MODUL PELATIHAN SISTEM INFORMASI GEOGRAFIS (SIG) Tingkat Dasar 
 

G. Manjela Eko Hartoyo Yuli Nugroho Ario Bhirowo Bilaludin Khalil

Diterbitkan oleh: Tropenbos International Indonesia Programme

MODUL PELATIHAN Sistem Informasi Geografis (SIG) Tingkat Dasar Oleh: G Manjela Eko Hartoyo, Yuli Nugroho, Ario Bhirowo dan Bilaludin Khalil Editor: Aritta Suwarno dan Petrus Gunarso

Diterbitkan oleh: Tropenbos International Indonesia Programme 127 Halaman

ISBN 978-979-18366-8-5 ©Tropenbos International Indonesia Programme

Photo sampul oleh: Aritta Suwarno, G Manjela Eko Hartoyo, Ario Bhirowo dan Yuli Nugroho

Disain sampul dan tata letak oleh: Aritta Suwarno

Tropenbos International Indonesia Programme PO BOX 494, Balikpapan 76100 www.tropenbos.org

Modul Sistem Informasi Informasi Geografis Geografis (SIG) (SIG) Tingkat Tingkat Dasar Dasar ini ini disusun disusun oleh oleh tim tim GIS GIS Tropenbos Modul Pelatihan Pelatihan Sistem International Indonesia Programme (TBI Indonesia) bekerjasama dengan Badan Litbang Kehutanan Tropenbos International Indonesia Programme (TBI Indonesia) bekerjasama dengan
Badan Litbang Kehutanan

KATAPENGANTAR      Modulinidibuatdalamrangkapelatihansisteminformasigeografisyangdilakukan oleh Tropenbos International Indonesia Program (TBI_Indonesia) sebagai bagian dari program peningkatan kapasitas sumber daya manusia di bidang kehutanan untukpemerintahbaikdidaerahmaupundipusatterkaitdenganSistemInformasi Geografis(SIG).  ArcGIS merupakan software yang dikembangkan oleh ESRI. Software ini merupakan software yang lebih integrated berbasis windows yang memiliki kemampuan pada berbagai tingkatan. Pemanfaatan software ini ke depan diharapkan semakin meningkatkan ketersediaan data dan informasi berbasis keruangan dan mampu memberikan informasi yang lebih baik dan akurat kepada penggunadatadaninformasikehutanan.  Dalam panduan ini, data geografis yang dipakai adalah dari Provinsi Riau. Penggunaan data Provinsi Riau semataͲmata sebagai sebuah contoh. Untuk pelatihan di tempat lain maka contoh data geografis dapat dipersiapkan sesuai permintaan.  Kami mengucapkan terima kasih kepada berbagai pihak yang telah membantu dalam penyusunan modul ini dan semoga modul ini dapat berguna bagi peningkatan kapasitas pengguna dalam lebih memahami teknik sistem informasi geografis.     Bogor,Desember2010    DR.PetrusGunarso DirekturProgram TBI–Indonesia

.

................................................2.................29 ProsesRektifikasi.17 4... PengelompokanLayer.... MenyiapkanSemuaLayerDataSpasial...................3...........DAFTARISI  1....30 5.... MelihatTampilanPeta........................................... 5 2........................................................21 4................6... SekilasTentangArcCatalog......................................28 5......MerubahTampilandenganSkala.......7......... MenggunakanTabelData........34 i i 4.. 5 3. MelihatAtributData........ MenyiapkanLayerImage...........2 SumberDataSpasial.......................................................17 5 REKTIFIKASI..2...... SISTEMINFORMASIGEOGRAFIS.............................30 5..............4...............................5..................................10 3..........2 1......1............. 5................3..........1...... RektifikasiMenggunakanTitikKontroldariGPS....................31 5..2.......................................1...............................................................2 1.....28 4...............................................22 4...4 2................ MelihatDataAtributSebuahLayerMenggunakanMapTipsdan Hyperlink.......12 4............. MenggunakanArcCatalog.............1................... PENGENALANArcMAP......................2.. ArcGISsebagaiPerangkatLunakSIGyangKomprehensif............................... MengaktifkandanMenonaktifkanLayer.... MenambahkanTitikKontrol.............................................. PENGENALANArcGIS.. PenyusunanLayer...10..........5.............................................2.....       PengertianRektifikasi.................................2.19 4............................6...... MerubahTampilanLayer..................4.................2.............. BrowsingDatadenganArcCatalog......................34 5...................... PerbedaanViewpadaDataAnda....................3............. 9                      3............................................................................................................................9 3...........2..........................9.......................... MembukaDataSpasialdenganArcMap.................................1 DataSpasial...............1...2........................................................ 1      1.................................................................................24 4...20 4.... 1.......................................31 5........26 4....................... MenampilkanToolGeoreferencing. PENGENALANArcCATALOG..1....2..........2......8................................................................................................................................................... FormatDataSpasial .......2...................33 5.....2.........................27 4................................................1...............   PengertianSistemInformasiGeografis(SIG).....29 .......................

....................2...... MembuatLayeratauShapefile. MenyimpanHasilRektifikasi..2..................................... ReshapingPolygonatauLine ......36 PengertianDigitasiPeta......................45 EditingDataAtribute...........3.............. ProsesPengaturan ........2.............51 7.8................6........................................................5....................49 7...............................39 6.................... MemulaiDigitasi.......2.........................................2......1.... SplitLine. MenyiapkanGeodatabase .............7.. MenyimpanHasilDigitasi.56 7...............47 8 TOPOLOGYGEODATABASE...2.. MergeObjek.....................................1.... IntersectObjek..63 8.....54 7.......2.................... Memasukandatashapefilekedatabaseyangtelahdibuat ...2.......................54 7..........3.................. MenambahDataGambar.....63  8........................................ MembuatTemaatauFeatureDatasetdiArcCatalog.....37 6.3.......10................2......2. Transformasi........................3...48 7...............    5.....48 7..2.....42 6.........69 ii ii ......................3....................37 6..................................9........... MemotongPolygondenganPolygonLain ......... 6............... MembuatFeatureClass..1..67 8......................................................43 6.......................1......................... MembuatObjekPointatauVertexdenganKoordinat.......2.........61 6 MEMBUATDATASPASIAL.................................34 5.....................................2.................................52 7....................55 7.....................6....................................................1.......................1...............................................1.................... Snapping.......37 MetodeDigitasi....... Digitasi................2..48 7.........2............................4....63  8.................. MembuatMultipartLineatauPolygon...........................2.....7...........................................2........................ MenampilkanHasilRektifikasi.........5...........................................2............................           7.....................8....... MenentukanSistemKoordinatShapefile......2.1...............................35 5.............................4.37 7 EDITINGDATASPASIALDANATRIBUT....2.......... Edgematching..............42 6..2......2..................MenambahPanjangGaris(Extend).........................1.............. RubberSheeting....7.................................2..............................56 SpatialAdjustment..............3....................9..... MemotongPolygonMenjadiDuaBagian..................1........50 7......................................                                  6.......2........................ MemotongGarisdenganBatasGaris .......2........................................................        7...................... 7..........................................57 7...........2........3.59 7..............47 EditingDataGrafis...........3.37 6.........................................................

............................................................................2............................2...76 9 QUERYDATA...............3.................................96  10........2..79 BekerjadenganDataAtribut.................................105 10..........106 iii 10 SPATIALANALYST(ArcToolbox)................ 9................... MelakukanPersamaanMatematis ..1..............3...................103  10.................................89 9.................. MemilihObyeksecaraInteraktifmenggunakanPernyataan SQL....................2.....Identity.........89  9..........1.....................................86 9....... BekerjaDenganTopology...............................5....106  10.2....... LoadingDataAtributEksternal......................89  9.................................................3.........................93 .............................2.......Buffer................79 9........................3................       9.........................1............   8.......................95  10...........1..................1.........99  10..................................................94  10........79 9.......................... PemilihanRecord ............................                                  8.......1........................................................Update.........................................Extract........1...86 9........................1...71 8.96  10.................95  10...................84 AnalisaQuerydalamDataAtribut .................... MengkalkulasiStatistikObyek ................................................Erase...................1...............................................................................87 9.2......SymmetricalDifference.....71 8...........Union...4...................1....3........4.............1....2..................73 EditingTopologypadaArcMap..5........................Clip...........................2....2.94  10..............6.....................2............................................90 10................... SettingTampilanTabel...........2........... MengaturUlangKolom..3...2.....................1........ MenganalisaDataAtributmelaluiObyekGrafik ............................................................................................................4.............................................1.............Intersect ....1................88 9..................... MembuatGrafikBaru............ KesalahanTopology ....................84 9....3..................6...83 9....2.........................1....................................................................4..............2...... MencariObyekTertentu......................1................4...................2.....1..........2............................ MenggabungkanTabelAtribut ..........................................................................................2........102  10.81 9.90  9.....    MembangunTopologypadaGeodatabase....................................1..................2.104  10................................................................3......................................1..... MembukaTabelAtribut............................ MenambahKolom................................3...........3..................TableSelect.........Select.....1.....Split..............Proximity ..............................Overlay ..................79 9..............96 10.... MemanipulasiDataAtribut....2..................

.................................3............111  11..........3.....MenampilkanatauMengaturPeta.......2....................126 iv iv .PengaturanLayout.............MencetakPeta ...........119  11............................................118  11................................MenambahkanJudulPeta.............................111 11..1.MenambahkanLegenda.....112  11.............MenambahkanTekspadaLayout..........5..............................................3...........112 11.......1......3...8............4..5..111  11...2.....1....3........2................................2..........3.......2..........124 11..125 11......123  11.....................MenambahkanSkala.............................2..............................................114  11............................MenambahkanObjectpadaLayout.............114  11......2..........2.....MenyimpanPeta...2...109 10......MenambahkanKoordinatPeta..........1.....................MenambahkanPanahPenunjukArah...PenambahanUnsurͲunsurPeta.......................Near(menghitungjarakterdekat)....4.............MengaturProyeksi.............................117  11..7.........................................................................108 10.................................................121  11..............125 11....EksporPeta..................4.........................1..................110 11 LAYOUTPETA......................2............MengaturHalamanLayout..............................................2.......................................2.....................PointDistance ........6.............................................MultipleRingBuffer..............MembuatExtentRectangle...........120  11............                         10...3.........................1....

 memperbaiki.1983. MenurutMarbleetal.1986.1. memanipulasi dan menganalisa data serta memberiuraian.beberapadefinisiSIGmenurutparaahli: 1. Dalam  pembahasan  selanjutnya. Orang 2. mengintegrasikan. Software :yangmenjalankansistem :proseduryangdigunakanuntukmengolahdata :informasiyangdibutuhkandandiolahdalamaplikasi :perangkatlunakSIGberupaprogramprogramaplikasi 5.1984. MenurutBurrough. menganalisa  dan menampilkandatadalamsuatuinformasiberbasisgeografis”. memperbaharui.1989. Harmon.  SIG  yang  berbasis komputer akan sangat membantu ketika data 1 1 .1 PengertianSistemInformasiGeografis(SIG) Berikutini. 3. MenurutBerry. data geografis dan sumberdaya manusia yang bekerja bersama secara efektif untuk memasukan. printer. Secara umum pengertian SIG sebagai berikut: ” Suatu komponen yang terdiri dari perangkat keras. Menurut John E.  SIG  akan  selalu  diasosiasikan  dengan sistem  yang  berbasis komputer. Steven J.  walaupun  pada  dasarnya  SIG  dapat  dikerjakan secara  manual. SIG merupakan sistem informasi. SIG adalah sistem informasi yang didasarkan pada kerja komputer yang memasukkan. SISTEMINFORMASIGEOGRAFIS 1. Data 4. Aplikasi 3. serta otomatisasi data keruangan. scanner dan perangkat pendukung lainnya. referensi internal. SIGmerupakansistemkomputerisasidatayangpenting. SIG merupakan alat yang bermanfaat untuk pengumpulan. MenurutAronoff. 2003.1988. Anderson. MenurutCalkindanTomlinson. penimbunan. perangkat lunak. Hardware : perangkat keras yang dibutuhkan untuk menjalankan sistem berupa perangkat komputer.  memanipulasi. secara rinci SIG tersebut dapatberoperasidengankomponenͲkomponensebagaiberikut: 1. mengelola. SIGmerupakansistempenanganandatakeruangan. 2. 4. menyimpan. 5. mengelola. pengambilan kembali data yang diinginkan dan penayangan data keruanganyangberasaldarikenyataandunia.

 2 2 . Informasi deskriptif (atribut) atau informasi non spasial. 1. Dalam SIG. Kemampuan inilah yangmembedakanSIGdarisisteminformasilainnya. pola dan pemodelan. data spasialdapatdirepresentasikandalamduaformat.dansebagainya. menganalisa dan akhirnya memetakan hasilnya. termasuk diantaranya informasidatumdanproyeksi.kodepos.1 FormatDataSpasial Secara sederhana format dalam bahasa komputer berarti bentuk dan kode penyimpanan data yang berbeda antara file satu dengan lainnya. yaitu informasi lokasi (spasial) dan informasi deskriptif (attribute)yangdijelaskanberikutini: 1. tidak hanya perangkat keras komputer beserta dengan perangkat lunaknya saja akan tetapi  harus  tersedia  data  geografis  yang benar  dan  sumberdaya  manusia  untuk  melaksanakan perannya dalam memformulasikandanmenganalisapersoalanyangmenentukankeberhasilanSIG. menggabungkannya. Sehingga aplikasi SIG dapat menjawab beberapa pertanyaan seperti.populasi. lokasi. sebagai dasar referensinya. memiliki sistem koordinat tertentu sebagai dasar referensinya dan mempunyai dua bagian penting yang membuatnya berbeda dari data lain. Telah  dijelaskan  diawal  bahwa  SIG  adalah  suatu  kesatuan  sistem  yang terdiri  dari  berbagai komponen. Data yang akan diolah pada SIG merupakan data spasial yaitu sebuah data yang berorientasi geografis dan merupakan lokasi yang memiliki sistem koordinat tertentu. suatu lokasi yang memilikibeberapaketeranganyangberkaitandengannya.Padadataraster. berkaitan dengan suatu koordinat baik koordinat geografi (lintang dan bujur) dan koordinat XYZ. 2. 1.obyekgeografisdirepresentasikansebagai strukturselgridyangdisebutdenganpixel(pictureelement).contohnya:jenis vegetasi. SIG mempunyai kemampuan untuk menghubungkan berbagai data pada suatu titik tertentu di bumi.luasan. Informasi lokasi (spasial).geografis merupakan data yang besar (dalam jumlah dan ukuran) dan terdiri dari banyaktemayangsalingberkaitan.yaitu: a) DataRaster Dataraster(ataudisebutjugadenganselgrid)adalahdatayangdihasilkandari sistemPenginderaanJauh.2 DataSpasial Sebagian besar data yang akan ditangani dalam SIG merupakan data spasial yaitu sebuah data yang berorientasi geografis. trend.2. kondisi.

  Keuntungan utama dari format data vektor adalah ketepatan dalam merepresentasikan fitur titik. semakin tinggi resolusi gridͲnya semakin besar pula ukuran filenya dan sangat tergantung pada kapasistasperangkatkerasyangtersedia. Semakin kecil ukuran permukaanbumiyangdirepresentasikanolehsatusel. seperti jenis tanah. kelembaban tanah. resolusi pixel menggambarkan ukuran sebenarnya di permukaan bumi yang diwakili oleh setiap pixel pada citra.titikdannodes(merupakantitikperpotonganantaraduabuahgaris). Contoh penggunaan lainnya adalah untuk mendefinisikan hubungan spasial dari beberapa fitur.  Dengan kata lain. resolusi (definisi visual) tergantung pada ukuran pixelͲ nya. vegetasi.Data raster sangat baik untuk merepresentasikan batasͲbatas yang berubah secara gradual. Pada data raster. suhu tanah dan sebagainya. misalnya pada basisdata batasͲbatas kadaster. area (daerah yang dibatasi oleh garis yang berawal dan berakhir pada titikyangsama). 3 3 . batasan dan garis lurus. Keterbatasan utama dari data raster adalah besarnya ukuran file. Kelemahan data vektor yang utama adalah ketidakmampuannyadalammengakomodasiperubahangradual.semakintinggiresolusinya. b) DataVektor Data vektor merupakan bentuk bumi yang direpresentasikan ke dalam kumpulan garis. Hal ini sangat berguna untuk analisa yang membutuhkan ketepatan posisi.

 pada umumnya data ini merupakan sumber data atribut contohnya: batas administrasi. d) DataGPS(GlobalPositioningSystem) Teknologi GPS memberikan terobosan penting dalam menyediakan data bagi  SIG.2 SumberDataSpasial Salah satu syarat SIG adalah data spasial. fotoͲudara dan sebagainya). batas kepemilikan lahan. merupakan sumber data yang terpenting bagi SIG karena ketersediaanya secara berkala dan mencakup area tertentu.2.arahmataangin dansebagainya.  ketelitian  yang diinginkan.  volume  data  yang dihasilkan.  Data vektor relatif lebih ekonomis dalam hal ukuran file dan presisi dalam lokasi. 4 4 . tetapi lebih mudahdigunakansecaramatematis.Datainibiasanyadirepresentasikan dalamformatraster. yang dapat diperoleh dari beberapa sumberantaralain: a) PetaAnalog Peta analog (antara lain peta topografi. Pemilihan  format  data  yang digunakan  sangat  tergantung  pada  tujuan penggunaan. b) DataSistemPenginderaanJauh Data Penginderaan Jauh (antara lain citra satelit. batas persil. Dengan adanya bermacamͲmacam satelit di ruang angkasa dengan spesifikasinya masingͲmasing.  data  yang  tersedia. Pengolahan data yang bersumber dari GPS biasanya dilakukandalamformatvektor. Pada umumnya peta analog dibuat dengan teknik kartografi. kemungkinanbesarmemilikireferensispasialsepertikoordinat. tetapi sangat sulit untuk digunakan dalam komputasi matematik. 1.MasingͲmasing format data mempunyai  kelebihan  dan  kekurangan. peta analog dikonversi menjadi peta digital dengan  cara  format  raster  diubah  menjadi  format  vektor melalui  proses  digitasi  sehingga  dapat menunjukan koordinat sebenarnya di permukaanbumi.  serta  kemudahan  dalam  analisa. Sedangkan data raster biasanya membutuhkan ruang penyimpanan file yang lebih besar dan presisi lokasinya lebih rendah. batas hak pengusahaan hutan dan lainͲlain. Dalam tahapan SIG sebagai keperluan sumber data. c) DataHasilPengukuranLapangan Data pengukuran lapangan yang dihasilkan berdasarkan teknik perhitungan tersendiri. kita bisa memperoleh berbagai jeniscitrasatelituntukberagamtujuanpemakaian. peta tanah dan sebagainya) yaitu peta dalam bentuk cetak.  Keakuratan pengukuran GPS semakin tinggi dengan berkembangnya teknologi satelit navigasi.skala.

AplikasiArcGISberbasisserverterdiridaritiga produk:ArcIMS. ArcGIS 9. server. daninternet (Web).ArcGISServer.ArcEditorTM.1. visualisasi. meningkatkan alur kerja secara efisien. SIG yang komprehensif akan menyediakansaranaatau media yang lengkap untuk pengelolaan.ArcGIS9.visualisasi. 2. antara lain untuk  kompilasi  dataset geografis.          5 5 . ArcGISSebagaiPerangkatLunakSIGyangKomprehensif ArcGIS menyediakan kerangka yang scalableͲ dapat disesuaikan menurut keperluan.danArcGISImageServer. yang mampudiimplementasikanuntuk single users maupun multiusers dalam aplikasi desktop.x merupakan kumpulan produkͲproduk perangkat lunak SIG yang dapatdigunakanuntuk membangunsuatuaplikasiSIGyanglengkap.pengelolaan. • ServerGIS– MerupakankumpulanaplikasiArcGISyangberbasiskanserver yangdigunakanuntukmembangun suatu sistem lintas departemen yang terintegrasi untuk koleksi. pembuatan alur kerja dan kontrol kualitas ‘authoring’ peta dan modelͲmodel analitik.serta pendistribusianinformasigeografis.danArcInfo®. SIG yang komprehensif mencakup berbagai penggunaan. serta sebagai sarana mengkomunikasikan suatufenomenayangdikaji.xterdiridariempatkerangka utama: • ArcGIS Desktop – Merupakan integrasi dari sederetan aplikasiͲaplikasi SIG yang terdiri dari tigaproduk perangkat lunak utama yang dibedakan menurut level kemampuannya: ArcView®. serta digunakan dalam perbaiki akses suatu informasi. organisasi. serta untuk mendokumentasikan metodeͲmetodekerja.2 PENGENALANArcGIS Teknologi  Sistem   Informasi  Geografi  (SIG) telah banyak digunakan manfaatnya untuk meningkatkan komunikasi dan  kolaborasi dalam  pengambilan keputusan (decisionͲmaking). pengelolaan asetͲaset dan sumberdaya secara efektif.

       6 6 .ArcGISMobile.IntidaripadaEDNDeveloperKitadalahArcObjects. yaitu suatu library dari berbagai komponenͲkomponenperangkat lunak yang dapatdigunakan untukmembangunsuatuaplikasi.         • Mobile GIS – Merupakan aplikasi ArcGIS yang difokuskan untuk keperluan mobile device.• ESRI Developer Network (EDNSM) – Merupakan perangkat lunak yang menyediakan sistem yanglengkapuntukmembangunaplikasimenggunakan ArcGIS. antaralain:ArcPad.

 7 7 . ArcGISDesktop ArcGISDesktopmerupakanplatformdasaryangdapatdigunakanuntukmengelola suatu proyek dan alur kerja SIG yang komplek serta dapat digunakan untuk membangun data.sertauntukquerydananalisayang berdasarkanpadapeta. ArcToolbox. model.2. dataͲdata format file. Dengan menggunakan aplikasi ini pengguna dapat menjalankan berbagai macam proses SIG dariyangpalingsimpelhinggatingkatlanjut. • ModelBuilder – merupakan bahasa pemrograman secara visual yang digunakan  untuk membangun suatu alur kerja dan skrip dari suatu rangkaiangeoprosesing. yang dapat digunakan untuk mappingdanediting. • ArcToolbox–merupakankoleksidaritoolsgeoprosesing • ArcGlobe – Aplikasi ArcGlobe tercakup dalam ekstensi ArcGIS 3D Analyst. dan ModelBuilder.metadata. serta aplikasi. yang mempunyai kemampuan untuk penayangan informasi geografis dalam bentuk kenampakan 3D yangdinamis. ArcGlobe. peta. • ArcMap – merupakan aplikasi utama dalam ArcGIS. seperti peta. 2. ArcGIS Desktop mencakup ArcCatalog. ArcMap. • ArcCatalog – digunakan untuk mengorganisasikan dan mengelola semua informasi geografis. toolboxesuntuk geoprosesing.sertaservicesSIG. geodatabases.

         8 8 . ArcInfo – mempunyaifungsionalitasterlengkap. mapping. visualisasi. ArcGIS Desktop menyediakan aplikasi yang scalable Ͳ yang dapat disesuaikan dengan kemampuan dan kebutuhan penggunanya.y yang simpel.mencakupfungsiͲfungsiyang tersedia padaArcViewdanArcEditorsertakemampuangeoprosesingtingkat lanjut. ModelDataGeografisdanFormatDataDalamArcGIS Penyimpan dan pengelolaan data geografis pada perangkat lunak ArcGIS dapat dilakukan dalamberbagaiformat.y yang mendefinisikan suatu segmen garis hingga menjadi suatu area yangtertutup. Polygon (area) disimpan sebagai rangkaian koordinat x. Garis (line) disimpan sebagai suatu rangkaian koordinat x. x Raster – Merupakan struktur data yang terdiri dari selͲsel (cellular/pixel) yang tersusundari baris dan kolom untuk menyimpan suatu gambar (image). 2.Terdapatbeberapamodeldatayangdigunakan dalamArcGISyaitu: • Vektor  –  Dalam  model  data  vektor  tiapͲtiap  lokasi  atau  posisi disimpan sebagai satu koordinat x. serta simpel editingdangeoprocessing. ArcEditor – mempunyai kemampuan untuk editing tingkat lanjut untuk data shapefiles dangeodatabasesebagaitambahandarifungsionalitasArcView. Titik (point) disimpan sebagai koordinat tunggal.3. MasingͲmasing sel atau pikselmenyimpansebuahnilaitertentu.y. berdasarkan level fungsionalitasnyadapatdibedakanmenjadi: • • • ArcView – fokus pada penggunaan data. analisa.

 menampilkan dan merevisi metadata. ArcCatalog menyediakan beberapa fungsi antara lain untuk menampilkan (preview). mengorganisir(organizing) 3. danmendokumentasikan(documenting)suatustrukturdatadalamArcGIS. mendokumentasikan dataset dan juga project yangtelahdibuat. personal geodatabase dan ArcSDE geodatabase dalam jaringanRDBMS. Pada saat Pengguna menjalankan ArcCatalog. LangkahͲlangkahmemulaiArcCatalogadalahsebagaiberikut: 1. Dalam ArcCatalog pengguna dapat mengatur/mengelola  folder  dan  fileͲfile data  ketika membuat project database di dalam computer. menelusuri/mencaridata(browsing) 2. membagiͲbagikan(distributing) 4. Dengan ArcCatalog pengguna juga dapat membuat. membuat dokumen dan mengatur data geografis serta membuat geodatabase untuk menyimpan data spasial dan tabular. Tampilan (views) data di dalam ArcCatalog sangat membantu Pengguna untuk secara cepat mencari data yang Pengguna perlukan walaupun tersimpan dalam sebuah file. Pengguna akan melihat ada duabuahpanel.sepertiterlihatpadagambardibawahini: 9 9 . KlikStart>Program>ArcGIS>ArcCatalog  2. 3 3. Pengguna juga dapat membuat personal geodatabase pada komputer dan membuat atau mengͲimport feature class dan tabel. ArcCatalog merupakan sebuah fasilitas untuk mengatur data dalam jumlah besar yang disimpan tersebar dalam folder data GIS.1 PENGENALANArcCATALOG SekilasTentangArcCatalog ArcCatalog  adalah  salah  satu  modul  dari  ArcGIS  yang  bisa  digunakan antaralainuntuk: 1.

Klikpada“File”>ConnectFolder   10 10 . Pembuatan  shortcut jugatersediadalamArcCatalogagarPenggunadapatmengaksesdatadenganmudah. 3.2 BrowsingDatadenganArcCatalog Fungsi  dari  ArcCatalog  adalah  untuk  browsing data. CarauntukmengaksesdatadalamArcCatalogadalahsebagaiberikut: 1.

Setelah Pengguna mendapatkan data yang dimaksud. selanjutnya akan Pengguna dapatkan katalog yang menujukkan turunan dari data tersebut danPenggunajugadapatlangsungmenggunakandata.   11 11 . KemudiancarilahfolderdatayangakanPenggunaakses:  3.2.

3. Pengguna bisa mengakses data dan informasi melalui Table of Contents. 12 12 . Pengguna juga dapat mengganti tabulasi yang ada untuk dapat melihat data tersebut dengan beberapa cara yaitu dalam bentuk gambar maupun dalambentuktabel. Pengguna dapat menampilkan atau menyembunyikan ekstensi data yang ada. dari Menu utama pilihlah Tools > Options.  4.  3. Informasi yang ditampilkan merupakan penjelasan atau uraian singkat dari datatersebut. Pilihlah folder data yang ingin diakses.3 MenggunakanArcCatalog 1. kemudian pilih General. contohnya D:\TBI GIS Training\Vector\Administrasi Pengguna akan melihat ada beberapa perbedaansimbolyangterdapatdidalamArcCatalogsepertidibawahini:  2. Hilangkanpengguna/pilihanpada“Hidefileextensions”danklikOK.

 jika Pengguna mengubah pilihan pada Table maka ArcCatalog akan menampilkan data dalam bentuk tabel sedangkan apabila Pengguna mengubahnya menjadi pilihan Geography makadataakanditampilkandatadalambentukgambarberikut.  13 13 . Pada Tab Preview Pengguna dapat menampilkan data dalam bentuk tabular maupun dalam bentuk gambar. 5.

 sehingga Pengguna dapat menambah atau mengurangi informasi tentang data tersebut. membuat file. ArcCatalog menyediakanbeberapaformatdata. Pada Options terdapat beberapa menu pilihan seperti mencari. serta mengekspor data menjadi file dengan ekstensi DBF. mengatur. Salah satu keunggulan ArcCatalog adalah karena tersedianya Metadata. serta dapat mengurutkan data sesuai dengankeinginanPenggunasertamenyimpannyadalamformattabel. Pada pilihan Metadata Pengguna akan menemukan beberapa informasi yang lebih detail tentang data yang Pengguna maksud dan juga dalam beberapa format yang telah disediakan oleh ArcCatalog.       6. Metadata adalah data yang menerangkan tentang data yang Pengguna maksud seperti informasi sumber data dan status data (apakah masih dalamprosesatausudahselesaiͲfinished). Melalui tool ini Pengguna juga bisa mencari data di dalam tabel secara berurutan maupun satu persatu.diantaranyaadalah: 14 14 . 7.

FGDC(FederalGeographicDataCommitee). e. b.a. FGDCClassic. d. FGDCFAQ.            15 15 . FGDCESRI. FGDCGeographyNetwork. c.

16 16 .

Penggunadapatmemilihantaralain: membuka Project baru (open new map).  3.4 4. TerlihatkotakdialogStartupyangakanmemberikanpilihanuntukmemulai sebuahsesipekerjaan. 17 17 . Pilih An Existing Map.1 PENGENALANArcMAP MembukaDataSpasialdenganArcMap 1. KlikStart>Programs>ArcGIS>ArcMapataudoubleklikiconArcMappada desktop.ataumembukasebuahProjectdocumentyangtelah adaatauProjectyangtelahdibuatsebelumnya.      2. membuka format yang telah disediakan (template). kemudian klik di Browse for Maps untuk melihat ProjectdocumentyangtelahadalanjutkandenganklikOK.

4. Arahkanpadadirectoryd:\TBIGISTraining\WorkspacedanpilihfileProject dengannamaPetaAdministrasiRiau 

5. Peta Indonesia akan tampil di layar. Perhatikan bahwa layar ArcMap akan menampilkanduabagian,yaitu: a. Window Table Of Contents (TOC), di bagian kiri layar yang berisi informasitentanglayer. b. Window Data Frame, di bagian kanan layar yang menunjukkan TampilanPeta

18 18

Tableof of Contents Contents

DataFrame Data Frame 

6. Selanjutnyakitaakanmelihatserangkaiandataset(shapefileatauimage) 4.2 MelihatDataAtributSebuahLayerMenggunakanMapTipsdanHyperlink 1. PadatoolbarToolsklikSelectElements  2. Sekarang, gerakan kursor ke arah salah satu bagian di peta. Perhatikan, bahwa ArcMap akan menampilkan nama Propinsi. Nama ini adalah data atributyangtersimpandilayerIndonesia_polygon. 3. Pada window Table of Contents, aktifkan tampilan layer berikut ini dengan kliktiaplayer: a. KotaProvnas_font_point b. Negara_polygon c. Indonesia_polygon d. Bps_riau_district2003 e. LautNas1_region f.   tbi_riauproject_esri_srtm.img 

19 19

4. Geser kursor di atas point Kota pada peta.  Perhatikan, ArcMap akan menampilkan nama kota. Data atribut dalam layer kota akan ditampilkan melaluiMapTips. 5. Untuk memperjelas data nama kota , kita harus melakukan perbesaran dengan menͲzoom (Zoom in) pada data frame. Pada toolbar Tools klik ZoomIndanklikpadapetauntukmemperbesartampilanpeta.  6. Kita dapat menggeser peta dengan menggunakan Pan. Klik Pan lalu pindahkankursorkearahpetakemudiankliktahandangeserpeta.  7. Perhatikan, pada saat kita memperbesar peta, maka nama kota akan muncul.Dataatributiniditampilkansebagailabel,danhanyadapatterlihat pada skala yang sudah ditetapkan. ArcMap memiliki kemampuan untuk mengatur tampilan layer pada skala yang ditetapkan dan berpengaruh pada keakuratan data spasial dengan skala tertentu. Sebagai contoh beberapa feature tidak dapat diberi label secara tepat pada perbesaran yangterlalukecil. 8. Apabila ada keterangan feature yang tidak muncul, klik kanan pada layer, properties, pada tab display checklis show map tips. Show map tips baru dapatdigunakanapabilalayertersebutmempunyaiindex(ArcCatalog). 9. Hyperlink, Klik kanan bps_riau_district2003, properties, pada tab Display checklist Support Hyperlinks using field dan pilih field yang digunakan. Untuk melihat Hyperlink, gunakan tool Hyperlink dan klik pada feature yangmempunyaihyperlink.  4.3 PenyusunanLayer 1. PadatoolbarToolsklikFullExtent.  2. Klik pada window Table of Contents dan aktifkan layer bps_riau_district2003.  Layer ini menampilkan gradasi warna yang menunjukkan poligon sebaran kabupaten. Untuk melihat nilainya, klik simbolexpanduntuklayer.

20 20

Sekarang. 4. NonͲaktifkanlayerbps_riau_district2003. 5.4 MengaktifkandanMenonaktifkanLayer Layer dapat diaktifkan dan dinonaktifkan.  6. 4.layeriniadalahpoligonwilayahadministrasikabupaten/kota. Pada window Table of Contents klik layer untuk bps_riau_district2003. 21 . Perhatikan. Klik tahan layer bps_riau_district2003 ke bagian atas window Table of ContentsdanperhatikanbagaimanaperubahantampilanlayerInset. kita akan melihat bagaimana cara menyusun layer dalam SIG. 3. kemudiankliktahan(drag)danpindahkanlayeritusehinggaberadadiatas layerIndonesia_polygon.LangkahͲlangkahnyasebagaiberikut: 1. semua data spasialnya adalah sama. Beberapa data atribut telah digunakan untuk membuat peta tematik. kita hanya dapat bekerja pada layer yangaktifpadaArcMap. Layer ini dibuat dari layer propinsi. Akan tampil gambar yang memperlihatkanpoligonsebarankabupatendiPropinsiRiau. Klik kotak tampilan layer bps_riau_district2003.

 Kita akan mulai melihat perbedaan view data dalam ArcMap.5 PerbedaanViewpadaDataAnda ArcMapadalahbagiandariaplikasiArcGISuntukmenampilkandataspasialdan melakukan operasi – operasi reporting query. View adalah window yang akan paling sering digunakan dibandingkan window lainnya di ArcGIS. Sebagian besar pengerjaan produk yang anda hasilkan hanya visual. Non aktifkan semua layer kecuali layer image atau layer yang berekstensi *. 4. yaitu salah satu tipe data berbeda yang digunakan dalam SIG. 5. Pilih No. edit. Akan muncul kotak dialog yang berisi pertanyaan apakah kita mau menyimpan perubahan pada dokumen. Perbesar (zoom in) hanya pada daerah Riau. atau data image. 4. Perhatikanbahwaimageberisibanyakinformasi.Kitadapatmenggunakan image untuk mendapatkan lebih banyak informasi dibandingkan dengan data vektor. Klik Full Extent untuk menampilkanseluruhimage. Kita bisa memperoleh berbagai variasi data seperti tinggi tempat di Propinsi Riau menggunakan image akan tetapi kita juga membutuhkan data vektor untuk mengetahui dimana lokasi daerah tersebut. Data raster maupun data vektor tidak cukup detil untuk digunakan pada skalatertentuyangmemilikiketerbatasanpadaskalatertentu. Tipe data ini dikenal sebagai data raster. Klik File menu dan pilih exit. 6. Pada skala ini kita dapat melihatketerbatasansebuahdataraster(image).  3. anda akan banyakmengunakanArcMapdibandingkandenganbeberapaaplikasiArcGISyanglain. komposisi dan mempublikasikan peta. 2. LangkahͲlangkahpengoperasianArcMapsebagaiberikut: 22 22 .img.

 Perhatikan Inset Data Frame – frame yang aktif akan berwarnahitamtebal. pilih Browser for Maps dan klikOK 3. Pilih Activate makapadalayarmonitorakantampilInsetDataFramesebuahpetaRiau. DataͲdataframeiniakanmunculpadatabelofcontentlayarmonitoranda. 10.  8. 2. 7. Pastikan anda memilih Arcmap document dan kemudian pilih document PetaAdministrasiRiau. misalkan pada layer Detail Data Frame.mxd 4. Perhatikan data yang ditampilkannya. 5. Untuk melihat view yang berbeda hanya dengan mengklik view Ͳ> layout viewatautombolLayoutViewpadasudutkiribawahArcMap: DataView Data View LayoutView Layout View  23 23 . Keduadataframedapatlangsungdilihatpadalayoutview–ArcMap’s desktoppublishingenvironment. Untuk mengaktifkan layer klik kanan pada layer tersebut. Pada Table of Content untuk map document yang terdapat 2 data frame. Sekarang perhatikan petapadadataview. 11. Sebagai indikasi frame yang aktif adalah tulisan tebalhitam. Dua data frame dalam map dokumen tersebut – dapat diperhatikan pada list Tabel of content. Sebuah menu box akan muncul. 6. Dari Startup dialog box pilih An Existing Map. keduanya memperlihatkan layer dan cover area yang berbeda. Peta akan menampilkan Indonesia dan Propinsi Riau. 9.1. Aktifkan kembali Inset Data Frame dengan mengunakan kursor klik kanan pada Inset Data Frame dalam Table of Content. dari kotak menu pilih Activate. Klik tombol Start > Program > ArcGIS > ArcMap atau dengan mengklik icon ArcMappadalayardesktopanda.

 zoomoutdanpan). Arahkankursorketomboltersebut.12. Perhatikan gambar di bawahini: 24 24 . 13. Pada latihansebelumnyaandatelahmengoperasikantombolͲtombol dasar(sepertizoomin. 1. ArcMap sekarang menampilkan frame yang sama seperti yang anda lihat pada data view. 4. Untuk mengetahui lebih jelas fungsi tombol tersebut perhatikan bar abuͲabu pada bagian bawah layar monitor anda. Untuk mengetahui fungsi dari masingͲmasing tombol dapat dilakukan denganlangkah–langkahsebagaiberikut: a. Pada layout view yang terlihat akan sama dengan hasil yangakandiͲprintnantinya. Pada data frame anotasi tidak tepat di atas feature tetapi berada di atas dataframesaja. Data DataFrames Frames (map) (map)  Annotation Annotation  14. c.6 MelihatTampilanPeta Pada toolbar terdiri beberapa tombol untuk memanipulasi setting view. b. KliktombolDataView.padatombolkirilayoutuntukkembailkemapview. Keterangandalamboxkuningakanmuncul.

  Berikut ini adalah fungsi dari tombol toolbarNavigation: Icon       Nama Zoomin ZoomOut FixedZoomIn FixedZoomOut Pan–Move FullExtents  Fungsi untuk memperbesar tampilan view dengan mengklik pada daerah yangakandiperbesar. untuk memperkecil tampilan view dengan mengklik pada daerah yangakandiperkecil.a b b c c  2.  3. memperbesarseluruhtampilanpetaatauviewpadalayar. Sekarang buka kembali map view untuk menampilkan data view Propinsi Riau.UntukmembuatnyaandadapatmenggunakanpreͲdefinedbookmark 25 . untuk menemukannya adalah dengan menggunakan tool tips. memindahkan  dan  menggeser  peta  atau tampilan dengan tidak menggantiskalaview. dan coba pahami bagaimana penggunaannya. untukmemperbesartampilanviewterhadappusatview. Perlu diperhatikan juga bahwa tidak semua tombol tersedia pada toolbar. untukmemperkeciltampilanviewterhadappusatview. Sekarang lihat setiap fungsi dari tombol pada toolbar navigation. GotoPrevious/Next untukkembalipadatampilansebelumnya/ Extents sesudahnya.

 jangan tutup Identify Results dialog dan pilih feature lainnnya dengan cara mengklik feature dari layer yang tersedia untuk melihat informasi yang terdapat di dalamnya. Layer yang anda pilih juga menampilkan nama layer featureͲnya termasuk semua primary display field (semua kolom atribut utama) pada layer tersebut dengan kata lain field (kolom atribut) yang digunakan dalam ArcMap tergantungfeatureͲnya. pilih Bookmark kemudianpilihRiau.yang telah di setͲup dalam map document. 26 26 . 4. berikut ini adalahlangkah–langkahnya: 1. Untuk melihat informasi pada feature yang lain.petaakanmenampilkanareaRiau. sepertiyangterlihatdataͲdatapadaprimarydisplayfield. KliktombolIdentifypadatoolbar  2. 4. dari hasil identify akan munculketerangansepertikotakdialogdibawahini:  3. ArcMap akan kembali menampilkan semua atribut informasi yang terdapat di dalam masingͲmasing layer tersebut. Klik menu view. Perhatikan pada setiap kasus.7 MelihatAtributData Pada ArcMap untuk mengidentifikasi suatu data atribut dan sekaligus komponen geografis pada setiap layer gunakan tombol identify atribut. Kemudian klik sebuah sebuah layer Kota point. Perhatikan atribut data pada kotak Identify Results yang akan memperlihatkan semua field (kolom) yang ada dalam feature.

 tambahkan beberapa layer ke dalam group tersebut. Pilih New GroupLayeruntukmembuatkumpulanlayerbarudanuntukmengganti nama Group Layer dengan cara klik kanan kemudian pada tab General. 5. 2. jika anda mengklik pada   feature   yang   lain   maka   atribut   tidak muncul   dan   saat   kita   klik   kembali   feature bps_riau_district2003. Sebagai jalan keluarnya adalah dengan klik kembali tombol indentify dan pilih kembali featureͲfeature yang lain dalam peta. apabila sebuah data tidak dapat teridentifikasi maka akan muncul peringatan nothing found hal ini disebabkan oleh banyaknya layer dalam feature pada saat mengklik tombol identify. Pada peta klik daerah sekitar bps_riau_district2003 feature. 6. Ulangi langkahͲlangkah identify dengan setting layer option dalam Identify Result dialog terhadap layerͲlayer yang lain  untuk  dapat  lebih memahamikegunaannya. LayerNameisidengannamabarumisalnyaBasisdata.pilihdataframe(layers)kemudianklikkananmouse maka akan muncul perintah seperti terlihat pada berikut ini. Setelah membuat group layer. 7. contohnya layer jalan dan layer transmigrasi ke dalam group layer Basis data. caranya dengan melakukan seleksi kedua layer tersebut dengan mouse kemudian geser ke bagian bawah group Basis data dan 27 27 .Padabagianinijugaakanmenolongkitauntuk lebihmemahamibagaimanacarakerjalayerͲlayerdalamGIS.8 PengelompokanLayer Untukmemudahkanprosesanalisadanmembuatsuatuperencanaandata spasial  dilakukan pengelompokan layer atau grouping layers. Dari Identify Result dialog klik tanda panah segi tiga dan pilih layer bps_riau_district2003 data yang akan ditampilkanhanyapadaatributlayeryangdipilihtersebut. Perhatikan. PadaTableofContent. IdentifyResultdialogakanmenampilkanatributdatanyakembali. Untuk membuat group layerdapatdilihatpadagambarberikut: 1. Pada beberapa kasus. 4.

kitadapatmengatursimboldanwarna. 4.10 MerubahTampilandenganSkala Pada Layer Properties kita dapat mengatur skala sehingga suatu layer dapat ditampilkan dengan skala tertentu yang kita inginkan langkah–langkahnya adalah sebagai berikut: Pada Layer Properties klik tab General dan terdapat dua option untuk pengaturan visible pada layer. 3. 2.9 MerubahTampilanLayer Pada ArcMap tersedia simbol default untuk membedakan setiap layer dengan pengaturan pada setiap layer (warna dan simbol) kita dapat melihat perbedaan dan menganalisalayer–layertersebut. Untuk melakukan setting simbol dan warna pada feature Point maupun Polygondigunakanproseduryangsama. SetelahTabSymbologydiklik. maka kedua layer tersebut akan berada dalam group basisdata. Pada layer jalan (layer line) klik kanan dan pilih Properties pilih tab Symbology.               28 28 . 4.Langkah–langkahnyaadalahsebagaiberikut: 1. misalnya skala maksimum1000danskalaminimum5000. Option yang pertama layer ditampilkan untuk semua skala dan option kedua layer ditampilkan pada interval skala tertentu.lepas tombol mouse.

 Untuk keperluan rektifikasi citra satelit. Geometrik citra adalah korelasi antara koordinat suatu obyek (x. diperlukan proses georeferencing ke dalam sebuah sistem koordinat yang disebutkoreksigeometrik. Banyaknya titik kontrol yang harus anda buat tergantung pada kompleksitas dari  bentuk transformasi polynomial yang rencananya akan anda gunakan untuk mengubah dataset raster ke dalam koordinatpeta. Untuk perbandingan sebuah pixel dalam beberapa aplikasi seperti perubahan yang terjadi atau pemetaan kelembaman panas (perbandingan citrayangdiambilpadasiangdanmalamhari) 2.antaralain: 1. juga terkadang mengorientasikancitrasehinggamempunyaiarahyangbenar(Erdas.1991). Untukkeperluantumpangsusun(overlay)sebuahcitradengandatavektor 29 29 .1 PengertianRektifikasi REKTIFIKASI Data raster yang biasanya diperoleh dari hasil scan peta.5 5. Koordinat titik kontrol lapangan ini dapat diperoleh dari pengukuran langsung di lapangan dengan GPS atau interpolasi daripetadasaryangsudahada.kolom)  dengan sistem koordinat proyeksi. Sehingga untuk menggunakanbeberapadatarastersecarabersamadengandataspasialyanglainyang sudah ada. Dalam  pekerjaan  koreksi  geometrik.  terdapat  satu  tahap  yang  dikenal dengan  nama  rektifikasi. baik yang tersimpan di dalam file atau yang disimpan sebagai suatu file yang terpisah.y) pada citra dengan koordinat (X. foto udara dan citra satelit belum berisi informasi yang menunjukkan referensi spasial. Untukidentifikasisampelyangmengacupadakoordinatpeta 4. UntukmembangunbasisdatasebuahpemodelanSIG 3. Untukmembuatpetafotoyangberskalatepat 5. Adabeberapaalasanuntukmelakukanrektifikasi. dibutuhkan beberapa koordinat titik kontrol lapangan sebagai bagian dari titik sekutu.Y) pada permukaan bumi. Rektifikasi adalah suatu proses pekerjaan untuk memproyeksikan citra yang ada ke bidang datar dan menjadikan bentuk konform (sebangun) dengan sistem proyeksi peta yang digunakan. Untuk hasil rektifikasi yang baik. Koreksi ini adalah merupakan proses mentransformasi koordinat titikͲtitik pada citra yangmasihmengandungkesalahangeometrikmenjadicitrayangbenar. Koreksi geometrik diperlukan untuk menghilangkandistorsigeometrikpadacitradanjugauntukmendapatkanhubungan antara  sistem koordinat  citra (baris. anda harus menyebarkan secara merata titik kontrol dibandingkan dengan hanya memusatkannyadalamsatuarea.

 Parameter tingkat keakurasian dari proses rektifikasi ini adalah nilai yang dipresentasikan oleh selisih antara koordinat titik kontrol hasil transformasi dengan koordinat titik kontrol. dari data yang belum mempunyai koordinat geografis menjadi data yang akan mempunyai koordinat geografi (georeferensi). Untukmembuatmosaikcitra 9.pilih georeferencing.2 ProsesRektifikasi Rektifikasi merupakan proses transformasi data. AdabeberapafaktoryangmempengaruhiRMSErroriniyaitu: 1.kemudian klik Toolbars.6.2. yang dikenal dengan nama RMS (Root Mean Square) Error. Sebagai contoh. Berbagai aplikasi lain yang membutuhkan identifikasi sebuah lokasi geografissecarateliti. Nilai  RMS  Error  yang  rendah  akan  menghasilkan  hasil rektifikasi yang akurat. Proses rektifikasi dapat dilakukan dengan langkahsebagaiberikut: 5.1 MenampilkanToolGeoreferencing Jalankan Program ArcMap. Klik Pada menu view. citra satelit atau peta scan dengan data spasial) di dalam GIS. hasil transformasi boleh jadi masih berisi kesalahan yang significant karenarendahnya/sedikitnyatitikcontrolyangdimasukkan. Untukmembandingansebuahcitradalamberbagaiskala 7. Tingkatketelitiantitikkontrolcitra 3. Tingkatketelitiantitikkontrollapangan 2. Modeltransformasiyangdigunakan 5. Data yang sudah direktifikasi selanjutnya dapat ditumpangsusunkan atau diͲoverlayͲkan dengan beberapa data lain yang sudah terekftifikasi lebih dulu seperti data raster/image (foto udara. Untukmeningkatkanketepatanhitunganjarakdanluaspadacitra 8.          30 30 . Jumlahdandistribusiletaktitikcontrol 4.

Tampilkan semua layer yang akan digunakan sebagai referensi image/raster dan layer yang berisi data raster / image yang akan direktifikasi. TambahkandatayangakandirektifikasidengancaraFile>AddData>Peta PenggunaanLahanKabSiak. 2. Zoomsesuaidenganfokusareayangdibutuhkanyangakandiambilsebagai titikreferensi.jpg  31 31 .2.           5. 3. 5.2. Untuklayerpolygonsebaiknyadibuattransparan(hollow).3 MenyiapkanLayerImage 1.2 MenyiapkanSemuaLayerDataSpasial 1.

 Untuk itu atur skala image agar sesuai dengan tampilan basis data.   32 . Pada  saat  image  dan  basis  data  ditampilkan  bersamaan  fullͲextent. yaitu dengan zoom pada layer basis data kemudian gunakan Tool georeferencing > fit to display. hal ini disebabkan image dan data spasial tidak memiliki sistem proyeksi yang sama. 2. maka image dan basis data bisa ditampilkan secara bersamaan/overlay tapi image masih belum sesuai atausejajardenganbasisdata. maka ArcMap akan menampilkan area kosong atau suatu titik kecil yang tidak jelas.

2. 4.2. tekan tombol kiri pada titik yang anda ketahui pada image. Kemudian. 3.tekantombolkiripadatitikkontrolpadalayerbasisdata.  33 33 .tandasilangakanditinggalkanpadatitikyangandapilih. Ulangi lagi tahapan diatas untuk 2 atau 3 titik kontrol lainya yang anda ketahui.4 MenambahkanTitikKontrol AgartitikimagetepatatauidentikdengantitikͲtitikkontrolyangterdapatbasis data.lakukanlahlangkahͲlangkahberikutini: 1.   5.halini akanmemindahkanimageyangselarasdengantitikkontrol. Setelah mengulangi 2 atau 3 titik kontrol lainnya maka image akan terlihat sepertipadagambardibawahini. Pada Toolbar georeferencing pilih (Add Control Points) untuk georeferensi terhadapimage. Gunakan mouse. 5.5.5 Carapengoperasiannyasebagaiberikut:  2.

7 RektifikasiMenggunakanTitikKontroldariGPS Bila anda ingin menggunakan titikͲtitik referensi yang diperoleh di lapangan dengan menggunakan GPS untuk merektifikasi citra satelit.  atau  ketiga.2.2. UntukaksestabelinipilihViewLinkTablepadaToolgeoreferencing. sebagai alternatif dari metode georeferensi yang telah dijelaskan diatas. 34 34 .  kedua.5. Apabila terjadi salah pengisian koordinat.6 MenggunakanTabelData Untuksetiapsettitikkontrolyangtelahdibuat. Jika tingkat penyimpangan cukup tinggi sebaiknya hapus titik tersebut dari dalam tabel dan klik Delete. Transformasi kedua (2nd) dan ketiga (3rd) akan lebih menyelaraskan data secara polynomial. LangkahͲlangkah untuk melakukan metodeinisamadenganmetoderektifikasimenggunakantabledata. atau image terputar. 5.sehinggamemudahkandalammelakukankoreksi. entri data pada table ini dapat dihapussekaligussecarabersamaan. koordinat titik kontrol dan tingkat penyimpangan yang terjadi.  5. Jumlah titik kontrol tergantung pada kebutuhan.masukantabelyangberisititikͲ titik koordinat awal. dari table georeferensi anda  bisa  melakukan transformasi  pertama.  Transformasi membandingkan  koordinat  pada  image dengan titikͲtitik kontrol (minimal 3 atau 4 titik kontrol) untuk menyelaraskan koordinat image kedalam peta dasar (basis data).2. kiri atau kanan. bawah.8 ProsesPengaturan Tingkat penyimpangan adalah nilai yang menyatakan tingkat kecocokan antara lokasi sebenarnya dengan lokasi transformasi sebagai Titik kontrol output. Transformasi pertama (1st) akan memindahkan image ke atas. image akan tertarik lebih lebar atau lebih kecil.

  Selanjutnya akan muncul kotak dialog Save As. anda bisa load text file bila ingin melakukan goereferensi lagiterhadapimage. dari Tool georeferencingpilihRectify. ESRI Grid.aux file. 3. 2. ini akan membuat image baru (TIFF. Kemudian klik tombol Save untuk menjalankanprosesrektifikasi.img. atau ERDAS imagine) dengan menyimpan koordinatͲkootdinatnya.dariLinktablepilihSave. Sebagai . Sebagai text file.2. Sebagai World file.  35 35 . 5.9 MenyimpanHasilRektifikasi Adatigapilihanuntukmenyimpanhasilrektifikasi 1. ini akan menyimpan semua perubahan dan file ini bisa dibacaolehsemuaprodukESRI.memungkinkan titikͲtitik tersebut berpindah tidak selaras (be shifted in nonͲuniform manner).Tunggubeberapasaatsampaiprosesrektifikasiselesai.  Isilah nama output file hasil rektifikasi Penggunaan_Lahan_Kab_Siak_rekt. Gunakan pilihan ini bila ingin menggunakan image untuk kepentingan GIS.

5.        36 36 .2.img sehinggaakantampaksepertigambardibawahini.10 MenampilkanHasilRektifikasi Jalankan ArcMap. Tambahkan layer Penggunaan_Lahan_Kab_Siak_rekt.

  6.2 MembuatLayeratauShapefile Langkah – langkah untuk memulai digitasi onscreen adalah sebagai berikut berikutini: 37 37 . 6.2 MetodeDigitasi Prosesdigitasisecaraumumdibagidalamduamacam: 1. rumah.2.6 6. Digitasimenggunakandigitizer Dalamprosesdigitasiinimemerlukansebuahmejadigitasiataudigitizer. tidak memerlukan tambahan peralatan lainnya.Kemudianpilihgambaryangdiperlukan. sawah dan lainͲlain yang sebelumnya dalam format raster Pada sebuah citra satelit resolusi tinggi dapat diubahkedalamformatdigitaldenganprosesdigitasi. ObjekͲobjek tertentu seperti jalan.1 MEMBUATDATASPASIAL PengertianDigitasiPeta Digitasi secara umum dapat didefinisikan sebagai proses konversi data analog ke dalam format digital. Digitasionscreendilayarmonitor Digitasi onscreen paling sering dilakukan karena lebih mudah dilakukan. 2.2. 6. File > Add Data di toolbar menu. dan lebih mudah untuk dikoreksiapabilaterjadikesalahan.1 MenambahDataGambar Untuk menambah data gambar ke dalam ArcMap.

 kemudian pilih Polyline di dropdown list Feature TypesebagaijenisfeatureͲnya.kemudianklikNew>pilihShapefile.1. kemudian akan muncul beberapapilihan. dan tentukan jenis feature (FeatureType)didropdownlistFeatureType. 6.  buatlah  shapefile  untuk  masingͲmasing kategori objek melalui ArcCatalog. Misalkan  Anda  akan  mendigitasi  objek  jalan.  3. Klik kanan jendela sebelah kanan ArcCatalog.  maka  isikan  “Jalan” dalam text box Name. Setelah ArcCatalog terbuka.  5. Isikan nama shapefile yang akan dibuat di text box Name. Setelah  objek  teridentifikasi. Kemudian akan muncul jendela “Create New Shapefile”. Untuk membuka ArcCatalog klik menu ArcCatalogdimenutoolbar. Pada contoh berikut kita akan menyimpan shape file yang akan dibuat di folder D:\TBI GIS Training\Workspace. IdentifikasiterlebihdahuluobjekͲobjekyangakandidigitasi. 4. masuklah ke dalam folder dimana shapefile yang akan dibuat ingin disimpan. 38 38 . 2.

 Untuk objekͲobjek yang berbentuk luasan seperti sawah. rumah. dan lainͲlain direpresentasikan dalam bentuk polygon. sumur bor. batas desa. 7.kemudianakanmunculjendela“SpatialReferenceProperties” sepertitampakpadagambardibawahini 39 39 .danlainlaindipresentasikandalambentukpoint 6. kolam.danlainͲlaindirepresentasikandalambetukgaris(Line/Polyline). Untuk menentukan sistem koordinat shapefile yang akan dibuat. FeatureTypeataujenisfeaturemerupakanrepresentasiobjekͲobjekdalam dunia nyata ke dalam bentuk geometri yang lebih sederhana.2. tekan tombolEdit.  telkom. Untuk objekͲobjek yang berbentuk titikͲtitik seperti tower.  jaringan listrik.  pipa  air. tiang listrik.3 MenentukanSistemKoordinatShapefile 1. Misalnya untuk objek yang memanjang seperti jalan.

 Misalkan kita tentukan sistem koordinatnya adalah geodetic dengan datum WGS 1984. 40 40 . Tekan tombol Select. kemudian pilih WGS 1984. 2. maka pilih world. kemudian pilih pilihan Geographic Coordinate Systems seperti gambar berikut.prj. sehingga muncul jendela “Browse for Coordinat System”.

Apabila shape file telah berhasil dibuat.   41 41 . akan tampak di jendela kanan Arc Catalog.   3.

5 Snapping Snapping adalah suatu tool yang sangat berguna untuk mendeteksi titik (Vertex).pilihmenuEditor>StartEditing  3. Kemudianakanmunculjendelasepertigambardibawahini.Dalamjendela tersebut akan muncul namaͲnama layer yang akan diedit yang berada dalamsatufolderyangsama. Setelah shapefile dibuat. Tool ini sangat bermanfaat untuk menghubungkan atau menghimpitkan antar garis atau titik dalam 42 42 . kemudian tambahkan shapefileͲshapefile yangakandigitasi.TekanlahtombolStartEditinguntukmemulai digitasi.2. Untukmemulaidigitasi.2. atau tepi (Edge) dari vektor shapefile.4 Digitasi 1.6.mengunakantombolAddData. Buka kembali ArcMap. ujung garis (End).  2.  6. selanjutnya siap untuk dilaksanakan proses digitasi.

sepertipadagambardibawahini: Sketch tool Dropdown list target Layer yang didigitasi  2.proses digitasi.6 MemulaiDigitasi 1.    43 43 . kemudian pilihlah layer yang akan didigitasi di dropdown list Target. Selanjutnya akan muncul jendela “Snapping Environment”. Untuk mengaktifkan snapping pilih menu File > View > Toolbar > Editor Snapping. sehingga tergambar garis hasil digitasi tersebut. Misalnya layer jalan. pada dropdown list Task pastikan Anda memilih Create New Feature. Kemudian pilihtombolSketchTool. Untukmemulaidigitasiarahkanmousekeobjek“jalan”dalamgambar.2.klik pada sebuah titik permulaan. Pada Menu utama pilih View > Toolbars > Editor.klikpadatiapͲtiapbelokanataupersimpanganjalan(setiap klik akan menghasilkan vertex).  6. sehingga bisa mereduksi kesalahan dalam digitasi berupa garis yang tidakbersambungatauberhimpit. Berilah tanda checkpadamasingͲmasinglayersesuaipilihanͲpilihansnappingyangdiinginkan. kemudian ikuti sepanjang jalan tersebut denganmouse.

 ganti nama layer pada menu TargetditoolbarmenuEditor.   44 44 . Untukmenghentikandigitasi. DigitasiLine  b. Untuk mendigitasi layerͲlayer yang lain. DigitasiPoint  3. DigitasiPolygon  c.MacamDigitasi a. 4.cukupdoubleclickpadatitikakhirdigitasi.

 klik menu Editor > Save Edits.6. Untuk menghentikandigitasipilihStopEditing.2.7 MenyimpanHasilDigitasi Untuk menyimpan hasil digitasi.              45 45 .

46 46 .

KliktombolEditorToolbaryangberadapadaToolbar 3. Pilihlayeryangakandiedit  2. Klikkanan.pilihOpenAttributeTable  5.7 7. Klikbarisyangakandiedit  47 47 .1 EDITINGDATASPASIALDANATRIBUT EditingDataAtribute 1. KlikEditormenudanklikstartediting 4.

SetTaskCurrentdenganmemilihCreateNewFeature 2. KlikEditormenudanklikstartediting 2.7.kemudiantekanEnter  5. KlikEditTask.tekanEnter  7. MasukanKoordinatXdanY.PilihCutPolygonFeature  48 48 . KlikPolygonyangakandipotong 3.2.2. TekanF6untukmemasukkannilaikoordinat. SetTargetuntukmemilihlayeraktif 3.2 7.2 MemotongPolygonMenjadiDuaBagian 1. KlikpointmenggunakanSketchTool(gambarpensil)  4.1 EditingDataGrafis MembuatObjekPointatauVertexdenganKoordinat 1.

Pilihmerge 49 49 .klikkanan. KliktombolEditorToolbar 5. KliktombolEditorToolbaryangberadapadaToolbar 2. PilihObjekyangakandiͲmerge  4. KlikSketchTool(gambarpensil) 5.  7.3 MergeObjek 1. KlikEditormenudanklikstartediting 3.2.tekanF2untukmengakhiri 6. Buatgarispemotong.4. Polygonakanterbagimenjadidua.

  7. BuatObjekbarudiatasobjek 3.4 MemotongPolygondenganPolygonLain 1.2. PilihObjekyangakandigunakanuntukmemotong 50 50 . KliktombolEditorToolbaryangberadapadaToolbar 2.

KliktombolEditorToolbaryangberadapadaToolbar 2.5 IntersectObjek 1. PilihObjekͲobjekyangmemilikiintersect 51 51 . PilihClip. 4.chekDiscardtheareathatintersects   6. KliktombolEditorToolbar 5.2. KlikOK 7.

Pilihintersect  5.kemudianpilihPreserveAreaatauDiscardArea 8. KliktombolEditorToolbar 7. KlikOK 7. BuatPolygonatauLine 52 52 .6 MembuatMultipartLineatauPolygon 1. Akantampakpolygonhasilintersect  6. Pilihclip. 3.2. KliktombolEditorToolbar 4.

klikkananpilihfinishPart  3.klikkananpilihfinishSketch(F2)   53 53 . 2. KemudianbuatlagiPolygonatauLine  4. Setelahselesai. Setelahselesai.

7 ReshapingPolygonatauLine 1. PilihPolygonataugarisyangakandireshape  4. KlikSpotpadagarisyangakandisplit  54 54 . KlikTaskpadaEditingToolbar.pilihReshapeFeature  2. Buatgarisbarupadaobjek.2.8 SplitLine 1. KlikSplitTool  4. PilihObjekgarisyangakandiSplit 3. KlikEditingTool 3. KliktombolEditorToolbaryangberadapadaToolbar 2.tekanF2  7.2.7. KlikSkecthToolpadaEditorToolbar 5.

KlikSkecthToolpadaEditorToolbar 5. KlikTaskpadaEditingToolbar.pilihExtend/TrimFeature  2. KlikEditingTool  3.tekanF2    55 55 . 7. Pilihgarisyangakandipotong  4. Buatbatasgarispemotong.2.9 MemotongGarisdenganBatasGaris 1.

7. Penyesuaianobyekpadabatastepipeta(edgematching) 56 56 .10 MenambahPanjangGaris(Extend) 1. Pilihgarisyangakandiperpajang  4. ProsesSpatialAdjustmentbisaberupa: 1. Penarikanobyek(rubbersheet) 3. Transformasi 2. KlikEditingTool 3.3 SpatialAdjustment  Spatial Adjustment adalah proses pembetulan data spasial agar sesuai/mendekati karakteristik data yang benar sesuai dengan kaidah GIS data dan logikakebenarandatadaninformasi.tekanF2  7.pilihExtend/TrimFeature  2.2. Buatbatasgarisbatas. KlikSkecthToolpadaEditorToolbar 5. KlikTaskpadaEditingToolbar.

 AdapunlangkahͲlangkahtransformasiadalahsebagaiberikut: 1. 4. lakukan pengukuran jarakterlebihduluuntukmenentukansnappingtolerancenya. check data yg akan ditransformasi     57 57 . ArcMap>AddData 2.checksemuacheckboxyangada 5. Semakin banyak jumlah titik sekutu akan semakin baik hasil yang dicapai. Transformasi memerlukan paling tidak 4 (empat) titik awal dan 4 (empat) titik target.sedangkanbentukdarifeatureitusendiriakandipertahankansesuaiaslinya.3. Rubbersheeting bisa dilakukanpembatasanpadaareamanaakandilakukanjustifikasi. KlikSpatialadjustment. KlikEditorͲ>Snapping. KlikEditorͲ>StartEditing 3.pilihTransfomasiAffine  6. bisa dilakukan multiple links untuk menambah akurasi feature sedangkan Edgematching  akan merubah/mempengaruhi vertex terakhir darisegment line saja. Klik EditorͲ> OptionͲ> masukan snapping tolerance. KlikSpatial Adjustmen Ͳ> Set Adjust Data. 7.1 Transformasi Adalah salah satu tool dalam lingkup Spatial Adjustment yang berfungsi untuk mentransform  (merubah  nilai  koordinat)  dari  suatu  feature  sehingga  akan menghasilkanfeatureyangbarudengankoordinatyangberbedadengankoordinat aslinya.Perbedaan antara Rubbersheeting dengan Edgematching adalah Rubbersheeting bisa merubah bentuk di semua segment line.

7. Createlinktransformasi: 

8. Klik LinksͲ> View link table utk melihat nilai titik sekutu transformasi Klik AdjustsFinish: 

9. Membuatlinktable: Parameter  nilai  koordinat  transformasi  dapat  dibuat  dengan  membuat tablekoordinatsekutupadatextfile(Notepad).Formatnyaadalahsbb: <ID><darix><dariy><xtujuan><ytujuan> Anda tidak perlu menuliskan judul table. File ini akan disimpan format txt file, dan digunakan dalam proses transformasi dengan cara memanggil fie tsb denganmengklikslinkssopenlinksfile 

58 58

 7.3.2 RubberSheeting 1. ArcMap,Adddata 2. EditorͲ>StartEditing 3. EditorͲ>Option,snappingtolerance 

4. EditorͲ>Snapping,checkvertex,edge,endcheckbook 5. KlikSpatialAdjustmentͲ>Rubbersheeting 6. KlikSpatialAdjustmentͲ>AdjustData,centangpadapeta2(source) 

59 59

7. KlikSpatialAdjustmentͲ>Option 8. Pilihsourcedantargetlayer 

9. KlikLink,created4link 

10. Buatlimitarea 

 

60 60

KlikSpatialAdjustmentOption 8.checkpeta2source 7. Pilihsourcedantargetlayer 9. Adjust  12. KlikSpatialAdjusmentEdgeSnap 6.11.edge.snappingtolerance 4.checkvertex. EditorsStartEditing 3.3 Edgematching 1. EditorsOption.3. EditorsSnapping. EdgeSnap 61 61 . KlikSpatialAdjusmenrAdjustData. Deletelimitarea 7.endcheckbox 5. ArcMap>Adddata 2.

62 .

 Buat  Personal Geodatabase Latihan di folder Workspace. Kita juga dapat mengimpor data yang sudah ada. kita dapat melakukannya dengan menggunakan ArcCatalog. Geodatabase memuat kelasͲkelas/golongan feature dan table.8 TOPOLOGYGEODATABASE Geodatabase merupakan database relasional yang mencakup informasi geografis. 8.1 MembuatTemaatauFeatureDatasetdiArcCatalog 1.1. polygon maupun point/titik. Browse pada lokasi dimana anda akan menyimpan  database.1 MenyiapkanGeodatabase Untuk membangun geodatabase. BukaprogramArcCatalog  2. Selanjutnya pada ArcCatalog.ataukombinasidarikeduanya. Dalam GIS topology didefinisikan oleh user sesuai dengan karakteristik data seperti line. menggunakan Unified Modellig Language (UML) dan ComputerͲAided Software Engineering(CASE)Tools. 8. 63 63 . KelasͲkelas featuredapatdiorganisasikankedalamsetdatafeature. Topologyadalahpendefinisiansecaramatematisyangmenerangkanhubungan relative antara objek yang satu dengan objek yang lain.  Setiap karakteristik data tertentu mempunyai rule/aturan tertentu. Rule atauaturantersebutsecaradefaulttelahdisediakanolehsoftwareGIS.

New>PersonalGeodatabase. atau taruh kursor di folder workspace lalupadawindowdataklikkanan.KemudianpilihNew>FeatureDataset. 64 64 .  5. BerinamafilepersonalgeodatabasedenganmengetikkanLATIHAN. Selanjutnya klik kanan mouse setelah mengarahkan mouse pada database latihan. Klik kanan pada folder workspace. 3. 4.

 6.  7. Selanjutnya akan tampil kotak dialog yang berisi pendefinisian koordinat sistemyangakandigunakanuntukfeaturedataset. PadaNamedariFeaturedatasetketikLandcover. 65 .

MinY. Setelah itu tekan tombol OK.MaxXdanMaxYsepertiyangterterapadagambarberikutini. 8. Pada layar akan tampil parameterͲparameter yang telah didefinisikan untuksistemkoordinatini. Masukan nilai MinX.  10. Tekan lagi tombol OK pada kotak dialog pembentukanFeatureDataset. Sekarang kita perlu memberi  nilai  pada X/Y Domain yang merupakan batas tepi dari tampilan peta yang akan kita tampilkan. 9. 66 66 .

Selanjutya kita akan membuat FeatureClass yang merupakan anggota dari FeatureDatasetLandcoverSiak. Kita mulai dengan Batas Kabupaten yang nama unsurnya Landcover. 67 67 .2 MembuatFeatureClass ArahkankursorkeFeatureDatasetLandcoverklikkananmouse.11. Ketik NamaLancoverSiak.1.danisialiasdengansiak2008.Isikannamaunsursepertiyangdisepakatipada desain.kemudianpilih New>FeatureClass. Sekarang anda memiliki tema Landcover sebagai Fetaure Dataset pada ArcCatalogdenganNamaLandcover.  Padakotakdalogyangmuncul.  12. 8.

  68 68 . Padakotakdialogberikutnyayangmuncul kemudiantekantombolNext. Sebelumnya pelajari terlebih dahulu desain basis data untuk tabelLandcoverSiakberikutini. Pada kotak dialog yang selanjutnya muncul kita perlu mengisikan field atribut yang telah disepakati. biarkan pilihan Default.

Kemudian Browse lokasi shape file yang akan dimasukkan (D:\TBI GIS Training\Workspace\tbi_siak_lc2008.8. 1.  2. Klikpada tombol Add Data.1.3 Memasukandatashapefilekedatabaseyangtelahdibuat. Untuk meLoad data terlebih dahulu kita klik kanan pada layer tbi_siak_lc2008kemudianpilihData>Export. Kita akan menggunakan ArcMap untuk memasukan data ke dalam Database.shp)kemudianklikAdd. BukaArcMap.untukmembukadata.DariStart>Programs>ArcGIS>ArcMap. 3.  4. Hal ini dikarenakan bekerja menggunakan Arcmap lebih fleksibel dibandingkan dengan ArcCatalog. 69 69 .

 70 70 . kemudian pada Look in kita pilih Featuredata Set Landcover_Siak . Setelah muncul Tab Saving Data. Setelah muncul Tab Export data. 5. klikkemudian akan muncul Tab Saving Data  6. kemudian Name kita isi dengan LC_SIAK2008 kemudianklikSave. pada Save as Type kita pilih Personal Geodatabase feature classes.

1 MembangunTopologypadaGeodatabase KesalahanTopology Beberapa tipe kesalahan topology yang akan dikoreksi dalam latihan ini adalah sebagaiberikut: a) Polygon 1. Pemilihan feature tergantung justifikasi kita mana yg akan dipilih sebagai feature yang dianggap salah.2 8. MustNotOverlap Subtract: Menghapus bagian yang overlap dari masing2 feature dan akanmeninggalkanareayangkosongpadadaeraherror. Merge:  Menambah/menggabung  feature  dari  feature  overlap  yang melangar aturan yg dipakai. Koreksi ini bisa diterapkan ke satu atau lebih kesalahan yang terselect oleh penerapan aturan Must Not Overlaperrors. Koreksi ini bisa diterapkanpadasatukesalahanMustNotOverlapsaja.Perbaikanini bisa diterapkan ke satu atau lebih kesalahan yang terjadi (terselesi) pada aplikasiruleMustNotOverlaperrors. Create Feature: Membuat polygon baru diluar kesalahan yang terjadi dan menghapus kesalahan yang ada. 8.   71 .2.

 Koreksi ini bisa diterapkan pada satu ataulebihkesalahanpadapenerapanaturanMustNotHaveGapserrors. Akan dicari endpoint terlebih dulu. Snap: Akan menyatukan dangle line ke line terdekat yang masuk dalam toleransi jarak snapping. hanya obyek yang terselek yg akan di validasi. Substract:  Menghapus  segmen  line  yang  overlapping  dari  feature2 yang membentuk kesalahan. 3. Koreksi ini dapat diterapkan pada satukesalahanMustNotIntersectsaja. b) Line 1. Anda harus melakukan seleksi lebih dulu sebelum menghapus obyek tersebut. Koreksi ini dapat diterapkankesatuataulebihkesalahanMustNotHaveDangles. Trim: Menghapus feature line jika dangle (point) pada akhir intersection line masuk dalam toleransi jarak snapping yg diterapkan.2. Koreksi ini dapat diterapkan pada satukesalahanMustNotOverlapsaja. MustNotIntersect Subtract: Menghapus segmen line yang overlapping dari feature yang membentuk  kesalahan. Koreksi ini bisa diterapkan pada satu atau lebih kesalahan Must Not Intersect. maka dangle akan tetap dipertahankan (tidak berubah). 2. MustNotHaveGap Create Feature: Membuat polygon baru dari garis batas yang saling membentuk polygon kosong (gap). Koreksi ini hanya dapat diterapkan padasatukesalahanmustnotoverlapsaja. Koreksi ini dapat diterapkankesatuataulebihkesalahanMustNotHaveDangles. Jika tidak masuk dalam toleransi jarak snapping. Anda harus melakukan seleksi lebih dulu sebelum menghapus obyek dimaksud. target line sendiri posisinya tetap.  Anda  harus  melakukan  seleksi  lebih  dulu sebelum menghapus obyek dimaksud. MustNotOverlap Substract: Menghapus segmen line yang overlapping dari featureͲfeature yang membentuk kesalahan. Split: Memotong feature line yang saling berpotongan menjadi 4 segmen garis. Koreksi ini dapatditerapkankesatuataulebihkesalahanMustNotHaveDangles.  72 72 . MustNotHaveDangles Extend: Menyambung dangle pada akhir segmen line ke feature di depannya sepanjang toleransi jarak snapping terpenuhi. vertex dan pada akhirnya garis.

c) Points Pada jenis kesalahan points hanya ada dua koreksi yang bisa dilakukan yaitu membiarkannyaataumenghapusfeatureyangdianggapsalah. AkanmunculkotakdialogNewtopologykemudiankliknext 73 73 . Klik kanan pada feature dataset dalam geodatabase yang telah dibangun. 8. jendela ArcMap terlebih dahulu di tutup kemudian proses topology dapat dilakukan pada ArcCatalog dengan langkahͲlangkah sebagai berikut: 1.2. newͲ>topology  2.x dapat dilakukan tahapanͲtahapan sebagaimana berikut. Untuk topology data penggunaan lahan ataupun dataͲdata lainya.2 BekerjaDenganTopology Untuk memulai membangun topology dengan menggunakan ArcGIS 9.

Rule yang dipilih bisa lebih dari satu sesuai dengan karakteristik data yang akanditerapkantopology. Disiniakanmunculkotakdialogyangmengharuskankitauntukmelakukan pemilihan (pengaktifan) feature yang akan dilakukan topology dan pemilihanruleyangakandipakaiterhadapfeaturetsb.   4.  3. 5. Lihatilustrasiberikutini: 74 74 . Pada tampilan selanjutnya akan muncul list rule yang bisa kita pilih sesuaikarakteristikdatanya.

MustNotGap 6. Sehingga akan muncul kotak dialog yang menampilkan keͲ2 rule sebagai berikut:  75 . MustNotOverlapdan b. Untuk data penggunaan lahan berupa polygon dapat kita terapkan dua aturan(rule)yaitu: a. PilihruleyangkeͲ2sepertigambarberikut:  7.

  Pilih feature yang memiliki kesalahan topology (warna merah tua) setelah feature yang di select/pilih menjadi warna hitam kemudian klik kanan. Klik next Ͳ> finish. Setelah itu akan munculhasiltopology. Lakukan proses validasi topology. 76 76 .8.  8.3 EditingTopologypadaArcMap Untuk memulai pengeditan topology langkah awal adalah klik ArcMap untuk menjalankan proses pengeditan polygonͲpolygon yang terdapat pada spatialdata yang terdapatdigeodatabasesepertipadagambarberikut. Untuk melakukankoreksidatapilihsalahsatufeaturesepertipadagambarberikut.

 77 . Kesalahan topology dikoreksi sesuai dengan tipe kesalahannya sebagaimana telahdijelaskanpadaawalsubbabini.

78 78 .

 Browsing dilakukan dengan cara mengͲKlik kanan pada layer TOC lalu pilih menu Open TabelAtribut. Arahkanposisipenunjukmouseditepikolomyangakandipindahkan. 2. analisa spasial. mengatur urutan tabel berdasarkan satuataubeberapafieldyangterpilih. atau integrasi atribut dan analisa spasial. Dalam latihan ini kita akan mulaimenjelajahidanmenganalisadataatribut.1. termasuk di dalamnya analisa atribut. Klikdantariktepikolomuntukmengaturulanglebarnya. pilih data geografik dan kliktombolAdduntukmeͲloadnya.1 BekerjadenganDataAtribut QUERYDATA Seperti yang telah disebutkan di atas. 3. memindahkan kolom. Carilah folder “D:\TBI GIS Training\Workspace\”. pelatihan ini akan memperkenalkan Anda dengan kemampuan analisa geografi GIS. LangkahͲlangkahnyaadalahsebagaiberikut: 1.1 MembukaTabelAtribut Dengan ArcMap kita mampu melakukan browsing seluruh data atribut untuk tiap layer. Browsing dapat dilakukan pada seluruh data atribut untuk tiap layer. LangkahͲlangkahnyaadalahsebagaiberikut: 1. Tampilkan seluruh data geografis dalam folder “D:\TBI GISTraining\Workspace\”dalamdataframeAnda. b) Latihan mengatur ulang posisi kolom dalam Tabel Attribute of landuse. Tiap layer dalam TOC mewakili data spasial yang ditampilkan dalam wilayah Map Display. 9. Anda dapat mengatur ulang tampilannya.LangkahͲlangkahnyaadalahsebagai berikut: 1. KliktombolAddDatauntukloaddatageografikdalamfilepetaAnda. Arahkan posisi penunjuk mouse di tepi kolom yang akan diatur ulang ukurannya.ataumelakukanfreezingpadasebuahfieldagar AndadapatselalumelihatfieldtersebutsaatAndamelakukanscrolling.1. Anda dapat memperbesar atau memperkecil lebar tabel yang ditampilkan. a) Latihan mengatur ulang lebar kolom dalam Tabel Attribute of landuse.2 MengaturUlangKolom Ketika Anda membuka sebuah tabel. Contohnya. 9.9 9. menyembunyikan kolom. 79 79 . Dalam Arcmap kita dapat pula memͲbrowse seluruh atribut yang berasosiasi dengan tiap layer. KlikikonArcMapdariStartͲProgramsͲArcGISͲArcMap 2.

 80 80 .  2. Arahkanposisipenunjukmousepadakolomtertentu. KlikkananmousedanpilihlFreeze/UnfreezeColumn. KlikkananmousedanpilihmenuShortDescending.LangkahͲlangkahnyaadalahsebagaiberikut: 1. 2. Arahkanposisipenunjukmousepadakolomtertentu. ArahkanposisipenunjukmousepadakolomyangakandiͲfreeze. Klikdantarikkolomuntukmengubahposisinya c) Latihan melakukan freezing sebuah kolom dalam Tabel Attribute of landuse. KlikkananmousedanpilihmenuShortAscending. 3.  d) Latihan mengatur urutan tabel berdasarkan kolom tertentu dalam Tabel Attribute of landuse dengan metode menurun (descending) dan menaik (ascending).2. LangkahͲlangkahnyaadalahsebagaiberikut: 1. 4.

 9. ukuran huruf 9. dan warna hurufhijaudalamwindowAttributesoflanduse.warna. KliktombolOptionslalupilihmenuAppearance. 81 . Set jenis huruf (table font) menjadi Tahoma. termasukdidalamnyamengaturjenishuruf.LangkahͲlangkahnyaadalahsebagaiberikut: 1.  2. a) LatihanmengubahjenishurufmenjadiTahomadenganwarnahijaudanukuran huruf9.kolomyangditampilkan.3 SettingTampilanTabel Dengan ArcMap Anda dapat melakukan setting tampilan tabel atribut.1.dannama samarankolom.

SetSelectionColormenjadikuning. 3. Pilih field  yang tidak ingin ditampilkan lalu pada kotak Visible lakukan unchecked. Klik tombol Options lalu pilih menu Appearance untuk menampilkan windowTableAppearance. KliktabFields. LangkahͲlangkahnya adalah sebagai berikut: 1. 2. Klik kanan pada tombol pada layer landuse lalu pilih menu Properties untukmenampilkanpropertilayerlanduse. c) Latihan mengeset tampilan Tabel Attribute of landuse agar hanya menampilkan field yang dikehendaki. 82 82 . 2. LangkahͲlangkahnya adalah sebagaiberikut: 1. b) Latihan mengubah warna huruf menjadi kuning.

Tekan Ctrl dan klik record pertama pada kolom paling kiri. Pilih kategori Numeric dan set Number of decimal places menjadi 3 lalu pilihlahkotakPathwithzeros. LangkahͲlangkahnyaadalahsebagaiberikut: 1. 9. 83 83 . b) Menukar record yang terpilih dalam tabel Attribute of landuse (record yang sebelumnya terpilih menjadi tidak terpilih dan record yang sebelumnya tidak terpilihmenjaditerpilih). KliktombolApplydiikutitombolOKuntukmelanjutkan. 2. LangkahͲlangkahnya adalahsebagaiberikut: 1. Anda dapat secara interaktif memilih sebuah record dengan cara memilih record tersebut atau memilih beberapa record yang memenuhi kriteria tertentu. 3. PilihfieldXlalukliktombolFormat. PilihmenuSelectionlalupilihSwitchSelection. Klikkananmousepadatombollayerlanduse.d) Mengubahnamafield. Pilih field yang akan dirubah namanya lalu isi nama samarannya pada text boxAlias. Dari sebuah tabel. 2.LangkahͲlangkahnyaadalahsebagaiberikut: 1. a) Pilih 10 record pertama pada Tabel Attribute of landuse secara manual. 2. e) Memformat field X dengan tiga digit desimal dan menampilkan angka desimal tersebut. tahan dan tarik penunjukmousemenujurecordkeͲ4. 4. BukaTabelAttributeoflanduse.4 PemilihanRecord Terdapat beragam cara untuk memilih obyek dalam ArcMap. Pemilihan recorddapatAndalakukansecaramanual. c) Memilih seluruh record pada tabel Attribute of landuse. Klik kanan pada layer landuse lalu pilih menu Properties untuk menampilkanpropertilayerlandusedankliktabFields.1. KliktombolOKuntukmelanjutkan. 2. Klik kanan pada layer landuse lalu pilih menu Properties untuk menampilkanpropertilayerdankliktabFields. Klikkananmousepadatombolpadalayerlanduse.LangkahͲlangkahnyaadalahsebagaiberikut: 1. 3. Salah satu cara yang dapat digunakan adalah memilih obyek melalui tabel atribut.LangkahͲlangkahnyaadalahsebagaiberikut: 1.

 Anda dapat menghubungkan tabel yang tengah Anda buka dan tabeltambahanyangberisiinformasiyangAndabutuhkan.lalu klikJoin.2.1. Klikkananmousepadatombolpadalayerlanduse.6 MenggabungkanTabelAtribut Ketika Anda membutuhkan informasi yang tidak terdapat pada tabel yang tengah Anda buka. KliktombolAddDatalalucarifolder“:\TBIGISTraining\Statistic\”. Oracle. 9. Pilih basisdata subdistrict_stat. Basisdata ini akan ditambahkandalamTOC. MS Access (mdb). 9.LangkahͲlangkahnyaadalahsebagaiberikut: 1. MS SQL Server. 2. PilihmenuSelectionlalupilihClearSelectedFeatures. PilihmenuSelectionlalupilihSelectAll.xls lalu klik tombol Add.pilihJoinsandRelates.Andadapat melakukanhubungantersebutdengancaramenghubungkan(joining)ataumerelasikan (relating). atau Informix merupakan hal yang lazim dalam lingkup GIS. DB2. KlikkananmousepadatombollayerSubdistrict.5 LoadingDataAtributEksternal Penyimpanan data atribut tambahan ke dalam basidata komersial seperti bBase file (dbf). 84 84 .DalamArcMap. Menghubungkan data atribut tambahan untuk subdistrict_stat ke dalam layer subdistrictpadamap. LangkahͲlangkahnya adalah sebagai berikut: 1. Dalam latihan berikut ini.1. Anda akan belajar cara mengisi data atribut tambahan yang tersimpan dalam format Microsoft Excel. 2. LangkahͲ langkahnyaadalahsebagaiberikut: 1. Mengisi data atribut tambahan pada peta. d) Tidak Memilih satu record pun pada tabel Attribute of landuse.

 3. Klik menu dropdown untuk memilih tabel yang akan digabungkan pada layer.  85 . 2. klik tombolbrowseuntukmencarilokasinyadalamdiskAnda. Jika tabel tabel yang dimaksud belum terdapat pada peta. Kliknamafieldpadalayeryangakanmenjadidasarpenggabungan.

4. Banyaknya obyek terkadang menjadi masalah ketika Anda mencari obyek tertentu yang tersimpan bersama ribuan record yang tersusun berdasarkan informasispesifiktertentusepertiID. Ketik “Minas” dalam text box Find what lalu klik tombol Find Next untuk mendapatkanrecordͲnya.nama. 86 86 .  3. Mencari Nama Kecamatan = Minas.2.2 AnalisaQuerydalamDataAtribut Sebagai bagian dari data geografis. BukatebelAttributeofSubdistrictlalukliktombolOption 2.dandeskripsi. sebuah layer berisi beragam obyek yang mewakili permukaan bumi.  9. 9. LangkahͲlangkahnya adalah sebagai berikut: 1. Anda dapat melakukan beberapa analisaberdasarkantipedataini. PilihperintahFindandReplace. 5. data atribut juga merupakan data mentah yang sangat penting dalam proses analisa geografis. Bukatabelatributuntukmelihathasilpenggabungan.1 MencariObyekTertentu Layaknya data GIS. Klik menu dropdown pada pilihan Choose the field in the table to base the joinonlalukliknamafielddalamtabelyangakandigabungkan.

 label.  2. Dengan demikian Anda dapat memberikan simbol. Klik kanan mouse pada field yang akan Anda rekapitulasi lalu klik Summarize. Anda dapat memperoleh beragam data statistik. temasuk nilai rataͲrata. Latihan merekapitulasi seluruh obyek yang terdapat pada Layer Subdistrict berdasarkantypenya. 9.2 MengkalkulasiStatistikObyek Terkadang informasi atribut tentang obyek peta tidak terorganisir sesuai keinginan Anda. Dengan merekapitulasi data dalam tabel.2. ArcMap akan membuat sebuah tabel baru yang berisi informasi statistik tersebut. maka ArcMAp akan memberikan peringatan. Klik tombol Find next untuk mendapatkan record “Minas” lainnya.LangkahͲlangkahnyaadalahsebagaiberikut: 1. 87 87 .4. nilaimaksimumdanminimum. Kemudian Anda dapat menghubungkan tabel tersebut dengan tabel atribut pada layer tertentu. TandaikotakyangbersebelahandenganringkasanstatistikyanginginAnda sertakandalamtabelkeluaran.sertainformasilainnyayangAndainginkan. contohnya. Jika tidak terdapat record “Minas”. Anda memiliki data populasi per kecamatan sementara yang Anda inginkan adalah data populasi per kabupaten. atau mencariobyeklayertertentuberdasarkannilainyapadaringkasanstatistik.

 Seperti yangtelah kita lakukan sebelumnya. MemilihObyeksecaraInteraktifmenggunakanPernyataanSQL   Seperti yang telah kita lakukan sebelumnya. Anda dapatmelihat diTOCterdapat tabelatribut baruyang bernama SumͲ  output. lalu klik tombol Yes untuk menambah output. SELECT *FROM NameOfTable WHEREthe Expression SQL secara interaktif. 4.  Anda dapat  memilih satu  atau Ketika menggunakan SQL. Dalam ArcMap. Ketika menggunakan SQL.  Dengan  ArcMap  Anda  dapat  pula  memilih  beberapa Attributes. Anda  harus  membuat  ekspresi  pada  dialog  box Select  By lebih  obyek  melalui  tabel  atribut.Bukalahtabelkeluarantersebut.Bukalahtabelkeluarantersebut. ekspresi ini hanya berupa WHERE saja (gunakan format ANSISQL).3 Memilih Obyek secaraInteraktif menggunakan Pernyataan SQL  5. Dalam ArcMap. Anda dapat memilih satu atau lebih obyek   melalui tabel atribut.3.2. tabelbarupadapeta. klik tombol OK untuk melanjutkan. 9. klik tombol OK untuk melanjutkan. ekspresi ini hanya berupa WHERE saja (gunakan format obyek  tertentu  secara  manual  atau menggunakan  pernyataan ANSISQL). AndadapatmelihatdiTOCterdapattabelatributbaruyangbernamaSumͲ 4.SELECT*FROMNameOfTableWHEREtheExpression 88 88 88 . Ketik nama dan lokasi tabel keluaran yang akan Anda buat atau klik ikon tabelbarupadapeta. browseuntukmencarilokasipenyimpananyangAndainginkan. Dengan ArcMap Anda dapat pula memilih beberapa obyek tertentu secara manual atau menggunakan pernyataan SQL secara interaktif. Anda harus membuat ekspresi pada dialog box Select By Attributes. Ketik nama dan lokasi tabel keluaran yang akan Anda buat atau klik ikon browseuntukmencarilokasipenyimpananyangAndainginkan. lalu klik tombol Yes untuk menambah 3.2. 5.3 9.

BukatabelAttributesofLanduse. kita perlu mempersiapkandata.3. Tambahkan kolom baru bernama “LUAS” dengan tipe “Short Integer” dan nilaiPrecision2. Bukalayerattribute. 4.3. Anda perlu menentukan tipe field. KembalikeArcMaplalubukalahlayertabelatributsubdistrict. Mengubah seluruh nilai item LUAS pada layer subdistrict menjadi hectares / 100.Petunjuk: 1.3 MemanipulasiDataAtribut Terkadang sebelum kita dapat melakukan analisa lebih jauh. presisi. Menambah kolom baru bernama “luas” dengantipeshortintegerpadatabelAttributeofsubdistrict. 9. 2.1 MenambahKolom Untuk menambah sebuah field. Klik ganda subdistrict untuk Training\Workspace\subdistrict”. dan skalanya jika field memiliki tipe numerik. lalu klik tombol Apply untukmemilihseluruhrecordyangmemilikiTypeIUPHHKͲHA. 3. Anda perlu menentukan  tipe field dan panjangnya. 9. PastikanlayerterpilihadalahlayerLanduse(periksaditextboxLayer). KlikmenuSelectiondanpilihSelectByAttributes.2 MelakukanPersamaanMatematis Dalam kasusͲkasus tertentu. Tulis pernyataan SQL: “Jenis_LU”= “IUPHHKͲHA”.pilihStartEditinguntukmulaimengedit. 89 89 . TampilkantoolbarEditor. 4.sepertiklarifikasidankalkulasiberdasarkanbeberapapersamaan matematis. membuka folder “D:\TBI GIS 3. Anda mungkin ingin melakukan kalkulasi matematis untuk mengatur nilai suatu field untuk sebuah record atau bahkan seluruh record. 9. Untuk field bertipe string. Buka ArcCAtalog dan temukan subdistrict shapefile dalam folder “D:\TBI GISTraining\Workspace\” 2. Kalkulator field ArcMap dapat membantu Anda melakukan perhitungan sederhana hingga perhitungan yang kompleks pada setiap record yang terpilih. 2. Petunjuk: 1.Memilih seluruh record pada tabel Attribute of Landuse yang memiliki tipe IUPHHKͲHA  menggunakan pernyataan SQL. LangkahͲlangkahnya adalah sebagai berikut: 1.

1 MembuatGrafikBaru Tampilkanjumlahtiaptipesubdistrictdalambentukgrafik.3.  9. Grafik melengkapi peta karena membawa informasi yang mampu menyajikan informasi yang sebetulnya perlu waktu untuk meringkasnya dan memahaminya. Anda dapat secara cepat membandingkan obyek untuk melihat atribut obyek mana yang memiliki nilai lebih kecilataulebihbesar 9. Grafik dapat pula menampilkan informasi tambahan tentang obyek pada peta atau menunjukkan informasi yang sama dengan cara yang berbeda.4. 90 90 . 5. Klikkananmousepadakolom“LUAS”lalu 4.Petunjuk: 1.4 MenganalisaDataAtributmelaluiObyekGrafik Sebuah grafik memberikan informasi tentang obyek peta dan hubungan antar obyek dalam bentuk yang interaktif dan mudah dipahami. KliktombolOptionslalupilihperintahCreateGraph. KliktombolOKuntukmelanjutkan. sebagai contoh. KetikpernyataanuntukmengisikolomLUASdenganhectares/100.

 2. Pastikan Anda memilih layer Subdistrict sebagai sumber data sementara nilanyadiambildarifieldhectaresdankecamatan.  91 .

  92 92 .3. dan pilihanlainnyalalukliktombolFinish. Beri tabel tersebut judul dan sub judul pada kotak Title dan Sub title.

MultipleRingBuffer. Terdapat dua modul penting yang dapat digunakan dalam melakukan analisa spasial yaitu Analysist Tools (vector) dan Spatial Analyst Tool (raster). Analisa Tool diperoleh pada section Analysis Tool yang terdiridaribeberapabagianutamayaitu.yangterdiridari4fungsiyaituClip.NeardanPointDistance 4. Symmetrical Difference. UniondanUpdate 3.terdiridariBuffer. Extract. Intersection.10 SPATIALANALYST(ArcToolbox) Salah satu kelebihan dari SIG adalah mampu melakukan analisa spasial. Identity. terdiri dari Erase. Overlay. modul kali ini kita akan berkenalan dengan beberapa performa ArcGis untuk melakukan beberapa analisa data menggunakan ArcToolBox. Proximity.Select. StatisticterdiridariFrequencydanSummaryStatistic     93 . 1.SplitdanTableSelect 2.

1 Clip Clip berfungsi untuk membuat Theme baru yang dihasilkan dari proses pemotongan oleh Clip Theme terhadap sebuah Theme Input.1 Extract 10.lineataupoint.1. Lanjutkan dengan mengklik ikon Next kemudian pilih input theme dan clip theme  94 94 .10. KlikArcToolbox їAnalystToolїExtractїClip  2. Syarat clip theme yaitu bertipefeaturepolygon.sedangkaninputthemedapatbertipepolygon. 1.

data yang menjadi clip featurenya (split) harus mempunyai kolom pada tableatributyangmemilikityperecordnyadalambentukkarakter 95 95 . Isi output fileͲnya dan tentukan tempat penyimpanan file tersebut dengan mengklikikon  4.3.1.3 Split Untuk perintah split hampir sama dengan perintah clip.2 Select Fungsi ini adalah fungsi Query Database (SQL) seperti yang telah kita pelajari sebelumnya 10. Makahasilclipberupadatasepertiberikutini:         10. KlikFinishuntukmenyelesaikanprosestersebut 5. tetapi perbedaannya adalah: 1.1.

 dan hasilnya adalah terpisah untuk tiap featuresplit  10. KlikArcToolbox   їAnalystToolїOverlayїErase 96 96 . output tersimpan didalam folder.1 Erase Perintah ini digunakan untuk membuat sebuah feature baru dengan cara memotongkan sebuah feature dengan feature pemotong.4 TableSelect Fungsiiniadalahsepertifungsiselectdanhasilnyaadalahberupatable 10.2 Overlay 10. Perintah ini seperti perintahpadaClip. 1. Feature yang terbentuk adalah bagian yang tidak termasuk dalam feature pemotong.2.1.2.

97 .

2. IsiEraseFeaturefileͲnyatersebutdenganmengklikikon            98 98 .kemudianadd          3. LanjutkanpilihinputFeature.

PerintahinisepertiperintahpadaSplit. KlikArcToolbox           їAnalystToolїOverlayїIdentity 99 99 . 1.2.kemudianklikOK   10.4. Isi output fileͲnya dan tentukan tempat penyimpanan file tersebut dengan mengklikikon.2 Identity Perintah ini digunakan untuk mengambil data atribut dari feature lain yang berpotongan.

100 .

Isi output fileͲnya dan tentukan tempat penyimpanan file tersebut denganmengklikikon.kemudianklikOK     101 .2. LanjutkanpilihinputFeature.kemudianadd  3.

3 Intersect Intersect digunakan untuk menggabungkan dua set data spasial yang saling berpotongan. Theme input ini bisa berupa line atau polygon. Aktifkanfungsi‘Intersect’padakotakdialogOverlay               102 102 .2.sedangkanthemeuntukoverlaynyaharusbertipepolygon. hanya featureͲfeature yang terdapat di dalam extent kedua theme ini yang akan ditampilkan. Atribut yang terdapat pada kedua theme ini juga akan digabungkan bersama shapefile yang baru. 1.10.

KlikFinishuntukmenyelesaikanprosestersebut 10. PilihinputthemedanthemeoverlayͲnya     3.2. IsioutputfileͲnyadantentukantempatpenyimpananfiletersebut 4. hanya saja feature yang terbentuk merupakanfeatureͲfeatureyangtidaksalingberpotongan.   103 103 .2.4 SymmetricalDifference Perintah ini seperti perintah intersect.

 1.5 Union Fungsi Union digunakan untuk membuat theme baru hasil penggabungan dari dua theme.10.2. Aktifkanfungsi‘Union’padakotakdialogOverlay             2. PilihinputthemedanthemeoverlayͲnya           104 104 . Theme yang telah digabung ini berisikan featureͲfeature dan atribut dariduathemeyangdigabungkantersebut.

2. IsioutputfileͲnyadantentukantempatpenyimpananfiletersebut            4.6 Update PerintahinisepertiperintahpadaClip.3.     105 105 . KlikFinishuntukmenyelesaikanprosestersebut 10.

AktifkanfungsiBufferpadakotakProximity            2.3 Proximity 10.kemudianadd         106 106 .10.1 Buffer 1. LanjutkanpilihinputFeature.3.

kemudiansave          4. Setelahsemuaprosestelahlengkap.klikOK 107 107 . Lanjutkan ketik distance (Jarak yang akan digunakan untuk Buffer).Dalamcontohinidipakaijarakbuffer50meter.    5. LanjutkanpilihinputFeature. 3.

10. LanjutkanpilihinputFeature           108 108 .2 MultipleRingBuffer 1.3. Aktifkanfungsi‘Intersect’padakotakdialogOverlay           2.

3.3 Near(menghitungjarakterdekat)  109 109 . LanjutkanpilihinputFeature          4. LanjutkanpilihinputFeature  10.3.

4 PointDistance        110 110 .10.3.

 Change Layout 111 111 . Aktifkanlayerdetail.mxd. 2. 7.1 PengaturanLayout 11.Halamanlayoutinimenyajikansatuataulebihdataframe. Zoom in/Zoom out: Memperbesar atau memperkecil peta pada layer yangaktifdihalamanlayout. 3.11 LAYOUTPETA 11.makapetaakandisajikanpadahalaman layout. b.   Fixed  GotoNext ToggleDraft  Zoomin/ Zoomin/ Zoom Extent/ Mode zoomout Zoomout 100% PreviousExtent      Zoom   Pan WholeZoomControlFocusData     Page   Frame  a.1. 8. Fixed zoom in/zoom out: Memperbesar atau memperkecil peta pada layeryangaktifdenganskalayangdiberikanlangsungolehArcMap.uncheckallothervalues. c. Pan:Menggerakkanpetapadalayeryangaktifdihalamanlayout. 9. 5. PindahkankeLayoutViewdenganklikView>LayoutView.pilihCategories>UniqueValues. Layout toolbar memuat tools yang dipakai untuk mengedit layout. BukafilePetaAdministrasiRiau. 6. Tools tersebutantaralain. Klik kanan pada bps_riau_district2003 > Properties > Symbology. KlikAddAllValues. Atau klik duakalipadafileyangdipilih. SetelahmenggantikeLayoutView. ArahkanketabSymbology.1 MenampilkanatauMengaturPeta 1. 4. PilihNMKABpadakolomValueField.Atauklikikondi bagianbawahhalamandata.

Untuk mengatur lebar halaman. 11. j. Klik kanan pada layer yang aktif. sehingga pengguna tidak perlu menunggu gambaran peta. Zoom control: Menampilkan peta dengan skala perbesaran yang diinginkanpengguna.KemudianakanmunculkotakdialogPageandPrintSetup. Focusdataframe:Untukfokuspadasalahsatudataframe. Langkah yang lain adalah dengan mengͲklik menu view > Page and Print Setup. Perlu dicatat bahwa setiap project di ArcGIS hanya dapat menyajikan satu layout. Go to next extent/previous extent: Ke tampilan peta sebelum atau sesudah. Klik kanan halaman pada halaman layout lalupilihPageandPrintSetup. Pada toggledraftmode. 3. 112 112 . 2.AkanmunculkotakPageandPrintSetup 2. 11. f. lalu klik Properties > Data Frame Properties>CoordinateSystem. g. AkanmunculkotakDataFrameProperties>CoordinateSystem.2 MengaturProyeksi 1. i.1.3 MengaturHalamanLayout 1.petadiwakilidenganjudullayer. Change layout: Untuk mengubah layout. h. Pengguna dapat memilih templatepetayangdiinginkan. ZoomWholePage:Menampilkanseluruhhalamanlayout. Pada Kotak Select a coordinate system.d. Toggle Draft mode: Digunakan untuk membuat layout tanpa tampilan peta. e. pilih Predefined > Geographic CoordinateSystem>World>WGS1984. Zoom100%:Menampilkanpetayangaktifdenganskala1:1.1.

Kotak dialog Page and Print Setup digunakan untuk mengubah orientasi portrait menjadi landscape  atau  sebaliknya.  Ukuran  halaman  dapat diubahdenganmengeditnyadikotakproperties.  113 113 . 3.

Klikkananpadadataframe.  3.2 PenambahanUnsurͲunsurPeta 11. AtaukemenuView>DataFrameProperties.  114 114 . 2.pilihProperties.11.1 MenambahkanKoordinatPeta 1. KotakdialogDataFrameProperties>Grids>NewGrid.2.

SelanjutnyaakanmunculkotakdialogGridsandGraticulesWizard.  115 115 .Aturintervalkoordinat pada 2 menit.KlikNext. Tahap kedua akan membimbing pengguna untuk membuat garis koordinat danmenentukanintervalgariskoordinatpadapeta. bila Anda merasa interval terlalu rapat ubah dengan interval yanglebihbesar. Pada tahap pertama pengguna akan memilihjenis koordinat dangariskoordinatyangdiinginkan.KlikNext. Kotak dialog Grid and Graticules  Wizard  akan  membimbing  pengguna melewati  4  tahap  untuk  melengkapi  peta dengan garis koordinat dan koordinatnya. 5.4.  6.

  116 116 . Tahap ketiga adalah untuk mengedit label koordinat dan garis koordinat. Atur ukuran huruf menjadi 8.  8. Setelah selesai. dengan mengubah di kotak text style.KlikNext.7. Tahap keempat untuk membuat batas kotak koordinat pada peta.klikFinish. Atau sesuaikanukuranhurufsesuaiyangAndainginkan.

 Skala dapat diedit dengan mengklikProperties. Klikskaladantarikkehalamanyangkosongpadahalamanlayout. 4. 5.danklikOK. Kotak dialog Scale Bar Selector akan muncul.2 MenambahkanSkala 1. KlikInsert>KlikScaleBaruntukmenambahkanskala.11. 117 117 . Pilihbentukskalayangdiinginkan.KlikInsert>ScaleText.  3. Penggunajugadapatmenambahkanskalateks.   2.2.

LaluakanmunculkotakScaleTextSelector. Setelah pengguna memilihjenisskalayangdiinginkan.3 MenambahkanPanahPenunjukArah 1. 118 118 . KlikInsert>NorthArrow.2.klikOk.  7. Teks skala dapat diubah dengan memilih Properties. 11. 6.

2.tarikkehalamankosongdihalamanlayout. KlikmenuInsert>Title. 2. Selanjutnya kotak dialog North Arrow Selector akan muncul. Klikpanahpenunjukarah. 11. 119 119 . PilihPanahpenunjukarahyangdiinginkan.4 MenambahkanJudulPeta 1.laluklikOk. 4.  3. Panah penunjukarahdapatdieditdenganmengkliktombolProperties.

 2. Tulis judul yang mewakili peta pada kotak judul. Untuk mengubah bentuk dan ukuran judul sesuai kebutuhan, klik kanan pada kotak judul dan pilih Properties. Setelah itu akan muncul kotak Properties. Ketiklah judul pada kolomtextyangtelahdisediakan. 

11.2.5 MenambahkanObjectpadaLayout 1. KlikInsert>Object.

120

120

 2. Akan muncul kotak Insert Object. User dapat memilih tipe objek yang akan di tampilkan pada layout.  Bila  objek  gambar  telah  ada,  klik  Create FromFile,danpilihobjekyanginginditampilkanpadalayout. 

3. Letakkanobjekpadahalamanlayoutkosong. 11.2.6 MenambahkanTekspadaLayout 1. KlikInsert>Text. 

2. Kemudian akan muncul kotak teks pada halaman layout. Klik kanan pada kotaktekstersebut,pilihProperties.AkanmunculkotakdialogProperties.

121 121

 3. Tulis teks untuk ditampilkan pada layout peta. Untuk mengatur jenis tulisan  klik  Change Symbol, maka selanjutnya akan muncul kotak dialog SymbolSelector. 

4. KlikOk.

122

122

 lalu pilih data yang akan dijadikan inset peta di kotak Other Data Frames.2.7 MembuatExtentRectangle Extent rectangle berguna apabila pengguna ingin menampilkan lebih dari satu dataframe. Setelahitu.laluklikProperties. Klik Extent Rectangles. Klik untuk memasukkan data satu per satu atau jika seluruh data ingin dijadikaninset.Langkah–langkahnyasebagaiberikut: 1.  2. Klikkananpadalayerpetayanglebihbesar.padahalamanlayoutakantampilpetadanpetainset. 123 123 . Akan muncul kotak dialog Data Frame Properties.misalnyauntukinsertpeta.  3.klikOK.11.

 d. Berikutcontohtampilanlayoutyangtelahselesai. lambang untuk data persil dapat diubah ukurannya dan bentuknya menjadioval.  Misalnya.2. 124 124 .klik menu drop down backdround untuk memilik warna latar. Tahap ketiga adalah untuk membuat kotak legenda sesuai yang diinginkan pengguna.KlikNext. c. Tahap keempat untuk mengedit ukuran dan bentuk lambang yang mewakili setiap data sesuai  yang  diinginkan  pengguna.lingkaranataukotak. KlikmenuInsert>Legend  2. Tahapterakhirmembimbingpenggunauntukmenentukanjarakantara bagianͲbagian yang disajikan pada legenda peta.  Pilih  data yangdiinginkanuntukditampilkandikotaklegenda.11.8 MenambahkanLegenda 1. Pilih warna latarolive. a. e. Klik Finish setelah menyelesaikanLegendWizard. Klik menu drop down border untuk menambah bingkaikotaklegenda. Tahap   pertama   akan   membimbing   pengguna   untuk   memilih dataͲdata   yang ingin ditampilkan  pada  kotak  legenda. b. Kotak ini akan membimbing pengguna melalui 5 tahap dalam membuat legenda sesuai dengan yang diinginkan. Tahap kedua membimbing pengguna untuk membuat judul legenda sesuaidenganyangdiinginkan. Kotak dialog Legend Wizard akan muncul.Pilihbordergarishitamdenganketebalan3.

danlainͲlain. 11. Atau dengan mengͲklik ikon.3 MenyimpanPeta Untuk menyimpan peta baru.  125 125 .JPEG. Peta dapat diekspor ke berbagai macam format. sepertiPDF. sedangkan ekstensi mxt untuk menyimpanpetadalambentuktemplate. klik menu File > Save As.4 EksporPeta Klik menu File > Export Map.   11. Peta dapat disimpan dalam ekstensi mxd dan mxt. Ekstensi mxd adalah untuk menyimpan peta dalam bentuk dokumen project.TIFF.

 11.5 MencetakPeta 1. Kotak Print akan muncul. KlikFile>Print  2. 126 126 . Setup cetak dapat disesuaikan dengan mengͲklik Setup>OK.

 127 127 . ukuran kertas dankualitascetakan. 3. Maka akan tampil kotak dialog Print untuk memilih printer.

Sign up to vote on this title
UsefulNot useful