu, kako ih danas
smatramo. Oni su sebe smatrali, prije svega,
patriotima i zaljubljenicima u folklorno blago
vlastitog naroda. "Bajke" nisu ni pripremane
da bi ih roditelji itali djeci pred spavanje,
nego da podigne nacionalnu svijest. Grim-
movi su bili veoma konzervativni i plaili su
se utjecaja revolucionalnih francuskih ideja,
koje je irio Napoleon. S politike strane bili
su u dananjem smislu dosta politiki "desno".
Godine 1837. prikljuili su se disidentskoj
grupi naziva "Goettingen sedam", koja se
pobunila protiv novog demokratskog ustava
koji je donio vladar drave Hannover. Prema
razmiljanju brae Grimm, "kralj je bio taj ija
je trebala biti posljednja".
Prema mnogima, prie brae Grim formirale
su duh njemake nacije i ivotnu flozofju
prosjenog Nijemca.
- Zasluga brae Grimm u vremenu kada su
djelovali bila je da su se trudili da zabiljee one
bajke u kojima su glavni akteri djeca ili mladi,
jer to ih je inilo privlanim za mlade itaoce
koje su kroz te prie vaspitavali u duhu mor-
alnih normi, upuujui ih, u duhu protestan-
tizma, da budu vrijedni, da sluaju starije, da
ine dobro i slijede Boije zapovijesti - napisao
je Hans Jorg Uther, urednik "Enciklopedije
Grimmovih bajki".
Na drugoj strani, javnost, posebno ona koju je
sainjavao stale tadanjih akademika i uni-
verzitetskih profesora, u poetku ih je gledala
kao nepozvane goste, te su esto izvrgavani
neopravdanim kritikama ili su nazivani oso-
benjacima, odnosno udacima. To nije nikakvo
udo, i period njihove neizvjesnosti okonat e
se tek 1841., kada ih je Friedrich Wilhelm, kralj
mone Prusije, pozvao u Berlin, gdje e ivjeti i
raditi do kraja ivota. Wilhelm e svijet napustiti
1859., preminuvi zbog infekcije, nakon jedne
sluajne povrede kamenom. Jacob Grimm je u
svojim zabiljekama tada dodao da je smru brata
Wilhelma "umrlo i pola njega samog".
Jacob e se pridruiti svom bratu 1863. Umro je
nakon dvostrukog sranog udara, piui njihovo
kapitalno djelo "Njemaki rjenik", djelo od
600.000 izraza, koje e posthumno biti zavreno
tek 1971. Posljednja rije koju je u trenutak prije
smrti zapisao Jacob Grimm bila je "die fruchte",
odnosno "voe.
Iako tokom ivota osporavani, omalovaavani i
protjerivani, braa Grimm bi danas, da su ivi,
bili ponosni na injenicu da su njihove "Bajke"
neto najbolje i najcjenjenije to je njemaka
kultura ikada stvorila. Njihovo djelo utoliko je
znaajnije, jer je ono odavno prevazilo granice
Njemake. "Bajke brae Grimm" prevedene su
na 160 jezika i itane su od Japana do Argentine,
te su postale dio svjetske batine.
KAKO JE
VUK POJEO
CRVENKAPICU
Tokom est godina prikupljanja materijala za
prvo izdanje "Bajki", braa Grimm e se za
pomo obraati ljudima koje su poznavali,
komijama, roacima i svima onima koji su znali
dio narodne usmene poezije ili legendi. Njihovi
izvori nisu bili samo intelektualci i drugi obra-
zovani ljudi, nego i osobe koje susreemo sva-
kodnevno, poput komija, seljaka ili zanatlija.
Braa Grimm imala su namjeru te prie preni-
jeti u to autentinijem obliku, a taj izvorni
oblik esto je sadravao i elemente i nasilja,
veoma jakih seksualnih aluzija, te ovinizma i
rasizma. Prie koje su sakupljali s raznih strana
od razliitih izvora, esto su imale varijacije na
temu.
U narodnoj, necenzuriranoj prii o Crven-
kapici, vuk naprosto pojede Crvenkapicu
nakon to ona provede s njim no u krevetu.
U jednoj drugoj narodnoj verziji, Crvenkapica
poklanja nevinost lovcu koji joj spasi ivot.
JEVREJ, VIOLINA I
VJEALA
1DMNRQWURYHU]QLMDEDMNDEUDH*ULPP]RYH
se "Jevrej i kupine" i nije gotovo nigdje
WDPSDQDQDNRQ8SULLPODGRJ
slugu u umi nahrani patuljak koji mu u
]QDN]DKYDOQRVWLREHDLVSXQLWLWULHOMH
Jedna od njih bila je da dobije violinu na
LMLH]YXNQHNRPRUDWLSOHVDWLVYHGRN
WRVDPVOXJDKRH8EU]RVOXJDVHXXPL
SRVYDDVMHGQLP-HYUHMRPVNR]LMRP
EUDGLFRPNRMHJQDWMHUDGDSOHHGR
L]QHPRJORVWLXJUPXVNXSLQDPD1HVUHWQL
LL]UDQMDYDQL-HYUHMPROL]DPLORVWNRMXH
dobiti tek nakon to slugi preda svoju kesu
VD]ODWQLFLPD-HYUHMVHREUDDVXGXJGMH
priznaje da je novce ukrao i zbog toga
]DYULQDYMHDOLPD3ULMHJRGLQDLRYR
MHVPDWUDQRSULRP]DQDMPODH
POLITIKI E
NJEMAKU
TEK "VATROM I
TOPOVIMA"
UJEDINITI
OTTO VON
BISMARCK, DOK
E BRAA GRIMM
PRAKTINO STVORITI
NJEMAKI JEZIK
KAO JEDINSTVEN
LINGVISTIKI
PROSTOR
AZRAExplorer
GDJE JE
NAJBOLJE
IVJETI PIE: KENAN BELIJA
68 AZRA 2013.
Kao to svi gradovi imaju zajedniko da ih
ine ljudi, tako i svi ljudi u svim gradovima
svijeta trae nekoliko istih stvari. Tu su na
prvom mjestu sigurnost na ulicama, ista,
jeftina i dostupna pitka voda, uz poeljno ist
zrak. Na listi poeljnih karakteristika mjesta u
kojem ivimo nalaze se i dobra ponuda radnim
mjestima, zelenilo, gradski prijevoz, dobre i
moderne kole, pristupane i kvalitetne zdravs-
tvene usluge, mogunost raznovrsne i povoljne
kupovine, te "duhovna hrana" u vidu muzeja,
galerija ili koncerata. Pobrojano veinom imaju
njemaki, austrijski i vicarski gradovi, kao i
gradovi Kanade, Australije i Novog Zelanda.
Na drugoj strani, ameriki gradovi vie ne
spadaju u najpoeljnija mjesta za ivot. Prema
listi najpoeljnijih svjetskih gradova agencije
"Mercer", od amerikih su najvie plasirani
Honolulu (13. pozicija) i San Francisko (26.
pozicija), a tu su i Boston, Chicago, New York,
svi daleko od prvih pozicija.
Mnogi ameriki gradovi, zbog jakog auto-
mobilskog lobija, imaju slab javni prijevoz ili
ak nemaju staze za kretanje pjeaka, kao ni
dovoljan broj parkova. Nedostatak planiranja,
kriminal na ulicama, posrnula ekonomija koja
ne uspijeva da uhvati korak s novim ekonom-
skim silama poput Kine i Brazila, ne ine vie
Ameriku obeanom zemljom kao nekada.
Neka druga mjesta, poput Dubaija, Singapura,
brazilskog Sao Paola, pa ak i Maputoa, glavnog
grada Mozambika, postaju primjeri ugodnih mjes-
ta za ivot. Ipak, broj jedan ve nekoliko godina je
najpoeljniji svjetski grad za ivljenje - Be.
BE: MJESTO PO
MJERI OVJEKA
Ne tako davno, Be je smatran gradom muze-
jem, iji su simbol bili graevine iz prolih epoha,
klasina muzika i mozzart - kugle. Zubin Mehta,
jedan od najveih dirigenata dananjice, tako je
izjavio da je "Be lijep grad, ali samo da ga ovjek
posjeti". Sve do proirenja EU na istok, kada
su Slovenija, eka, Poljska i Maarska postale
lanice Unije, Be je bio periferni grad Zapadne
Evrope, pomalo uspavano mjesto koje je ivjelo
na lovorikama slavne, ali izblijedjele prolosti.
Neto se moralo promijeniti.
Osam godina nakon to se Evropa nanovo
"proirila" na istok, Be je ponovo postao ono to
je bio vijekovima, sve do 1918. i nestanka Aus-
tro-Ugarske: magnet za turiste, gastarbajtere, stu-
dente, umjetnike i poslovne ljude iz cijele istone
polovine Kontinenta, od Baltika do Jadrana,
od Urala do Dunava. Danas je Be dinamian
Ugledna amerika
agencija "Mercer"
nedavno je objavila
svoju tradicionalnu
listu najboljih i najgorih
mjesta za ivljenje i
poslovanje u protekloj
godini. Na prvom mjestu
je Be, na posljednjem,
225., nalazi se Baghdad.
Izmeu prve i posljednje
pozicije najpoeljnijih
i onih manje poeljnih
gradova nalazi se
vie od 400 manjih i
veih mjesta, bogatih
i onih manje bogatih
gradova. Svaki grad ine
ljudi, njihove navike
i temperament. Grad
bez ljudi nije grad, to
je tek kulisa, muzej ili
neto zastraujue,
poput Hasheme u
Japanu, grada duhova
naputenog prije etiri
decenije
Be
AZRA 2013. 69
AZRAExplorer
Aston Martin ili Ferrari. Ipak, u Beu se mogu
povoljno kupiti jeftina i kvalitetna obua, odjea,
elektronika, sitnice za kue i knjige. Grad je pun
ogromnih ali jeftinih knjiara, prepunih ljudi.
Be je, osim to je odlino mjesto za kupovinu,
studiranje, lijeenje, poslovanje, vikend provod
ili lutanje po nekom od 100 muzeja, prije svega,
grad po mjeri obinog malog ovjeka. Uprkos
uurbanom razvoju, Be nije podlegao opasnoj
"Ford ivotnoj flozofji" gdje je automobil
mjera stvari. Automobil je ovdje tek nuno
zlo koje se nastoji svesti na najmanju moguu
mjeru: Be je grad ogromnih i prelijepih
parkova, grad za sportiste, etae i bicikliste.
To je grad u kojem se moe i studirati i raditi i
ivjeti i uivati u vlastitom miru.
BAGHDAD:
MJESTO U KOJEM
NE ELITE BITI
Prije otprilike tri decenije gotovo svaka bosan-
ska kua je imala lana porodice koji je radio
i zaraivao u dalekom Iraku. Osim novca i
poklona koje su donosili, ukuani bi priali
nestvarne prie o Baghdadu, udesnom gradu na
obali Tigrisa. Priali bi o njegovim bulevarima,
bazarima, mostovima, spomenicima, hotelima.
Irak je tada bio najbogatija, najobrazovanija i
najnaprednija zemlja Azije, osim Japana. Saddam
Husein, iako diktator, mnogo je ulagao u ivotni
standard svojih graana, u obrazovanje, stano-
vanje i zdravstvo. Svi Iraani, ukljuujui i i ene,
dobili su pravo na besplatno obrazovanje. Bagh-
dad je cvjetao u to vrijeme i posao je poznat kao
jeftina, ali veoma zanimljiva turistika destinacija,
grad za sve tipove ljudi, u kojem se moete baviti
ime god poelite. Jedino to vam ovdje nee
biti tolerirano jeste bavljenje kriminalom. Beka
policija je vrlo efkasna i vrlo "neugodna" za one
koji poele neto ukrasti ili nekome nauditi. Za
one koji "zgrijee" pred zakonom beki sudovi
nemaju mnogo milosti. Treba rei da se i u ovom
gradu obian ovjek moe nai u pogreno vri-
jeme na pogrenom mjestu, deavaju se pljake,
krae, ubistva, ali Be se smatra jednim od
najsigurnijih gradova na svijetu.
Prije nekoliko dana jedna mlada ena silovana
je u bekom metrou. Svega jedan dan poslije,
poinitelj, jedan beki beskunik, uhvaen je i
priveden pravdi, zahvaljujui jednoj od hiljada
nadzornih kamera koje se brinu za sigurnost
graana i turista. Za nas, koji dolazimo iz
regiona gdje je haos drugi sinomin za svakodne-
vicu, Be je primjer grada koji gotovo bespri-
jekorno funkcionira i gdje nevidljive gradske
slube znaju ta rade.
Beki gradski prijevoz je kolski primjer toga.
Metroi, tramvaji i autobusi skoro nikad ne
kasne i dolaze prema "toperici" na displeju.
Ukoliko se pak desi neki zastoj ili kvar, glas
iz zvunika e "cijenjene putnike" obavijestiti
gdje mogu nai zamjensku liniju. Vozila bekog
gradskog prijevoza su ista, dobro odravana i
voze u sve dijelove grada, tokom 24 sata. Trebali
li napomenuti da godinja karta za beku ver-
ziju Grasa kota 365 eura, gotovo kao i godinja
karta za gradski prijevoz u Sarajevu.
Be je odlino mjesto za opingholiare i u
ovom gradu moete kupiti ta god poelite,
od "Armanijevih" odijela koja kotaju 15.000
eura, preko najboljih klavira, do automobila
omiljena ak i kod hipika. Bio je to grad koji se
morao posjetiti i, vjerovatno, najpoeljnije mjesto
za ivljenje u tom dijelu svijeta.
Bajka nije dugo potrajala. Saddamovo odsustvo
realnosti, tri rata u trideset godina i sankcije
UN-a, nisu samo fziki razorili gradove Iraka,
nego i do temelja unitili dostojanstvo Iraana.
Baghdad je najgore proao u svemu ovome i od
nekadanjeg bisera Azije, postao najgori grada
na svijetu. Prema "Mercerovoj" listi, nalazi se na
neslavnom 225. mjestu. ta to konkretno znai,
najbolje znaju graani ovog grada, koji je sada
samo sjena onoga to je bio prije tri decenije.
ivot obinog ovjeka u Baghdadu nita ne znai
i gine se svakodnevno, u tako velikoj mjeri da su
gradske vlasti, ako takvo neto i postoji, oformile
posebnu slubu za prikupljanje mrtvih s ulica.
Graani Baghdada ginu u napadima lokalnih
razbojnika i pljakaa, ginu od oruja i bombi
raznih militantnih grupa, ginu od metaka vlastite
policije i vojske koja se bezuspjeno bori protiv
terorista. U Baghdadu se gine u svako vrijeme i
na svakom mjestu, na ulici, u damijama, auto-
mobilu, trgovinama i restoranima. Svi teroristi,
svih boja i politikih ubjeenja, posebno vole
trgovine i restorane kao mjesta atentata. Od
grada ugodnog, pomalo hedonistikog naina
ivota Baghdad je tako postao grad straha. Strah
opet, u ljudima budi smisao za humor, humor
tako crn, da crnji ne moe biti.
Naime, najpopularniji TV show na tamonjoj
televiziji zove se "Poalji ga u Buccu". Bucc ja,
inae, bio zloglasni ameriki zatvor u blizini Bagh-
dada. Emisija je neka vrsta vrlo morbidne skrivene
kamere, u kojoj se na vrlo prometno mjesto
doveze automobili, neko iz ekipe pone vikati
da je u automobilu bomba i da e eksplodirati vrlo
brzo. Nastaje panika koju snima kamera i od toga
se producira ova bizarna emisija.
- Ovo je neto originalno i ovo je komedija. Mi
elimo da se nai graani smiju Al Qaidi. Ako
nita, uinili smo da svako pria o "autobom-
bama" i kontrolnim punkovima. Veoma je
opasno praviti ovakvu emisiju. Ljudi ovdje
ele samo normalan ivot - kae za njemaki
"Spiegel" producent ove emisije.
Novinari ovog njemakog lista bili su tek rijetki
stranci koji su posjetili Baghdad u zadnjoj
deceniji i na recepciji hotela su dobili neobian
zahtjev za "posebnim iframa koje slue za lake
pregovaranje s otmiarima".
Kako je ivjeti u Baghdadu, najbolje govori savjet
jedne online turistike agencije: "Ukoliko elite
biti bezbjedni u Baghdadu, najbolje je da u njega
uope ne doete". Ako se uope usudite otii
Baghdad
70 AZRA 2013.
tamo, preporuuje vam se iznajmljivanje oklo-
pnog vozila, ete zatitara ili vojnog helikoptera.
Baghdad, grad koji je u vrijeme kada su Pariz,
Berlin, Rim i London bili sela od 20.000
stanovnika okruena umom, imao je univer-
zitet, poploane ulice i ulinu rasvjetu, danas
nema redovno ni struju i vodu.
ZRICH I
AUCKLAND: ZA
MIRAN SAN I
UGODAN DAN
Visoko na "Mercerovoj" listi najboljih gradova za
ivljenje nalaze se vicarski Zrich i novozeland-
ski Auckland. Zrich je dugo godina bio svjetski
broj jedan, kada je kvalitet ivota u pitanju, sve
dok ga nije s trona maknuo neto jeftiniji i vei
Be. Ali, Zrich je poslovno i fnansijsko sredite
vicarske, s najveom koncentracijom novca
u ovoj zemlji. Grad je, takoer, najznaajnija
turistika taka ove drave, posebno zbog jezera i
elitnih skijalita u blizini.
Auckland je jedinstven grad na svijetu, s
obzirom na to da se nalazi na uskoj kopnenoj
prevlaci Sjevernog Otoka, izmeu dvije luke.
Ovo je najvei svjetski grad registriranih brodica
i jahti po stanovniku. Gdje su jahte, tu sigurno
ima poslovnih ljudi i kompanija, kojih u Auck-
landu na manjka. Ovaj grad je najvei i najbo-
gatiji grad Novog Zelanda, s veoma ugodnom,
gotovo mediteranskom klimom. Posebnu dra
gradu daje injenica da u njemu ivi 30 posto
Maora, starosjedilaca zemlje.
Ukoliko se elite preseliti negdje gdje smatrate
da e vam biti bolje, visoko kotiraju Toronto,
Sidney i Amsterdam, ali i Singapur. Svi ovi
gradove su na glasu kao veoma sigurna mjesta,
kao mjesta mjeavine raznih kultura, ali i
mjesta gdje se moe solidno ivjeti od vlasti-
tog rada. Tu su kompanije, tu je kultura, ali i
zadovoljni stanovnici.
MJESTO
KOJA TREBA
IZBJEGAVATI:
CIUDAD JUAREZ
Ovaj grad na granici Meksika i SAD-a - dugo
vremena vodio je bitku s Baghdadom za titulu
najgoreg mjesta za ivljenje. Naime, Juarez
se nalazi na glavom putu kokaina od June
Amerike do bogatog sjevera. Gdje je droga, tu
je i kriminal, tu su i karteli, bande i korupcija.
Godine 2005. u Ciudadu je dnevno ivot
gubilo petnaestak ljudi. Meksika vlada je tada
bila prisiljena na ovaj "Divlji" zapad poslati
hiljade vojnika i policajaca, to je donekle
smirilo situaciju. Danas u Cuidad Juarezu
gone "samo 1.3 " ljudi dnevno, to je priblino
280 godinje. Za usporedbu, u Sarajevu se u
prosjeku desi est ubistava godinje.
Na "Mercerovoj" listi najgorih gradova,
odmah iza Baghdada nalazi se i Bangui,
glavni grad Centralnoafrike Republike, jedne
"banana" drave, koju su kreirali Francuzi
kako bi lake unosili sukobe i vladali ovim
podrujem. Statistika kae da e od sadanjih
1000 stanovnika njih 463 biti mrtvo idue
godine u ova doba. Razlog: loa voda, loa
zdravstvena zatita kao i graanski ratovi koju
ovu zemlju tresu otkad postoji. U blizini grada
se, navodno, kree i zlokobni Joseph Kony,
vjersko-militantni fanatik iz Ugande, ija vo-
jska decenijama terorizira cijelu tu regiju.
Haiti je jedina zemlja na zapadnoj hemisferi
u kojoj je slubeni jezik francuski. Takoer,
Hiati je jedino mjesto gdje je izvedena jedna
uspjena pobuna afrikih robova. Haiti je i
najsiromanija zemlja zapadne polulopte, a
Port Au Prince je prema "Mercerovoj" listi,
tree najjadnije mjesto na Planeti, podlono
mnogim vrstama prirodnih katastrofa, od ura-
gana, kolere, do razarajuih zemljotresa. Haiti
je politiki nestabilna drava, gdje ima malo
prava, reda i zakona.
Osim ova tri grada, mjesta za izbjei u irokom
luku su i ameriki Detroit, grad Alir, Damask,
Karai, Kartum i Karakas.
Zrich
Ciudad Juarez
AZRA 2013. 71
BELGIJA
%RLUD]ORJ]D
poziranje
Boini i novogodinji praznici za evropske
kraljevske porodice, izmeu ostalog, znae i
snimanje novih fotografja, koje objavljuju na
svojim web stranicama. Ovu tradiciju nije ni ove
godine propustio belgijski kraljevski par - princeza
Mathilde i njen suprug Philippe, koji su pozirali
sa svoje etvero maliana. Par se vjenao 1999.
godine u Bruxellesu, te su od tada dobili etvero
djece. Najstarija je princeza Elizabeth roena 2001.
godine, zatim njen brat Gabriel (2003), potom
princ Emmanuel (2005) i najmlaa, princeza
Eleonore roena je 2008. godine.
AZRA Plava krv
VEDSKA
Princeza Madeleine
1D)DFHERRNX
REMDYLODGDWXP
vjenanja
vedska princeza Madeleine, koja nekoliko
posljednjih godina sa zarunikom ivi u New
Yorku, na svom Facebook proflu objavila je datum
vjenanja. Madeleine i njen izabranik Cristopher
O'Neill e se vjenati osmog juna ove godine u
kraljevskoj kapeli u Stockholmu. Princeza je objavu
napisala na svom maternjem, ali i na engleskom
jeziku. Na Facebook joj je pristiglo hiljade estitki iz
svih dijelova svijeta.
1DMPODD(OHRQRUHPH]LPLFDMHX
kraljevskoj porodici
Ponosni na svoju djecu
72 AZRA 2013.
HOLANDIJA
Novogodinji praznici
ljepi su u Argentini
Princeza Maxima je sa suprugom Willemom-
Alexanderom i njihove tri kerkice Boi i Novu
godinu provela u njenoj rodnoj Argentini. Par je
do sada ove praznike uvijek doekivao u Holandiji,
no sada su ih odluili provesti u toplijim krajevima.
Tome su se najvie obradovale njihove djevojice koje
su uivale u vedrom i toplom vremenu.
VELIKA BRITANIJA
Kate Middleton i
princ William
%HEDHVH]YDWL
Diana
Vojvotkinja Kate Middleton i princ William su
odluili - njihova beba zvat e se Diana, naravno,
ukoliko bude djevojica. Kate i William sigurni su
u svoju odluku da njihovo prvoroeno dijete nosi
ime tragino preminule Williamove majke. Njihova
odluka odmah je uznemirila pojedince iz kraljevske
porodice koji smatraju da se nee ispotovati
britanska tradicija, te da bi se beba trebala zvati
Victoria, ako bude djevojica, a George ako bude
djeak. Pravila nalau da prijestolonasljednici moraju
nositi imena svojih predaka koji su bili na tronu. A,
ime Diana samo je, kau, obrukalo kraljevsko ime,
zbog njenog razvoda od princa Charlesa.
3ULQFH]H$OH[LD&DWKDULQD$PDOLDL$ULDQH
AZRA 2013. 73
Zvijezde i ove godine
u Aspenu
Boi, Nova godina, Aspen... obiljeili su
proteklih dana ivote celebrityja u Hol-
lywoodu. Rijetko da se moe nai poznato
ime meu zvijezdama koje nije vieno u
mondenskom zimovalitu u Coloradu.
Krajem decembra na minusu i shoppingu
uivali su Antonio Banderas, Goldie
Hawn, Lori Loughlin, Mariah Carey...
A, bilo je i onih koji su u Aspen doli da
promoviraju novog deka, kao to je to
bio sluaj s Paris Hilton i njenim mnogo
mlaim partnerom Riverom Viiperijem.
Affleck senator?
Nakon Ronalda Reagana i Arnolda
Schwarzeneggera, jo jedan holivudski glu-
mac mogao bi da flmsku karijeru zamijeni
politikom. Prema pisanju sajta politico.
com, Ben Afeck ozbiljno razmilja da se
kandidira za senatora. Gostujui nedavno na
televiziji CBS, 40-godinji glumac i reditelj
izjavio je da ga politika veoma zanima i
priznao da bi volio mjesto u Amerikom
senatu.
Afleck je nedavno boravio u Washingtonu,
kako bi skrenuo panju javnosti na nasilje
u istonom dijelu DR Konga, za ije se
stanovnitvo zalae u okviru svoje fondacije, i
tom prilikom se sreo s mnogim politiarima,
meu kojima je bio i senator Massachusettsa
John Kerry.
$IHFNVDVHQD
torom Johnom
Kerryjem
Banderas u shoppingu
Paris Hilton
pokazala novog
PRPND5LYHUD
=YLMH]GDVHULMH%HYHUO\+LOOV/RUL/RXJKOLQ
KUDEURVHVXRLODVDVNLMDPD
*ROGLH+DZQMHWUDGLFLRQDOQRX$VSHQX
Ovoga puta je povela i sina Olivera Hudsona
AZRAMetro
74 AZRA 2013.
Naomi sina i majku
odvela na pedikir
U blagodatima zvjezdanog statusa ne uiva
samo glumica Naomi Watts, ve i njeni
majka Miv i sin Samuel Kai. Glumica ih
je odvela u beauty salon na pedikir. Tako
je i maleni Samuel nauio ta znai imati
mamine milione, lei u udobnu fotelju i
prepustiti se vjetinama jeftine radne snage
u salonima ljepote.
Naomi sa sinom u
jednom od salona
ljepote
Otac i sin u novogodinjem shoppingu
%ORRPVDVLQRPEH]
Mirande
Orlando Bloom je u novogodinji shop-
ping otiao sa sinom Flynnom, to je bilo
dovoljno da se pria o njegovom razvodu
aktuelizira. Naime, glumac ve due vre-
mena nije vien sa suprugom Mirandom
Kerr. Orlandova majka Sonja pak tvrdi da
glasine ne mogu biti dalje od istine".
- Upravo dolazimo s jednog mirnog
porodinog vikenda u Kentu. Oboje su
poprilino zauzeti svojim poslovima, ali sve
to mogu rade zajedno - izjavila je Sonja za
magazin Telegraph".
AZRA 2013. 75
AZRAMetro
3MHYDLFD*HUL+DOOLZHOOXGUXWYX
nepoznatog momka
=DUXQLFLYLHQLNDNRRELOD]HQDMVWDULMXFUNYXX3DUL]X
Halle i Olivier u
Parizu pripremaju
vjenanje
Halle Berry i Olivier Martinez su u
Francuskoj. Vieni su kako obilaze
najstariju crkvu u Parizu "St. Germain
des Prs". Moe li obilazak znaiti i
da su ve utvrdili datum i lokaciju
vjenanja?
.RJDOMXEL*HUL
Uveliko se pria da se bend "Spice Girls"
ponovo okuplja. Navodno bi sve djevojke
trebale da se vrate na scenu, izuzev Victorie
Beckham. Dok se dogovori privode kraju,
jedna od spajsica Geri Halliwell u Londonu
uiva u showu "Viva Forever!" u koji su
inkorporirani i najvei hitovi grupe "Spice
Girls". Pred paparazzima se pojavila u drutvui
nepoznatog mukarca i podgrijala prie o svom
ljubavnom ivotu.
Heigl sa supru
gom i usvojenim
NHUNDPD1D
leigh i Adelaide
Katherine progovorila
RXVYDMDQMXNHUNL
Katherine Heigl, koju pamtimo po ulozi u hit
seriji "Uvod u anatomiju", prole sedmice je u
TV showu Jayja Lenoa prvi put progovorila o
usvajanju djevojice Adelaide.
- Prvo smo suprug i ja eljeli da dijete bude
iz strane zemlje, ali to je prilino dug proces,
koji moe da potraje godinama. Veoma je
teko usvojiti dijete iz Koreje, a u Kini postoje
nerealno duge liste ekanja. Poeli smo
razmiljati o djetetu iz Amerike. Javio nam
se na advokat s informacijom da je pronaao
enu koja bi trebalo da se porodi za etiri
nedjelje i ije dijete istog trena moe postati
nae - kazala je Katherine.
Glumica i njen suprug Josh Kelley ve imaju
usvojenu etverogodinju kerku Naleigh, koja
je dijete s posebnim potrebama. Usvijili su je s
deset mjeseci u Sjevernoj Koreji, odakle potjee
Katherinina starija sestra.
- Roditelji su moju sestru usvojili tri godine
prije nego to sam se ja rodila. Htjela sam da
moja porodica nalikuje na onu u kojoj sam ja
odrasla - izjavila je glumica.
76 AZRA 2013.
M
I
R
O
S
L
A
V

M
A
R
K
O
V
I
N
O
V
I
]


SIMBOL
ERBIJA
GLUMICA SA
SLIKE
MINERAL,
CINKOV SULFID
ZEMLJA
(LAT.)
SIMBOL ARG-
ONA
RAZONODITI SE
IME ST.
SPRINTERA
BOLTONA
NAJVI[I
STEPEN
USHI]ENJA
(GR~.)
MANA,
SLABOST
(TURC.)
POKAZNA
ZAMJENICA
OKRUZI,
KOTARI (LAT.)
STARIJI
NOGOMETA[
ARGENTINE,
ROBERTO
ANTIKNI GRAD
KOD
METKOVI]A
ISCRPNI,
OP[IRNI
IZVJE[TAJI
VJERAN,
PRIVR@EN
PRODUKT
IMITACIJE,
PATVORINA
JU@NOAFRI^KA
REPUBLIKA
(SKR.)
J. AMERI^KA
DR@AVA
POGODAK U
KO[ARCI
TE@AK RAD
KULUK (POKR.)
IZASLANIK
IME ST.
AFRI^KOG DIK-
TATORA AMINA
HIDRO ELEK-
TRANA (SKR.)
UVITI, OMOTATI
IME ST. GLU-
MICE EKBERG
TEREN
ZEMLJI[TE
EKSTRAKT
BILJKE ALOJE
KIKIRIKI
(ARAP.)
NAPRAVA ZA
RAZBIJANJE
ZIDOVA, OVAN
DIO KOSTURA
OLIVERA
ODMILJA
FRANCUSKA
PLEMI]KA
TITULA
GL. GRAD
ITALIJE
ST. AMER.
GLUMAC,
D@ENS
LI^NA
ZAMJENICA
NOVAC U
TAJLANDU
(MN.)
SIMBOL
TANTALA
AUSTRIJA
ALASKA OUT-
DOOR JOURNAL
(SKR.)
DATI
OPROST
RIJEKA KOJA
OTI^E, RUKAVAC
RIJEKE
AUTOOZN.
OSIJEKA
SIMBOL
NATRIJA
FINSKI PISAC,
EINO
GR^KO
OSTRVO
SIMBOL KALIJA
RIJEKA U
FRANCUSKOJ
OBIM
STANOVNICA
AZIJSKE
DR@AVE
PRIBALTI^KA
DR@AVA
IME ST.
GENERAL.
TAJNIKA UN-a
ANANA
OMERA
ODMILJA
VRSTA
TVORNI^KE
POSLASTICE
(FRANC.)
AUTOOZN.
TUNISA
TRGOVCI
RI@OM
ASIMIN
IMENJAK
DO@IVJETI,
NESRE]U,
NASTRADATI
LI^NA
ZAMJENICA
NAPRAVA ZA
USISAVANJE
PRA[INE (LAT.)
VRSTA BILJKE,
ODOLJEN
PREDIO GRADA
RIJEKE
STANOVNIK
IKARIJE
KORPA,
SEPET
PROTIVNICI
KOMUNISTA
MRTVA^KI
KOV^EG
FARAONA
PLOD HRASTA
IME ST. GLUM-
CA BRANDA
PLIVA^I
PRSNIM
STILOM
AMERI^KA
DJE^IJA
UMJETNA HRANA
ST. GR^KA MITS-
KA PRORO^ICA
NOV^ANA
POMO],
POTPORA
(TURC.)
MATOR
BODLJA
RIMSKI: 500
OBLIK
PEKARSKOG
KRUHA
REOMIR
TRIDESET
(ENGL.)
SVOTA, ZBIR
MORSKA
OBALA
VRSTA @UTE
BOJE
PRVAK,
[AMPION
BRODSKA
KATARKA
ST. GRAD KOD
ZADRA
EMA TOMPSON
SJEVERNI
JELEN, SOB
IME GLUMICE
BERIMOR
ST. ENGL.
GLUMAC,
ROD@ER
DUG ODSJEK
VREMENA
RIJE^ UZ
SUPERLATIV
VELIKA
MORSKA RIBA
GLUMICA SA
SLIKE
SIMBOL
ASTATINA
EMA
ODMILJA
JEDAN DO
BITLSA D@ON
VOLT
MEMBRURA
ODMILJA
RIMSKI: 1000
PRIJEVREMEN MATERIJA
JAPANSKI
VITEZ, RATNIK
@ENA ZA SVA VREMENA
@ENA ZA SVA VREMENA
AZRA 2013. 77
AZRA Arte(i)fakti
NOVI FILMOVI U 2013. GODINI
Na sarajevsku
SUHPLMHUXVWLH$LGD
%HJL=XEHYL
USKORO "BEBA
BRIDGET JONES"
Produkcijska kua Working Title Films
priprema snimanje treeg flma o Bridget
Jones.
Nakon "Dnevnika Bridget Jones" iz 2001.
godine i jednako uspjenog nastavka "Bridget
Jones: na rubu pameti" tri godine kasnije,
nastalih po istoimenim knjigama britanske
knjievnice Helen Fielding, trei nastavak toga
serijala konano je zakoraio u produkcijsku
fazu. Radnja se ovog puta vrti oko Bridgetinog
pokuaja da zatrudni s jednim od svoja dva
udvaraa, a radni naziv je "Beba Bridget
Jones". Helen Fielding jo je poetkom godine
najavila da e istovremeno pisati treu knjigu o
Bridget i flmski scenarij.
REMAKE "ANE
KARENJINE"
Redatelj Joe Wright garancija je da e
ekranizacija romana Lava Nikolajevia
Tolstoja "Ana Karenjina" biti neto novo za
sve ljubitelje klasike i romantike. U flmu
glume Jude Law, Aaron Johnson, Matthew
MacFadyen, Kelly Macdonald, Michelle
Dockery i Keira Knightley kao Ana. Keira
je na londonskoj premijeri dobila sjajne
kritike za utjelovljenje aristokratkinje Ane
u visokom ruskom drutvu 19. stoljea, iji
se ivot mijenja nakon to zapone aferu s
grofom Vronskim. U ulozi Aninog supruga
Alekseja pojavljuje se Jude Law. U naim
kinima ovaj flm trebao bi se pojaviti u
februaru.
STIE "AROBNJAK
IZ OZA"
U novoj verziji prie o uvenom arobnjaku
iz Oza, glavna uloga povjerena je Jamesu
Francu, a pored njega u flmu igraju i Mila
Kunis, Michelle Williams, dok je reiju jednog
od najiekivanijih flmova u 2013. potpisao
poznati reditelj Sam Rajmi.
Ko god je vidio poster za remake "arobnjaka
iz Oza", nije mogao ni naslutiti da se iza lika
zle vjetice krije glumica Rachel Weisz. U
crnoj haljini, picastom eiru, s krivim nosem,
loim zubima i borama, ova ljepotica je sasvim
neprepoznatljiva. Film u kina stie u martu
2013. godine.
78 AZRA 2013.
)
2
7
2

1
,
1
$

1
2
9
$
.
2
9
,

"MUJO, SULJO I FATA U


DRUTVU SPEKTAKLA"
KAO PARADIGMA STANJA
U BH. DRUTVU
Nakon to je najprije izvedena u Zenici, prole sedmice
u Narodnom pozoritu u Sarajevu odrana je premijera
predstave Harisa Paovia "Mujo, Suljo i Fata u drutvu
spektakla". Rije je o uspjenoj koprodukciji "East West
Centra" Sarajevo i Bosanskog narodnog pozorita iz Zenice.
Zbog velikog interesovanja publike, predstava je izvedena u
dva termina, a sala je bila ispunjena do posljednjeg mjesta.
Sam komad "Mujo, Suljo i Fata u drutvu spektakla" iz
tri dijela, govori o naem drutvu i baziran je na teoriji
francuskog flozofa Guya Deborda, da su spektakli pokretai
odnosa izmeu ljudi.
Reditelj Haris Paovi, nakon sarajevske premijere, istakao
je kako bi bilo odlino kad bi ljudi mogli da ive umjereno
i racionalno, ali i zaneseni idejom bolje budunosti. Ova
drutvena satira sigurno ih je nakratko probudila, to je bio
i cilj. Pria govori i o tome kako spektakli otuuju ljude,
a Mujo i Fata su metafora, jer predstavljaju sve Bosance i
Hercegovce.
U predstavi igraju Dana Dani i Saa Handi, te
lanovi Djeije, omladinske i lutkarske scene BNP Zenica,
Ena Badali i Haris Hadisejdi. Sarajevskoj premijeri
prisustvovale su brojne poznate linosti iz svih sfera javnog
ivota.
(OPLU-XNL
doao je sam
=DQD0DUMDQRYL
u pratnji Emira
.DSHWDQRYLD
)XDG%DFNRYLL7DQMD
XURYLSR]LUDMXXR]
biljnom izdanju 5HGLWHOM+DULV3DRYLSR]GUDYOMD]YDQLFH
0HGLKD0XVOLRYLQHSURSXWD]DQLPOMLYHNRPDGH
-DVPLODEDQLMHGROD
VNHUNRP=RH
+D]LP%HJDJL
SURDVNDRVD6HOPRP
$OLVSDKL
NDRL(OYLU%DMUL
$PDU6HOLPRYLL$GLVD9DWUHXYLMHN]DMHGQR
-DVQD'LNOLELODRGXHYOMHQDL]YHGERP
AZRA
PARTY zonE
SARAJEVO
DVIJE NOI S
MIROSLAVOM
ILIEM
Miroslav Ili pobrinuo se da u klubu Co-
loseum" napravi odlinu uvertiru uoi
novogodinjih praznika. S obzirom na to da je
vladalo veliko interesovanje za njegov nastup,
scena je bila rezervirana dvije veeri uzastopno.
Tako je sarajevska publika 27. i 28. decembra
imala priliku da uje najvee hitove koji su
obiljeili 40 godina dugu karijeru ovog pjevaa.
7(.67,)2721,1$129$.29,
8YHOLNRPXJODYQRPPXNRPGUXWYXELOLVX(OYLU%ROLL
0LU]D9DUHDQRYL
9HOLNLIDQRYL,OLDVX'DQDL$UPLQDNRYL
AZRA 2012. 79
SARAJEVO
ENERGINI
NASTUP "TROPICO
BENDA"
Tropico bend" je u Sarajevu stekao veliki broj
fanova, tako da se dugo ekalo na njihov koncert u
Coloseumu". Publika je imala priliku da uje do-
bro poznate pjesme, a ovaj sve popularniji bend,
predvoen pjevaem Aleksandrom Cvetkoviem,
potrudio se da opravda oekivanja publike.
Energian nastup bio je garant dobrog provoda,
a publika je nakon koncerta otila kui vie nego
zadovoljna.
7(.67,)2721,1$129$.29,
8UHVWRUDQXHWLULVREHJRVSRH6DMH
ugodnu atmosferu napravila je Natali Dizdar
SARAJEVO
MJESTA ZA DOBRU ZABAVU
U prijestolnici BiH protekle sedmice vladala je prava praznina atmosfera. Meu brojnim nastu-
pima u posljednjim danima decembra izdvajamo i onaj Natali Dizdar, koja je u restoranu etiri
sobe gospoe Safje" nastupila uz pratnju samo dviju akustinih gitara. Uz repertoar prilagoen
prostoru napravila je veoma ugodnu atmosferu. U klubu Cinemas" sasvim drugaija slika. Kon-
cert hiphop grupe Elemental" rasplesao je publiku, a najvee zasluge za to pripadaju pjevaici
Mireli Priselac Remi.
7(.67,)2721,1$129$.29,
Klub "Cinemas" bio je rezerviran za
"Elemental" i fanove ove grupe
AZRA
NOVI DNEVNIK
'QHYQLN%ULGJHW-RQHVHYMHURYDWQR
GRELWLQRYLQDVWDYDNDOLGRWDGD]JRGQRJ
EULWDQVNRJGHQWOPHQD&ROLQD)LUWKDJOHGD
MWHXKLWNRPHGLML3UDYHPXNH3DUWQHULFD
PXMH&DPHURQ'LD]
SMART FOOD
Smart food pristup prehrani koji podra
]XPLMHYDNRPELQDFLMXQDPLUQLFDLMLVDVWRMFL
SRGPODXMXWLMHORLXPXSRWSXQRVWLMH
SULODJRHQXXUEDQRPQDLQXLYRWD-HGLWH
LQWHJUDOQLKOMHEEDGHPHVDODWXRGNUXDND
NHULQH]DERUDYLWHSDPHWQRMHSRQHNDG
SRSLWLLGHWR[MXLFH5HFHSWHWHQDLXVYD
koj boljoj kuharici!
PIE: AMELA KESEROVI
PREPORUUJEM
AMPANJAC
VRAA SJAJ
DPSDQMDFLQLXGD]DNRVXQDURLWR
SODYX]DWRWRVWYDUD]ODWQLVMDMDQHLVXXMH
.RVXQDMSULMHRSHULWHDPSRQRPDSRWRP
LVSHULWHPMHDYLQRPSRODDHPODNHYRGHL
SRODDHDPSDQMFD1HPRMWHLVSLUDWLNRVD
HELWLVMDMQLMDLSXQDYROXPHQD
AZRA AZRA Moja je zadnja
BIRAMO LI
drugorazredne
MUKARCE?
0
$
.
(

8
3

'
(
%
2
5
$
+

Nauka je zanimljiva i zabavna. Naroito kada


se bavi postankom i krajem svijeta. Ali, zna li
odgovor na pitanje: ta ena ini kada su svi dobri
mukarci ve zauzeti? Nedavno sam itala studiju
naunika s Univerziteta Marcquarie u Sydneyu,
koji su prouavali jednu vrstu australskih ptica.
Naziv im je toliko kompliciran, da se ni trudila
nisam upamtiti ga.
Uglavnom, nakon dana i noi neprestanog
izuavanja, zakljuili su da su se enke, koje nisu
dobile partnera kojeg su htjele, ustruavale pariti
i bile pod konstantnim stresom. Meu njima je
bilo i onih praktinih, te su odluile da je, ipak,
bolje spariti se i s drugorazrednim mujakom,
nego ostati sama.
Pamtim i to da kod ovih ptica partnera biraju
enke, te da im je jako vano kakve im je boje
glava. A ona, tvrdi studija, mora biti ista kao i
njihova. Ovakvu selekciju iskljuuju jedino kada
u okruenju nema jednakoglavih, pa se stoga u
nudi zdruuju i s partnerima koji im se prvobitno
nisu inili privlanima.
Nije li selekcija ista i kod ljudi? Zar ena nije
ta koja na kraju bira mukarca? I bira li, kada
namirie godine", mahom drugorazredne frajere?
Ali, kako uope zna ko je drugorazredan, a ko
prvorazredan? Odreuje li se prva i druga liga
mukaraca danas srcem ili mozgom? Ili je uputno
koristiti i jedno i drugo?
Ima li ona ikakve veze s miiima, brojem
diploma, nekretnina, prezimenom...? Biramo li
mi ivot u kojem emo graditi vlastitu porodicu
ili onaj u kojem emo se uklapati u onu u koju
dolazimo? Jesmo li skrojili takvo vrijeme, da,
priznali mi to ili ne, u neko doba, kao i ove ptice
iz Australije, pruamo ansu i onima koje u
drugim okolnostima ne bismo ni pogledale?
- Ako ste ena u Americi i niste se skrasili
do 30., mogli ste slobodno otii do Grand
Canyona i baciti se - govorila je davnih ezdesetih
Helen Gurley Brown, dugogodinja urednica
Cosmopolitana".
Dok je bila iva, uila je slobodne ene kako
da izvuku najvie iz vlastitog ivota, naroito iz
ljubavnih veza.
Jesam li ja izvukla najbolje iz svojih, pitam se. I, da
li sam spremna da ve sada ispijem tu gorku pilulu
kompromisa koja mi se nudi? to bi Amerikanci
rekli: Tanks, but, no thanks" (Hvala, ali ne,
hvala). Barem ne ove godine.
Moe ti tome nadijevati kakva hoe imena,
ali sve to radi u ivotu, i nema to veze samo sa
selekcijom partnera, radi po istoj matrici. I lae,
i voli, i vara, i petlja, i bira, i manipulira i
doekuje raun na naplatu. A, on doe kad-tad.
Zato, ko je spreman, neka ga odmah plati!
82 AZRA 2013.