You are on page 1of 129

Traduo da 6 Edio Americana

Manual de Bioqumica com Correlaes Clnicas


Thomas M. Devlin

Lanamento 2007
ISBN: 9788521204060 Pginas: 1216 Formato: 21x28 cm Peso: 2.948 kg

CONTEDO

VII

RESUMO DO CONTEDO
PARTE I

| |

ESTRUTURA DE MACROMOLCULAS

PARTE IV

VIAS METABLICAS E SEU CONTROLE

1 Estrutura da Clula Eucaritica, 1 2 DNA e RNA: Composio e Estrutura, 23 3 Protenas I: Composio e Estrutura, 73

PARTE II

TRANSMISSO DA INFORMAO

4 Replicao, Recombinao e Reparo do DNA, 132 5 RNA: Transcrio e Processamento, 172 6 Sntese de Protenas: Traduo e Modicaes Ps-Traduo, 197 7 DNA Recombinante e Biotecnologia, 241 8 Regulao da Expresso Gnica, 287

14 Bioenergtica e Metabolismo Oxidativo, 521 15 Metabolismo de Carboidratos I: Principais Vias Metablicas e Seu Controle, 572 16 Metabolismo de Carboidratos II: Vias Especiais e Glicoconjugados, 626 17 Metabolismo de Lipdeos I: Sntese, Armazenamento e Utilizao de cidos Graxos e Triacilgliceris, 650 18 Metabolismo de Lipdeos II: Vias do Metabolismo de Lipdeos Especiais, 683 19 Metabolismo de aminocidos, 725 20 Metabolismo de Purina e Pirimidina Nucletdeos, 770 21 Metabolismo do Heme e do Ferro, 803 22 Inter-Relaes Metablicas, 829

PARTE III

FUNES DE PROTENAS

PARTE V

PROCESSOS FISIOLGICOS

9 10 11 12 13

Protenas II: Relaes Estrutura-Funo em Famlias de Protenas, 315 Enzimas: Classicao, Cintica e Controle, 358 Citocromos P450 e xido Ntrico Sintases, 407 Membranas Biolgicas: Estruturas e Transporte em Membranas, 436 Fundamentos da Transduo de Sinal, 483

23 Bioqumica de Hormnios, 870 24 Biologia Molecular das Clulas, 925 25 Ciclo Celular, Morte Celular Programada e Cncer, 987 26 Digesto e Absoro de Constituintes Nutricionais Bsicos, 1009 27 Princpios de Nutrio I: Macronutrientes, 1043 28 Princpios de Nutrio II: Micronutrientes, 1063

APNDICE REVISO DE QUMICA ORGNICA, 1094 GLOSSRIO, 1107 NDICE, 1134

BioQ.00 7

22.01.07 16:25:01

CONTEDO

IX

CONTEDO
PREFCIO, XXI PREFCIO PARA A EDIO BRASILEIRA, XXIII AGRADECIMENTOS, XXV TRADUTOR E CO-AUTORES, XXVII
BIBLIOGRAFIA, 69 QUESTES E RESPOSTAS, 70 CORRELAES CLNICAS 2.1 Vacinas de DNA, 25 2.2 Uso Diagnstico de Matrizes (Arrays) de DNA em Medicina e Gentica, 38 2.3 Antibiticos Antitumorais que Mudam a Forma do DNA, 42 2.4 Persistncia Hereditria de Hemoglobina Fetal, 45 2.5 Telomerase como Alvo para Agentes Anticncer, 46 2.6 Expanso de Tripletes de DNA repetitivos em Doena Humana, 48 2.7 Topoisomerases no Tratamento de Doena, 52 2.8 Resistncia de Staphylococcus Eritromicina, 65

PARTE I ESTRUTURA DE MACROMOLCULAS


1 | ESTRUTURA DA CLULA EUCARITICA, 1
1.1 VISO GERAL: CLULAS E COMPARTIMENTOS CELULARES, 2 1.2 GUA, PH E SOLUTOS: O AMBIENTE AQUOSO DAS CLULAS, 3 1.3 COMPOSIO DE CLULAS EUCARITICAS: PAPIS FUNCIONAIS DE ORGANELAS SUBCELULARES E SISTEMAS DE MEMBRANAS, 11 1.4 INTEGRAO E CONTROLE DAS FUNES CELURES, 19 BIBLIOGRAFIA, 20 QUESTES E RESPOSTAS, 20 CORRELAES CLNICAS 1.1 Concentrao Sangnea de Bicarbonato na Acidose Metablica, 10 1.2 Doenas Mitocondriais, 15 1.3 Enzimas Lisossomais e Gota, 16 1.4 Decincia de Lipase cida Lisossomal, 18 1.5 Doenas da Biognese de Peroxissomos (PBDs), 19

PROTENAS I: COMPOSIO E ESTRUTURA, | 73


3.1 PAPIS FUNCIONAIS DE PROTENAS NO HOMEM, 74 3.2 COMPOSIO EM AMINOCIDOS DE PROTENAS, 75 3.3 PROPRIEDADES DE CARGAS E QUMICAS DE AMINOCIDOS E PROTENAS, 81 3.4 ESTRUTURA PRIMRIA DE PROTENAS, 88 3.5 NVEIS SUPERIORES DE ORGANIZAO PROTECA, 90 3.6 OUTROS TIPOS DE PROTENAS, 97 3.7 DOBRAMENTO ( FOLDING ) DE PROTENAS DE ESTRUTURAS ALEATRIAS PARA SINGULARES: ESTABILIDADE DA PROTENA, 108 3.8 ASPECTOS DINMICOS DA ESTRUTURA DE PROTENAS, 115 3.9 CARACTERIZAO, PURIFICAO E DETERMINAO DA ESTRUTURA E ORGANIZAO DE PROTENAS, 116 BIBLIOGRAFIA, 128 QUESTES E RESPOSTAS, 129 CORRELAES CLNICAS 3.1 Protenas Plasmticas no Diagnstico de Doenas, 86

E RNA: COMPOSIO E ESTRUTURA, | DNA 23


2.1 2.2 2.3 2.4 2.5 2.6 2.7 VISO GERAL, 24 COMPONENTES ESTRUTURAIS DOS CIDOS NUCLICOS: NUCLEOBASES, NUCLEOSDEOS E NUCLEOTDEOS, 26 ESTRUTURA DO DNA, 28 ORDEM SUPERIOR DA ESTRUTURA DO DNA, 47 SEQNCIA E FUNO DO DNA, 57 ESTRUTURA DO RNA, 61 TIPOS DE RNA, 64

BioQ.00 9

22.01.07 16:25:01

CONTEDO

3.2 Diferenas em Insulinas Usadas em Tratamento de Diabetes Mellitus, 89 3.3 Uma Mutao No-Conservativa Ocorre em Anemia Falciforme, 90 3.4 Doenas de sntese de Colgeno, 98 3.5 Hiperlipidemias, 103 3.6 Hipolipoproteinemias, 105 3.7 Hemoglobina Glicosilada, HbA1c , 108 3.8 Protenas Como Agentes Infecciosos: Prons e Encefalopatias Espongiformes Transmissveis Humanas (TSEs), 110 3.9 Uso de Anlise de Aminocidos em Diagnstico de Doenas, 121

RNA: TRANSCRIO E PROCESSAMENTO, 172


5.1 5.2 5.3 5.4 5.5 VISO GERAL, 173 MECANISMOS DE TRANSCRIO, 173 TRANSCRIO EM EUCARIOTOS, 178 PROCESSAMENTO DE RNA, 184 EXPORTAO DO RNA E CONTROLE DE QUALIDADE, 191 5.6 RNAs PEQUENOS INIBITRIOS, 192 5.7 REPARO DO DNA ACOPLADO TRANSCRIO, 192 5.8 NUCLEASES E TURNOVER DO RNA, 193 BIBLIOGRAFIA, 194 QUESTES E RESPOSTAS, 195 CORRELAES CLNICAS 5.1 Antibiticos e Toxinas Que Tm RNA Polimerase Como Alvo, 176 5.2 Sndrome do X Frgil: Uma Doena de RNA-Cromatina?, 179 5.3 Envolvimento de Fatores Transcripcionais em Carcinognese, 182 5.4 Talassemia Devido a Defeitos na Sntese de RNA Mensageiro, 188 5.5 Auto-Imunidade em Doena do Tecico Conjuntivo, 189 5.6 Sndrome de Cockayne, 193

PARTE II TRANSMISSO DA INFORMAO


4

REPLICAO, RECOMBINAO E REPARO DO DNA, 132


4.1 CARACTERSTICAS COMUNS DA REPLICAO, RECOMBINAO E REPARO, 133 4.2 REPLICAO DO DNA, 133 4.3 RECOMBINAO, 151 4.4 REPARO, 156 BIBLIOGRAFIA, 169 QUESTES E RESPOSTAS, 169 CORRELAES CLNICAS 4.1 Quimioterapia Pode Ter Como Alvos Precursores da Sntese do DNA, 135 4.2 Topoisomerases Como Alvos Para Drogas, 144 4.3 Cncer e o Ciclo Celular, 149 4.4 Anlogos de Nucleosdeos e Resistncia a Drogas na Terapia do HIV, 149 4.5 Terapia Gnica, 156 4.6 Quimioterapia, Leso do DNA e Reparo, 157 4.7 Anlogos de Nucleosdeos Como Drogas: Tiopurinas, 158 4.8 Medicina Individualizada, 159 4.9 Xeroderma Pigmentoso, 162 4.10 Reparo de Pareamento Errado e Cncer, 164

SNTESE DE PROTENAS: TRADUO E MODIFICAES PS-TRADUO, 197


6.1 6.2 VISO GERAL, 198 COMPONENTES DO APARELHO DE TRADUO, 198 6.3 BIOSSNTESE DE PROTENAS, 209 6.4 AMADURECIMENTO DE PROTENAS: DOBRAMENTO, MODIFICAO, SECREO E DIRECIONAMENTO, 218 6.5 DIRECIONAMENTO PARA MEMBRANA E ORGANELAS, 224 6.6 MAIS MODIFICAES PS-TRADUO, 227 6.7 REGULAO DA TRADUO, 234 6.8 DEGRADAO E TURNOVER DE PROTENAS, 235 BIBLIOGRAFIA, 237 QUESTES E RESPOSTAS, 239 CORRELAES CLNICAS 6.1 Mutaes Com Sentido Errado: Hemoglobina, 202 6.2 Mutao Gerando Cdon de Terminao, 202 6.3 -Talassemia, 203 6.4 Mudana na Fase de Leitura ( Frameshifting) Programada na Biossntese das Protenas de HIV, 204

BioQ.00 10

22.01.07 16:25:02

CONTEDO

XI

6.5

Mutao em RNA Ribossmico Mitocondrial Resulta em Surdez Induzida por Antibitico, 217 6.6 Deleo de um Cdon, Modicao Ps-Traduo Incorreta e de Gradao Prematura de Protena: Fibrose Cstica, 219 6.7 Dobramento Errado e Agregao de Protena: Doena de Creuzfeldt-Jacob, Doena da Vaca Louca, Doena de Alzheimer e Doena de Huntington, 220 6.8 Doenas de Funo de Lisossomos, 226 6.9 Hiperproinsulinemia Familiar, 229 6.10 Ausncia de modicao Ps-Traduo: Decincia Mltipla de Sulfatases, 230 6.11 Defeitos na Sntese de Colgeno, 233

RECOMBINANTE E BIOTECNOLOGIA, | DNA 241


7.1 7.2 VISO GERAL, 242 A REAO DE POLIMERASE EM CADEIA ( POLYMERASE CHAIN REACTION ), 243 7.3 ENDONUCLEASES DE RESTRIO E MAPAS DE RESTRIO, 243 7.4 SEQENCIAMENTO DE DNA, 245 7.5 DNA RECOMBINANTE E CLONAGEM, 248 7.6 SELEO DE UM DNA ESPECFICO CLONADO EM BIBLIOTECAS, 252 7.7 DETECO E IDENTIFICAO DE CIDOS NUCLICOS E PROTENAS QUE LIGAM DNA, 254 7.8 DNA COMPLEMENTAR E BIBLIOTECAS DE DNA COMPLEMENTAR, 260 7.9 BACTERIFAGO, COSMDEO E VETORES DE CLONAGEM EM LEVEDURA, 262 7.10 ANLISE DE LONGAS SEQNCIAS DE DNA, 265 7.11 VETORES DE EXPRESSO E PROTENAS DE FUSO, 265 7.12 VETORES DE EXPRESSO EM CLULAS EUCARITICAS, 267 7.13 MUTAGNESE STIO-DIRIGIDA, 269 7.14 APLICAES DA TECNOLOGIA DO DNA RECOMBINANTE, 272 7.15 GENMICA, PROTEMICA E ANLISE MICROARRAY, 279 BIBLIOGRAFIA, 283 QUESTES E RESPOSTAS, 284 CORRELAES CLNICAS 7.1 Reao de Polimerase em Cadeia ( Polymerase Chain Reaction), 245

7.2 Mapas de Restrio e Evoluo, 246 7.3 Seqenciamento Direto de DNA para o Diagnstico de Doenas Genticas, 248 7.4 Anlise por PCR Multiplex de Defeitos no Gene de HGPRTase na Sndrome de Lesch-Nyhan, 252 7.5 Polimorsmo de Comprimento de Fragmentos de Restrio Determina a Origem Clonal de Tumores, 257 7.6 Polimorsmo de Conformao de Cadeia-nica para Deteco de Mutaes Espontneas que Podem Levar a SIDS, 259 7.7 Mutagnese Stio-Dirigida de HSV IgD, 271 7.8 Inibio de HIV Mediada por RNA, 274 7.9 Terapia Gnica: Genes Normais Podem Ser Introduzidos em Clulas com Genes Defectivos, 276 7.10 Modelos de Animais Transgnicos, 277 7.11 Camundongos Knockout para Denir um Papel para o Purinoceptor P2Y1, 279 7.12 Anlise por Microarray de Cncer de Mama, 280

8 | REGULAO DA EXPRESSO GNICA, 287


8.1 8.2 VISO GERAL, 288 UNIDADE DE TRANSCRIO EM BACTRIAS: O OPERON, 288 8.3 OPERON LACTOSE DE E. COLI, 288 8.4 OPERON TRIPTOFANO DE E. COLI, 293 8.5 OUTROS OPERONS BACTERIANOS, 297 8.6 TRANSPOSONS BACTERIANOS, 299 8.7 EXPRESSO GNICA EM EUCARIOTOS, 300 8.8 COMPLEXO DE PR-INICIAO EM EUCARIOTOS: FATORES DE TRANSCRIO, RNA POLIMERASE II E DNA, 303 8.9 REGULAO DA EXPRESSO GNICA EUCARITICA, 308 BIBLIOGRAFIA, 312 QUESTES E RESPOSTAS, 312 CORRELAES CLNICAS 8.1 Resistncia Transmissvel a Mltiplas Drogas, 300 8.2 Sndrome de Rubstein-Taybi, 302 8.3 Tamoxifeno e Receptor de Estrgeno como Alvo, 309 8.4 Fatores de Transcrio e Doena Cardiovascular, 310

BioQ.00 11

22.01.07 16:25:02

XII

CONTEDO

PARTE III | FUNES DE PROTENAS


9

PROTENAS II: RELAES ESTRUTURAFUNO EM FAMLIAS DE PROTENAS, 315


9.1 9.2 VISO GERAL, 316 MOLCULAS DE ANTICORPOS: SUPERFAMLIA DE PROTENAS IMUNOGLOBULINAS, 316 9.3 PROTENAS COM UM MECANISMO CATALTICO COMUM: SERINO PROTEASES, 324 9.4 HEMOGLOBINA E MIOGLOBINA, 334 9.5 O COMPLEXO PROTICO DA LMINA BASAL, 347 BIBLIOGRAFIA, 355 QUESTES E RESPOSTAS, 355 CORRELAES CLNICAS 9.1 As Protenas do Complemento, 319 9.2 Funes de Diferentes Classes de Anticorpos, 319 9.3 Imunizao, 320 9.4 Formao de Fibrina em um Infarto do Miocrdio e Uso de Ativador de Plasminognio Tecidual Recombinante (rt-PA), 326 9.5 Envolvimento de Serino Proteases em Metstase de Clulas Tumorais, 326 9.6 Hemoglobinopatias, 335

CORRELAES CLNICAS 10.1 Mutao de um Stio de Ligao de Coenzima Resulta em Doena Clnica, 371 10.2 Um Caso de Gota Demonstra Duas Fases no Mecanismo de Ao Enzimtica, 382 10.3 Efeito Fisiolgico de Mudanas nos Valores de Km de Enzimas, 383 10.4 Labilidade Trmica da Glicose-6Fosfato Desidrogenase Resulta em Anemia Hemoltica, 386 10.5 Isoenzimas da lcool Desidrogenase com Diferentes pHs timos, 386 10.6 Inibidores de Xantina Oxidase Isolados de Plantas, 388 10.7 Planejamento de um Inibidor Seletivo, 390 10.8 Um Caso de Envenenamento, 393 10.9 Cogumelos e Metabolismo de lcool, 393 10.10 Um Caso de Gota Demonstra a Diferena entre um Stio Alostrico e um Stio de Ligao de Substrato, 394 10.11 Identicao e Tratamento de uma Decincia Enzimtica, 400 10.12 Ambigidade no Ensaio de Enzimas Mutadas, 401

11

CITOCROMOS P450 E XIDO NTRICO | SINTASES, 407


11.1 VISO GERAL, 408 11.2 CITOCROMOS P450: PROPRIEDADES E FUNO, 408 11.3 CICLO DE REAO DO CITOCROMO P450, 409 11.4 SISTEMAS DE TRANSPORTE DE ELTRONS DOS CITOCROMOS P450, 410 11.5 CITOCROMO P450: NOMENCLATURA E ISOFORMAS, 412 11.6 CITOCROMOS P450: SUBSTRATOS E FUNES FISIOLGICAS, 413 11.7 CITOCROMOS P450 PARTICIPAM DE SNTESE DE HORMNIOS ESTERIDES E DE OXIGENAO DE COMPOSTOS ENDGENOS, 414 11.8 INDUO E INIBIO DE CITOCROMO P450, 423 11.9 AS XIDO NTRICO SINTASES: PROPRIEDADES E FUNO, 425 11.10 ISOFORMAS DE XIDO NTRICO SINTASES E FUNES FISIOLGICAS 428 BIBLIOGRAFIA, 432 QUESTES E RESPOSTAS, 434

10

ENZIMAS: CLASSIFICAO, CINTICA E | CONTROLE, 358


10.1 VISO GERAL, 359 10.2 CLASSIFICAO DE ENZIMAS, 360 10.3 CONCEITOS GERAIS DE MECANISMOS ENZIMTICOS, 363 10.4 STIO ATIVO DE UMA ENZIMA, 368 10.5 COENZIMAS, CO-SUBSTRATOS E COFATORES, 371 10.6 CINTICA DE REAES QUMICAS, 376 10.7 CINTICA ENZIMTICA DE REAES DE UM SUBSTRATO, 379 10.8 CINTICA DE REAES DE DOIS SUBSTRATOS, 387 10.9 INIBIDORES, 388 10.10 REGULAO DE ATIVIDADE ENZIMTICA, 394 10.11 REGULAO DE VIAS METABLICAS, 398 10.12 APLICAES CLNICAS DE ENZIMAS, 399 BIBLIOGRAFIA, 404 QUESTES E RESPOSTAS, 404

BioQ.00 12

22.01.07 16:25:03

CONTEDO

XIII

CORRELAES CLNICAS 11.1 Hiperplasia Adrenal Congnita: Decincia de CYP21A2, 416 11.2 Produo de Hormnios Esterides Durante a Gestao, 418 11.3 Inibio de Citocromo P450: Interaes Droga-Droga e Efeitos Adversos, 420 11.4 Papel de CYP2E1 em Toxicidade Heptica Induzida por Acetaminofen, 422 11.5 Induo de Citocromo P450: Interaes Droga-Droga e Efeitos Adversos, 423 11.6 Polimorsmos Genticos das Enzimas P450, 426 11.7 Mecanismo de Ao de Sildenal, 430 11.8 Aspectos Clnicos da Produo de xido Ntrico, 431 11.9 Histria da Nitroglicerina, 432

13

FUNDAMENTOS DA TRANSDUO DE | SINAL, 483


13.1 VISO GERAL, 484 13.2 TRANSDUO DE SINAL INTERCELULAR, 485 13.3 RECEPTORES PARA MOLCULAS SECRETADAS, 487 13.4 TRANSDUO DE SINAL INTRACELULAR POR RECEPTORES DE SUPERFCIE CELULAR, 488 13.5 RECEPTORES CANAIS INICOS LIGANTEDEPENDENTES, 493 13.6 RECEPTORES LIGADOS A ENZIMAS, 496 13.7 RECEPTORES DE CITOCINAS, 500 13.8 RECEPTORES ACOPLADOS A PROTENA G, 500 13.9 TRANSDUO DE SINAL BASEADA EM AMP CCLICO, 506 13.10 TRANSDUO DE SINAL BASEADA EM GMP CCLICO, 509 13.11 TRANSDUO DE SINAL BASEADA EM CLCIO, 512 13.12 TRANSDUO DE SINAL BASEADA EM FOSFOLIPDEOS, 514 BIBLIOGRAFIA, 517 QUESTES E RESPOSTAS, 518 CORRELAES CLNICAS 13.1 Famlia de Receptores Tirosina Quinases ErbB/HER como Alvos para Quimioterapia do Cncer, 498 13.2 Receptores de Quimiocinas Acoplados a Protena G como Alvos para o Vrus da Imunodecincia Humana (HIV), 502 13.3 Mutaes em Protena G Gs em Tumores de Glndula Pituitria e Doenas Endcrinas, 504 13.4 Alteraes em Protenas Sinalizadoras de Receptor Adrenrgico em Insucincia Cardaca Congestiva, 507 13.5 Eixos Sinalizadores xido Ntrico/ cGMP como Alvos Teraputicos em Doenas Cardacas e Vasculares, 511

12

MEMBRANAS BIOLGICAS: ESTRUTURA E | TRANSPORTE EM MEMBRANAS, 436


12.1 VISO GERAL, 437 12.2 COMPOSIO QUMICA DE MEMBRANAS, 438 12.3 MICELAS, BICAMADAS LIPDICAS E LIPOSSOMOS, 445 12.4 ESTRUTURA DE MEMBRANAS BIOLGICAS, 447 12.5 MOVIMENTO DE MOLCULAS ATRAVS DE MEMBRANAS, 456 12.6 CANAIS DE MEMBRANAS, 458 12.7 TRANSPORTADORES DE MEMBRANA, 466 12.8 TRANSPORTE PASSIVO, 468 12.9 TRANSPORTE ATIVO, 469 12.10 IONFOROS, 478 BIBLIOGRAFIA, 479 QUESTES E RESPOSTAS, 480 CORRELAES CLNICAS 12.1 Lipossomos como Carregadores de Drogas e Enzimas, 447 12.2 Anomalias na Fluidez de Membranas Celulares em Doenas, 454 12.3 Fibrose Cstica e o Canal de Cl , 460 12.4 O Rim de Mamferos e Aquaporinas, 462 12.5 Doenas Envolvendo a Superfamlia de Transportadores ABC, 475 12.6 Doenas que se Devem Perda de Sistemas de Transporte de Membranas, 476

BioQ.00 13

22.01.07 16:25:03

XIV

CONTEDO

PARTE IV VIAS METABLICAS E SEU CONTROLE


14 E METABOLISMO | BIOENERGTICA OXIDATIVO, 521
14.1 SISTEMAS DE PRODUO E DE UTILIZAO DE ENERGIA, 522 14.2 RELAES TERMODINMICAS E COMPONENTES RICOS EM ENERGIA, 524 14.3 FONTES E DESTINOS DA ACETILCOENZIMA A, 529 14.4 CICLO DOS CIDOS TRICARBOXLICOS, 534 14.5 ESTRUTURA E COMPARTIMENTALIZAO POR MEMBRANAS MITOCONDRIAIS, 540 14.6 CADEIA DE TRANSPORTE DE ELTRONS, 542 14.7 FOSFORILAO OXIDATIVA, 553 14.8 MEMBRANA MITOCONDRIAL INTERNA CONTM SISTEMAS DE TRANSPORTE DE SUBSTRATO 559 14.9 GENES MITOCONDRIAIS E DOENAS, 563 14.10 ESPCIES REATIVAS DE OXIGNIO (ROS), 565 BIBLIOGRAFIA, 568 QUESTES E RESPOSTAS, 569 CORRELAES CLNICAS 14.1 Decincia de Piruvato Desidrogenase, 533 14.2 Decincia de Fumarase, 537 14.3 Envenenamento por Cianeto, 552 14.4 Neuropatia ptica Hereditria de Leber, 564 14.5 Miopatias Mitocondriais Devido a Mutaes em Genes de tRNA, 564 14.6 Intolerncia a Exerccio em Pacientes com Mutaes no Citocromo b, 565 14.7 Leso por Isquemia/Reperfuso, 567

15.6 GLICOGENLISE E GLICOGNESE, 609 BIBLIOGRAFIA, 623 QUESTES E RESPOSTAS, 623 CORRELAES CLNICAS 15.1 lcool e Barbituratos, 584 15.2 Envenenamento por Arsnico, 585 15.3 Intolerncia Frutose, 587 15.4 Diabetes Mellitus, 589 15.5 Acidose Lctica, 591 15.6 Picles de Porco e Hipertermia Maligna, 592 15.7 Angina Pectoris e Infarto do Miocrdio, 593 15.8 Decincia de Piruvato Quinase e Anemia Hemoltica, 598 15.9 Hipoglicemia e Crianas Prematuras, 599 15.10 Hipoglicemia e Intoxicao Alcolica, 608 15.11 Doenas de Armazenamento de Glicognio, 612

16

METABOLISMO DE CARBOIDRATOS II: VIAS ESPECIAIS E GLICOCONJUGADOS, 626


16.1 VISO GERAL, 627 16.2 VIA DAS PENTOSES FOSFATO, 627 16.3 INTERCONVERSES DE ACARES E FORMAO DE NUCLEOTDEOACAR, 631 16.4 BIOSSNTESE DE CARBOIDRATOS COMPLEXOS, 637 16.5 GLICOPROTENAS, 638 16.6 PROTEOGLICANOS, 642 BIBLIOGRAFIA, 647 QUESTES E RESPOSTAS, 647 CORRELAES CLNICAS 16.1 Glicose 6-Fosfato Desidrogenase: Decincia Gentica ou presena de Variantes Genticas em Eritrcitos, 629 16.2 Sndrome de Wernicke-Korsakoff: Decincia ou Presena de Variantes Genticos de Transcetolase, 629 16.3 Sndromes de Glicoprotenas Decientes em Carboidratos (CDGS), 632 16.4 Frutosria Essencial e Intolerncia Frutose: Decincia de Frutoquinase e de Frutose 1-Fosfato Aldolase, 633 16.5 Galactosemia: Incapacidade de Transformar Galactose em Glicose, 634

15

METABOLISMO DE CARBOIDRATOS I: PRINCIPAIS VIAS METABLICAS E SEU CONTROLE, 572


15.1 VISO GERAL, 573 15.2 GLICLISE, 574 15.3 VIA GLICOLTICA, 577 15.4 REGULAO DA GLICLISE, 584 15.5 GLUCONEOGNESE, 597

BioQ.00 14

22.01.07 16:25:04

CONTEDO

XV

16.6 Pentosria: Decincia de Xilitol Desidrogenase, 635 16.7 cido Glucurnico: Signicado Fisiolgico da Formao de Glucurondeos, 635 16.8 Substncias dos Grupos Sangneos, 638 16.9 Carboidrato Marcador Comum do Direcionamento Lisossomal e Doena da Clula I, 640 16.10 Aspartilglicosilaminria: Ausncia de 4-L-Aspartilglicosamina Amidohidrolase, 641 16.11 Doenas de Glicolipdeos, 642 16.12 Heparina um Anticoagulante, 643 16.13 Condrodistroas Devidas a Defeitos de Sulfatao, 645 16.14 Mucopolissacaridoses, 646

18

METABOLISMO DE LIPDEOS II: VIAS DO METABOLISMO DE LIPDEOS ESPECIAIS, 683


18.1 18.2 18.3 18.4 18.5 VISO GERAL, 684 FOSFOLIPDEOS, 684 COLESTEROL, 694 ESFINGOLIPDEOS, 706 PROSTAGLANDINAS E TROMBOXANES, 714 18.6 LIPOXIGENASE E CIDOS OXIEICOSATETRAENICOS, 718 BIBLIOGRAFIA, 721 QUESTES E RESPOSTAS, 722 CORRELAES CLNICAS 18.1 Sndrome do Desconforto Respiratrio, 687 18.2 Tratamento da Hipercolesterolemia, 703 18.3 Aterosclerose, 704 18.4 Diagnstico da Doena de Gaucher em um Adulto, 713

17

METABOLISMO DE LIPDEOS I: SNTESE, ARMAZENAMENTO E UTILIZAO DE CIDOS GRAXOS E TRIACILGLICERIS, 650


17.1 VISO GERAL, 651 17.2 NATUREZA QUMICA DE CIDOS GRAXOS E ACILGLICERIS, 652 17.3 TRANSPORTE INTERRGOS DE CIDOS GRAXOS E SEUS PRODUTOS PRIMRIOS, 656 17.4 SNTESE DE CIDOS GRAXOS: LIPOGNESE, 657 17.5 ARMAZENAMENTO DE CIDOS GRAXOS COMO TRIACILGLICERIS, 665 17.6 UTILIZAO DE CIDOS GRAXOS PARA PRODUO DE ENERGIA, 667 17.7 REGULAO DO METABOLISMO DE LIPDEOS, 679 BIBLIOGRAFIA, 680 QUESTES E RESPOSTAS, 681 CORRELAES CLNICAS 17.1 Obesidade, 654 17.2 Papel do Metabolismo de cidos Graxos em Diabetes Tipo 2, 655 17.3 Ciclo Triacilglicerol/cido Graxo, 668 17.4 Decincias Genticas no Transporte por Carnitina ou na Carnitina Palmitoil Transferase, 670 17.5 Decincias Genticas das Acil-CoA Desidrogenases, 672 17.6 Doena de Refsum, 675 17.7 Corpos Cetnicos como Combustveis: A Dieta Atkins, 677

19 | METABOLISMO DE AMINOCIDOS, 725


19.1 VISO GERAL, 726 19.2 INCORPORAO DE NITROGNIO EM AMINOCIDOS, 727 19.3 TRANSPORTE DE NITROGNIO PARA FGADO E RIM, 732 19.4 CICLO DA URIA, 733 19.5 SNTESE E DEGRADAO DE AMINOCIDOS INDIVIDUAIS, 736 BIBLIOGRAFIA, 766 QUESTES E RESPOSTAS, 767 CORRELAES CLNICAS 19.1 Decincias de Carbamoil Fosfato Sintetase e N-Acetilglutamato Sintetase, 736 19.2 Decincias de Enzimas do Ciclo da Uria, 738 19.3 Doenas do Metabolismo de Prolina, 739 19.4 Selenoprotenas, 740 19.5 Hiperglicinemia No-Cettica, 741 19.6 Decincia de cido Flico, 743 19.7 Fenilcetonria, 745 19.8 Doenas do Metabolismo de Tirosina, 747 19.9 Mal de Parkinson, 748 19.10 Hiper-homocisteinemia e Aterognese, 751 19.11 Doenas de Aminocidos que Contm Enxofre, 752 19.12 Acidria Glutrica, 756 19.13 Esquizofrenia e Outras Doenas Associadas a Neurotransmissores Derivados de Triptofano, 757

BioQ.00 15

22.01.07 16:25:04

XVI

CONTEDO

19.14 Doenas do Metabolismo de Aminocidos de Cadeia Ramicada, 757 19.15 Doenas do Metabolismo de Propionato e Metilmalonato, 760 19.16 Doenas Envolvendo Lisina e Ornitina, 762 19.17 Histidinemia, 762 19.18 Doenas do Metabolismo de Folato, 764

21

METABOLISMO DO HEME E DO FERRO, | 803


21.1 METABOLISMO DO FERRO: VISO GERAL, 804 21.2 PROTENAS QUE CONTM FERRO, 804 21.3 ABSORO INTESTINAL DE FERRO, 807 21.4 REGULAO MOLECULAR DA UTILIZAO DE FERRO, 808 21.5 DISTRIBUIO E CINTICA DO FERRO, 811 21.6 BIOSSNTESE DE HEME, 813 21.7 CATABOLISMO DE HEME, 821 BIBLIOGRAFIA, 826 QUESTES E RESPOSTAS, 827 CORRELAES CLNICAS 21.1 Sobrecarga de Ferro e Infeco, 805 21.2 Patogenicidade Microbiana e Ferro, 805 21.3 Sntese do Grupo Ferro-Enxofre e Doena Humana, 807 21.4 Ataxia de Friedreich, 807 21.5 Absoro Duodenal de Ferro, 809 21.6 Elementos de Resposta ao Ferro Mutante, 811 21.7 Decincia de Ceruloplasmina, 812 21.8 Anemia por Decincia de Ferro, 812 21.9 Hemocromatose Tipo I: Gentica Molecular e a Questo das Dietas Enriquecidas em Ferro, 814 21.10 Hemocromatose Tipo III, 814 21.11 Porria Intermitente Aguda, 817 21.12 Papel Citoprotetor de Heme Oxigenase, 822 21.13 Hemlise Isoimune Neonatal, 824 21.14 Decincia de Bilirrubina UDPGlucuronosiltransferase, 824 21.15 Elevao de Bilirrubina Conjugada no Soro, 825

20

DE PURINA E PIRIMIDINA | METABOLISMO NUCLEOTDEOS, 770


20.1 VISO GERAL, 771 20.2 FUNES METABLICAS DOS NUCLEOTDEOS, 771 20.3 METABOLISMO DE PURINA NUCLEOTDEOS, 772 20.4 METABOLISMO DE PIRIMIDINA NUCLEOTDEOS, 783 20.5 FORMAO DE DESOXIRRIBONUCLEOTDEOS, 786 20.6 NUCLEOSDEO E NUCLEOTDEO QUINASES, 789 20.7 ENZIMAS QUE METABOLIZAM NUCLEOTDEOS COM UMA FUNO EM CICLO CELULAR E TAXA DE DIVISO CELULAR, 790 20.8 SNTESE DE COENZIMAS NUCLEOTDEOS, 791 20.9 SNTESE E UTILIZAO DE 5-FOSFORRIBOSIL-1-PIROFOSFATO, 791 20.10 AGENTES QUIMIOTERPICOS QUE INTERFEREM COM METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTDEOS, 793 BIBLIOGRAFIA, 799 QUESTES E RESPOSTAS, 800 CORRELAES CLNICAS 20.1 Gota, 777 20.2 Sndrome de Lesch-Nyhan, 779 20.3 Atividade Aumentada da 5Nucleotidase Citoslica, 781 20.4 Doenas com Imunodecincias Associadas com Defeitos na Degradao de Purina Nucleosdeos, 782 20.5 Pacientes com Cncer em Tratamento por Radiaes ou Quimioterapia, 783 20.6 Subclasses de Pacientes com Autismo, 783 20.7 Acidria Ortica Hereditria, 785

22 | INTER-RELAES METABLICAS, 829


22.1 VISO GERAL, 830 22.2 CICLO JEJUM-ALIMENTAO, 830 22.3 MECANISMOS ENVOLVIDOS NA MUDANA DO METABOLISMO HEPTICO ENTRE OS ESTADOS BEMALIMENTADO E DE JEJUM, 843 22.4 INTER-RELAES METABLICAS DE TECIDOS EM VRIOS ESTADOS NUTRICIONAIS E HORMONAIS, 852 BIBLIOGRAFIA, 866 QUESTES E RESPOSTAS, 868

BioQ.00 16

22.01.07 16:25:05

CONTEDO

XVII

CORRELAES CLNICAS 22.1 Obesidade, 831 22.2 Subnutrio Protica, 832 22.3 Jejum, 833 22.4 Sndrome de Reye, 837 22.5 Coma Hiperglicmico, Hiperosmolar, 841 22.6 Hiperglicemia e Glicao de Protenas, 841 22.7 Diabetes Mellitus Tipo 2, 855 22.8 Diabetes Mellitus Tipo 1, 857 22.9 Via do Poliol e Complicaes do Diabetes, 857 22.10 Caquexia do Cncer, 858

24

BIOLOGIA MOLECULAR DAS CLULAS, | 925


24.1 VISO GERAL, 926 24.2 TECIDO NERVOSO: METABOLISMO E FUNO, 926 24.3 OLHO: METABOLISMO E VISO, 938 24.4 MOTORES MOLECULARES E PROTENAS ASSOCIADAS, 952 24.5 MECANISMO DA COAGULAO DO SANGUE, 967 BIBLIOGRAFIA, 983 QUESTES E RESPOSTAS, 984 CORRELAES CLNICAS 24.1 Sndrome Miastnica de LambertEaton, 933 24.2 Miastenia Gravis: Uma Doena Neuromuscular, 935 24.3 Degenerao da Mcula e Perda de Viso, 942 24.4 Doena de Niemann-Pick e Retinite Pigmentosa, 942 24.5 Retinite Pigmentosa por Mutao do Gene da Periferina, 944 24.6 Amaurose Congnita de Leber: Distroa da Retina Levando a Cegueira, 949 24.7 Glicao e Estrutura e Funo de Miosina, 956 24.8 Cardiomiopatias Hipertrcas Familiares e Mutaes em Protenas Musculares, 957 24.9 Cardiomiopatia Dilatada e Mutaes em Actina, 958 24.10 Subunidades da Troponina como Marcadores de Infarto do Miocrdio, 961 24.11 Canelopatias de ons VoltagemDependentes, 962 24.12 Canais Inicos e Doena do Msculo Cardaco, 962 24.13 Mutaes Afetando Pigmentao: Existe uma Conexo com Motor Molecular?, 965 24.14 Defeitos da Via Intrnseca: Decincia de Pr-calicrena, 970 24.15 Hemolia Clssica, 974 24.16 Uso de Fator VIIa Recombinante para Controlar Sangramento, 975 24.17 Trombose: Defeitos na Via da Protena C e Nveis Aumentados de Fatores da Coagulao, 979

PARTE V

PROCESSOS FISIOLGICOS

23 | BIOQUMICA DE HORMNIOS, 870


23.1 VISO GERAL, 871 23.2 HORMNIOS E O SISTEMA DE CASCATA HORMONAL, 872 23.3 SNTESE DE HORMNIOS POLIPEPTDICOS E HORMNIOS DERIVADOS DE AMINOCIDOS, 875 23.4 PROTENAS DE SINALIZAO HORMONAL, 883 23.5 RECEPTORES DE HORMNIOS DE MEMBRANA, 891 23.6 CASCATA HORMONAL INTRACELULAR: PROTENAS QUINASES, 894 23.7 HORMNIOS ESTERIDES, 902 23.8 RECEPTORES DE HORMNIOS ESTERIDES, 914 BIBLIOGRAFIA, 921 QUESTES E RESPOSTAS, 922 CORRELAES CLNICAS 23.1 Testando a Atividade da Pituitria Anterior, 875 23.2 Hipopituitarismo, 879 23.3 Atividade Reduzida do Receptor de Insulina Quinase no Diabetes Mellitus Gestacional, 897 23.4 Contracepo Oral, 913 23.5 Sndrome do Excesso Aparente de Mineralocorticide, 917 23.6 Mutao no Receptor de Mineralocorticide Resulta em Hipertenso e Toxemia da Gravidez, 919

BioQ.00 17

22.01.07 16:25:05

XVIII
25

CONTEDO

CELULAR, MORTE CELULAR | CICLO PROGRAMADA E CNCER, 987


25.1 VISO GERAL, 988 25.2 CICLO CELULAR, 988 25.3 APOPTOSE: MORTE CELULAR PROGRAMADA, 993 25.4 CNCER, 997 BIBLIOGRAFIA, 1005 QUESTES E RESPOSTAS, 1007 CORRELAES CLNICAS 25.1 Vrus Oncognicos de DNA, 999 25.2 Droga Anti-Cncer Molecularmente Dirigida, 1002 25.3 Causa Ambiental de Cnceres Humanos, 1003

27

DE NUTRIO I: | PRINCPIO MACRONUTRIENTES, 1043


27.1 27.2 27.3 27.4 VISO GERAL, 1044 METABOLISMO ENERGTICO, 1044 METABOLISMO DE PROTENAS, 1045 DESNUTRIO PROTICO-ENERGTICA, 1048 27.5 EXCESSIVA INGESTO PROTICOENERGTICA, 1050 27.6 CARBOIDRATOS, 1051 27.7 GORDURAS, 1051 27.8 FIBRAS, 1052 27.9 COMPOSIO DOS MACRONUTRIENTES DA DIETA, 1054 BIBLIOGRAFIA, 1059 QUESTES E RESPOSTAS, 1060 CORRELAES CLNICAS 27.1 Dietas Vegetarianas e Necessidades Protico-Energticas para Crianas, 1047 27.2 Ingesto de Protenas na Dieta e Doena Renal, 1048 27.3 Oferecendo Protenas e Calorias Adequadas a Pacientes Hospitalizados, 1049 27.4 Carga de Carboidratos e Resistncia Atltica, 1052 27.5 Dietas Ricas em Carboidratos Versus Dietas Ricas em Gorduras para Diabticos, 1053 27.6 cidos Graxos Poliinsaturados e Fatores de Risco para Doena Cardaca, 1055 27.7 Adaptao Metablica: Relao entre Ingesto de Carboidratos e Triacilgliceris no Soro, 1059

26

DIGESTO E ABSORO DE CONSTITUINTES NUTRICIONAIS BSICOS, 1009


26.1 26.2 26.3 26.4 VISO GERAL, 1010 CONSIDERAES GERAIS, 1012 TRANSPORTE EPITELIAL, 1016 DIGESTO E ABSORO DE PROTENAS, 1024 26.5 DIGESTO E ABSORO DE CARBOIDRATOS, 1028 26.6 DIGESTO E ABSORO DE LIPDEOS, 1031 26.7 METABOLISMO DE CIDOS BILIARES, 1037 BIBLIOGRAFIA, 1040 QUESTES E RESPOSTAS, 1040 CORRELAES CLNICAS 26.1 Cloridorria Familiar Causa Alcalose Metablica, 1017 26.2 Fibrose Cstica, 1020 26.3 Diarrias Toxignicas Bacterianas e Terapia de Reposio de Eletrlitos, 1021 26.4 Aminoacidria Neutra: Doena de Hartnup, 1026 26.5 Decincia de Dissacaridases, 1030 26.6 Intervenes Farmacolgicas para Evitar Absoro de Gordura e Obesidade, 1033 26.7 Clculos de Colesterol, 1036 26.8 A- -Lipoproteinemia, 1038

28

DE NUTRIO II: | PRINCPIO MICRONUTRIENTES, 1063


28.1 VISO GERAL, 1064 28.2 AVALIAO DE M NUTRIO, 1064 28.3 INGESTO DIETTICAS DE REFERNCIAS, 1064 28.4 VITAMINAS LIPOSSOLVEIS, 1066 28.5 VITAMINAS HIDROSSOLVEIS, 1073 28.6 VITAMINAS HIDROSSOLVEIS LIBERADORAS DE ENERGIA, 1074 28.7 VITAMINAS HIDROSSOLVEIS HEMATOPOITICAS, 1079 28.8 OUTRAS VITAMINAS HIDROSSOLVEIS, 1082 28.9 MACROMINERAIS, 1084 28.10 MINERAIS TRAOS, 1084

BioQ.00 18

22.01.07 16:25:05

CONTEDO

XIX

28.11 DIETA AMERICANA: FATO E FALCIA, 1087 28.12 AVALIAO DO ESTADO NUTRICIONAL NA PRTICA CLNICA, 1087 BIBLIOGRAFIA, 1089 QUESTES E RESPOSTAS, 1091 CORRELAES CLNICAS 28.1 Consideraes Nutricionais na Fibrose Cstica, 1068 28.2 Osteodistroa Renal, 1069 28.3 Consideraes Nutricionais em Recm-Nascidos, 1073 28.4 Drogas Anticonvulsivantes e Necessidades Vitamnicas, 1074

28.5 Consideraes Nutricionais em Alcolatras, 1076 28.6 Necessidades de Vitamina B6 em Usurios de Contraceptivos Orais, 1078 28.7 Polimorrmos Genticos e Necessidades de cido Flico, 1081 28.8 Dieta e Osteoporose, 1085 28.9 Necessidades Nutricionais de Idosos, 1089

APNDICE REVISO DE QUMICA ORGNICA, 1094 GLOSSRIO, 1107 NDICE, 1134

BioQ.00 19

22.01.07 16:25:06

CAPTULO 1 ESTRUTURA DA CLULA EUCARITICA

PARTE 1 ESTRUTURAS DE MACROMOLCULAS

H
+

104.5o

H
+

ESTRUTURA DA CLULA EUCARITICA


Thomas M. Devlin

1.1

VISO GERAL: CLULAS E COMPARTIMENTOS CELULARES, 2

1.2 GUA, pH E SOLUTOS: O AMBIENTE AQUOSO DAS CLULAS, 3 Pontes de hidrognio formam-se entre molculas de gua, 3 gua tem propriedades singulares como solvente, 4 Algumas molculas dissociam-se formando ctions e nions, 5 gua um eletrlito fraco, 6 Muitas molculas biologicamente importantes so cidos ou bases fracos, 6 cido carbnico, 7 Equao de Henderson-Hasselbalch dene a relao entre pH e concentraes de cido e base conjugados, 8 Tamponamento importante para controlar o pH, 9 1.3 COMPOSIO DE CLULAS EUCARITICAS: PAPIS FUNCIONAIS DE ORGANELAS SUBCELULARES E SISTEMAS DE MEMBRANAS, 11 Composio qumica geral das clulas, 12 Papel funcional de organelas subcelulares e sistemas de membranas, 13 Membrana Plasmtica a fronteira de uma clula, 13 Ncleo local de sntese de DNA e RNA, 13

Retculo endoplasmtico participa da sntese protica e de muitas vias de sntese, 13 Complexo de Golgi est envolvido na secreo de protenas, 14 Mitocndria fornece a maior parte do ATP de que a clula necessita, 14 Lisossomos so necessrios para digesto intracelular, 15 Peroxissomos desempenham papel importante no metabolismo de lipdeos, 17 Citoesqueleto organiza o contedo intracelular, 18 Citosol contm componentes celulares solveis, 18 1.4 INTEGRAO E CONTROLE DAS FUNES CELULARES, 19 BIBLIOGRAFIA, 20 QUESTES E RESPOSTAS, 20 CORRELAES CLNICAS 1.1 Concentrao Sangnea de Bicarbonato na Acidose Metablica, 10 1.2 Doenas Mitocondriais, 15 1.3 Enzimas Lisossomais e Gota, 16 1.4 Decincia de Lipase cida Lisossomal, 18 1.5 Doenas da Biognese de Peroxissomos (PBDs), 19

BioQ.01 1

22.01.07 16:09:40

1.3 COMPOSIO DE CLULAS EUCARITICAS: PAPIS FUNCIONAIS DE ORGANELAS SUBCELULARES E SISTEMAS DE MEMBRANAS
Clulas eucariticas contm organelas celulares bem denidas, como ncleo, mitocndrias, lisossomos e peroxissomos, todos delimitados por uma membrana (Figura 1.9). Membranas formam uma rede tubular por toda a clula, o retculo endoplasmtico e o complexo de Golgi, englobando um espao interconectado ou cisternas, respectivamente. A natureza lipdeo-protena das membranas celulares (ver p. 455) impede rpido movimento de muitas molculas, incluindo gua, de um compartimento para outro. Mecanismos especcos para deslocamento de molculas pequenas e grandes, carregadas ou no-carregadas, permitem que as vrias membranas modulem concentraes de substncias em seus compartimentos. Citosol e compartimento uido de organelas tm composio distinta em ons inorgnicos, molculas orgnicas, protenas e cidos nuclicos.

CAPTULO 1 ESTRUTURA DA CLULA EUCARITICA

11

Partio de atividades e componentes em espaos delimitados por membranas tem muitas vantagens para a economia da clula, incluindo (a) seqestro de substratos, cofatores e enzimas para maior ecincia metablica e (b) ajuste de pH e composio inica para mxima atividade de processos biolgicos. As atividades e a composio de estruturas e organeER las celulares so determinadas em clulas intactas por mtodos histoqumicos, imunolgicos Pe de colorao uorescente. Observaes contnuas em tempo real de eventos celulares em clulas intactas viveis so possveis. Por exemplo, mudanas de pH e de concentrao M de on clcio podem ser estudadas no citosol pelo uso de indicadores on-especcos. Organelas individuais, ER membranas e componentes do citosol podem ser isolaG analisados aps rompimento da membrana plasdos e Ly mtica. Tcnicas para romper membranas Ncleo incluem uso de detergentes, choque osmtico ou homogeneizao de tecidos, onde o atrito quebra a membrana plasmtica. Em meios de isolamento apropriados, organelas celulaNuclolo res e sistemas de membranas podem ser separados por centrifugao, graas a diferenas em tamanho e densidade. Essas tcnicas permitiram isolamento de fraes celulares da maioria dos tecidos de mamferos. Alm M disso, componentes de organelas, como mitocndrias e peroxissomos, podem ser isolados aps rompimento da membrana da organela. Pelo uso dessas vrias tcnicas, as atividades e as funes dos vrios compartimentos (a) celulares foram estudadas.
Membrana nuclear Ncleo Nuclolo

Centrolos Complexo de Golgi

ER P

Cromatina

Ribossomos livres Retculo endoplasmtico

Vacolo

ER G Ly Ncleo (b) Lisossomos

Mitocndria Membrana celular

Nuclolo

(a)

FIGURA 1.9 (a) Micrograa eletrnica de uma clula de fgado de rato, marcada para indicar os principais componentes estruturais de clulas eucariticas e (b) desenho esquemtico de uma clula animal. Note o nmero e a variedade de organelas subcelulares e a rede de membranas interconectadas que delimitam canais ou cisternas. Nem todas as clulas eucariticas so to complexas em sua aparncia, mas a maioria contm as principais estruturas mostradas. ER, retculo endoplasmtico; G, zona do Golgi; Ly, lisossomo; P, peroxissomo; M, mitocndria. Fotograa (a) reimpressa com permisso de Dr. K. R. Porter de Porter, K. R., e Bonneville, M. A. Em: Fine Structure of Cells and Tissues. Philadelphia: Lea & Febiger, 1972; esquema (b) reimpresso com permisso de Voet, D., e Voet, J. G. Biochemistry, 2 ed., New York, Wiley, 1995. (1995) John Wiley & Sons, Inc.

Membrana nuclear
BioQ.01 11

Centrolos Complexo
22.01.07 16:09:57

Ncleo

CAPTULO 1 ESTRUTURA DA CLULA EUCARITICA

15

pendncia mtua. Estima-se que esse evento possa ter ocorrido h cerca de trs bilhes de anos. A herana mitocondrial ocorre por transmisso materna e tem sido possvel estudar o movimento global humano por avaliao das variaes em mtDNA. Mitocndrias tambm tm os RNAs (ver p. 66) e enzimas necessrias para catalisar a sntese de algumas protenas. A maioria das protenas mitocondriais, entretanto, derivaram de genes presentes no DNA nuclear e so sintetizadas em ribossomos livres no citosol, depois importadas para a organela. H vrias centenas de doenas genticas de atividades mitocondriais; algumas resultam de mutaes no DNA nuclear que codica protenas mitocondriais, enquanto outras resultam de mutaes no DNA mitocondrial (ver Corr. Cln. 1.2).

Lisossomos So Necessrios para Digesto Intracelular


Lisossomos so responsveis pela digesto intracelular de substncias extracelulares e intracelulares. Com uma nica membrana delimitante, mantm uma matriz com pH cido de cerca de 5. Encapsulada nessas organelas est uma classe de enzimas glicoproticas hidrolases que catalisam clivagem hidroltica de ligaes carbono-oxignio, carbono-nitrognio, carbo-

no-enxofre e oxignio-fsforo em protenas, lipdeos, carboidratos e cidos nuclicos. Uma lista parcial das enzimas lisossomais apresentada na Tabela 1.7. Hidrolases lisossomais so mais ativas em pHs cidos e quebram molculas complexas em compostos simples de baixo peso molecular que podem ser reutilizados. A relao entre pH e atividade enzimtica discutida na p. 368. O contedo enzimtico dos lisossomos varia em diferentes tecidos e depende das funes especcas do tecido. A membrana lisossomal contm mediadores e receptores proticos especcos, bem como transportadores para deslocamento de substncias atravs dela. Lisossomos isolados s catalisam hidrlise de substratos adicionados quando a membrana lisossomal rompida. Rompimento da membrana em clulas leva digesto celular. Vrias condies patolgicas tm sido atribudas liberao de enzimas lisossomais, incluindo artrite, respostas alrgicas, vrias doenas musculares e destruio tecidual induzida por drogas (ver Corr. Cln. 1.3).

CORRELAO CLNICA 1.2

Doenas Mitocondriais
A primeira doena (doena de Luft) envolvendo especicamente transduo de energia mitocondrial foi relatada em 1962. Uma paciente de 30 anos de idade apresentava fraqueza generalizada, transpirao excessiva, alta ingesta calrica sem ganho de peso e taxa de metabolismo basal muito elevada (uma medida da utilizao de oxignio). Ela tinha um defeito no mecanismo que controla a utilizao de oxignio pela mitocndria (ver Captulo 14). Desde ento, vrias centenas de anomalias genticas foram identicadas que levam a alteraes em enzimas, cidos ribonuclicos, componentes do transporte de eltrons e sistemas de transporte de membranas mitocondriais. Mutaes no mtDNA bem como no DNA nuclear levam a doenas genticas mitocondriais. A primeira doena identicada que se deve a uma mutao no mtDNA foi Neuropatia ptica Hereditria de Leber, que leva a cegueira sbita no incio da idade adulta. Muitas doenas mitocondriais envolvem msculo esqueltico e sistema nervoso central. Leses no DNA mitocondrial podem ocorrer, devido a radicais livres (superxidos) formados nas mitocndrias. Anomalias nas mitocndrias tm sido implicadas na patosiologia de esquisofrenia, doena bipolar e doenas degenerativas relacionadas com idade, como a doena de Parkinson, de Alzheimer e cardiomiopatias. Recentemente, sugeriu-se que uma nica mutao em um tRNA mitocondrial levaria a uma constelao de sintomas, incluindo hipertenso, colesterol elevado no sangue e nveis baixos de Mg 2+ no plasma. Ver as seguintes Correlaes Clnicas para detalhes de doenas mitocondriais: 6.5, p. 217; 14.4, p. 564; 14.5, p. 564; 14.6, p. 565; e 14.7, p. 567.

Fonte: Luft, R. The development of mitochondrial medicine. Proc. Natl. Acad. Sci. USA 91:8731, 1994; Chalmers, R.M. e Schapira, A.H.V. Clinical, biochemical and molecular genetic features of Lebers hereditary optic neuropathy. Biochim. Biophys. Acta 1410:147, 1999; Wallace, D.C. Mitochondrial DNA in aging and disease. Sci. Am. 280:40, 1997; e Wallace, D.C. Mitochondrial diseases in man and mouse. Science 283:1482, 1999.

BioQ.01 15

22.01.07 16:10:00

CAPTULO 1 ESTRUTURA DA CLULA EUCARITICA

19

CORRELAO CLNICA 1.5

Doenas de Biognese de Peroxissomos (PBDs)


Peroxissomos so responsveis por vrias reaes metablicas importantes, incluindo sntese de glicerol teres, encurtamento de cidos graxos de cadeia muito longa para que as mitocndrias possam oxid-los completamente, e oxidao da cadeia lateral do colesterol necessria sntese de cidos biliares. Doenas de biognese de peroxissomos (PBDs) compreendem mais de 25 doenas gentica e fenotipicamente relacionadas que envolvem atividades enzimticas de peroxissomos. So doenas autossmicas recessivas raras que se caracterizam por nveis diminudos de lipdeos glicerol-teres (plasmalognios), nveis aumentados de cidos graxos de cadeias muito longas (C24 e C26) e de derivados do cido colestanico (precursores de cidos biliares). As doenas podem afetar fgado, rim, crebro e sistema esqueltico. A mais grave sndrome de Zellweger, que se deve ausncia de peroxissomos funcionais; morte freqentemente ocorre por volta dos 6 meses de idade. Nessa condio, o defeito gentico est no mecanismo para importar enzimas para a matriz dos peroxissomos. Algumas condies PBD so causadas por mutaes de splice doador ou de sentido errado (missense) (ver p. 158); em algumas, h ausncia de uma nica enzima metablica ou defeito em um componente do transporte de membranas. Em alguns casos, a doena pode ser diagnosticada antes do nascimento por ensaio de enzimas de peroxissomos ou de cidos graxos em clulas do lquido amnitico.

Fonte: Wanders, R. J., Schutgens, R. B., e Barth, P. G. Peroxissomal disorders: A review. J. Neuropathol. Exp. Neurol. 54: 726, 1995; FitzPatrick, D. R., Zellweger syndrome and associated phenotypes. J. Med. Genet. 33:863, 1996; e Warren, D.S., Wolfe, B. D. e Gould, S. J. Phenotype-genotype relationships in PEX10-decient peroxisome biogenesis disorder patients. Hum. Mutat. 15:509, 2000.

1.4 INTEGRAO E CONTROLE DAS FUNES CELULARES


Uma clula eucaritica uma estrutura complexa que mantm um ambiente intracelular que permite que muitas reaes complexas e funes ocorram com a mxima ecincia possvel. Clulas de organismos multicelulares tambm participam da manuteno do bemestar de todo o organismo, exercendo inuncias umas sobre as outras para manter equilbrio entre atividades tissulares e celulares. Processos intracelulares e vias metablicas so muito bem controlados e integrados para conseguir esse equilbrio. Pouqussimas funes operam de modo totalmente independente; mudanas em uma funo podem exercer uma inuncia, positiva ou negativa, sobre outras funes. Como ser descrito ao longo deste livro, controles de funo so mediados em muitos nveis, desde a expresso de um gene para alterar a concentrao de uma enzima ou protena efetora, at mudanas em nveis de substrato ou coenzima para ajustar a velocidade de uma reao enzimtica especca. A integrao de muitos processos celulares controlada por protenas que funcionam como ativadores ou inibidores, que mantm homeostase celular. Muitos processos celulares so programados para ocorrerem em condies especcas; por exemplo, diviso

celular em clulas normais s ocorre quando os processos necessrios diviso celular so ativados (ver p. 989). Ento, e somente ento, ocorre uma srie de reaes ordenadas e integradas, culminando na diviso de uma clula em duas clulas lhas. Um processo fascinante apoptose, morte celular programada, tambm chamada suicdio celular (ver p. 993). Esse processo cuidadosamente regulado ocorre em clulas de todos os tecidos de mamferos, mas etapas individuais do processo variam de tecido para tecido. Muitas doenas devem-se a erro em mecanismos especcos de controle. medida que algum amplia sua compreenso da complexidade de clulas biolgicas, esse algum ca admirado de que no ocorram muito mais erros e de que no existam muito mais indivduos com condies anormais. Assim, medida que prosseguimos para o estudo de componentes qumicos separados e atividades de clulas em captulos subseqentes, importante no esquecer as atividades concomitantes e vizinhas, limitaes e inuncia do ambiente. S conciliando todas as partes e atividades de uma clula isto , montando o quebra-cabea que apreciaremos a maravilha das clulas vivas.

BioQ.01 19

22.01.07 16:10:03

CAPTULO 2 DNA E RNA: COMPOSIO E ESTRUTURA

23

PARTE 1 ESTRUTURAS DE MACROMOLCULAS

DNA E RNA: COMPOSIO E ESTRUTURA


Stephen A. Woski e Francis J. Schmidt

2.1 VISO GERAL, 24 Dogma central da biologia molecular, 24 DNA pode transformar clulas, 24 Capacidade de informao do DNA enorme, 25 2.2 COMPONENTES ESTRUTURAIS DOS CIDOS NUCLICOS: NUCLEOBASES, NUCLEOSDEOS E NUCLEOTDEOS, 26 Propriedades fsicas de nucleosdeos e nucleotdeos, 26 Propriedades estruturais de nucleosdeos e nucleotdeos, 27 2.3 ESTRUTURA DO DNA, 28 Estrutura polinucleotdica, 28 Conformaes dos polinucleotdeos, 29 Estabilidade do Esqueleto polinucleotdico, 30 DNA dupla-hlice, 31 Fatores que estabilizam DNA dupla-hlice, 34 Desnaturao e renaturao, 35 Hibridizao, 36 Conformaes do DNA dupla-hlice, 39 Estruturas no-cannicas de DNA, 40 DNA dobrado, 41 DNA cruciforme, 41 DNA tripla-ta, 43 DNA quatro-tas, 44 DNA deslocado, 46 2.4 ORDEM SUPERIOR DA ESTRUTURA DO DNA, 47 DNA genmico pode ser linear ou circular, 47 DNA super-hlice, 49 Topoisomerases, 50

Empacotamento do DNA procaritico, 51 Organizao da cromatina eucaritica, 54 Nucleossomos e polinucleossomos, 55 Empacotamento de polinucleossomos em estruturas superiores, 56 2.5 SEQNCIA E FUNO DO DNA, 57 Endonucleases de restrio e palndromes, 57 A maior parte do DNA procaritico codica protenas especcas, 58 Apenas uma pequena percentagem do DNA eucaritico consisde de genes funcionais, 59 Seqncias repetidas, 60 2.6 ESTRUTURA DO RNA, 61 RNA um polmero de ribonucleosdeos 5-mono fosfato, 61 Estrutura secundria do RNA envolve pareamento de bases intramolecular, 61 Molculas de RNA tm estruturas tercirias, 62 2.7 TIPOS DE RNA, 64 RNA transportador tem duas funes: ativar aminocidos e reconhecer cdons no mRNA, 64 RNA ribossmico parte do aparelho de sntese protica, 65 RNAs mensageiros carregam a informao para a estrutura primria de protenas, 66 Mitocndrias contm espcies peculiares de RNA, 66 RNA em partculas ribonucleoproticas, 67 RNA cataltico: ribozimas, 67 RNAs podem ligar outras molculas, 68 RNAs controlam traduo, 69

BioQ.02 23

22.01.07 16:20:49

28

PARTE 1 ESTRUTURA DE MACROMOLCULAS


H H O
6

os tomos de carbono desse arranjo lembram a letra S; por isso, essa conformao s vezes chamada conformao-Sul. Na segunda toro comum, C3 deslocada em direo face endo e chamada C3- endo. Os carbonos da pentose desenham uma letra N, produzindo a conformao-Norte. notvel que os grupos ligados ao acar quem em orientaes muito diferentes em cada uma dessas conformaes. Por exemplo, grupos 5- e 3-fosfatos cam muito mais afastados na toro C2- endo do que na C3- endo. A orientao da ligao glicosdica tambm muda signicativamente nas duas conformaes. Conformaes C2- endo e C3- endo esto em rpido equilbrio. Um substituinte eletronegativo na posio 2 da pentose favorece a conformao C3- endo. Portanto, ribonucleosdeos em RNA preferem essa toro do acar. Fatores adicionais como pontes de hidrognio entre o grupo 2-OH e o tomo O4 do resduo vizinho deslocam o equilbrio para a conformao C3- endo. Entretanto, os 2-desoxinucleosdeos do DNA contm um hidrognio em lugar do grupo 2-OH, e a conformao C2- endo preferida. As bases em nucleosdeos so planas. Embora rotao livre em torno da ligao glicosdica seja possvel, duas orientaes da base em relao ao acar predominam (Figura 2.7). Em purinas, a conformao anti coloca H8 sobre o acar, enquanto a conformao syn posiciona esse tomo longe do acar e a maior parte da purina bicclica sobre o acar. Em pirimidinas, o tomo H6 ca acima do anel de pentose na conformao anti, e o tomo O2, maior, ca acima do anel na conformao glicosdica syn. Pirimidinas, portanto, mostram uma grande preferncia pela conformao com menos impedimento estrico anti. Purinas rapidamente se interconvertem entre as duas conformaes, mas favorecem a orientao anti. Contudo, guanina 5-nucleotdeos so excees. Nesses casos, interaes favorveis entre o grupo 2-NH2 e o grupo 5-fosfato estabilizam a conformao syn. 2-Desoxiguanosina 5-monofosfato (dGMP), por exemplo, prefere a conformao glicosP O O base

NH2 N N O O O
2

N HO N

NH2 H H

HO

OH anti

OH syn H O N N N H NH2 H 2N N HO O N N N O N H

H HO O

HO

OH anti

HO

OH

syn

FIGURA 2.7 Conformaes glicosdicas de purinas e pirimidinas. Em pirimidinas, fatores estricos entre o acar e O2 da base desfavorecem fortemente a conformao syn. Em purinas, as conformaes anti e syn se interconvertem facilmente, com anti sendo mais estvel na maioria dos casos. A conformao syn estabilizada em guanosina 5-fosfato, devido a interaes favorveis entre o grupo 2-NH2 e os oxignios do fosfato.

dica syn. Essa preferncia tambm foi observada em DNA ta-dupla com seqncias de Gs e Cs alternados. A conformao syn dos resduos G nesses DNAs resulta na formao de uma hlice pouco usual, que gira para a esquerda (ver p. 40).

2.3 | ESTRUTURA DO DNA


Estrutura Polinucleotdica
cidos nuclicos so tas de nucleotdeos ligados por ligaes fosfodister (Figura 2.8). O comprimento dessas tas varia consideravelmente, de dois resduos a centenas de milhes de resduos. Tipicamente, tas de cidos nuclicos contendo 50 nucleotdeos so chamados oligonucleotdeos, enquanto os mais longos so polinucleotdeos. A ligao fosfodister liga o grupo 5-hidroxila de um resduo ao grupo 3-hidroxila do seguinte. Ligaes entre dois 5-OHs ou dois 3-OHs no so vistas em DNA de ocorrncia natural. A direcionalidade dessa ligao signica que oligo- e polinucleotdeos lineares tm uma extremidade que termina em um 5-OH e outra que termina em 3-OH. Essas extremidades so extremidade 5 e extremidade 3, respectivamente. Em muitos polinucleotdeos, uma ou ambas as extremidades so quimicamente modicadas com resduos de grupos fosfatos ou aminocidos. Polinucleotdeos circulares no tm nenhuma extremidade livre, e so formados unindo-se a extremidade 5 de um polinucleotdeo linear com sua prpria extremidade 3 por uma ligao fosfodister.

7.0

P O

C-2 Sul base

P O 5.9 P O

C-3 Norte

FIGURA 2.6 Conformaes preferenciais de acares pentoses. Duas conformaes produzem variaes na orientao relativa da base (com relao ao acar) e na distncia entre os grupos 3- e 5-fosfato (P). Finalmente, essas diferenas afetam a conformao geral do complexo dupla-hlice.

BioQ.02 28

22.01.07 16:20:54

42

PARTE 1 ESTRUTURA DE MACROMOLCULAS

CORRELAO CLNICA 2.3

Antibiticos Antitumorais que Mudam a Forma do DNA


A estrutura local tridimensional do DNA importante em interaes com protenas envolvidas em reparo, transcrio, recombinao e condensao da cromatina. Foi proposto que antibiticos possam induzir formao de estruturas de DNA que podem recrutar essas protenas com resultados citotxicos. O exemplo melhor estudado a droga antitumoral cisplatina, um complexo tetracoordenado de platina [ cis-Pt(NH2)2CL2]. Cisplatina usada sozinha ou em combinao com outros agentes antitumorais para tratar uma variedade de tumores, incluindo cncer testicular, ovariano, sseo e pulmonar. Forma ligaes cruzadas inter- e intra-tas em DNA dupla-ta com o ltimo aducto compreendendo 90% das leses do DNA. Essas ligaes surgem do deslocamento de cloretos ligados platina por tomos N7 de duas guaninas vizinhas. Estudos estruturais de DNA com aducto fazendo ligao cruzada intra-ta mostra que a dupla hlice fortemente dobrada em direo fenda maior. Estruturas dobradas de aductos DNA-cisplatina so reconhecidas especicamente por vrias protenas que se ligam ao DNA, tais como protenas do reparo por exciso de nucleotdeos (NER) e protenas no-histonas que se ligam ao DNA como HMG-1. A citotoxicidade da cisplatina um processo complicado mediado por interaes especcas com essas protenas. Processos celulares como transcrio e apoptose so afetados e os complexos aducto-protena provavelmente interferem com transcrio. Protenas NER so recrutadas para reparar a leso, mas reparo por exciso est sujeito a introduzir quebras de ta no DNA. Acmulo dessas quebras induzir, nalmente, apoptose, quando o DNA se tornar danicado demais para funcionar. Mecanismos semelhantes foram propostos como responsveis pela citotoxicidade de outras drogas que ligam ao DNA, como ditercalinium, uma molcula bifuncional que forma aductos no-covalentes com DNA que tambm ca fortemente dobrado. Acredita-se que citotoxicidade surja da induo da via de reparo abortivo, que leva a quebras da ta de DNA. Interaes do aducto cisplatina-DNA com protenas HMG tambm podem contribuir para sua citotoxicidade. Ligao de protenas HMG pode sinalizar incorretamente que a regio danicada do DNA transcripcionalmente ativa e impedir condensao em estruturas de cromatina enovelada. Esses complexos tambm perpetuam a leso, porque bloqueiam o aducto DNAcisplatina impedindo reparo.

Fonte: Zamble, D.B. e Lippard, S.J. The response of cellular proteins to cisplatin-damaged DNA. In: B. Lippert (Ed.) Cisplatin: Chemistry and Biochemistry of a Leading Anticancer Drug. New York: Wiley-VCH, 1999, pp. 73134; e Lambert, B., Segal-Bendirjian, E., Esnault, C., Le Pecq, J.-B., Roques, B.P., Jones, B. e Yeunf, A.T. Recognition by the DNA repair system of DNA structural alterations induced by reversible drug-DNA interactions. Anti-Cancer Drug Des. 5:43, 1990.

BioQ.02 42

22.01.07 16:21:15

CAPTULO 2 DNA E RNA: COMPOSIO E ESTRUTURA

61

mente 300 pb de comprimento e so repetidas mais de 500.000 vezes. As estruturas das repeties dispersas curtas, incluindo famlia Alu, so remanescentes de transposons. Aproximadamente 1-15% do DNA genmico eucaritico consiste de seqncias tipicamente menores do que 20 nucleotdeos reiteradas milhares ou milhes de vezes. A maioria das seqncias altamente reiteradas tem uma composio em bases caracterstica, e elas podem ser isoladas fragmentando-se o DNA em segmentos de algumas centenas de nucleotdeos e separando-se os fragmentos por centrifugao em gradiente de densidade. Esses fragmentos so chamados DNA satlite, porque aparecem como satlites das bandas que contm a maior parte do DNA aps centrifugao. Outras seqncias altamente reiteradas, que no podem ser isoladas por centrifugao, podem ser identicadas por sua propriedade de rpido reanelamento. Esses DNAs altamente reiterados so tambm chamados DNAs de seqncia simples. Seqncias simples esto tipicamente presentes no DNA da maioria dos eucariotos, se no de todos. Em algumas espcies, uma seqncia principal est presente, enquanto em outras, vrias seqncias simples so repetidas at um milho de vezes. DNAs de seqncia simples podem freqentemente ser isolados, como DNA satlite. O encontrado no centrmero de eucariotos superiores consiste de milhares de cpias em seqncia de uma ou de algumas poucas seqncias curtas. Seqncias satlites tm apenas 5-10 pb de comprimento e so um constituinte dos telmeros, onde tm um papel bem denido na replicao do DNA. Alguns DNAs de seqncia simples mais longos foram identicados. Por exemplo, no genoma do macaco verde africano, um segmento de 172 pb que contm algumas repeties de seqncias altamente reiterado. Repeties invertidas so motivos estruturais do DNA. Repeties invertidas curtas, consistindo de at seis nucleotdeos de comprimento (p. ex., a seqncia palindrmica GAATTC), ocorrem por acaso uma vez a cada 3.000 nucleotdeos. Tais repeties curtas no podem formar uma estrutura cruciforme estvel, como a formada por seqncias palindrmicas mais longas. Seqncias repetitivas invertidas que so sucientemente longas para formar cruciformes estveis, pouco provvel que ocorram por acaso, e deveriam ser classicadas como uma classe separada de seqncias eucariticas. No DNA humano, cerca de dois milhes de repeties invertidas esto presentes, com um comprimento mdio de cerca de 200 pb; entretanto, seqncias invertidas com mais de 1.000 pb j foram detectadas. A maioria das seqncias repetidas invertidas repetida 1.000 ou mais vezes por clula.

2.6 | ESTRUTURA DO RNA


RNA um Polmero de Ribonucleosdeo 5-Monofosfatos
RNA um polmero linear de ribosdeos monofosfatos. As bases pricas do RNA so adenina e guanina; as pirimdicas so citosina e uracil. Exceto por uracil, que substitui timina, so as mesmas bases encontradas no DNA. Nucleotdeos de A, C, G e U so incorporados no RNA durante transcrio. Muitos RNAs tambm contm nucleotdeos modicados, que so produzidos por processamento. Nucleotdeos modicados so especialmente caractersticos de espcies de RNAs estveis (i., tRNA e rRNA); contudo, alguns nucleotdeos metilados esto tambm presentes em mRNA eucaritico. Na sua maior parte, nucleotdeos modicados no RNA tm papel no ajuste no, e no funes indispensveis na clula. As ligaes 3,5-fosfodister do RNA formam um esqueleto, a partir do qual as bases se estendem (Figura 2.51). RNAs eucariticos variam de aproximadamente 20 nucleotdeos de comprimento a mais de 200.000 nucleotdeos. Cada RNA complementar seqncia de bases de pores especcas de apenas uma das tas do DNA. Portanto, ao contrrio da composio em bases do DNA, as relaes molares (A + U) e (G + C) no RNA no so iguais. RNA celular linear e de ta-nica, mas RNA ta-dupla est presente em certos genomas virais. Quimicamente, RNA semelhante a DNA. Ambos contm ligaes fosfodister carregadas negativamente, e as bases so quimicamente muito semelhantes. As diferenas qumicas entre DNA e RNA devem-se principalmente a dois fatores. Primeiro, RNA contm ribose em lugar de 2-desoxirribose como acar componente do nucleotdeo, e segundo, RNAs geralmente so tanica em lugar de dupla-ta. O grupo 2-hidroxila torna as ligaes fosfodister de uma molcula de RNA mais susceptvel hidrlise qumica, especialmente em solues alcalinas, do que as do DNA. A instabilidade qumica do RNA reete-se em sua instabilidade metablica. Alguns RNAs, como mRNA bacteriano, so sintetizados, usados e degradados em minutos. Outros, como rRNA humano, so mais estveis metabolicamente, com tempo de vida medido em dias. Entretanto, mesmo os RNAs mais estveis, so menos estveis que o DNA.

Estrutura Secundria do RNA Envolve Pareamento de Bases Intramolecular


Como molculas de RNA so ta-nica, geralmente no formam extensas duplas-hlices. Em vez disso, a estrutura secundria de uma molcula de RNA resulta de regies relativamente curtas com pareamento de

BioQ.02 61

22.01.07 16:21:40

CAPTULO 3 PROTENAS I: COMPOSIO E ESTRUTURA

73

PARTE 1 ESTRUTURAS DE MACROMOLCULAS

PROTENAS I: COMPOSIO E ESTRUTURA


Richard M. Schultz e Michael N. Liebman

3.1 PAPIS FUNCIONAIS DE PROTENAS NO HOMEM, 74 3.2 COMPOSIO EM AMINOCIDOS DE PROTENAS, 75 Aminocidos comuns, 75 Cadeias laterais denem a natureza qumica e as estruturas de -aminocidos, 76 Cistina um aminocido derivado, 78 Aminocidos tm um centro de assimetria, 78 Aminocidos So Polimerizados em Peptdeos e Protenas, 78 3.3 PROPRIEDADES DE CARGAS E QUMICAS DE AMINOCIDOS E PROTENAS, 81 Grupos ionizveis de aminocidos e protenas so crticos para a funo biolgica, 81 Forma inica de um aminocido ou uma protena pode ser determinada em dado pH, 82 Titulao de um cido monoamino-monocarboxlico: determinao do pH isoeltrico, 82 Titulao de um cido monoamino-dicarboxlico, 83 Relao geral entre as propriedades de carga de aminocidos e protenas, e pH, 83 Aminocidos e protenas podem ser separados com base em valores de pI, 84 Cadeias laterais de aminocidos tm propriedades polares e apolares, 84 Aminocidos sofrem vrias reaes qumicas, 87 3.4 ESTRUTURA PRIMRIA DE PROTENAS, 88

3.5 NVEIS SUPERIORES DE ORGANIZAO PROTICA, 90 Estrutura secundria, 90 Estrutura em -hlice, 91 Estrutura- , 92 Motivos estruturais e dobras das protenas, 92 Estrutura terciria, 93 Estrutura quaternria, 94 Bioinformtica relaciona estrutura e funo das protenas como produtos gnicos, 95 Estruturas de dobras homlogas so freqentemente formadas a partir de seqncias de aminocidos no-homlogas, 96 3.6 OUTROS TIPOS DE PROTENAS, 97 Protenas brosas: colgeno, elastina, queratina e tropomiosina, 98 Colgeno, 98 Composio em aminocido do colgeno, 98 Seqncia de aminocido do colgeno, 98 Estrutura do colgeno, 99 Formao de ligaes covalentes cruzadas no colgeno, 100 Elastina uma protena brosa com ligaes cruzadas geradas por alisina, 100 Queratina e tropomiosina, 102 Lipoprotenas plasmticas so complexos de lipdeos com protenas, 102 Glicoprotenas contm carboidratos ligados covalentemente, 107 Ligaes covalentes carboidrato-protena, 107

BioQ.03 73

22.01.07 16:30:59

3.3 PROPRIEDADES DE CARGAS E QUMICAS DE AMINOCIDOS E PROTENAS


Grupos Ionizveis de Aminocidos e Protenas So Crticos para a Funo Biolgica
Grupos ionizveis comuns a protenas e aminocidos so mostrados na Tabela 3.3. As formas cidas esto esquerda do sinal de equilbrio, e as formas bsicas do lado direito. Ao formar sua base conjugada, a forma cida libera um prton. Ao contrrio, a forma bsica associa-se com um prton para formar o respectivo cido. A dissociao de um cido caracterizada por uma constante de dissociao cida (Ka) e seu valor de pKa : pKa = log10 (1/Ka). Tabela 3.3 mostra a faixa de valores de pK a para cada grupo cido, porque o pKa real depende do meio no qual o grupo cido est colocado. Por exem-

CAPTULO 3 PROTENAS I: COMPOSIO E ESTRUTURA

81

plo, quando um grupo amnio carregado positivamente (NH3+) colocado perto de um grupo carregado negativamente em uma protena, a carga negativa estabiliza a forma cida carregada positivamente, tornando mais difcil a dissociao do seu prton. O pKa do NH3+ ter um valor maior do que o normal para um grupo amnio na ausncia de uma estabilizao por uma carga negativa prxima. Outros fatores, alm da carga, que afetam o pKa incluem polaridade do meio, ausncia ou presena de gua e potencial para formao de pontes de hidrognio. Alm disso, grupos cidos (-COOH ou -NH3+) nas extremidades dos polipeptdeos tipicamente tm um valor de pKa mais baixo do que os mesmos tipos de grupos cidos nas cadeias laterais (Tabela 3.4). Os aminocidos cujos grupos R contm tomos de nitrognio (Lys e Arg) so os aminocidos bsicos, uma vez que suas cadeias laterais tm valores relativamente altos de pKa e funcionam como bases em pH siolgico. Eles esto geralmente em sua forma cida e carregada positivamente em pH siolgico. Aminocidos cujas cadeias laterais contm um grupo carboxlico tm valores de pKa relativamente baixos que facilmente perdem seus prtons e so aminocidos acdicos. Esto predomi-

TABELA 3.3 Valores de pKa caractersticos para os Grupos cidos Comuns em Protenas
Onde o Grupo cido Encontrado NH2-terminal ou cadeia lateral de lisina COOH-terminal ou cadeias laterais de glutamato e aspartato Cadeia lateral de arginina Forma cida RNH3 + Amnia RCOOH cido carboxlico RNHC NH2 | NH2 Guanidnio RSH Tiol
+

Forma Bsica RNH2 + H + Amina RCOO + H + Carboxilato RNHC= NH + H | NH2 Guanidino RS + H + Tiolato

Faixa Aproximada de pKa Para o Grupo 7,610,6 3,05,5

11,512,5

Cadeia lateral de cistena Cadeia lateral de histidina

8,09,0

RC=CH | | + HN NH C H
Imidazlio

RC=CH | | HN N+H + C H
Imidazol

6,07,0

Cadeia lateral de tirosina R Fenol OH R OH +H + Fenolato 9,510,5

TABELA 3. 4 pKa da Cadeia Lateral e Grupos cidos Terminais em Ribonuclease


NH3 + Cadeia lateral Final da cadeia Lisina 10,2 N-terminal = 7,8 COOH Glu e Asp 4,6 C-terminal = 3,8

nantemente em sua forma desprotonada e carregada negativamente em pH siolgico. Protenas nas quais a razo (Lys + Arg)/(Glu + Asp) maior do que 1 so protenas bsicas. Protenas, nas quais a razo menor do que 1, so protenas cidas.

BioQ.03 81

22.01.07 16:31:12

98

PARTE 1 ESTRUTURA DE MACROMOLCULAS

Protenas Fibrosas: Colgeno, Elastina, Queratina e Tropomiosina


Protenas brosas caracteristicamente tm quantidades maiores de estrutura secundria regular, uma forma cilndrica longa (tipo basto), baixa solubilidade em gua e uma funo estrutural em lugar de um papel dinmico. Exemplos de protenas brosas com essas caractersticas so colgeno, queratina e tropomiosina.

Composio em Aminocidos do Colgeno


A composio do colgeno tipo I de pele e das protenas globulares ribonuclease e hemoglobina so dadas na Tabela 3.10. Colgeno de pele rico em glicina (33% de seus aminocidos), prolina (13%) e aminocidos derivados 4-hidroxiprolina (9%) e 5-hidroxilisina (0,6%) (Figura 3.37). Hidroxiprolina exclusiva de colgenos, sendo formada enzimaticamente a partir de prolina. A maior parte das hidroxiprolinas tem o grupo hidroxila na posio 4 (carbono ), embora uma pequena quantidade de 3-hidroxiprolina tambm seja formada (Tabela 3.10). Colgenos so glicoprotenas com carboidratos ligados a 5-hidroxilisina por uma ligao O-glicosdica por meio do grupo hidroxila do carbono- .

Colgeno
Colgeno uma famlia de protenas presente em todos os tecidos e rgos e fornece o arcabouo que d aos tecidos sua forma e resistncia. A porcentagem de colgeno por peso para alguns tecidos e rgos humanos representativos : fgado 4%, pulmo 10%, aorta 12-24%, cartilagem 50%, crnea 64%, osso cortical total 23% e pele 74% (ver Corr. Cln. 3.4).

Seqncia de Aminocidos do Colgeno


A famlia colgeno composta por polipeptdeos derivados de 40 genes conhecidos de cadeias de colgeno, que produzem cerca de 20 tipos de colgeno. Cada molcula de colgeno maduro ou tropocolgeno contm trs cadeias polipeptdicas. Alguns tipos de colgeno contm trs cadeias polipeptdicas idnticas. No tipo I (Tabela 3.11), h duas cadeias 1(I) e uma 2(I). Colgeno tipo V contm 1(V), 2(V) e 3(V). Colgenos diferem em seqncia de aminocidos, mas h grandes regies de seqncias homlogas entre todos os diferentes tipos de colgeno. Em todos os tipos de colgeno h regies com os tripeptdeos Gly-Pro-Y e Gly-X-Hyp (onde X e Y so quaisquer aminocidos) repetidos em seguida v-

CORRELAO CLNICA 3.4

Doenas de Sntese de Colgeno


Colgeno est presente em praticamente todos os tecidos e a mais abundante protena do corpo. Certos rgos dependem muito dele para funcionar siologicamente. Sntese ou estrutura anormal de colgeno causa disfuno em rgos cardiovasculares (aneurisma da aorta e arterial e defeitos de vlvulas cardacas), ossos (fragilidade e fratura fcil), pele (cicatrizao difcil e distensibilidade incomum), articulaes (hipermobilidade e artrite) e olhos (deslocamento do cristalino). Doenas causadas por sntese anormal de colgeno incluem sndrome de Ehlers-Danlos, osteognese imperfeita e escorbuto. Essas doenas podem resultar de genes anormais de colgeno, modicaes ps-traduo anormais do colgeno ou decincia de cofatores necessrios s enzimas responsveis por modicaes pstraduo de colgeno. Fonte: Aronson, D. Cross-linking of glycated collagen in the pathogenesis of arterial and myocardial stiffening of aging and diabetes. J. Hypertens. 21:3, 2003. Byers, P. H. Disorders of collagen biosynthesis and structure. In: C. R. Scriver, et al. (Eds.), The Metabolic and Molecular Bases of Inherited Disease, 8th ed. McGraw-Hill, 2001, Chapter 205. Hudson, B. G., et al., Alports syndrome, Goodpastures syndrome and type IV collagen, N. Engl J Med 348:2543, 2003.

H2C HC OH

H N

CH CH2

COOH

H2C H2C

H N

CH CH OH

COOH

4-Hidroxiprolina

3-Hidroxiprolina

OH NH2 CH2 CH CH2 CH2

NH2 C H

COOH 5-Hidroxilisina NH2 O C H Alisina CH2 CH2 CH2 C H

COOH

FIGURA 3.37 Aminocidos derivados encontrados no colgeno. Carboidrato ligado a 5-OH de hidroxilisina por uma ligao glicosdica tipo III (ver Figura 3.45).

BioQ.03 98

22.01.07 16:31:51

116

PARTE 1 ESTRUTURA DE MACROMOLCULAS

Absorbncia (415 nm)

tos de domnios e mudanas de estrutura quaternria, como os observados em hemoglobina aps ligao de O2 (ver p. 344). O comportamento dinmico de protenas a base para (a) mudanas conformacionais induzidas por substrato, inibidor ou droga quando se liga a uma enzima ou receptor, (b) gerao de efeitos alostricos em hemoglobinas, (c) transferncia de eltrons em citocromos, e (d) a formao de montagens supramoleculares como vrus. Os movimentos tambm podem ter um papel funcional na ao cataltica de enzimas.

0.05
A2

A1c

A1c

A F
S A2

3.9 CARACTERIZAO, PURIFICAO E DETERMINAO DA ESTRUTURA E ORGANIZAO DE PROTENAS


Separao de Protenas com Base em Carga
Em eletroforese, protena dissolvida em uma soluo tampo em um pH em particular colocada num campo eltrico. Dependendo da relao entre o pH do tampo e o pI da protena, a protena move-se em direo ao ctodo () ou ao nodo (+) ou permanece estacionria (pH = pI). Suportes como gis polimricos (p. ex., poliacrilamida), amido ou papel so usados. Os suportes inertes so saturados com soluo tampo, uma amostra de protena colocada sobre o suporte, um campo eltrico aplicado ao suporte, e a protena carregada migra no suporte em direo ao plo de carga oposta. Uma tcnica de resoluo extremamente alta a focalizao isoeltrica, na qual misturas de anfolitos poliamino-cidos policarboxlicos com uma faixa denida de valores de pI so usadas para estabelecer um gradiente de pH ao longo do campo eltrico aplicado. Uma protena carregada migra pelo gradiente de pH no campo eltrico at alcanar uma regio de pH no gradiente igual ao seu valor de pI. Nesse ponto, a protena torna-se estacionria e pode ser visualizada (Figura 3.55). Protenas que diferem por to pouco quanto 0,0025 em seus valores de pI so separadas no gradiente apropriado de pH. Cromatograa de troca-inica em colunas usada para separao preparativa de protenas por carga. Resinas de troca-inica consistem de materiais insolveis (agarose, poliacrilamida, celulose e vidro) que contm grupos carregados (Figura 3.56). Resinas carregadas negativamente ligam ctions fortemente e so resinas de troca catinica. Resinas carregadas positivamente ligam nions fortemente e so resinas de troca aninica. O grau de retardo de uma protena (ou um aminocido) por uma resina depende da magnitude da carga da protena no pH particular do experimento. Molculas

0 14 15 16 17 (b)

Tempo (min) (a)

FIGURA 3.55 Focalizao isoeltrica de hemoglobinas de um paciente heterozigoto para HbS e -talassemia. Figura mostra separao por focalizao isoeltrica de HbA1c (HbA glicosilada na extremidade NH2, ver Corr. Cln. 3.7), HbA de adulto normal, HbF fetal, HbS de anemia falciforme (ver Corr. Cln 3.3) e HbA 2 minoritria de adulto. ( a) Focalizao isoeltrica realizada por eletroforese capilar com anflito na faixa de pH entre 6,7 e 7,7 e deteco de bandas a 415 nm. ( b ) Focalizao isoeltrica realizada em gel com Pharmacia Phast System; anflito na faixa de pH entre 6,7 e 7,7. De Molteni, S., Frischknecht, H. e Thormann, W. Electrophoresis 15:22, 1994 (Figura 4, partes A e B).

CH2

COO

Ligante carregado negativamente: carboximetil


R N H
+

C2H5 C2H5

Ligante carregado positivamente: dietilamino


FIGURA 3.56 Dois exemplos de ligantes carregados usados em cromatograa de troca-inica.

de mesma carga que a resina so eludas primeiro, em uma nica banda, seguidas das que tm carga oposta da resina, em uma ordem baseada na densidade de cargas da protena (Figura 3.57). Quando difcil remover uma molcula da resina, devido fora de interao atrativa entre a molcula ligada e a resina, mudanas sistemticas no pH ou na fora inica so usadas para enfraquecer a interao. Por exemplo, um gradiente crescente de pH em uma resina de troca catinica reduz a diferena entre o pH da soluo e o pI da protena ligada. Essa diminuio entre pH e pI reduz a magnitude da carga nal da protena e diminui a fora da interao de cargas entre a protena e a resina. Um gradiente crescente de fora inica tambm diminui a interao de cargas e elui eletrlitos fortemente ligados resina.

BioQ.03 116

22.01.07 16:32:44

132

PARTE 2 TRANSMISSO DA INFORMAO

PARTE 2 TRANSMISSO DA INFORMAO

REPLICAO, RECOMBINAO E REPARO NO DNA


Howard J. Edenberg
4.1 CARACTERSTICAS COMUNS DA REPLICAO, RECOMBINAO E REPARO, 133 4.2 REPLICAO DO DNA, 133 O bsico, 133 A qumica da elongao da cadeia, 134 DNA polimerases, 135 Separando as tas parentais: a forquilha de replicao, 137 Resolvendo o problema da polaridade: sntese de DNA semidescontnua, 138 Movimento da forquilha de replicao, 138 Incio, 138 Elongao da ta, 138 Remoo do primer, 138 Preenchimento da falha, 138 Ligao, 139 Desenrolando as tas parentais, 141 Braadeiras corredias (sliding clamps) e processividade, 142 Coreograa em trs dimenses: o replissomo, 142 Enzimas procariticas de replicao, 142 Enzimas eucariticas de replicao, 144 Incio da replicao, 146 O ciclo celular, 147 Trmino da replicao em genomas circulares, 150 Trmino da replicao em genomas lineares: telmeros, 150 Telomerase, 151 Replicao de genomas de RNA, 151 4.3 RECOMBINAO, 151 Modelos de recombinao homloga, 152 Modelo Holliday, 152 Modelo de Meselson e Radding, 153 Modelo de quebra da dupla ta, 153 Enzimas-chaves da recombinao em E. coli, 153 RecA, 153 RecBCD, RuvA, RuvC, 155 Recombinao no-homloga, 155 Recombinao stio-especca, 155 Transposio, 155 Ligao de extremidades no-homlogas, 155 4.4 REPARO, 156 Leso no DNA, 156 Mutaes, 158 Reparo por exciso, 160 Reparo por exciso de base, 160 Reparo por exciso de nucleotdeo, 161 Reparo acoplado transcrio, 162 Reparo de pareamento errado, 162 Desmetilao direta, 165 Fotorreativao, 165 Leses podem bloquear a replicao, 165 Sntese bypass (transleso), 166 Reparo de falha na ta lha, 166 Enrolamento e reparo de forquilhas de replicao, 167 Reparo de quebra na dupla ta, 167 Regulao do reparo do DNA: o regulon SOS, 168

BioQ.04 132

22.01.07 16:37:06

CAPTULO 4 REPLICAO, RECOMBINAO E REPARO NO DNA

151

Telomerase
Telmeros so mantidos por telomerases, enzimas que adicionam novas repeties de seis nucleotdeos extremidade 3 dos telmeros. Telomerases so complexos ribonucleoproticos contendo um pequeno RNA que serve de molde para adio de uma nova repetio de seis nucleotdeos (Figura 4.18). Uma telomerase liga-se extremidade da ta 3, como parte do RNA da telomerase ligado por pontes de hidrognio aos ltimos nucleotdeos do cromossomo. Uma repetio de seis nucleotdeos sintetizada, usando o RNA como molde. Ento, a telomerase pode se dissociar e reassociar para adicionar outro hexmero. Telmeros no precisam permanecer exatamente do mesmo tamanho; algum encurtamento no problema porque essas repeties no codicam protenas. Telmeros passam por ciclos de encurtamento das tas tardias devido a incapacidade de sntese completa (Figura 4.17a) e adio de novas repeties de seis nucleotdeos extremidade 3 pela telomerase (Figura 4.18). Embora o comprimento dos telmeros no permanea constante, encurtamento progressivo evitado por adio de repeties. Telomerases tambm restabelecem os excessos 3, caractersticos dos telmeros. Clulas que diferenciaram e se dividiro apenas um nmero limitado de vezes, no expressam telomerase. Assim, os telmeros encurtam a cada diviso subseqente; isso limita o nmero de vezes que tais clulas podem se dividir antes que a perda dos telmeros dispare apoptose isto , morte celular programada (ver p. 1020). Expresso de telomerase geralmente reativada em clulas tumorais, o que lhes permite continuar as divises indenidamente, sem encurtamento cromossmico. Isso torna a telomerase um alvo atraente para quimioterapia do cncer. Deve-se notar que inativao da telomerase em um tumor no levaria a uma parada rpida no crescimento do tumor; o efeito seria retardado por muitos ciclos celulares, at que as extremidades cromossmicas fossem encurtadas signicativamente. Portanto, provvel que inibidores da telomerase sejam teis apenas em combinao com outras terapias.

Replicao de Genomas de RNA


Alguns vrus tm um genoma de RNA. Tais genomas so replicados com muito menor preciso e eles podem acumular variaes em perodo relativamente curto. Um exemplo particularmente importante disso o vrus da imunodecincia humano ( HIV ), que causa AIDS (sndrome da imunodecincia adquirida). O RNA viral do HIV reversamente transcrito em DNA e, depois, o DNA integra-se ao cromossomo. A transcriptase reversa do HIV um alvo para quimioterapia antiviral (Corr. Cln. 4.4). Transcrio reversa do RNA genmico do HIV muito menos precisa que sntese de DNA, e a preciso diminuda leva rpida gerao de uma coleo de vrus variantes em um indivduo. provvel que uma pequena frao desses variantes seja resistente a qualquer droga nica que esteja sendo usada para tratar a infeco. Essa frao pode continuar a replicar na presena do agente teraputico at se tornar a variante dominante, o que leva perda de eccia da droga. Atuais terapias combinadas so projetadas para reduzir a probabilidade de um vrus ser resistente simultaneamente a todas as drogas da combinao. Terapias combinadas atuais tm como alvos tanto a transcriptase reversa do HIV como a protease do HIV.

4.3 | RECOMBINAO
Recombinao a troca de informao gentica. H dois tipos bsicos: recombinao homloga e recombinao no-homloga. Recombinao homloga (tambm chamada recombinao geral) ocorre entre seqncias idnticas ou quase idnticas por exemplo, entre os cromossomos paterno e materno de um par. Cromossomos no so passados intactos de gerao para gerao (Figura 4.19); em vez disso, cada cromossomo que voc herda de seu pai contm pores de ambos os pais e, da mesma forma para os cromossomos herdados de sua me. Esta uma parte normal do processo de alinhamento cromossmico e segregao

[TTAGGG]nTTAGGGTTAGGGTTAGGG 3 [AATCCC]nAATCCC 5
3

FIGURA 4.18 Telomerase. Telomerase um complexo ribonucleoprotico com uma ta curta de RNA, como parte integral; catalisa a adio de novas repeties telomricas de 6-nt extremidade 3 de uma cadeia de DNA. O RNA da telomerase pareia parcialmente pelas bases com a repetio telomrica e serve de molde para a reao, enquanto o componente protico funciona como uma transcriptase reversa, sintetizando DNA usando o RNA como molde. Depois da adio de uma repetio de seis nucleotdeos, a enzima pode se dissociar e se ligar novamente e adicionar novas repeties de 6-nt.

k l m n o p q r

KLMNOPQR

FIGURA 4.19 Recombinao homloga. ( a) O cromossomo paterno mostrado em cinza com os alelos mostrados por letras maisculas. O cromossomo homlogo materno mostrado em preto com os alelos mostrados por letras minsculas. ( b ) Depois da recombinao homloga entre os genes j e k, ambos os cromossomos contm DNA de ambos os pais. Houve uma troca igual, recproca entre eles.

BioQ.04 151

22.01.07 16:37:33

158

PARTE 2 TRANSMISSO DA INFORMAO

Mutaes
As mutaes so alteraes hereditrias na seqncia do DNA. Podem resultar de erros na replicao, de leses no DNA ou de erros durante o reparo de leses. Mutaes que so trocas de um nico par de bases so chamadas mutaes puntuais. Mutaes puntuais podem ser classicadas pela natureza das bases alteradas. Transies so mutaes puntuais, nas quais uma purina substituda por outra (p. ex., A por G ou G por A) ou uma pirimidina substituda por outra (p. ex., T por C ou C por T). Deaminao de C, se no reparada, levaria a uma transio. A freqncia de transies aumentada por anlogos de bases, incluindo 2-amino purina (Corr. Cln. 4.7). Transverses so mutaes puntuais, nas quais uma purina substituda por uma pirimidina ou vice versa (p. ex., A por C ou C por A). Mutaes puntuais tambm podem ser caracterizadas por seu efeito sobre uma seqncia codicadora. Mutaes de sentido errado (missense) so mutaes puntuais que trocam um nico par de bases em um cdon, de modo que o cdon agora codica um aminocido diferente (Figura 4.24 a). Mutaes sem sentido (nonsense) so mutaes puntuais que trocam um nico par de bases em um cdon para um cdon de terminao (stop codon) que termina a traduo (Figura 4.24b). Mutaes sem sentido geralmente tm efeitos mais graves do que mutaes de sentido errado porque levam sntese de polipeptdeos truncados (e geralmente instveis). Mutaes silenciosas ou sinnimos no alteram o aminocido codicado; estas incluem muitas mudanas no terceiro nucleotdeo de um cdon.

Inseres ou remoes de um ou mais pares de bases podem levar a mudanas na estrutura de leitura ( frameshifts) (se o nmero de pares de bases no for mltiplo de 3), destruindo o cdigo de uma protena (Figura 4.24 c,d). Traduo de um mRNA no tem pontuao; ao contrrio, uma vez que o cdigo de iniciao tenha sido determinado, tripletes sucessivos so lidos como cdons. Portanto, adio (ou deleo) de um mltiplo de trs pares de bases em uma regio codicadora adicionaria (ou subtrairia) aminocidos a uma protena, mas adio de outros nmeros de pares de bases deslocaria a estrutura da leitura daquele ponto em diante. Mudana na estrutura de leitura ( frameshift) muda os aminocidos codicados a partir do ponto de insero ou remoo. Frameshifts geralmente levam terminao prematura (ou, mais raramente, elongao) da cadeia polipeptdica codicada, quando cdons de terminao (stop codons) so gerados ou removidos pela mudana na estrutura de leitura. Alguns agentes qumicos, incluindo acridinas e proavina , intercalam-se no DNA; isto , inserem-se entre pares de bases adjacentes. Isso geralmente leva a inseres ou remoes de um nico par de bases. Mutaes tambm podem resultar de alteraes em larga escala, incluindo insero de transposons. Embora raras em uma gerao qualquer, mutaes acumularam-se em populaes ao longo de milhes de anos, de modo que duas pessoas diferem em cerca de 1 pb por 1000 ao longo de seus genomas. Muitas dessas diferenas genticas no tm efeito, mas outras afetam nossa siologia, susceptibilidade a doenas e resposta a tratamentos (Corr. Cln. 4.8).

CORRELAO CLNICA 4.7

Anlogos de Nucleosdeos como Drogas: Tiopurinas


6-Mercapto purina (6-MP) um anlogo de purina administrado oralmente que til na quimioterapia de leucemias agudas e para imunossupresso aps transplante de rgos. Age por vrios mecanismos, incluindo inibio da biossntese de purinas e toxicidade aps incorporao no DNA. metabolizado a 6-MP ribosina 5-fosfato, que tem curta meia-vida, porque degradada por xantina oxidase. A velocidade de degradao muito reduzida em pacientes que esto sendo tratados com alopurinol (um inibidor da xantina oxidase) para hiperuricemia relacionada gota, de modo que a dose deve ser drasticamente reduzida em tais pacientes. Outra enzima que metaboliza 6-MP (e o antimetablito relacionado 6-tioguanina) tiopurina metil transferase (TPMT). Alguns pacientes (cerca de 10% da populao) so heterozigotos para um polimorsmo que inativa a enzima e, portanto, tem aproximadamente 50% da atividade, e 1/300 das pessoas no tm atividade de TPMT e tm risco extremamente alto de imunossupresso grave e morte se forem tratadas com 6-MP. Por outro lado, pessoas que metabolizam as drogas mais rapidamente podem no chegar a ter dose teraputica suciente. Essa diferena farmacogentica, portanto, tem srias implicaes para o tratamento com tiopurinas.

Fonte: Sanderson, J., Ansari, A., Marinaki, T. e Duley, J. Thiopurine methyltransferase: Should it be measured before commencing thiopurine drug therapy? Ann. Clin. Biochem. 41:294, 2004.

BioQ.04 158

22.01.07 16:37:40

CAPTULO 4 REPLICAO, RECOMBINAO E REPARO NO DNA

169

| BIBLIOGRAFIA |
Baynton, K. e Fuchs, R. P. P. Lesions in DNA: Hurdles for polymerases. Trends Biochem. Sci. 25:75, 2000. Berger, J. M., Gamblin, S. J., Harrison, S. C. e Wang, J. C. Structure and mechanism of DNA topoisomerase II. Nature 379:225, 1996. Blow, J. J. e Tada, S. A new check on issuing the license. Nature 404:560, 2000. Cooke, M. S., Evans, M. D., Dizdaroglu, M. e Lunec, J. Oxidative DNA damage: Mechanisms, mutation, and disease. FASEB J. 17:1995, 2003. Cox, M. M., Goodman, M. E., Kreuzer, K. N., Sherratt, D. J., Sandler, S. J. e Marians, K. J. The importance of repairing stalled replication forks. Nature 404:37, 2000. Evans, A. R., Limp-Foster, M. e Kelley, M. R. Going Ape over Ref-1. Mutat. Res. 461:83, 2000. Flores-Rozas, H. e Kolodner, R. D. Links between replication, recombination, and genome instability in eucaryotes. Trends Biochem. Sci. 25:196, 2000. Friedberg, E. C. DNA damage and repair. Nature 421:436, 2003. Friedberg, E. C. How nucleotide excision repair protects against cancer. Nature Rev. Cancer 1: 22, 2001. Gerson, S. L. MGMT: Its role in cancer aetiology and cancer therapeutics. Nature Rev. Cancer 4: 296, 2004. Haber, J. E. DNA recombination: the replication connection. Trends Biochem. Sci. 25:271, 2000. Hanawalt, P. C. Transcription-coupled repair and human disease. Science 266:1957, 1994. Hanawalt, P. C. The bases for Cockayne syndrome. Nature 405:415, 2000. Hubscher, U., Maga, G. e Spadari, S. Eukaryotic DNA polymerases. Annu. Rev. Biochem. 71:133, 2002. Human genome project. http://www.nhgri.nih.gov/HGP/ Human genome sequencing. http://www.ncbi.nih.gov/genome/ seq/ Johnson, R. E., Washington, M. T., Haracska, L., Prakash, S. e Prakash, L. Eucaryotic polymerases and act sequentially to bypass DNA lesion. Nature 406:1015, 2000. Kowalczykowski, S. C. Initiation of genetic recombination and recombination-dependent replication. Trends Biochem, Sci. 25:156, 2000. Lieber, M. R., Ma, Y., Pannicke, U. e Schwarz, K. Mechanism and regulation of human non-homologous DNA end joining. Nature Rev. Mol. Cell Biol. 4:712, 2003. Lindahl, T. e Wood, R. D. Quality control by DNA repair. Science 286:1897, 1999. Modrich, P. Mismatch repair, genetic stability, and cancer. Science 266:1959, 1994. Naktinis, V., Turner, J. e ODonnell, M. A molecular switch in a replication machine dened by internal competition for protein rings. Cell 84:137, 1996. Online Mendelian Inheritance in Man (OMIM) http://www. ncbi.nlm.\nih.gov/entrez/query.fcgi?db=OMIM Rattray, A. J. e Strathern, J. N. Error-prone DNA polymerases: When making a mistake is the only way to get ahead. Annu. Rev. Genet. 37:31, 2003. Sancar, A. Excision repair in mammalian cells. J. Biol. Chem. 270:15915, 1995. Stillman, B. Cell cycle control of DNA replication. Science 274:1659, 1996. Stahl, F. Meiotic recombination in yeast: coronation of the double-strand-break repair model. Cell 87:965, 1996. Ulaner, G. A. Telomere maintenance in clinical medicine. Am. J. Med. 117:262, 2004. Von Hippel, P. H. e Jing, D. H. Bit players in the trombone orchestra. Science 287:2435, 2000. Waga, S. e Stillman, B. Anatomy of a DNA replication fork revealed by reconstitution of SV40 replication in vitro. Nature 369:207, 1994. Watson, J. D. e Crick, F. H. C. Genetical implications of the structure of deoxyribonucleic acid. Nature 171:964, 1953. Wood, R. D., Mitchell, M., Sgouros, J. e Lindahl, T. Human DNA repair genes. Science 291:1284, 2001. Yu, Z., Chen, J., Ford, B. N., Brackley, M. E. e Glickman, B. W. Human DNA repair systems: an overview. Environ. Mol. Mutagen. 33:3, 1999. Zakian, V. A. Telomeres: beginning to understand the end. Science 270:1601, 1995.

| QUESTES | Carol N. Angstadt


Questes de Mltipla Escolha. 1. Replicao: A. semiconservativa. B. requer apenas protenas com atividade de DNA polimerase. C. usa atividade de polimerase 5 para 3 para sintetizar uma ta, e atividade de polimerase 3 para 5 para sintetizar a ta complementar. D. requer um primer em eucariotos, mas no em procariotos. E. deve comear com uma etapa de quebra. 2. Na replicao de DNA eucaritica: A. s um replissomo se forma, porque h uma nica origem de replicao. B. os fragmentos de Okasaki tm 1000 a 2000 nucleotdeos de comprimento. C. helicase se dissocia do DNA assim que as bolhas de iniciao se formam. D. FEN 1 ( ap endonuclease 1) est envolvida na remoo do primer. E. o processo ocorre ao longo de todo o ciclo celular. 3. Todas as armativas seguintes sobre a telomerase so corretas, exceto: A. o componente RNA age como molde para a sntese de um segmento de DNA. B. adiciona telmeros s extremidades 5 das tas de DNA. C. fornece um mecanismo para replicar as extremidades de cromossomos lineares. D. reconhece uma ta nica do DNA rica em G. E. uma transcriptase reversa. 4. Uma mutao por transio: A. ocorre quando uma purina substituda por uma pirimidina ou vice-versa. B. resulta da insero de uma ou duas bases na cadeia de DNA.

BioQ.04 169

22.01.07 16:37:56

172

PARTE 2 TRANSMISSO DA INFORMAO

PARTE 2 TRANSMISSO DA INFORMAO


IIF IID PA IIB IIA TATA INR DPE
Pol II

IIE

IIH

RNA: TRANSCRIO E PROCESSAMENTO


Francis J. Schmidt e David R. Setzer
5.1 VISO GERAL, 173 5.2 MECANISMOS DE TRANSCRIO, 173 Processo inicial de sntese de RNA transcrio, 173 Informao em seqncia de DNA sinaliza sntese de RNA, 173 RNA polimerase catalisa o processo de transcrio, 174 Etapas da transcrio em procariotos, 175 Reconhecimento do promotor, 175 Incio da sntese, 176 Elongao, 177 Terminao, 178 5.3 TRANSCRIO EM EUCARIOTOS, 178 Natureza da cromatina ativa, 178 Ativao da transcrio opera por recrutamento de RNA polimerase, 179 Enhancers, 179 Transcrio por RNA polimerase II, 180 Promotores para a sntese de mRNA, 180 Transcrio por RNA polimerase I, 181 Transcrio por RNA polimerase III, 181 A base enzimtica comum para ao de RNA polimerases, 183 5.4 PROCESSAMENTO DE RNA, 184 RNA transportador modicado por clivagem, adio e modicao de bases, 184 Clivagem, 184 Adio na extremidade 3, 184 Nucleosdeos modicados, 184 Processamento de RNA ribossmico libera vrios RNAs de um precursor mais longo, 184 Processamento de RNA mensageiro garante a seqncia codicadora correta, 185 RNA polimerase II recruta enzimas de processamento durante transcrio em eucariotos, 186 Capping, 186 Remoo de ntrons de precursores de mRNA, 186 Poliadenilao, 188 Mutaes em sinais de splicing causam doenas humanas, 188 Splicing alternativo de pr-mRNA pode levar sntese de mltiplas isoformas de protenas a partir de uma nica seqncia codicadora no DNA, 190 5.5 EXPORTAO DO RNA E CONTROLE DE QUALIDADE, 191 5.6 RNAs PEQUENOS INIBITRIOS, 192 5.7 REPARO DO DNA ACOPLADO TRANSCRIO, 192 5.8 NUCLEASES E TURNOVER DO RNA, 193 BIBLIOGRAFIA, 194 QUESTES E RESPOSTAS, 195 CORRELAES CLNICAS 5.1 Antibiticos e Toxinas que Tm RNA Polimerase como Alvo, 176 5.2 Sndrome do X Frgil: Uma Doena de RNACromatina?, 179 5.3 Envolvimento de Fatores Transcripcionais em Carcinognese, 182 5.4 Talassemia Devido a Defeitos na Sntese de RNA Mensageiro, 188 5.5 Auto-imunidade em Doena do Tecido Conjuntivo, 189 5.6 Sndrome de Cockayne, 193

BioQ.05 172

22.01.07 16:40:55

CAPTULO 5 RNA: TRANSCRIO E PROCESSAMENTO


Stios HSS (setas) Oviduto, imaturo Oviduto, maduro

179

transcrito

CORRELAO CLNICA 5.2

Sndrome do X Frgil: Uma Doena de RNA-Cromatina?


Sndrome do X frgil a forma individual mais comum de retardo mental hereditrio, afetando 1/1250 homens e 1/2000 mulheres. Uma variedade de sintomas anatmicos e neurolgicos resulta de inativao do gene FMR1, localizado no cromossomo X. A gentica da sndrome complexa, devido ao mecanismo molecular da mutao do X frgil. A condio do X frgil resulta de expanso de uma seqncia repetida de um trinucleotdeo, CGG, encontrado na regio 5 no-traduzida do gene FRM1. Normalmente, essa repetio est presente em 30 cpias, embora indivduos normais possam ter at 200 cpias da repetio. Em indivduos com sndrome do X frgil, o gene FRM1 contm muito mais cpias, de 200 a milhares, da repetio CGG. A gentica complexa da doena resulta do potencial da repetio CGG se expandir de gerao para gerao. A presena de um nmero anormalmente elevado de repeties CGG induz extensa metilao do DNA de toda a regio do promotor de FMR1. DNA metilado transcripcionalmente inativo, de modo que mRNA de FMR1 no sintetizado. Ausncia da protena FMR1 leva patologia da doena. Protena FMR1 normalmente se localiza no citoplasma de todos os tecidos do feto jovem e, mais tarde, especialmente no crebro e tecido neural fetal. A protena FMR afeta traduo de vrios mRNAs e uma hiptese que essa protena ajude na traduo e localizao de mRNAs especcos durante desenvolvimento. Uma possibilidade descoberta recentemente que a protena FMR1 esteja envolvida em RNA de interferncia e sua perda possa causar ampla regulao gnica anormal (ver Seo 5.7). provvel que vrias vias de sinalizao estejam ligadas patologia dessa doena muito complexa. Fonte: Warren, S. L. e Nelson, D. L. Advance in molecular analysis of Fragile X syndrome. JAMA 271:536, 1994. Caskey, C. T. Triple repeat mutations in human disease. Science 256:784, 1992. Jin, P., Zarnescu, D. C., Ceman, S., Nakamoto, M., Mowrey, J., Jongens, T. A., Nelson, D. L., Moses, K. e Warren, S. T. Biochemical and genetic interaction between the fragile X mental retardation protein and the micro RNA pathway. Nature Neurosci. 7:113, 2004. Miyashiro, K. e Eberwine, J. Fragile X syndrome: (Whats) lost in translation? Proc. Natl. Acad. Sci. USA 101:17329, 2004. Fragile Site Mental Retardation 1 Gene; FMR1 in Online Mendelian Inheritance in Man, http://www.ncbi. nlm.nih.gov/entrez/dispomim.cgi?id=309550

Eritrcitos -5 0

Distncia no DNA do incio da transcrio, em quilobases

FIGURA 5.5 Stios hipersensveis DNase (HSS) antes do promotor do gene de lisozima de galinha, uma unidade transcripcional eucaritica tpica. Stios hiper-sensveis isto , seqncias prximas ao gene da lisozima que so particularmente susceptveis digesto por nucleases mesmo quando empacotadas em cromatina so indicados por setas. provvel que esses stios quem livres de nucleossomos. Note que alguns stios hipersensveis so encontrados no promotor da lisozima tanto em oviduto maduro como imaturo. Induo da sntese de lisozima em oviduto maduro acompanhada pelo aparecimento de um novo stio hipersensvel. Em contraste, nenhum stio hipersensvel est presente em eritrcitos nucleados que nunca sintetizam lisozima. Adaptado de Elgin, S. C. R. J. Biol. Chem. 263:1925, 1988.

Outras modicaes de histonas que inuenciam atividade gnica incluem metilao, fosforilao e ubiquitinao. Combinaes dessas modicaes ocorrendo em diferentes posies especcas em histonas podem constituir um cdigo histona que acopla modicao de histonas, compactao de cromatina, modicao do DNA e atividade gnica (Corr. Cln. 5.2). A idia geral que cromatina parcialmente desdobrada seja necessria, mas no suciente, para transcrio.

Ativao de Transcrio Opera por Recrutamento de RNA Polimerase


Fatores proticos eucariticos, independentemente da seqncia qual se liguem, operam de modo fundamentalmente diferente do fator de E.coli. Em vez de primeiro fazer parte de um complexo protico e depois procurar a seqncia relevante no DNA, os fatores se ligam a um stio especco (seqncia) do DNA e depois ligam RNA polimerase (com ou sem envolvimento de fatores intermedirios). Esse mecanismo chamado recrutamento. Recrutamento um meio pouco importante em ativao de genes em procariotos, e o principal mecanismo em eucariotos.

Enhancers
Enhancers ou amplicadores aumentam muitas vezes a expresso de um gene. Fatores de transcrio

BioQ.05 179

22.01.07 16:41:05

184

PARTE 2 TRANSMISSO DA INFORMAO

Nucleotdeos entram e RNA sai por dois outros canais separados na molcula. A despeito das diferenas em seqncias e composio em subunidades, RNA polimerases procariticas e eucariticas mantiveram estruturas semelhantes para desempenhar os mesmos objetivos levando sntese de uma nova cadeia de RNA. Estas incluem: (1) passagem do DNA molde por um canal na enzima; (2) separao das tas de DNA para formar uma bolha na qual um hbrido RNA-DNA existe com a extremidade 3 da cadeia de RNA posicionada no stio ativo; (3) colocao de nucleotdeos no stio ativo por um poro da enzima; (4) uso de um on metlico para ajudar na catlise da formao de uma nova ligao ster fosfato entre o fosfato do nucleosdeo trifosfato que est chegando e a extremidade 3 da cadeia nascente de RNA; (5) excluso do RNA produzido por outro poro; e (6) direo do re-pareamento das duas tas de DNA, medida que saem da enzima. Lembre-se que a subunidade da holoenzima procaritica responsvel por ligar as caixas 10 e 35 de promotores. Estudos estruturais demonstraram que sigma uma molcula oblonga, composta por um feixe de resduos em -hlice, empacotados em uma forma de V aberto. Um brao do V contm resduos crticos para reconhecimento do promotor e ligao com polimerase core. Um lado desse brao contm uma -hlice que se liga seqncia 10, e a outra face liga polimerase core por interaes hidrofbicas.

ordem temporal bem denida, mas no necessariamente rgida. Primeiro, o transcrito primrio cortado de modo relativamente inespecco para gerar uma molcula precursora com extenses 5 e 3 mais curtas. Ento ribonuclease P, uma ribozima (ver p. 68), remove a extenso 5 por clivagem endonucleoltica. A extremidade 3 cortada exonucleoliticamente, seguida por sntese da terminao CCA. Sntese dos nucleotdeos modicados ocorre em qualquer ordem em relao clivagem nucleoltica. Remoo de ntrons determinada pela estrutura secundria do precursor (ver Figura 5.10) e executada por um sistema enzimtico solvel, com dois componentes; uma enzima remove o ntron e a outra sela novamente a cadeia nucleotdica.

Adio na Extremidade 3
Todo tRNA funcional tem a seqncia CCA em sua extremidade 3. Essa seqncia essencial para tRNA aceitar aminocidos. Na maioria dos casos, adicionada seqencialmente pela enzima tRNA nucleotidiltransferase. Nucleotidiltransferases usam ATP e CTP como substratos e sempre incorporam-nos em tRNA numa razo de 2C/1A. As extremidades CCA so encontradas tanto em tRNAs citoplasmticos como mitocondriais.

Nucleosdeos Modicados
Nucleotdeos de RNA transportador so os mais modicados de todos os cidos nuclicos. Mais de 60 modicaes diferentes nas bases e na ribose, exigindo bem mais de 100 diferentes reaes enzimticas, foram encontradas em tRNA. Muitas so simples, metilaes de uma etapa, mas outras envolvem sntese com mltiplas etapas. Formao de algumas bases modicadas na realidade requer quebra da ligao -glicosdica entre ribose e a base. Enzimas modicadoras produzem as mesmas modicaes especcas em mais de uma espcie de tRNA; entretanto, as enzimas modicadoras so localespeccas. A maioria das modicaes se completa antes de os precursores de tRNA terem sido clivados ao tamanho do tRNA maduro.

5.4 PROCESSAMENTO DE RNA


Cpias em RNA de seqncias de DNA devem ser modicadas em molculas maduras, funcionais, em procariotos e eucariotos. As reaes de processamento do RNA podem incluir remoo de nucleotdeos extras, modicao de bases, adio de nucleotdeos e separao de diferentes seqncias de RNA pela ao de nucleases especcas. Reaes de processamento podem ocorrer cotranscripcionalmente (enquanto o RNA ainda est sendo transcrito) ou ps-transcripcionalmente (depois do transcrito ter sido liberado pela RNA polimerase). Finalmente, em eucariotos, RNAs so exportados do ncleo.

RNA Transportador Modicado por Clivagem, Adio e Modicao de Bases


Clivagem
O transcrito primrio de um gene de tRNA contm seqncias extras de nucleotdeos, tanto 5 como 3 da seqncia do tRNA. Esses transcritos primrios tambm podem conter ntrons na regio do anticdon. Reaes de processamento ps-transcripcional ocorrem em uma

Processamento de RNA Ribossmico Libera Vrios RNAs de um Precursor Mais Longo


O produto primrio da transcrio do gene de rRNA um RNA longo, chamado 45S RNA, que contm as seqncias dos rRNAs 28S, 5,8S e 18S. Processamento do 45S RNA ocorre no nuclolo, e feito por grandes estruturas de ribonucleoprotenas, com mltiplas subunidades. Processamento dos rRNAs segue uma ordem seqencial (Figura 5.11). Processamento de pr-rRNA em procariotos tambm envolve clivagem de precursores de alto peso molecular

BioQ.05 184

22.01.07 16:41:13

CAPTULO 5 RNA: TRANSCRIO E PROCESSAMENTO

193

CORRELAO CLNICA 5.6

Sndrome de Cockayne
Sndrome de Cockayne (CS) uma doena complexa autossmica recessiva causada por uma mutao em um de dois genes. Pacientes com CS apresentam alteraes de desenvolvimento e neurolgicas, anomalias esquelticas e de retina, e uma deformidade facial tipo pssaro. Morte geralmente ocorre por volta dos 20 anos de idade e causada por degenerao neural. A maioria dos pacientes com sndrome de Cockayne so tambm fotossensveis e predispostos a cncer de pele. Fotossensibilidade aponta para um defeito em reparo do DNA. Por exemplo, xeroderma pigmentoso (XP) resulta de mutaes em vrios dos componentes da via de reparo do DNA. CS tambm uma decincia em reparo do DNA. Surpreendentemente, um dos dois genes responsveis pela sndrome uma subunidade da RNA polimerase II. A protena codicada pelo gene da sndrome de Cockayne B aumenta a velocidade de elongao pela RNA polimerase II. Como pode uma decincia de RNA polimerase causar um problema no reparo do DNA? A resposta que os pacientes com CS so decientes no reparo do DNA acoplado transcrio. Reparo acoplado transcrio ocorre quando RNA polimerase ca parada por ter encontrado uma base alterada (p. ex., um fotodmero de timina). Transcrio pra, o transcrito parcial degradado, e a ta molde do DNA reparada. Aparentemente, aumento da transcrio pela protena CSB tambm estimula o reparo do DNA acoplado transcrio. Se esta fosse toda a histria, sndrome de Cockayne seria uma variante do xeroderma pigmentoso; entretanto, pacientes com XP tm desenvolvimento normal e so neurologicamente normais, embora ainda sejam fotossensveis. O que causa as outras caractersticas de CS? provvel que esses outros sintomas sejam devidos a uma decincia primria na elongao da transcrio causada pelo fator de elongao CSB alterado pela mutao. Essa idia expande nosso entendimento da relao entre mutao e doena. Geralmente, doenas genticas so causadas por uma mutao em processos bioqumicos que cam fora das vias centrais de informao da clula. Isso faz sentido, porque inibio geral da sntese de DNA, RNA ou protena seria letal num estgio precoce do desenvolvimento. Os defeitos generalizados de CS devem se dever mutao afetando a transcrio de alguns genes mais do que a de outros.

Fonte: Citterio, E., Vermeulen, W. e Hoeijmakers, J. H. J. Transcriptional healing. Cell 101:447, 2000; Selby, C. P. e Sancar, A. Cockayne syndrome group B protein enhances elongation by RNA polymerase II. Proc. Natl. Acad. Sci. U.S.A. 94:11205, 1997. van Gool, A. J., van der Horst, G. T. J., Citterio, E. e Hoeijmakers, J. H. J. Cockayne syndrome: defective repair of transcription? EMBO J. 16:4155, 1997. Cockayne Syndrome, Type I; CKN1 in Online Mendelian Inheritance in Man, http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=216400

5.8 NUCLEASES E TURNOVER DO RNA


As diferentes funes de RNA e DNA em expresso gnica reetem-se em seus destinos metablicos. O repositrio de informao gentica de uma clula (DNA) deve ser preservado, explicando assim a existncia dos mltiplos sistemas de reparo e edio do DNA no ncleo. Embora seqncias individuais de nucleotdeos no DNA possam ser recicladas, a molcula como um todo metabolicamente inerte quando no est replicando. As vrias molculas de RNA, por outro lado, so individualmente dispensveis e podem ser substitudas por espcies recm-sintetizadas com a mesma especicidade. No surpreendente que sistemas de reparo de RNA no sejam conhecidos. Em vez disso, RNAs defeituosos so removidos das clulas por degradao a nucleotdeos, que depois so reutilizados em novas espcies de RNA.

Isso mais claro para espcies de mRNA, que so classicadas como instveis. Entretanto, mesmo os RNAs ditos estveis so reciclados; por exemplo, a meia vida de espcies de tRNA no fgado cerca de 5 dias. Uma meia vida bastante longa para um mRNA de mamferos 30 h. Remoo de RNAs do citoplasma realizada por ribonucleases celulares. Nucleases so de vrios tipos e especicidades. A distino mais til entre exonucleases, que degradam RNA a partir da extremidade 5 ou 3, e endonucleases, que clivam ligaes fosfodister dentro de uma molcula. Produtos de ao de RNase contm fosfatos 3- ou 5-terminal, e tanto endo- como exonucleases podem ser melhor caracterizadas pela posio (5 ou 3), na qual o monofosfato criado pela clivagem ca localizado. A estrutura do RNA tambm afeta a ao da nuclease. A maioria das nucleases menos eciente em regies de RNA com estrutura muito ordenada. Assim, tRNAs so preferencialmente clivados em regies no-pareadas da seqncia. Por outro lado,

BioQ.05 193

22.01.07 16:41:25

CAPTULO 6 SNTESE DE PROTENAS: TRADUO E MODIFICAES PS-TRADUO

197

PARTE 2 TRANSMISSO DA INFORMAO

SNTESE DE PROTENAS: TRADUO E MODIFICAES PS-TRADUO


Dohn Glitz
6.1 VISO GERAL, 198 6.2 COMPONENTES DO APARELHO DE TRADUO, 198 RNA mensageiro transmite informao codicada em DNA, 198 RNA transportador uma molcula tradutora bilnge, 199 O cdigo gentico usa um alfabeto de quatro letras de nucleotdeos, 199 Cdons em mRNA so palavras de trs letras, 199 Pontuao, 199 Interaes cdon-anticdon permitem leitura de mRNA, 199 Decifrando o cdigo gentico, 200 Mutaes, 201 Aminoacilao de RNA transportador ativa aminocidos para sntese protica, 203 Especicidade e delidade de reaes de aminoacilao, 205 Ribossomos so bancadas de trabalho para sntese protica, 205 6.3 BIOSSNTESE DE PROTENAS, 209 Traduo direcional e colinear com mRNA, 209 Iniciao da sntese de protenas um processo complexo, 209 Elongao a formao passo a passo de ligaes peptdicas, 211 Terminao da sntese do polipeptdeo requer um cdon de parada (stop codon), 215 Traduo tem custo energtico signicativo, 215 Sntese de protenas em mitocndrias difere ligeiramente, 215 Alguns antibiticos e toxinas inibem biossntese de protenas, 215 6.4 AMADURECIMENTO DE PROTENAS: DOBRAMENTO, MODIFICAO, SECREO E DIRECIONAMENTO, 218 Chaperones ajudam em dobramento de protenas 218 Protenas para exportao seguem a via secretria, 218 Glicosilao de protenas ocorre no retculo endoplasmtico e no complexo de Golgi, 218 6.5 DIRECIONAMENTO PARA MEMBRANA E ORGANELAS, 224 Seleo de protenas na via secretria, 224 Importao de protenas por mitocndrias requer sinais especcos, 227 Direcionamento para outras organelas requer sinais especcos, 227 6.6 MAIS MODIFICAES PS-TRADUO, 227 Protelise parcial libera insulina e ativa zimognios, 227 Aminocidos podem ser modicados aps incorporao em protenas, 228 Biossntese de colgeno requer muitas modicaes ps-traduo, 231 Formao de pr-colgeno no retculo endoplasmtico e no complexo de Golgi, 231 Maturao de colgeno, 231 6.7 REGULAO DA TRADUO, 234

BioQ.06 197

22.01.07 16:43:42

CAPTULO 6 SNTESE DE PROTENAS: TRADUO E MODIFICAES PS-TRADUO

209

sintetizam protenas que sero secretadas da clula ou seqestradas e funcionam em retculo endoplasmtico, complexo de Golgi ou lisossomos. Em homogenatos celulares, fragmentos de membranas com ribossomos ligados constituem a frao microssomal ; detergentes que destroem membranas liberam esses ribossomos.

6.3 BIOSSNTESE DE PROTENAS


Traduo Direcional e Colinear com mRNA
Seqncias de RNA mensageiro so escritas (e transcritas) 53, e durante traduo so lidas na mesma direo. Seqncias de aminocidos so tanto escritas como sintetizadas do resduo amino-terminal para o carboxi-terminal. Um ribossomo permanece ligado a uma molcula de mRNA e se move ao longo do comprimento do mRNA at que chegue a um cdon de parada. Comparaes de seqncias de mRNA com seqncias das protenas que codicam mostraram uma correspondncia perfeita, colinear, sem sobreposies e sem falhas entre a seqncia codicadora do mRNA e a do polipeptdeo sintetizado. (Para uma rara exceo, ver Corr. Cln. 6.4). De fato, comum deduzir a seqncia de uma protena, exclusivamente a partir da seqncia de seu mRNA ou do DNA de seu gene. Entretanto, a seqncia deduzida pode diferir da protena genuna, devido a modicaes ps-traduo. Uma histria pode ser analisada em funo de seu incio, seu desenvolvimento ou parte do meio e seu nal. Biossntese de protenas ser descrita num arcabouo semelhante: incio do processo, elongao durante a qual a maior parte da protena formada, e terminao da sntese e liberao do polipeptdeo completo. Vamos depois examinar modicaes ps-traduo, pelas quais uma protena pode passar.

Iniciao da Sntese de Protenas um Processo Complexo


Iniciao requer aproximao de uma subunidade ribossmica pequena (40 S), um mRNA e um complexo tRNA do aminocido amino-terminal, todos em uma orientao correta. Segue-se associao da subunidade grande (60 S) para formar um complexo de iniciao completo em um ribossomo 80 S. Esse processo requer um grupo de protenas ligadas transitoriamente, conhecidas como fatores de iniciao, que s atuam na iniciao. A funo especca de alguns fatores de iniciao eucariticos permanece pouco clara, mas sntese de protenas procaritica fornece um modelo mais simples para comparao. A iniciao da traduo apresentada na Figura 6.7. Como primeira etapa, fator de iniciao eucari-

tico 2a (eIF-2a) liga-se a GTP e ao tRNA iniciador, MettRNA imet, para formar um complexo ternrio. Nenhum outro aminoacil-tRNA pode substituir o Met-tRNA imet iniciao-especco nessa etapa. Procariotos tambm utilizam um tRNA iniciador especco, cuja metionina modicada por formilao de seu amino grupo. S fMettRNA imet reconhecido pelo IF-2 procaritico. A segunda etapa requer subunidades ribossmicas 40 S associadas a uma protena muito complexa, eIF-3. eIF-3 de mamferos contm oito polipeptdeos diferentes e tem uma massa de 600-650 kDa; liga-se superfcie da subunidade 40 S que far contato com a subunidade 60 S e bloqueia sicamente a associao das subunidades. Portanto, eIF-3 um fator antiassociao ribossmica assim como eIF-6 que se liga a subunidades 60 S. Um complexo que inclui eIF-2a-GTP, Met-tRNA i Met, eIF-3-40 S e fatores proticos adicionais agora se forma. Na terceira etapa, o complexo de priniciao formado: mRNA, eIF-4f, tambm chamado complexo de ligao ao cap, eIF-4a, uma helicase que desenrola estrutura secundria da seqncia lder no-traduzida do mRNA, PAB, uma protena de ligao a poliA que faz uma ala aproximando a extremidade 3 do mRNA do 5- cap, e vrias outras protenas so necessrias. O mRNA ento percorrido 53 at que o primeiro triplete AUG seja encontrado. Raramente, o primeiro AUG no usado e um AUG posterior, caracterizado por sua estrutura secundria no mRNA, selecionado para iniciao. GTP hidrolisado por eIF-2a com a ajuda de eIF-5, e eIF-2a-GDP e outros fatores so liberados. O eIF-2a-GDP interage com fator trocador de nucleotdeo de guanina eIF-2b e GTP para regenerar eIF-2a-GTP para outro ciclo de iniciao. A etapa nal requer ligao desse complexo com uma subunidade 60S e um fator adicional, eIF-5b-GTP. GTP hidrolisado, e eIF-5b-GDP e outros fatores so liberados. O complexo de iniciao completo um ribossomo 80 S com o mRNA e tRNA iniciador corretamente posicionados para comear traduo. Procariotos usam menos fatores de iniciao para formar um complexo de iniciao similar. Suas subunidades 30 S, complexadas com um IF-3 mais simples, podem ligar mRNA ou um complexo ternrio de IF-2, fMet-tRNA i met e GTP. Orientao do mRNA depende, em parte, do pareamento de bases entre uma seqncia rica em pirimidinas de oito nucleotdeos no 16 S rRNA e uma seqncia Shine-Dalgarno rica em purinas, cerca de 10 nucleotdeos antes do cdon AUG iniciador. Complementaridade entre rRNA e mRNA pode incluir vrios pares errados, mas maior complementaridade geralmente leva a iniciao que mais eciente. Fator de iniciao IF1 tambm atua na formao do complexo de pr-iniciao. Finalmente, subunidade 50 S ligada, GTP hidrolisado a GDP e os fatores de iniciao so liberados. interessante que procariotos usem pareamento de bases RNA-RNA para posicionar mRNA, enquanto eucariotos usam muitos fatores proticos para chegar ao mesmo resultado.

BioQ.06 209

22.01.07 16:43:55

CAPTULO 6 SNTESE DE PROTENAS: TRADUO E MODIFICAES PS-TRADUO

219

CORRELAO CLNICA 6.6

Deleo de um Cdon, Modicao Ps-Traduo Incorreta e Degradao Prematura de Protena: Fibrose Cstica
Fibrose cstica a doena autossmica recessiva mais comum em caucasianos, com uma freqncia de cerca de 1 por 2000. O gene CF tem 230 kb de comprimento e inclui 27 xons que codicam uma protena de 1480 aminocidos. A protena conhecida como regulador de condutncia transmembrnica da brose cstica ou CFTR (ver p. 474) um membro de uma famlia de protenas de transporte dependentes de ATP. Contm dois domnios que atravessam a membrana, cada um com seis regies transmembrnicas, dois domnios de ligao a ATP e um domnio regulatrio que inclui vrios stios de fosforilao. CFTR funciona como um canal de cloreto regulado por AMP cclico. Epitlios em CF caracterizam-se por transporte defeituoso de eletrlitos. Os rgos mais afetados incluem pulmes, pncreas e fgado, e os efeitos que mais oferecem risco de vida envolvem secrees mucosas viscosas que levam a doena pulmonar obstrutiva crnica e infeces persistentes nos pulmes. Em cerca de 70% dos indivduos afetados, h uma deleo dos trs nucleotdeos que codicam fenilalanina 508, normalmente localizada no domnio 1 de ligao ao ATP, no lado citoplasmtico da membrana plasmtica. Como em vrias outras mutaes CF, a protena com deleo de Phe 508 no se dobra corretamente no ER e no adequadamente glicosilada ou transportada para a superfcie celular. Em vez disso, devolvida ao citoplasma para ser degradada nos proteassomos. Uma abordagem teraputica, ainda no aplicada em pacientes, usa drogas que mimetizam interaes chaperones com CFTR mutante e ajudam-nas em seu dobramento e transporte para a membrana.

Fonte: Ward, C., Omura, S., e Kopito, R. Degradation of CFTR by the ubiquitin-proteasome pathway. Cell 83:121, 1995. Plemper, R. K. e Wolf, D. H. Retrograde protein translocation: Eradication of secretory proteins in health and disease. Trends Biochem. Sci. 24:266, 1999. Egan, M. E., Pearson, M., Weiner, S. A., Rajendran, V., Rubin, D., GlocknerPagel, J., et al. Curcumin, a major constituent of turmeric, corrects cystic brosis defects. Science 304:600, 2004.

na nascente, a seqncia sinal hidrofbica inserida, e traduo e extruso no, ou atravs do, translocon esto agora acopladas. Mesmo segmentos muito hidroflicos ou carregados so direcionados atravs da membrana para o lmen do ER. O peptdeo sinal excisado pela peptidase sinal, uma protena integral de membrana da face luminal do ER. A protena pode dobrar, e componentes de protenas formadas por mltiplas subunidades podem se organizar. Outras etapas podem incluir processamento proteoltico e glicosilao, que ocorre no lmen do ER e durante trnsito da protena pelo aparelho de Golgi e em vesculas secretrias.

Glicosilao de Protenas Ocorre no Retculo Endoplasmtico e no Complexo de Golgi


Glicosilao de protenas para formar glicoprotenas (ver p. 231) importante por muitas razes. Glicosilao altera as propriedades de protenas, modicando sua estabilidade, solubilidade e volume fsico. Alm disso, os resduos de carboidratos atuam como sinais de reconhecimento que podem dirigir a distribuio de protenas e inuenciar interaes clula-clula e

FIGURA 6.12 Retculo endoplasmtico rugoso. Trs setas paralelas indicam trs ribossomos dentre os muitos ligados s membranas. Seta nica indica uma mitocndria, para comparao. Cortesia de Dr. U. Jarlfors, University of Miami.

BioQ.06 219

22.01.07 16:44:09

CAPTULO 6 SNTESE DE PROTENAS: TRADUO E MODIFICAES PS-TRADUO

235

ala da seqncia lder 5 do mRNA da ferritina (ver p. 807). Esse mRNA seqestrado para uso futuro. cido -aminolevulnico sintase, uma enzima da biossntese de heme, tambm regulada por um 5-IRE no seu mRNA. Em contraste, mais mRNA do receptor de ferritina necessrio se ferro estiver limitado; seu mRNA tem IREs em sua regio 3 no-traduzida. Ligao da protena repressora estabiliza o mRNA e prolonga sua vida til. Muitos mRNAs regulados por crescimento, incluindo os de protenas ribossmicas, tm um encadeamento de polipirimidinas em sua seqncia lder. Uma protena que se liga a polipirimidinas ajuda a regular sua traduo. Molculas pequenas de RNA regulam biossntese de protenas em dois nveis. Micro-RNAs (miRNA) so RNAs de 21 a 23 nucleotdeos de comprimento que so formados a partir de RNAs maiores dupla-ta ou grampo por uma endonuclease citoplasmtica chamada Dicer. Uma RNA helicase separa as tas, uma das quais ligada por um complexo silenciador induzido por RNA ( RISC) que guia o miRNA para seqncias complementares no mRNA. Formao de um duplex mRNA-miRNA imperfeito reprime traduo, mas no afeta estabilidade do mRNA. Interao cooperativa de mltiplos miRNAs com um mRNA aumenta ecincia de inibio. Dicer e RISC tambm geram duplexes perfeitamente complementares de molculas pequenas de RNA com mRNA. Esses complexos de RNA pequeno de interferncia (siRNA) resultam em clivagem e inativao do mRNA alvo por uma endonuclease RISC chamada slicer. RNAs de silenciamento e interferncia so importantes no desenvolvimento normal e no desenvolvimento de cncer.

tico gera peptdeos no-funcionais como o peptdeo-C da pr-insulina. Em todos os casos, um tratamento do lixo necessrio. Protelise reduz as protenas a peptdeos e eventualmente a aminocidos. A maioria desses aminocidos reciclada para sintetizar novas protenas, mas alguns so metabolizados e seus produtos de degradao so excretados. Proteases digestivas como pepsina, tripsina, quimotripsina e elastase hidrolisam protenas da dieta e no participam do turnover (reciclagem) intracelular de protenas, mas os aminocidos que geram contribuem para a reserva metablica usada na traduo. Isso particularmente necessrio para aminocidos essenciais (ver Tabela 19.1, p. 726).

Protelise Dependente de ATP Ocorre em Proteassomos


Uma via proteoltica bem descrita usa proteassomos, estruturas em forma de halteres que contm cerca de 28 polipeptdeos (Figura 6.22). Um ncleo cilndrico tampado em ambas as extremidades por complexos em forma de V que ajudam a reconhecer e desdobrar polipeptdeos e transport-los para o ncleo proteoltico em um mecanismo que depende de ATP. Direcionamento para proteassomos normalmente requer ubiquitina, uma protena muito conservada de 76 aminocidos. Protenas so marcadas para degradao por poliubiquitinao, como mostrado na Figura 6.23. Ubiquitina ativada por enzima E1 para formar um tioster; ATP necessrio e um complexo transitrio AMP-ubiquitina est envolvido. A ubiquitina , ento, passada para enzima E2 e, nalmente, via um grupo de complexos multiproticos E3, para uma protena alvo. Ligao da ubiquitina ocorre por ligaes isopeptdicas entre -amino grupos de resduos de lisina da protena e o resduo de glicina carboxi-terminal da ubiquitina. Vrias molculas de ubiquitina so ligadas protena e uma outra, e a protena poliubiquitinada levada aos proteassomos e degradada; uma isopeptidase libera ubiquitina intacta para ser reutilizada. Protenas danicadas, defeituosas, dobradas erroneamente ou mutadas so rapidamente degradadas pela via da ubiquitina. Uma mutao na brose cstica que resulta em deleo de um aminocido altera muito a estabilidade de CFTR (Corr. Cln. 6.6). Seleo de protenas nativas para degradao depende da especicidade da enzima E3; tanto conformao como seqncia de aminocidos so importantes. Seqncias desestabilizadoras PEST (ricas em Pro, Glu, Ser e Thr) foram identicadas em vrias protenas de vida curta, e um motivo de interao com ubiquitina, que liga ubiquitina e s vezes tambm promove poliubiquitinao, foi identicado. Outro determinante a identidade do aminocido amino-terminal. De acordo com a regra do N-terminal, protenas com resduos amino-terminais diferentes so degradadas a velocidades completamente diferentes, e o tempo de vida de uma protena pode ser modicado pela incorporao de um resduo N-terminal desestabi-

6.8 DEGRADAO E TURNOVER DE PROTENAS


Protenas tm tempos de vida que variam muito. Clulas do cristalino no so substitudas e suas protenas no so recicladas. Hemoglobina em eritrcitos dura o tempo de vida dessas clulas, cerca de 120 dias. Outras protenas tm tempos de vida medidos em dias, horas ou at minutos. Algumas protenas da coagulao do sangue sobrevivem apenas alguns dias, de modo que hemoflicos s esto protegidos por um curto perodo aps transfuso ou injeo de fatores necessrios. Diabticos requerem injees de insulina regularmente uma vez que o hormnio metabolizado. Enzimas metablicas variam quantitativamente, dependendo de necessidade ou mudana de situao; por exemplo, a concentrao de enzimas do ciclo da uria muda em resposta dieta. Protenas esto tambm sujeitas a danos por oxidao, protelise, desnaturao ou outras modicaes irreversveis. Erros em traduo e dobramento levam a protenas no-funcionais, e processamento proteol-

BioQ.06 235

22.01.07 16:44:26

CAPTULO 7 DNA RECOMBINANTE E BIOTECNOLOGIA

241

PARTE 2 TRANSMISSO DA INFORMAO


Plasmdeo Promotor Z Restrio ao stio A Restrico ao stio B Gene resistente antibiticos

DNA RECOMBINANTE E BIOTECNOLOGIA


Gerald Soslau
7.1 VISO GERAL, 242 7.7 DETECO E IDENTIFICAO DE CIDOS NUCLICOS E PROTENAS QUE LIGAM DNA, 254 cidos nuclicos como sondas ( probes) para seqncias especcas de DNA ou RNA, 254 Tcnica de Southern blot para identicar fragmentos de DNA, 255 Polimorsmo de conformao de cadeia nica, 256 Deteco de mRNA, 258 Deteco de protenas que se ligam a seqncia especca no DNA, 258 7.8 DNA COMPLEMENTAR E BIBLIOTECAS DE DNA COMPLEMENTAR, 260 mRNA como molde para sntese de DNA usando transcriptase reversa, 260 mRNA desejado pode ser enriquecido por tcnicas de separao, 261 Sntese de DNA complementar, 261 RNA celular total como molde para sntese de DNA usando RT-PCR, 262 7.9 BACTERIFAGOS, COSMDEO E VETORES DE CLONAGEM EM LEVEDURA, 262 Bacterifagos como vetores de clonagem, 263 Examinando (screening) bibliotecas de bacterifagos, 264 Clonando fragmentos de DNA em cosmdeos e vetores cromossomos articiais, 264 7.10 ANLISE DE LONGAS SEQNCIAS DE DNA, 265 Subclonagem permite denio de grandes segmentos de DNA, 265 Caminhar nos cromossomos (chromosome walking) dene arranjo de genes em segmentos longos de DNA, 265

7.2 A REAO DE POLIMERASE EM CADEIA (POLYMERASE CHAIN REACTION), 243 7.3 ENDONUCLEASES DE RESTRIO E MAPAS DE RESTRIO, 243 Endonucleases de restrio hidrolisam seletivamente DNA, 243 Mapas de restrio permitem preparao rotineira de segmentos denidos de DNA, 245 7.4 SEQENCIAMENTO DE DNA, 245 Mtodo de clivagem enzimtica interrompida: procedimento de Sanger, 246 7.5 DNA RECOMBINANTE E CLONAGEM, 248 DNAs de diferentes fontes podem ser ligados para formar uma nova espcie de DNA: DNA recombinante, 248 Vetores de DNA recombinante so produzidos por clonagem, 249 Clonagem direcional: DNA inserido em DNA vetor em uma direo especca, 249 Bactrias transformadas com DNA recombinante e necessidade de um processo de seleo, 250 Molculas de DNA recombinante em uma biblioteca gnica, 250 PCR contorna a necessidade de clonar DNA, 251 7.6 SELEO DE UM DNA ESPECFICO CLONADO EM BIBLIOTECAS, 252 Seleo de bactria transformada por perda de resistncia a antibitico, 252 -Complementao para selecionar bactrias que carregam plasmdeos recombinantes, 254

BioQ.07 241

22.01.07 16:48:30

254

PARTE 2 TRANSMISSO DA INFORMAO

-Complementao para Selecionar Bactrias que Carregam Plasmdeos Recombinantes


Vetores foram construdos (a srie pUC) de tal modo que bactrias selecionadas transformadas com esses vetores carregando insertos de DNA estrangeiro, podem ser identicadas visualmente (Figura 7.10). Os plasmdeos pUC contm as seqncias regulatrias e parte da seqncia 5-codicadora (146 aminocidos N-terminais) do gene da -galactosidase (gene lacZ ) do operon lac (ver p. 293). O fragmento traduzido N-terminal da -galactosidase um polipeptdeo inativo. E. coli mutante, que codica a poro carboxi-terminal inativa que falta da -galactosidase, pode ser transformada usando-se os plasmdeos pUC. A traduo das pores da -galactosidase do plasmdeo e a da clula hospedeira em resposta a um indutor, isopropil tio --d-galactosdeo, se complementam mutuamente gerando uma enzima ativa. O processo chamado -complementao. Quando essas bactrias transformadas so crescidas em presena de um substrato cromognico (5-bromo-4-cloro-3-indolil- -D-galactosdeo [X-gal]) para a -galactosidase, formam colnias azuis. Se, entretanto, um fragmento de DNA estrangeiro for inserido na seqncia da poro N-terminal da -galactosidase, a enzima ativa no pode ser formada. Bactrias transformadas com esses plasmdeos recombinantes e crescidas em X-gal do colnias brancas e podem ser selecionadas visualmente, das colnias azuis no transformadas.
Stio de policlonagem

7.7 DETECO E IDENTIFICAO DE CIDOS NUCLICOS E PROTENAS QUE LIGAM DNA


cidos Nuclicos como Sondas (Probes) para Seqncias Especcas de DNA ou RNA
Sondas de DNA e RNA so usadas para seleo de bactrias que abrigam DNA recombinante de interesse, para anlise de mRNA expresso em uma clula ou para identicao de seqncias de DNA em um genoma. Contm seqncias complementares ao cido nuclico alvo e hibridizam com o cido nuclico de interesse. O grau de complementaridade determina a fora de ligao da sonda. A sonda no precisa conter a seqncia complementar inteira do DNA. A sonda pode ser marcada, geralmente com 32P ou com marcas no-radioativas que dependem de substratos de enzimas acoplados a nucleotdeos que, quando incorporados ao cido nuclico, podem ser detectados por uma reao catalisada por enzima. Sondas marcadas podem ser produzidas por nick translation (traduo com corte) do DNA dupla-ta.

ampr

pUC 18 2686 bp

Seqncia codificadora N-terminal do gene da -galactosidase do operon-

N-terminal interrompido ampr pUC 18 2686 bp DNA estranho inserido N-terminal interrompido Transformao

Promotor Transformao Cromossomo

pUC18

Seqncia codificadora N-terminal do gene da -galactosidase do operon-

pUC18 recombinante A bactria cresce em agar contendo X-gal a um indutor do operon

A bactria cresce em agar contendo X-gal a um indutor do operon

Colnias brancas contm pUC18 recombinante Colnias azuis Colnias azuis contm pUC18 sem o DNA estrangeiro

FIGURA 7.10 -Complementao para deteco de bactrias transformadas. Um vetor construdo (pUC 18) expressa a seqncia codicadora N-terminal da enzima -galactosidase do operon lac. Bactrias mutantes que codicam a regio C-terminal da -galactosidase so transformadas com pUC 18. Essas bactrias transformadas, crescidas em presena de um substrato especial para a enzima intacta (X-gal), resultam em colnias azuis, porque contm a enzima para reagir com o substrato. As seqncias codicadoras funcionais N-terminal e C-terminal do gene complementam-se mutuamente, gerando uma enzima funcional. Se, entretanto, um fragmento de DNA estrangeiro for inserido, interrompe a seqncia codicadora N-terminal da -galactosidase, bactrias transformadas com essa molcula recombinante no produziro enzima funcional. Colnias de bactrias que contm esses vetores recombinantes podem ser detectadas visualmente como colnias brancas.

BioQ.07 254

22.01.07 16:48:41

CAPTULO 7 DNA RECOMBINANTE E BIOTECNOLOGIA

259

CORRELAO CLNICA 7.6

Polimorsmo de Conformao de Cadeia-nica para Deteco de Mutaes Espontneas que Podem Levar a SIDS
A sndrome da morte sbita infantil (SIDS) uma causa importante de morte durante o primeiro ano de vida nos Estados Unidos. Estudo prospectivo em mais de 34.000 recm-nascidos que foram monitorados por eletrocardiograa indicou uma forte correlao entre risco aumentado de SIDS e intervalo QT prolongado em seu ECG. Com base nesse estudo, decidiu-se procurar uma mutao em um ou mais dos genes que se sabe estarem relacionados com a sndrome do QT longo em uma criana de 44 dias de idade, que se apresentou ciantica, apnica e sem pulso ao pronto-socorro de um hospital. A arritmia da criana com um intervalo QT prolongado foi estabilizada com mltiplos eletrochoques DC, seguidos de tratamento com drogas. DNA genmico foi preparado a partir de linfcitos do sangue perifrico da criana e de seus pais. Um gene associado com a sndrome do QT longo continha a substituio de AAC para TCC na posio 2971 a 2972 (protena associada com o canal de sdio), por anlise de polimorsmo de conformao de cadeia-nica (SSCP) na amostra de DNA da criana, mas no dos pais. A mutao substituiu um resduo de serina por uma asparagina em uma regio muito conservada da protena, que se presume participe da funo do canal de sdio. A mutao no foi detectada em 200 indivduos controles. A concluso foi que a criana tinha uma mutao espontnea em um gene associado com intervalo QT prolongado e isso contribuiu para um evento tipo SIDS. Aps tratamento, a criana cou sem nenhum sintoma por volta dos cinco anos de idade. Esse estudo indica o valor potencial do exame eletrocardiogrco neonatal para reduzir mortalidade infantil por SIDS.

Fonte: Schwartz, P. J., Priori, S. G., Dumaine, R. Napolitano, C., Antzelevitch, C., Stramba-Badiale, M., Richard, T. A., Berji, M. R. e Bloise, R. A molecular link between the sudden infant death syndrome and the long-QT syndrome. N. Engl. J. Med. 343:262, 2000.

(a) Soluo de hidrizao Sonda X 250 bases

+ +

Sonda Y

300 bases

mRNAX

mRNAY 400 bases

Outros RNAs

Sonda Z mRNAZ (b) Digesto com nuclease Hbrido X 250 bp

+
e sondas no hidridizadas

Hbrido Y

300 bp

Hbrido Z

400 bp

FIGURA 7.13 Ensaio de proteo de nuclease. mRNA celular total pode ser isolado de diferentes tecidos. Sondas de DNA ta-nica que so complementares a seqncias conhecidas de diferentes genes transcritos (mRNAx, mRNAy, mRNAz) so hibridizadas com a mistura de RNAs. Digesto com uma ribonuclease hidrolisar as regies de RNA ta-nica de mRNA no-hibridizado com a sonda de DNA e todas as espcies de RNA que no hibridizaram. S os hbridos DNA-RNA protegidos da nuclease permanecero para anlise por eletroforese em gel de poliacrilamida. Expresso diferencial de genes em diferentes tecidos , ento, facilmente observada

(c ) Reaes de amostras de RNA de diferentes tecidos analisadas por eletroforese em gel de poliacrilamida. Corao Crebro Pulmo

Padro

400 bp 300 bp 250 bp

BioQ.07 259

Pele

22.01.07 16:48:46

272

PARTE 2 TRANSMISSO DA INFORMAO


Gene Z truncado

RE Gene clonado Endonucleose de restrio (RE) Gene clonado e purificado

Stio de policlonagem

RE PLASMDEO Transformar susceptvel Isolar DNA fita nica de M13 recombinante do meio

Elemento regulatrio de Z

Vetor M13

Fita recombinante () do M13

M13 RECOMBINANTE

Oligmero com um nico nucleotdeo com pareamento errado

DNA polimerase quatro dNTPs, DNA ligase

5 3

DNA ligado a filtro de nitrocelulose com NaOH, hibridizado com sonda marcada para o oligmero com pareamento errado

Transformar suscetvel e plaquear o bacterifago resultante contendo M13 tipo selvagem mais DNA mutado sobre o tapete de crescida em agar

Tocar a placa de agar com filtro de nitrocelulose Mutante putativo

FIGURA 7.25 Mutagnese stio-dirigida de um nico nucleotdeo e deteco do DNA mutado. A gura uma viso geral simplicada do mtodo. Esse processo envolve a insero de um fragmento de DNA amplicado puro em um vetor bacterifago modicado, M13. E. coli susceptvel, transformada com o DNA recombinante de M13, sintetiza a ta (+) de DNA, acondicionada nas protenas do bacterifago. Os bacterifagos so isolados do meio de cultura, e o DNA do M13 recombinante ta-nica puricado. O DNA do M13 recombinante serve de molde para replicao do DNA por DNA polimerase, desoxinucleosdeos trifosfato (dNTPs), DNA ligase e um primer especial. O primer de DNA (oligmero com pareamento errado) sintetizado de modo a ser exatamente complementar a uma regio do DNA (gene) de interesse, exceto por uma base que se deseja alterar (mutar). O DNA do M13 recm-sintetizado, portanto, contm uma base especicamente mutada que, quando reintroduzida em E. coli susceptvel, ser elmente replicada. A E. coli transformada crescida em placas de agar com rplicas das colnias resultantes sendo feitas em ltro de nitrocelulose. DNA associado com cada colnia desnaturado e xado ao ltro com NaOH, e o DNA ligado ao ltro hibridizado com uma sonda oligmero de DNA marcada com 32P, com pareamento errado. Os mutantes putativos so, ento, identicados por exposio do ltro a lme de raio X.

Auto-radiografia

ta de M13 transformado em uma E. coli tipo-selvagem, a ta contendo uracil destruda e a ta mutada ()serve de molde para a prognese dos bacterifagos, a maioria dos quais carregando a mutao de interesse. O PCR tambm pode ser empregado para mutagnese stio-dirigida. Estratgias foram desenvolvidas para incorporar uma base com pareamento errado em um dos oligonucleotdeos que servem de primer para o PCR. Alguns desses procedimentos empregam bacterifago M13 e seguem os princpios descritos na Figura 7.26. Uma variao desses mtodos de PCR, mutagnese por PCR inverso, foi aplicada a pequenos plasmdeos recombinantes (4-5 kb) (Figura 7.25). O mtodo muito rpido, com 50-100% das colnias geradas contendo a seqncia mutante. Os dois primers so sintetizados de modo que pareiem nal-comnal com um primer contendo a base errada.

7.14 APLICAES DA TECNOLOGIA DO DNA RECOMBINANTE


Mtodos de DNA recombinante so aplicveis a numerosas disciplinas biolgicas incluindo agricultura, estudos de evoluo, biologia forense e clnica mdica. Engenharia gentica pode introduzir protenas novas ou alteradas em gros (p. ex., milho), de modo que eles contenham aminocidos essenciais para o homem mas freqentemente ausentes de protenas vegetais. Toxinas letais a insetos especcos, mas incuas ao homem, podem ser introduzidas em gros para protegerem as plantas, evitando assim o uso de pesticidas que agridem o meio ambiente. O DNA isolado de clulas do lquido amnitico de uma mulher grvida pode ser analisado quanto a defeitos genticos no feto. Quantidades mi-

BioQ.07 272

22.01.07 16:49:01

CAPTULO 8 REGULAO DA EXPRESSO GNICA

287

PARTE 2 TRANSMISSO DA INFORMAO

REGULAO DA EXPRESSO GNICA


Daniel L. Weeks e John E. Donelson

8.1 VISO GERAL, 288 8.2 UNIDADE DE TRANSCRIO EM BACTRIAS: O OPERON, 288 8.3 OPERON LACTOSE DE E. COLI, 288 Repressor do operon lactose uma protena difusvel, 290 Seqncia operador do operon lactose contgua a um promotor e trs genes estruturais, 291 RNA polimerase e uma protena reguladora reconhecem seqncia do promotor do operon lactose, 292 Protena ativadora de catablito liga promotor lactose, 292 8.4 OPERON TRIPTOFANO DE E. COLI, 293 Operon triptofano controlado por uma protena repressora, 293 Regio atenuadora do operon triptofano, 295 Atenuao da transcrio controla outros operons de biossntese de aminocidos, 296 8.5 OUTROS OPERONS BACTERIANOS, 297 Sntese de protenas ribossmicas regulada de modo coordenado, 297 Resposta estringente controla sntese de rRNAs e tRNAs, 297 8.6 TRANSPOSONS BACTERIANOS, 299 Transposons so segmentos mveis do DNA, 299 Transposons TN3 contm trs genes estruturais, 299

8.7 EXPRESSO GNICA EM EUCARIOTOS, 300 DNA eucaritico ligado a histonas para formar cromatina, 301 Metilao do DNA correlaciona-se com inativao de genes, 302 8.8 COMPLEXO DE PR-INICIAO EM EUCARIOTOS: FATORES DE TRANSCRIO, RNA POLIMERASE II E DNA, 303 Promotores eucariticos e outras seqncias que inuenciam transcrio, 305 Projeto modular de fatores de transcrio eucariticos, 305 Motivos comuns em protenas que ligam DNA e regulam transcrio, 306 8.9 REGULAO DA EXPRESSO GNICA EUCARITICA, 308 Regulando os reguladores, 309 Ativao da transcrio do gene do receptor de LDL ilustra muitas caractersticas encontradas na regulao gnica eucaritica, 309 BIBLIOGRAFIA, 312 QUESTES E RESPOSTAS, 312 CORRELAES CLNICAS 8.1 Resistncia Transmissvel a Mltiplas Drogas, 300 8.2 Sndrome de Rubstein-Taybi, 302 8.3 Tamoxifeno e Receptor de Estrgeno como Alvo, 309 8.4 Fatores de Transcrio e Doena Cardiovascular, 310

BioQ.08 287

22.01.07 16:52:32

CAPTULO 8 REGULAO DA EXPRESSO GNICA

297

inuencie a formao de alas em grampo alternativas, uma das quais lembrando um grampo de terminao seguido de vrios resduos U. Ao contrrio do operon trp, transcrio do operon his regulada primariamente por atenuao, uma vez que no possui um operador reconhecido por uma protena repressora. Em vez disso, o ribossomo age como uma protena reguladora positiva, semelhante ao complexo cAMP-CAP no operon lac. Se o ribossomo estiver ligado (i.., parado) no stio atenuador, transcrio dos genes estruturais a seguir estar aumentada. Se o ribossomo no estiver ligado, transcrio desses genes estar muito reduzida. Transcrio de alguns operons, mostrados na Figura 8.11, pode ser atenuada por mais de um aminocido. Por exemplo, o operon thr atenuado por treonina ou isoleucina, enquanto o operon ilv atenuado por leucina, valina ou isoleucina. Esse efeito pode ser explicado em todos os casos por pausa do ribossomo no cdon correspondente, o que interfere com formao de um grampo de terminao. possvel que em seqncias lderes mais longas, a pausa em mais de um cdon seja necessria para atingir mxima transcrio pela regio de atenuao.

Operon

Protena regulatria S8 L4 S7 S4 L1 L10

Protenas especificadas pelo operon

L14-L24-L5-S14-S8-L6-L18-S5-L15-L30 S10-L3-L2-L4-L23-S19-L22-S3-S17-L16-L29 S12-S7-EFG-EFTu S13-S11-S4--L17 L11-L1 L10-L7-

FIGURA 8.12 Operons contendo genes de protenas ribossmicas de E. coli. Genes dos componentes proticos das subunidades ribossmicas pequena (S) e grande (L) de E. coli cam agrupados em vrios operons. Alguns desses operons tambm contm genes das subunidades , e da RNA polimerase e fatores de sntese protica EF-G e EF-Tu. Pelo menos um dos produtos proticos de cada operon geralmente regula expresso desse operon (ver texto).

8.5 OUTROS OPERONS BACTERIANOS


Sntese de Protenas Ribossmicas Regulada de Modo Coordenado
Muitos operons bacterianos possuem os mesmos mecanismos regulatrios gerais dos operons lac, trp e his. Entretanto, cada operon tem suas prprias caractersticas distintas. Um exemplo dado pelos genes estruturais das 70 ou mais protenas que compem os ribossomos (Figura 8.12). Cada ribossomo contm uma cpia de cada protena ribossmica (exceto protenas L7L12, que provavelmente esto presentes em quatro cpias). Portanto, todas as 70 protenas so necessrias em quantidades equimolares, e faz sentido que sua sntese seja regulada de modo coordenado. Seis operons diferentes, contendo cerca de metade dos genes de protenas ribossmicas, ocorrem em dois grupos principais de genes. Um grupo contm quatro operons adjacentes (Spc, S10, str e a) e o outro grupo tem dois operons (L11 e rif ) localizados em outro ponto do cromossomo de E. coli. No h nenhum padro bvio de distribuio dos genes entre esses operons. Alguns operons codicam protenas de uma subunidade ribossmica; outros codicam protenas de ambas as subunidades. Esses operons tambm contm genes de outras protenas (relacionadas). Por exemplo, o operon str contm genes de fatores de elongao de traduo solveis, EF-Tu e EF-G, e genes de algumas protenas da subunidade ribossmica 30S. O operon a contm genes de protenas de ambas

as subunidades ribossmicas e um gene da subunidade da RNA polimerase. O operon rif tem os genes das subunidades e da RNA polimerase e de protenas ribossmicas. Uma caracterstica comum aos seis operons de protenas ribossmicas que sua expresso regulada por um dos produtos de seus prprios genes estruturais; isto , so auto-regulados. Em alguns casos, regulao ocorre em nvel de traduo, no de transcrio como discutido para operons lac e trp. Depois que o mRNA policistrnico feito, a protena ribossmica regulatria liga-se a esse mRNA e determina que regio, se alguma, ser traduzida. Em geral, a protena ribossmica que regula expresso de seu prprio operon associa-se com RNA ribossmico (rRNAs) no ribossomo. Essa protena tem uma alta anidade por rRNA e uma anidade menor por uma ou mais regies de seu prprio mRNA. Portanto, competio ocorre entre rRNA e o operon do mRNA pela ligao com a protena. medida que a protena se acumula, alcanando um nvel mais alto que o de rRNA livre, liga-se a seu prprio mRNA e impede sntese protica em uma ou mais das seqncias codicadoras desse mRNA (Figura 8.13). Quando mais ribossomos so formados, o excesso dessa protena ribossmica usado e traduo de seu mRNA pode recomear.

Resposta Estringente Controla Sntese de rRNAs e tRNAs


Bactrias respondem de vrias maneiras a extremo estresse geral. Uma dessas situaes quando h aminocidos insucientes para manter sntese protica. Nessas condies, a clula invoca a resposta estringente, que reduz sntese de rRNAs e tRNAs cerca de 20 vezes. Sntese de mRNAs tambm diminui cerca de trs vezes.

BioQ.08 297

22.01.07 16:52:44

300

PARTE 2 TRANSMISSO DA INFORMAO

CORRELAO CLNICA 8.1

Resistncia Transmissvel a Mltiplas Drogas


Uma tendncia alarmante que bactrias patognicas esto cando cada vez mais resistentes a um grande nmero de antibiticos. Muitos casos foram documentados, nos quais uma cepa bacteriana em um paciente que vinha sendo tratado com um antibitico, subitamente torna-se resistente a esse antibitico e, simultaneamente, a vrios outros antibiticos, embora essa cepa bacteriana nunca tenha sido exposta antes a esses outros antibiticos. Isso ocorre quando a bactria subitamente adquire, de outra cepa bacteriana, um plasmdeo que contm vrios transposons diferentes, cada um contendo um ou mais genes de resistncia a antibiticos. Exemplos incluem: os genes que codicam -lactamase, que inativa penicilina e cefalosporinas; a cloranfenicol acetiltransferase, que inativa cloranfenicol; e fosfotransferases, que modicam aminoglicosdeos, como neomicina e gentamicina. Fonte: Neu, H. C. The crisis in antibiotic resistance. Science 257:1064, 1992

8.7 EXPRESSO GNICA EM EUCARIOTOS


Transcrio de genes em organismos eucariticos tambm regulada para dar a resposta adequada a necessidades biolgicas. Alm de modular a expresso de genes em resposta a condies nutricionais ou ambientais, organismos multicelulares regulam a expresso de genes especializados que direcionam diferenciao celular e caracterizam tipos celulares especcos. Alguns genes (chamados genes zeladores ou housekeeping) so expressos na maioria das clulas, outros so ativados sob demanda e outros, ainda, cam permanentemente inativos em todos, exceto alguns poucos tipos de clulas. Em clulas eucariticas, a membrana nuclear serve de barreira que permite seletivamente o acesso de algumas protenas ao DNA, enquanto mantm outras no citosol. Em bactrias, uma RNA polimerase responsvel pela transcrio de todos os RNAs (tRNA, rRNA e mRNA). Em organismos eucariticos, trs RNA polimerases diferentes so usadas (ver p. 181). RNA polimerase I transcreve os genes de rRNA, RNA polimerase II transcreve os genes que codicam protenas, cujos transcritos se tornam mRNAs, e RNA polimerase III transcreve os genes de tRNAs e a maioria dos outros RNAs pequenos. Embora alguns princpios de ativao gnica e controle eucariticos se apliquem a todas as trs RNA polimerases, nesta seo o foco ser transcrio por RNA polimerase II. RNA polimerase II composta por pelo menos 10 subunidades diferentes, com tamanhos entre 10 e 220 kDa. Algumas das subunidades so tambm parte dos complexos das RNA polimerases I e III, enquanto outras so exclusivas da RNA polimerase II. A subunidade maior da RNA polimerase II tem, dependendo da espcie, at 52 repeties da seqncia de aminocidos PTSPSYS em sua regio C-terminal (CTD, C-terminal domain). Uma caracterstica prpria dessas repeties que treonina (T), serina (S) e tirosina (Y) podem ser fosforiladas. Para entender melhor a regulao da transcrio em eucariotos, til relembrar a organizao do DNA em cromatina e o papel de modicao no DNA, especialmente metilao de citosina, sobre ativao gnica. Alm disso, vamos considerar como RNA polimerase II posicionada no ponto correto do promotor de um gene para transcrever esse gene pela formao de um complexo de pr-iniciao, que envolve organizao de fatores de transcrio gerais ( TFs) com RNA polimerase II. A seguir, vamos ver como atividade de genes especcos pode ser regulada pelo uso de enhancers, stios de ligao de fatores de transcrio e stios de organizao de RNA polimerase. Finalmente, vamos discutir a ativao da transcrio por fatores de transcrio especcos, algumas de suas caractersticas gerais e como so regulados.

transcritos de modo divergente a partir de uma regio de controle de 163 pb, localizada entre eles, que liga o repressor. O repressor tambm participa da insero do novo transposon, mas no afeta transcrio do gene de resistncia ampicilina. Mutaes em tnpA que inativam a transposase diminuem a freqncia de transposio de Tn 3. Mutaes em tnpR que inativam o repressor aumentam a freqncia de transposio. Essas mutaes desreprimem tnpA, resultando em mais molculas de transposase; isso aumenta a formao de mais cpias duplicadas do transposon. Tambm desreprime tnpR, mas como o repressor inativo, isso no tem efeito. Transposons localizados em plasmdeos bacterianos so de importncia crescente em uso clnico de antibiticos. Plasmdeos bacterianos que no foram alterados para uso experimental geralmente contm genes que facilitam sua transferncia de uma bactria para outra. Quando esses plasmdeos se transferem entre diferentes cepas bacterianas infecciosas, seus transposons contendo genes de resistncia a antibiticos so transportados para as novas cepas bacterianas. Uma vez dentro de uma nova bactria, o transposon pode se duplicar no cromossomo e car permanentemente estabelecido naquela linhagem celular. O resultado que mais e mais cepas de bactrias patognicas tornaramse resistentes a um nmero crescente de antibiticos.

BioQ.08 300

22.01.07 16:52:47

308

PARTE 2 TRANSMISSO DA INFORMAO

Protenas bZIP tm um domnio de ligao ao DNA composto por uma regio bsica, denida pela presena de arginina e lisina, localizada a sete aminocidos antes da primeira leucina e -hlice. Os aminocidos bsicos estabilizam a associao DNA-protena por interaes eletrostticas com o esqueleto carregado negativamente do DNA, alm de formar pontes de hidrognio na fenda maior. Stios de ligao de homodmeros tm simetria dade, enquanto essa simetria no encontrada em stios de ligao de heterodmeros. A classe hlice-ala-hlice de fatores de transcrio inclui myoD, myc e max. Dois segmentos de -hlice anptica separados por uma ala interveniente caracterizam protenas hlice-ala-hlice. As hlices no so responsveis por ligao com DNA, como nas protenas dedos de zinco, mas por dimerizao com outra protena. Como foi descrito para as protenas bZIP, os dmeros formados podem ser homo ou heterodmeros. O domnio de ligao ao DNA uma extenso de uma das -hlices que formam o feixe de quatro-hlices gerado por dimerizao (Figura 8.27).

8.9 REGULAO DA EXPRESSO GNICA EUCARITICA


Como indicado acima, uma regio relativamente pequena de uma protena regulatria pode ser dedicada ligao seqncia-especca ao DNA, enquanto outros domnios esto envolvidos em interaes protena-protena ou ligante. Vrios domnios de ativao caractersticos foram identicados, incluindo domnios cidos (alta concentrao de aminocidos com cadeias laterais cidas), domnios ricos em glutamina, e domnios ricos em prolina. Experimentalmente, superproduo de qualquer desses domnios por tcnicas de recombinao, mesmo sem seus domnios de ligao ao DNA correspondentes, pode levar ativao errnea de transcrio de uma variedade de genes. Eles parecem ativar transcrio por meio do aumento da taxa de montagem do complexo de pr-iniciao. Alguns interagem diretamente com TFIID, aumentando ligao ao TATA box, enquanto outros interagem com TFIIB ou TAFs que so parte do complexo TFIID. Quando mltiplos fatores de transcrio se ligam a um promotor, eles podem ter um efeito combinatrio sobre a ligao e a montagem do complexo de pr-iniciao. Domnios de ativao de muitos fatores de transcrio tm como alvos as mesmas protenas no complexo de pr-iniciao.
FIGURA 8.27 Formao do fator de transcrio dimrico mediada por interaes hlice-ala-hlice. O motivo hlice-ala-hlice aproxima dois monmeros para formar um dmero que se liga ao DNA. ( a) Cada monmero tem duas hlices unidas por uma ala. Uma hlice usada para interao protena-protena, enquanto a outra usada para ligar a fenda maior do DNA. Assim, o dmero consiste de um feixe de quatro hlices Se o dmero for formado por dois monmeros idnticos, ento se espera que os stios de ligao no DNA sejam muito semelhantes ou idnticos; entretanto, se os monmeros forem protenas diferentes (formando heterodmeros), ento os stios de ligao no DNA podem ser no-relacionados. ( b ) Quando fatores de transcrio ligam-se como dmeros, a presena de um monmero truncado pode impedir ligao ao DNA, mesmo em presena de monmeros completos. Por exemplo, se a hlice de dimerizao da protena for feita sem o domnio de ligao ao DNA, a dimerizao com um monmero completo produz um produto incapaz de se ligar ecientemente ao DNA. Modicado de Alberts, B., Bray, D., Lewis, J., Raff, M., Roberts, K. e Watson, J. Molecular Biology of the Cell. New York: Garland, 1994.

Homodmero HLS ativo

Heterodmero HLS inativo

DNA

BioQ.08 308

22.01.07 16:53:21

CAPTULO 9 PROTENAS II: RELAES ESTRUTURA-FUNO

315

PARTE 3 FUNES DE PROTENAS


Fab 1 Stio de ligao do anticorpo (Ag) SS Fab 2 Stio de ligao do anticorpo (Ag)

Tuftsina CHO ProtA

C1q

ProtA

Fc

PROTENAS II: RELAES ESTRUTURA-FUNO EM FAMLIAS DE PROTENAS


Richard M. Schultz
9.1 VISO GERAL, 316 9.2 MOLCULAS DE ANTICORPOS: SUPERFAMLIA DE PROTENAS IMUNOGLOBULINAS, 316 Molculas de anticorpos contm quatro cadeias polipeptdicas, 317 Regies de seqncias constantes e variveis da estrutura primria, 318 Imunoglobulinas de uma classe contm regies de seqncias homlogas comuns, 318 Seqncias repetitivas geram dobras homlogas tridimensionais em um anticorpo, 318 H dois stios de ligao de antgeno por molcula de anticorpo, 322 Gentica das imunoglobulinas, 323 Dobra de imunoglobulina encontrada em uma grande famlia de protenas com diferentes papis funcionais, 323 9.3 PROTENAS COM UM MECANISMO CATALTICO COMUM: SERINO PROTEASES, 324 Enzimas proteolticas so classicadas por seu mecanismo cataltico, 324 Serino proteases apresentam notvel especicidade em hidrlise de ligaes peptdicas, 325 Serino proteases so sintetizadas como zimognios, 329 Inibidores proticos especcos para serino proteases, 330 Serino proteases tm relaes estrutura-funo semelhantes, 330 Homologia de seqncia em serino proteases, 331 Estruturas tercirias da famlia serino proteases so semelhantes, 332 9.4 HEMOGLOBINA E MIOGLOBINA, 334 Hemoglobina humana ocorre em vrias formas, 334 Mioglobina: uma cadeia polipeptdica nica com um stio de ligao para O2, 334 Grupo prosttico heme stio de ligao de O2, 334 Cristalograa de raios-X deniu a estrutura de hemoglobina e mioglobina, 336 Estruturas primria, secundria e terciria de mioglobina e cadeias de hemoglobina, 336 Um equilbrio simples dene ligao de O2 mioglobina, 337 Ligao de O2 hemoglobina envolve cooperatividade entre subunidades, 339 Mecanismo molecular de cooperatividade na ligao de O2, 340 Hemoglobina facilita transporte de CO2 e NO, 342 Diminuio em pKa de grupos cidos com mudana de conformao T para R leva dissociao de prtons, 343 Transporte de CO2 e O2 ligado por prtons de efeito Bohr, 344 2,3-Bisfosfoglicerato (BPG) em eritrcitos modula liberao de oxignio de hemoglobina, 345 Hemoglobina entrega xido ntrico (NO) para a parede capilar de tecidos onde promove liberao de O2, 345

BioQ.09 315

22.01.07 16:59:32

324

PARTE 3 FUNES DE PROTENAS


FIGURA 9.9 Seqncia de aminocidos das regies constantes de cadeias pesadas de genes de cadeia pesada de IgG 1, 2 e 4. Seqncias de CH1, regio de articulao H ( hinge ), regies CH2 e CH3 so apresentadas. Seqncia de 1 est completa, e diferenas em 2 e 4 em comparao com seqncia 1 so mostradas usando abreviaes de uma letra dos aminocidos. Linha tracejada () indica ausncia de aminocido na posio correspondente em 1, com a nalidade de melhor alinhar as seqncias para mostrar a homologia mxima. Seqncia de cadeia 1 de Ellison, J. W., Berson, B. J. e Hood, L. E. Nucleic Acid Res. 10:4071, 1982. Seqncias dos genes 2 e 4 de Ellison, J. e Hood, L. Proc. Natl. Acad. Sci. USA 79:1984, 1984.

9.3 PROTENAS COM UM MECANISMO CATALTICO COMUM: SERINO PROTEASES


Serino proteases so uma famlia de enzimas que usam um resduo de serina ativado de modo singular no stio de ligao ao substrato, para hidrolisar cataliticamente ligaes peptdicas. Essa serina pode ser caracterizada pela reao irreversvel de seu grupo hidroxila de cadeia lateral com diisopropiluorofosfato (DFP) (Figura 9.11). De todas as serinas da protena, DFP reage s com a serina cataliticamente ativa, formando um ster de fosfato.

Enzimas Proteolticas So Classicadas por seu Mecanismo Cataltico


Enzimas proteolticas so classicadas de acordo com seu mecanismo cataltico. Alm das serino proteases, outras classes utilizam cistena (cisteno proteases), aspartato (aspartato proteases) ou ons metlicos (metalo proteases) para realizar sua funo cataltica. As que hidrolisam ligaes peptdicas no interior de um polipeptdeo so endopeptidases, e aquelas que quebram a ligao peptdica de aminocidos COOH- ou NH2-terminais so exopeptidases. Serino proteases freqentemente ativam outras serino proteases a partir de sua forma precursora inativa, denominada um zimognio, por clivagem de uma ligao peptdica especca. Esse mecanismo de ativao

BioQ.09 324

22.01.07 16:59:43

CAPTULO 9 PROTENAS II: RELAES ESTRUTURA-FUNO

335

CORRELAO CLNICA 9.6

Hemoglobinopatias
H mais de 800 hemoglobinas humanas mutantes diferentes. Mutaes causam instabilidade na estrutura da hemoglobina, anidade aumentada ou diminuda por oxignio, ou um aumento na taxa de oxidao do ferro ferroso do heme (Fe2+) para o estado frrico (Fe3+). Uma hemoglobina frrica, nofuncional, chamada meta-hemoglobina e simbolizada por HbM. Hemoglobinas instveis surgem por substituio de prolina por um aminocido em uma regio de hlice da dobra de globina. Prolinas no participam da estrutura em -hlice e a quebra de um segmento de -hlice gera uma hemoglobina instvel (exemplos so HbSaki14LeuPro e HbGenova 28LeuPro). Outras hemoglobinas instveis surgem por substituio por um aminocido que muito grande ou muito pequeno para estabelecer contatos corretos, ou por colocao de um grupo carregado ou polar no lado de dentro de um domnio. Hemoglobinas instveis desnaturam facilmente e precipitam, formando corpos de Heinz, que danicam a membrana do eritrcito. Pacientes com hemoglobinas instveis podem desenvolver anemia, reticulocitose, esplenomegalia e urobilinria. Algumas hemoglobinas mutantes tm anidade aumentada por oxignio (P50 mais baixa). Um exemplo interessante HbCowtown 246HisLeu, na qual a histidina, que dissocia 50% dos prtons do efeito Bohr, perdida. Essa mutao impede a regulao da dissociao de oxignio por concentrao de ons hidrognio e desestabiliza a conformao T, em relao conformao R, causando um aumento na anidade por oxignio e liberao diminuda de O2 para os tecidos. Mutaes em hemoglobina que interferem com ligao de DPG tambm aumentam anidade por oxignio. Hemoglobinopatias com anidade aumentada por oxignio so freqentemente caracterizadas por anemia hemoltica e formao de corpos de Heinz. Hemoglobinas mutantes que formam metahemoglobina incluem HbM Iwate87HisTyr e HbM HydePark92HisTyr, onde as histidinas proximais F8 das cadeias e , respectivamente, esto mutadas. Na HbM Boston58HisTyr e na HbMSaskatoon63HisTyr, as histidinas distais E7 esto mutadas. Mutaes de aminocidos que cam junto do heme ou formam o stio de ligao com oxignio freqentemente levam a meta-hemoglobina. Pacientes com altas concentraes de meta-hemoglobina apresentam cianose (cor azulada na pele). Duas das mutaes mais prevalentes ocorrem no aminocido da mesma posio, o 6Glu. Quando esse glutamato substitudo por valina, o resultado HbS 6GluVal; enquanto substituio por lisina gera HbC6GluLys. Homozigotos com HbS expressam anemia falciforme, na qual as molculas de hemoglobina precipitam como tactides ou longas cadeias, o que produz a forma de foice dos eritrcitos (ver Corr. Cln. 3.3). HbC forma uma estrutura diferente de agregado consistindo de cristalides de extremidades cegas. Isso reduz o tempo de vida dos eritrcitos, mas causa menos hemlise que HbS. Esta forma de hemoglobinopatia apresenta efeitos patolgicos mais limitados. Como ambas HbS e HbC so comumente encontradas em certas populaes negras da frica, no raro encontrar indivduos heterozigotos para ambos os genes mutantes nessas populaes. Indivduos com HbSC tero uma anemia intermediria entre as observadas para homozigotos de HbS e HbC.

Fonte: Dickerson, R. E. e Geis, I. Hemoglobin: Structure, Function, Evolution, and Pathology. Menlo Park, CA: Benjamin-Cummings, 1983. Arcasoy, M. O. e Gallagher, P. G. Molecular diagnosis of hemoglobinopathies and other red blood cell disorders. Semin. Hematol. 36:328, 1999.

Quatro ligaes so com os tomos de nitrognio pirrlico da porrina. Como os anis pirrlicos e os carbonos de ligao fazem parte do mesmo sistema aromtico, esses tomos cam em um plano comum. O ferro ligado porrina tender a car no mesmo plano da porrina. A quinta e a potencial sexta ligaes com ferro so direcionadas ao longo de um eixo perpendicular ao plano do anel porrnico (Figura 9.20). A quinta ligao com um nitrognio do imidazol de uma histidina. Esta

designada como histidina proximal nas estruturas de hemoglobina e mioglobina (Figuras 9.20 e 9.21). O2 forma a sexta ligao; o O2 colocado entre o tomo ferroso e um segundo imidazol de histidina, designada como histidina distal. Na desoxi-hemoglobina, a sexta posio est desocupada. O heme posicionado dentro de um bolso hidrofbico de cada subunidade globina, com aproximadamente 80 interaes fornecidas por cerca de 18 resduos,

BioQ.09 335

22.01.07 16:59:57

CAPTULO 9 PROTENAS II: RELAES ESTRUTURA-FUNO


VEIA 1 HS SH CO2 T 5 ON HS SH O2 T X-SNO ARTRIA 2 O HS SH O 2 2 CO2 O2 R O2

347

O2

ONS SH O 6 O2 2 O2 R O2

X-SNO 8 ON HS SH CO2 T HS SH NO T 3 O2 CAPILAR 1 O2 ARTEROLA 4 O2 3 NO CO2 7 HS SH T O2 HS SH O2 NO R O2

FIGURA 9.37 Ligao e liberao de NO por hemoglobina durante o ciclo respiratrio. O modelo mostra a ligao e a dissociao de NO, O2 e CO2 enquanto uma molcula de hemoglobina faz dois ciclos completos na circulao. O primeiro ciclo envolve intermedirios 1-4, e o segundo ciclo, intermedirios 5-8. As conformaes T e R so mostradas e os grupos SH so da cadeia lateral de Cys93. O NO ligado diretamente a um ferro-heme ou ao SH da Cys93. As etapas-chaves no transporte de NO so (i) sua ligao inicial a um heme no intermedirio 3 e transferncia do heme de uma subunidade para Cys93 no intermedirio 6 (conformao R) e (ii) sua transferncia para uma molcula tiol pequena X-SH no intermedirio 7 (conformao T), quando hemoglobina convertida de R para T. A molcula de hemoglobina representada pode ser apenas 1 em 1.000 molculas de hemoglobina circulantes, devido relativamente baixa concentrao molar de NO no sangue. Redesenhado de Gross, S. S. e Lane, P. Proc. Natl. Acad. Sci. USA 96:9967, 1999.

de diviso celular, morte (apoptose), diferenciao e migrao. Todas as clulas produzem constituintes de membrana basal, e cada membrana basal tem caractersticas do tipo celular, a partir do qual sintetizada. Uma membrana basal sublinha camadas de clulas epiteliais e endoteliais, e circunda outros tipos de clulas (Figura 9.39). Uma membrana basal separa duas camadas de clulas no glomrulo renal, onde funciona como um ltro seletivo. Uma lmina basal formada por associaes nocovalentes entre stios especcos localizados em domnios de ligao das protenas associadas. Muitas protenas de membrana basal tambm se ligam a clulas por meio de domnios de ligao a clulas nas protenas e receptores celulares na membrana celular externa. A estrutura de muitas das protenas composta de unidades modulares com homologia de seqncia e de dobras com superdobras comuns, como as dobras de imunoglobulinas (Ig) e de fator de crescimento epidrmico (EGF). Essas dobras so encontradas repetitivamente e so os blocos construtores de protenas de matriz extracelular. Enquanto mdulos EGF nessas protenas no parecem ter funo de fator de crescimento, protenas fatores de crescimento e citocinas so encontradas na lmina basal, particularmente em associao com as partes carboidrato dos proteoglicanos componentes. Durante a reciclagem (turnover) da membrana basal induzida por proteases e heparanases, esses fatores de crescimento e citosinas so liberados para agirem sobre clulas vizinhas. Alm disso, muitas protenas de lmina basal escondem atividades crpticas que so ativadas quando clivadas e removidas da seqncia completa por ao de proteases (ver endostatina, p. 1021). O prprotease plasminognio est ubiquamente presente na matriz extracelular e ativado por secreo celular de ativadores de plasminognio (ver p. 979).

Composio Protica da Lmina Basal


A lmina basal composta de colgeno tipo IV, laminina, nidogem (tambm chamado entactina) e perlecam, o proteoglicano de heparam sulfato. Alm disso, pequenas quantidades de talvez 50 outras protenas podem estar presentes, incluindo osteopontina (tambm chamada BM-40 ou SPARC), bulina, colgeno tipo XV, colgeno tipo XVIII e o proteoglicano agrim. A diversidade e a tecido-especicidade de uma membrana basal determinada pelas isoformas de colgeno tipo IV e laminina e os tipos de protenas minoritrias presentes. Isoformas de colgeno tipo IV so produzidas por sete genes diferentes de colgeno tipo IV. Essas isoformas compartilham homologia de estrutura de domnios, mas diferem em 30-50% de suas seqncias de aminocidos. H pelo menos 12 isoformas de laminina. As isoformas de colgeno tipo IV e laminina expressas so caractersticas do tipo celular e do tecido que sintetiza a membrana basal associada.

9.5 O COMPLEXO PROTICO DA LMINA BASAL


Uma lmina basal um complexo muito estruturado de protenas de matriz extracelular observado inicialmente ao microscpio como uma regio amorfa densamente empacotada de cerca de 50 a 100 nm de espessura circundando tecidos ou clulas (Figura 9.39). O termo membrana basal usado para descrever a lmina basal e os colgenos brilares ligados ao seu lado externo. A membrana basal d suporte a tecidos e regula acesso de clulas ao estroma intersticial. Tambm participa da determinao de propriedades de clulas que esto ligadas a ela, incluindo os crticos processos

BioQ.09 347

22.01.07 17:00:54

358

PARTE 3 FUNES DE PROTENAS

PARTE 3 FUNES DE PROTENAS

ENZIMAS: CLASSIFICAO, CINTICA E CONTROLE


Henry Weiner
10.1 VISO GERAL, 359 10.2 CLASSIFICAO DE ENZIMAS, 360 Classe 1: xido-redutases, 361 Classe 2: Transferases, 361 Classe 3: Hidrolases, 361 Classe 4: Liases, 362 Classe 5: Isomerases, 362 Classe 6: Ligases, 363 10.3 CONCEITOS GERAIS DE MECANISMOS ENZIMTICOS, 363 Consideraes termodinmicas, 363 Ligao de substrato por uma enzima, 364 Estado de transio, 364 Ligao forte no estado de transio, 365 Reaes inicas no precisam envolver ons, 365 Ligaes parcialmente carregadas, 366 Importncia do grupo carbonila, 366 Oxidaes, 367 Adio e remoo de prtons, 367 Ligao covalente de substrato enzima, 367 pH afeta a reao por afetar cidos e bases gerais, 368 10.4 STIO ATIVO DE UMA ENZIMA, 368 Estereoqumica ajuda a explicar o mecanismo de reaes catalisadas por enzimas, 370 Inuncia de grupos sobre o substrato distal ligao a ser modicada, 370 10.5 COENZIMAS, CO-SUBSTRATOS E COFATORES, 371 Coenzimas, 371 NAD e NADP so formas coenzimas da niacina, 372 FMN e FAD so formas coenzimas da riboavina, 373 Piridoxal fosfato a forma coenzima de piridoxal, 373 Adenosina trifosfato pode ser um segundo substrato ou um modulador de atividade, 374 Cofatores ons metlicos, 374 Papel de metais em oxidao e reduo, 376 10.6 CINTICA DE REAES QUMICAS, 376 Velocidade de formao de produto, 376 Reaes de primeira e segunda ordem, 377 Velocidade de desaparecimento de substrato, 377 Reaes reversveis, 378 Reaes complexas, 378 10.7 CINTICA ENZIMTICA DE REAES DE UM SUBSTRATO, 379 Equao de Michaelis-Menten, 380 Concentrao de enzima livre, 382 Signicado de Km, 382 Nmero de turnover (kcat), 382 Signicado de kcat na equao de Michaelis-Menten, 383 Quando concentrao de substrato muito maior que Km, 383 Quando concentrao de substrato muito menor que Km, 383 Reaes reversveis, 384 Baixo Km versus alto kcat, 384 Calculando as constantes, 384 Substrato e produto ligam-se ao mesmo stio, 385 Efeito das condies de ensaio, 385 Temperatura, 385 pH, 385

10

BioQ.10 358

22.01.07 17:10:09

CAPTULO 10 ENZIMAS: CLASSIFICAO, CINTICA E CONTROLE

371

CORRELAO CLNICA 10.1

Mutao de um Stio de Ligao de Coenzima Resulta em Doena Clnica


Cistationinria uma doena gentica na qual -cistationase est deciente ou inativa. A cistationase catalisa a reao: Cistationina cistena + -cetobutirato Decincia da enzima leva ao acmulo da cistationina no plasma. Como cistationase uma enzima dependente de piridoxal fosfato, vitamina B6 foi administrada a pacientes cujos broblastos continham material que apresentavam reao cruzada com anticorpos contra cistationase. Muitos responderam terapia com B6 com uma queda nos nveis plasmticos de cistationina. Esses pacientes produzem a apoenzima, que reagiu com o anticorpo. Em um paciente, a atividade enzimtica era no-detectvel em homogenatos de broblastos, mas aumentou para 31% do normal com a adio de piridoxal fosfato 1 mM mistura de reao. Acredita-se que o Km para a ligao do piridoxal fosfato enzima tenha aumentado, devido a uma mutao no stio de ligao. Atividade parcialmente restaurada aumentando-se a concentrao de coenzima. Aparentemente, esses pacientes requerem uma concentrao de estado estacionrio mais alta de coenzima para manter a atividade de -cistationase.

Fonte: Pascal, T. A., Gaull, G. E., Beratis, N. G., Gillam, B. M., Tallan, H. H. e Hirschhorn, K. Vitamin B6 -responsive and unresponsive cystathionuria: two variant molecular forms. Science 190: 1209, 1975.

10.5 COENZIMAS, CO-SUBSTRATOS E COFATORES


Muitas enzimas requerem a participao de uma coenzima, um co-substrato ou cofator na reao cataltica. Coenzimas so molculas orgnicas pequenas, freqentemente derivados de vitaminas (ver p. 1074). Podem ser ou no modicadas (p. ex., oxidadas ou reduzidas) na reao. As que so alteradas so tambm chamadas cosubstratos. Para algumas reaes, a energia de hidrlise de ATP necessria sem incorporao de sulfato ao produto. ATP nessas reaes um co-substrato. ons metlicos so freqentemente necessrios para reaes enzimticas e chamados cofatores. TABELA 10.2 Coenzimas
Coenzima Biotina Cobalamina (B12) Coenzima A Coenzimas avina cido lipico Coenzimas nicotinamida Piridoxal fosfato Tetra-hidrofolato Tiamina pirofosfato Nicotinamida Piridoxina (B6 ) cido flico Tiamina (B1) Vitamina Biotina Cobalamina (B12) Pantotenato Riboavina (B2)

Coenzimas
Tabela 10.2 lista as coenzimas e vitaminas a partir das quais so derivadas. Coenzimas participam de enzimas catalisadas por enzimas, mas no so os compostos primrios que esto sendo modicados. Algumas coenzimas participam da ao de muitas enzimas diferentes, enquanto outros participam apenas de um nmero limitado de reaes. Podem ter anidades pela enzima semelhantes ao substrato, podem ser fortemente ligadas ou podem ser covalentemente ligadas. Algumas so modicadas durante uma reao, mas esto no seu estado original no nal da reao (modicao cclica), enquanto outras permanecem modicadas no m. Se estiverem modicadas no m (p. ex., oxidadas ou reduzidas), devem participar de outra reao para retornar ao seu estado original. Coenzimas esto presentes em clulas em uma concentrao razoavelmente constante,

Reao Mediada Carboxilao Alquilao Transferncia de acil Oxidao-reduo Transferncia de acil Oxidao-reduo Transferncia de amino Transferncia de grupo de um carbono Transferncia de carbonila

BioQ.10 371

22.01.07 17:10:28

CAPTULO 10 ENZIMAS: CLASSIFICAO, CINTICA E CONTROLE

383

CORRELAO CLNICA 10.3

Efeito Fisiolgico de Mudanas nos Valores de Km de Enzimas


A sensibilidade incomum de asiticos a bebidas alcolicas tem uma base bioqumica. Em alguns japoneses e chineses, muito menos lcool necessrio para produzir vasodilatao, que resulta em rubor facial e acelerao dos batimentos cardacos, do que o necessrio para causar o mesmo efeito em europeus. Os efeitos siolgicos devem-se ao acetaldedo gerado pela lcool desidrogenase heptica. Acetaldedo normalmente removido por aldedo desidrogenase (ALDH), que converte acetaldedo em acetato. Um aminocido na posio 487 na subunidade de 500 aminocidos da enzima tetramrica est trocado em alguns dos indivduos afetados. A enzima ativa tem um glutamato, enquanto a variante inativa tem uma lisina. Descobriu-se que a variante asitica tem atividade muito baixa, e o Km para NAD+ aumentado de 30 M para 7.000 M. Embora a enzima esteja ativa, teria muito pouca atividade no fgado porque o Km muito alto e kcat, muito baixa. Alm disso, indivduos afetados eram heterozigotos, tendo genes para a enzima glutamato ativa e a enzima lisina essencialmente inativa. Esperar-se-ia que sua enzima fosse 50% ativa, mas apresentava atividade muito baixa. ALDH forma tetrmeros com os dois monmeros (E4, E3K, E2K2, EK3 e K4), onde E4 e K4 so formas homotetramricas das subunidades contendo glutamato e lisina, respectivamente, e as outras so heterotetrmeros. E3K tinha 50% da atividade total, no 75%, enquanto EK3 praticamente no tinha atividade, no os 25% que se poderia esperar com uma subunidade ativa. A subunidade K era dominante e podia inativar a subunidade, qual estava pareada, uma vez que o resduo da posio 487 interage com uma arginina da posio 475. Quando um glutamato estava na posio 487, uma ligao salina estvel se formava, mas quando uma lisina estava na posio 487, causava um movimento da arginina. O movimento rompia o bolso de ligao a NAD, embora o resduo 487 no estivesse em contato com a dobra de Rossmann. Este exemplo ilustra o fato de uma mutao puntual em uma enzima poder afetar o stio ativo, embora o resduo no esteja em contato direto com essa regio. Tambm mostra como uma subunidade pode ser dominante sobre outra.

Fonte : Zhou J. e Weiner, H. Basis for half-of-the-site reactivity and the dominance of the K487 oriental subunit over the E487 subunit in heterotetrameric human liver mitochondrial aldehyde dehydrogenase. Biochemistry 39:12019, 2000. geral, este termo representa a(s) etapa(s) mais lenta(s) da reao. Como Km, kcat composta de vrias constantes de velocidade individuais. xima nessas condies porque praticamente 100% da enzima est no complexo ES. No instante em que uma molcula de produto feita, ela deixa a enzima e outra molcula de S liga-se enzima, mantendo sempre a enzima saturada com S. Nessas condies, a velocidade governada estritamente pelos termos que governam a reao de ES indo para produto (ES E + P).

Signicado de kcat na Equao de Michaelis-Menten


Quando Concentrao de Substrato Muito Maior do que Km
Equao 10.19 est na forma de uma equao hiperblica geral. Quando o valor de [S] muito maior que o valor de Km, o valor do denominador aproxima-se do valor de [S], e a equao pode ser aproximada por v= kcat [E][S] [S] = kcat [E] (10.26)

Quando Concentrao de Substrato Muito Menor do que Km


Quando [S] muito baixa comparada com Km, Eq. 10.18 pode ser aproximada como v= kcat [Et ][S] km ou v = Vmax [S] Km (10.27)

isto , a velocidade torna-se independente da concentrao de S; a reao torna-se de ordem zero com relao a S. Isso encontrado na parte da curva onde a velocidade essencialmente se nivela, e no aumenta quando a concentrao de [S] aumenta (inclinao = 0) (Figura 10.47). A reao est acontecendo sua velocidade m-

Um grco de v versus [S] seria linear, uma condio que existe s quando [S] << valor de Km. Como para qualquer reao qumica a velocidade de formao de produto uma constante de velocidade multiplicada pela concentrao de reagentes, o termo kcat /Km pode ser considerado como uma constante de velocidade de segunda ordem, uma vez que h dois termos de concen-

BioQ.10 383

22.01.07 17:10:54

394

PARTE 3 FUNES DE PROTENAS

10.10 REGULAO DE ATIVIDADE ENZIMTICA


Modicao Covalente
Clulas tm capacidade de regular a atividade de enzimas-chaves por modicao covalente ou ligao reversvel de ligantes. Muitos exemplos de modicao covalente, como fosforilao, sero descritos em outros captulos. H muitas protenas quinases que catalisam fosforilao de resduos de serina, treonina ou treonina em protenas e enzimas especcas (ver p. 490) e protena fosforilases que removem o fosfato por hidrlise. Dependendo da protena, fosforilao pode aumentar ou diminuir a atividade enzimtica. Outros grupos alm do fosfato podem ser adicionados a uma enzima para alterar sua atividade, incluindo sulfato e acetato. Modicao covalente de protenas um modo rpido e eciente de controlar atividade de uma protena ou enzima.

Controle Alostrico de Atividade Enzimtica


Embora os stios de ligao de substrato e ativo de uma enzima sejam estruturas bem denidas, a atividade de muitas enzimas pode ser modulada por ligantes agindo

de modos diferentes de inibidores competitivos ou nocompetitivos. Ligantes podem ser ativadores, at mesmo os substratos de enzimas. Os ligantes que mudam a atividade enzimtica, mas no so modicados em conseqncia da ao enzimtica, so chamados efetores, modicadores ou moduladores. A maioria das enzimas sujeitas modulao por ligantes so enzimas determinantes de velocidade de vias metablicas. Enzimas que respondem a moduladores tm stios adicionais conhecidos como stio(s) alostrico(s). Alostrico derivado da raiz grega allo, signicando o outro. Um stio alostrico uma regio especca da enzima, bem diferente do stio de ligao do substrato. A existncia de stios alostricos ilustrada na Corr. Cln. 10.10. Os ligantes que se ligam a stios alostricos so chamados efetores alostricos ou moduladores. Ligao de um efetor alostrico causa uma mudana conformacional na enzima, de modo que a anidade pelo substrato ou outros ligantes tambm muda. Efetores alostricos positivos (+) aumentam a anidade da enzima por substrato ou outro ligante. O inverso verdade para efetores alostricos negativos (). O stio alostrico no qual o efetor positivo se liga chamado um stio ativador; o efetor negativo liga-se a um stio inibitrio. Enzimas alostricas so divididas em duas classes, com base no efeito do efetor alostrico sobre Km e Vmax. Na classe K, o efetor altera o Km, mas no Vmax, enquanto na classe V, o efetor altera Vmax, mas no Km. Enzimas da classe K do grcos duplos-recprocos como os de inibidores competitivos, e enzimas da classe

CORRELAO CLNICA 10.10

Um Caso de Gota Demonstra a Diferena entre um Stio Alostrico e um Stio de Ligao de Substrato
A descoberta de que stios alostricos inibitrios so separados de stios alostricos ativadores, bem como dos stios de ligao de substrato e cataltico, ilustrada por um estudo de um paciente com gota, cujo nvel de PRPP nos eritrcitos estava aumentando. Descobriu-se que a PRPP sintetase do paciente tinha valores normais de Km, Vmax, juntamente com sensibilidade ativao por fosfato. Os nveis aumentados de PRPP e hiperuricemia surgiram porque os produtos nais da via (ATP, GTP) no eram capazes de inibir a sintetase no stio alostrico inibitrio (I). Sugeriu-se que uma mutao no stio inibitrio ou no mecanismo de acoplamento entre o stio inibitrio e cataltico levou ao defeito do mecanismo de controle por feedback.

PRPP sintetase C

PRPP Pi ATP Ribose

AMP GMP

ATP GTP

Fonte: Sperling, O., Persky-Brosh, S., Boen, P. e DeVries, A. Human erytrocyte phosphoribosyl-pyrophosphate synthetase mutationally altered in regulatory properties. Biochem. Med. 7: 389, 1973

BioQ.10 394

22.01.07 17:11:17

CAPTULO 11 CITOCROMOS P450 E XIDO NTRICO SINTASES

407

PARTE 3 FUNES DE PROTENAS


Adenina Ribose Fosfato Fosfato Ribitol N N
[FAD]

Citocromo P450 Redutase Citocromo 5


C N C N Fe N C N C

NADPH

2e-

N N
O

CH3 1e- Fosfato CH3 Ribitol N N H3C O N H3C N

[FMN]

1eC

N
N

N N C C

Citocromo P450

CITOCROMOS P450 E XIDO NTRICO SINTASES


Linda J. Roman e Bettie Sue Siler Masters
11.1 VISO GERAL, 408 11.2 CITOCROMOS P450: PROPRIEDADES E FUNO, 408 11.3 CICLO DE REAO DO CITOCROMO P450, 409 11.4 SISTEMAS DE TRANSPORTE DE ELTRONS DOS CITOCROMOS P450, 410 NADPH-citocromo p450 redutase a avoprotena doadora de eltrons no retculo endoplasmtico, 410 NADPH-adrenodoxina redutase a avoprotena doadora de eltrons em mitocndrias, 411 11.5 CITOCROMO P450: NOMENCLATURA E ISOFORMAS, 412 11.6 CITOCROMOS P450: SUBSTRATOS E FUNES FISIOLGICAS, 413 11.7 CITOCROMOS P450 PARTICIPAM DE SNTESE DE HORMNIOS ESTERIDES E DE OXIGENAO DE COMPOSTOS ENDGENOS, 414 Citocromos P450 oxidam substratos lipoflicos exgenos, 417 11.8 INDUO E INIBIO DE CITOCROMO P450, 423 Interaes droga-droga, 423 Polimorsmos genticos de citocromo P450, 425 Inibio teraputica de citocromo P450, 425 11.9 AS XIDO NTRICO SINTASES: PROPRIEDADES E FUNO, 425 11.10 ISOFORMAS DE XIDO NTRICO SINTASES E FUNES FISIOLGICAS, 428 NOSI, 428 NOSII, 429 NOSIII, 430 BIBLIOGRAFIA, 432 QUESTES E RESPOSTAS, 434 CORRELAES CLNICAS 11.1 Hiperplasia Adrenal Congnita: Decincia de CYP21A2, 416 11.2 Produo de Hormnios Esterides Durante a Gestao, 418 11.3 Inibio de Citocromo P450: Interaes Droga-Droga e Efeitos Adversos, 420 11.4 Papel de CYP2E1 em Toxicidade Heptica Induzida por Acetaminofen, 422 11.5 Induo de Citocromo P450: Interaes Droga-Droga e Efeitos Adversos, 423 11.6 Polimorsmos Genticos de Enzimas P450, 426 11.7 Mecanismo de Ao de Sildenal, 430 11.8 Aspectos Clnicos da Produo de xido Ntrico, 431 11.9 Histria da Nitroglicerina, 432

11

BioQ.11 407

22.01.07 17:15:52

412

PARTE 3 FUNES DE PROTENAS

11.5 CITOCROMO P450: NOMENCLATURA E ISOFORMAS


Devido ao grande nmero de citocromos P450 que foram identicados (mais de 4.500 em janeiro de 2005), um sistema de classicao das enzimas em grupos funcionais e nomenclatura foi desenvolvido. O sistema escolhido baseado em classicao de acordo com a identidade relativa das seqncias de aminocidos das enzimas. A superfamlia dos citocromos P450 assim dividida inicialmente em famlias, nas quais a identidade da seqncia de aminocidos dos membros superior a 40%. A famlia designada pelo prexo CYP, em referncia a cytochrome P450, seguida por um numeral arbico (p. ex., CYP1, CYP2, CYP3, etc). As famlias so ainda divididas em subfamlias, nas quais a identidade

de seqncia de aminocidos dos membros superior a 55%. A subfamlia identicada por uma letra maiscula arbica (p. ex., CYP1A, CYP1B, CYP1C, etc.). Os membros individuais de cada subfamlia so ento numerados na ordem em que foram identicados (p. ex., CYP1A1, CYP1A2, CYP1A3, etc.). Embora citocromos P450 sejam enzimas, os termos isoenzima ou isozima no so usados para descrever essas protenas; em ver disso, o termo formaou isoforma usado. Tabelas 11.1 e 11.2 relacionam as isoformas conhecidas de citocromos P450 humanos. H 57 isoformas divididas em 18 famlias e 41 subfamlias. O genoma humano codica 58 pseudogenes CYP que no formam protena ativa. Tabela 11.1 lista as isoformas que utilizam primariamente compostos exgenos (p. ex., drogas e xenobiticos); cada isoforma metaboliza uma ampla variedade de substratos. Tabela 11.2 lista as isoformas envolvidas em metabolismo de compostos endgenos; essas isoformas geralmente reconhecem apenas um ou dois substratos especcos, e estes so apresentados na tabela.

TABELA 11.1 Citocromos P450 Humanos Envolvidos em Metabolismo Exgeno


Famlia CYP 1 Isoformas 1A1 1A2 1B1 2 2A6 2A7 2A13 2B6 2C8 2C9 2C18 2C19 2D6 2E1 2F1 2J2 2R1, 2S1 2U1, 2W1 3 3A4 3A5 3A7 3A43
a

Substrato(s) Selecionado(s) Benzo( a)pireno, diclofenac Benzo( a)pireno, warfarina Benzo( a)pireno, aatoxina B1 Acetaminofen, nicotina NC Hexametilfosforamida Diazepam, mefenitona Taxol, ibuprofen, verapamil Amitriptilina, naproxen Imipramina, metadona Diazepan, omeprazol Fluvastatina, codena, risperidona Acetaminofen, halotano Naftaleno, estireno Bufuralol NC NC Eritromicina, nifedipina, codena, warfarina, terfenadina Verapamil, prevastatina cido retinico, codena, cortisol Testosterona

Inibidor(es) Selecionado(s) Cetoconazol Ciprooxin Tamoxifen Canabidol NC NC Cetoconazol Quinina Sulfafenazol NC Isoniazida Quinidona Watercress NC NC NC NC Troleandomicina, cetoconazol NC DHEA NC

Indutor(es) Selecionado(s) Benzo( a)pireno Erva de So Joo NCa Dexametasona NC NC Rifampicina Fenobarbital Rifampicina Rifampicina Rifampicina Dimetilsulfxido Isoniazida, etanol NC NC NC NC Cortisol, rifampina, fenobarbital Dexametazona NC NC

NC, no bem caracterizado.

BioQ.11 412

22.01.07 17:16:01

420

PARTE 3 FUNES DE PROTENAS


Metabolismo de Terfenadina OH HO N Terfenadina (Seldane)

CYP3A4

OH HO N

Fexofenadina (Allegra)

CO2H

FIGURA 11.12 O metabolismo de terfenadina em fexofenadina, o composto bioativo.

Acetaminofen, comumente usado como analgsico e antipirtico, convertido por CYP2E1 em N-acetil-pbenzoquinoneimina (NAPQ1), um composto muito reativo levando a aductos proticos, estresse oxidativo e toxicidade. Normalmente, acetaminofen primariamente metabolizado por vias de glucuronidao e sulfatao em conjugados polares, inativos, que so facilmente excretados (Figura 11.14, vias superior e inferior, respectivamente). Acetaminofen tambm metabolizado por CYP2E1 em NAPQ1 muito reativo (Figura 11.14, via do meio). A quantidade de acetaminofen que metabolizada por CYP2E1 normalmente baixa, em comparao com glucuronidao e sulfatao. As pequenas quantidades de NAPQ1 formadas so rapidamente conjugadas por glutationa (ver p. 764) em um metablito no-txico.

CORRELAO CLNICA 11.3

Inibio de Citocromo P450: Interaes Droga-Droga e Efeitos Adversos


Os papis que citocromos P450 desempenham no metabolismo de drogas e as srias conseqncias das interaes droga-droga foram demonstrados com clareza para duas drogas, terfenadina (Seldane) e cisapride (Propulside), quando seu metabolismo foi inibido por outras drogas. Uma pequena porcentagem dos usurios teve efeitos adversos graves, que foraram seus fabricantes e o Food and Drug Administration (FDA) a divulgar avisos de que essas drogas no podem ser tomadas juntamente com outras drogas que inibem CYP3A4. A gravidade dos efeitos adversos forou o FDA a remover ambas as drogas do mercado. O FDA aprovou terfenadina, um anti-histamnico de segunda gerao, em 1985, para tratar alergias sazonais. Terfenadina rapidamente metabolizada no fgado por CYP3A4 em fexofenadina, como mostra a Figura 11.12, resultando em baixos nveis da droga original logo depois da ingesto, mas os efeitos teraputicos do terfenadina so realmente causados por fexofenadina. Como muitas outras drogas so substratos ou inibidores de CYP3A4, o metabolismo de terfenadina potencialmente passvel de inibio. Indivduos que tomaram terfenadina com o antibitico macroldeo eritromicina, ou com o agente antifngico cetoconazol, ambos fortes inibidores de CYP3A4, apresentaram nveis plasmticos signicativamente elevados de terfenadina. Numa pequena porcentagem de usurios de terfenadina, problemas cardacos srios surgiram, porque a droga parental causou alterao nos canais cardacos de potssio e aumentou o risco de uma taquicardia ventricular rara, chamada Torsade de Pointes. Alguns indivduos morreram de problemas cardacos que se desenvolveram depois que tomaram terfenadina com eritromicina ou cetoconazol. Como as propriedades teraputicas da terfenadina esto associadas com seu metablito no-txico fexofenadina, o fabricante testou fexofenadina como um novo medicamento e buscou aprovao do FDA para esse metablito, agora comercializado como Allegra. Cisapride foi aprovado em 1993 para pacientes que sofrem de azia noturna, que resulta de doena de reuxo gastro-esofgico ou GERD. A eliminao dessa droga do corpo depende do seu metabolismo por CYP3A4, e quando administrada sozinha ou com outras drogas que no inibem CYP3A4, a droga original no se acumula no plasma. Entretanto, quando tomada com outras drogas que so substratos ou inibidores de CYP3A4, o metabolismo de cisapride reduzido e acumula-se com administraes subseqentes. Em alguns indivduos, nveis aumentados de cisapride causam arritmias cardacas e, por volta do nal de 1999, anomalias de ritmo cardaco foram relatados em 341 pacientes que tomavam cisapride, resultando em 80 mortes. Ento, o fabricante de cisapride parou de comercializar essa droga nos Estados Unidos, aps 2000.

Fonte: Terfenadine: proposal to withdraw approval of two new drugs applications and one abbreviated new drug application. Fed. Reg. 62:1889, 1997. (Esse documento pode ser visto na pgina da internet do Federal Register em http://www.access.gpo.gov/su_docs/aces/aces140.html); e Desta, Z., Soukhova, N., Mahal, S. K. e Flockhart, D. A. Interactions of cisapride with the human cytochrome P450 system: metabolism and inhibition studies. Drug Metab. Dispos. 28:789, 2000.

BioQ.11 420

22.01.07 17:16:08

428

PARTE 3 FUNES DE PROTENAS

11.10 ISOFORMAS DE XIDO NTRICO SINTASES E FUNES FISIOLGICAS


H trs isoformas principais de NOS neuronal ( NOSI ou nNOS), indutvel ( NOSII ou iNOS) e endotelial ( NOSIII ou eNOS) embora variaes em cada um desses tipos ocorram em muitos organismos diferentes. Propriedades dessas isoformas so resumidas na Tabela 11.4. Muitas das funes siolgicas de NO so mediadas por ativao de guanilato ciclase solvel, uma protena heterodimrica (/ ) contendo heme que converte GTP em cGMP. cGMP um segundo mensageiro envolvido em muitas cascatas de transduo de sinal (ver p. 518). A forma inativa da guanilato ciclase solvel tem um heme penta-coordenado, ligado por uma histidina subunidade . NO liga-se sexta posio para formar um heme hexa-coordenado e causa quebra da ligao heme-histidina, gerando o complexo nitrosil ativo, penta-coordenado, da guanilato ciclase solvel (Figura 11.19). Ativao da guanilato ciclase solvel causa aumento de at 400 vezes na taxa de formao de cGMP. Os nveis de cGMP so regulados por um equilbrio entre atividade de guanilato ciclase e fosfodiesterase (PDE), particularmente PDE5, que especca para cGMP, que hidrolisa cGMP em 5-GMP, desligando o sinal.

NOSI
NOSI encontrada primariamente em msculo esqueltico e em neurnios tanto do sistema nervoso central como do perifrico. uma enzima solvel, em 1 His Fe F e2+ 1 1 His Fe
2+

bora se localize na membrana por interaes protena-protena com uma gama de protenas regulatrias e de localizao. expressa constitutivamente, o que signica que no normalmente induzida em nvel transcripcional, e ativada pelo inuxo de clcio. No caso de NOSI, e NOSIII, ver a seguir), calmodulina no est ligada enzima nos nveis intracelulares basais de clcio. Requer um inuxo de clcio para elevar a concentrao de clcio, permitindo ligao da calmodulina, assim ativando a formao de NO. A quantidade de NO sintetizado no estado ativado muito baixa isto , picomolar. O NO produzido funciona como um neurotransmissor nos sistemas nervosos central e perifrico. No msculo esqueltico, NO tambm serve de mediador da fora contrtil. No sistema nervoso central, NO produzido geralmente por NOSI no neurnio ps-sinptico, mas difunde de volta na sinapse para o neurnio pr-sinptico. Sntese de NO regulada pelo inuxo de clcio por canais dependentes de receptor isto , aps estimulao ps-sinptica de receptores de N-metil-D-aspartado (NMDA) pelo neurotransmissor excitatrio glutamato. Guanilato ciclase ativada por NO, produzindo cGMP, que regula sntese dos neurotransmissores norepinefrina e glutamato, aumentando assim a produo de NO (Figura 11.20). NO est implicado em sinalizao neural, neurotoxicidade, plasticidade neuronal, aprendizado e memria, e percepo de dor. Alm de seus domnios oxigenase e redutase, NOSI tem um domnio PDZ N-terminal de 300 aminocidos, que medeia sua interao com outras protenas. No sistema nervoso central, o domnio PDZ da NOSI interage com a protena de densidade ps-sinptica PSD-95. O receptor NMDA tambm interage com PSD-95, aproximando muito NOSI e o receptor NMDA, de modo que NOSI ca diretamente exposta ao clcio entrando pelo canal inico do receptor NMDA ativado.
FIGURA 11.19 Ativao da guanilato ciclase solvel por NO. Redesenhado com base em gura de Bellamy, T. C. e Garthwaite, J. The receptor-like properties of nitric oxide-activated soluble guanylate cyclase in intact cells. Mol. Cell. Biochem. 230:165, 2002.

His 1 1 Fe F e2+ NO 1

NO NO

TABELA 11.4 Propriedades das Isoformas de NOS


Propriedade Massa molecular Expresso Frao celular Dependncia de inuxo de clcio Ao siolgica 160 kDa Constitutiva Citoplasmtica Dependente Neurotransmisso NOSI 130 kDa Indutvel Citoplasmtica Independente Citotoxicidade NOSII 135 kDa Constitutiva Ligada membrana Dependente Vasodilatao NOSIII

BioQ.11 428

22.01.07 17:16:19

436

PARTE 3 FUNES DE PROTENAS

PARTE 3 FUNES DE PROTENAS

MEMBRANAS BIOLGICAS: ESTRUTURA E TRANSPORTE EM MEMBRANAS


Thomas M. Devlin
12.1 VISO GERAL, 437 Protenas perifricas de membrana, 451 Protenas de membrana ancoradas por lipdeos, 451 Protenas e lipdeos difundem em lamelas da membrana, 452 Microdomnios de complexos lipdeo-protena esto presentes em membranas, 454 Natureza dinmica de membranas, 455 12.5 MOVIMENTO DE MOLCULAS ATRAVS DE MEMBRANAS, 456 Algumas molculas difundem atravs de bicamadas lipdicas, 456 Classicao e nomenclatura de sistemas de deslocamento por membrana, 457 12.6 CANAIS DE MEMBRANAS, 458 Classicao dos canais de membrana, 458 Caractersticas dos canais de membrana, 459 Aquaporinas e aquagliceroporinas, 459 Canais inicos de Na+, Ca 2+, K+ e Cl controlados por voltagem, 460 Canal nicotnicos de acetilcolina (nAChR), 464 Junes comunicantes ( gap junctions) e canais do poro nuclear, 465 12.7 TRANSPORTADORES DE MEMBRANA, 466 Quatro etapas no transporte de molculas de soluto, 466 Energtica de sistemas de transporte de membrana, 467 12.8 TRANSPORTE PASSIVO, 468

12

12.2 COMPOSIO QUMICA DE MEMBRANAS, 438 Lipdeos so importantes componentes de membranas, 438 Glicerofosfolipdeos so os lipdeos mais abundantes de membranas, 438 Glicerofosfolipdeos so anpticos, 441 Esngolipdeos esto presentes em membranas, 441 Colesterol um importante componente de membranas plasmticas, 443 Composio em lipdeos varia entre membranas, 443 Protenas de membrana, 444 Carboidratos de membranas so parte de glicoprotenas ou glicolipdeos, 445 12.3 MICELAS, BICAMADAS LIPDICAS E LIPOSSOMOS, 445 Lipdeos formam estruturas vesiculares, 445 Bicamadas lipdicas sintticas e lipossomos, 445 Propriedades gerais de bicamadas lipdicas, 446 12.4 ESTRUTURA DE MEMBRANAS BIOLGICAS, 447 Modelo do mosaico uido de membranas biolgicas, 447 Lipdeos so distribudos assimetricamente em membranas, 448 Protenas integrais de membrana cam mergulhadas na bicamada lipdica, 449

BioQ.12 436

22.01.07 17:18:53

CAPTULO 12 MEMBRANAS BIOLGICAS: ESTRUTURA E TRANSPORTE EM MEMBRANAS

445

Carboidratos de Membranas So Parte de Glicoprotenas ou Glicolipdeos


Carboidratos esto presentes em membranas como oligossacardeos covalentemente ligados a protenas (glicoprotenas) e a lipdeos (glicolipdeos). Os acares nos oligossacardeos incluem glicose, galactose, manose, fucose, N-acetilgalactosamina, N-acetilglucosamina e cido N-acetilneuramnico (cido silico) (Figura 12.18 e Apndice, para estruturas). Estruturas de glicoprotenas e glicolipdeos so apresentadas nas pginas 638 e 708, respectivamente. O carboidrato ca na superfcie extracelular da membrana plasmtica e na superfcie luminal do retculo endoplasmtico. Funes de carboidratos ligados a protenas em membranas incluem reconhecimento clula-clula, adeso e ao como receptor. H pouco ou nenhum carboidrato livre em membranas.

CH2OH H HO O H OH H H OH

HNCOCH3

N-Acetil--D-glucosamina CH2OH HO H O H OH H H OH

HNCOCH3

N-Acetil--D-galactosamina H H HO O CH3 H HO H OH

12.3 MICELAS, BICAMADAS LIPDICAS E LIPOSSOMOS


O

OH

-L-Fucose H H N HCOH HCOH CH2OH H OH O COOH

Lipdeos Formam Estruturas Vesiculares


A caracterstica estrutural bsica das membranas devese s propriedades fsico-qumicas dos glicerofosfolipdeos e esngolipdeos. Esses compostos anpticos, com uma cabea hidroflica e uma cauda hidrofbica (Figura 12.19a), interagem em sistemas aquosos in vitro para formar esferas, chamadas micelas (Figura 12.19b). Os grupos das cabeas polares cam no lado de fora da esfera, enquanto as caudas hidrofbicas interagem para excluir gua. Micelas tm apenas uma superfcie polar, que ca no lado apresentado para a fase aquosa. Micelas podem ser preparadas contendo um nico lipdeo ou uma mistura de lipdeos. A concentrao de lipdeos necessria para formao de micelas a concentrao micelar crtica. Formao de micelas tambm depende da temperatura e, se uma mistura de lipdeos estiver presente, da razo entre as concentraes dos diferentes lipdeos (ver p. 1062). A estrutura da micela muito estvel, graas s interaes hidrofbicas entre cadeias hidrocarbnicas e atrao dos grupos polares de cabea pela gua. Micelas so importantes em digesto intestinal e absoro de lipdeos (ver p. 1031).

CH3

OH

H II cido N-Acetil-D-neuramnico

FIGURA 12.18 Estruturas de alguns carboidratos de membrana.

Bicamadas Lipdicas Sintticas e Lipossomos


Dependendo das condies experimentais, lipdeos anpticos como glicerofosfolipdeos formam uma es-

trutura em bicamada, com duas camadas de lipdeos formando uma estrutura na qual h contato mnimo das cadeias hidrocarbnicas com gua. Os grupos da cabea polar cam na interface entre o meio aquoso e o lipdeo, e as caudas hidrofbicas interagem, criando um ambiente interior hidrofbico que exclui gua (Figura 12.19c). Esta conformao em bicamada a estrutura lipdica bsica de todas as membranas biolgicas. Bicamadas lipdicas so extremamente estveis, sendo mantidas juntas por foras hidrofbicas das cadeias hidrocarbnicas e interaes inicas dos grupos carregados das cabeas com gua. Bicamadas lipdicas selamse automaticamente, se rompidas. Uma bicamada lipdica, em condies adequadas, fechar-se- sobre si mesma para formar uma vescula esfrica que separa o ambiente externo de um compartimento aquoso interno. Tais vesculas, chamadas lipossomos (Figura 12.19d), so preparadas usando lipdeos puricados e lipdeos extrados de membranas

BioQ.12 445

22.01.07 17:19:06

462

PARTE 3 FUNES DE PROTENAS

CORRELAO CLNICA 12.4

O Rim de Mamferos e Aquaporinas


O papel primrio do rim regular o pH do sangue, eliminar produtos txicos do metabolismo e regular equilbrio de gua do corpo. Cada rim contm cerca de um milho de nfrons, as unidades funcionais multicelulares do tecido. Cada nfron tem vrias regies distintas (ver diagrama), cada uma com funes muito especcas no processamento do ltrado do sangue, que ocorre no glomrulo. Uma grande quantidade de sangue ltrada (cerca de 150 L/dia), e a gua deve ser reabsorvida no nfron e ductos coletores, exceto cerca de 1,5 L/dia, que excretado como urina. Aquaporinas so responsveis pela recuperao de gua do ltrado medida que ue pelo lmen do nfron. Como indicado no diagrama, pelo menos sete diferentes isoformas de aquaporinas, localizadas em diferentes pontos ao longo do nfron e dos ductos coletores, so responsveis pela reabsoro de gua. Existem vrias doenas renais nas quais a reabsoro de gua anormal e nas quais a expresso e a funo das aquaporinas foi investigada. Vrios modelos animais dessas condies foram teis na determinao da causa de algumas dessas condies. Baixos nveis de AQP2 e poliria (excreo excessiva de urina) so encontrados em diabetes insipidus nefrognica adquirida (NDI), hipocalemia adquirida (baixo K+ sangneo) e hipercalcemia (Ca 2+ sangneo aumentado). Em muitos casos, NDI causada por incapacidade do rim responder a vasopressina (ver p. 897); considera-se que isso leve a uma expresso diminuda e/ou incorporao de AQP2 na membrana. Em outros casos de NDI, h um defeito no gene da aquaporina; em alguns casos, este defeito leva a uma incapacidade do monmero formar estruturas tetramricas normais. Nveis de AQP1, AQP2 e AQP3 em modelos animais so reduzidos em isquemia tissular. Em algumas condies, como insucincia cardaca congestiva, cirrose heptica e gravidez, h um aumento na quantidade de AQP2 no rim, levando a uma expanso no volume lquido extracelular. Seres humanos sem atividade de AQP1 do rim aparentemente no tm problemas detectveis em condies normais, mas podem ter em condies de estresse (desidratao). Espera-se que condies clnicas adicionais venham a ser atribudas a alteraes nas outras aquaporinas.
Tbulo contornado distal Tbulo de conexo

Glomrulo

gua

Tubo proximal AQP 1, 7, 8


gua

+ADH gua

gua

Ala descendente fina AQP 1


gua Ala ascencente fina

Dutos coletores AQP 2, 3, 4, 6, 8

+ADH gua

Urina final

Localizao de aquaporinas em cada segmento do nfron e ductos coletores do rim. Modicado a partir de gura das citaes abaixo.

Fonte: King, L. S. e Yasui, M. Aquaporins and disease: Lessons from mice to humans. Trends Endocrinol. Metab. 13:355, 2002. Nielsen, S., Frokiaer, J., Marples, D., Kwon, T-H., Agre, P., e Knepper, M. A. Aquaporins in the kidney: From molecules to medicine. Physiol. Rev. 82: 205, 2002. King, L. S., Kozono, K., e Agre, P. From structure to disease: The evolving tale of Aquaporin biology. Nature Rev. Mol. Cell Biol. 5:687, 2004.

acessrias (, ou ) no tm uma estrutura comum; algumas tm vrios segmentos transmembrnicos e outras so protenas perifricas localizadas inteiramente intra ou extracelularmente. Esto geralmente envolvidas em regulao do canal; subunidades podem interagir com protenas de citoesqueleto e de matriz extracelular. Um modelo do canal de Na+ apresentado na Figura 12.38. Um segmento transmembrnico tem um

resduo carregado positivamente a cada terceira posio, e pode servir como um sensor de voltagem; deslocamento mecnico deste segmento pode levar a uma mudana conformacional na protena, resultando em abertura do canal. Dois mecanismos muito diferentes foram sugeridos, mas nenhum provado, para como o canal e os domnios sensveis a voltagem so acoplados e iniciam a abertura do canal. Canais inicos voltagem-

BioQ.12 462

22.01.07 17:19:39

478

PARTE 3 FUNES DE PROTENAS

12.10 | IONFOROS
Um grupo interessante de compostos sintetizados e excretados por bactrias facilita a translocao de ons inorgnicos atravs de membranas de outras clulas. Essas molculas, chamadas ionforos, so membros dos canais sintetizados no-ribossomicamente (ver p. 459) e so compostos de peso molecular relativamente baixo (at alguns milhares de daltons). H dois subgrupos principais. (1) transportadores mveis, que ligam um on e se difundem facilmente em uma membrana, e (2) formadores de canal. Alguns ionforos importantes so listados na Tabela 12.11. Cada transportador mvel tem uma especicidade denida para ons. Valinomicina (Figura 12.59) tem uma anidade por K+ 1.000 vezes maior do que por Na+, e A23187 (Figura 12.60) tem uma anidade por Ca 2+ 10 vezes maior do que por Mg2+. Vrios dos transportadores mveis tm uma estrutura cclica, e o on ca coordenado com tomos de oxignio no centro da estrutura; a periferia da molcula consiste de grupos hidrofbicos. Quando um on quelado pelo ionforo, sua capa de gua removida e o on envolvido pela capa hidrofbica. O complexo ionforo-on difunde-se livremente atravs da membrana. Como interao de on e ionforo uma reao de equilbrio, uma concentrao de estado estacionrio (steady state) do on se estabelece em ambos os lados da membrana. Valinomicina transporta K+ por um mecanismo eletrognico uniporte que cria um gradiente eletroqumico atravs de uma membrana, visto que transporta um K+ carregado positivamente (Figura 12.61a). Nigericina um antiporter eletricamente neutro; seu grupo carboxila, quando dissociado, liga um on positivo, como K+, formando um complexo neutro que cruza a membrana. Transporta um prton de volta na difuso pela membrana, levando a uma troca de K+ por H+ (Figura 12.61b). Gramicidina A um peptdeo de 15 resduos com D- e L-aminocidos alternados. Em membranas, forma uma -hlice e pode dimerizar, formando um longo segmento transmembrnico (25 ) e um canal de dimetro estreito (5 ) (Figura 12.62). Resduos polares revesTABELA 12.11 Importantes Ionforos
Composto Valinomicina Nonactina A23187 Nigericina Monensina Gramicidina Alameticina Importantes Ctions Transportados K ou Rb NH4 , K
+ + + +

tem o canal e grupos hidrofbicos cam na periferia do canal, interagindo com a membrana lipdica. A estrutura permite a passagem de gua e ctions divalentes, mas no nions. Associao e dissociao de monmeros controla a taxa de uxo de ons. Ionforos tm atividade de antibitico, porque rompem o equilbrio inico intracelular. So tambm valiosas ferramentas experimentais em estudos de translocao de ons em membranas biolgicas e para manipulao da composio inica de clulas.
L-Val

O O
D-Val

O N O L O H

O N O L O H N

D-Val

O O N O O
D-Val L-Val

N O O

K+ L O O

H O N O

L-Val

FIGURA 12.59 Estrutura do complexo valinomicina-K+. Abreviaturas: D-Val, D-valina; L-Val: L-valina; L, L-lactato; H, D-hidroxiisovalerato.
CH3 H3C H H C CH3 O NH OH C O NH CH3 N O O O CH3

FIGURA 12.60 Estrutura de A23187, um ionforo de Ca2+.

Ao Uniporte, eletrognico Uniporte, eletrognico Antiporte, eltron-neutro Antiporte, eltron-neutro

Ca2+ /2 H + K /H
+ + + +

Na /H

Antiporte, eltron-neutro Forma canais Forma canais

H +, Na +, K+, Rb + K , Rb
+ +

BioQ.12 478

22.01.07 17:20:19

CAPTULO 13 FUNDAMENTOS DA TRANSDUO DE SINAL

483

PARTE 3 FUNES DE PROTENAS


P
P
P
P

FUNDAMENTOS DA TRANSDUO DE SINAL


George R. Dubyak
13.1 13.2 VISO GERAL, 484 TRANSDUO DE SINAL INTERCELULAR, 485 Dois modos fundamentais de transduo de sinal intercelular, 485 Sinalizao justcrina ou contato-dependente, 485 Sinalizao endcrina, 486 Sinalizao parcrina, 486 Sinalizao sinptica ou neuronal, 486 Sinalizao autcrina, 486 Molculas sinalizadoras secretadas, 487 RECEPTORES PARA MOLCULAS SECRETADAS, 487 TRANSDUO DE SINAL INTRACELULAR POR RECEPTORES DE SUPERFCIE CELULAR, 488 Ligantes, receptores e interaes receptor-ligante, 488 Relaes entre receptores, efetores e segundos mensageiros, 489 Fosforilao de protenas na transduo de sinal, 490 Protenas regulatrias que ligam GTP na transduo de sinal, 491 Outros componentes de complexos de sinalizao mediada por receptor e cascatas, 491 Interao ligante-receptor e eventos subseqentes de sinalizao, 492 Trmino da transduo de sinal por receptores de superfcie celular, 492 RECEPTORES CANAIS INICOS LIGANTE-DEPENDENTES, 493 Receptores canais inicos, 494 Trmino da sinalizao por receptores canais inicos, 495 Regulao de canais inicos por outros receptores, 495 13.6 RECEPTORES LIGADOS A ENZIMAS, 496 Funes siolgicas de ligantes extracelulares, 496 Receptores tirosina quinases (RTKs), 496 Ras GTPase e MAP quinase, 497 Receptores serina/treonina quinases, 499 RECEPTORES DE CITOCINAS, 500 Receptores de citocinas: estrutura e funo, 500 RECEPTORES ACOPLADOS A PROTENA G, 500 Funes siolgicas e ligantes extracelulares, 500 Estrutura de receptores acoplados a protena G, 501 Protenas G heterotrimricas, 503 O ciclo da protena G, 505 Trmino da sinalizao por receptores acoplados a protena G, 506 Efeitos de toxinas bacterianas sobre protenas G heterotrimricas, 506 TRANSDUO DE SINAL BASEADA EM AMP CCLICO, 506 Regulao da sntese e degradao de AMP cclico, 506 Mecanismos intracelulares de sinalizao por AMP cclico, 508

13

13.3 13.4

13.7

13.8

13.9

13.5

BioQ.13 483

22.01.07 17:40:53

488

PARTE 3 FUNES DE PROTENAS

ou reprimir transcrio e, assim, alterar a expresso de protenas codicadas por estes genes. Devido a seus efeitos sobre a expresso gnica, ativao de receptores intracelulares produz mudanas de longa durao (de horas a dias) na funo das clulas-alvos. A estrutura e a funo desses receptores so descritas em maiores detalhes na p. 488. Receptores de superfcie celular atuam como stios de reconhecimento para a vasta maioria de molculas sinalizadoras que so muito grandes (protenas ou hormnios polipeptdicos) ou muito hidroflicas para cruzar rapidamente a membrana plasmtica da clula-alvo. Tais molculas sinalizadoras interagem com a clula-alvo ligando-se a receptores de superfcie celular que so protenas integrais de membrana (Figura 13.3b). Protenas receptores de superfcie so acopladas a uma variedade de reaes bioqumicas intracelulares chamadas cascatas ou vias de transduo de sinal. O evento mais proximal ou precoce da transduo de sinal, desencadeado pela ligao de uma molcula sinalizadora a um receptor, uma mudana conformacional do receptor que resulta no seguinte: (1) gerao

de molculas sinalizadoras intracelulares conhecidas como segundos mensageiros (a molcula secretada extracelular o primeiro mensageiro); ou (2) uma mudana no potencial eltrico de membrana plasmtica; e (3) ativao de cascatas enzimticas envolvendo protena quinases, protena fosfatases ou proteases. Quatro superfamlias principais de receptores de superfcie celular estrutural e funcionalmente relacionados so mediadores da imensa maioria de vias de comunicao intercelular (Figura 13.4); estas incluem receptores canais inicos ligante-dependentes, receptores ligados a enzimas ou catalticos; famlia de receptores de citocinas; e receptores acoplados a protena G ou GPCR.

13.4 TRANSDUO DE SINAL INTRACELULAR POR RECEPTORES DE SUPERFCIE CELULAR


Ligantes, Receptores e Interaes Receptor-Ligante
Um ligante qualquer molcula que se liga a uma receptor protico. Um agonista um ligante que, ao se ligar, ativa transduo de sinal, enquanto um antagonista um ligante que impede transduo de sinal quando se liga ao receptor. Um agonista ou antagonista siolgico uma molcula de ocorrncia natural (como um hormnio ou neurotransmissor) que atua como um ligante para um receptor. Um agonista ou antagonista farmacolgico uma molcula sinttica que atua como um ligante para um receptor. Muitas drogas teraputicas so agonistas ou antagonistas de receptores. Certos agonistas siolgicos podem estimular mltiplos tipos de receptores que so chamados subtipos de receptores. O conceito-chave que a mesma molcula extracelular sinalizadora pode se ligar a diferentes receptores proticos que so produtos de diferentes genes. Por exemplo, acetilcolina pode interagir com um receptor canal inico ligante-dependente (ver p. 465) que causa contrao de msculo esqueltico, ou com receptores acoplados a protena G (ver p. 491) que causam relaxamento do msculo cardaco (Figura 13.5).

Receptor canal inico ligante-dependente Membrana plasmtica ons Neurotransmissor

Receptor Receptores ligados a enzimas

Citosol

Domnio cataltico inativo Receptores de citocinas

Domnio cataltico inativo

Enzima ativada Receptores acoplados a protena G Neurotransmissor ou hormnio

Protena G

Enzima

Protena G ativada

Enzima ativada

FIGURA 13.4 Principais classes de receptores de superfcie celular para molculas sinalizadoras secretadas. Redesenhado com base em gura de Alberts, B., et al. Essential Cell Biology, 2nd ed. New York: Garland, 2004.

BioQ.13 488

22.01.07 17:41:19

498

PARTE 3 FUNES DE PROTENAS

CORRELAO CLNICA 13.1

Famlia de Receptores Tirosina Quinases ErbB/HER como Alvos para Quimioterapia do Cncer
O receptor de fator de crescimento epidrmico (EGF) foi o primeiro com atividade intrnseca de tirosina quinase a ser identicado e caracterizado em detalhes. Este receptor cataltico membro de uma famlia de quatro protenas relacionadas, chamadas receptores ErbB/HER, devido sua semelhana com o oncogene v-erbB de vrus de eritroblastose aviria, que induz leucemia eritride em pssaros. Esta ligao entre protenas ErbB/HER e cncer tambm se observa no homem. Superexpresso do gene ErbB1 humano, que codica o receptor humano de EGF (HER1), caracteriza cnceres de bexiga, mama, rim, prstata e pulmo de clula no-pequena. Um gene ErbB1 mutante produz um receptor que no tem o domnio extracelular de ligao a EGF, e muito expresso nos glioblastomas, que correspondem a 25% dos tumores de crebro humano adulto. ErbB3 e ErbB4 humanos, respectivamente, codicam os receptores HER3 e HER4 que se ligam a protenas extracelulares pertencentes famlia NRG (neurregulina/herregulina/neu) de fatores de crescimento e diferenciao. ErbB3 freqentemente superexpresso em cnceres de mama, clon, prstata e estmago, enquanto superexpresso de ErbB4 foi observada em tumores de clulas da granulosa ovariana. O outro membro da famlia o gene ErbB2, que codica a protena HER2 a qual, surpreendentemente, no tem capacidade de se ligar a nenhum fator de crescimento extracelular conhecido. Em vez disso, receptores HER2 possuem uma conformao basal que permite a eles formarem homodmeros com outras protenas HER2 no-ligadas ou heterodmeros com receptores HER1, HER3 ou HER4 ocupados por fator de crescimento. Como dimerizao a etapa crtica para ativar a atividade intrnseca de tirosina quinase dessa protena, mesmo modesta superexpresso de HER2 pode alterar regulao normal de crescimento celular. Signicativamente, expresso do gene ErbB2 amplicada em at duas ordens de grandeza em 20% dos seres humanos com cncer de mama invasivo. A expresso aberrante de protena ErbB/HER em mltiplos cnceres humanos tem levado ao desenvolvimento de vrias terapias por drogas que tm estes receptores como alvos. Um grupo de agentes teraputicos inclui anticorpos monoclonais que se ligam a domnios extracelulares funcionalmente signicativos de diferentes subtipos de HER. Trastuzumab (Herceptin da Genentech) um anticorpo antiHER2 que tem sido usado, desde 1998, para o tratamento desses cnceres de mama caracterizados por superexpresso de ErbB2/HER2. O mecanismo por trs das aes antitumorais de Trastuzumab/Herceotin envolve o recrutamento de fatores imunes anticorpo-dependentes que matam as clulas tumorais e a atenuao da protelise do ectodomnio de HER2 (por metaloproteases nativas) que potencializa ainda mais a dimerizao constitutiva desses receptores. Cetixumab (IMC-C225 ou Erbitux da ImClone) um anticorpo que interage com o domnio de ligao de EGF da protena ErbB1/HER1 e, assim, impede ativao induzida por ligante do receptor. Este agente est sendo testado em pacientes com cnceres de clula escamosa de cabea e pescoo ou cnceres de pulmo de clula no-pequena. Alm dessas terapias baseadas em anticorpos, uma variedade de drogas que so molculas pequenas foi projetada para atingir os domnios intracelulares tirosina quinase das protenas ErbB/HER. Esses reagentes so compostos baseados em 4-anilinoquinazolina, que atuam como inibidores competitivos dos stios de ligao de ATP das quinases, particularmente do subtipo ErbB1/HER1. No momento, tais drogas esto sendo testadas em pacientes sofrendo de cnceres de pulmo de clula no-pequena que no responderam a outras quimioterapias.

Fonte: Roskowski, R., Jr. The ErbB/HER receptor protein-tyrosine kinases and cancer. Biochem. Biophys. Res. Commun. 319:1, 2004. transitoriamente e estimulam uma famlia de protena serina/treonina quinases, que desencadeiam a cascata da protena quinase ativada por mitgeno (mitogen-a ctivated protein kinase) ou cascata da MAP quinase (Figura 13.17). Esta cascata de amplicao envolve aes em srie de trs protena quinases; a primeira quinase, ativada por Ras (ou MAP quinase quinase quinase) ativa um conjunto intermedirio de MAP quinase quinases, que ativam as MAP quinases nais efetoras. Quando ativadas, as MAP quinases terminais fosforilam mltiplas protenas-alvos no citosol e no ncleo, incluindo fatores de transcrio que regulam a expresso de genes necessrios para diviso celular, sobrevivncia celular ou diferenciao fenotpica.

BioQ.13 498

22.01.07 17:42:09

514

PARTE 3 FUNES DE PROTENAS


FIGURA 13.31 Papel de calmodulina e protena quinases reguladas por calmodulina nas cascatas de sinalizao intracelular reguladas por Ca2+. Redesenhado com base em gura de Alberts, B., et al. Molecular Biology of the Cell, 4th ed. New York: Garland, 2002. Principais classes de fosfolipases usadas durante transduo de sinal mediada por receptor.

Protena quinase dependente de calmodulina

Protena fosfatase

Pi

Domnio inibitrio COOH

Ca2+ independente (50-80% ativa)

Inativa NH2 Domnio cataltico

Calmodulina

+Ca2+ +Ca2+/calmodulina

Ca2+

ADP P

ATP

Autofosforilao Totalmente ativa

Ativada

nal) podem fosforilar uma ampla faixa de protenas substratos. Alterar a atividade dessas protenas o mecanismo primrio, pelo qual Ca 2+ aumentado altera o comportamento celular. CaM-quinase II tambm se autofosforila quando ligada a calmodulina. Embora Ca 2+ citoslico seja s transitoriamente aumentado em resposta ativao de receptores de superfcie celular, esta autofosforilao de CaM-quinase II permite que permanea ativa muito depois do Ca 2+ citoslico ter voltado ao nvel de linha basal. CaM-quinases podem fosforilar e modular uma ampla faixa de enzimas, canais inicos, protenas contrteis e protenas regulatrias de genes.

fosfatos e diacilgliceris como segundos mensageiros. Inositol fosfolipdeos podem ser mais fosforilados por fosfoinositdeo-3-quinase ( PI-3K) para produzir fosfatidilinositol-3,4,5-trisfosfato ( PIP3), outro segundo mensageiro. Enzimas fosfolipases D ( PLD) hidrolisam predominantemente fosfolipdeos de colina ou etanolamina para produzir cido fosfatdico, que subseqentemente metabolizado por cido fosfatdico fosfo-hidrolases (PAP) para gerar o segundo mensageiro diacilglicerol. Enzimas fosfolipases A2 ( PLA2) atacam vrios fosfolipdeos para produzir cidos graxos livres, como cido araquidnico e liso-fosfolipdeos.

13.12 TRANSDUO DE SINAL BASEADA EM FOSFOLIPDEOS


Metabolismo Regulado de Fosfolipdeos como um Componente de Vias Intracelulares de Sinalizao
Transduo de sinal por muitos receptores de superfcie celular envolve ativao de uma ou mais fosfolipases que catalisam a hidrlise de diferentes classes de fosfolipdeos (p. ex., fosfolipdeos de inositol ou colina). Vrias importantes classes de enzimas efetoras fosfolipases catalisam a produo de diferentes produtos que atuam como segundos mensageiros ou reguladores de produo de segundos mensageiros (Figura 13.32). Enzimas fosfolipases C ( PI-PLC) hidrolisam fosfolipdeos de inositol gerando inositol

Regulao de Fofolipase C e Fosfolipase D


Como descrito anteriormente para transduo de sinal baseada em Ca 2+, muitos receptores acoplados a protena G e receptores tirosina quinases estimulam a liberao de Ca 2+ do retculo endoplasmtico por meio de ativao da produo de 1,4,5-inositol trisfosfato (IP3). Este segundo mensageiro solvel em gua derivado da hidrlise de fosfatidilinositol-4,5-bisfosfato ( PIP2), um fosfolipdeo de membrana relativamente minoritrio que gerado por mltiplas fosforilaes do resduo de inositol do fosfatidilinositol. Esta hidrlise de PIP2 catalisada por uma famlia de fosfolipases tipo C ( PLC) com alta seletividade para inositol fosfolipdeos (Figura 13.32). importante apreciar que a hidrlise de PIPs por uma PLC gera dois segundos mensageiros diferentes: (1) o produto solvel IP3 e (2) diacilglicerol ( DAG), um segundo mensageiro hidrofbico. Enzimas PI-PLC so ativadas por interao com subunidades de protenas G da famlia Gq /11 ou as subunidades

BioQ.13 514

22.01.07 17:43:19

CAPTULO 14 BIOENERGTICA E METABOLISMO OXIDATIVO

521

PARTE 4 VIAS METABLICAS E SEU CONTROLE


P
P
P
P

BIOENERGTICA E METABOLISMO OXIDATIVO


Diana S. Beattie
14.1 SISTEMAS DE PRODUO E DE UTILIZAO DE ENERGIA, 522 ATP liga sistemas de produo e de utilizao de energia, 522 NAD+ e NADPH em catabolismo e anabolismo, 523 RELAES TERMODINMICAS E COMPONENTES RICOS EM ENERGIA, 524 Energia Livre energia disponvel para trabalho til, 525 Valor calrico de componentes da dieta, 526 Compostos so classicados com base em energia liberada na hidrlise de grupos especcos, 526 Variaes de energia livre podem ser determinadas em reaes enzimticas acopladas, 527 Energias de ligaes de alta energia de vrios grupos podem ser transferidas de um composto para outro, 527 FONTES E DESTINOS DA ACETIL-COENZIMA A, 529 Fontes e destinos metablicos do piruvato, 530 Piruvato desidrogenase um complexo multienzimtico, 531 Piruvato desidrogenase rigorosamente regulada, 531 Acetil-CoA usado por vrias vias diferentes, 534 CICLO DOS CIDOS TRICARBOXLICOS, 534 Reaes do ciclo dos cidos tricarboxlicos, 535 Converso do grupo acetil de acetil-CoA a CO2 e H2O conserva energia, 537 Ciclo dos cidos tricarboxlicos serve como uma fonte de intermedirios biossintticos, 537 Reaes anaplerticas repem intermedirios do ciclo dos cidos tricarboxlicos, 538 Atividade do ciclo dos cidos tricarboxlicos cuidadosamente regulada, 539 14.5 ESTRUTURA E COMPARTIMENTALIZAO POR MEMBRANAS MITOCONDRIAIS, 540 Membranas mitocondriais interna e externa tm diferentes composies e funes, 540 CADEIA DE TRANSPORTE DE ELTRONS, 542 Reaes de oxidao-reduo, 542 Variaes da energia livre em reaes redox, 544 Transporte mitocondrial de eltrons um sistema com mltiplos componentes, 544 Complexo I: NADH-ubiquinona xido-redutase, 545 Complexo II: succinato-ubiquinona xido-redutase, 546 Outras desidrogenases avoprotenas mitocondriais, 546 Complexo III: ubiquinol-citocromo c xido-redutase, 547 Citocromos, 547 Ciclo Q para transferncia de eltrons e bombeamento de prtons no complexo III, 549 Movimento proposto das protenas ferroenxofre durante transferncia de eltrons no complexo III, 549

14

14.2

14.6

14.3

14.4

BioQ.14 521

22.01.07 17:50:31

524

PARTE 4 VIA METABLICAS E SEU CONTROLE Carboidrato


H C OH Nicotinamida adenina dinucleotdeo (NAD+) Nicotinamida (oxidada) H
5 6

Nicotinamida (reduzida) on hbrido, H: H H O C .. N ... NH2 + H+

O
3 2

NH2

N+
1

C H

OH

O O

CH2 H H

Oxidado

O AMP P O O

H OH OH N

NH2 N N

Lipdeo
H C H

CH2 H H

Reduzido

H OH OH NADP+ contm um grupo fosforil nessa 2-hidroxila

FIGURA 14.3 Estados de oxidao de tomos de carbono tpicos em carboidratos e lipdeos.

FIGURA 14.4 Estrutura de nicotinamida adenina dinucleotdeo (NAD +). on hidreto (H: -, um prton com dois eltrons) transferido para NAD + forma NADH.

14.2 RELAES TERMODINMICAS E COMPONENTES RICOS EM ENERGIA


Clulas podem interconverter diferentes formas de energia e tambm trocam energia com seu ambiente. Os princpios de termodinmica governam reaes desse tipo. Conhecimento desses princpios facilita uma percepo de como reaes que produzem e que utilizam energia ocorrem dentro da mesma clula, e como um organismo capaz de executar vrias funes de trabalho. A primeira lei da termodinmica arma que energia no pode ser criada nem destruda. Essa lei de conservao de energia estipula que, embora energia possa ser convertida de uma forma para outra, a energia total de um sistema permanece constante. Por exemplo, energia qumica disponvel em um combustvel metablico, como glicose, convertida na gliclise em energia qumica de ATP. No msculo esqueltico, a energia qumica envolvida em ligaes fosfato ricas em energia do ATP convertida em energia mecnica, durante a contrao muscular. A energia de um gradiente de prtons com eletropotencial osmtico atravs da membrana mitocondrial convertida em energia qumica durante a sntese de ATP. A segunda lei da termodinmica diz respeito a entropia. Entropia, designada por S, uma medida ou indicador do grau de desordem ou casualidade de um

Substrato reduzido Catabolismo

Produto oxidado

NADP+

NADPH

Anabolismo Produto reduzido Precursor oxidado

FIGURA 14.5 Transferncia de equivalentes de reduo durante catabolismo e anabolismo usando NADPH e NADH.

sistema. Entropia vista como a energia de um sistema que no est disponvel para realizar trabalho til. Todos os processos, sejam qumicos ou biolgicos, tendem a progredir em direo a uma situao de mxima entropia. Portanto, sistemas vivos que so muito ordenados, nunca esto em equilbrio com seu ambiente, visto que o equilbrio em um sistema resulta quando acaso ou desordem (entropia) est no mximo. Em sistemas biolgicos, entretanto, quase impossvel quanticar mudanas de entropia porque tais sistemas raramente esto em equilbrio. Para maior simplicidade e por utilidade inerente nessas consideraes, uma grandeza chamada energia livre empregada.

BioQ.14 524

22.01.07 17:50:36

CAPTULO 14 BIOENERGTICA E METABOLISMO OXIDATIVO


COO CH2 CH2 COO Succinato Malonato Maleato COO CH2 COO H H COO

537

C C

COO

O NADH produzido nas trs desidrogenases NAD + ligadas no ciclo TCA rapidamente oxidado a NAD + pela cadeia respiratria. Este outro fator que favorece a direo para frente da malato desidrogenase.

FIGURA 14.21 Estruturas do succinato, um intermedirio do ciclo TCA; malonato, um inibidor da succinato desidrogenase e do ciclo; e maleato, um composto no envolvido no ciclo.

Converso do Grupo Acetil de AcetilCoA a CO2 e H2O Conserva Energia


O ciclo TCA (Figura 14.20) a via oxidativa terminal para a maioria dos combustveis metablicos. Resduos de dois carbonos na forma de acetil-CoA so completamente oxidados a CO2 e H2O, e quatro etapas oxidativas resultam na formao de 3 NADH + H+ e 1 FADH2, que so usados subseqentemente para gerao de ATP. Oxidao de cada NADH + H+ resulta em formao de 2,5 ATPs por fosforilao oxidativa, enquanto que oxidao do FADH2 formado na reao da succinato desidrogenase gera 1,5 ATPs. Uma ligao de alta energia formada como GTP, na reao da succinil-CoA sintetase. Assim, a gerao lquida de ATP ou seus equivalentes (i. , GTP) para a completa oxidao de um grupo acetil no ciclo de Krebs 10.

(200 kDa) e estereoespecca para a forma trans do substrato (a forma cis, maleato, no substrato; Figura 14.21). A reao livremente reversvel em condies siolgicas. Correlao Clnica 14.2 descreve uma decincia gentica de fumarase. A reao nal do ciclo TCA catalisada pela malato desidrogenase, na qual os equivalentes de reduo so transferidos para NAD +, para formar NADH + H+. O equilbrio da reao fortemente deslocado para a formao de L-malato, com um Go = +7,0 kcal mol1. Esta reao endergnica deslocada no sentido para frente por ao da citrato sintase e de outras reaes, que removem oxaloacetato.

Ciclo dos cidos Tricarboxlicos Serve como uma Fonte de Intermedirios Biossintticos
A discusso do ciclo TCA at agora se concentrou em seu papel na quebra oxidativa de grupos acetil a CO2 e H2O, formao de coenzimas reduzidas e sntese de ATP. Em geral, o ciclo TCA o mecanismo nal comum para quebra de alimentos; entretanto, como resumido na Figura 14.22, os compostos de quatro, cinco e seis carbonos gerados nas reaes do ciclo TCA so importantes intermedirios em processos biossintticos. Succinil-CoA, malato, oxaloacetato, -cetoglutarato e citrato so todos precursores da biossntese de importantes compostos celulares. Transaminao converte -cetoglutarato em glutamato, que pode deixar a mitocndria e ser convertido em vrios outros aminocidos. No tecido nervoso, -cetoglutarato convertido nos neurotransmissores glutamato e cido -aminobutrico (GABA). Glutamato tambm produzido a partir de -cetoglutarato pela enzima mitocondrial glutamato desidrogenase, em presena de NADH ou NADPH e amnia. O amino grupo incorporado em glutamato pode, ento, ser transferido para formar vrios aminocidos, por diferentes aminotransferases. Estas enzimas e a relevncia da incorporao ou da liberao de amnia em ou de -cetocidos so discutidas no Captulo 19. Succinil-CoA representa um ponto de ramicao metablico (Figura 14.23), porque pode ser formado a partir de -cetoglutarato no ciclo ou a partir de metilmalonil-CoA, nas etapas nais da quebra de cidos graxos de cadeia mpar ou dos aminocidos de cadeia ramicada valina e isoleucina, ou pode ser convertido

CORRELAO CLNICA 14.2

Decincia de Fumarase
Decincia de enzimas do ciclo TCA rara, indicando a importncia desta via para sobrevivncia. Vrios casos, entretanto, foram descritos, de severa decincia de fumarase em mitocndrias e citosol de tecidos (p. ex., linfcitos do sangue). caracterizada por severa decincia neurolgica, encefalopatia e distonia, que se desenvolvem logo aps o nascimento. Urina contm quantidades anormais de fumarato e nveis elevados de succinato, -cetoglutarato, citrato e malato. As isoenzimas mitocondrial e citoslica de fumarase so derivadas de um nico gene. Em pacientes afetados, ambos os pais tm a metade dos nveis normais de atividade enzimtica, mas so clinicamente normais, como seria de se esperar em uma doena autossmica recessiva. A primeira mutao caracterizada no gene da fumarase contm uma glutamina substituda por um resduo de glutamato 319. Fonte: Bourgeron, T., Chreiten, D., Poggi-Bach, J., et. al. Mutation of the fumarase gene in two siblings with progressive encephalopathy and fumarase deciency. J. Clin. Invest. 93:2514, 1994.

BioQ.14 537

22.01.07 17:50:57

CAPTULO 14 BIOENERGTICA E METABOLISMO OXIDATIVO

565

CORRELAO CLNICA 14.6

Intolerncia a Exerccio em Pacientes com Mutaes no Citocromo b


Em 1993, uma mutao no citocromo b resultando em atividade diminuda do complexo citocromo bc1 foi encontrada em um homem de 25 anos de idade, que se apresentava com intolerncia a exerccio e fraqueza proximal. A mutao substitua um resduo de aspartato, no lugar de uma glicina conservada na posio 290. Subseqentemente, demonstrou-se que outros pacientes com sintomas semelhantes e atividade diminuda do complexo bc1 tm mutaes nas quais um glutamato substituiu uma glicina conservada na posio 339, e uma serina substituiu uma glicina conservada na posio 34. Mais recentemente, demonstrou-se que um paciente com severa cardiomiopatia hipertrca tinha uma mutao na qual um glutamato substituiu uma glicina conservada na posio 166. As mutaes de glicina para aspartato ou glutamato estavam localizadas no citocromo b prximo ao stio QO para oxidao de ubiquinol, enquanto a mutao glicina para serina localizava-se prxima do stio Qi da reduo de ubiquinona. Todas essas mutaes envolvem uma transio de guanina para adenina no mtDNA, sugerindo que a mutao pode ter resultado de dano oxidativo. Alm disso, em todas as mutaes de sentido errado (missense), uma glicina conservada foi substituda por uma molcula carregada maior; isto alterou a estrutura do citocromo b, resultando em atividade cataltica diminuda do complexo bc1. Mutaes sem sentido (nonsense) resultando em citocromo b truncado e mutaes envolvendo delees de 4-24 pares de bases do mtDNA foram identicadas. Estas mutaes nonsense e por delees freqentemente levam a severa intolerncia a exerccio, acidose lctica no estado de repouso e ocasionalmente mioglobinria. Em contraste com a maioria das mutaes no mtDNA, as mutaes identicadas no gene do citocromo b no so de herana materna. Alm disso, a maioria foi expressa apenas em tecidos musculares, sugerindo que sejam mutaes somticas, que ocorreram durante diferenciao de clulas troncos miognicas.

Fonte: Andreu, A. L., et al. Exercise intolerance due to mutations in the cytochrome b gene of mitochondrial DNA. N. Engl. J. Med. 341:1037, 1999.

14.10 ESPCIES REATIVAS DE OXIGNIO (ROS)


Oxignio essencial para a vida. A maioria das oxidaes intracelulares resulta em transferncia de dois eltrons para aceptores apropriados, como NAD + ou FAD, que so ento oxidados pela cadeia de transporte de eltrons. A etapa nal desta cadeia catalisada por citocromo c oxidase, que liga fortemente O2 ao centro binuclear, onde reduo passo a passo do O2 ocorre, sem liberao de intermedirios no processo de oxidao (ver Seo 14.6, p. 542). A estrutura eletrnica do O2, entretanto, favorece sua reduo por adio de um eltron de cada vez, levando gerao de radicais de oxignio que podem causar dano celular. Um radical uma molcula com um eltron no-pareado muito reativo em um orbital externo, que pode iniciar uma cadeia de reaes por remoo de um eltron de outra molcula para completar seu prprio orbital. A transferncia passo a passo de eltrons para O2 resulta em formao de nions superxido (O2-), depois perxido de hidrognio (H2O2), e nalmente radical hidroxila livre (OH) (Figura 14.61).

O radical hidroxila , sem dvida, o radical livre mais perigoso, uma vez que est envolvido em reaes como peroxidao de lipdeos e gerao de outros radicais txicos. Perxido de hidrognio no um radical livre, mas convertido pelas reaes de Fenton ou de HaberWeiss no radical hidroxila, em presena de Fe2+ ou de Cu+, que so prevalentes em clulas (Figura 14.62).

Produo de Espcies Reativas de Oxignio


Embora processos oxidativos em clulas geralmente resultem em transferncia de eltrons para O2 para formar gua, sem liberao de intermedirios, um pequeno nmero de radicais de oxignio inevitavelmente formado devido a vazamento nas reaes de transferncia de eltrons. A principal fonte intracelular de radicais de oxignio a cadeia de transporte de eltrons mitocondrial, onde superxido produzido por transferncia de um eltron para O2, a partir da semiquinona estvel produzida durante a reduo de ubiquinona pelos complexos I e II (Figura 14.63). Superxido tambm pode ser produzido por transferncia de um eltron de uma avina, como FMN. As espcies reativas de oxi-

BioQ.14 565

22.01.07 17:51:56

572

PARTE 4 VIA METABLICAS E SEU CONTROLE

PARTE 4 VIAS METABLICAS E SEU CONTROLE


Glicognio
G
C

METABOLISMO DE CARBOIDRATOS I: PRINCIPAIS VIAS METABLICAS E SEU CONTROLE


Robert A. Harris
15.1 VISO GERAL, 573 15.2 GLICLISE, 574 Gliclise ocorre em todas as clulas humanas, 574 Glicose metabolizada diferentemente em vrias clulas, 575 15.3 VIA GLICOLTICA, 577 Gliclise ocorre em trs estgios, 578 Estgio um: preparao da glicose, 578 Estgio dois: quebra de um intermedirio fosforilado, 578 Estgio trs: reaes de xido-reduo e sntese de ATP, 578 Rendimento em ATP e equao balanceada da gliclise anaerbica, 581 NADH gerado por gliclise deve ser oxidado novamente a NAD +: papel da lactato desidrogenase e das lanadeiras de substrato, 582 Gliclise anaerbica, 582 Gliclise aerbica, 582 Lanadeiras so importantes em outras vias de xido-reduo, 583 Oxidao de lcool, 583 Formao de glucurondeo, 583 Reagentes suldrila e uoreto inibem gliclise, 583 Arsenato impede sntese de ATP sem inibir gliclise, 583 15.4 REGULAO DA GLICLISE, 584 Hexoquinase e glucoquinase tm propriedades diferentes, 586 6-Fosfofruto-1-quinase uma enzima regulatria da gliclise, 589 Regulao da 6-fosfofruto-1-quinase por ATP e AMP, 589 Regulao da 6-fosfofruto-1-quinase por pH intracelular, 590 Regulao da 6-fosfofruto-1-quinase por citrato, 592 Controle hormonal da 6-fosfofruto-1-quinase por cAMP e frutose 2,6-bisfosfato, 592 A enzima bifuncional 6-fosfofruto-2-quinase/frutose 2,6-bisfosfatase regulada por fosforilao, 595 Corao contm uma isoenzima diferente da 6-fosfofruto-2-quinase/frutose 2,6-bisfosfatase, 595 Piruvato quinase tambm uma enzima regulatria da gliclise, 595 15.5 GLUCONEOGNESE, 597 Sntese de glicose necessria para sobrevivncia, 597 Ciclos de Cori e da alanina, 599 Sntese de glicose a partir de lactato, 600 Gluconeognese usa muitas enzimas glicolticas na direo inversa, 601 Glicose sintetizada a partir da maioria dos aminocidos, 602

15

BioQ.15 572

22.01.07 18:00:31

574

PARTE 4 VIA METABLICAS E SEU CONTROLE


GLICOGNIO Glicogenlise GLICOSE Gliclise LACTATO Gluconeognese Glicognese H HO OH CH2OH O H OH

H OH -D-Glicose 2 ADP3 + 2 Pi2 2 ATP4 O O C 2 HO C H

FIGURA 15.1 Relao da glicose com as principais vias do metabolismo de carboidratos.

gulao exercida em enzimas chaves ser enfatizado ao longo do captulo. Isto ser particularmente verdadeiro para sntese (glicognese) e degradao (glicogenlise) de glicognio. Muitas clulas armazenam glicognio para suas prprias necessidades futuras. O fgado menos egosta, armazenando glicognio principalmente para manuteno da glicose sangnea, para garantir que outros tecidos, em especial o crebro, tenham um suprimento adequado. Regulao da sntese e da degradao de glicognio um modelo para nosso entendimento de como hormnios funcionam e como vias metablicas so reguladas. Estes tpicos contribuem para nosso entendimento da condio diabtica, do jejum e de como os tecidos do corpo respondem a estresse, trauma severo e leses. A qumica e a nomenclatura dos carboidratos so apresentadas no Apndice.

CH3 L-Lactato

FIGURA 15.2 Equao geral balanceada da soma das reaes da gliclise.

15.2 | GLICLISE
Gliclise Ocorre em Todas as Clulas Humanas
A via de Embden-Meyerhof ou via glicoltica representa um processo antigo, que ocorre em todas as clulas do corpo humano, pelo qual ocorre degradao anaerbica de glicose em lactato, com liberao de energia como ATP. Este um exemplo da fermentao anaerbica, um termo usado para vias metablicas que organismos usam para extrair energia qumica de combustveis ricos em energia, em ausncia de oxignio. Para muitos tecidos, gliclise s uma via fornecedora de energia de emergncia, capaz de produzir 2 moles de ATP a partir de 1 mol de glicose, em ausncia de oxignio (Figura 15.2). Quando o suprimento de oxignio de um tecido interrompido, os nveis de ATP ainda podem ser mantidos pela gliclise, pelo menos por um curto perodo. Muitos exemplos poderiam ser dados, mas a capacidade de utilizar gliclise como uma fonte de energia particularmente importante durante o nascimento natural de seres humanos. Com exceo do crebro, a circulao do sangue diminui para a maioria das partes do corpo do beb, durante o parto. Normalmente, o crebro no privado de oxignio durante o parto, mas outros tecidos passam a depender da glicli-

se para seu suprimento de ATP, at que um suprimento normal de oxignio esteja disponvel. Isto economiza oxignio para ser usado pelo crebro, ilustrando um dos muitos mecanismos que evoluram para assegurar a sobrevivncia do tecido cerebral em momentos de estresse. Oxignio no necessrio para gliclise; de fato, oxignio pode, indiretamente, suprimir gliclise pelo efeito Pasteur, que ser considerado mais tarde (p. 589). Contudo, gliclise ocorre em clulas com um suprimento abundante de oxignio molecular. Desde que as clulas tambm contenham mitocndrias, o produto nal da gliclise em presena de oxignio piruvato, e no lactato. Piruvato , ento, completamente oxidado a CO2 e H2O pelo complexo piruvato desidrogenase e enzimas do ciclo TCA alojadas dentro de mitocndrias (Figura 15.3). Gliclise, portanto, prepara para a oxidao aerbica dos carboidratos. O processo completo de gliclise e oxidao mitocondrial do piruvato a CO2 e H2O tem a seguinte equao: D-Glicose(C6H12O6) + 6 O2 + 32 ADP3- + 32 Pi 2- + + 32 H+ 6 CO2 + 6 H2O + 32 ATP4 Muito mais ATP produzido na oxidao completa da glicose a CO2 e H2O (32 ATP/glicose) do que na converso de glicose em lactato (2 ATP/glicose). Isto tem importantes conseqncias a serem consideradas em detalhes mais adiante. A importncia da gliclise como uma via preparatria melhor exemplicada pelo crebro, que tem uma necessidade absoluta de glicose. O piruvato processado pela gliclise oxidado a CO2 em mitocndrias. Um crebro humano adulto usa aproximadamente 120 g de glicose por dia para suprir sua necessidade de ATP. Em contraste, gliclise com lactato como produto nal o principal mecanismo de produo de ATP em alguns outros tecidos. Glbulos vermelhos no tm mitocndrias e, portanto, so incapazes de converter piruvato em CO2. A crnea, o cristalino e regies da retina

BioQ.15 574

22.01.07 18:00:33

CAPTULO 15 METABOLISMO DE CARBOIDRATOS I: PRINCIPAIS VIAS METABLICAS E SEU CONTROLE

589

na enzima glucoquinase no fgado. Portanto, uma pessoa que est consumindo uma refeio grande e rica em carboidratos ter maiores quantidades de glucoquinase do que uma que no est. O fgado com glucoquinase induzida contribui mais para baixar os nveis elevados de glicose no sangue. A ausncia de insulina torna o fgado de pacientes com diabetes mellitus deciente em glucoquinase, a despeito dos altos nveis de glicose sangnea, e diminui a capacidade de o fgado tamponar a glicose sangnea (ver Corr. Cln. 15.4). Defeitos no gene que codica glucoquinase, que alteram sua S0,5 e/ ou Vmax causam diabetes do jovem com incio na maturidade (MODY, maturity- onset diabetes of the young), uma forma de diabetes mellitus tipo 2.

CORRELAO CLNICA 15.4

Diabetes Mellitus
Diabetes mellitus uma doena crnica que se caracteriza por alteraes no metabolismo de carboidratos, lipdeos e protenas. Dois tipos principais so identicados clinicamente: tipo 1 (ver Corr. Cln. 22.8, p. 857) e tipo 2 (ver Corr. Cln. 22.7, p. 855). Em pacientes sem hiperglicemia em jejum, o teste de tolerncia glicose por via oral pode ser usado para diagnstico. Consiste na determinao do nvel de glicose sangnea no estado de jejum e em intervalos de 30-60 min., por 2 h ou mais, aps consumo de sobrecarga de 100 g de glicose. Em indivduos normais, glicose sangnea retorna aos nveis normais em 2 h aps ingesto do carboidrato. No diabetes, glicose no sangue atinge um nvel mais elevado e permanece elevada por perodos de tempo mais longos, dependendo da gravidade da doena. Entretanto, muitos fatores podem contribuir para um teste de tolerncia a glicose anormal. O paciente deve ter consumido uma dieta rica em carboidratos nos 3 dias anteriores, presumivelmente para permitir induo de enzimas das vias de utilizao de glicose, por exemplo, glucoquinase, acil graxo sintase e acetil-CoA carboxilase. Quase todas as infeces (at mesmo um resfriado) e estresse menos denido (presumivelmente por efeitos sobre o sistema nervoso simptico) podem resultar em anormalidades transitrias no teste de tolerncia glicose. Devido a esses problemas, hiperglicemia de jejum seria, provavelmente, o teste sine qua non para o diagnstico de diabetes. Captao de glicose por tecidos sensveis a insulina isto , mscular e adiposo diminuda no estado diabtico. O paciente diabtico ou no tem insulina ou desenvolveu resistncia insulina nestes tecidos. Resistncia insulina resulta de anomalia no receptor de insulina ou em etapas subseqentes, mediadoras dos efeitos metablicos da insulina. Clulas do parnquima heptico no requerem insulina para captar glicose. Sem insulina, contudo, o fgado tem capacidade diminuda para remover glicose do sangue. Isto explicado, em parte, por atividade diminuda de glucoquinase e a perda de ao da insulina sobre enzimaschaves da glicognese e da via glicoltica.

6-Fosfofruto-1-quinase uma Enzima Regulatria da Gliclise


6-Fosfofruto-1-quinase seja um ponto regulatrio muito importante da gliclise. Catalisa a primeira etapa de comprometimento da gliclise porque a reao catalisada pela fosfoglicose isomerase reversvel, e clulas fazem uso de glicose 6-fosfato na via das pentoses fosfato e para sntese de glicognio. Citrato, ATP e ons hidrognio (baixo pH) so os efetores alostricos negativos importantes, enquanto AMP e frutose 2,6-bisfosfato so importantes efetores alostricos positivos (Figura 15.13). Estes compostos sinalizam a necessidade de diferentes velocidades da gliclise em resposta a mudanas em (a) estado energtico da clula (ATP e AMP), (b) ambiente interno da clula (ons hidrognio), (c) disponibilidade de combustveis alternativos, como cidos graxos e corpos cetnicos (citrato), e (d) razo insulina/glucagon no sangue (frutose 2,6-bisfosfato).

Regulao da 6-Fosfofruto-1-quinase por ATP e AMP


O efeito Pasteur a inibio da utilizao de glicose e o acmulo de lactato que ocorre quando respirao (consumo de oxignio) iniciada em clulas anaerbicas. perfeitamente compreensvel em bases termodinmicas, uma vez que a oxidao completa da glicose a CO2 e H2O rende muito mais ATP do que gliclise anaerbica: Gliclise: D-Glicose + 2 ADP3 + 2 Pi 2 2 L-lactato + 2 ATP4 Oxidao completa: D-Glicose + 6 O2 + 32 ADP3- + 32 Pi 2 + 32 H+ 6 CO2 + 6 H2O + 32 ATP4 Clulas usam ATP para fornecer a energia necessria a seus processos de trabalho inerentes. Como muito mais ATP produzido a partir de glicose em presena de oxignio, muito menos glicose precisa ser consumida para satisfazer a demanda de energia. O efeito Pasteur

Fonte: Taylor, S. I. Insulin action, insulin resistance and type 2 diabetes mellitus. Em: C. R. Scriver, A. L. Beaudet, W. S. Sly e D. Valle (Eds.), The Metabolic and Molecular Bases of Inherited Disease, 8th ed., New York: McGraw-Hill, 2001, p. 1433.

BioQ.15 589

22.01.07 18:00:57

CAPTULO 15 METABOLISMO DE CARBOIDRATOS I: PRINCIPAIS VIAS METABLICAS E SEU CONTROLE

609

15.6 GLICOGENLISE E GLICOGNESE


Glicognio a Forma de Armazenamento de Glicose
Glicogenlise refere-se quebra de glicognio em glicose ou glicose 6-fosfato; glicognese refere-se sntese de glicognio. Estes processos ocorrem em quase todos os tecidos, mas especialmente em msculo e fgado. No homem bem alimentado, o contedo de glicognio no fgado pode responder por at 10% do peso mido desse rgo. Msculo armazena menos glicognio, quando expresso nas mesmas bases um mximo de apenas 1-2% do seu peso mido. Contudo, a maioria das pessoas tem mais msculos do que fgado, com o total do glicognio muscular chegando ao dobro da quantidade de glicognio heptico. Grnulos de glicognio so abundantes no fgado de animais bem alimentados (Figura 15.46), mas esto virtualmente ausentes deste rgo aps 24 h de jejum. Exerccio pesado causa a mesma perda de grnulos de glicognio em bras musculares. Esses grnulos so grupos de molculas individuais de glicognio que tm uma massa de at 2 107 Da. Glicognio composto de resduos glucosil, ligados principalmente por ligaes glicosdicas -1,4 (Figura 15.47). Ramicaes surgem de ligaes -1,6 freqentes. Um brao da

CH2OH O O O

CH2OH O O

Ligao glicosdica -1,4

CH2OH O O O CH2 O O O

Ligao glicosdica -1,6

FIGURA 15.47 Dois tipos de ligaes entre as molculas de glicose esto presentes no glicognio.

rvore do glicognio (ver Figura 15.48) caracterizado por ramos a cada quatro resduos glucosil no esqueleto (core) mais central da molcula, e muito menos freqentemente em regies mais externas. Glicognio contrasta com protenas e cidos nuclicos, devido a essa ramicao, mas, claro, uma forma de armazenamento de combustvel e no catalisa reaes nem contm informao em uma clula. Glicognio estocado em msculo e fgado por razes bem diferentes. Glicognio do msculo uma reserva de combustvel para a produo de ATP dentro daquele tecido, enquanto glicognio heptico uma reserva de glicose para a manuteno das concentraes de glicose no sangue. Os nveis de glicognio heptico variam: so altos logo aps uma refeio e, depois, diminuem lentamente medida que usado para ajudar a manter o nvel de glicose no sangue (ver Figura 15.49) entre refeies e durante o jejum noturno. No homem como no rato, o

FIGURA 15.46 Micrograa eletrnica mostrando grnulos de glicognio (material corado escuro) no fgado de um rato alimentado. Micrograa generosamente cedida por Dr. Robert R. Cardell do Department of Anatomy da University of Cincinnati.

FIGURA 15.48 Estrutura ramicada do glicognio

BioQ.15 609

22.01.07 18:01:40

626

PARTE 4 VIA METABLICAS E SEU CONTROLE

PARTE 4 VIAS METABLICAS E SEU CONTROLE


COO
H
O

CH2OH
O SO 3

H OH
H

OH

HNCOCH3

Unidade repetitiva do condroitim 4-sulfato

METABOLISMO DE CARBOIDRATOS II: VIAS ESPECIAIS E GLICOCONJUGADOS


Nancy B. Schwartz
16.1 VISO GERAL, 627 16.2 VIA DAS PENTOSES FOSFATO, 627 Via das pentoses fosfato tem duas fases, 627 Glicose 6-fosfato oxidada e descarboxilada em uma pentose fosfato, 627 Interconverses de pentoses fosfato levam a intermedirios glicolticos, 628 Glicose 6-fosfato pode ser completamente oxidada a CO2, 628 Via das pentoses fosfato produz NADPH, 630 16.3 INTERCONVERSES DE ACARES E FORMAO DE NUCLEOTDEOS-ACAR, 631 Isomerizao e fosforilao so reaes comuns para interconverter carboidratos, 631 Acares ligados a nucleotdeos so intermedirios em muitas transformaes de acares, 633 Epimerizao interconverte glicose e galactose, 633 cido glucurnico formado por oxidao de UDP-glicose, 634 Descarboxilao, xido-reduo e transaminao de acares geram produtos necessrios, 635 cidos silicos so derivados de N-acetilglucosamina, 637 16.4 BIOSSNTESE DE CARBOIDRATOS COMPLEXOS, 637 16.5 GLICOPROTENAS, 638 Glicoprotenas contm quantidades variveis de carboidratos, 639 Carboidratos so ligados Covalentemente a glicoprotenas por ligaes N- ou O-glicosdicas, 639 Sntese de glicoprotenas N-ligadas envolve dolicol fosfato, 640 16.6 PROTEOGLICANOS, 642 Existem seis classes de proteoglicanos, 642 Hialuronato um copolmero de N-acetilglucosamina e cido glucurnico, 642 Condroitim sulfatos so os glicosaminoglicanos mais abundantes, 642 Dermatam sulfato contm cido L-idurnico, 643 Heparina e heparam sulfato diferem dos outros glicosaminoglicanos, 643 Queratam sulfato existe em duas formas, 643 Biossntese de condroitim sulfato tpica da formao de glicosaminoglicanos, 643 BIBLIOGRAFIA, 647 QUESTES E RESPOSTAS, 647

16

BioQ.16 626

22.01.07 18:09:26

CAPTULO 16 METABOLISMO DE CARBOIDRATOS II: VIAS ESPECIAIS E GLICOCONJUGADOS


ATP Glicose ADP (6) Glicose 6-fosfato (6) NADP+ (6) NADPH + (6) H+ 6-Fosfoglucono-lactona H2O 6-Fosfogluconato (6) NADP+ (6) NADPH + (6)H+

631

(6) CO2

(6) Ribulose 5-fosfato

(4) Xilulose 5-fosfato

(2) Ribose 5-fosfato

(2) Frutose 6-fosfato + Gliceraldedo 3-fosfato (2) Gliceraldedo 3-fosfato + (2) Sedo-heptulose 7-fosfato

(2) Eritrose 4-fosfato + (2) Frutose 6-fosfato

FIGURA 16.3 Via das pentoses fosfato.

des, requerem equivalentes de reduo de NADPH. No fgado, 20-30% do CO2 produzido pode ser proveniente da via das pentoses fosfato; o equilbrio entre gliclise e via das pentoses fosfato depende das necessidades metablicas do rgo. Em msculo estriado de mamferos, que apresenta pouca sntese de cidos graxos e esterides, todo catabolismo de G6P ocorre por gliclise e ciclo TCA, com nenhuma oxidao direta de glicose 6-fosfato pela via das pentoses fosfato.

Isomerizao e Fosforilao so Reaes Comuns para Interconverter Carboidratos


Formao de alguns acares pode ocorrer diretamente, comeando com glicose, por reaes de modicaes, como converso de G6P em frutose 6-fosfato por fosfoglucose isomerase, na gliclise. Uma isomerizao aldose-cetose semelhante, catalisada por fosfomanose isomerase, produz manose 6-fosfato. Decincia dessa enzima leva a uma forma de sndrome de glicoprotenas decientes em carboidratos (CDGS, carbohydrate- decient glycoprotein syndrome) (ver Corr. Cln. 16.3). Fosforilao e transferncia interna de um grupo fosfato na mesma molcula de acar so tambm modicaes comuns. Glicose 1-fosfato, resultante da glicogenlise, convertida em G6P pela fosfoglucomutase. Galactose fosforilada a galactose 1-fosfato por galactoquinase, e manose a manose 6-fosfato por manoquinase. Frutose livre, um importante constituinte da dieta, fosforilada no fgado a frutose 1-fosfato, por uma frutoquinase especial. Entretanto, nenhuma mutase interconverte frutose 1-fosfato e frutose 6-fosfato, nem a fosfofrutoquinase pode sintetizar frutose 1,6-bisfosfato a partir de frutose 1-fosfato. Em vez disso, frutose 1-fos-

16.3 INTERCONVERSES DE ACARES E FORMAO DE NUCLEOTDEO-ACAR


A maioria dos monossacardeos encontrados em compostos biolgicos deriva da glicose. As transformaes dos acares mais comuns em sistemas de mamferos so resumidas na Figura 16.4.

BioQ.16 631

22.01.07 18:09:30

638

PARTE 4 VIA METABLICAS E SEU CONTROLE

redutora de um acar aceptor. Uma glicosiltransferase especca para o acar aceptor, o acar transferido e a ligao formada. Uma reao de glicosiltransferase resumida como se segue: Nucleosdeoglicosiltransferase glicosil1 difosfato- + glicose O glicose2 (aceptor) glicose
(doador) (glicosdeo)

+ nucleosdeo difosfato

CORRELAO CLNICA 16.8

Substncias dos Grupos Sangneos


A superfcie dos eritrcitos humanos coberta por um complexo mosaico de determinantes antignicos especcos, muitos dos quais so polissacardeos complexos. H cerca de 100 determinantes de grupos sangneos, pertencentes a 21 sistemas de grupos sangneos independentes. Os mais estudados so os do sistema ABO de grupos sangneos e do sistema Lewis, estreitamente relacionado. Variao gentica alcanada por glicosiltransferases especcas, responsveis pela sntese dos determinantes heterossacardicos. O gene H codica uma fucosiltransferase, que adiciona fucose a uma galactose perifrica do heterossacardeo precursor. O alelo A codica uma N-acetilgalactosamina glicosiltransferase, o alelo B codica uma galactosiltransferase, e o alelo O codica uma protena inativa. Os acares transferidos pelas enzimas A e B so adicionados ao oligossacardeo H-especco. O gene Lewis (Le) codica outra fucosiltransferase, que adiciona fucose a um resduo perifrico de N-acetilglucosamina do precursor. Ausncia do produto do gene H d origem ao determinante Lea especco, enquanto ausncia de ambas as enzimas H e Le responsvel pela especicidade Leb. Elucidao das estruturas desses oligossacardeos determinantes representa um marco na qumica de carboidratos. Este conhecimento essencial para prticas de transfuso de sangue e para propsitos legais e histricos. Por exemplo, p de tecidos contendo carboidratos complexos foi utilizado em anlises sorolgicas para estabelecer o grupo sangneo de Tutankhamen e de seus provveis ancestrais. Fonte: Yamamoto, F., Clausen, I., White, T., Mark, J. e Hakomori, S. Molecular genetic basis of the histoblood group ABO system. Nature 345:229, 1990.

Mais de 40 tipos de ligaes glicosdicas foram identicados em oligossacardeos de mamferos, e cerca de 15 mais em glicosaminoglicanos. A multiplicidade de ligaes surge da diversidade de monossacardeos envolvidos e da formao de ligaes e com cada um dos grupos hidroxila disponveis no acar aceptor. Isso sugere que oligossacardeos tenham o potencial para grande contedo informacional. De fato, sabe-se que a bioatividade de muitas molculas determinada pela natureza dos resduos de acares constituintes. Por exemplo, a especicidade antignica dos principais tipos sangneos determinada pela composio em acares (ver Corr. Cln. 16.8). N-acetilgalactosamina o imunodeterminante do sangue tipo A, e galactose, do sangue tipo B. Remoo de N-acetilgalactosamina de eritrcitos do tipo A, ou de galactose de eritrcitos do tipo B, converte ambos em eritrcitos do tipo O. Cada vez mais, outros exemplos de acares como determinantes de especicidade de receptores de superfcie celular e interaes com lectinas, do direcionamento de clulas para certos tecidos e da sobrevivncia ou remoo da circulao de certas molculas, tm sido reconhecidos. Todas as ligaes glicosdicas identicadas em compostos biolgicos so degradadas por enzimas hidrolticas especcas, glicosidases. Alm de serem instrumentos valiosos para a elucidao da estrutura de oligossacardeos, o interesse nessa classe de enzimas baseiase nas muitas doenas genticas do metabolismo de carboidratos complexos que resultam de defeitos em glicosidases (ver Corr. Cln. 16.10 e 16.11; p. 641 e 642, respectivamente).

16.5 | GLICOPROTENAS
Glicoprotenas foram denidas como protenas conjugadas, que contm um ou mais acares, sem uma unidade repetitiva serial, e so ligados covalentemente a uma protena. Esta denio exclui os proteoglicanos (ver p. 652). Glicoprotenas em membranas celulares podem ter um papel importante no comportamento de clulas e, especialmente, em funes biolgicas da membrana. Glicoprotenas so constituintes do muco secretado por certas clulas epiteliais, onde medeiam lubricao e proteo de tecidos que revestem os sistemas respiratrio, gastrointestinal e reprodutor feminino. Muitas protenas secretadas so glicoprotenas, e estas incluem (a) hormnios como hormnio folculoestimulante, hormnio luteinizante e gonadotrona corinica e (b) protenas plasmticas como orosomucides, ceruloplasmina, plasminognio, protrombina e imunoglobulinas.

BioQ.16 638

22.01.07 18:09:38

642

PARTE 4 VIA METABLICAS E SEU CONTROLE

CORRELAO CLNICA 16.11

Defeitos Enzimticos na Degradao de Glicolipdeos Doena Tay-Sachs de Sandhoff GM1 gangliosidose Sialidose de Fabry de Gaucher de Krabbe Leucodistroa metacromtica Decincia Enzimtica -Hexosaminidase A -Hexosaminidases A e B -Galactosidase Sialidase -Galactosidase -Glucoceramidase -Galactoceramidase Arilsulfatase A (cerebrosdeo sulfatase)

Doenas de Glicolipdeos
Um grupo de doenas genticas humanas surge de decincias em hidrolases, que agem predominantemente em substratos glicolipdicos, resultando em acmulo de produtos de glicolipdeos e gangliosdeos. Os sintomas clnicos associados a cada um dos glicoconjugados podem variar muito. Entretanto, devido preponderncia de lipdeos no sistema nervoso, tais doenas freqentemente tm neurodegenerao associada e severa deteriorao mental e motora.

Fonte: Beutler, E. e G. Garabowski. Gaucher disease. Em: C. R. Scriver, A. R. Beaudet, W. S. Sly e D. Valle (Eds.), The Metabolic and Molecular Bases of Inherited Disease, Vol. III, 8th ed. New York: McGraw-Hill, 2001, p. 3635.

16.6 | PROTEOGLICANOS
Esta uma classe de macromolculas complexas que pode conter 95% ou mais carboidratos, e lembra mais polissacardeo do que protena. Para distingui-los de outras glicoprotenas, eles so chamados proteoglicanos. Suas cadeias de carboidratos so chamadas glicosaminoglicanos ou mucopolissacardeos, especialmente em referncia s doenas de acmulo mucopolissacaridoses, que resultam de uma incapacidade de degradar essas molculas (ver Corr. Cln. 16.13).

das matrizes extracelulares e das superfcies celulares, e participam de adeso e sinalizao celular.

Hialuronato um Copolmero de N-Acetilglucosamina e cido Glucurnico


Hialuronato difere dos outros tipos de glicosaminoglicanos. no-sulfatado, no ligado covalentemente a protena, e no est limitado a tecidos animais, sendo tambm produzido por bactrias. classicado como glicosaminoglicano devido a sua similaridade estrutural com esses polmeros, e consiste exclusivamente de unidades dissacardicas repetitivas de N-acetilglucosamina e cido glucurnico (Figura 16.12). Embora tenha a estrutura qumica menos complexa dos glicosaminoglicanos, as cadeias podem alcanar 105 -107 Da. A alta massa, o carter polieletroltico e o grande volume que ocupa em soluo contribuem para as propriedades do hialuronato como um lubricante e absorvente de choques. encontrado predominantemente em lquido sinovial, humor vtreo e cordo umbilical.

Existem Seis Classes de Proteoglicanos


Proteoglicanos consistem de muitas cadeias de glicosaminoglicanos diferentes, ligadas covalentemente a um esqueleto protico. Seis classes so reconhecidas: condroitim sulfato, dermatam sulfato, queratam sulfato, heparam sulfato, heparina e hialuronato. Certas caractersticas so comuns a todas as diferentes classes de glicosaminoglicanos. As longas cadeias heteropolissacardicas no-ramicadas so compostas, em grande parte, por unidades dissacardicas repetitivas, consistindo de uma hexosamina e um cido urnico. Constituintes comuns dos glicosaminoglicanos so grupos sulfatos, ligados por ligaes ster a certos monossacardeos, ou por ligaes amida ao grupo amino de glucosamina. S hialuronato no sulfatado e no covalentemente ligado a protena. As carboxilas dos cidos urnicos e os grupos sulfatos contribuem para a natureza fortemente carregada dos glicosaminoglicanos. Sua carga eltrica e sua estrutura macromolecular so importantes em seu papel como lubricantes e como elementos de sustentao no tecido conjuntivo. Glicosaminoglicanos so componentes predominantes

Condroitim Sulfatos So os Glicosaminoglicanos Mais Abundantes


Os glicosaminoglicanos mais abundantes do corpo, os condroitim sulfatos, so ligados a resduos especcos de serina em um esqueleto protico por meio de uma regio de ligao tetrassacardica:
GluUA
13

Gal

13

Gla

14

Xyl

-Ser

As unidades dissacardicas caractersticas consistem de N-acetilgalactosamina e cido glucurnico, que so ligadas a essa regio de ligao (Figura 16.12). Os dissacardeos podem ser sulfatados na posio 4- ou 6- da N-acetilgalactosamina. Cada cadeia contm 30-

BioQ.16 642

22.01.07 18:09:43

650

PARTE 4 VIA METABLICAS E SEU CONTROLE

PARTE 4 VIAS METABLICAS E SEU CONTROLE


Fgado cidos graxos Acetil-CoA Corpos cetnicos Glicose Glicerol

METABOLISMO DE LIPDEOS I: SNTESE, ARMAZENAMENTO E UTILIZAO DE CIDOS GRAXOS E TRIACILGLICERIS


Martin D. Snider, J. Denis McGarry e Richard W. Hanson
17.1 VISO GERAL, 651 17.2 NATUREZA QUMICA DE CIDOS GRAXOS E ACILGLICERIS, 652 cidos graxos so cadeias alquila terminando em um grupo carboxila, 652 A maioria dos cidos graxos no homem ocorre como triacilgliceris, 653 A hidrofobicidade dos triacilgliceris importante para suas funes, 653 17.3 TRANSPORTE INTERRGOS DE CIDOS GRAXOS E SEUS PRODUTOS PRIMRIOS, 656 Transporte de lipdeos no estado alimentado, 656 Transporte de lipdeos no estado de jejum, 657 17.4 SNTESE DE CIDOS GRAXOS: LIPOGNESE, 657 Glicose o principal precursor para sntese de cidos graxos, 657 Via de biossntese de cidos graxos, 658 Formao de malonil-CoA a etapa de comprometimento na sntese de cidos graxos, 658 Seqncia de reaes para a sntese de cido palmtico, 658 cido graxo sintase de mamferos um polipeptdeo multifuncional, 659 Estequiometria da sntese de cidos graxos, 659 Via de clivagem de citrato fornece acetil-CoA e NADPH para lipognese no citosol, 660 Modicao de cidos graxos, 662 Reaes de elongao, 662 Formao de cidos monoenicos pela estearoil-CoA dessaturase, 662 Formao e modicao de cidos graxos poliinsaturados, 663 Formao de hidroxicidos graxos no tecido nervoso, 664 cido graxo sintase pode produzir outros cidos graxos alm do palmitato, 664 Acil graxo-CoAs podem ser reduzidos a lcoois graxos, 664

17

BioQ.17 650

22.01.07 18:11:45

656

17.3 TRANSPORTE INTERRGOS DE CIDOS GRAXOS E SEUS PRODUTOS PRIMRIOS


Em todos os mamferos, o transporte e o armazenamento de cidos graxos so regulados pelo estado diettico. Triacilglicerol armazenado no estado alimentado, com deposio em tecido adiposo. Durante jejum, triacilglicerol do tecido adiposo hidrolisado, e os produtos so distribudos por todo o corpo para serem usados para produo de energia. Em jejum prolongado (mais de 2 dias), o fgado converte cidos graxos em corpos cetnicos, acetoacetato e -hidroxibutirato, que so liberados no sangue e so uma fonte importante de energia para muitos tecidos. Esses processos so resumidos na Figura 17.6

PARTE 4 VIA METABLICAS E SEU CONTROLE

Transporte de Lipdeos no Estado Alimentado


Triacilgliceris da dieta so digeridos no estmago e intestino delgado por lpases gstrica e pancretica (ver p. 1031). Os principais produtos so 2-monoacilgliceris e cidos graxos livres, que so absorvidos pelas clulas epiteliais que revestem o intestino delgado. Estas clulas ligam os cidos graxos e monoacilgliceris absorvidos em triacilgliceris (ver p. 1031), que so ento empacotados em quilomcrons, uma lipoprotena plasmtica rica em triacilglicerol (ver p. 1035). Quilomcrons so secretados na linfa e, depois, circulam para a corrente sangnea. O fgado outra fonte de triacilgliceris no estado alimentado. cidos graxos so sintetizados nesse tecido a partir do excesso de carboidratos e aminocidos. Esses cidos graxos so ligados em triacilgliceris e acondicionados em lipoprotenas de muito baixa densidade ( VLDL), uma segunda li-

Estado alimentado

Fgado

Glicose e outros combustveis Acetil-CoA

Intestino delgado Triacilglicerol da dieta Quilomcrons

cidos graxos Triacilglicerol Lipoprotenas de densidade muito baixa

Corrente sangnea

Triacilglicerol em quilomcrons e lipoprotenas de densidade muito baixa

FIGURA 17.6 Transporte interrgos de cidos graxos. (A) No estado alimentado, h deposio de triacilglicerol no tecido adiposo. As fontes so gordura da dieta e cidos graxos sintetizados no fgado a partir de excesso de carboidratos e aminocidos. (B) No estado de jejum, triacilgliceris so hidrolisados, e cidos graxos livres e glicerol so liberados no sangue. *Durante jejum prolongado, o fgado sintetiza corpos cetnicos, que se tornam um importante combustvel no sangue.

cidos graxos Msculo

cidos graxos Triacilglicero l Tecido adiposo

Estado de jejum
Crebro Corpos cetnicos Acetil-CoA Fgado cido graxo Glicose Acetil-CoA Glicerol Corpos cetnicos

Corrente sangnea

Corpos cidos graxos = albumina ceetnicos

Glicerol Glicerol + cidos graxos Triacilglicerol

cidos graxos (+ corpos cetnicos) Msculo e outros tecidos

Tecido adiposo

BioQ.17 656

22.01.07 18:11:51

668

PARTE 4 VIA METABLICAS E SEU CONTROLE

CORRELAO CLNICA 17.3

Ciclo Triacilglicerol/cido Graxo


Triacilglicerol que armazenado no tecido adiposo hidrolisado a cidos graxos livres (FFA) durante jejum para fornecer energia para tecidos como os msculos esqueltico e cardaco, e tambm indiretamente para o crebro, via corpos cetnicos. Hormnios, principalmente insulina, controlam este processo. medida que o nvel de insulina cai durante o jejum, a taxa de hidrlise de triacilglicerol (liplise) aumenta, resultando em liberao de FFA do tecido adiposo. Um aspecto surpreendente deste processo o destino de FFA; em seres humanos em jejum, at 65% destes FFA so reestericados em triacilgliceris no fgado e em outros tecidos perifricos. No fgado, aproximadamente 60% do FFA captado reestericado em triacilglicerol, liberado no sangue como VLDL, e enviado de volta para o tecido adiposo para deposio como triacilglicerol. Este processo foi chamado ciclo triacilglicerol/cido graxo. A sntese de triacilglicerol em tecidos de mamferos requer glicerol 3-fosfato, que derivado da glicose da dieta via gliclise, no estado alimentado. Durante jejum, quando insulina baixa inibe a utilizao de glicose, o glicerol 3-fosfato para a reestericao de FFA gerado por gliceroneognese, uma verso abreviada da gluconeognese. Nesta via, piruvato, ou compostos que podem gerar piruvato, como alanina ou lactato, convertido em glicerol 3fosfato via di-hidroxiacetona fosfato (Figura 17.19). A enzima que controla a velocidade da via de gliceroneognese fosfoenolpiruvato carboxiquinase (PEPCK), que tem alta atividade em tecido adiposo pardo e branco. Se a expresso do gene PEPCK for abolida no tecido adiposo de camundongos, gliceroneognese inibida e o estoque de triacilglicerol reduzido. Ao contrrio, superproduo do gene PEPCK no tecido adiposo de camundongos transgnicos aumenta a taxa de gliceroneognese, resultando em obesidade. A lgica metablica do ciclo triacilglicerol/cido graxo reside provavelmente na importncia dos cidos graxos como combustveis durante jejum. Para garantir que exista FFA suciente no sangue, mais FFA liberado de clulas adiposas do que o necessrio; o que no usado reestericado a triacilglicerol e redepositado no tecido adiposo, com um custo energtico mnimo. O ciclo triacilglicerol/cido graxo consome 3-6% da energia em uma molcula de triacilglicerol. Aparentemente, melhor ter o combustvel necessrio disponvel, e pagar por isso energeticamente, do que car sem! A taxa de reestericao de FFA no ciclo triacilglicerol/cido graxo , muito provavelmente, um fator-chave na determinao da concentrao de estado estacionrio de FFA no sangue, um parmetro que est diretamente envolvido na etiologia do diabetes Tipo 2. As glitazonas, uma classe de drogas antidiabticas, induzem a atividade de PEPCK em tecido adiposo e fgado, e aumentam a taxa de reestericao de FFA em triacilglicerol via gliceroneognese nesses tecidos, suportando o importante papel deste processo na manuteno da homeostase lipdica.

Fonte: Reshef, L. Olswang, Y. Cassuto, H. Blum, B. Croniger, C. M. Kalhan S. C, Tilghman, S. M. e Hanson R. W. Glyceroneogenesis and the triglyceride/fatty acid cycle. J. Biol. Chem. 278:30413, 2003. Jensen, M. D., Ekberg, K. e Landau, B. R. Lipid metabolism during fasting. Am. J. Physiol. Endocrinol. Metab. 281:E789 2001. Tordjman, J. Khazan, W. Antoine, B. Chauvet, G. Quette, J Fouque, F. Beale, E. G. Benelli, C. e Forest, C. Regulation of glyceroneogenesis and phosphoenolpyruvate carboxykinase by fatty acids, retinoic acid and thiazolidinediones. Biochimie 85:1213, 2003. repouso. A maioria dos tecidos pode usar cidos graxos como combustvel. cidos graxos so uma importante fonte de energia em msculos esqueltico e cardaco, mas o crebro oxida pouco os cidos graxos devido ao transporte limitado atravs da barreira hemato-enceflica. Eritrcitos so incapazes de oxidar cidos graxos, porque no tm mitocndrias, o local de oxidao de cidos graxos. Durante jejum prolongado, o fgado converte acetil-CoA gerado por oxidao de cidos graxos e quebra de aminocidos em corpos cetnicos, que se tornam importantes combustveis. A maioria dos tecidos, incluindo o crebro, adapta-se ao jejum pela utilizao destes corpos cetnicos.

-Oxidao de cidos Graxos de Cadeia Linear um Importante Processo de Produo de Energia


steres de CoA dos cidos graxos so os substratos para oxidao. Na maior parte, a via de oxidao de cidos graxos semelhante, mas no idntica, ao reverso do processo de sntese de palmitato. Isto , fragmentos de dois carbonos so removidos seqencialmente a partir da extremidade carboxila do cido graxo por desidrogenao, hidratao e oxidao, para formar um cetocido, que ento quebrado por tilise.

BioQ.17 668

22.01.07 18:12:07

CAPTULO 17 METABOLISMO DE LIPDEOS I:

679

17.7 REGULAO DO METABOLISMO DE LIPDEOS


Regulao no estado alimentado
O metabolismo de lipdeos no homem controlado pelo estado diettico do indivduo via um conjunto complexo de sinais hormonais. Depois de uma refeio que contm lipdeos, carboidratos e protenas, o lipdeo da dieta depositado como triacilglicerol no tecido adiposo. Alm disso, carboidrato e aminocidos da dieta, em excesso em relao ao necessrio para energia ou sntese de protenas, so convertidos em cidos graxos e depositados no tecido adiposo como triacilglicerol. O principal hormnio anablico, insulina, necessrio para sntese de cidos graxos e para formao de triacilglicerol no tecido adiposo. Um resumo destas regulaes apresentado nas Tabelas 17.2, p. 657, e 17.3, p. 661. Este hormnio age em dois nveis; induz a transcrio de genes que codicam enzimas crticas das vias de sntese e armazenamento de lipdeos (regulao de longo prazo) e controla processos como captao de glicose e hidrlise de triacilglicerol (regulao de curto prazo). Insulina estimula sntese de cidos graxos por aumentar os nveis de enzimas-chaves, incluindo cido graxo sintase, NADP-malato desidrogenase (enzima mlica) e acetil-CoA carboxilase, no fgado, por induzir a transcrio de seus genes. Insulina tambm estimula a sntese de glicose 6-fosfato desidrogenase e 6-fosfogluconato desidrogenase, as duas enzimas da poro oxidativa da via das pentoses, que geram parte do NADPH que necessrio para sntese de cidos graxos. O efeito de curto prazo da insulina na sntese heptica de cidos graxos exercido por ativao de uma fosfoprotena fosfatase especca, que remove fosfato da acetil-CoA carboxilase, ativando assim esta enzima. Fluxo aumentado pela gliclise tambm importante para fornecer acetil-CoA para sntese de cidos graxos. No tecido adiposo, insulina necessria no estado alimentado para captao de glicose via transportador GLUT 4. O metabolismo desta glicose via gliclise fornece glicerol 3-fosfato para a sntese de triacilglicerol. Insulina tambm bloqueia um ciclo ftil. Como no fgado, insulina exerce seus efeitos de curto prazo por ativar fosfoprotena fosfatases. Isso diminui a fosforilao de protenas-chaves, incluindo lipase hormnio-sensvel e perilipina, levando quebra diminuda de triacilgliceris.

um aumento em epinefrina e glucagon, que elevam o nvel de cAMP e ativam protena quinase A. No tecido adiposo, h uma fosforilao aumentada de lipase hormnio sensvel e perilipina, resultando em um aumento na quebra de triacilglicerol e liberao de cidos graxos livres e glicerol deste tecido (ver Tabela 17.2, p. 657, para um resumo destes controles). No fgado, essas alteraes hormonais levam a uma diminuio na sntese de cidos graxos, devido reduo nos nveis de enzimas chaves (ver Tabela 17.3, p. 661). H tambm inibio da enzima limitante da velocidade, acetil-CoA carboxilase, devido fosforilao cAMP-dependente da enzima. Gliclise tambm inibida, com diminuio no suprimento de acetil-CoA para lipognese. O fgado comea a produzir corpos cetnicos, medida que o jejum progride, devido a um aumento na taxa de oxidao de cidos graxos e nveis aumentados de enzimas da sntese de corpos cetnicos. Durante jejum prolongado, cerca de metade dos cidos graxos que entram no fgado so convertidos em corpos cetnicos e liberados no sangue para utilizao por tecidos como msculo, corao e (aps 2 dias de jejum) o crebro, economizando assim o uso de glicose.

Regulao da oxidao de cidos graxos


A taxa de oxidao de cidos graxos em mitocndrias controlada pela regulao da entrada de substratos nestas organelas. A enzima-chave carnitina palmitoiltransferase I (CPT I), que sintetiza acilcarnitina a partir de acil-CoA citoslico (Figura 17.20). No fgado, acetil-CoA carboxilase ativada no estado alimentado, porque os nveis de enzima so altos, fosforilao cAMP-dependente baixa e a enzima ativada por citrato. A alta concentrao de malonil-CoA resultante estimula sntese de cidos graxos, mas bloqueia oxidao de cidos graxos por inibir CPT I. Esta regulao impede um ciclo ftil. Ao contrrio, no estado de jejum, a atividade de acetil-CoA carboxilase no fgado baixa, porque os nveis de enzima so baixos, a enzima est fosforilada e oxidao de cidos graxos ocorre em alta velocidade nessas condies, devido aos baixos nveis de malonil-CoA. Oxidao de cidos graxos em msculo tambm regulada por malonil-CoA, embora este tecido no sintetize cidos graxos. Msculo contm uma isoenzima da acetil-CoA carboxilase, que produz malonil-CoA exclusivamente para regulao de CPT I. A enzima ativada por citrato e inibida por fosforilao. fosforilada pela protena quinase A e por uma quinase dependente de AMP. Fosforilao pela primeira enzima permite que a oxidao de cidos graxos seja regulada pelo estado diettico. No estado alimentado, a alta concentrao de insulina resulta em baixos nveis de fosforilao. A enzima produz malonil-CoA, que inibe CPT I e bloqueia oxidao de cidos graxos. Ao contrrio, no estado de

Regulao no estado de jejum


Jejum resulta em uma alterao dramtica do metabolismo de lipdeos. medida que a concentrao de glicose no sangue diminui, h um decrscimo paralelo da concentrao de insulina na circulao. H tambm

BioQ.17 679

22.01.07 18:12:19

684

PARTE 4 VIAS METABLICAS E SEU CONTROLE

18.5 PROSTAGLANDINAS E TROMBOXANES, 714 Prostaglandinas e tromboxanes so derivados de cidos monocarboxlicos, 714 Sntese de prostaglandinas envolve uma ciclooxigenase, 715 Produo de prostaglandinas inibida por agentes antiinamatrios esterodicos e no-esterodicos, 717 Prostaglandinas tm muitos efeitos siolgicos 718 18.6 LIPOXIGENASE E CIDOS OXIEICOSATETRAENICOS, 718 cidos mono-hidroperoxieicosatetraenicos so produtos da ao da lipoxigenase, 718

Leucotrienos e cidos hidroxieicosatetraenicos so hormnios derivados de HPETEs, 719 Leucotrienos e HETEs afetam vrios processos siolgicos, 719 BIBLIOGRAFIA, 721 QUESTES E RESPOSTAS, 722 CORRELAES CLNICAS 18.1 Sndrome do Desconforto Respiratrio, 687 18.2 Tratamento da Hipercolesterolemia, 703 18.3 Aterosclerose, 704 18.4 Diagnstico da Doena de Gaucher em um Adulto, 713 de hormnios farmacologicamente potentes derivados do cido araquidnico a saber, prostaglandinas e leucotrienos sero discutidos. Ver o Apndice para uma discusso sobre nomenclatura e qumica dos lipdeos.

18.1 | VISO GERAL


Lipdeo um termo geral que descreve substncias que so relativamente insolveis em gua e que podem ser extradas por solventes apolares. Lipdeos complexos do homem esto classicados em duas categorias amplas: lipdeos no-polares, tais como triacilgliceris e steres de colesterol, e lipdeos polares, que so anpticos pois contm tanto uma regio hidrofbica, como uma regio hidroflica na mesma molcula. Este captulo discute lipdeos polares, incluindo fosfolipdeos, esngolipdeos e eicosanides. As regies hidrofbicas e hidroflicas so unidas por um resduo de glicerol em glicerofosfolipdeos, e por esngosina em esngomielina e glicoesngolipdeos. Triacilglicerol est connado, em grande parte, a locais de armazenamento no tecido adiposo, enquanto lipdeos polares ocorrem primariamente em membranas celulares. Membranas geralmente contm 40% do seu peso seco como lipdeo, e 60% como protena. Reconhecimento clula-clula, fagocitose, inibio por contato e rejeio de tecidos e rgos transplantados so todos fenmenos de importncia mdica, que envolvem stios de reconhecimento muito especcos na superfcie das membranas plasmticas. Glicoesngolipdeos parecem desempenhar um papel nestes eventos biolgicos. Sua sntese ser descrita. Vrios esngolipdeos acumulam-se no fgado, no bao, no rim e no sistema nervoso em certas doenas genticas chamadas esngolipidoses. Glicolipdeos merecem estudo, porque os determinantes antignicos dos grupos sangneos ABO so primariamente de natureza glicolipdica. A via de biossntese de colesterol e sua regulao, como colesterol funciona como um precursor de sais biliares e hormnios esterides, e o papel da lipoprotena de alta densidade (HDL, high density lipoprotein) e da lecitina:colesterol aciltransferase (LCAT) no gerenciamento do colesterol plasmtico so descritos. Finalmente, o metabolismo e a funo de duas classes

18.2 | FOSFOLIPDEOS
Duas classes principais de acilglicerolipdeos so triacilgliceris e glicerofosfolipdeos, que tm em seu ncleo o poliol C3 glicerol. Os dois grupos lcool primrio do glicerol no so estereoquimicamente idnticos; no caso de fosfolipdeos, geralmente o mesmo grupo hidroxila que estericado ao resduo de fosfato. O sistema de numerao esteroespecca a melhor maneira de designar diferentes grupos hidroxila. Neste sistema, quando a estrutura do glicerol desenhada na projeo de Fischer, com o grupo hidroxila C2 projetando-se para a esquerda da pgina, os tomos de carbono so numerados como mostra a Figura 18.1. Quando o sistema de numerao estreo-especca (sn) utilizado, o prexo sn- usado antes do nome do composto. Glicerofosfolipdeos geralmente contm um resduo de sn-glicerol 3-fosfato. Embora ambos contenham o resduo de glicerol como um elemento estrutural fundamental, triacilgliceris neutros e fosfolipdeos inicos carregados tm propriedades fsicas e funes muito diferentes.

Nmero do carbono CH2OH 1 HO C H 2 3

CH2OH

FIGURA 18.1 Numerao estreo-especca do glicerol.

BioQ.18 684

22.01.07 19:25:50

694

PARTE 4 VIAS METABLICAS E SEU CONTROLE


O R1C
H2COH C H2C O O O

CoA
CoA 1

H2C C H2C

O O O

CR1 O P O O

R2OH

2 H2C C H 2C OR2 O O O P O O

O P O O

R1CO
O

DHAP

O
R3C O

H2C CH H2C

OR2 O O P O Colina plasmalognio OCH2CH2 N(CH3)3 H2C HOCH H 2C


+

NADPH + H+ NADP+

CMP

OR2 O O P O O

CDP-colina O
R3C O H2C CH H2C OH Pi H2O OR2 5 4 O

O H C 2
R3C CH H 2C

OR2 O O P O O

R3C CoA

CoA

FIGURA 18.25 Via de biossntese de colina plasmalognio a partir de DHAP. 1, acil-CoA:di-hidroxiacetona fosfato aciltransferase; 2, alquil-di-hidroxiacetona fosfato sintase; 3, NADPH:alquil-di-hidroxiacetona fosfato xi-redutase; 4, acil-CoA:1-alquil-2-liso-sn -glicero-3-fosfato aciltransferase; 5, 1-alquil-2-acil-sn -glicerol-3-fosfato fosfohidrolase; 6, CDP-colina:1-alquil-2-acil-sn -glicerol colina fosfotransferase.

18.3 | COLESTEROL
Colesterol, um Composto Alicclico, Amplamente Distribudo nas Formas Livre e Estericada
Colesterol um composto alicclico, cuja estrutura inclui (1) o ncleo peridrociclopentanofenantreno com seus quatro anis fundidos, (2) um nico grupo hidroxila em C3, (3) um centro insaturado entre C5 e C6, (4) uma cadeia hidrocarbnica ramicada de oito membros ligada ao anel D em C17 e (5) um grupo metil (designado por C19) ligado posio C10, e outro grupo metil (designado por C18) ligado posio C13 (Figuras 18.26 e 18.27). Colesterol tem solubilidade muito baixa em gua; a 25oC, o limite de solubilidade aproximadamente 0,2 mg dL -1, ou 4,7 mM. A concentrao real de colesterol no plasma de uma pessoa sadia geralmente 150 a 200 mg dL -1. Este valor quase duas vezes a concentrao normal de glicose no sangue. Esta alta concentrao de colesterol no sangue possvel graas s lipoprotenas plasmticas (principalmente LDL e VLDL), que contm grandes quantidades de colesterol (ver p. 698). Apenas cerca de 30% do total de colesterol no plasma est livre

(no-estericado); o restante colesteril steres, nos quais um cido graxo de cadeia longa, geralmente cido linolico, estericado ao C3 do anel A. Este resduo de cido graxo aumenta a hidrofobicidade do colesterol (Figura 18.28).
12 11 1 2 9 13 17

C
8 7 6 14

16

10

15

A
3 4 5

FIGURA 18.26 O anel ciclopentanofenantreno.


24 23

21 18

20 17

22

25 27

26

19

HO

FIGURA 18.27 Estrutura do colesterol (5-colesteno-3-ol).

BioQ.18 694

22.01.07 19:26:07

704

PARTE 4 VIAS METABLICAS E SEU CONTROLE

Em tecidos especializados, como crtex adrenal e ovrios, o colesterol derivado de LDL o precursor de hormnios esterides, como cortisol e estradiol, respectivamente. No fgado, o colesterol extrado de LDL e HDL convertido em sais biliares, que funcionam na digesto intestinal de gordura.

Colesterol Excretado Primariamente como cidos Biliares


cidos biliares so os produtos nais do metabolismo de colesterol. cidos biliares primrios so sintetizados em hepatcitos, diretamente a partir de colesterol. Os

CORRELAO CLNICA 18.3

Aterosclerose
Aterosclerose a principal causa de morte em pases ocidentais industrializados. O risco de desenvolv-la diretamente relacionado com a concentrao plasmtica de LDL-colesterol e inversamente proporcional ao nvel de HDL-colesterol. Isso explica por que o primeiro freqentemente chamado colesterol ruim, e o ltimo, colesterol bom, embora quimicamente no exista diferena. Na aterosclerose, a parede arterial contm colesteril-steres acumulados em clulas derivadas da linhagem moncito-macrfago, h tambm proliferao de clulas musculares lisas e brose. A anomalia mais precoce migrao de moncitos do sangue para o subendotlio da artria. Estas clulas ento se diferenciam em macrfagos e acumulam colesteril-steres derivados de LDL plasmtica. Parte da LDL pode ser captada por vias que no requerem receptor de LDL. Por exemplo, existem receptores que captam LDL acetilada ou LDL complexada com dextran sulfato; entretanto, esta via no regulada por contedo celular de colesterol. Distoro do subendotlio leva agregao plaquetria na superfcie do endotlio e liberao de mitgenos derivados de plaquetas, como o fator de crescimento derivado de plaquetas (PDGF, platelet derived growth factor), que estimula o crescimento de clulas musculares lisas. Morte das clulas esponjosas leva deposio do lipdeo celular e brose. A placa aterosclertica resultante estreita o vaso sangneo e leva formao de trombo, o que precipita o infarto do miocrdio (ataque cardaco). Fonte: Wick, G, Knoach, M. e Xu, Q. B. Autoimmune and inammatory mechanisms in atherosclerosis. Annu. Rev. Immunol. 22:361,~2004.

cidos biliares so derivados de cido colnico (Figura 18.41). cido clico e cido quenodesoxiclico (Figura 18.42) so compostos C24, contendo trs e dois grupos OH, respectivamente, e uma cadeia lateral C5 que termina em um grupo carboxila, que ionizado a pH 7,0 (da o nome sal biliar). O grupo carboxila freqentemente conjugado, por uma ligao amida, com glicina (NH2-CH2-COOH) (Figura 18.43) ou taurina (NH2-CH2-CH2-SO3H), para formar cido glicoclico ou tauroclico, respectivamente. Os cidos biliares primrios so modicados por microorganismos dos intestinos para cidos biliares secundrios: cido desoxiclico e cido litoclico so derivados do cido clico e do cido quenodesoxiclico, respectivamente, por remoo de um grupo OH (Figura 18.42). Transformao de colesterol em cidos biliares requer: (1) epimerizao do grupo 3 -OH, (2) reduo da dupla ligao C5, (3) introduo de grupos OH em C7 (cido quenodesoxiclico) ou em C7 e C12 (cido clico), e (4) converso da cadeia lateral C27 em um cido carboxlico C24 por eliminao de um equivalente propil. cidos biliares so secretados na bile, armazenados na vescula biliar e depois secretados no intestino delgado. Produo heptica de cidos biliares insuciente para atender as necessidades siolgicas, de modo que o corpo depende de uma circulao ntero-heptica, que carrega os cidos biliares do intestino, de volta para o fgado, vrias vezes por dia. cidos biliares e fosfolipdeos solubilizam colesterol na bile e, assim, impedem que colesterol se precipite na vescula biliar. cidos biliares no intestino atuam como agentes emulsicantes para triacilgliceris da dieta, facilitando sua hidrlise pela lipase pancretica. cidos biliares desempenham um papel direto na ativao da lipase pancretica (ver p. 1031) e facilitam a absoro de vitaminas lipossolveis, particularmente vitamina D, no intestino.

H3C
18 11 9 12 13 14 8 7 20 17

21

22 23

CH3

COOH
16 15 24

19 2 3 1

CH2
10

FIGURA 18.41 Estrutura do cido colnico.

BioQ.18 704

22.01.07 19:26:18

718

PARTE 4 VIAS METABLICAS E SEU CONTROLE

Prostaglandinas Tm Muitos Efeitos Fisiolgicos


Prostaglandinas so mediadores naturais da inamao. Reaes inamatrias freqentemente envolvem as articulaes (p. ex., artrite reumatide), pele (p. ex., psorase) e olhos, e so tratadas, freqentemente, com corticosterides que inibem sntese de prostaglandinas. Administrao de PGE2 e PGE1 induz rubor e calor (devido vasodilatao arteriolar), juntamente com inchao e edema resultantes de permeabilidade capilar aumentada caracterstica da inamao. PGE2 gerada no sistema imune (p. ex., macrfagos, mastcitos, clulas B) evoca quimiotaxia de clulas T. PGE2 em quantidades que no causam dor, antes da administrao de histamina e bradicinina, aumenta a intensidade e a durao da dor causada por esses dois agentes. Acredita-se que pirgenos (agentes indutores de febre) ativem a via de sntese de prostaglandinas com liberao de PGE2 no hipotlamo, onde a temperatura do corpo regulada. Aspirina, uma droga antipirtica, inibe a ciclooxigenase. PGE2 e PGF2 tm sido utilizadas para induzir parto e para terminar gravidez no-desejada, especicamente no segundo trimestre. Tambm h evidncias de que as prostaglandinas da srie PGE possam ser efetivas no tratamento da infertilidade masculina. Prostaglandinas sintticas so muito ecientes na inibio de secreo cida gstrica em pacientes com lcera pptica. Parecem inibir a formao de cAMP em clulas da mucosa gstrica e acelerar a cicatrizao de lceras gstricas. PGE, PGA e PGI 2 so vasodilatadores que baixam a presso arterial sistmica, aumentando assim o uxo sangneo local e diminuindo a resistncia perifrica. TXA 2 causa contrao da musculatura vascular lisa e do mesngio glomerular. No feto, PGE2 mantm a desobstruo do ductus arteriosus antes do nascimento. Se o ductus permanecer aberto aps o nascimento, o fechamento pode ser acelerado por administrao do inibidor de ciclooxigenase indometacina. Em bebs nascidos com anomalias congnitas, nos quais o defeito pode ser corrigido cirurgicamente, infuso de prostaglandinas manter o uxo sangneo atravs do ductus at que a cirurgia seja feita. PGI2 inibe agregao plaquetria, enquanto PGE2 e TXA 2 promovem esse processo de coagulao. TXA 2 produzido por plaquetas e responsvel por sua agregao quando em contato com alguma superfcie estranha, colgeno ou trombina. Clulas endoteliais que revestem os vasos sangneos liberam PGI2, que pode responder pela no-aderncia de plaquetas parede do vaso sangneo sadio. PGE2 e PGD2 dilatam os vasos sangneos renais e aumentam o uxo sangneo pelo rim. Elas tambm regulam a excreo de sdio e o ritmo de ltrao glomerular.

18.6 LIPOXIGENASE E CIDOS OXIEICOSATETRAENICOS


Ciclooxigenase direciona cidos graxos poliinsaturados para a via das prostaglandinas que tem cido araquidnico como substrato. Lipoxigenase uma dioxigenase que tambm atua sobre cido araquidnico. Diferentes lipoxigenases so especcas para a dupla ligao do cido araquidnico, na qual o ataque inicial do oxignio ocorre (p. ex., posies 5, 12 ou 15). No homem, os leucotrienos mais importantes so os produtos da 5lipoxigenase, que so mediadores de doenas inamatrias. Lipoxigenases ocorrem amplamente em plantas e fungos, bem como em animais, mas esto ausentes em leveduras e na maioria dos procariotos. Elas contm ferro no-hemnico e so ativas quando este ferro est no estado frrico.

cidos Mono-Hidroperoxieicosatetraenicos So Produtos da Ao da Lipoxigenase


Lipoxigenase adiciona um grupo hidroperxido ao cido araquidnico para produzir cidos mono-hidroperoxieicosatetraenicos (HPETEs) (Figura 18.71). Em contraste com a ciclooxigenase da prostaglandina endoperxido sintase, que catalisa a bis-dioxigenao de cidos graxos insaturados a endoperxidos, lipoxigenases catalisam a monodioxigenao de cidos graxos insaturados a hidroperxidos allicos. Substituio hidroperoxi de cido araquidnico por lipoxigenases pode ocorrer nas posies 5, 12 ou 15. Uma 15-lipoxigenase (15-LOX) oxigena cido araquidnico no carbono 15. 5-HPETE o principal produto em baslos, leuccitos polimorfonucleares (PMN), macrfagos, mastcitos e qualquer rgo passando por resposta inamatria; 12-HPETE predomina em plaquetas, clulas das ilhotas pancreticas, musculatura lisa vascular e clulas glomerulares; 15-HPETE o principal produto em reticulcitos, eosinlos, linfcitos T e clulas epiteliais da traquia. As 5-, 12- e 15-lipoxigenases ocorrem principalmente no citosol. Como o tomo de carbono oxigenado em HPETEs assimtrico, existem dois estereoismeros possveis do cido hidroperoxi, (R) ou (S ). Por exemplo, a estreo-congurao especicada 12 R-LOX ou 12S-LOX. Os trs principais HPETEs so da congurao (S ). 5-LOX tem uma atividade de dioxigenase que converte cido araquidnico em 5HPETE, e uma atividade de desidratase que transforma 5-HPETE em LTA4. A atividade 5-LOX restrita a poucos tipos celulares, incluindo linfcitos B, mas no linfcitos T. ativada por uma protena acessria chamada protena ativadora de 5-lipoxigenase (FLAP). Em leuccitos hu-

BioQ.18 718

22.01.07 19:26:40

CAPTULO 19 METABOLISMO DE AMINOCIDOS

725

PARTE 4 VIAS METABLICAS E SEU CONTROLE


Fgado
NH4+ glutamato
+

piruvato

glutamato

uria

NH4 -cetoglutarato

glutamina

METABOLISMO DE AMINOCIDOS
Marguerite W. Coomes
19.1 VISO GERAL, 726 19.2 INCORPORAO DE NITROGNIO EM AMINOCIDOS, 727 A maioria dos aminocidos obtida da dieta, 727 Grupos amino so transferidos de um aminocido para formar outro, 728 Piridoxal fosfato cofator de aminotransferases, 729 Glutamato desidrogenase incorpora e produz amnia, 729 Amnia livre incorporada em e produzida a partir de glutamina, 730 O grupo amida da asparagina derivado de glutamina, 732 Aminocido oxidases removem grupos amino, 732 19.3 TRANSPORTE DE NITROGNIO PARA FGADO E RIM, 732 Protena constantemente degradada, 732 Aminocidos so transportados do msculo aps protelise, 733 Amnia liberada no fgado e no rim, 733 19.4 CICLO DA URIA, 733 tomos de nitrognios da uria vm de amnia e aspartato, 733 Sntese de uria requer cinco enzimas, 734 Sntese da uria regulada por um efetor alostrico e induo enzimtica, 735 Doenas metablicas da sntese da uria tm resultados srios, 735 19.5 SNTESE E DEGRADAO DE AMINOCIDOS INDIVIDUAIS, 736 Glutamato o precursor de glutationa e -aminobutirato, 736 Arginina tambm sintetizada em intestinos e rins, 737 Ornitina e prolina, 737 Serina e glicina, 738 Tetra-hidrofolato um cofator em algumas reaes de aminocidos, 741 Treonina, 744 Fenilalanina e tirosina, 744 Metabolismo de tirosina produz fumarato e acetoacetato, 744 Dopamina, epinefrina e norepinefrina so derivados de tirosina, 746 Tirosina necessria para sntese de melanina, hormnio tireoideano e quinoprotenas, 747 Metionina e cistena, 747 Metionina primeiro reage com adenosina trifosfato, 749 S-Adenosilmetionina um doador de grupo metil, 751 S-Adenosilmetionina o precursor de espermidina e espermina, 752 Metabolismo de cistena produz compostos que contm enxofre, 753 Triptofano, 754 Triptofano um precursor de NAD, 755 Piridoxal fosfato importante no metabolismo de triptofano, 756 Serotonina e melatonina so derivadas do triptofano, 756 Triptofano induz sono, 757 Aminocidos de cadeia ramicada, 758 Reaes iniciais do metabolismo de BCAA so as mesmas, 758

19

BioQ.19 725

22.01.07 18:16:14

732

PARTE 4 VIAS METABLICAS E SEU CONTROLE

O Grupo Amida da Asparagina Derivado de Glutamina


O grupo amida da asparagina vem da glutamina (Figura 19.17), e no de amnia livre, como na sntese de glutamina. ATP necessrio para ativar o grupo -carboxila receptor. Asparagina facilmente sintetizada na maioria das clulas, mas algumas clulas leucmicas parecem ter perdido esta capacidade. Uma abordagem teraputica que foi tentada em pacientes com tumores decientes em asparagina sintetase tratamento com asparaginase exgena, para hidrolisar a asparagina originria do sangue, da qual estas clulas dependem (Figura 19.18). Clulas normais sintetizam e degradam asparagina.
NH2 C COO CH2 HC + NH3 + CH2 CH2 HC + NH3 O

Aminocido Oxidases Removem Grupos Amino


Muitos aminocidos so substratos para L-aminocido oxidase (Figura 19.19). O signicado desta reao no metabolismo incerto, mas parece ser pequeno. A enzima contm avina mononucleotdeo (FMN) e produz perxido de hidrognio. Catalase metaboliza o perxido de hidrognio a oxignio e gua. Os produtos nais so um -cetocido, amnia e gua, os mesmos produtos da reao da glutamato desidrogenase. Na reao da aminocido oxidase, diferentemente da reao catalisada pela glutamato desidrogenase, no h produo de NADH e, portanto, nenhuma produo de ATP. Uma D-aminocido oxidase ocorre em clulas humanas. Muito pouco dos ismeros D-aminocidos encontrado no homem, e a enzima pode degradar Daminocidos derivados de bactrias intestinais.

COO Aspartato

COO Glutamina ATP AMP + PPi

19.3 TRANSPORTE DE NITROGNIO PARA FGADO E RIM


Protena Constantemente Degradada
Clulas morrem em uma base regular e programada, um processo chamado apoptose (ver p. 993), e suas molculas componentes so metabolizadas. Protenas individuais tambm sofrem turnover regular em condies normais (ver p. 239). Embora muitas reaes envolvidas

NH2 C CH2 HC O + NH3 +

COO CH2 CH2 HC + NH3

COO Asparagina

COO Glutamato COO HC R + NH3

FIGURA 19.17 Sntese de asparagina.


NH2 C CH2 HC O + NH3 Asparagina

FMN FMNH2 COO C R H2O COO C R O + + NH4 + NH2

H2O2 O2

COO H2O + NH4 COO CH2 HC + NH3 Aspartato

COO

FIGURA 19.18 Reao catalisada pela asparaginase.

FIGURA 19.19 Reao da L-aminocido oxidase, uma avoprotena.

BioQ.19 732

22.01.07 18:16:32

CAPTULO 19 METABOLISMO DE AMINOCIDOS


+

745

NH3 CH2 CH

COO

tetra-hidrobiopterina di-hidrobiopterina H2O O2 fenilalanina hidroxilase HO

NH3 CH2 CH COO

H2N HN

H N

H H H

Fenilalanina

Tirosina

N H

CH OH

CH OH

CH3

FIGURA 19.46 Fenilalanina hidroxilase.


HN HN O N

Tetra-hidrobiopterina H N

H H H

FIGURA 19.47 Biopterina. A forma di-hidro- (quinonide) produzida durante oxidao de aminocidos aromticos e depois reduzida forma tetra-hidro por uma desidrogenase, usando NADH.

CH OH

CH OH

CH3

Di-hidrobiopterina

CORRELAO CLNICA 19.7

Fenilcetonria
Fenilcetonria (PKU) a doena mais comum causada por uma decincia de uma enzima do metabolismo de aminocidos. O nome vem da excreo do cido fenilpirvico, uma fenilcetona, na urina. Fenil-lactato (Figura 19.47), a forma reduzida do fenilpiruvato, e fenilacetato so tambm excretados. O ltimo d urina um odor murino. Esses trs metablitos so encontrados em quantidades muito pequenas na urina de pessoas saudveis. Os sintomas de retardo mental associados a esta doena podem ser evitados por uma dieta pobre em fenilalanina. Teste de triagem de rotina determinado pelos governos de muitas partes do mundo. PKU clssica uma decincia autossmica recessiva de fenilalanina hidroxilase. Mais de 417 mutaes no gene foram descritas. Em alguns casos, h sintomas neurolgicos graves e QI muito baixo. Estes so geralmente atribudos aos efeitos txicos da fenilalanina, possivelmente devido ao transporte reduzido e metabolismo de outros aminocidos aromticos no crebro, devido competio das altas concentraes de fenilalanina. A cor clara caracterstica da pele e dos olhos deve-se falta de pigmentao, devido decincia de tirosina. Tratamento convencional por uma dieta sinttica, pobre em fenilalanina, mas incluindo tirosina, por cerca de quatro a cinco anos, seguida de restrio de protenas na dieta por vrios anos mais ou por toda a vida. Cerca de 3% das crianas com altos nveis de fenilalanina tm hidroxilase normal, mas so decientes na sntese ou na reduo de biopterina. Uma decincia de BH4 pode ser causada por mutao na GTP ciclo-hidrolase (GTPCH), 6-piruvoiltetra-hidrobiopterina sintetase (PTPS) ou sepiapterina redutase (SPR), as trs enzimas que convertem GTP em BH4. Duas enzimas so necessrias para regenerao de BH4: pterina-4a-carbinolamina desidratase (PCD) e di-hidropterina redutase (DHPR). Decincia de BH4 ocorre a uma taxa de um em um milho. Screening para hiperfenilalaninemia sem reduo de atividade de fenilalanina hidroxilase in vitro indica a possibilidade de uma decincia de BH4. Se a condio no for tratada, pacientes apresentam sintomas de hiperfenilalaninemia, cabelo vermelho, retardo psicomotor e deteriorao neurolgica progressiva. Estes ltimos sintomas so um resultado da incapacidade de produzir melanina, catecolaminas e serotonina. Tratamento suplementao com BH4 e precursor de neurotransmissores. Distonia que responde a DOPA (DRD) e decincia de SR no podem ser detectadas em testes de screening para PKU. Fibroblastos de pele so teis para o diagnstico destas condies. A descoberta da decincia de SR levou descoberta de vias alternativas do metabolismo de BH4, incluindo um papel para di-hidrofolato redutase (DHFR). Baixos nveis de DHFR no crebro permitem que di-hidrobiopterina se acumule e iniba tirosina e triptofano hidroxilases. DHP tambm desacopla xido ntrico sintase e pode levar morte de clula neuronal.

Fonte: Scriver, C. R. e Clow, L. L. Phenylketonuria: Epitome of human biochemical genetics. N. Engl. J. Med. 303:1336,1980. Woo, S. L. C. Molecular basis and population genetics of phenylketonuria. Biochemistry 28:1, 1989. Shintaku, H. Disorders of tetrahydrobiopterin metabolism and their treatments. Curr. Drug. Metab. 3:123; 2002. Blau, N., Bonafe, L. e Thony, B. Tetrahydrobiopterin deciencies without hyperphenylalaninemia diagnosis and genetics of dopa-responsive distonia and sepiapterin reductase deciency. Mol. Genet. Metab. 74:172, 2001.

BioQ.19 745

22.01.07 18:16:49

760
CH3 C

PARTE 4 VIAS METABLICAS E SEU CONTROLE


ATP CO2 H2O ADP + Pi CH3 CH2 C O Propionil-CoA CO2 propionil-CoA carboxilase SCoA
OOC

(A partir de leucina) CH C O SCoA CH3

OOC

SCoA

CH2

CH

SCoA

Metilcrotonil-CoA O CH3 C SCoA Acetil-CoA

metilcrotonil-CoA carboxilase

O CH3 Metilglutaconil-CoA H 2O metilglutaconil-CoA hidratase OH

hidroximetilglutaril-CoA liase

OOC

CH2

C CH3

CH2

C O

CH3 CH C O
DMetilmalonil-CoA

SCoA

CH3

C O

CH2

C O

Hidroximetilglutaril-CoA (HMG CoA)

Acetoacetato

FIGURA 19.70 Reaes nais na degradao de leucina.

metilmalonil-CoA racemase

ocorre, de maneira dependente de piridoxal. Reaes subseqentes levam a acetoacetil-CoA. Uma via minoritria comea com remoo do -amino-grupo e prossegue via o composto cclico pipecolato (Figura 19.73), para se juntar via principal no nvel do intermedirio semialdedo. Esta no substitui a via principal, mesmo em uma decincia de enzimas na parte inicial da via (ver Corr. Cln. 19.16).

OOC

CH

SCoA

CH3 O
LMetilmalonil-CoA

FIGURA 19.71 Interconverso de propionilCoA, metilmalonil-CoA e succinil-CoA. A mutase requer 5-desoxiadenosilcobalamina para atividade.

metilmalonil-CoA mutase

OOC

CH2

CH2

SCoA

O Succinil-CoA

CORRELAO CLNICA 19.15

Doenas do Metabolismo de Propionato e Metilmalonato


Decincia de qualquer das trs enzimas mostradas na Figura 19.71 contribui para cetoacidose. Propionato formado na degradao de valina, isoleucina, metionina, treonina, cadeia lateral do colesterol e cidos graxos de cadeia mpar. Os aminocidos parecem ser os principais precursores, uma vez que diminuio ou eliminao de protenas da dieta minimiza imediatamente a acidose. Um defeito na propionil-CoA carboxilase resulta em acmulo de propionato, que desviado para vias alternativas, incluindo incorporao em cidos graxos em lugar do primeiro grupo acetil, para formar cidos graxos de cadeia mpar. A extenso dessas reaes muito limitada. Em um caso, relatou-se que grandes quantidades de biotina produziram efeitos bencos, sugerindo que mais de um defeito diminua a atividade da propionil-CoA carboxilase. As possibilidades so: uma perda de biotinidase intestinal, que libera biotina de alimento ingerido para absoro, ou uma perda de biotina holocarboxilase, que incorpora biotina de alimentos ingeridos para absoro, ou perda de biotina holocarboxilase, que incorpora biotina em enzimas biotinadependentes. Acidose em crianas pode ser causada por altos nveis de metilmalonato, que normalmente no detectado no sangue. Fgado retirado de autpsia ou broblastos em cultura mostraram em alguns casos, decincia de metilmalonil-CoA mutase. Algumas amostras foram incapazes de converter metilmalonil-CoA em succinil-CoA em qualquer condio, mas outras amostras executaram a converso quando 5-adenosilcobalamina foi adicionada. claro que aqueles com defeito no stio ativo da enzima, no conseguem metabolizar metilmalonato, mas aqueles com defeito no manuseio da vitamina B12 respondem a altas doses da vitamina. Outros casos de acidria metilmalnica tm uma incapacidade mais fundamental de usar vitamina B12, que leva a decincia de metilcobalamina (co-enzima da recuperao de metionina) e decincia de 5-adenosilcobalamina (coenzima da isomerizao de metilmalonil-CoA).

Fonte: Mahoney, M. J. e Bick, D. Recent advances in the inherited methylmalonic acidemias. Acta Paediatr. Scand. 76:689, 1987.

BioQ.19 760

22.01.07 18:17:07

770

PARTE 4 VIAS METABLICAS E SEU CONTROLE

PARTE 4 VIAS METABLICAS E SEU CONTROLE


HCO3 Amina de aspartato
1 6

Glicina
5

N N
3

N
8

"C1"H4folato

N
9

"C1"H4folato

Amida de glutamina

METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTDEOS


Joseph G. Cory
20.1 VISO GERAL, 771 20.2 FUNES METABLICAS DOS NUCLEOTDEOS, 771 Distribuio de nucleotdeos varia com o tipo de clula, 771 20.3 METABOLISMO DE PURINA NUCLEOTDEOS, 772 Sntese de purina nucleotdeos, 772 Sntese de IMP, 772 IMP precursor de AMP e GMP, 774 Sntese de purina nucleotdeos muito regulada, 774 Purina bases e nucleosdeos so recuperados para regenerar nucleotdeos, 775 Purina nucleotdeos so interconvertidos para equilibrar nveis celulares de adenina e guanina nucleotdeos, 778 GTP o precursor de tetra-hidrobiopterina , 778 cido rico o produto nal da degradao de purinas no homem, 778 Formao de cido rico, 781 20.4 METABOLISMO DE PIRIMIDINA NUCLEOTDEOS, 783 Sntese de pirimidina nucleotdeos, 783 Sntese de pirimidina nucleotdeos regulada ao nvel da carbamoil fosfato sintetase II, 784 Bases pirimdicas so recuperadas para regenerar nucleotdeos, 786 20.5 FORMAO DE DESOXIRRIBONUCLEOTDEOS, 786 Desoxirribonucleotdeos so formados por reduo de ribonucleosdeos 5-difosfatos, 786 Sntese de desoxitimidilato requer N5, N10 -metileno H4folato, 788 Interconverses de pirimidinas com nfase em desoxirribopirimidina nucleosdeos e nucleotdeos, 788 Pirimidina nucleotdeos so degradados a -aminocidos, 789 20.6 NUCLEOSDEO E NUCLEOTDEO QUINASES, 789 20.7 ENZIMAS QUE METABOLIZAM NUCLEOTDEOS COM UMA FUNO EM CICLO CELULAR E TAXA DE DIVISO CELULAR, 790 20.8 SNTESE DE COENZIMAS NUCLEOTDEOS, 791 20.9 SNTESE E UTILIZAO DE 5-FOSFORRIBOSIL1-PIROFOSFATO, 791 20.10 AGENTES QUIMIOTERPICOS QUE INTERFEREM COM METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTDEOS, 793 Inibidores do metabolismo de purina e pirimidina nucleotdeos, 794 Antimetablitos so anlogos estruturais de bases ou nucleosdeos. 794 Antifolatos inibem a formao de tetra-hidrofolato, 795

20

BioQ.20 770

22.01.07 18:22:07

CAPTULO 20 METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTDEOS

783

CORRELAO CLNICA 20.5

CORRELAO CLNICA 20.6

Pacientes com Cncer em Tratamento por Radiaes ou Quimioterapia


Pacientes com cncer com tumores grandes, em tratamento por radioterapia ou quimioterapia tambm apresentam concentraes aumentadas de cido rico no soro e na urina. A fonte deste cido rico aumentado no sntese aumentada de purina nucleotdeos, mas sim destruio de clulas tumorais que, por sua vez, liberam cidos nuclicos degradados e nucleotdeos celulares, que so metabolizados a cido rico. Muitos dos protocolos de tratamento de cncer incluem alopurinol como uma das drogas, com o nico propsito de limitar o acmulo de cido rico nos pacientes. Uma nova droga uricoltica (Rasburicase, uma enzima bacteriana) que converte cido rico em um composto hidrossolvel est sendo usada em crianas e adultos para lidar com os nveis aumentados de cido rico formado aps clulas tumorais terem sido destrudas. Embora o uso de uricase ter certas vantagens farmacolgicas sobre alopurinol, tem a desvantagem de ser mais caro. Fonte: Smalley, R. V., Guaspari, A., Haase-\break Statz, S., Anderson, S. A., Cederberg, D. e Hohneker, J. A. Allopurinol: Intravenous use for prevention and treatment of hyperuricemia. J. Clin. Oncol. 18:1758, 2000. Ribeiro, R. C. e Pui, C. H. Recombinant urate oxidase for prevention of hyperuricemia and tumor lysis syndrome in lymphoid malignancies. Clin. Lymphoma 3:252, 2003. Yim, B. T., Sims-McCallum, R. P. e Chong, P. H. Rasburicase for the treatment and prevention of hyperuricemia. Ann. Pharmacother. 37:1047, 2003. causa de hiperuricemia/hiperuricria pode ser denida como um defeito metablico relacionado com a superproduo de purina nucleotdeos, e outras situaes nas quais no h alteraes metablicas denidas (ver Corr. Cln. 20.1, 20.2, 20.5 e 20.6).

Subclasse de Pacientes com Autismo


Recentemente demonstrou-se que uma subclasse de crianas com autismo infantil excreta cido rico em mais de dois desvios padres acima da mdia normal. Este grupo de crianas representa aproximadamente 20% da populao autista. Com cultura de broblastos destas crianas autistas, descobriu-se que a sntese de novo de purina nucleotdeos, medida por incorporao de [14C]-formato em purina nucleotdeos, estava aumentada quatro vezes, em relao ao observado em broblastos de controles normais. A razo de adenina nucleotdeos para guanina nucleotdeos no pool estava alterada, sugerindo que a via de interconverso de purina nucleotdeos estava comprometida. At o momento, a base molecular para a sntese de novo aumentada de purina nucleotdeos nestas crianas autistas no conhecida. Um aspecto incomum da sntese aumentada de purina nucleotdeos nestas crianas que a excreo de cido rico elevada, mas a concentrao de cido rico no soro est na faixa normal. Em um relato recente, um paciente do sexo masculino foi tratado com uma dose oral de uridina por um perodo de dois anos. Como resultado, o paciente teve notvel melhora no desempenho social, cognitivo, de linguagem e motor. Surpreendentemente, quando a uridina foi descontinuada, os sintomas de autismo voltaram, mas com o reincio do tratamento com uridina, o comportamento do menino melhorou novamente. Page, T. e Coleman, M. Purine metabolism abnormalities in a hyperuricosuric subclass of autism. Biochim. Biophys. Acta 1500:291, 2000. Page, T. e Moseley, C. Metabolic treatment of hyperuricosuric autism. Prog. Neuro-Psychopharmacol. Biol. Psychiatry 26:397, 2002. etapas. Hidrlise de ATP (ou equivalente) necessria para direcionar diversas etapas da via.

20.4 METABOLISMO DE PIRIMIDINA NUCLEOTDEOS


A sntese de novo do anel pirimidnico em clulas de mamferos utiliza aminocidos como doadores de carbono e nitrognio, alm de CO2. Uridina 5-monofosfato (UMP) sintetizado em uma via metablica de seis

Sntese de Pirimidina Nucleotdeos


Em contraste com a sntese de novo de purina nucleotdeos, nem todas as enzimas para a sntese de novo de pirimidina nucleotdeos so citoslicas. Reaes que levam formao de UMP so apresentadas na Figura 20.13. Aspectos importantes da via devem ser observados. O anel pirimidina formado primeiro, e depois ribose 5-fosfato adicionada com PRPP, sendo o doador

BioQ.20 783

22.01.07 18:22:20

CAPTULO 20 METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTDEOS

791

O pool de desoxirribonucleotdeos extremamente pequeno em clulas em repouso (inferior a 1 M). Como resultado do aumento de atividade de ribonucleotdeo redutase, as concentraes de desoxirribonucleotdeos alcanam 10-20 M durante sntese de DNA. Entretanto, esta concentrao suportaria sntese de DNA por alguns minutos, enquanto a replicao completa do DNA requer horas. Conseqentemente, os nveis de atividade da ribonucleotdeo redutase no s devem aumentar, mas devem ser mantidos durante a fase S, para fornecerem os substratos necessrios sntese de DNA. Tecidos em crescimento, como o fgado em regenerao, tecidos embrionrios, clulas da mucosa intestinal e clulas eritropoiticas esto inclinados em direo replicao de DNA e sntese de RNA. Estes tecidos apresentaro nveis elevados das enzimas-chaves envolvidas com sntese e interconverses de purina e pirimidina nucleotdeos, juntamente com diminuio complementar na quantidade de enzimas que catalisam reaes nas quais estes precursores so degradados. Estas mudanas reetem a proporo de clulas que esto na fase S. Um padro ordenado de alteraes bioqumicas ocorre em clulas tumorais. A partir de uma srie de tumores de fgado, clon e rim, com diferentes velocidades de crescimento, estas alteraes foram identicadas como: (1) ligadas transformao (signicando que todos os tumores, independentemente da velocidade de crescimento, apresentam quantidades de certas enzimas aumentadas e, de certas enzimas, diminudas), (2) ligadas progresso (alteraes que se correlacionam com a velocidade de crescimento dos tumores) e (3) alteraes coincidentes (no ligadas ao estado maligno). Os nveis de ribonucleotdeo redutase, timidilato sintase e IMP desidrogenase aumentam em funo da velocidade de crescimento do tumor. PRPP amidotransferase, UDP quinase e uridina quinase esto aumentadas em todos os tumores, independentemente de serem de crescimento lento ou rpido. Alteraes de expresso gnica em clulas tumorais no so apenas alteraes quantitativas em nveis enzimticos, mas tambm alteraes qualitativas (troca de isozimas, isozyme shifts). Enquanto algumas enzimas esto aumentadas em tecido normal de crescimento rpido (p. ex., embrionrio e fgado em regenerao) e em tumores, os padres gerais quantitativo e qualitativo para tecidos normal e tumoral podem ser diferenciados.

coenzimas tenham um resduo de AMP como parte de sua estrutura, o resduo de AMP no est diretamente envolvido nas reaes em que cada uma delas funciona. Em NAD e NADP, o anel de nicotinamida que est envolvido na funo de oxidao/reduo; em FMN ou FAD, o anel avina que est envolvido na funo de oxidao/reduo; na coenzima A, o grupo suldrila que parte funcional da molcula. So sintetizadas por uma variedade de tipos de clulas de mamferos. Figuras 20.27, 20.28 e 20.29 apresentam as vias biossintticas para cada uma. Sntese de NAD requer niacina, sntese de FAD requer riboavina, e CoA requer cido pantotnico. NAD sintetizado por trs vias diferentes, comeando com triptofano (ver p. 754), nicotinato ou nicotinamida, respectivamente. Quando triptofano est em excesso, em relao quantidade necessria para sntese de protenas e de serotonina (ver p. 773), ele pode ser usado para sntese de NAD. Esta situao no provvel na maioria das dietas normais; conseqentemente, niacina necessria na dieta. Sntese de NAD + por qualquer uma das trs vias requer PRPP como doador de ribose 5-fosfato. Nicotinamida adenina dinucleotdeo fosfato (NADP+) derivado por fosforilao do NAD +. NAD+ usado no s como cofator em reaes de oxidao-reduo, mas tambm como um substrato em reaes de ADP-ribosilao (p. ex., reparo de DNA e envenenamento por toxina pertussis; ver p. 514). Estas reaes levam ao turnover de NAD+. O produto nal da degradao de NAD + 2-piridona-5-carboxamida, que excretado na urina. Sntese de coenzimas nucleotdeos regulada de maneira que existam concentraes essencialmente constantes destas coenzimas na clula. Quando se diz que uma certa condio metablica favorecida quando a concentrao de NAD + baixa, a concentrao de NADH correspondentemente alta. Como um exemplo, para que a gliclise continue em condies anaerbicas, NAD+ deve ser continuamente regenerado por reduo de piruvato a lactato, catalisado pela lactato desidrogenase (ver p. 582).

20.9 SNTESE E UTILIZAO DE 5-FOSFORRIBOSIL1-PIROFOSFATO


5-Fosforribosil-1-pirofosfato (PRPP) uma molcula chave na sntese de novo de purina e pirimidina nucleotdeos, na recuperao de bases pricas e pirimdicas, e na sntese de NAD+. PRPP sintetase catalisa a reao apresentada na Figura 20.30. Ribose-5-fosfato usada nesta reao gerada a partir do metabolismo de glicose 6-fosfato, pela via das pentoses fosfato, ou da ribose 1-fosfato gerada por fosforlise de nucleosdeos, via nucleosdeo fosforilase. PRPP sintetase tem uma necessidade absoluta de fosfato inorgnico e fortemente regulada. A curva de velocidade versus concentrao

20.8 SNTESE DE COENZIMAS NUCLEOTDEOS


Nicotinamida adenina nucleotdeo (NAD+), avina adenina nucleotdeo (FAD+) e coenzima A (CoA) so importantes coenzimas ou grupos prostticos do metabolismo intermedirio. Embora todas essas

BioQ.20 791

22.01.07 18:22:30

CAPTULO 20 METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTDEOS


H CH2 C H C H C CH2OH

793

FIGURA 20.28 Sntese de avina adenina dinucleotdeo.

OH OH OH H3C H3C N N O Riboflavina N O ATP riboflavina quinase ADP H CH2 C H C H C CH2 O O P O O NH

OH OH OH N N O NH O ATP FAD - pirofosforilase PPi

H3C H3C

Riboflavins fosfato (flavina mononucleotdeo, FMN)

NH2 N N N

N Flavins adenina dinucleotdeo (FAD)

H CH2 C

H C

H C CH2 O

O P
O

O O P
O

CH2

OH OH OH N N O NH O

H3C H3C

HO

OH

5. Sntese de NAD + PRPP + nicotinato nicotinato mononucleotdeo + PPi PRPP + nicotinamida nicotinamida mononucleotdeo + PPi PRPP + quinolinato nicotinato mononucleotdeo + PPi Deve-se lembrar que os nveis celulares de pirofosfatase so muito altos em clulas, levando hidrlise de pirofosfato a fosfato, e tornando as reaes irreversveis.

20.10 AGENTES QUIMIOTERPICOS QUE INTERFEREM COM METABOLISMO DE PURINA E PIRIMIDINA NUCLEOTDEOS
Sntese de novo de purina e pirimidina nucleotdeos crtica para replicao, manuteno e funo da clula normal. Regulao destas vias importante, uma vez que foram identicadas doenas que surgem de defeitos nas enzimas regulatrias. Compostos sintticos e produtos naturais de plantas, bactrias ou fungos, que so anlogos estruturais das nucleobases ou dos nucleosdeos usados em reaes metablicas, tm

BioQ.20 793

22.01.07 18:22:33

CAPTULO 21 METABOLISMO DO HEME E DO FERRO

803

PARTE 4 VIAS METABLICAS E SEU CONTROLE


M M
N

V
N Fe N N

M V

Heme

METABOLISMO DO HEME E DO FERRO


William M. Awad, Jr.

21

21.1 METABOLISMO DO FERRO: VISO GERAL, 804 21.2 PROTENAS QUE CONTM FERRO, 804 Transferrina transporta ferro no soro, 804 Lactoferrina liga ferro no leite, 805 Ferritina uma protena envolvida no armazenamento de ferro, 805 Protenas que contm ferro no-hemnico esto envolvidas em processos enzimticos, 806 21.3 ABSORO INTESTINAL DE FERRO, 807 21.4 REGULAO MOLECULAR DA UTILIZAO DE FERRO, 808 21.5 DISTRIBUIO E CINTICA DO FERRO, 811 21.6 BIOSSNTESE DO HEME, 813 Enzimas da biossntese do heme ocorrem em mitocndrias e citosol, 818 cido -aminolevulnico sintase, 818 cido aminolevulnico desidratase, 818 Porfobilinognio deaminase e uroporrinognio III sintase, 818 Uroporrinognio descarboxilase, 819 Coproporrinognio oxidase, 820 Protoporrinognio oxidase, 820 Ferroquelatase, 820 ALA sintase catalisa a etapa limitante da velocidade da biossntese do heme, 821

21.7 CATABOLISMO DO HEME, 821 Bilirrubina conjugada para formar bilirrubina diglucurondeo no fgado, 821 Hemlise intravascular requer remoo de ferro, 823 BIBLIOGRAFIA, 826 QUESTES E RESPOSTAS, 827 CORRELAES CLNICAS 21.1 Sobrecarga de Ferro e Infeco, 805 21.2 Patogenicidade Microbiana e Ferro, 805 21.3 Sntese do Grupo Ferro-Enxofre e Doena Humana, 807 21.4 Ataxia de Friedreich, 807 21.5 Absoro Duodenal de Ferro, 809 21.6 Elementos de Resposta ao Ferro Mutante, 811 21.7 Decincia de Ceruloplasmina, 812 21.8 Anemia por Decincia de Ferro, 812 21.9 Hemocromatose Tipo I: Gentica Molecular e a Questo das Dietas Enriquecidas em Ferro, 814 21.10 Hemocromatose Tipo III, 814 21.11 Porria Intermitente Aguda, 817 21.12 Papel Citoprotetor de Heme Oxigenase, 822 21.13 Hemlise Isoimune Neonatal, 824 21.14 Decincia de Bilirrubina UDP-Glucuronosiltransferase, 824 21.15 Elevao de Bilirrubina Conjugada no Soro, 825

BioQ.21 803

22.01.07 18:25:39

CAPTULO 21 METABOLISMO DO HEME E DO FERRO

811

CORRELAO CLNICA 21.6

Elemento de Resposta ao Ferro Mutante


Mutaes simples foram descritas no segmento de ala do elemento de resposta ao ferro do mRNA da cadeia leve da ferritina, com uma quantidade aumentada de apoferritina sendo sintetizada, mas sem um aumento no ferro total do corpo. Esta mutao leva a uma anidade 28 vezes menor para IRP-1, em um caso. O contedo de L-ferritina do cristalino pode aumentar nove vezes em comparao ao contedo no cristalino de indivduos controles. Como conseqncia, cristais de cadeias leves puras de ferritina aparecem no cristalino, levando a catarata. A sntese muito aumentada de ferritina no cristalino pode levar a uma quantidade aumentada de reaes catalisadas por ferro, com dano lenticular oxidativo muito bem descrito. Uma mutao numa famlia japonesa ocorre no IRE do mRNA da cadeia H da ferritina, com um marcado aumento na anidade por IRP. O seqestro de IRPs leva sntese diminuda de cadeia H e sntese aumentada de cadeia L. Esta condio est associada com aumento signicativo no contedo de ferro do corpo, mas aparentemente sem evidncia de catarata.

Fonte: Girelli, D., Corrocher, R., Bisceglia, L., et al. Molecular basis for the recently described hereditary hyperferritinemia-cataract syndrome: a mutation in the iron-responsive elements of ferritin L-subunit gene (the Verona mutation). Blood 86: 4050, 1995. Beaumont, C., Leneuve, P., Devaux, I., Scoazec, J.Y., et al. Mutation in the iron responsive element of the L ferritin mRNA in a family with dominant hyperferritinaemia and cataract. Nature Genet. 11: 444, 1995. Mumford, A. D., Cree, I. A., Arnold, J. D., et al. The lens in hereditary hyperferritinemia cataract syndrome contains crystalline deposits of L-ferritin. Br. J. Ophthalmol. 84:697, 2000. Kato, J., Fujikawa, K., Kanda, M., et al. A mutation in the ironresponsive element of H-ferritin mRNA, causing autosomal dominant iron overload. Am. J. Hum. Genet. 69:191, 2001. TABELA 21.2 Sndromes de Sobrecarga de Ferro
Nome Sndrome GRACILE Hemocromatose juvenil Hemocromatose juvenil Hemocromatose Hemocromatose Hemocromatose Sobrecarga de ferro Aceruloplasminemia Gene BCS1L HFE2 HFE2B HFE1 HFE3 HFE4 FTH1 CP Cromossomo 2q33 1q21 19q13 6p21 7q22 2q32 11q13 3q23 Herana Recessiva Recessiva Recessiva Recessiva Recessiva Dominante Dominante Recessiva Ocorrncia Muito rara Incomum Incomum Comum Incomum Rara Muito rara Rara Protena Chaperone mitocondrial Hemojuvelina Hepcidina Protena HFE Receptor 2 de transferrina Ferroportina Ferritina H Ceruloplasmina

Fonte : Fellman, V. The GRACILE syndrome, a neonatal lethal metabolic disorder with iron overload. Blood Cells Mol. Dis. 29:444, 2002. Ver Corr. Cln. 21.6, 21.7, 21.9 e 21.10 para maiores detalhes.

21.5 DISTRIBUIO E CINTICA DO FERRO


Um homem normal de 70 kg contm 3-4 g de ferro, dos quais apenas 0,1% (3,5 mg) no plasma. Aproximadamente 2,5 g esto na hemoglobina. Tabela 21.3 lista a distribuio de ferro no ser humano. Normalmente, cerca de 33% dos stios de transferrina contm ferro. Ferro absorvido do intestino entregue primariamente medula ssea, para incorporao em hemoglobina dos eritrcitos.

TABELA 21.3 Distribuio Aproximada de Ferro: Homem de 70 kg


g Hemoglobina Mioglobina Transferrina Ferritina, tecido Ferritina, soro Enzimas Total 2,5 0,15 0,003 1,0 0,0001 0,02 3,7 % 68 4 0,1 27 0,004 0,6 100

BioQ.21 811

22.01.07 18:25:46

CAPTULO 21 METABOLISMO DO HEME E DO FERRO

817

CORRELAO CLNICA 21.11

Porria Intermitente Aguda


Uma mulher de 40 anos de idade procurou o pronto-socorro em um estado agitado, chorando e reclamando de intensa dor abdominal. Estava constipada h vrios dias e notou marcada fraqueza nos braos e nas pernas e que as coisas no parecem estar completamente corretas. Exame fsico revelou uma velocidade de batimento cardaco ligeiramente acelerada (100/min) e hipertenso moderada (presso sangnea de 160/110 mmHg). Episdios anteriores de dor abdominal severa j haviam ocorrido; operaes realizadas em duas ocasies no revelaram nenhuma anormalidade. Os testes laboratoriais comuns so normais. As queixas neurolgicas no so localizadas num foco anatmico. Decide-se que os sintomas presentes so amplamente de origem psiquitrica e tm uma base funcional, e no orgnica. A paciente sedada com 60 mg de fenobarbital; um psiquiatra consultado concorda, por telefone, em ver a paciente em aproximadamente 4 h. O corpo clnico percebe uma piora notvel; fraqueza generalizada surge rapidamente, progredindo para um comprometimento da funo respiratria. Esta evoluo ruim leva incorporao imediata de um regime de ventilao assistida, com transferncia para unidade de terapia intensiva para monitorao siolgica. Sua condio piora e ela morre 48 h depois. Uma amostra de urina da paciente relatada mais tarde como apresentando um nvel muito elevado de porfobilinognio. Esta paciente tinha porria intermitente aguda, uma doena pouco entendida da biossntese de heme. H um padro de herana dominante associado a uma superproduo de ALA e porfobilinognio, os precursores de porrina. Trs anomalias enzimticas foram observadas em casos que foram estudados cuidadosamente. Estas incluem: (1) um grande aumento de ALA sintase, (2) uma reduo metade da atividade de porfobilinognio deaminase, e (3) uma reduo metade da atividade da esteride 5-redutase. A mudana no contedo da segunda enzima consoante com uma expresso dominante. A mudana no contedo da terceira enzima adquirida, e aparentemente no existe expresso hereditria da doena. Acredita-se que uma diminuio na porfobilinognio deaminase leve a uma pequena diminuio no contedo de heme do fgado. A concentrao menor de heme leva a uma insucincia na represso da sntese e na inibio da atividade da ALA sintase. Quase nunca manifestada antes da puberdade, acredita-se que a doena aparea apenas com a induo da 5 -redutase, na adolescncia. Sem uma quantidade suciente de 5-redutase, o aumento observado nos 5 -esterides devido a um desvio de esterides para a via da 5 -redutase. A importncia de anomalias nesta ltima via metablica na patognese da porria controversa. A doena um grande enigma: o desarranjo do metabolismo da porrina connado ao fgado, que anatomicamente parece normal, enquanto achados patolgicos esto restritos ao sistema nervoso. No presente caso, envolvimento de (1) crebro leva ao estado agitado e confuso e ao colapso respiratrio, (2) sistema autnomo leva hipertenso, aumento na velocidade de batimentos cardacos, constipao e dor abdominal, e (3) sistema nervoso perifrico e medula espinhal levam fraqueza e distrbios sensoriais. Experimentalmente, nenhum intermedirio metablico conhecido da biossntese do heme pode causar a patologia observada na porria intermitente aguda. Deveria ter havido uma suspeita maior da possibilidade de porria, logo aps a chegada da paciente. O tratamento incluiria infuso de glicose, excluso de qualquer droga que pudesse causar aumento de ALA sintase (p.ex., barbituratos) e, se a doena no respondesse satisfatoriamente apesar destas medidas, administrao de hematina intravenosa para inibir a sntese e a atividade de ALA sintase. Porria heptica aguda de interesse poltico histrico. A doena foi diagnosticada em dois descendentes do rei George III, sugerindo que o ltimo tinha uma personalidade alterada antes e durante a Revoluo Americana, que poderia talvez ser atribuda porria.

Fonte: Meyer, U.A., Strand, L.J., Doss, M., et al. Intermittent acute porphyria: demonstration of a genetic defect in porphobilinogen metabolism. N. Engl. J. Med. 286: 1277, 1972. Stein, J.A. e Tscudy, D.D. Acute intermittent porphyria: a clinical and biochemical study of 46 patients. Medicine (Baltimore) 49: 1, 1970.

BioQ.21 817

22.01.07 18:25:51

CAPTULO 21 METABOLISMO DO HEME E DO FERRO

821

sensvel aos efeitos de metais pesados, especialmente chumbo, e, claro, deprivao de ferro. Nestes ltimos casos, zinco incorporado em lugar do ferro, formando um complexo zinco-protoporrina IX. Em contraste com heme, o complexo zinco-protoporrina IX muito uorescente e facilmente detectvel em pequenas quantidades. Ferroquelatase procaritica no contm um grupo prosttico; enquanto a enzima de mamferos contm um grupo Fe2S2.

21.7 CATABOLISMO DE HEME


Catabolismo de protenas contendo heme apresenta duas necessidades para o mamfero hospedeiro: (a) um meio para processar os produtos hidrofbicos de clivagem do anel porrnico e (b) reteno e mobilizao do ferro contido, de forma que possa ser reutilizado. Eritrcitos tm um tempo de vida de aproximadamente 120 dias. Clulas senescentes so reconhecidas por alteraes em suas membranas, e removidas pelo sistema retculoendotelial em locais extravasculares. As cadeias de globina desnaturam, liberando heme no citoplasma. A globina degradada at seus aminocidos constituintes, que so reutilizados para suprir necessidades metablicas gerais. Figura 21.12 mostra os eventos do catabolismo de heme. Heme degradado primariamente por um sistema de enzimas do retculo endoplasmtico em clulas retculoendoteliais, que requerem oxignio molecular e NADPH. Heme oxigenase tem dois ismeros; tipo I induzido por substrato e tipo II constitutivo. A enzima catalisa clivagem da ponte -meteno, que une os dois resduos pirrlicos contendo substituintes vinil. O carbono -meteno convertido, quantitativamente, em monxido de carbono. Esta a nica fonte endgena de monxido de carbono no homem. Uma frao do monxido de carbono liberada pelo trato respiratrio. Assim, a medida de monxido de carbono na respirao exalada fornece um ndice da quantidade de heme que degradada em um indivduo. O oxignio presente no monxido de carbono e nos anis lactmicos recm-derivados gerado totalmente a partir de oxignio molecular. A estequiometria da reao requer 3 moles de oxignio para cada clivagem de anel. Heme oxigenase s usar heme como substrato, com o ferro possivelmente participando no mecanismo de clivagem. Assim, protoporrina IX livre no substrato. O tetrapirrol linear biliverdina IX formado por heme oxigenase. Biliverdina IX reduzida por biliverdina redutase a bilirrubina IX. Descobriu-se que os produtos de ao da heme oxigenase so citoprotetores (ver Corr. Cln. 21.12).

ALA Sintase Catalisa a Etapa Limitante da Velocidade da Biossntese do Heme


ALA sintase controla a etapa limitante da velocidade de sntese de heme em todos os tecidos. Succinil-CoA e glicina so substratos para uma variedade de reaes. A modulao da atividade de ALA sintase determina a quantidade de substratos que ser desviada para biossntese de heme. Heme e hematina agem como repressores da sntese de ALA sintase e como inibidores de sua atividade. Como heme no se assemelha nem com os substratos nem com o produto da ao da enzima, provvel que atue sobre um stio alostrico. Quase 100 drogas e metablitos diferentes podem causar induo de ALA sintase; por exemplo, um aumento de 40 vezes observado em rato aps tratamento com 3,5-dicarbetoxi-1,4-di-hidrocolidina. O efeito dos agentes farmacolgicos levou a uma caracterstica clnica importante: alguns pacientes com certos tipos de porria tiveram exacerbao de sua condio aps administrao inadequada de certas drogas (p. ex., barbituratos). ALA desidratase tambm inibida por heme; mas isto tem poucas conseqncias siolgicas, uma vez que a atividade de ALA desidratase cerca de 80 vezes maior do que a de ALA sintase e, portanto, efeitos inibitrios do heme reetem-se primeiro na atividade de ALA sintase. Glicose ou um de seus metablitos proximais inibe biossntese de heme por um mecanismo desconhecido. Isto de relevncia clnica, uma vez que alguns pacientes manifestam seu estado porfrico pela primeira vez quando colocados em dieta muito hipocalrica (e, portanto, de pouca glicose). Outros reguladores do metabolismo de porrinas incluem certos esterides. Hormnios esterides (p. ex., plulas contraceptivas orais) com uma dupla ligao no anel A entre os tomos C4 e C5 podem ser reduzidos por duas redutases diferentes. O produto da reduo de 5 tem pouco efeito sobre a biossntese de heme; entretanto, o produto da 5 -reduo serve com um estmulo para sntese de ALA sintase.

Bilirrubina Conjugada para Formar Bilirrubina Diglucurondeo no Fgado


Bilirrubina derivada de glbulos vermelhos senescentes, mas tambm do turnover de outras protenas que contm heme, como os citocromos. Estudos, com glicina marcada como um precursor, revelaram que uma bilirrubina marcada precocemente, com um pico em 1-3 h, aparece muito rapidamente aps uma administrao em pulso do precursor marcado. Uma quantidade maior de bilirrubina aparece muito mais tarde, em aproximadamente 120 dias, reetindo o turnover do heme em

BioQ.21 821

22.01.07 18:25:56

CAPTULO 22 INTER-RELAES METABLICAS

829

PARTE 4 VIAS METABLICAS E SEU CONTROLE


Fgado
Aminocidos
Sntese protica Lactato

Glicose

Glicognio

Piruvato Gordura

Uria

Sntese protica (todos os tecidos)

Crebro
CO2 + H2O

INTER-RELAES METABLICAS
Robert A. Harris e David W. Crabb
22.1 VISO GERAL, 830 22.2 CICLO JEJUM-ALIMENTAO, 830 No estado bem alimentado a dieta supre as necessidades energticas, 830 No estado de jejum inicial, glicogenlise heptica uma importante fonte de glicose sangnea, 834 O estado de jejum requer gluconeognese a partir de aminocidos e glicerol, 835 No estado de realimentao inicial, glicognio formado por uma via indireta, 837 Importantes interaes metablicas interrgos, 838 Necessidades energticas, reservas e homeostase calrica, 839 Homeostase da glicose tem cinco fases, 842 22.3 MECANISMOS ENVOLVIDOS NA MUDANA DO METABOLISMO HEPTICO ENTRE OS ESTADOS BEM-ALIMENTADO E DE JEJUM, 843 Disponibilidade de substratos controla muitas vias metablicas, 843 Efetores alostricos regulam enzimas-chaves, 843 Modicao covalente regula enzimas-chaves, 845 Mudanas nas quantidades de enzimas-chaves fornecem adaptao de longo prazo, 849 22.4 INTER-RELAES METABLICAS DE TECIDOS EM VRIOS ESTADOS NUTRICIONAIS E HORMONAIS 852 Obesidade, 853 Fazendo dieta, 853 Diabetes mellitus tipo 2, 855 Diabetes mellitus tipo 1, 856 Cncer, 858 Exerccios aerbico e anaerbico, 858 Gravidez, 860 Lactao, 860 Estresse e trauma, 861 Doena heptica, 862 Doena renal, 863 lcool, 863 Equilbrio cido-base, 864 Clon, 866 BIBLIOGRAFIA, 866 QUESTES E RESPOSTAS, 868 CORRELAES CLNICAS 22.1 Obesidade, 831 22.2 Subnutrio Protica, 832 22.3 Jejum, 833 22.4 Sndrome de Reye, 837 22.5 Coma Hiperglicmico, Hiperosmolar, 841 22.6 Hiperglicemia e Glicao de Protenas, 841 22.7 Diabetes Mellitus Tipo 2, 855 22.8 Diabetes Mellitus Tipo 1, 857 22.9 Via do Poliol e Complicaes do Diabetes, 857 22.10 Caquexia do Cncer, 858

22

BioQ.22 829

22.01.07 18:27:18

CAPTULO 22 INTER-RELAES METABLICAS

843

corpos cetnicos se acumularam at concentraes sucientemente elevadas para que entrem no crebro e supram parte de suas necessidades energticas. Gluconeognese renal tambm se torna signicativa nesta fase. Fase V ocorre aps jejum muito prolongado de indivduos extremamente obesos, e caracterizada por dependncia ainda menor da gluconeognese. Nesta fase, as necessidades energticas de quase todos os tecidos so supridas, em grande parte, por oxidao de cidos graxos ou de corpos cetnicos. Enquanto as concentraes de corpos cetnicos estiverem elevadas e os nveis de glicose mantidos, protelise ser um tanto restrita, talvez por pequenas quantidades de insulina ainda produzidas pelo pncreas, e preservao de protenas musculares e enzimas ocorrer. Isto continua at que praticamente toda a gordura tenha sido consumida, e os nveis de corpos cetnicos caem. Depois que toda a gordura se esgotou, o corpo precisa usar protena muscular para manter a glicose sangnea. Antes que ela se acabe, voc se acabou (ver Corr. Cln. 22.3).

explica alguns tipos de hipoglicemia, como as observadas durante gravidez ou jejum avanado. Sntese de uria tambm regulada por suprimento de substratos. Metabolismo de aminocidos no intestino fornece uma frao substancial da amnia usada pelo fgado para produo de uria. O intestino libera citrulina, como discutido acima, o precursor metablico de ornitina. Um pool maior de ornitina permite sntese aumentada de uria aps uma refeio rica em protenas. Na decincia de protenas, a velocidade de formao de uria diminui. Podemos concluir que suprimento de substratos um importante determinante da velocidade em que operam virtualmente todos os processos metablicos do corpo. Entretanto, variaes no suprimento de substratos no so sucientes para explicar as mudanas marcantes no metabolismo, que devem ocorrer no ciclo jejum-alimentao. Ajuste mais no das vias necessrio.

22.3 MECANISMOS ENVOLVIDOS NA MUDANA DO METABOLISMO HEPTICO ENTRE OS ESTADOS BEM-ALIMENTADO E DE JEJUM
O fgado de pessoas bem-alimentadas sintetiza ativamente glicognio e triacilglicerol; tal fgado glicognico, glicoltico e lipognico. Em contraste, o de uma pessoa em jejum glicogenoltico, gluconeognico, cetognico e proteoltico. A estratgia empregada armazenar calorias quando alimento est disponvel, e mobiliz-las quando o resto do corpo estiver precisando. O fgado muda entre estes extremos metablicos por uma variedade de mecanismos regulatrios: suprimento de substratos, efetores alostricos, modicao covalente e induo-represso de enzimas.

Efetores Alostricos Regulam Enzimas-Chaves


Figuras 22.10 e 22.11 resumem os efeitos de efetores alostricos no fgado, em estados bem-alimentado e jejum, respectivamente. Como mostra a Figura 22.10, glicose ativa glucoquinase [indiretamente por promover seu deslocamento do ncleo para o citoplasma (p. 590)], promovendo assim fosforilao da glicose. Glicose tambm inativa glicognio fosforilase e ativa glicognio sintase indiretamente, dessa forma impedindo degradao e promovendo sntese de glicognio. Frutose 2,6-bisfosfato estimula 6-fosfofruto-1-quinase e inibe frutose 1,6-bisfosfatase, desta forma estimulando gliclise e inibindo gluconeognese. Frutose 1,6-bisfosfato ativa piruvato quinase, desta forma estimulando gliclise, e piruvato ativa o complexo piruvato desidrogenase [indiretamente, por inibio da piruvato desidrogenase quinase (ver p. 628)]. Citrato ativa acetil-CoA carboxilase, desta forma estimulando sntese de cidos graxos, e malonil-CoA inibe carnitina palmitoiltransferase I, desta forma inibindo oxidao de cidos graxos. Como mostra a Figura 22.11, acetil-CoA estimula gluconeognese em estado de jejum por ativar piruvato carboxilase e inibir o complexo piruvato desidrogenase [diretamente por estmulo da piruvato desidrogenase quinase (ver p. 531)]. steres de acil-CoA de cadeia longa inibem acetil-CoA carboxilase, o que diminui o nvel de malonil-CoA e aumenta atividade de carnitina palmitoiltransferase I e oxidao de cidos graxos. Frutose 6-fosfato inibe glucoquinase [indiretamente por promover seu deslocamento do citoplasma para o ncleo (ver p. 590)]. Citrato, que est aumentado em concentrao como conseqncia de maior oxidao de cidos graxos, inibe 6-fosfofruto1-quinase e 6-fosfofruto-2-quinase (no mostrado); e NADH, produzido pela oxidao de cidos graxos, inibe o ciclo dos cidos tricarboxlicos.

Disponibilidade de Substratos Controla Muitas Vias Metablicas


Este mecanismo de controle freqentemente ignorado. Entretanto, a concentrao de cidos graxos no sangue que entra no fgado um importante determinante da taxa de cetognese. Sntese de glicose pelo fgado afetada pela velocidade com que substratos gluconeognicos uem para o fgado. Entrega de aminocidos para o fgado no diabetes, em virtude de protelise acelerada e descontrolada, estimula gluconeognese e exacerba hiperglicemia. Por outro lado, incapacidade de suprir o fgado adequadamente com substratos glucognicos

BioQ.22 843

22.01.07 18:27:34

852

PARTE 4 VIAS METABLICAS E SEU CONTROLE

22.22). Insulina se ope a esta ao do glucagon. Vrios mecanismos esto envolvidos, mas o mais importante envolve inibio da atividade de fatores de transcrio forkhead que so necessrios para a transcrio dos genes contendo elementos de resposta insulina (IRE) e codicando enzimas gluconeognicas (Figura 22.21). Decincia de energia leva inibio de sntese de gordura, colesterol e glicose pelas clulas do fgado. Ativao de AMPK por AMP reduz a transcrio de SREBP e inibe sua atividade transcripcional e, portanto, inibe sntese de gordura e de colesterol (Figura 22.21). Ativao de AMPK tambm inibe a atividade transcripcional de fator nuclear heptico 4 (HNF-4), que necessrio para transcrio de genes que codicam enzimas gluconeognicas. Receptor de peroxissomos proliferador-ativado ( PPAR), um membro da famlia de receptores nucleares, um receptor de cidos graxos, e expresso em altos nveis em tecidos que oxidam cidos graxos (fgado, rim e corao). cidos graxos poliinsaturados estimulam o receptor para ativar transcrio de genes envolvidos em utilizao de cidos graxos (Figura 22.23), que contm um elemento de resposta a proliferador de peroxissomo ( PPRE) em seus promotores, incluindo aqueles para enzimas dos sistemas de peroxissomos, microssomos e mitocndrias para oxidao de cidos graxos ( FOX), genes de apolipoprotenas necessrias para exportao de triacilgliceris hepticos como VLDL, e enzimas da cetognese. No tecido adiposo, a isoforma PPAR expressa. Quando ativada (talvez por derivados de cidos graxos, como prostaglandinas), orquestra a diferenciao de pr-adipcitos em adipcitos, aumentando a capacidade de armazenar triacilglicerol. A atividade de ambas as formas de PPAR aumentada pelo PPAR-coativador 1 (PGC-1), que induzido por cAMP. Estas mudanas adaptativas tambm inuenciam a ecincia dos mecanismos regulatrios de curto pra-

zo. Por exemplo, no jejum prolongado ou no diabetes no-controlado, mudana na concentrao de efetores alostricos de acetil-CoA carboxilase ter pouco efeito quando a enzima estiver virtualmente ausente, devido regulao negativa da expresso do seu gene. Uma pessoa em jejum crnico no pode utilizar ecientemente uma carga de glicose devido ausncia de enzimaschaves necessrias ao metabolismo de glicose. Isto a intolerncia a glicose do jejum. Uma carga de glicose, entretanto, colocar em ao as adaptaes necessrias e o restabelecimento dos mecanismos regulatrios de curto prazo.

22.4 INTER-RELAES METABLICAS DE TECIDOS EM VRIOS ESTADOS NUTRICIONAIS E HORMONAIS


Muitas mudanas que ocorrem nos diferentes estados nutricionais e hormonais so variaes do ciclo jejumalimentao. Alguns exemplos so dados na Figura 22.24. Outros so bvios por exemplo, o rpido crescimento de uma criana, quando aminocidos so direcionados do catabolismo para sntese de protenas. As mudanas que ocorrem em algumas situaes siologicamente importantes, entretanto, so bastante sutis e pouco conhecidas. Por exemplo, no envelhecimento parece haver uma sensibilidade diminuda dos principais tecidos do corpo a hormnios, com capacidade diminuda dos tecidos de responderem normalmente durante o ciclo jejum-alimentao. Se isso um fator que contribui ou uma conseqncia do processo de envelhecimento, no se sabe.

cidos graxos + PPAR + + +

FIGURA 22.23 Ativao de PPAR por cidos graxos promove transcrio de genes de oxidao de cidos graxos (FOX) e cetognese.

PPRE Mitocndria genes FOX

PPRE Peroxissomo genes FOX

PPRE Genes de cetognese

Oxidao de cidos graxos

Cetognese

BioQ.22 852

22.01.07 18:27:50

858

PARTE 4 VIAS METABLICAS E SEU CONTROLE

excesso, de combustveis provenientes do intestino. De fato, pacientes com diabetes tipo I cam presos ao estado de jejum, sem o benefcio da parada geralmente imposta, durante o jejum, pela baixa, mas constante, produo de insulina pelo pncreas. Isto leva a severo desgaste dos tecidos do corpo e, no nal, morte, a menos que insulina seja administrada.

CORRELAO CLNICA 22.10

Caquexia do Cncer
Perda de peso sem explicao pode ser um sinal de malignidade, e perda de peso comum no cncer avanado. Isto no completamente explicado por perda de apetite e diminuio na ingesto de alimentos. A perda de peso deve-se principalmente a msculo esqueltico e tecido adiposo, sendo relativamente poupadas as protenas viscerais (i., fgado, rim e corao). Embora tumores comumente apresentem velocidades altas de gliclise, a necessidade energtica do tumor provavelmente no explica a perda de peso, uma vez que pode ocorrer mesmo com tumores pequenos. Anomalias endcrinas foram identicadas em pacientes com cncer. Os pacientes tendem a ser resistentes insulina, tm nveis elevados de cortisol, e tm alta taxa de metabolismo basal. Alguns tumores sintetizam e secretam peptdeos biologicamente ativos como ACTH, fator de crescimento neural, e fator de crescimento tipo-insulina, que podem modicar o metabolismo energtico. A resposta do hospedeiro a um tumor, por analogia com infeco crnica, inclui liberao de interleucina-1 (IL-1), interleucina-6 (IL-6) e fator de necrose tumoral (TNF- ) por clulas imunes. TNF- tambm chamado caquexina, porque produz depauperamento. TNF- e IL-1 podem atuar de modo parcrino, uma vez que seus nveis plasmticos no cam elevados. Estas citocinas estimulam febre, protelise, liplise e secreo de reagentes de fase aguda pelo fgado. Estudos mais recentes identicaram o fator indutor de protelise (PIF) e o fator mobilizador de lipdeo (LMF) como produtos de tumores que estimulam catabolismo de protena esqueltica e consumo do tecido adiposo, respectivamente. Fonte: Beutler, B. e Cerami, A. Tumor necrosis, cachexia, shock, and inammation: a common mediator. Annu. Rev. Biochem. 57:1505, 1988. Tracey, K. J. e Cerami, A. Tumor necrosis factor: A pleitropic cytokine and therapeutic target. Annu. Rev. Med. 45:491, 1994. Nitenberg, G. e Raynard, B. Nutritional support of the cancer patients: issues and dilemmas. Crit. Rev. Oncol. Hematol. 34:137, 2000. Tisdale, M. J. Cancer anorexia and cachexia. Nutrition 17:438, 2001. Wray, C. J., Mammen, J. M. e Hasselgren, P. O. Catabolic response to stress and potential benets of nutrition support. Nutrition 18:971, 2002. para sntese de ATP (Figura 22.6), at que glicogenlise e gliclise sejam estimuladas. Por falta de oxignio, gliclise torna-se a fonte primria de ATP. Durante

Cncer
Tumores so compostos de clulas cancerosas, que precisam se alimentar como todas as clulas, mas ao contrrio da maioria dos tecidos normais, tumores funcionam independentemente do ciclo jejum-alimentao (ver Corr. Cln. 22.10). Sua demanda por glicose como fonte de energia e aminocidos para sntese protica incessante. Geralmente, preferem glicose e raramente se adaptam, na fase de jejum do ciclo jejum-alimentao, ao uso de cidos graxos e corpos cetnicos para minimizar seu uso de glicose, para benefcio do resto do corpo. A maioria dos tumores no responde a mudanas hormonais que alteram os processos metablicos em tecidos normais. Estabelecem um ciclo de Cory com o fgado, mas ainda assim podem oxidar completamente quantidades substanciais de glicose, contanto que oxignio esteja disponvel (Figura 22.24e). Clulas do centro de um tumor esto freqentemente em hipxia porque cnceres muitas vezes ultrapassam o desenvolvimento de vasos sangneos, que trazem oxignio. Falta de oxignio em qualquer clula, normal ou cancerosa, leva a um aumento em fator 1 hipxia induzido ( HIF-1), um fator de transcrio excepcionalmente potente para ativao de genes que codicam transportadores de glicose e as enzimas da gliclise. HIF-1 tambm se torna constitutivamente ativo em algumas clulas cancerosas devido a mutaes que ativam certos oncogenes. Como uma conseqncia da ao de HIF-1, a maioria dos tumores de cncer tem excepcional capacidade de gerar ATP por gliclise. Gliclise no um processo eciente, em comparao com oxidao completa de glicose, mas utilizao eciente dos recursos do corpo no caracterstica de um cncer. Capacidade excepcional de gerar ATP por gliclise permite s clulas cancerosas sobreviverem e crescerem enquanto se espalham e do metstases em regies de baixa tenso de oxignio.

Exerccios Aerbico e Anaerbico


Exerccio aerbico exemplicado por corrida de longa distncia, exerccio anaerbico por corrida de velocidade ou levantamento de peso. Durante exerccio anaerbico, existe pouca cooperao interrgos. Os vasos sangneos do interior dos msculos so comprimidos durante o pico de contrao, de modo que suas clulas cam isoladas do resto do corpo e dependem muito de seu prprio glicognio e fosfocreatina. Fosfocreatina uma fonte de fosfato de alta energia

BioQ.22 858

22.01.07 18:27:58

870

PARTE 5 PROCESSOS FISIOLGICOS

PARTE 5 PROCESSOS FISIOLGICOS


ACTH

1
R

AC

2
Protena G
ATP PKAi

cAMP PKA

BIOQUMICA DE HORMNIOS
Thomas J. Schmidt e Gerald Litwack
23.1 VISO GERAL, 871 23.2 HORMNIOS E O SISTEMA DE CASCATA HORMONAL, 872 Sistema de cascata amplica sinais especcos, 872 Principais hormnios polipeptdicos e suas aes, 874 Hormnios polipeptdicos e pituitria anterior, 874 23.3 SNTESE DE HORMNIOS POLIPEPTDICOS E HORMNIOS DERIVADOS DE AMINOCIDOS, 875 Hormnios polipeptdicos: codicao gnica, 875 Pr-opiomelanocortina precursor de oito hormnios, 875 Genes de hormnios polipeptdicos podem codicar peptdeos adicionais, 880 Um gene pode codicar mltiplas cpias de um hormnio, 881 Hormnios derivados de aminocidos, 882 Epinefrina sintetizada a partir de tirosina, 882 Sntese de hormnio da tireide requer incorporao de iodo em tirosinas da tireoglobulina, 883 Inativao e degradao de hormnios derivados de aminocidos, 883 23.4 PROTENAS DE SINALIZAO HORMONAL, 883 Viso geral da sinalizao, 883 Receptores de membrana, 883 Cascata de sinalizao intracelular: segundos mensageiros, 885 Sistemas hormonai s cclicos, 887 Sntese de melatonina e serotonina controlada por ciclos claro/escuro, 887 Ciclo ovariano controlado por secreo pulstil e cclica de hormnio liberador de gonadotropina, 888 Ausncia de fertilizao, 888 Fertilizao, 889 23.5 RECEPTORES DE HORMNIOS DE MEMBRANA, 891 Algumas interaes hormnio-receptor envolvem mltiplas subunidades hormonais, 891 Receptor -adrenrgico, 892 Internalizao de receptores, 893 Clatrina direciona internalizao de complexos hormnio-receptor da membrana plasmtica, 894 23.6 CASCATA HORMONAL INTRACELULAR: PROTENAS QUINASES, 894 Receptor de insulina: transduo por tirosina quinase, 895 Atividade de vasopressina: protena quinase A, 897 Hormnio liberador de gonadotropina (GnRH): protena quinase C, 898 Atividade do fator natriurtico atrial (ANF): protena quinase G, 900 23.7 HORMNIOS ESTERIDES, 902 Estruturas e funes de hormnios esterides, 902 Biossntese de hormnios esterides, 902 Metabolismo de hormnios esterides, 905 Regulao da sntese de hormnios esterides, 907

23

BioQ.23 870

22.01.07 18:32:35

CAPTULO 23 BIOQUMICA DE HORMNIOS

875

CORRELAO CLNICA 23.1

Testando a Atividade da Pituitria Anterior


Hormnios liberadores e anlogos qumicos, particularmente dos peptdeos menores, so hoje sintetizados rotineiramente. O hormnio liberador de gonadotropina, um decapeptdeo, est disponvel para uso na avaliao da funo da pituitria anterior. Isto de importncia quando uma situao de doena puder envolver o hipotlamo, a pituitria anterior ou o rgo nal. Esterilidade um exemplo de tal situao. O que precisa ser avaliado qual o rgo defeituoso na cascata hormonal. Isto pode ser conseguido por injeo do hormnio da pituitria anterior LH ou FSH. Se a secreo de hormnio sexual foi desencadeada, ento a glndula nal parece estar funcionando adequadamente. A seguir, a pituitria anterior deveria ser analisada. Isto pode ser feito por administrao i.v. de GnRH sinttico; por esta via, GnRH pode chegar s clulas gonadotrpicas da pituitria anterior e desencadear secreo de LH e FSH. Rotineiramente, os nveis de LH so medidos no sangue como uma funo do tempo aps a injeo. Estes nveis so medidos por radioimunoensaio (RIA), no qual LH ou hCG deslocado da ligao com uma protena de ligao ao LH na amostra de soro. A extenso da competio proporcional quantidade de LH no soro. Deste modo, uma progresso da resposta medida e estar dentro dos limites normais ou claramente decientes. Se a resposta for deciente, as clulas da pituitria anterior no esto funcionando normalmente e so a causa da sndrome. Por outro lado, resposta normal da pituitria a GnRH indicaria que o hipotlamo no est funcional. Tal descoberta sugeriria exame do hipotlamo, quanto a condies que levam disponibilidade/produo insuciente de hormnios liberadores. Obviamente, o conhecimento da estrutura do hormnio e a capacidade de sintetizar hormnios especcos permite o diagnstico destas doenas. Fonte: Marshall, J. C. e Barkan, A. L. Disorders of the hypothalamus and anterior pituitary. Em: W. N. Kelley (Ed.), Internal Medicine. New York: Lippincott, 1989, p. 2159. Conn, P. M. The molecular basis of gonadotropin-releasing hormone action. Endocr. Rev. 7: 3, 1986.

dia), prolactina (PRL), hormnio folculo-estimulante (FSH) e hormnio luteinizante (LH). Todos so cadeias polipeptdicas nicas, exceto TSH, FSH e LH, que so dmeros que compartilham uma subunidade semelhante ou idntica. Como o lbulo intermedirio no homem rudimentar, os nveis circulantes de e -MSH livres so relativamente baixos. de interesse, particularmente no homem, o fato dos receptores de MSH reconhecerem e serem ativados por ACTH, j que os 13 primeiros aminocidos do ACTH contm a seqncia do -MSH. Por esta razo, ACTH pode ser um fator contribuinte importante para a pigmentao da pele e pode exceder a importncia de MSH, especialmente em condies em que o nvel circulante de ACTH alto. As conseqncias clnicas do hipopituitarismo so apresentadas na Correlao Clnica 23.2.

23.3 SNTESE DE HORMNIOS POLIPEPTDICOS E HORMNIOS DERIVADOS DE AMINOCIDOS


Hormnios Polipeptdicos: Codicao Gnica
Genes de hormnios polipeptdicos contm a seqncia codicadora do hormnio e os elementos de controles a montante (upstream) do gene estrutural. Em alguns casos, mais de um hormnio codicado em um gene. Por exemplo, pr-opiomelanocortina gera pelo menos oito hormnios a partir de um nico produto gnico. Ocitocina e vasopressina so codicados por genes separados, juntamente com suas respectivas protenas neurosinas. Neurosinas so co-secretadas com seus respectivos hormnios, mas no tm ao endcrina conhecida.

Pr-opiomelanocortina Precursor de Oito Hormnios


Pr-opiomelanocortina um precursor de hormnios para os seguintes hormnios: ACTH, -lipotropina, -lipotropina, -MSH, -MSH, CLIP, -endorna e potencialmente -MSH e encefalinas (Figura 23.5). Nem todos estes produtos so expressos simultaneamente em um nico tipo celular, mas so produzidos em clulas separadas com base em seu contedo de proteases especcas necessrias, controles metablicos especcos e a presena de reguladores. Assim, enquanto pr-opiomelacortina expressa em corticotropos da pituitria anterior e em clulas da pars intermedia, o estmulo e os produtos so diferentes (Tabela 23.3). Pars intermedia uma estrutura anatmica discreta, localizada

BioQ.23 875

22.01.07 18:32:42

CAPTULO 23 BIOQUMICA DE HORMNIOS

897

tas seqncias de aminocidos em torno de um resduo de fosfotirosina. Vrias vias diferentes so ativadas, e estas incluem ativao de PI3 quinase (fosfatidilinositol 3-OH quinase), Ras (protena pequena que liga GTP), a cascata da MAP quinase (protena quinase ativada por mitose) e TC10 (protena pequena que liga GTP). Uma vez ativada por troca de GTP por GDP, TC10 promove translocao de vesculas de GLUT4 para a membrana plasmtica, talvez por estabilizao de lamentos de actina corticais. Estas vias atuam de modo orquestrado para coordenar a regulao do trfego de vesculas [incorporao de transportador 4 de glicose (GLUT4) membrana plasmtica], sntese de protenas, ativao e inativao de enzimas e expresso gnica. O resultado nal destas diversas vias regulao do metabolismo de glicose, lipdeos e protenas, bem como crescimento e diferenciao celular. A importncia da atividade da quinase do receptor de insulina e da via geral de transduo de sinal da insulina enfatizada na Correlao Clnica 23.3.

Atividade de Vasopressina: Protena Quinase A


Arginina angiotensina (AVP), ou hormnio antidiurtico, causa reabsoro de gua aumentada da urina no rim distal. Um mecanismo para este sistema apresentado na Figura 23.30. Neurnios que sintetizam AVP (neurnios vasopressinrgicos) liberam AVP em resposta a estmulos de barorreceptores que respondem a uma queda na presso do sangue ou de osmorreceptores que respondem a um aumento na concentrao extracelular de sal. VP liga-se a seu receptor de membrana cognato no rim distal, na pituitria anterior, em hepatcitos e, talvez, em outros tipos celulares, No rim, a ligao de AVP a seu receptor acoplado a protena G estimula a atividade de adenilato ciclase e ativa protena quinase A, que fosforila subunidades que se agregam para formar canais aquosos especcos, ou aquaporinas (ver p. 459). gua atravessa a clula do rim para o lado basolateral e depois entra na circulao geral, onde dilui a concentrao de sal. Mutaes especcas nas seqncias

CORRELAO CLNICA 23.3

Atividade Reduzida do Receptor de Insulina Quinase no Diabetes Mellitus Gestacional


Durante a gravidez, uma importante adaptao metablica materna uma reduo na sensibilidade insulina. Esta adaptao ajuda a fornecer glicose adequadamente para o feto em desenvolvimento. Entretanto, em 3-5% das mulheres grvidas, desenvolve-se intolerncia a glicose. Diabetes mellitus gestacional (GDM) caracterizada por um decrscimo adicional na sensibilidade a insulina e uma incapacidade de compensar com secreo aumentada de insulina. Embora ambos resistncia insulina induzida pela gravidez e GDM sejam geralmente reversveis aps a gravidez, aproximadamente 30-50% das mulheres com histria de GDM desenvolvem diabetes tipo 2 mais tarde na vida, especialmente se forem obesas. Embora os mecanismos celulares responsveis pela resistncia insulina em GDM no sejam totalmente conhecidos, a resistncia ao transporte de glicose mediado por insulina parece ser maior em msculo esqueltico de indivduos com GDM do que em mulheres grvidas que no tm GDM. Dados recentes indicam que defeitos na ao da insulina, e no diminuio na anidade da insulina pelo receptor, podem contribuir para a patognese de GDM. Mais especicamente, clulas de msculo esqueltico de sujeitos com GDM aparentemente expressam excesso de glicoprotena-1 de membrana plasmtica (PC-1), que se vericou inibir a atividade de tirosina quinase do receptor de insulina, por interagir diretamente com as subunidades e bloquear a mudana conformacional induzida por insulina. Alm disso, excessiva fosforilao de resduos de serina/treonina localizados nos receptores de insulina do msculo parece regular negativamente (downregulate) a atividade de tirosina quinase em GDM. Assim, uma superexpresso de PC-1 e um decrscimo na atividade quinase do receptor, acoplados com expresso e fosforilao (resduos de tirosina) diminudas do substrato 1 do receptor de insulina (IRS-1; ver Figura 20.29), podem estar por trs da resistncia insulina em GDM.

Fonte: Shao, J., Catalono, P. M., Hiroshi, Y., Ruyter, I., Smith, S., Youngreen, J. e Friedman, J. E. Decreased insulin receptor tyrosine kinase activity and plasma cell membrane glycoprotein-1 overexpression in skeletal muscle from obese women with gestational diabetes mellitus (GDM). Diabetes 49(4): 603, 2000. Maddux, B. A. e Goldne, I. D. Membrane glycoprotein PC-1 inhibition of insulin receptor function occurs via direct interaction with the receptor alpha-subunit. Diabetes 49(1): 13, 2000.

BioQ.23 897

22.01.07 18:33:26

914

PARTE 5 PROCESSOS FISIOLGICOS

Transporte de Hormnios Esterides: Protenas de Ligao


Quatro protenas plasmticas principais respondem pela ligao dos hormnios esterides no sangue. Elas so globulina de ligao a corticoesterides, protena de ligao a hormnios sexuais, protena de ligao a andrgenos e albumina. A maior parte do cortisol circulante (75-80%) ocorre ligado a uma 2 -globulina de ligao a corticosteride (CBG) especca, tambm conhecida como transcortina. Cada molcula desta glicoprotena liga uma nica molcula de cortisol, com Ka de 2,4 107 M-1. A concentrao normal de transcortina no plasma 3 mg/dl, e sua capacidade de ligao 20 g de cortisol/dl. Cerca de 15% do cortisol do plasma ocorre ligado a albumina, com uma anidade muito mais baixa (Ka = 103 M-1). Portanto, embora albumina esteja presente em concentrao 1.000 vezes superior de CBG, cortisol vai preencher primeiro os stios de ligao em CBG. A concentrao de transcortina, e portanto de cortisol, est aumentada durante a gravidez e administrao de estrgeno. Durante o estresse, quando os nveis de cortisol so altos, os stios de ligao de CBG estaro saturados, e o excesso de cortisol se ligar a albumina. Apenas 5-10% do cortisol plasmtico est normalmente livre (no-ligado). Cortisol livre difundese atravs da membrana plasmtica, liga-se aos receptores intracelulares de cortisol, e medeia uma resposta biolgica. Em contraste com cortisol, apenas 50-70% da aldosterona circulante ca ligada com baixa anidade a albumina e transcortina. Portanto, aldosterona tem uma meia-vida mais curta no plasma (20 minutos) em comparao com cortisol (70 minutos). Globulina de ligao a hormnios sexuais (SHBG) liga andrgenos com uma constante de anidade de cerca de 109 M-1. Cerca de 65% da testosterona so ligados a esta glicoprotena derivada do fgado. Apenas 1-2% da testosterona circulante est na forma livre, e o andrgeno restante est ligado a albumina e a outras protenas. As fraes ligadas a SHBG servem, portanto, como reservatrios circulantes de testosterona. Cerca de 60% dos estrgenos so transportados ligados a SHBG, 20% so ligados a albumina , e 20% na forma livre. Entretanto, estradiol liga-se a SHBG com uma anidade muito mais baixa do que testosterona. Assim, estradiol ligado a SHBG dissocia-se muito rapidamente e captado pelos tecidos alvos. Por esta razo, mudanas nos nveis de SHBG no homem podem alterar a razo de andrgenos para estrgenos livres. A concentrao plasmtica de SHBG antes da puberdade aproximadamente a mesma em homens e mulheres. Entretanto, na puberdade, h um pequeno decrscimo em mulheres e um decrscimo maior em homens, garantindo uma quantidade relativamente maior de testosterona circulante no-ligada em homens. Homens adultos tm cerca da metade da SHBG circulante de mulheres, de modo que testosterona livre cerca de 20 vezes mais alta em homens do que em mulheres. Alm

disso, a concentrao total (ligada mais no-ligada) de testosterona cerca de 40 vezes maior em homens. A prpria testosterona reduz os nveis de SHBG (aumenta a porcentagem de testosterona livre) no sangue, enquanto 17 -estradiol e hormnio da tireide elevam os nveis de SHBG no sangue. Durante a gravidez e no hipertireoidismo, as porcentagens de testosterona e de 17 -estradiol no-ligados estariam reduzidas. Protena de ligao a andrgeno (ABP) produzida pelas clulas de Sertoli em resposta a testosterona e FSH, que estimulam sntese de protenas nessas clulas. ABP tambm chamada globulina de ligao a testosterona-estrgeno ( TeBG). Esta protena semelhante a SHBG, exceto que se localiza no testculo e ajuda a manter nveis locais elevados de andrgeno no testculo e no lquido seminal. Estes nveis locais de andrgeno elevados so importantes no desenvolvimento e maturao dos espermatozides. Progesterona liga-se fracamente a transcortina e albumina, e sua meia-vida circulante apenas cerca de 5 minutos.

23.8 RECEPTORES DE HORMNIOS ESTERIDES


Hormnios Esterides Ligam-se a Protenas Receptores Intracelulares
Receptores de hormnios esterides e receptores de no-esterides (i. , hormnio da tireide, cido retinico, vitamina D3) localizam-se intracelularmente. O receptor de glucocorticide no-ligado e, possivelmente, o receptor de aldosterona parecem residir no citoplasma, enquanto os outros receptores no-ligados localizam-se dentro do ncleo, provavelmente em associao com a cromatina. Na Figura 23.48, a Etapa 1 mostra um hormnio esteride se dissociando de uma protena plasmtica transportadora. O esteride livre entra na clula por difuso, atravs da bicamada lipdica (Etapa 2). Cortisol liga-se a seu receptor com uma constante de anidade de 109 M-1, comparada a uma constante de anidade de cerca de 107 M-1 para CBG. O receptor no-ligado (neste caso, receptor de glucocorticide) um complexo (~300 kDa) que contm outras protenas associadas, incluindo um dmero de uma protena de choque trmico 90 kDa, que mascara o domnio de ligao ao DNA do receptor (Figura 23.49), e outra protena de choque trmico designada por Hsp56, que uma imunolina que liga vrias drogas imunossupressoras. Ligao do ligante esteride (Etapa 3) causa uma mudana conformacional, chamada ativao, da prpria protena do receptor, resultando em liberao das protenas associadas, incluindo o dmero Hsp90, e exposio dos resduos de aminocidos carregados positivamente localizados no domnio de ligao ao DNA (Etapa 4).

BioQ.23 914

22.01.07 18:34:18

CAPTULO 24 BIOLOGIA MOLECULAR DAS CLULAS

925

PARTE 5 PROCESSOS FISIOLGICOS


BIOLOGIA MOLECULAR DAS CLULAS


Thomas E. Smith
24.1 VISO GERAL, 926 24.2 TECIDO NERVOSO: METABOLISMO E FUNO, 926 ATP e potencial eltrico transmembrnico em neurnios, 928 Interao neurnio-neurnio ocorre por meio de sinapses, 929 Sntese, armazenamento e liberao de neurotransmissores, 930 Terminao de sinais em junes sinpticas, 934 Acetilcolina, 934 Catecolaminas, 935 5-Hidroxitriptamina (serotonina), 936 -Aminobutirato (GABA), 936 Neuropeptdeos so derivados de protenas precursoras, 937 24.3 OLHO: METABOLISMO E VISO, 938 Crnea deriva ATP de metabolismo aerbico, 938 Cristalino consiste principalmente de gua e protena, 939 Retina deriva ATP de gliclise anaerbica, 941 Transduo visual envolve eventos fotoqumicos, bioqumicos e eltricos, 941 Bastonetes e cones so clulas fotorreceptoras, 943 Viso de cores origina-se nos cones, 951 Viso de cores tricromtica, 951 Outras diferenas entre bastonetes e cones, 952 24.4 MOTORES MOLECULARES E PROTENAS ASSOCIADAS, 952 Contrao muscular, 953 Contrao do msculo esqueltico, 953 Organizao estrutural dos componentes do msculo esqueltico, 953 Estrutura e caracterizao de algumas protenas envolvidas nos processos contrteis, 956 Miosina forma lamentos grossos do msculo, 956 Actina, tropomiosina e troponina so protenas de lamentos nos, 957 Contrao muscular requer Ca 2+, 961 Reservatrios de energia para contrao muscular, 961 Modelo de contrao do msculo esqueltico: o golpe de fora, 963 Clcio Regula a Contrao do Msculo Liso, 963 Envolvimento de xido ntrico e monxido de carbono na contrao muscular, 964 Outras classes de miosinas e motores moleculares, 965 Miosinas no-convencionais e suas funes, 965 Cinesinas, 966 Dinena, 967 24.5 MECANISMO DA COAGULAO DO SANGUE, 967 Processos bioqumicos da hemostasia, 967 Fase pr-coagulante da hemostasia (fase 1), 969 Via extrnseca e incio da coagulao, 969 Formao de trombina, 970 Reaes da via intrnseca, 970 Algumas propriedades das protenas envolvidas na formao do cogulo, 971 Formao da rolha de plaquetas, 975 Fase anticoagulante da hemostasia (fase 2), 975 Inibio da via extrnseca, 975 Inativao de FVa e FVIIIa, 978

24

BioQ.24 925

22.01.07 19:35:10

938

PARTE 5 PROCESSOS FISIOLGICOS

TABELA 24.3
Peptdeo -Endorna Met-encefalina Leu-encefalina Somatostatina

Peptdeos Encontrados no Tecido Cerebrala


Estrutura YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE YGGFM YGGFL AGCKNFFW | | CSTFTK p-E H W S Y G L R P G NH2 p-E H P-NH2 R P K P E E F F G L M-NH2 p-E L Y E N K P R R P Y I L DRVYIHPFHL DRVYIHPF H S D A V F T D N Y T R L R K E M A V K K Y L N S I L N-NH2

Hormnio liberador de hormnio luteinizante Hormnio liberador de tirotropina Substncia P Neurotensina Angiotensina I Angiotensina II Peptdeo intestinal vasoativo
a

Peptdeos com p precedendo a estrutura indicam que o N-terminal piroglutamato. Aqueles com NH2 na extremidade indicam que o C-terminal uma amida.

Cinesinas e miosinas, protenas motores moleculares (ver p. 966), facilitam este processo de transporte. Neuropeptdeos so mediadores de respostas sensoriais e emocionais, tais como as associadas com fome, sede, sexo, prazer, dor e assim por diante. Includas nesta categoria esto encefalinas, endornas e substncia P. Substncia P um neurotransmissor excitatrio que desempenha um papel na percepo de dor. Est em uma classe de neuropeptdeos chamados neurocininas. Seu receptor, NK-1 (ou neurocinina-1), uma protena tipo-G consistindo de sete elementos de hlices transmembrnicas. Endornas e opiides ligam-se a receptores que tambm tm sete elementos de hlices transmembrnicas. Endornas desempenham papis na eliminao da sensao de dor. Alguns dos peptdeos encontrados no tecido cerebral so apresentados na Tabela 24.3. Note que Met-encefalina derivada da regio N-terminal da -endorna. Os aminocidos da extremidade N-terminal ou de ambas as extremidades N- e C-terminal de muitos neuropeptdeos transmissores so modicados.

24.3 OLHO: METABOLISMO E VISO


O olho, nossa janela para o mundo exterior, nos permite ver as belezas da natureza, as belezas da vida e, considerando o contedo deste livro, as belezas da bioqumica. Uma vista atravs de qualquer janela ou de qualquer lente de cmera mais clara quando no obstruda. O olho evoluiu de tal modo que um objetivo semelhante foi alcanado. composto de tecidos vivos que reque-

rem nutrio contnua obtida pelo uso de metablicas convencionais apropriadas a suas necessidades especcas. Estruturas pigmentadas, como citocromos e mitocndrias, ou no esto presentes em algumas estruturas ou esto arranjadas e distribudas de modo a no interferirem com o processo visual. Alm disso, o crebro desenvolveu um sistema de ltro enormemente eciente que torna objetos dentro do olho invisveis, os quais poderiam levar a distoro visual. Um diagrama esquemtico de um corte transversal do olho apresentado na Figura 24.16. A luz que entra no olho passa progressivamente por (a) a crnea, a cmara anterior que contm humor aquoso, (b) o cristalino, e (c) o corpo vtreo, que contm humor vtreo; nalmente focaliza na retina, que contm o aparelho sensor visual. Lgrimas banham o exterior da crnea, enquanto o interior banhado pelo humor aquoso, um uido isosmtico contendo sais, albumina, globulina, glicose e outros constituintes. O humor aquoso traz nutrientes para a crnea e para o cristalino, e remove produtos nais do metabolismo deles. O humor vtreo uma massa gelatinosa que ajuda a manter a forma do olho, enquanto o mantm um tanto exvel.

Crnea Deriva ATP de Metabolismo Aerbico


O olho uma extenso do sistema nervoso e, como outros tecidos do sistema nervoso central, seu principal combustvel metablico glicose. A crnea no um tecido homogneo e obtm uma porcentagem relativamente alta do seu ATP de metabolismo aerbico. Cer-

BioQ.24 938

22.01.07 19:35:53

956

PARTE 5 PROCESSOS FISIOLGICOS

Estrutura e Caracterizao de Algumas Protenas Envolvidas nos Processos Contrteis


Miosina Forma Filamentos Grossos do Msculo
Miosina, uma molcula brosa longa com duas cabeas globulares em uma extremidade, consiste de duas cadeias pesadas de cerca de 230 kDa cada. Ligada perto de cada grupo de cabea est um par no-semelhante de cadeias leves, cada uma das quais com aproximadamente 20 kDa. As cadeias leves so protenas tipocalmodulina e esto envolvidas em vrios aspectos da regulao do processo, sendo que nem todos foram denidos com clareza. Elas ligam motivos IQ em miosinas, que esto localizados prximos dos grupos de cabea e tm a seqncia consenso IQXXXRGXXXR. A extremidade carboxila de cada cadeia de miosina localiza-se na regio da cauda, onde as duas cadeias pesadas so enroladas uma na outra, num arranjo espiral-espiral (Figura 24.29 m). Tripsina cliva a cauda em cerca de um tero do seu comprimento a partir da cabea para produzir meromiosina pesada (o grupo da cabea e uma cauda curta) e meromiosina leve (o restante da regio da cauda). S a meromiosina leve pode agregar em condies siolgicas in vitro, sugerindo que agregao seja um dos seus papis na formao da cadeia pesada in vivo. A regio da cabea pode ser clivada do restante da regio de cauda por papana (Figura 24.29 n), resultando em um fragmento do grupo de cabea chamado Subfragmento 1 ou S-1. A ao destas proteases tambm demonstra que a molcula tem pelo menos duas regies de articulao, perto da juno cabea-cauda. Anlise de cDNAs de miosinas de muitas espcies diferentes e tipos diferentes de msculos indicam que existe um grau muito alto de homologia entre miosinas de diferentes fontes, particularmente na regio da cabea. Existe um pouco menos de homologia de seqncia na regio da cauda, mas homologia funcional existe em um grau extraordinariamente alto, independentemente do comprimento, que vai de cerca de 86 a cerca de 150 nm para espcies diferentes. A cabea da miosina contm quase metade (cerca de 839 a cerca de 850) dos resduos de aminocidos da molcula inteira, em mamferos (ver Corr. Cln. 24.7). Miosina forma um agregado simtrico cauda-cauda em torno da linha M da zona H dos sarcmeros. Regies de cauda so alinhadas de modo paralelo em ambos os lados da linha M, com os grupos de cabea apontando para a linha Z. Cada lamento grosso contm cerca de 400 molculas de miosina. A protena C (Tabela 24.7) est envolvida em sua montagem. A protena M tambm est envolvida, presumivelmente, na manuteno das regies de cauda juntas e em sua ancoragem na linha M.

CORRELAO CLNICA 24.7

Glicao e Estrutura e Funo de Miosina


Hiperglicemia prolongada afeta a funo de muitos sistemas. Glicose pode formar bases de Schiff com amino grupos livres em protenas e alterar sua funo. Experimentos in vitro usando espectroscopia de massa demonstram que miosina tambm poderia ser glicada. A importncia desta observao em envelhecimento e diabetes ainda no foi determinada. Fonte: Ramamurthy, B., Hook, P., Jones, A. D. e Larsson, L. Changes in myosin structure and function in response to glycation. FASEB J. 15:2415, 2001. A cabea da miosina contm atividade de ATPase, que fornece energia para contrao, e stios de ligao de actina. O fragmento S-1 tambm contm stios de ligao para a cadeia leve essencial e a cadeia leve regulatria que se liga nos motivos IQ, como mencionado anteriormente. Um modelo da estrutura tridimensional do fragmento S-1 da miosina apresentado na Figura 24.31. A regio de ligao actina localiza-se no canto inferior direito, na regio da fenda visvel. O fragmento S-1 tem vrias regies estruturais tipodomnio com massas de 25, 50 e 20 kDa, coloridos em verde, vermelho e azul, respectivamente. A cadeia leve essencial (ELC) e a cadeia leve regulatria (RLC) so mostradas em amarelo e lils, respectivamente (ver Corr. Cln. 24.8). O stio de ligao ao ATP, logo acima da fenda visvel, tambm uma fenda aberta de cerca de 13 de profundidade e 13 de largura. separada do stio de ligao

FIGURA 24.31 Um modelo de preenchimento de espao dos resduos de aminocidos no fragmento S-1 da miosina. Os domnios de 25, 50 e 20 kDa da cadeia pesada so cinzaescuro, cinza e cinza quase preto, respectivamente. As cadeias leves essencial e regulatria so cinza-claro e cinza-mdio, respectivamente. Reimpresso com permisso de Rayment, I., Rypniewski, W. R., Schmidt-Base, K., Smith, R., et al. Science 261:50, 1993. Direitos autorais (1993) AAAS.

BioQ.24 956

22.01.07 19:36:31

CAPTULO 24 BIOLOGIA MOLECULAR DAS CLULAS

967

Cinesina-13 tambm uma cinesina cromossmica e est provavelmente envolvida no movimento mittico dos cromossomos. Cinesina-14 est entre os motores de extremidademenos como a cinesina mittica Ncd em Drosophila, que funciona nos estgios iniciais da mitose. Localizase nos fusos de ocitos. Cinesinas-1 e -2 esto mais relacionadas com o material discutido neste captulo, embora as outras estejam associadas com aspectos mais gerais da diviso celular e do movimento associado de vrios componentes associados com este processo.

(+)

Microtbulo () 5 4 3 1 2

Golpe de fora (sem carga) ADP + Pi

ATP

Carga

ATP or ADP 2

A A ATP

Dinena
Existem duas classes de motores dinenas: (a) axonmica, que funciona na realizao do movimento de agelos e clios, e (b) citoplasmtica, que efetua a distribuio e a organizao de estruturas citoplasmticas. Estas funes incluem seleo e movimento de protenas; organizao dos cromossomos durante vrios estgios de sua funo; distribuio e/ou redistribuio de organelas como endossomos, lisossomos e outros; e transporte axonal retrgrado isto , transporte de carga na direo oposta da maioria das cinesinas. A estrutura da dinena muito mais complexa do que as das outras duas classes de motores. Dinena tem uma estrutura em anel plano de seis membros que tem, no total, aproximadamente 10 vezes a massa molecular das cinesinas. Uma representao esquemtica de sua estrutura mostrada na Figura 24.39. ATP liga com um motivo AAA no domnio 1. Sua ligao e hidrlise induz mudanas conformacionais que so transmitidas pelos domnios 2-4 para a haste que interage com microtbulos e causa movimentos de passos de 24-32 nm para uma dinena descarregada. O movimento de dinena responde carga de modo parecido com mudana para marcha mais lenta e, com carga pesada, d passos de aproximadamente 8 nm. Essa mudana parece estar associada com mudanas conformacionais em vrios de seus outros domnios e com a disponibilidade de ATP. Em condies de carga pesada, ATP tambm parece ligar motivos AAA no domnio 3. Motivos AAA so regies conservadas de 220-230 resduos de aminocidos que existem em uma famlia de protenas que participam em vrias atividades celulares diferentes, que dependem de energia de hidrlise de ATP para afetar suas funes, que podem incluir protelise, dobramento e desdobramento de protenas, metabolismo de on de metal, e outras atividades, alm das associadas com dinena. O nome do motivo AAA refere-se a ATPase Associada com diversas Atividades celulares. Note que (1) dinenas como motores so estruturalmente mais complexas do que miosinas ou cinesinas, (2) esto geralmente envolvidas em movimento retrgrado de material celular, (3) esto envolvidas em vrios outros aspectos de organizao estrutural, e (4) seu movimento de passo ao longo dos microtbulos carga-dependente.

Golpe de fora (sob carga) ADP + Pi

FIGURA 24.39 Dinena funciona como uma molcula motora. Redesenhado de Mallik, R., Carter, B. C., Lex, S. A., King, S. J. e Gross, S. P. Cytoplasmic dynein functions as a gear in response to load. Nature 427:649, 2004.

24.5 MECANISMO DA COAGULAO DO SANGUE


A circulao do sangue ocorre em um tipo muito especializado de sistema fechado no qual o volume do lquido circulante mantido quase constante. Mltiplas funes do sistema tornam a transferncia de solutos atravs de seus limites uma funo necessria. Como em qualquer sistema de canos e tubos, vazamentos podem ocorrer como resultado de vrios tipos de agresses e devem ser reparados para manter um estado de hemostasia, isto , sem sangramento.

Processos Bioqumicos da Hemostasia


Hemostasia implica em que o processo de formao do cogulo ( pr-coagulao, designada como Fase 1) esteja em equilbrio com processos de parada de formao do cogulo (anticoagulao, Fase 2) e de dissoluo do cogulo (brinlise, Fase 3). Pr-coagulao leva produo de brina a partir de brinognio e agregao em uma rede insolvel, ou cogulo, que recobre a rea da ruptura e impede maior perda de sangue. Concomitantemente, agregao de plaquetas do sangue ocorre no local da leso. Agregao plaquetria forma uma rolha fsica para ajudar a parar o vazamento. Plaquetas tambm sofrem alteraes morfolgicas que liberam (a) alguns compostos qumicos que ajudam em outros aspectos do processo todo, como vasoconstrio para reduzir o uxo de sangue para a rea e (b) enzi-

BioQ.24 967

22.01.07 19:37:01

CAPTULO 25 CICLO CELULAR, MORTE CELULAR PROGRAMADA E CNCER

987

PARTE 5 PROCESSOS FISIOLGICOS


(Separao de cromtides e diviso celular) M G2 G1 G0

S (Duplicao do DNA)

CICLO CELULAR, MORTE CELULAR PROGRAMADA E CNCER


Richard M. Schultz
25.1 VISO GERAL, 988 25.2 CICLO CELULAR, 988 Regulao do ciclo celular, 989 Regulao de Rb, 990 Regulao de p53, 991 Transduo de sinal de fator de crescimento, 991 25.3 APOPTOSE: MORTE CELULAR PROGRAMADA, 993 Principais vias, 994 Via do receptor de morte, 994 Vias mitocondriais, 995 Apoptose induzida por p53, 996 Regulao de apoptose por MAPK, 996 25.4 CNCER, 997 Oncogenes e genes supressores de tumor, 997 Propriedades de clulas de cncer, 998 Imortalidade das clulas de cncer, 999 Metstase de clulas de cncer, 999 Angiognese induzida por clulas de cncer, 1000 Mltiplas mutaes so necessrias para formar um cncer, 1001 Heterogeneidade gentica e bioqumica de cnceres, 1001 Agentes mutagnicos e promotores causam cncer, 1004 Anlise bioqumica de cnceres, 1004 BIBLIOGRAFIA, 1005 QUESTES E RESPOSTAS, 1007 CORRELAES CLNICAS 25.1 Vrus Oncognicos de DNA, 999 25.2 Droga Anti-Cncer Molecularmente Dirigida, 1002 25.3 Causa Ambiental de Cnceres Humanos, 1003

25

BioQ.25 987

22.01.07 18:41:43

CAPTULO 25 CICLO CELULAR, MORTE CELULAR PROGRAMADA E CNCER

993

te um sinal por meio de uma mudana conformacional e associaes protena-protena. Grb2 contm ambos os domnios SH2 e SH3. Ligao de Grb2 ao receptor de PDGF por seu domnio SH2 induz uma mudana conformacional que abre seus domnios SH3 para ligar uma regio de hlice poliprolina na protena GEF Ras, que depois se liga a Ras e catalisa a troca de seu GDP ligado por GTP (Figura 25.8). GPT-Ras a forma ativa de Ras. Ras uma enzima GTPase e se inativa por catalisar a hidrlise do GTP ligado em GDP. Mutaes no gene Ras que resultam em Ras constitutivamente ativo ocorrem em aproximadamente 30% dos cnceres humanos. As mutaes comumente encontradas so nos resduos de aminocidos 12, 13 e 61, que participam da atividade de Ras GTPase, de modo que Ras mutado no pode se desativar e permanece em uma conformao GTP-Ras ativa. No Ras normal, a atividade de Ras GTPase aumentada 100 a 1000 vezes pela ligao de Ras a GAPRas (GAP, protena ativadora de GTPase). Entretanto, a ligao de GAPRas ao Ras mutado cataliticamente inerte no tem efeito, porque sua atividade de GTPase est ausente. Ras tambm precisa se associar com a membrana plasmtica para ser ativado. Isto conseguido por modicaes ps-traduo que incluem remoo por uma protease do tetrapeptdeo C-terminal, metilao do novo grupo cido carboxlico C-terminal e adio de um grupo cido graxo farnesil a uma cadeia lateral de cistena na extremidade COOH-terminal. Em algumas isoformas de Ras, um segundo grupo acil graxo adicionado, perto da extremidade COOH-terminal. Trs genes Ras diferentes existem no homem Hras, N- ras e K- ras que produzem protenas homlogas de 21 kDa. As seqncias de aminocidos de seus primeiros 85 resduos so idnticas, e os seguintes 80 resduos mostram 85% de homologia, mas as extremidades C-terminais diferem mais dramaticamente. Embora existam diferenas em alguns dos sinais posteriores entre as isoformas de Ras, em geral seus sinais se sobrepem. Estas isoformas so caracteristicamente expressas em diferentes tipos celulares, e mutaes nos resduos 12, 13 e 61 ativam constitutivamente todas elas. Como ativao da atividade de Ras promove o fentipo cncer, genes Ras so conhecidos como protooncogenes. Proto-oncogenes so transformados em oncogenes por uma mutao ativadora que promove ou mantm uma clula cancerosa. O oncogene ras d continuamente um sinal de fator de crescimento que promove diviso celular, em ausncia de ativao anterior. GTP-Ras transmite seu sinal de diviso celular por ativao de MAP quinase quinase quinase (MAPKKK) (Figura 25.9). MAPKKK inicia uma cascata de quinases que inclui MAPKK e MAPK. MAPK ativada (fosforilada) se desloca para o ncleo, onde fosforila e ativa


FIGURA 25.9 GTP-Ras ativa uma cascata de quinases. Ras-GTP ativa uma cascata de quinases resultando na fosforilao e ativao da quinase terminal MAPK. MAPK ativada entra no ncleo e fosforila fatores de transcrio que regulam a expresso de protenas envolvidas na fase S. MAPK mitgeno-ativada protena quinase, MAPKK MAP quinase quinase, e MAPKKK MAP quinase quinase quinase.

fatores de transcrio, como Jun e Fos, aumentando assim a transcrio de genes como o fator de transcrio Myc e as ciclinas de G1 envolvidas na diviso celular. Myc aumenta a expresso de muitos genes envolvidos na fase S, incluindo as S-ciclinas e o fator de transcrio E2F (ver p. 211). Entretanto, se as condies no forem adequadas para diviso celular, Myc pode iniciar um processo levando morte celular.

25.3 APOPTOSE: MORTE CELULAR PROGRAMADA


Apoptose a palavra grega para folhas que caem, e apoptose descreve um processo bioqumico freqente natural de morte celular. Morte apopttica necessria durante processos de desenvolvimento, bem como para manter a homeostase de um organismo inteiro. medida que novas clulas so geradas no homem, morte de um nmero semelhante de clulas necessria na mesma escala de tempo para manter um estado estacionrio. Morte apopttica difere da morte celular necrtica. Na ltima, lise de uma membrana celular leva liberao dos contedos celulares no espao extracelular e a uma resposta inamatria, como freqentemente acontece em infeces bacterianas ou virais e em trauma. Em contraste, apoptose freqentemente

BioQ.25 993

22.01.07 18:42:05

CAPTULO 25 CICLO CELULAR, MORTE CELULAR PROGRAMADA E CNCER

997

quinases ativadas por Ras transmitem sinais opostos de vida e morte, e o resultado depende do contexto celular e do tipo de clula.

25.4 | CNCER
Oncogenes e Genes Supressores de Tumor
O ciclo celular e a apoptose so crticos para um entendimento do cncer. Genes que codicam protenas que promovem diviso celular ou que promovem resistncia a apoptose so proto-oncogenes (Tabela 25.2). Suas mutaes ativadoras ou super-expresso resultam em atividade aumentada, o que leva a diviso celular desregulada ou resistncia a apoptose. Mutaes em um proto-oncogene podem convert-lo em um oncogene. Duas cpias (ou alelos) de cada gene autossmico (i., aqueles em cromossomos que no os cromossomos X e Y) esto presentes no genoma de toda clula somtica [cada clula somtica tem um alelo derivado da me e outro do pai para cada gene autossmico]. Uma mutao ativadora em um nico alelo de um proto-oncogene suciente para causar um efeito pr-proliferativo ou anti-apopttico em uma clula. Tais mutaes so portanto autossmicas dominantes para progresso do cncer. Proto-oncogenes, cujos produtos promovem diviso celular ou resistncia a apoptose incluem genes de fatores de crescimento, receptores de fatores de crescimento, molculas adaptadoras tipo-Grb, tirosina quinases tipo-Src, quinases das cascatas MAPK, Cdks, ciclinas, CAKs, Cdc25, e fatores de transcrio (como Jun, Fos, Myc e E2F) que aumentam a expresso de

FIGURA 25.14 Mltiplas vias podem ser reguladas por Ras. MAPKKK so MAPK quinase quinases. MAPKs, aps ativao por uma MAPKK, podem se deslocar para o ncleo para fosforilar fatores de transcrio. As quinases tambm podem fosforilar protenas outras, alm dos fatores de transcrio. Alvos alternativos para as quinases incluem protenas tipo-Bcl-2 e p53.

sobrevivncia. Os resultados dos sinais so dependentes do tipo celular. Em algumas circunstncias, JNK promove morte por fosforilao de Bcl-2 para promover sua dissociao da membrana mitocondrial (Figura 25.15), o que aumenta as concentraes mitocondriais de Bak e Bax livres e promove morte celular. JNK tambm pode fosforilar p53, tornando-a mais resistente a Mdm-2, resultando em um aumento na concentrao de p53 e morte celular. Tambm a MAPK ERK, a MAPKKK Raf, e a quinase Akt promovem sobrevivncia celular por fosforilao da protena facilitadora pr-apopttica Bad ou por ativao da expresso dos genes anti-apoptticos tipo-Bcl-2 (Figura 25.15). Portanto, diferentes

FIGURA 25.15 Interao de quinases ativadas por Ras com protenas que regulam apoptose. S, sobrevive (via promove sobrevivncia celular); D, morre ( die ) (via promove morte celular apopttica). ERK, JNK, Raf e Akt so quinases Pi3K, 1-fosfatidilinositol-3 quinase.

BioQ.25 997

22.01.07 18:42:10

CAPTULO 25 CICLO CELULAR, MORTE CELULAR PROGRAMADA E CNCER

1003

CORRELAO CLNICA 25.3

Causa Ambiental de Cnceres Humanos


Fatores ambientais e culturais so as causas predominantes do cncer humano. Se estes fatores puderem ser regulados, a incidncia de cncer pode ser reduzida em mais de 75%. Fumar cigarros responsvel por aproximadamente 30% das mortes por cncer nos EUA Alm disso, estima-se que dieta pode prevenir o desenvolvimento de aproximadamente 30% dos cnceres nos EUA (estimativas variam entre 10 e 70%). Estes nmeros so baseados primariamente em dados epidemiolgicos da incidncia de tipos de cncer em diferentes localizaes geogrcas, culturas e ambientes (ver tabela anexa). Na migrao de uma cultura ou localizao para outra, a incidncia de um tipo de cncer freqentemente se aproxima da populao na nova cultura, medida que os indivduos ou seus descendentes assimilam. Tambm rpidas mudanas de dieta ou estilo de vida ao longo do tempo em um pas mostram a importncia destes fatores na incidncia de cncer. A quarta parte da populao americana que tem maior quantidade de frutas e vegetais na dieta tem uma incidncia 30-40% menor de muitos tipos de cncer. Entretanto, os constituintes destes alimentos que inibem a formao do cncer no foram determinados. Nveis inadequados de cido flico na dieta americana foram implicados como um fator de risco para cnceres de clon e de mama. A ingesto de cido flico pode ser particularmente crtica em indivduos com um polimorsmo em seu gene da metilenotetra-hidrofolato redutase, uma enzima envolvida no metabolismo de cido flico, que resulta em atividade diminuda. Decincia de folato causa incorporao excessiva de uracil no DNA e quebras cromossmicas. Decincia de folato comum em alcolatras e pode ser a razo para um aumento na incidncia de certos cnceres com lcool. A dieta e o estilo de vida de pr-adolescentes afetam o incio da menarca, e incio precoce de menarca e extenso do perodo de tempo entre menarca e menopausa esto associados com risco aumentado de cncer de mama em mulheres. Obesidade correlaciona-se inversamente com risco de cncer de mama em mulheres pr-menopausa, e correlaciona-se positivamente na ps-menopausa. Muita gordura animal na dieta foi associada com risco aumentado de cncer de clon, mas os dados so inconsistentes. Ao contrrio da gordura animal total na dieta, os dados podem sugerir que a razo entre gordura poliinsaturada e saturada que se correlaciona com risco de cncer clon-retal. A incidncia de cncer de clon tambm tem sido inversamente correlacionada com falta de atividade ou exerccio. Estudos ambientais e dietticos so difceis, uma vez que grandes populaes devem ser estudadas ao longo do tempo de uma gerao, e mltiplas variveis devem ser controladas. Entretanto, avanos no nosso conhecimento e controle destes fatores podem ter enormes efeitos na diminuio da incidncia de cncer.

Variao na Incidncia de Tipo de Cncer em uma Comparao de Dois Locais


Comparao de Localizao Pulmo Mama Prstata Colo uterino Fgado Clon Melanoma New Orleans (negros) Madras (ndia) Hawaii (havaianos) Israel (no-judeus) Atlanta (negros) - China (Tianjin) Brasil (Recife) Israel (no-judeus) China (Xangai) Canad (Nova Esccia) Estados Unidos (Connecticut, brancos) ndia (Madras) Austrlia (Queensland) Japo (Osaka) Incidncia na Localizao 1 110 94 91 83 34 34 31 Incidncia na Localizao 2 5,8 14 1,3 3,0 0,7 1,8 0,2 Diferena em Vezes a Incidncia 19 7 70 18 49 19 155

* Incidncia em nmero de novos casos por ano por 100.000 pessoas, ajustado para variao de idade com a populao especca. Dados retirados de Alberts, B., Johnson, A.,. Lewis, J., Raff, M., Roberts, K., e Watson, J. D. Molecular Biology of the Cell, 4th ed. New York: Garland, 2002, Tabela 24-2, que foi adaptada de DeVita, V. T., Hellman, S., e Rosenberg, S. A. (Eds.). Cancer: Principles and Practice of Oncology, 4th ed. Philadelphia: Lippincott, 1993; baseado em dados de C. Muir et al. Cancer Incidence in Five Continents, Vol. 5, Lyon: International Agency for Research on Cancer, 1987. Referncias Gerais: Shibuya, K., Mathers, C. D., Boschi-Pinto, C., Lopez, A. D., e Murray, C. J. L. Global and regional estimates of cancer mortality and incidence by site: II. Results for the global burden of disease 2000. BMC Cancer 2:37, 2002. Pisani, P., Parkin, D. M., Bray, F. e Ferlay, J. Estimates of the worldwide mortality from 25 cancers in 1990. Int. J. Cancer 93:18, 1999.

(continua na pgina seguinte)

BioQ.25 1003

22.01.07 18:42:17

CAPTULO 26 DIGESTO E ABSORO DE CONSTITUINTES NUTRICIONAIS BSICOS

1009

PARTE 5 PROCESSOS FISIOLGICOS


2Na+

Galactose
SGLT1

Glicose Frutose
GLUT5

DIGESTO E ABSORO DE CONSTITUINTES NUTRICIONAIS BSICOS


Ulrich Hopfer
26.1 VISO GERAL, 1010 Vrios rgos gastrointestinais contribuem para a digesto de alimentos, 1010 26.2 CONSIDERAES GERAIS, 1012 Diferentes locais de digesto intestinal, 1012 Enzimas digestivas so secretadas como pr-enzimas, 1013 Secreo regulada por muitos secretagogos, 1014 26.3 TRANSPORTE EPITELIAL, 1016 Transporte de solutos pode ser transcelular ou paracelular, 1016 Absoro de NaCl tem componentes ativos e passivos, 1017 Secreo de NaCl depende da ATPase trocadora de Na+/K+ contraluminal, 1019 Gradientes de concentrao ou potenciais eltricos dirigem transporte de nutrientes, 1021 Clulas gstricas parietais secretam HCl, 1023 26.4 DIGESTO E ABSORO DE PROTENAS, 1024 Peptidases garantem digesto eciente de protenas, 1024 Pepsinas catalisam digesto gstrica de protenas, 1024 Zimognios pancreticos so ativados no intestino delgado, 1024 Peptidases da borda em escova e citoplasmticas digerem peptdeos pequenos, 1025 Transportadores de aminocidos e di e tripeptdeos, 1026 26.5 DIGESTO E ABSORO DE CARBOIDRATOS, 1028 Dissacardeos e polissacardeos requerem hidrlise, 1028 Transportadores de monossacardeos, 1030 26.6 DIGESTO E ABSORO DE LIPDEOS, 1031 Digesto de lipdeos requer vencer sua solubilidade limitada em gua, 1031 Lipdeos so digeridos por lipases gstrica e pancretica, 1031 Micelas de cidos biliares solubilizam lipdeos durante a digesto, 1032 A maior parte dos lipdeos absorvidos incorporada a quilomcrons, 1037 26.7 METABOLISMO DE CIDOS BILIARES, 1037 Qumica e sntese de cidos biliares, 1037 Transporte de cidos biliares, 1038 BIBLIOGRAFIA, 1040 QUESTES E RESPOSTAS, 1040 CORRELAES CLNICAS 26.1 Cloridorria Familiar Causa Alcalose Metablica, 1017 26.2 Fibrose Cstica, 1020 26.3 Diarrias Toxignicas Bacterianas e Terapia de Reposio de Eletrlitos, 1021 26.4 Aminoacidria Neutra: Doena de Hartnup, 1026 26.5 Decincia de Dissacaridases, 1030 26.6 Intervenes Farmacolgicas para Evitar Absoro de Gordura e Obesidade, 1033 26.7 Clculos de Colesterol, 1036 26.8 A- -Lipoproteinemia, 1038

26

BioQ.26 1009

22.01.07 18:43:16

1012

PARTE 5 PROCESSOS FISIOLGICOS

funes, o trato gastrointestinal contm glndulas especializadas e superfcies epiteliais:


rgo Glndulas salivares Estmago Pncreas Fgado Vescula biliar Intestino delgado Intestino grosso Funo Principal em Digesto e Absoro Elaborao de uido e enzimas digestivas Elaborao de HCl e enzimas digestivas Elaborao de NaHCO3 e enzimas para a digesto intraluminal Elaborao dos cidos biliares Armazenamento e concentrao da bile Digesto terminal dos alimentos, absoro de nutrientes e eletrlitos Absoro de eletrlitos

O pncreas e o intestino delgado so essenciais para digesto e absoro de todos os nutrientes bsicos. Felizmente, ambos os rgos tm grandes capacidades de reserva. Assim, m digesto devido a insucincia pancretica torna-se um problema clnico s quando a taxa de secreo pancretica de enzimas digestivas cai abaixo de um dcimo da taxa normal. Secreo de bile pelo fgado importante para digesto e absoro ecientes de lipdeos, que dependem de cidos biliares. Em contraste, a digesto gstrica de alimentos noessencial para nutrio adequada, e perda desta funo pode ser compensada pelo pncreas e pelo intestino delgado. No entanto, digesto gstrica normal aumenta muito a facilidade e a ecincia do processo digestivo total. O estmago ajuda a digesto por sua funo de reservatrio, sua capacidade de misturar, e pelo incio da hidrlise de protenas e lipdeos que, embora pequena, importante para estimular a secreo pancretica e biliar. Peptdeos, aminocidos e cidos graxos liberados no estmago estimulam a liberao coordenada do suco pancretico e da bile no lmen do intestino delgado, assegurando assim digesto eciente dos alimentos.

gam a 30 g de protenas por dia, pelo menos, em um adulto saudvel. Enzimas pancreticas, juntamente com a bile, so derramadas no lmen da segunda parte (descendente) do duodeno, de modo que a maior parte da digesto intraluminal ocorre na poro distal, em relao a este ponto. Entretanto, mesmo aps exaustivo contato com enzimas gstricas e pancreticas, uma parte substancial dos carboidratos e aminocidos permanece como dmeros e oligmeros, e depende, para continuar a quebra, de enzimas digestivas das clulas epiteliais intestinais (entercitos). A membrana plasmtica luminal dos entercitos aumentada por uma matriz organizada de projees, chamadas microvilosidades, o que lhe confere a aparncia de uma escova e que levou ao nome borda em escova. Esta borda em escova fornece uma grande rea, que coberta em sua superfcie mais externa por muitas di- e oligossacaridases, amino- e dipeptidases, e esterases (Tabela 26.2). Muitas destas enzimas projetam-se a at 100 em direo ao lmen, ligadas membrana plasmtica por um polipeptdeo de ancoragem. Este arranjo permite eciente digesto na superfcie, gerando molculas nutrientes que podem ser absorvidas pelos entercitos. Uma questo interessante como as enzimas de superfcie, que so elas prprias protenas, escapam da digesto por proteases solveis. Parece que sua grande glicosilao confere alguma proteo, impedindo o acesso de proteases a ligaes peptdicas relevantes. TABELA 26.2 Enzimas Digestivas da Superfcie do Intestino Delgado
Enzima (Nome Comum) Maltase Sacarase/isomaltase Glucoamilase Trealase -Glucosidase Lactase Endopeptidase Substrato Maltose Sacarose/dextrina -limite Amilose Trealose Glucosilceramida Lactose Protena (clivagem de aminocidos hidrofbicos internos) Oligopeptdeo com NH2 terminal acdico Oligopeptdeo com NH2 terminal neutro Oligopeptdeo com X-Pro ou X-Ala na extremidade NH2 terminal Peptdeos com aminocido neutro na extremidade NH2 terminal Glutationa + aminocido Tripsinognio Fosfatos orgnicos

26.2 CONSIDERAES GERAIS


Diferentes Locais de Digesto Intestinal
As primeiras etapas da quebra dos alimentos so catalisadas por enzimas solveis e ocorrem dentro do lmen do estmago e do intestino delgado. Enzimas digestivas so secretadas pelas glndulas salivares, estmago e pncreas, sendo que o pncreas faz as contribuies maiores e mais importantes. Enzimas secretadas che-

Aminopeptidase A Aminopeptidase N Dipeptidil aminopeptidase IV Leucina aminopeptidase

-Glutamiltransferase Enteropeptidase (enteroquinase) Fosfatase alcalina

BioQ.26 1012

22.01.07 18:43:19

1026

PARTE 5 PROCESSOS FISIOLGICOS

duz aminocidos livres e di e tripeptdeos, que so absorvidos por sistemas transportadores especcos de aminocidos e peptdeos, respectivamente. Di e tripeptdeos transportados so geralmente hidrolisados dentro da clula epitelial intestinal, antes de sarem da clula. Isto explica por que praticamente s aminocidos livres so encontrados no sangue portal aps uma refeio. A ausncia virtual de peptdeos era tida como evidncia de que a digesto luminal de protenas prosseguia at aminocidos livres antes de ocorrer absoro. Entretanto, agora est estabelecido que uma grande parte do nitrognio amino da dieta absorvida na forma de pequenos peptdeos, com subseqente hidrlise intracelular. Excees so di e tripeptdeos contendo prolina, hidroxiprolina ou aminocidos incomuns, como -alanina na carnosina ( -alanil-histidina) ou anserina ( -alanil-1-metil-histidina). Estes peptdeos so absorvidos e liberados intactos no sangue portal, Embora incomum, -alanina parte da dieta, porque est presente, por exemplo, em carne de frango.

CORRELAO CLNICA 26.4

Aminoacidria Neutra: Doena de Hartnup


Doena de Hartnup um defeito gentico no transportador Na+ -acoplado que normalmente medeia absoro de aminocidos neutros do lmen do intestino delgado e dos tbulos proximais. Foi assim denominada pela famlia na qual a anomalia foi identicada pela primeira vez, e o homlogo em camundongo foi recentemente clonado (famlia gnica SLC6). No rim, a incapacidade de reabsorver aminocidos neutros do ultraltrado leva sua excreo na urina (aminoacidria neutra). No intestinal, o defeito resulta em m absoro de aminocidos neutros da dieta. Os sintomas clnicos so os que se esperariam para uma decincia de triptofano, com caractersticas semelhantes s da pelagra (ver p. 1074), que uma expresso da disponibilidade diminuda de triptofano para converso em nicotinamida. Entretanto, os sintomas so variveis e mais brandos do que os esperados no bloqueio total de reabsoro de aminocidos neutros. Investigaes de pacientes com doena de Hartnup revelaram a existncia de transportadores intestinais para di ou tripeptdeos, que so diferentes daqueles para aminocidos livres. PEPT1 (SLC5A1) o principal transportador intestinais para absoro de produtos peptdicos pequenos da digesto. Fonte: Broer, A., Klingel, K., Kowalczuk, S., Rasko, J. E., Cavanaugh, J. e Broer, S., Molecular cloning of mouse amino acid transport system B0, a neutral amino acid transporter related to Hartnup disease. J. Biol. Chem. 279:24467, 2004. Daniel, H. Molecular and integrative physiology of intestinal peptide transport. Annu. Rev. Physiol. 66:361, 2004. http://www.emedicine.com/derm/topic713.htm funcionalmente caracterizados nas membranas luminal e contraluminal, respectivamente. O transporte da borda em escova para outros aminocidos, no os neutros, energizado de modos mais complicados. Por exemplo, aminocidos cidos podem ser concentrados por co-transporte com 2 ons Na+ e contra-transporte com 1 on K+ (SLC12A1), enquanto aminocidos bsicos dependem do co-transporte de uma carga positiva e do potencial negativo do interior da clula (SLC3A1/SLC7A9). Concluses sobre transportadores envolvidos em absoro dos aminocidos alanina, serina e cistena esto associadas com alguma incerteza porque estes aminocidos so substratos de vrios transportadores, um dos quais parece catalisar uma troca obrigatria aminocido/aminocido (SLC1A5).

Transportadores de Aminocidos e Di e Tripeptdeos


O intestino delgado tem uma alta capacidade de absorver aminocidos livres e di e tripeptdeos. A maior parte dos L-aminocidos pode ser transportada atravs do epitlio contra um gradiente de concentrao, embora a necessidade de transporte concentrador in vivo no seja bvia, uma vez que as concentraes luminais so geralmente mais altas do que os nveis plasmticos de 0,1-0,2 mM. A captao para dentro das clulas mediada por vrios transportadores diferentes na membrana luminal, enquanto a liberao no sangue mediada por vrios transportadores adicionais, diferentes, na membrana contraluminal (Tabela 26.7). notvel que vrias mutaes com perda de funo em transportadores de aminocidos foram descobertas, porque o intestino delgado e os tbulos proximais renais compartilham tipos de transportadores, e perda renal de qualquer transportador de aminocidos em particular produz um resultado facilmente detectvel, a saber, a excreo do aminocido na urina (aminoacidria). De mesma forma, a importncia da absoro de di e tripeptdeos para a nutrio foi descoberta quando uma mutao com perda de funo no principal transportador de aminocidos neutros (aminoacidria neutra) no foi acompanhada por uma decincia esperada nos aminocidos correspondentes, sugerindo pelo menos um transportador adicional mediando captao (ver Corr. Cln. 26.4). O mecanismo de absoro ativa de aminocidos neutros parece ser semelhante discutida para a D-glicose (ver Figura 26.18). Um co-transportador Na+ -dependente da famlia SLC6 (tambm chamado NBB para aminocido neutro da borda em escova ou B0AT), e transportador facilitador, Na+ -independente (SLC3A2/ SLC7A8 ou sistema L para preferncia a leucina) foram

BioQ.26 1026

22.01.07 18:44:07

CAPTULO 26 DIGESTO E ABSORO DE CONSTITUINTES NUTRICIONAIS BSICOS

1037

Micelas de cidos biliares contornam este problema para os lipdeos, por aumentarem sua concentrao efetiva na camada no-misturada. O aumento na velocidade de transporte quase proporcional ao aumento na concentrao efetiva e pode ser 1000 vezes superior de cidos graxos individuais solubilizados, de acordo com as diferentes solubilidades em gua dos cidos graxos como micelas e como molculas individuais. Esta relao entre uxo e concentrao efetiva permanece, porque a constante de difuso s um pouco menor para micelas do que para molculas de lipdeos em soluo. Em ausncia de cidos biliares, a absoro de triacilgliceris no pra completamente, mas a ecincia drasticamente reduzida. Absoro residual depende da baixa solubilidade em gua dos cidos graxos livres e dos monoacilgliceris. Lipdeos no-absorvidos chegam ao intestino inferior, onde uma pequena parte pode ser metabolizada por bactrias. A maior parte dos lipdeos no-absorvidos, entretanto, excretada nas fezes (esteatorria). Micelas tambm transportam colesterol e as vitaminas lipossolveis A, D, E e K atravs das camadas uidas no-misturadas. Secreo de cidos biliares essencial para sua absoro.

A Maior Parte dos Lipdeos Absorvidos Incorporada a Quilomcrons


Captao de lipdeos por clulas epiteliais intestinais ocorre por difuso atravs da membrana plasmtica. Alm disso, captao de cidos graxos de cadeia longa aumentada por um transportador (FATP4 ou SLC27A4) e de colesterol por um canal (protena tipoC1 de Niemann-Pick ou NPC1L1) na membrana luminal. Esteris tambm podem ser bombeados de volta para fora por um transportador ABC (ver p. 479) consistindo de dois meios-transportadores (ABCG5 e ABCG8) e uma parte do colesterol realmente devolvida ao compartimento luminal. Exportao de esteris por transportador ABC particularmente importante para rejeitar esteris de plantas; normalmente, esteris de plantas no so encontrados no soro. Mutaes com perda de funo em qualquer dos meios-transportadores esto associadas com uma elevao no soro do esterol de planta sintosterol (tosterolemia ou sitosterolemia). Absoro virtualmente completa para cidos graxos e monoacilgliceris, que so ligeiramente solveis em gua. menos eciente para lipdeos insolveis em gua. Por exemplo, apenas 30-40% do colesterol da dieta geralmente absorvido. Dentro das clulas epiteliais que fazem absoro, o destino dos cidos graxos absorvidos depende do comprimento da cadeia. cidos graxos de cadeias curtas ou mdias (10 tomos de carbono) ou seus monoacilgliceris so ligados a uma protena citoslica que liga cido graxo (FAB intestinal o I-FABP) e so transporta-

dos para o retculo endoplasmtico, onde so convertidos em triacilgliceris. Glicerol para este processo derivado dos 2-monoacilgliceris absorvidos e, em menor grau, da glicose. Colesterol estericado pela colesterol aciltransferase. Os triacilgliceris recm-sintetizados e os colesteril steres formam glbulos lipdicos aos quais fosfolipdeos e apolipoprotenas adsorvem. Os glbulos so chamados quilomcrons porque podem crescer at vrios micrmetros e dimetro, e deixam o intestino pelos vasos linfticos (quilo = linfa leitosa derivada do grego chylos, que signica suco). passam atravs da clula para o sangue portal, sem modicao. cidos graxos de cadeia longa (>12 tomos de carbono) so ligados a uma protena citoplasmtica de ligao a cidos graxos (FABP intestinal ou I-FABP, intestinal fatty-acid binding protein) e so transportados para o retculo endoplasmtico, onde so convertidos novamente em triacilgliceris. Quilomcrons so sintetizados no lmen do retculo endoplasmtico, de onde migram pelo Golgi e depois para vesculas e para a membrana contraluminal. So liberados no espao intercelular por fuso destas vesculas com a membrana plasmtica. interessante que quilomcrons no entram no espao capilar e na veia porta, mas sim viajam pelos vasos linfticos intestinais (ou lacteals) e o ducto torcico para o sistema venoso sistmico. As apolipoprotenas intestinais so designadas por A-1 e B48 (ver Corr. Cln. 26.8); so diferentes daquelas do fgado, com funes semelhantes (ver p. 698). Enquanto cidos graxos de cadeia mdia da dieta chegam ao fgado diretamente com o sangue portal, cidos graxos de cadeia longa chegam primeiro ao tecido adiposo e ao msculo via circulao sistmica, antes de entrarem em contato com o fgado. Clulas adiposas e musculares captam grandes quantidades de lipdeos da dieta para armazenamento ou metabolismo. Um atalho sem passar pelo fgado pode ter evoludo para proteger este rgo da sobrecarga lipdica aps uma refeio. O manuseio diferencial de cidos graxos de cadeia mdia e longa por clulas intestinais pode ser explorado para fornecer ao fgado nutrientes altamente calricos, na forma de cidos graxos. cidos graxos de cadeia curta e mdia tm cheiro e gosto ranoso, e no so muito palatveis; entretanto, triacilgliceris que contm estes cidos graxos so bastante palatveis e podem ser usados como parte da dieta. cidos graxos de cadeia curta so produzidos siologicamente, particularmente no clon, por bactrias, a partir de carboidratos residuais. Estes cidos graxos so absorvidos no sangue portal.

26.7 METABOLISMO DE CIDOS BILIARES


Qumica e Sntese de cidos Biliares
cidos biliares so sintetizados em clulas do fgado (hepatcitos) a partir de colesterol, secretados na bile juntamente com fosfolipdeos, e modicados por enzimas bacterianas no lmen intestinal.

BioQ.26 1037

22.01.07 18:44:59

CAPTULO 27 PRINCPIOS DE NUTRIO I: MACRONUTRIENTES

1043

PARTE 5 PROCESSOS FISIOLGICOS

PRINCPIOS DE NUTRIO I: MACRONUTRIENTES


Stephen G. Chaney
27.1 VISO GERAL, 1044 27.2 METABOLISMO ENERGTICO, 1044 Contedo energtico dos alimentos medido em quilocalorias, 1044 Gasto energtico inuenciado por quatro fatores, 1044 27.3 METABOLISMO DE PROTENAS, 1045 Protenas da dieta cumprem muitas funes incluindo produo de energia, 1045 Balano de nitrognio relaciona ingesto com excreo de nitrognio, 1045 Aminocidos essenciais devem estar presentes na dieta, 1045 Economia de protenas est relacionada com o contedo de carboidratos e gorduras, 1046 Necessidades de protena para adulto normal, 1046 Necessidades de protena aumentam durante crescimento e doenas, 1047 27.4 DESNUTRIO PROTICO-ENERGTICA, 1048 27.5 EXCESSIVA INGESTO PROTICOENERGTICA, 1050 Obesidade tem componentes dietticos e genticos, 1050 Obesidade tem implicaes signicativas para a sade, 1050 27.6 CARBOIDRATOS, 1051 27.7 GORDURAS, 1051 27.8 FIBRAS, 1052 27.9 COMPOSIO DOS MACRONUTRIENTES DA DIETA, 1054 Composio da dieta afeta colesterol do soro, 1054 Carboidratos, ndice glicmico e carga glicmica, 1056 Mistura de protenas vegetais e animais satisfaz as necessidades nutricionais de protena, 1056 Fibra de fontes variadas desejvel, 1057 Recomendaes dietticas, 1057 BIBLIOGRAFIA, 1059 QUESTES E RESPOSTAS, 1060 CORRELAES CLNICAS 27.1 Dietas Vegetarianas e Necessidades Protico-Energticas para Crianas, 1047 27.2 Ingesto de Protenas na Dieta e Doena Renal, 1048 27.3 Oferecendo Protenas e Calorias Adequadas a Pacientes Hospitalizados, 1049 27.4 Carga de Carboidratos e Resistncia Atltica, 1052 27.5 Dietas Ricas em Carboidratos Versus Dietas Ricas em Gorduras para Diabticos, 1053 27.6 cidos Graxos Poliinsaturados e Fatores de Risco para Doena Cardaca, 1055 27.7 Adaptao Metablica: Relao entre Ingesto de Carboidratos e Triacilgliceris no Soro, 1059

27

BioQ.27 1043

22.01.07 18:46:45

CAPTULO 27 PRINCPIOS DE NUTRIO I: MACRONUTRIENTES

1045

correr mais de uma hora para queimar as calorias presentes em um pedao de torta de ma. Exerccio regular aumenta a taxa de metabolismo basal, permitindo que calorias sejam queimadas mais rapidamente, 24 horas por dia. Um programa de exerccios regulares deve ser planejado para aumentar a massa muscular magra e deve ser repetido 3-5 dias por semana, mas no precisa ser exerccio aerbico para ter efeito sobre a taxa de metabolismo basal. Para um indivduo idoso ou enfermo, mesmo caminhada diria pode ajudar a aumentar a um pouco a taxa de metabolismo basal. Nveis hormonais tambm so importantes, uma vez que tiroxina, hormnios sexuais, hormnio de crescimento e, em menor grau, epinefrina e cortisol aumentam BMR. Os efeitos da epinefrina e do cortisol provavelmente explicam, em parte, porque estresse severo e trauma importante aumentam signicativamente as necessidades energticas. Finalmente, a prpria ingesto energtica tem uma relao inversa com o gasto, porque durante perodos de jejum ou semijejum, BMR pode cair a at 50%. Isto de grande valor para sobrevivncia em casos de genuna falta de alimento, mas no ajuda muito a pessoa que quer perder peso com uma dieta de restrio calrica.

adequada na dieta deve ser fornecida em todas as refeies. Entretanto, na realidade, isto no muito correto. Embora no exista uma classe separada de protenas de armazenamento, existe certa percentagem da protena do corpo que sofre um processo constante de quebra e sntese. No estado de jejum, a quebra desta protena aumenta, e os aminocidos resultantes so utilizados para produo de glicose, sntese de outros compostos nitrogenados no-protenas, e das protenas plasmticas e secretrias essenciais mencionadas acima. Mesmo no estado alimentado, parte destes aminocidos utilizada para produo de energia e como precursores biossintticos. Assim, o turnover de protenas do corpo um processo normal e uma caracterstica essencial do assim chamado balano de nitrognio.

Balano de Nitrognio Relaciona Ingesto com Excreo de Nitrognio


Balano de nitrognio (Figura 27.2) uma relao entre ingesto de nitrognio (principalmente na forma de protenas) e excreo de nitrognio (principalmente na forma de protena no-digerida nas fezes e uria e amnia na urina). Um adulto normal est em equilbrio de nitrognio, com perdas exatamente equilibradas por ingesto. Balano de nitrognio negativo resulta de ingesto inadequada de protena, uma vez que os aminocidos utilizados para energia e reaes de biossntese no so substitudos. Isto tambm ocorre em leso quando h destruio dos tecidos, e em traumas graves ou doenas, quando resposta adaptativa do corpo causa catabolismo aumentado de protena. Balano de nitrognio positivo ocorre quando h um aumento nal na protena do corpo, como em crianas em crescimento, mulheres grvidas ou adultos convalescentes.

27.3 METABOLISMO DE PROTENAS


Protenas da Dieta Cumprem Muitas Funes Incluindo Produo de Energia
Protena carrega certa mstica como alimento de construo do corpo. Embora seja componente estrutural essencial de todas as clulas, tambm importante para manuteno de secrees essenciais, como enzimas digestivas e hormnios peptdicos e proticos. Protena tambm necessria para sntese de protenas plasmticas, que so essenciais para manter equilbrio osmtico, transporte de substncias no sangue e manuteno da imunidade. Entretanto, o adulto norte-americano mdio consome muito mais protena do que o necessrio para desempenhar estas funes essenciais. O excesso de protena tratado como uma fonte de energia, com aminocidos glucognicos sendo convertidos em glicose e aminocidos cetognicos, em cidos graxos e cetocidos. Ambos os tipos de aminocidos so eventualmente convertidos em triacilglicerol no tecido adiposo, se os suprimentos de gordura e carboidratos j forem adequados para suprir as necessidades energticas. Assim, para a maioria de ns, a nica construo corporal obtida com dietas ricas em protenas no tecido adiposo. Tem sido comum dizer que o corpo no tem depsitos para armazenamento de protena e, portanto, protena

Aminocidos Essenciais Devem Estar Presentes na Dieta


Vrios fatores devem ser considerados, alm da quantidade de protena na dieta. Um o complemento de aminocidos essenciais ingeridos. Aminocidos essenciais so aminocidos que no podem ser sintetizados pelo corpo (Tabela 27.2). Se apenas um destes aminocidos essenciais estiver faltando na dieta, o corpo no poder sintetizar novas protenas para substituir a perdida no turnover normal, e balano de nitrognio negativo resulta (Figura 27.2). Obviamente, o complemento de aminocidos essenciais na protena da dieta determina o quanto ela pode ser usada pelo corpo. A maioria das protenas animais contm todos os aminocidos essenciais, mais ou menos nas quantidades necessrias ao corpo humano. Protenas vegetais, por outro lado, freqentemente no tm um ou mais aminocidos essenciais e podem, em alguns casos, ser

BioQ.27 1045

22.01.07 18:46:50

1052

PARTE 5 PROCESSOS FISIOLGICOS

CORRELAO CLNICA 27.4

Carga de Carboidratos e Resistncia Atltica


A prtica de dar uma carga de carboidratos vem de observaes feitas no incio da dcada de 1960 de que a resistncia durante exerccio vigoroso era limitada primariamente pelos estoques de glicognio muscular. Claro, glicognio no a nica fonte de energia para o msculo. cidos graxos livres aumentam no sangue durante exerccio vigoroso e so utilizados pelo msculo, juntamente com seus estoques de glicognio. Uma vez que o glicognio tenha se esgotado, entretanto, o msculo no pode depender inteiramente de cidos graxos livres sem se cansar rapidamente, provavelmente porque o msculo ca cada vez mais hipxico durante exerccio vigoroso. Enquanto glicognio utilizado aerobicamente e anaerobicamente, cidos graxos s podem ser utilizados aerobicamente. Em condies anaerbicas, cidos graxos no podem fornecer ATP em velocidade suciente para servir como nica fonte de energia. A prtica de dar uma carga de carboidratos para aumentar as reservas de glicognio foi introduzida para atletas de enduro e outras provas de resistncia. O regime de carga de carboidratos original consistia de um perodo de 3 a 4 dias de exerccio pesado com uma dieta pobre em carboidratos, seguidos por 1-2 dias de exerccio leve com dieta rica em carboidratos. O perodo inicial de baixo carboidrato e alta demanda energtica causava uma depleo das reservas musculares de glicognio. A mudana subseqente para uma dieta rica em carboidratos resultava na produo de nveis acima do normal de insulina e hormnio de crescimento, e as reservas de glicognio chegavam a quase duas vezes as quantidades normais. Esta prtica realmente aumentava signicativamente a resistncia. Em um estudo, indivduos em teste com dieta rica em gordura e protena tinham menos do que 1,6 g de glicognio por 100 g de msculo e conseguiam realizar uma carga de trabalho padronizado por apenas 60 min. Quando os mesmos indivduos consumiram uma dieta rica em carboidratos por 3 dias, suas reservas de glicognio aumentaram para 4 g por 100 g de msculo, e a mesma carga de trabalho pde ser realizada por at 4 h. Embora a tcnica evidentemente funcionasse, os atletas freqentemente se sentiam letrgicos e irritveis durante a fase pobre em carboidratos do regime, e a dieta rica em gordura estava em desacordo com as recomendaes atuais para sade. Estudos recentes indicam que o consumo regular de uma dieta rica em carboidratos complexos e pobre em gordura durante o treinamento aumenta as reservas de glicognio, sem mudanas sbitas de dieta. Recomendaes atuais so de que atletas de provas de resistncia consumam uma dieta rica em carboidratos (com nfase em carboidratos complexos) durante o treinamento. Depois, a ingesto de carboidratos aumentada ainda mais (para 70% das calorias) e o exerccio diminudo durante os 2-3 dias que antecedem um evento atltico. Isto aumenta as reservas de glicognio muscular at nveis comparveis aos descritos anteriormente no regime de carga de carboidratos.

Fonte: Lambert, E. V. e Goedecke, J. H. The role of dietary micronutrients in optimizing endurance performance. Curr. Sports Med. Rep. 2:194, 2003. Hargreaves, M., Hawley, J. A. e Jeukendrup, A. Pre-exercise carbohydrate and fat ingestion: Effects on metabolism and performance. J. Sports Sci. 22:31, 2004. Burke, L. M., Kiens, B. e Ivey, J. L. Carbohydrates and fat for training and recovery. J. Sports Sci. 22:15, 2004. de cidos graxos essenciais uma dermatite com descamao. Decincia de EFAs muito rara nos Estados Unidos, ocorrendo primariamente em bebs prematuros em peso alimentados com frmulas articiais desprovidas de EFA e em pacientes hospitalizados mantidos em alimentao totalmente parenteral por longos perodos. Na outra extremidade, h preocupao de que excesso de gordura na dieta cause elevao de lipdeos do soro e, assim, risco aumentado de doena cardaca. Estudos recentes sugerem que dietas ricas em gordura estejam associadas com risco aumentado de cncer de clon, mama e prstata, mas no est claro se o risco de cncer est associado com ingesto de gordura per se ou com o excesso de calorias associado a uma dieta rica em gorduras. Estudos em animais sugerem que cidos graxos poliinsaturados da srie -6 possam ser mais tumorignicos do que outros cidos graxos insaturados. A razo para isso desconhecida, mas sugeriu-se que prostaglandinas derivadas de cidos graxos -6 possam estimular progresso de tumores.

27.8 | FIBRAS
Fibras da dieta compreendem os componentes do alimento que no podem ser quebrados por enzimas digestivas humanas. incorreto, entretanto, assumir que bras so no-digeridas, uma vez que algumas bras so, de fato, quebradas, pelo menos parcialmente, por bactrias intestinais. Nosso conhecimento atual das

BioQ.27 1052

22.01.07 18:46:56

CAPTULO 27 PRINCPIOS DE NUTRIO I: MACRONUTRIENTES

1059

CORRELAO CLNICA 27.7

Adaptao Metablica: Relao entre Ingesto de Carboidratos e Triacilgliceris no Soro


Quando se avalia a literatura de nutrio, importante lembrar que a maioria dos testes clnicos de durao relativamente curta (2-6 semanas), enquanto algumas adaptaes metablicas podem ser consideravelmente mais demoradas. Portanto, mesmo estudos clnicos aparentemente bem projetados podem levar a concluses erradas, que sero repetidas na literatura popular por anos a o. Por exemplo, vrios estudos realizados nas dcadas de 1960 e 1970 tentaram vericar os efeitos de ingesto de carboidratos sobre os nveis de triacilglicerol no soro. Tipicamente, jovens estudantes do sexo masculino receberam uma dieta na qual at 50% de suas calorias em gordura foram substitudas por sacarose ou outro acar simples por um perodo de 2-3 semanas. Na maioria dos casos, os nveis de triacilglicerol no soro aumentaram muito (at 50%). Isto levou concluso de que alta ingesto de acares simples, particularmente sacarose, poderia aumentar o risco de doena cardaca, uma noo que se popularizou por meio de best sellers nutricionais como Sugar Blues e Sweet and Dangerous. Infelizmente, enquanto as concluses originais eram promovidas na imprensa leiga, os experimentos propriamente ditos eram questionados. Estudos subseqentes demonstraram que se estes testes fossem continuados por perodos mais longos (3-6 meses), os nveis de triacilglicerol geralmente se normalizavam. A natureza desta adaptao metablica lenta desconhecida. Tambm importante considerar o tipo de carboidrato da dieta. Para muitos americanos, uma dieta rica em carboidratos signica uma dieta que rica em acares simples. Os nveis de triacilgliceris nestes indivduos respondem dramaticamente a dietas que substituem alimentos contendo ou gordura ou carboidratos complexos e bras por alimentos contendo acares simples como fonte de carboidrato.

Fonte: Leahy, P., Croniger, C. e Hanson, R.W. Molecular and cellular adaptations to carbohydrate and fat intake. Eur. J. Clin. Nutr. 53(Suppl 1):S6, 1999. Parks, E. J. e Hellerstein, M. K. Carbohydrate-induced hypertriacylglycerolemia: Historical perspective and review of biological mechanisms. Am. J. Clin. Nutr. 71:412, 2000.

| BIBLIOGRAFIA |
Desnutrio Protico-Energtica em Pacientes Hospitalizados Bif, W. L., Moore, E. E. e Haenel, J. B. Nutrition support of the trauma patient. Nutrition 18:960, 2002. Wilmore, D. W. Metabolic response to severe surgical illness: An overview. World J. Surg. 24:705, 2000. Wolfe, R. R. e Martini, W. Z. Changes in intermediary metabolism in severe surgical illness. World J. Surg. 24:639, 2000. Conseqncias Metablicas da Obesidade Boden, G. Free fatty acids, insulin resistance, and type 2 diabetes mellitus. Proc. Assoc. Am. Physicians 111, 241, 1999. Hotamisligii, G. S. The role of TNF and TNF receptors in obesity and insulin resistance. J. Intern. Med. 245:621, 1999. Le Roith, R. e Zick, Y. Recent advances in our understanding of insulin action and insulin resistance. Diabetes Care 24:588, 2001. Pi-Sunyer, F. X. Health implications of obesity. Am. J. Clin. Nutr. 53:15955, 1991. Predisposio Gentica Obesidade Fliers, J. S. Obesity wars: Molecular progress confronts an expanding epidemic. Cell 116:337, 2004. Evans, R. M., Barish, G. D. e Wang, Y. X. PPARs and the complex journey to obesity. Nat. Med. 10:355, 2004. Ochoa, M. C., Marti, A., Azcona, C., Cheuca, M., Oyaizabal, M., Pelach, R. et al. Gene-gene interactions between PPAR gamma 2 and ADR beta 3 increases obesity risk in children and adolescents. Int. J. Obes. Relat. Metab. Disord. 28 (Suppl. 3):S37, 2004. Pihlajamaki, J., Vanhala, M., Vanhala, P. e Laakso, M. The Pro12Ala polymorphism of the PPAR gamma 2 gene regulates weight from birth to adulthood. Obes. Res. 12:187, 2004. Saper, C. B., Chou, T. C. e Elmquist, J. K. The need to feed: Homeostatic and hedonic control of eating. Neuron 36:199, 2002. Zigman, J. M. e Elmquist, J. K. Minireview: From anorexia to obesity The yin and yang of body weight control. Endocrinology 144:3749, 2003. Dieta e Doena Cardiovascular Holub, D. J. e Holub, B. J. Omega-3 fatty acids from sh oils and cardiovascular disease. Mol. Cell. Biochem. 263:217, 2004. Krauss, R. M., Eckel, R. H., Howard, B., Appel, L. J., Daniels, S. R., Deckelbaum, R. J., et al. AHA Dietary Guidelines Revision 2000: A statement for healthcare professionals from the nutrition committee of the American Heart Association. Circulation 102:2284, 2000. Kris-Etherton, P. M., Harris, W. S. e Appel, L. J. Omega-3 fatty acids and cardiovascular disease. New recommendations from the American Heart Association. Arterioscler. Thromb. Vasc. Biol. 23:151, 2003.

BioQ.27 1059

22.01.07 18:47:02

CAPTULO 28 PRINCPIOS DE NUTRIO II: MICRONUTRIENTES

1063

PARTE 5 PROCESSOS FISIOLGICOS


Necessidades nutricionais aumentadas M-absoro

Ingesto inadequada da dieta

PRINCPIOS DE NUTRIO II: MICRONUTRIENTES


Stephen G. Chaney
28.1 VISO GERAL, 1064 28.8 OUTRAS VITAMINAS HIDROSSOLVEIS, 1082 cido ascrbico funciona em reaes de reduo e hidroxilao, 1082 Colina e carnitina desempenham vrias funes, 1083 MACROMINERAIS, 1084 Clcio tem muitas funes siolgicas, 1084 Magnsio requerido por muitas enzimas, 1084

28

28.2 AVALIAO DE M NUTRIO, 1064 28.3 INGESTO DIETTICAS DE REFERNCIAS, 1064 28.4 VITAMINAS LIPOSSOLVEIS, 1066 Vitamina A derivada de carotenides de plantas, 1066 Sntese de vitamina D requer luz do sol, 1068 Vitamina E uma mistura de tocoferis e tocotrienis, 1071 Vitamina K um derivado de quinona, 1072 VITAMINAS HIDROSSOLVEIS, 1073 VITAMINAS HIDROSSOLVEIS LIBERADORAS DE ENERGIA, 1074 Tiamina forma a coenzima tiamina pirofosfato, 1074 Riboavina forma as coenzimas FAD e FMN, 1075 Niacina forma as coenzimas NAD e NADP, 1075 Piridoxina (vitamina B6) forma a coenzima piridoxal fosfato, 1076 cido pantotnico e biotina formam coenzimas envolvidas no metabolismo energtico, 1079 VITAMINAS HIDROSSOLVEIS HEMATOPOITICAS 1079 cido flico (folacina) funciona como tetra-hidrofolato no metabolismo de um carbono, 1079 Vitamina B12 (cobalamina) contm cobalto em um anel tetrapirrlico, 1080 28.9

28.5 28.6

28.10 MINERAIS TRAOS, 1084 Decincia de ferro causa anemia e imunocompetncia diminuda, 1084 Iodo incorporado a hormnios da tireide, 1086 Zinco requerido por muitas protenas, 1086 Cobre um cofator de enzimas importantes, 1086 Cromo um componente da cromodulina, 1086 Selnio encontrado em selenoprotenas, 1087 Mangans, molibdnio, uoreto e boro so elementos traos essenciais, 1087 28.11 DIETA AMERICANA: FATO E FALCIA, 1087 28.12 AVALIAO DO ESTADO NUTRICIONAL NA PRTICA CLNICA, 1087 BIBLIOGRAFIA, 1089 QUESTES E RESPOSTAS, 1091 CORRELAES CLNICAS 28.1 Consideraes Nutricionais na Fibrose Cstica, 1068

28.7

BioQ.28 1063

22.01.07 18:48:29

CAPTULO 28 PRINCPIOS DE NUTRIO II: MICRONUTRIENTES

1073

CORRELAO CLNICA 28.3

Consideraes Nutricionais em Recm-Nascidos


Bebs recm-nascidos correm risco nutricional especial devido ao crescimento muito rpido e porque as necessidades de muitos nutrientes so altas. Alguns micronutrientes (tais como vitaminas E e K) no atravessam bem a membrana placentria e as reservas teciduais so baixas no recm-nascido. O trato gastrointestinal (GI) pode no estar completamente desenvolvido, levando a problemas de m absoro (particularmente com respeito s vitaminas lipossolveis). O trato GI tambm estril ao nascer, e a ora intestinal, que normalmente fornece quantidades signicativas de certas vitaminas (especialmente vitamina K), demora vrios dias para se estabelecer. Se o beb for prematuro, o risco nutricional um pouco maior, uma vez que o trato GI ser menos desenvolvido e as reservas teciduais sero ainda menores. A complicao nutricional mais sria parece ser doena hemorrgica. Recm-nascidos, especialmente bebs prematuros, tm baixas reservas teciduais de vitamina K e no tm a ora intestinal necessria para sintetizar a vitamina. Leite materno uma fonte relativamente pobre de vitamina K. Aproximadamente 1 em cada 400 nascidos vivos apresentam alguns sinais de doena hemorrgica, que pode ser evitada por 0,5 a 1 mg da vitamina, dada ao nascer. A maioria dos bebs recm-nascidos tem reservas de ferro sucientes para durar 3-4 meses. Como leite de vaca e leite materno contm pouco ferro, suplementao com ferro geralmente iniciada em idade relativamente precoce, pela introduo de cereal enriquecido com ferro. Nveis de vitamina D tambm so baixos no leite materno, e suplementao com 200 UI/dia de vitamina D geralmente recomendada. Quando bebs precisam ser mantidos em ventilao assistida com altas concentraes de oxignio, suplementao com vitamina E pode reduzir o risco de displasia broncopulmonar e broplasia retrolental, complicaes em potencial da terapia por oxignio. A anemia da prematuridade pode responder a suplementao com folato e vitamina B12. Em resumo, vitamina K suplementar dada ao nascer para evitar doena hemorrgica. Bebs amamentados pela me geralmente recebem um suplemento de vitamina D, com ferro sendo introduzido juntamente com alimentos slidos. Bebs alimentados com mamadeira recebem uma suplementao de ferro. Se o beb precisar ser mantido em oxignio, vitamina E suplementar pode ser benca.

Fonte: Mueller, D. P. R. Vitamin E therapy in retinopathy of prematurity. Eye 6: 221, 1992. Morin, K. H. Current thoughts on healthy term infant nutrition, MCN. Am. J. Matern. Child Nurs. 29:312, 2004. Collier, S., Fulhan, J. e Duggan, C. Nutrition for the pediatric ofce: Update on vitamins, infant feeding and food allergies. Curr. Opin. Pediatr. 16:314, 2004.

28.5 VITAMINAS HIDROSSOLVEIS


Vitaminas solveis em gua diferem das vitaminas lipossolveis em vrios aspectos. A maioria facilmente excretada, uma vez que sua concentrao ultrapasse o limite renal, de modo que toxicidade rara. Suas reservas metablicas so lbeis, e depleo pode ocorrer freqentemente em questo de semanas ou meses, de modo que decincias ocorrem relativamente rpido, com uma dieta inadequada. Como vitaminas hidrossolveis so coenzimas para muitas reaes bioqumicas comuns, freqentemente possvel ensaiar o estado vitamnico medindo-se uma ou mais atividades enzimticas em eritrcitos isolados. Estes ensaios so especialmente teis se se medir a atividade endgena e o estmulo desta atividade por adio da coenzima ativa derivada da vitamina.

A maior parte das vitaminas hidrossolveis convertida em coenzimas, que so usadas em vias de gerao de energia ou hematopoiese. Decincias das vitaminas que liberam energia produzem vrios sintomas sobrepostos e aparecem primeiro em tecidos de crescimento rpido. Sintomas tpicos incluem dermatite, glossite (edema e vermelhido da lngua), queilite dos cantos dos lbios e diarria. Em muitos casos, o tecido nervoso tambm est envolvido devido sua alta demanda energtica ou efeitos especcos da vitamina. Sintomas neurolgicos comuns incluem neuropatia perifrica (formigamento dos nervos nas extremidades), depresso, confuso mental, falta de coordenao motora e indisposio. Desmielinizao e degenerao do tecido nervoso tambm podem ocorrer. Estes sintomas de decincias so to comuns e sobrepostos que podem ser considerados como propriedades das vitaminas liberadoras de energia como uma classe, e no como sendo especcos para cada uma.

BioQ.28 1073

22.01.07 18:48:39

CAPTULO 28 PRINCPIOS DE NUTRIO II: MICRONUTRIENTES

1081

CORRELAO CLNICA 28.7

Polimorsmos Genticos e Necessidades de cido Flico


Suplementao com cido flico reduz o risco de defeitos no tubo neural e diminui os nveis de homocistena no soro, o que pode baixar o risco de doena cardaca. Estes dados levaram a um aumento na RDA para cido flico e ao enriquecimento de produtos de gros com cido flico. Entretanto, mesmo com uma dieta marginal, nem todos os adultos tm nveis elevados de homocistena e nem todas as mes do luz bebs com defeitos de tubo neural. O que determina estas respostas individuais ingesto inadequada de folato? Existe um polimorsmo gentico comum no gene da 5,10-metilenotetra-hidrofolato redutase (MTHFR) que produz o 5-metiltetra-hidrofolato necessrio converso de homocistena em metionina (ver Figura 28.15). Uma substituio CT no bp 677 resulta em uma substituio de valina por alanina que baixa a atividade especca e reduz a estabilidade da enzima. Aproximadamente 12% dos caucasianos e asiticos so homozigotos (T/T) e 50% so heterozigotos (C/T) para este polimorsmo. As concentraes plasmticas de folato so signicativamente mais baixas e os nveis de homocistena plasmtica so signicativamente mais altos em indivduos T/T consumindo dietas pobres em folato. Quando acoplado com baixa ingesto de folato, o gentipo T/T pode responder por 15% dos defeitos de tubo neural. Alm disso, indivduos mais velhos com o gentipo T/T e baixa ingesto de folato parecem ter risco aumentado de cncer de clon. Uma investigao ativa de polimorsmos genticos nos outros genes envolvidos no metabolismo de folato est em andamento. Polimorsmos foram descritos em metionina sintetase e receptor alfa de folato, que necessrio para captao de 5-metiltetra-hidrofolato. Ambos parecem ser benignos. Entretanto, a absoro de folato pelo intestino pode ser mais baixa em mes com uma histria de gestaes com defeito no tubo neural do que em mes controles. A gentica deste defeito ainda no foi determinada.

Fonte: Bailey, L. B. e Gregory, J. F. Polymorphisms and methylenetetrahydrofolate reductase and other enzymes: metabolic signicance, risks, and impact on folate requirement. J. Nutr. 129:919, 1999. Barber, R. C., Lammer, E. J., Shaw, G. M., Greer, K. A. e Finnell, R. H. The role of folate transport and metabolism in neural tube defect risk. Mol. Genet. Metab. 66:1, 1999. Fang, J. Y. e Xiao, S. D. Folic acid, polymorphism of methyl-group metabolism genes, and DNA methylation in relation to GI carcinogenesis. J. Gastroenterol. 38:821, 2003. um dentre vrios ligantes diferentes (Figura 28.15). As formas cristalinas de B12 usadas em suplementao so geralmente hidroxicobalamina ou cianocobalamina. B12 em alimentos geralmente ocorre ligada a protena, em forma metil ou 5-desoxiadenosil. Para ser utilizada, B12 deve ser liberada da protena por hidrlise cida no estmago, ou por digesto por tripsina no intestino. Em seguida, combina com fator intrnseco, uma protena secretada pelo estmago, que a transporta at o leo para absoro. Vitamina B12 s participa de duas reaes no homem (Figura 28.16). O metil derivado de B12 requerido pela metionina sintase, na qual homocistena metilada a metionina. O 5-desoxiadenosil derivado requerido pela metilmalonil-CoA mutase, que converte metilmalonil-CoA em succinil-CoA, uma reao-chave no catabolismo de valina, isoleucina, metionina, treonina, cidos graxos de cadeia mpar, timina e a cadeia lateral do colesterol. Como poderia ser esperado, decincia de B12 causa acmulo de homocistena e cido metilmalnico.

R1 CH3 CH3

R2

CH3

CH3 R1

R2

X N Co N N
CH3 R2 CH3

R1 HNOCCH2CH2 CH3 CH3 CH2 CH O O P H H CH3 O O OH N

CH3 CH3

HOCH2 N

FIGURA 28.15 Estrutura da vitamina B12 (cobalamina).

BioQ.28 1081

22.01.07 18:48:47

CAPTULO 28 PRINCPIOS DE NUTRIO II: MICRONUTRIENTES

1089

CORRELAO CLNICA 28.9

Necessidades Nutricionais de Idosos


Se as tendncias atuais continuarem, um a cada cinco americanos ter mais de 65 anos no ano 2030. Com este envelhecimento projetado da populao americana, tem havido interesse crescente na denio das necessidades nutricionais dos idosos. Pesquisa recente demonstra necessidades alteradas de pessoas idosas para vrios nutrientes essenciais. Por exemplo, absoro e utilizao de vitamina B6 diminuem com a idade. Levantamentos dietticos mostraram consistentemente que B6 um problema nutricional para muitos americanos, e os idosos no so excees. Muitos americanos mais velhos obtm menos de 50% da RDA para B6 em sua dieta. Decincia de vitamina B12 tambm mais prevalente entre os idosos. Muitos adultos mais velhos desenvolvem gastrite atrca (produo diminuda de cido no estmago) e produo diminuda de fator intrnseco, o que leva a pouca absoro de B12. O nvel sangneo de homocistena, um possvel fator de risco de aterosclerose, demncia e doena de Alzheimer, est freqentemente elevado no idoso. Homocistena um produto colateral da metilao do DNA e normalmente metabolizada a metionina ou cistena em reaes que requerem cido flico, B12 e B6 (ver Figura 28.14). Suplementao simples com estas vitaminas B geralmente suciente para normalizar os nveis de homocistena. Vitamina D pode ser um problema tambm. Muitos idosos no passam muito tempo expostos ao sol, e a converso de 7-desidrocolesterol em vitamina D na pele e de 1,25-(OH)D em 1,25-(OH)2D no rim diminui com a idade. Estes fatores levam a decincias signicativas de 1,25-(OH)2D no idoso, o que pode causar um balano negativo de clcio. Estas alteraes podem contribuir para osteoporose. Existe alguma evidncia de necessidade aumentada de cromo e zinco tambm. Muitos idosos parecem ter diculdade em converter o cromo da dieta em cromodulina biologicamente ativa. Decincia de cromo pode contribuir para diabetes tipo 2. De modo semelhante, a maioria dos idosos consome entre metade e dois teros da RDA para zinco, e condies como gastrite atrca podem interferir com absoro de zinco. Sintomas de decincia de zinco incluem perda de acuidade do paladar, dermatite e sistema imune enfraquecido. Todos estes sintomas so comuns na populao idosa, e decincia de zinco pode contribuir. Nem todas as notcias so ms, entretanto. Absoro de vitamina A aumenta com a idade e sua remoo pelo fgado diminui, de modo que vitamina A permanece em circulao por um tempo maior. No apenas a necessidade de vitamina A diminui com a idade, mas o idoso tambm precisa ser particularmente cuidadoso para evitar toxicidade de vitamina A. Embora isto no restrinja sua escolha de alimentos ou de suplementos multivitamnicos, geralmente devem evitar suplementos de vitamina A isolada.

Fonte: Russell, R. M. e Suter, P. M. Vitamin requirements of elderly people: An update. Am. J. Clin. Nutr. 58:4, 1993. Ubbink, J. B., Vermoak, W. J., van der Merne, A. e Becker, P. J. Vitamin B12, vitamin B6 and folate nutritional status in men with hyperhomocysteinemia. Am. J. Clin. Nutr. 57:47, 1993. Joosten, E., van der Berg. A., Riezler, R. Neurath, H. J., Linderbaum, J., Stabler, S. P. e Allen, R. H. Metabolic evidence that deciencies of vitamin B12, folate and vitamin B6 occur commonly in elderly people. Am. J. Clin. Nutr. 58:468,1993. Wood, R. J., Suter, P. M. e Russell, R. M. Mineral requirements of elderly people. Am. J. Clin. Nutr. 62:493, 1995. Johnson, K. A., Bernard, M. A. e Funderburg, K. Vitamin nutrition in older adults. Clin. Geriatr. Med. 18:773, 2002.

| BIBLIOGRAFIA |
Referncias de Ingesto na Dieta Food and Nutrition Board, Institute of Medicine of the National Academy of Sciences: www.iom.edu/board.asp?id=3788 Vitamina A Goodman, D. S. Vitamin A and retinoids in health and disease. N. Engl. J. Med. 310:1023 - 1031, 1984. Soprano, D. R., Qin, P. e Soprano, K. J. Retinoic acid receptors and cancers. Annu. Rev. Nutr. 24:201, 2004. Thurnham, D. I. E Northrop-Clew, C. A. Optimal nutrition: vitamin A and the carotenoids. Proc. Nutr. Soc. 58:449, 1999. Vitamina D Darwish, H. e DeLuca, H. F. Vitamin D-regulated gene expression. Crit. Rev. Eukaryot. Gene Expr. 3:89, 1993. DeLuca, H. F. Overview of general physiologic features and functions of vitamin D. Am. J. Clin. Nutr. 80:1689S, 2004. Langman, C. B. New developments in calcium and vitamin D metabolism. Curr. Opin. Pediatr. 12:135, 2000.

BioQ.28 1089

22.01.07 18:48:54

R$ 268,00

Este livro est venda nas seguintes livrarias e sites especializados:

EXCELNCIA E INOVAO EM

BIOQUMICA