KAMUS Arteri jantung Tekanan darah : tekanan yang dialami darah pada pembuluh arteri darah ketika darah

di : (pembuluh nadi) pembuluh darah berotot yang membawa darah dari

pompa oleh jantung ke seluruh anggota tubuh manusia. Systole Diastole usia lanjut : tekanan ke atas pembuluh arteri akibat denyutan jantung : tekanan saat jantung beristirahat di antara pemompaan : fase menurunnya kemampuan akal dan fisik, yang di mulai dengan

adanya beberapa perubahan dalam hidup Hipertensi maligna : hipertensi yang sangat parah, yang bila tidak diobati, akan menimbulkan

kematian dalam waktu 3-6 bulan. arteriosklerosis sirkulasi darah ginjal : dinding arteri yang menebal dan kaku akibat endapan kapur : suatu sistem organ yang berfungsi memindahkan zat ke dan dari sel : organ ekskresi dalam vertebrata yang berbentuk mirip kacang sebagai

bagian dari sistem urin Hipertensi esensial : (hipertensi primer) kombinasi antara berbagai faktor genetik dan

lingkungan yang menyebabkan fenotipe hipertensif yang tidak diketahui penyebabnya hipertensi sekunder : beberapa perubahan pada jantung dan pembuluh darah yang

kemungkinan bersama-sama yang menyebabkan meningkatnya tekanan darah dan penyebabnya diketahui Stres tekanan mental : bentuk ketegangan dari fisik, psikis, emosi maupun mental : keadaan emosi seseorang pd saat mengalami tekanan berbagai hal

sehingga dapat menimbulkan gangguan jiwa, biasanya tercermin pd perilaku yg menyimpang alcohol : (ethanol) senyawa organik dimana memilkiki gugus fungsional hidroksil

(-OH) terikat pada atom karbon pil KB elastisitas arteri : salah satu alat kontrasepsi yang banyak digunakan oleh wanita : arteri tidak dapat lentur dan cenderung kaku, sehingga volume darah

yang mengalir sedikit dan kurang lancar Kegemukan (obesitas) : suatu kondisi medis berupa kelebihan lemak tubuh yang terakumulasi sedemikian rupa sehingga menimbulkan dampak merugikan bagi kesehatan, yang kemudian menurunkan harapan hidup dan/atau meningkatkan masalah kesehatan

C2H5OH. Metabolisme : pertukaranzatpadaorganisme yang meliputi proses fisikadankimia. Kortison : hormon yang dikeluarkanolehkelenjarkulit adrenal . Deteksi : usahamenemukandanmenentukankeberadaan. hausterusmenerus yang disebabkanolehkerusakankelenjarhipofisis . Korteks : bagianluarsuatu organ --Adrenal :bagianluarkelenjar adrenal vertebrata yang membentuklebihdariseratusmacamhormon 3. terutamadiabetes mellitus. Nikotin : racun yang terdapat di dalmtembakau. 2berjangkitterusdalamwaktu yang lama. dipakaidalam industry danpengobatan. biasanya disertai dengan perasaan letih dan lemah sesak napas :kesulitan bernapas atau dalam medis disebut sebagai dispnea :penderita hipertensi berat yang mengalami penurunan kesadaran ensefalopati hipertensif dan bahkan koma karena terjadi pembengkakan otak 1.penyakitgula --insipidus :penyakit yang disebabkankekurangan hormone antidiuretikakibatgangguanpadakelenjarpituitary yang ditandaidenganpembentukan urine yang berlebihan.menahun (tentangpenyakit yang melandadiriseseorang)yang tidaksembuh-sembuh 14. Renin : enzimpengurai protein susu (kasein) yang lazimdiperolehdari pancreas anaksapi 4. Inflamasi : reaksitubuhthdmikroorganismedanbendaasing yang ditandaiolehpanas. Hemodialisis : pencuciandarahdenganmaksudmengeluarkanbahantertentudaridarahdenganmenggunakanalat yang dinamakanginjalbuatan 5. anggapan. C21H28O5 10. Hipertensi : tekanandarahataudenyutjantung yang lebihtinggidaripada normal karenapenyempitanpembuluhdarahataugangguanlainnya 2. nyeri. merupakanunsurramuan yang memabukkandalamkebanyakanminuman keras.Kelelahan : kondisi yang ditandai oleh kapasitas berkurang untuk bekerja dan mengurangi efisiensi prestasi. bengkak. Kronis : 1terus menerusberlangsungtahandalamwaktu yang lama (tentengkeadaan). biasanyadisertaidengankelumpuhan 8. digunakandalampengobatandanuntukinsektisida 12. mudahterbakar.etanol 13. Risiko : akibat yang kurangmenyenangkan (merugikan. Stroke : seranganotak. dangangguanfungsi organ tubuh anti-inflamasi : anti peradangan 11. pembentukandanpenguraianzat di dalambadan yang memungkinkanberlangsungnyahidup 6. Diabetes : penyakit yang ditandaidngsekresidanekskresi urine dalamjumlah yang banyak. Alkohol : cairantidakberwarna yang mudahmenguap. membahayakan) darisuatuperbuatanatautindakan 7. ataukenyataan -terdeteksi :dapatdideteksi 9. penyakitkencingmanis.

otak. Sitrat : ester atau anion yang diturunkandariasamsitrat 23. sehinggakadarglukosadalamdarahmeninggidandikeluarkandalam urine Progresif : kea rah kemajuan. C27H45OH. terutamaselsarafdanotak. turunnyaberatbadan. terdapat di dalamseluruhtunuhmanusiadanhewan. air kemih air seni 24. danbanyakkencing. jaringansaraf. 16. danbatuempedu3 steroid yang banyakterdpatdalamminyakdanlemakhewan. selaluhausdanlapar. Urine : zatcairbuangan yang terhimpun di dalamkandungkemihdandikeluarkandaridalamtubuhmelaluisalurankemih. 21. danbatuempedu. 19. empedu. empedu.15. berhaluan kea rah perbaikankeadaansekarang Gejala : perihal (keadaan. mempunyaiperananpentingdalampengangkutanlemakdanpembuatan hormone. --melitus :gangguanmetabolismekarbohidatkarenakelenjar pancreas tidakmampumenyekresi insulin yang cukupdengangejalaadanyaguladalam urine. penderita (sakit) Kolesterol : 1 lemak yang menyerupai alcohol. kuningtelur. berkilausepertimutiara. 2 lemak yang biasaterdapatdalamdarah. AlatSkrining : alatuntukmenayangkangambardsb Permanen : tetap (berlangsung lama)tanpaperubahan yang berarti Dialisis : pemisahzatdalamlarutan --peritoreal :cucidarahmelaluironggaperut 22. Retroperitoneal : terikat (terletak) kebelakangselaputronggaperut 25. 18. 17. keadaankekurangan insulin dengankaibatglukosatidakdapatdiolholehbadan. peristiwa. Reabsorbsi : proses penyerapankembali . 20.dsb) yang tidakbiasadanpatutdiperhatikan (adakalanyamenandakanakanterjadisesuatu) Pasien : orang sakit (yang dirawatdokter).