P. 1
Revista Conocimiento 90

Revista Conocimiento 90

|Views: 5,919|Likes:

More info:

Published by: Revista Conocimiento en línea. on Sep 11, 2009
Copyright:Attribution Non-commercial

Availability:

Read on Scribd mobile: iPhone, iPad and Android.
download as PDF, TXT or read online from Scribd
See more
See less

11/09/2012

pdf

text

original

104

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

A personajes nuestros en ciencias de la vida
Doctor César Martín Cantú Ayala
Estudioso de la evolución, especialmente en el área que permite el entendimiento de los procesos naturales con miras a la conservación ecológica; los cambios graduales de los organismos vivos y los ecosistemas, y la percepción humana de la realidad, César Martín Cantú Ayala estudia las relaciones insectos-plantas y la selección de ecosistemas prioritarios para establecer áreas naturales protegidas. Es licenciado en Biología por la Facultad de Ciencias Biológicas de la Universidad Autónoma de Nuevo León, y tiene un Doctorado en Zoología por la Facultad de Ciencias Formales y Naturales de la Universidad de Viena, en Austria. Hizo una estancia sabática en Evaluación de Omisiones Geográficas de Conservación, en la Universidad de Idaho, en los Estados Unidos. Actualmente es profesor investigador en la Facultad de Ciencias Forestales de la UANL y miembro del Sistema Nacional de Investigadores.

Juan Roberto Zavala zavat_2004@yahoo.com.mx

Doctora María de Lourdes Lozano Vilano
Destacada investigadora en la relación evolutiva de los peces ciprinodóntidos, en cuanto a su desaparición y a la asociación con las actividades antropogénicas, María de Lourdes Lozano Vilano tiene también un importante trabajo sobre la Sistemática, Evolución y Zoogeografía del complejo alvarezi de los peces del género Cyprinodon, en el sur de Nuevo León. Actualmente es profesora investigadora y responsable del Laboratorio de Ictiología y de la Colección Ictiológica de la Facultad de Ciencias Biológicas de la UANL. Es bióloga y tiene una Maestría en Ciencias, con especialidad en Ecología Acuática y Pesca, ambos grados académicos por la UANL. Su Doctorado en Ciencias Biológicas es de la misma institución. Ha recibido numerosos premios y distinciones, de los que mencionamos: es miembro del SNI Nivel I, y en 1993 The Southwestern Association of Naturalis le otorgó el “Reconocimiento Misksch Sutton”.

Doctor Ricardo M. Cerda Flores
Estudioso de la evolución humana en grupos de mestizos e indígenas mexicanos, buscando la asociación de enfermedades, como la diabetes, obesidad y cáncer con genes candidatos y algunos factores ambientales como estilos de vida y sociodemográficos, Ricardo M. Cerda Flores realiza lo anterior utilizando modelos estadísticos y matemáticos. Asimismo, es estudioso de la genética forense en pruebas de paternidad. Es biólogo y tiene una Maestría en Genética, ambos grados académicos de la UANL. Su Doctorado en Ciencias, con especialidad en Genética, es de la misma institución. Hizo estudios posdoctorales en el Texas Medical Center, de la Universidad de Texas en Houston. Es autor de más de 70 artículos publicados en revistas indexadas, nacionales y extranjeras. Actualmente es investigador del CIBIN-IMSS; profesor de la Facultad de Enfermería de la UANL y, desde 1984, miembro del SNI.

Doctor Manuel Humberto Reyes Valdés
Investigador en el área de genética, con enfoque molecular para estudiar la estructura de las poblaciones silvestres de plantas mexicanas, y así conocer su diversidad y facilitar su conservación, Manuel Humberto Reyes Valdés trabaja con un enfoque de teoría de la información para conocer la complejidad en la expresión genética de los organismos, con el fin de medir el grado de especialización de sus diferentes tejidos. Es biólogo egresado de la Universidad Autónoma de Nuevo León, y tiene una Maestría en Genética de Plantas por la Universidad Autónoma Agraria Antonio Narro. Su Doctorado en Ciencias, con especialización en Genética, es de la Texas A & M University, en College Station, Texas. Actualmente es miembro del Sistema Nacional de Investigadores y profesor investigador en la UAAAN. Es autor de numerosos artículos científicos y de divulgación.

Doctora María Elena García Ramírez
Con importantes trabajos en la relación evolutiva del grupo de peces fundúlidos en México, investigando su origen y su posición taxonómica, con el fin de revisar si se encuentran bien ubicados jerárquicamente, María Elena García Ramírez ha descrito también una nueva especie de fundúlido para el manantial Baño de Ignacio, del sur de Nuevo León. Asimismo, es autora del importante artículo publicado en Bélgica “Estado actual del género Fundulus (Teleostei: Fundulidae) en México”. Es bióloga, e hizo una Maestría en Ecología Acuática, en la Universidad Autónoma de Nuevo León. Tiene un Doctorado en Ciencias, con especialidad en Ecología, de la misma institución. Actualmente es profesora investigadora en la Facultad de Ciencias Biológicas de la UANL. Es autora de diversos artículos científicos y de capítulos en libros.

Doctora Amada Torres Salazar
Dedicada a la investigación en el campo de la evolución humana, utilizando diferentes marcadores genéticos moleculares, Amada Torres Salazar busca conocer los procesos de migración que tienen impacto en la salud y la enfermedad, como la diabetes mellitus tipo II, obesidad y cáncer. Asimismo, realiza la búsqueda de proteínas con interés biotecnológico producidas en Bacillus thuringiensis, en concordancia con las herramientas de la genómica funcional y la bioinformática. Es química bacterióloga y parasitóloga, egresada de la Escuela Nacional de Ciencias Biológicas del IPN, habiendo realizado su disertación en Transferencia Horizontal en Microorganismos. Efectuó estudios de maestría en el Laboratorio de Variación Biológica y Evolución ENCB-IPN. Es profesora invitada de la FCQ-UANL y del ICB-UACJ, así como técnica en Investigación, del Instituto Mexicano del Seguro Social.

104y1.indd 1 forros.indd 1

CONTENIDO

EVOLUCIÓN DE LAS ESPECIES

Editorial
3
Evolución y creación ¿Será un dilema?

Evolución de las Especies
4
El origen de las especies: el libro de las maravillas Doctor Porfirio Carrillo Castilla-Alcocer Breve historia de la evolución del hombre Maestro Rodrigo Soto El problema del diseño y la revolución darwiniana Doctora Ana Barahona Efemérides en el pensamiento darwiniano Doctor César Cantú Ayala Vida: donación de amor Cardenal Javier Lozano Barragán Creación y evolución: azar y necesidad Doctor Carlos Mendoza Álvarez Un polizón llamado Darwin Doctor Antonio Lazcano Araujo Aproximaciones al origen de la vida y la evolución de las vías metabólicas Licenciado Geovani López La teoría sintética de la evolución y sus críticos Doctora Rosaura Ruiz Gutiérrez La teoría neutralista de la evolución molecular Maestro David Eduardo González Femat Evolución molecular Doctora Amada Torres Salazar Evolución de la pigmentación en la especie humana Doctor Esteban J. Parra Duplicación de genes: ¿Tautología biológica o evolución molecular hacia la diversificación de funciones? Licenciado Geovani López

Consejo Editorial
Presidente del Consejo de Ciencia y Tecnología de Nuevo León Ingeniero Juan Antonio González Aréchiga N. L. Gob. Licenciado Omar Cervantes Rodríguez Director del Programa Ciudad Internacional del Conocimiento Ingeniero Jaime Parada Ávila CAINTRA Ingeniero Xavier Lozano Martínez ITESM M. C. Silvia Patricia Mora Castro UANL Doctor Mario César Salinas Carmona Doctora Diana Reséndez Pérez Doctor Alan Castillo Rodríguez Ingeniero Jorge Mercado Salas

10 15 19 22 30 36 39

En su participación página 4, el doctor Porfirio Carrillo analiza concienzudamente el contenido de la obra de Darwin, El origen de las especies; el maestro Rodrigo Soto, página 10, se remonta a los orígenes del género humano, y lo acompaña en su proceso evolutivo hasta los tiempos actuales; la doctora Ana Barahona escribe, página 15, sobre la revolución científica que empezó con Copérnico y que dio un paso gigantesco con Darwin.

43 50 53 57 64

Directorio
Director General Doctor Luis Eugenio Todd Subdirector Licenciado Juan Roberto Zavala Director Editorial Félix Ramos Gamiño Educación Profesor Ismael Vidales Delgado Ciencias Básicas y del Ambiente Doctor Juan Lauro Aguirre Desarrollo Urbano y Social Ingeniero Gabriel Todd Ciencias Médicas Doctor David Gómez Almaguer Ciencias Políticas y / o de Administración Pública Contador Público José Cárdenas Cavazos Ciencias de la Comunicación Doctora Patricia Liliana Cerda Pérez

El doctor César Cantú Ayala destaca, página 19, fechas importantes en la vida de Darwin y su obra; el cardenal Javier Lozano Barragán, página 22, considera que el debate entre creacionismo y evolucionismo está fuera de lugar, ya que, vistos en la correcta perspectiva, no se excluyen; el doctor Carlos Mendoza Álvarez recuerda, página 30, que, al final de su obra, el mismo Darwin reconoce la posibilidad de que su teoría de la evolución de las especies fuese compatible con la afirmación teológica de un Dios creador.

17/02/2009 05:31:45 p.m. 17/02/2009 03:32:59 p.m.

En la Pinacoteca de Nuevo León

102

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

CONTENIDO

‘“José Luis Cuevas en bronce”, homenaje al artista en su aniversario 75
68
La morfología de los primeros humanos de la cuenca de México Antropólogo Físico José Concepción Jiménez López Antropólogo Físico Gloria Martínez Sosa Antropólogo Físico Rocío Hernández Flores Aplicaciones de la genética de poblaciones en las ciencias genómicas Doctor Ricardo M. Cerda Flores

EVOLUCIÓN DE LAS ESPECIES

72

Directorio
La Ciencia es Cultura Licenciado Jorge Pedraza Ingeniera Claudia Ordaz Educación Física y Deporte Doctor Óscar Salas Fraire Las Universidades y la Ciencia Doctor Mario César Salinas Carmona Redacción Licenciado Carlos Joloy Diseño Lindsay Jiménez Espinosa Javier Estrada Ceja Arte Gráfico Arquitecto Rafael Adame Doria Circulación y Administración Profesor Oliverio Anaya Rodríguez
“CIENCIA CONOCIMIENTO TECNOLOGIA”, revista quincenal. Editor responsable: Dr. Luis Eugenio Todd Pérez. Número de Certificado de Reserva otorgado por el Instituto Nacional del Derecho de Autor: 04-2008052311205700-102. Número de Certificado de Licitud de Título: No. 14158 Número de Certificado de Licitud de Contenido: No. 11731. Domicilio de la Publicación: Andes No. 2722 Col. Jardín Obispado, Monterrey, Nuevo León. Imprenta: Milenio Diario de Monterrey, S.A. de C.V., con domicilio en Ave. Avena No. 17 Col. Granja Sanitaria Ixtapalapa, Estado de México. Distribuidor: Milenio Diario de Monterrey, S.A. de C.V. con domicilio en Ave. Eugenio Garza Sada Sur No. 2245 Monterrey, Nuevo León.” Teléfonos en la redacción: 8346 7351 y 8346 7499 info@conocimientoenlinea.com Las opiniones expresadas en los artículos son responsabilidad exclusiva de sus autores.

77

81

84 88

90

92

93 94 96 100 102 102

a Pinacoteca de Nuevo León celebrará el 75 aniversario de vida del artista José Luis Cuevas, con la preLos arrecifes coralinos: evolución biológica, sentación de una exposición-homenaje denominada no creación divina “José Luis Cuevas en bronce”. La inauguración se llevará Biólogo Juan Jacobo Schmitter Soto a cabo el 26 de febrero, día en que el artista festeja su La teoría de la evolución, dice el cumpleaños. La vaquita (Phocoena sinus), marsopa endémica doctor Antonio Lazcano Araujo, Por primera vez en Monterrey se ofrecerá una exdel Golfo de California página 36, nos permite comprenposición exclusiva de esculturas de Cuevas; se contará con Maestro Adrián Munguía Vega der el origen de la resistencia a los 25 esculturas realizadas en bronce de pequeño y mediano Doctor Ricardo Vázquez Juárez antibióticos, y el surgimiento de formato, que abarcan de 1991 a 2008. Se incluyen seis la gripe aviar; el licenciado Geoobras inéditas del artista y una escultura de gran formato, Darwinismo en la era de la información vani López afirma, página 39, que piezas que forman parte de la colección del Museo José Doctor M. Humberto Reyes Valdés cuando se habla de evolución, se Luis Cuevas. tiene que contemplar el origen de La curaduría para este evento corrió a cargo de José Las teorías de la evolución la vida en términos materialistas; Luis Cuevas y la señora Beatriz del Carmen Bazán de Cueno han evolucionado la doctora Rosaura Ruiz revisa vas, mientras que la museografía es de Manuel Alegría. Profesor Ismael Vidales Delgado dos de las polémicas recientes Para la inauguración se contará con la presencia de que han surgido en torno al darimportantes personalidades del ámbito cultural de la CiuCharles Darwin y su obra maestra, winismo, página 43. dad de México. El artísta estará acompañado de su esposa, 150 años después Beatriz del Carmen Bazán de Cuevas, quien es también la Ingeniera Claudia Ordaz directora del Museo José Luis Cuevas. El evento, que encabezará el gobernador de Nuevo León, La teoría de la evolución y su impacto en el licenciado José Natividad González Parás, se llevará a cabo pensamiento occidental moderno a las 20:00 horas en el patio de las esculturas de la PinaDoctora Patricia Liliana Cerda Pérez coteca, institución que dirige la señora Elvira Lozano de Todd, y que se ubica en Colegio Civil Centro Cultural Universitario, en Juárez y Washington. La entrada es libre. La evolución de la Tierra se dio en dos oleadas de oxigenación

L

Darwin: su legado La mente humana Herbolaria Doctor Alfredo Piñeyro “José Luis Cuevas en bronce”, homenaje al artista en su Aniversario 75 Reconocimiento

Dos artículos concebidos desde ópticas diferentes en torno a la teoría de la evolución molecular escriben el maestro David Eduardo González, página 50, y la doctora Amada Torres Salazar, página 53; a su vez, la evolución de la pigmentación en la especie humana es tema del doctor Esteban J. Parra, página 57; el antropólogo José Concepción Jiménez y sus colaboradores estudian la morfología de los primeros humanos de la cuenca de México, página 68.

Portada

Evolución de las Especies

CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES

103

Evolución y creación
¿Será un dilema?
José Luis Cuevas

EDITORIAL

E

El artista nació en México el 26 de febrero de 1934. Es dibujante, grabador, escultor y escritor. Personaje clave en el arte mexicano de la segunda mitad del siglo XX, dibujante desde los cinco años, alumno irregular de La Esmeralda, expuso por primera vez a los catorce años, época en la que estudió grabado con Dolores Cueto. Desde los años 40, su obra se dio a conocer en los círculos de arte internacional. En 1954 expuso en Washington, D.C. Desde entonces, comenzó a desarrollar su personaje público que lo ha llevado a convertirse en una figura polémica del mundo cultural. Miembro de la Generación de la Ruptura en la plástica mexicana, al lado de Manuel Felguérez, Lilia Carrillo y Vicente Rojo, entre otros, Cuevas se opuso a los movimientos nacionalistas. En 1958 publicó una carta dirigida a Femando Benítez en el suplemento México en la Cultura del periódico Novedades que más tarde se conocería como una especie de manifiesto titulado La Cortina de Nopal, en la que criticó la situación cultural del México de la época. Ha recibido diversos reconocimientos entre los que destacan, Primer Premio de Dibujo de la Quinta Bienal de Sao Paulo por la serie Funerales n este volumen se vierten opiniones científicas so- deelun Dictador, en 1959; Primer la opinión de una estema, pero también agregamos Premio Internacional de Grabado en la Trienal bre un tema que se ha contaminado a lo largo de la tructura en 1968; Premio Nacional de Nueva Delhi India, eclesiástica muy importante, como es la Iglesia historia reciente, y desde la publicación de ElCiencias yCatólica, con su representante brillante y mexicano, el de origen Artes en 1981; Premio Nacional de las especies, de Charles Darwin, por unade Arte otorgado por el Gobierno de la Ciudad presidente del Conaparente cardenal Javier Lozano Barragán, de México, en 1982. discusión entre la religión y la ciencia y con una concep- creó el Museo José Luis Cuevasde la Salud, del Vaticano, En 1992 se sejo Pontificio para la Pastoral al ción antitésica del concepto evolución vs descripción, y con un destacado jesuita, el de que el artista donó su colección privada doctor Carlos Mendoza arte y un Álvarez. que en el Génesis se hace de la acción creativa de en donde presentó en 1994 la muestra Dios que en los llamados siete días creó este Renovación de piel. En 1997 este viaje una planeta. Aprovechando presenta histórico, dejamos en la exposición en el Museo de la Moneda de La conmemoración del nacimiento de Darwin, que recibe el Premio de la Medallística bellísimo recuerdo contraportada de esta revista el Madrid y desde Cambridge, Inglaterra, hizo temblar Tomás Francisco Prieto, de un darwinista Reina al mundo presencial entregado por la excepcional, el biólogo SalSofía. En con su visión de la evolución como elemento fundamen-1991 recibe la Orden de Caballero partió al cosmos del vador Contreras Balderas, quien de las Artes y las Letras. En 2001 recibe la tal para la perfección de las especies, con su máxima infinitootorgada porfebrero de 2009. Orden Andrés Bello, el día 11 de la República obra: el ser humano, merece reconocimiento mundial, de Venezuela. Bolivariana En figura basado en la comprensión y la exaltación de la junio de 2008 se realizó en el Palacio de Bellas Artes una exposición-homenaje a José científica de ese gran personaje, y no debe ser contamiLuis Cuevas, como un reconocimiento a su nada por una visión metafísica que, aunquedestacada labor artística. La exposición fue muy resinaugurada petable, se basa en la fe y en la interpretación de la Bi- por el presidente de la República, blia, bellísimo documento lleno de parábolas,licenciado Felipe Calderón Hinojosa. ejemplos 1596 a 1650 y comparaciones, que no tiene por qué utilizar el método científico convencional, porque, quizás, para ese libro trascendental, los días y las horas son diferentes ¿Por qué tantos problemas, si que los que marca la clásica estructura de los calenla creación se justicia con la darios y la de los horarios en que vivimos. evolución? Como homenaje a Charles Darwin, en este número de la revista Ciencia, Conocimiento, Tecnología, invitamos a científicos nacionales y extranjeros, expertos en

Pienso, luego existo

DESCARTES

100

4

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

HERBOLARIA
El origen de las especies:
Treinta por ciento de los fármacos utilizados en medicina proceden del reino vegetal terminada; Porfirio Carrillo Castilla-Alcocer “Mi obra está ahora (1859)
pero como el completarla me tomará aún muchos años y mi salud

(Nota de la Redacción: En nuestra edición anterior, se publicó incompleto el artículo del doctor Alfredo Piñeyro López. En esta edición se repite –ya con el agregado- el artículo de referencia).

el libro de las maravillas
E

l Origen, y nos referimos principalmente a la sexta edición, comienza con una nota histórica sobre el desAlfredo Piñeyro López arrollo de las ideas acerca de la evolución de las esdista de ser robusta, he sido alenprimitivo difíciles de comprender, ya que su ingestión o pecies. En ella, Darwin nos indica cómo leer su obra, “un tado a publicar este resumen. erbolaria: forma anticuada de referirse a la botánica exposición a ellas, podía dar lugar a cambios notorios del resumen” de lo que debiera ser un trabajo monumental, Me ha movido especialmente a orientada a la terapéutica médica. Según el Diccio- comportamiento humano, tanto en su conducta como en que el naturalista concibió originalmente para muchos hacerlo el hecho de que mister nario de la Lengua de la Real Academia Española, su estado físico. más años de reflexión y sobre todo para colectar y analiWallace, quien está estudiando la Vigésima Segunda Edición, debiera preferirse el vocablo zar más evidencia. historia natural del Archipiélago CAMBIOS DE COMPORTAMIENTO Doctor Porfirioherbología. Doctor en Exhibe sin pudor sus propias interpretaciones erróneas Malayo, ha llegado exactamente a Carrillo CastillaEn la antigüedad, el reino vegetal fue la mayor fuente Esos cambios en el comportamiento del ser humano tarMedicina Alfredo desde la publicación del origen: “…cuando se publicó la las mismas conclusiones generales Alcocer de medicamentos y de venenos utilizados por los médi- daron miles de años en ser comprendidos, desde interprePiñeyro López Investigador primera tan completamente a las que yo he llegado sobre el Ex-rector UANL Ccos, quienes por acierto-error, durante milenios separaron ori-tarlos comoedición de esta obra, estaba yoprincipio bueno debidos a la presencia de un Titular engañado, como lo estaban otros por gen de Profesor emérito de delas plantas alimenticias de aquéllaslas especies… este resumeno malo, a la acción potente de la magia, a expresiones como: Instituto que no lo eran. la homeopatía, Farmacología “la actuación continua del creador”. Asimismo, hace un que publico ahora tiene necesaNeurotología Los alimentos de sabor dulce se dejan separar de etcétera, etcétera… y Toxicología / Universidad reconocimiento a la claridad de la explicación dada para la riamente que ser imperfecto”. Finalmente fue la teoría de los receptores, planteada UANL Veracruzanamanera relativamente fácil de los compuestos amargos, selección natural por Alfred Russel Wallace. pineyro@ipharma. Director Generallos que habitualmente contienen alcaloides y glucósidos. a finales del siglo XIX por Paul Erhlich (1896), lo que ha com.mx Sabía Darwin Charles Darwin de PosgradoLas plantas que los contienen resultaban para el brujo permitido desarrollarque la primera batalla que debía librar, el conocimiento del mecanismo y si y sin duda una de la centrales, era la de demostrar que pocarrillo@uv.mx

H

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

5

101

con el paso del tiempo las especies cambiaban; no eran tio exacto de acción de los medicamentos, primero a inmutables; variaban; eran dinámicas en sus formas, y nivel molecular, tanto a nivel membrana como a nivel inlo resuelve recurriendo a sus orígenes, al entorno de tracelular y luego a nivel nanomolecular. su infancia, al huerto, a la granja, a los agricultores; criaSin embargo, todas las creencias acumuladas en el dores de plantas y animales, que, si algo saben de suyo, transcurso de los milenios no han desaparecido; han es precisamente eso: que las especies domésticas bajo su persistido, y constituyen nuestro pensamiento mágico, cuidado van variando constantemente, y que no obstante nuestra vía de pensamiento paralelo a nuestro pensano saber cuál es el origen de las razas domésticas y sus miento científico, y al mismo tiempo motor de él. variaciones, sí se sabe –y se demuestra ampliamente- que Podría decirse, sin caer en el exceso, que todo el pensaesa variación de los progenitores puede ser transmitida a miento humano procede de un primer contacto entre esos la descendencia. alimentos y venenos primigenios, que nos llevaron a desarrollarnos tal como hoy somos, como seres humanos. EL PERRO Y LA PALOMA Aparecen en este capítulo dos especies importantes en la MEDICAMENTOS DEL REINO VEGETAL obra de Darwin: el perro y la paloma. Las descripciones En la actualidad, después del auge de la síntesis química, de las distintas cruzas entre razas de paloma, hechas a lo todavía alrededor del 30 por ciento de los fármacos utilargo de muchos años por el propio Darwin, junto con las lizados en medicina proceden del reino vegetal, con una interesantes referencias históricas, muestran al lector lo tendencia notoria a crecer, ya que progresivamente se aísque será este atento y disciplinado observador-relator: un lan nuevos medicamentos de este origen. apasionado de las especies vivientes, que traza una ruta Sin embargo, debemos preguntarnos si esto es lo que hacia la comprobación de sus teorías, utilizando, referense entiende como herbolaria, y la respuesta es tajante: cias eruditas, descripciones que rayan en la composición de ninguna manera; esto no es herbolaria, esto es sólo la literaria y un rigor de pensamiento basado en abundantes fuente del origen de nuestro abastecimiento de materia evidencias: Clásicos romanos, enciclopedias chinas, refeprima, a veces interconectado con la síntesis artificial de rencias a Plinio, África vista por lo ojos del gran Livingnuevos fármacos. stone, salvajes y bárbaros y su relación con los animales, Herbolaria sería el uso directo de las plantas como horticultores de la antigüedad, etcétera; todos reunidos en medicamentos, lo que es frecuentemente posible, pero se un deslumbrante y bien descrito mosaico que nos muestra requiere de severos controles, donde se conozca la natula importancia que tiene la selección de especies por el raleza química de los diversos compuestos que la planta hombre, la selección artificial. produzca; donde se determinen las concentraciones de ellos; donde se establezcan las características de estabiFUNCIÓN DE LAS VARIACIONES lidad, como son humedad, temperatura y luz permitida; A continuación, en el capítulo dos, Darwin nos vuelve a donde en estudios clínicos controlados se pueda establedejar perplejos, ahora poniéndonos justo en el lugar que cer, en función de la dosis, la actividad y seguridad del nos corresponde, estemos para verlas o no, para selecciomedicamento; en fin, tratar ese medicamento herbolario narlas o no; es en realidad la naturaleza el escenario más como cualquier otro que deba ser incorporado en el arseimportante donde se llevan a cabo las variaciones; es ahí nal terapéutico. mismo donde ellas toman su principal función: servir a la para no perdernos en creer actos únicos de creación para sobrevivencia y evolución de las especies. cada especie o individuo, a lo que irremediablemente lleFACTORES QUE INFLUYEN Nuestra intervención, si se da, es apenas una mera megaríamos si no aceptamos que hay variaciones individuaNaturalmente habrá quienes generen objeciones a estos táfora expresada en la crianza; lo real es la lucha por la exisles entre las especies. procedimientos, por considerarlos excesivos o innecesatencia, donde las variaciones ventajosas, por mínimas rios. Sin embargo, la cantidad y calidad de un fármaco que sean, determinan al ganador; es éste el verdadero LA LUCHA POR LA EXISTENCIA depende de las características de la cosecha, de la naturavalor del cambio, la sobrevivencia, como lo demostrará En el capítulo tres, Darwin advierte, con su proverbial senleza del suelo, de la genética de la planta, de la humedad a continuación. tido de la crítica, que lo anteriormente descrito no es una recibida, de la luz y temperatura expuesta, de la forma de En el capítulo tres encontramos explicaciones muy imregla absoluta; así, indica que la simple existencia de variarecoger la cosecha, de la forma de almacenarla (exposición portantes. La primera es la comprobación de que las espebilidad no explica cómo aparecen las especies en la naa bacterias, hongos, virus). cies varían en estado natural, no tan sólo en la granja o en turaleza; es necesario considerar el fenómeno fundamenSólo así se puede llevar el control de estos medila huerta, de tal modo que varios de los principios de la tal de la lucha por la existencia. De acuerdo a esta lucha, camentos, en la industria destinada a este fin y no en variación y sus consecuencias, descritos en el capítulo anlas más ligeras variaciones, si son provechosas para los una hierbería, localizada en la penumbra húmeda de un terior, se aplican a la variación individual en la naturaleza individuos de una especie, tenderán a conservar a estos mercado, revueltos con otras yerbas y sin controles de y cómo incluso esta variación puede servir para reconocer individuos y sobre todo serán transmitidas, heredadas, a alguna clase y ordenar, clasificar a las especies. su descendencia. Finalmente, se debe remarcar que, por las razones Las mariposas de Wallace en el Archipiélago Malayo, Aquí está, pues, la selección natural; la conservaexpuestas, la fabricación de medicamentos realmente los crustáceos en Brasil, las hormigas, son algunos de los ción de variaciones útiles para la sobrevivencia de los herbolarios es notoriamente más cara que la de los conejemplos que se citan. Sin embargo, en esta amplia diverque serán los más aptos. La selección natural, nos dice vencionales, ya que de manera implícita requiere mayor sidad de variaciones es importante ser un observador cuiDarwin, “siempre es una fuerza dispuesta a la acción y complejidad. dadoso para decidir cuáles son las variedades y cuáles las será siempre enormemente superior a los esfuerzos del especies, o al menos recurrir a los consensos y todo ello hombre; así de superiores serán las obras de la naturaleza

98

6

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

con respecto a las obras de arte”. Hablando de la lucha por la existencia, ese principio tan importante al cual llegó más rápida y claramente a través de la obra de Malthus, el viajero del Beagle nos advierte que la desarrollará más ampliamente en una obra futura. Será muy difícil entender la complejidad del mundo natural, sin este principio en mente, o de plano haremos una mala comprensión, y esto es fácil, si nos dejamos llevar por el “rostro resplandeciente y aparentemente feliz de la naturaleza”, nos dice el agudo e inteligente observador; tenemos que apreciar el resplandor sin dejar de reconocer que éste implica también destrucción; ciertamente es así: las aves de bellos cantos se alimentan de los insectos que matan, y a su vez las cantoras son aniquiladas, junto con su polluelos por otras aves o mamíferos rapaces; la naturaleza es para Darwin, y está exactamente en lo cierto, un espectáculo de belleza y horror, escenario de distintos niveles naturales interconectados por eslabones de individuos, donde, dependiendo de lo observado, te- hay quien conscientemente seleccione; no es una fuerza nemos escenas de esplendor o de destrucción; de gene- divina; es una metáfora explicativa de un conjunto de proración de vida o de muerte. cesos que permiten la adaptación, la sobrevivencia y la reLa expresión de la lucha por la existencia es usada por producción de los más aptos; una síntesis o metáfora. “Si Darwin en un sentido metafórico: “sólo tiene sentido para personificamos la palabra naturaleza, es por asumir que describir cómo los seres dependen unos de otros, un teji- esta personificación es en realidad sólo la acción y el do de complejas relaciones”, y, lo que es más importante, resultado totales de muchas leyes naturales, y por leyes, no se trata solamente del individuo, sino de la producción la sucesión de hechos, en cuanto conocidos por nosotros”. de descendencia. Es, nos dice Darwin, la doctrina de Mal- Brillante, sin duda, la explicación darwiniana para lo que thus llevada al reino vegetal y al animal; incluso el hombre llama objeciones superficiales a los términos. también está sujeto a esta ley y a esta lucha. Hila sus explicaciones con contundentes metáforas Leer este importante capítulo es imaginar que Darwin comparativas entre el papel seleccionador del hombre y de bien pudo haber quedado maravillado y a la vez horror- la naturaleza, revelando el pobre papel del hombre; la seizado de esta visión de la lucha. La prueba está en el ex- lección natural como mecanismo es constante, imparable, traordinario párrafo que El polvo se asienta cierra el capitulo: “cuando reflex- cuidadosa, selectiva, conservativa, silenciosa, oportunista, ionamos sobre esta lucha, nos podemos consolar con la colorista, invisible, intemporal, e incluso hasta buena a los completa seguridad de que la guerra en la naturaleza no ojos de Darwin, en cuanto que adiciona ventajas indiviParece que este conflicto es entre dos diferentes con- querir la importación de un principio divino para a fin de es incesante; que no se siente ningún miedo; que la muerte duales que se transforman en bienes colectivos para benjuntos axiomáticos, ambos utilizando algunos principios cuentas terminar dicho cuestionamiento. es generalmente rápida, y que el vigoroso, el sano, el feliz, eficio de una comunidad. científicos, ambos con el misticismo como fundamento, sobrevive y se multiplica”. Desafortunadamente, no todo proponente viene a la ambos rechazando ciertos aspectos de la ciencia estabmesa con una intención pura. Algunos expertos en Diseño lecida. EXPLICACIÓN DE LA SELECCIÓN NATURAL Inteligente buscan instituir un principio místico específico El capítulo cuarto, uno de los más extensos, si no el que Desafortunadamente, ambos lados tienen algunos pro- por encima del proceso científico. más, es la argumen-tación y descripción cuidadosa del ponentes con objetivos alternativos. principio poderoso de la selección natural o la supervivenAlgunos proponentes de la Teoría de la Evolución cia del más apto. La argumentación y explicación darwiEl “verdadero” proponente de la Teoría de la Evolución exigen que el contenido actual de dicha teoría sea geniana nuevamente inicia partiendo de los procesos que no tendría problema en cuestionar observaciones, datos neralmente aceptado sin cuestionamientos; a veces desean ha observado en las crianzas domésticas; la selección de o teorías. La Teoría de la Evolución es más que sólo una propagar una agenda ateísta trascendente de la ciencia. caracteres que el agricultor hace ¿opera en la naturaleza? Las teorías científicas y los datos siempre se basan en teoría; es más bien un reflejo directo de la conciencia huSí, y eficazmente, nos dice el autor. Así, nos define que “a axiomas y deben ser cuestionados, pero la naturaleza axiomana del tiempo. la conservación de las diferencias y variaciones indiviLos resultados del cuestionamiento relativo a la evo- mática del pensamiento humano no debe ser corrompida dualmente favorables y a la destrucción de las perjudilución sólo nos ayudan a profundizar lo que entendemos con agendas cerradas. ciales le he llamado yo selección natural o sobrevivencia de nuestras propias mentes y de la física del universo: su del más apto”. Ahí está, resumido, en gran parte, el arduo inteligencia. Por qué y cómo trabajo de observación y deducción en la vida de Darwin; brevedad descriptiva, resultado de un largo proceso. Si no podemos explicar algo, eso no significa que esta Jamás entenderemos por completo un universo desA partir de este poderoso enunciado, Darwin tejerá painteligencia no existe; significa que no la entendemos, se provisto de presencia humana. A través de nuestra exiscientemente un cúmulo importante de explicaciones para base o no en Dios. tencia nuestra mente, percepción y conciencia se vuelven derrumbar los malentendidos de su propuesta y la franca El “verdadero” proponente del Diseño Inteligente bus- parte de la realidad: su descripción completa debe ser conoposición a la misma; incluso aclara que la palabra seleccaría profundizar el cuestionamiento de la ciencia, sin re- tenida dentro de cualquier modelo de física cerrado. ción natural es, obviamente, falsa en su sentido literal; no

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

7

99

modificación gradual en las especies, es “convertir las oSELECCIÓN SEXUAL Si hay un Dios, la evolución es meramente una herramienta para ayudarnos La evolución es el proceso de la mente humana. No bras de Dios en pura burla y engaño; casi preferiría yo A continuación, Darwin explica otro de los principios atestiguar la majestad de Dios más plenamente. Si Dios nos creó, puede que podemos invalidarlo, ni podemos extraerlo de nuestro creer, junto con los antiguos e ignorantes cosmogonistas, poderosos de su teoría: la selección sexual, “esta forma de jamás sepamos porqué ya que la ciencia no intenta contestar dicha pregunta. proceso científico; sólo podemos refinarlo, atemperando y que las conchas fósiles no han vivido nunca, sino que han selección depende, no de una lucha por la existencia, sino Pero nos quedamos con nuestra existencia; y un sorprendente sendero de artereformando nuestras bases axiomáticas de pensamiento. sido creadas de piedra para imitar las conchas que viven de la lucha de los individuos de un sexo, generalmente los factos demostrando que algún fantástico proceso ha ocurrido. Atestiguamos en las orillas del mar”. machos- por la posesión del otro sexo. El resultado no es nuestra evolución de todo lo que nos precede: si Dios creó al hombre del polvo, La doctrina de la Selección Natural depende del axioDespués de cinco capítulos ampliamente descriptivos, la muerte del competidor perdedor, sino el dejar poca o la ciencia estudia, con asombro, las migajas dejadas tentadoramente a su paso. ma de cómo se define lo natural. Cuando uno sustrae a deductivos, plagados de evidencias y citas de autores resninguna descendencia. La selección sexual es menos riguSi no hay Dios, el hecho de que existimos y que de algún modo somos derivala humanidad del universo participativo, el resultado es lo petados, el enunciado de la teoría está casi construido; rosa que la natural”. dos de / con fuerzas fundamentales y “algo externo” me deja sólo una palabra, que la mayoría de la gente define como naturaleza: aquello esta seguridad está íntimamente basada en los hechos desDe regreso a la selección natural, el acostumbrado impoluta de formalidad estructural, más allá de la plena definición, para refedesprovisto de interferencia humana. Esto presupone que critos. Darwin nos los demuestra ciertamente, no tan detalle de los ejemplos inunda el texto y nos llena de rirme a la totalidad de mis insondables circunstancias: Dios. dicha sustracción es de hecho posible. Si nos vemos a sólo al agrupar las principales objeciones que cualquieevidencias; entre otros, lobos, aranes, insectos, flores y nosotros mismos menos arrogantemente—no como amos ra y él mismo le pondría a su teoría, sino además por la inglés por Farouk Rojas abejas observadas por Darwin en un fundacional trabajo Traducción del del universo o aislados en su centro—descubrimos que contundente explicación que va dando a cada de estas de etología. Todo para decirnos cómo esta visión por él somos en verdad naturales. La perspectiva expandida de cuatro Acerca de Executive Success Programs, Inc. objeciones, para él las principales. En realidad la propuesta da pie a la comprensión de hechos que de otra la física para incluir a la humanidad conduce a un signifiexplicación detallada para cada una se encuentra, al memanera serían inexplicables. cado más profundo de la Selección Natural. Con esta persExecutive Success Programs, Inc.MR (ESP) ofrece programas de nos, en los próximos cuatro capítulos. Un punto fundamental para entender la selección pectiva más ecológica, holográfica, ¿cómo podría haber entrenamiento enfocados en crear consistencia en todas las áreas En el primer caso, Darwin se pregunta: “¿Por qué, si las natural es la comprensión de los procesos de extinción, y ayudar a desarrollar las habilidades prácticas, emocionales e Selección Antinatural? Así, la Evolución y las ideas sobre especies, como las aves actuales, necesita para alcanzar su máximo potencial. principalmente de las especies poco representadas o intelectuales que la gente han descendido de otras Selección Natural se vuelven tautologías: siempre verdad. Todos los programas de ESP utilizan una de tranespecies, no encontramos innumerables formastecnología punta con patente escasas. Otro principio básico del capítulo lo es la diverMR sición? en trámite llamada Cuestionamiento Racional , una ciencia basada en ¿Por qué, en lugar de haber confusión, hay especies gencia de caracteres: “cuanto más se diferencian los desla creencia que entre más consistentes sean las creencias y patrones ¿Fuerza esto la no-existencia de Dios? bien definidas en la de un individuo, más exitoso será quetodo lo que haga. El cendientes de una especie, tanto más serán capaces de de conducta naturaleza? Darwin nos recuerda en las variaciones seleccionadas naturalmente a las personas volver a examinar ocupar puestos adicionales en la economía de la naturaCuestionamiento RacionalMR permite para la sobreEn mi mente, la práctica religiosa o espiritual ofrece e incorporar aptos, para la adaptación a condiciovivencia de los más percepciones que pueden ser la base de limitaciones leza y aumentar en número”. un propósito de existencia: a la religión le conciernen axioautoimpuestas. nes y competencias, van acompañadas irremediablemente Darwin nos explica, en un cuadro brillantemente consmas de “porqué”, la ciencia utiliza axiomas para examinar de extinción de las formas menos adaptadas. Las formas truido, y combinando los principios de selección natural y “cómo”. Son compañeros sin conflicto de la condición huMayores informes: info@nxivm.com de transición resultado de esta selección y adaptación no extinción, un gran árbol con ramas que se extienden por mana. las vemos, ya que los registros geológicos, lo conservado todas partes; cómo los descendientes modificados de las pues, es significativamente menor e imperfecto de lo que especies prosperan mejor en la medida que sean más difegeneralmente se asume. Dice Darwin: “la corteza terrestre rentes a sus progenitores. La comprensión de este cuadro es un inmenso museo”, pero “imperfecto y lento”. es fundamental para entender gran parte del proceso de la evolución, y regresará a él en otros capítulos. Nos previene Darwin de que la construcción de este árbol debe ser leída e interpretada con cuidado; hay ramificaciones en todos sentidos, obviamente no representadas en un espacio bidimensional, y, además, el sentido de arriba y abajo “no es sinónimo de inferioridad o superioridad en la cualidad de los seres vivos”. A continuación, la expresión de Goethe “la naturaleza, para gastar en un lado, está obligada a economizar en otro”, sirve para adentrarnos en la explicación sobre la compensación y economía de crecimiento. Aquí, Darwin nos ofrece explicaciones detalladas de uno de los grupos más estudiados por él: los crustáceos del grupo de los cirrípedos. REAPARICIÓN DE CARACTERES La presencia súbita del color azul en distintas palomas: la presencia de tallos gruesos o raíces en distintos nabos; la presencia de rayas entre los asnos, cebras y/o caballos, son algunos de los brillantes ejemplos de este capítulo; deducciones elaboradas, entre otras, en el caballo belga, a partir de dibujos realizados por uno de los hijos de Darwin, o la cruza que el propio Darwin realizó entre una yegua y un caballo. Nos dice el autor: “la mejor hipótesis para explicar la reaparición de caracteres antiquísimos es que en los jóvenes de sucesivas generaciones existe una tendencia a presentar el carácter perdido desde hace mucho tiempo”. No admitirla, como prueba de la descendencia común con

96

8

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

La mente humana

Darwin, por lo resumido de su obra, tanto en argumenMECANISMO DE EVOLUCIÓN Para hablar de las sutiles pero importantes gradaciones, tación como en ejemplos que quisiera mostrar, no quiere Darwin usa una amplia explicación acerca de cómo la se- dejar dudas sin aclarar, objeciones que en la mente del lección natural pudo ciertamente haber sido el mecanismo lector del Origen quedaran como elementos de crítica y para la evolución del ojo, sin duda uno de los órganos más desacreditación de la teoría expuesta. El lector, para Darsofisticados y a la vez flexible. En uno de los párrafos win, debe ser un convencido de que la selección es el por Keith Raniere más contundentes y bellos del origen, Darwin manifiesta: mecanismo central de la teoría. Por ello dedica también el capítulo siete a explicar y Lo “Cuando se dijo por vez primera que el sol estaba quieque es es to y la tierra giraba a su alrededor, el sentido común de- aclarar ampliamente las dificultades que pueden seguirse claró como falsa esta doctrina; pero el antiguo adagio de presentando para aceptarla; sin embargo, Darwin hace Todo lo que experimentamos es incierto sin embargo Todo es cierto y todo es falso. Esta es la naturaleza y vox populi, vox Dei, como todo filósofo sabe, no puede una importante aclaración: las objeciones contestadas son limitación del pensamiento y la percepción humanos. La de algún modo construimos la suficiente certeza para admitirse en la ciencia. La razón me dice que puede de- para los que al menos intenten comprender sus ideas; los única forma de darle sentido a la “realidad” es dar un salto movernos en el mundo. Por ejemplo, yo creo que puedo mostrarse que existen muchas gradaciones, desde un ojo lectores o naturalistas que no traten el Origen con atende fe, aceptar ciertos axiomas y, en base a estos axiomas, levantarme de mi escritorio y viajar al piso de abajo de mi sencillo e imperfecto a un ojo complejo y perfecto, y cada ción y esmero no cuentan”. casa. ¿Cómo sé esto? Recuerdo haber hecho recorridos intentar construir conocimiento. De acuerdo con lo anterior, no llama entonces la atengrado es útil al animal que lo posee”. ¿Qué es el conocimiento? El conocimiento es capacid- similares; de hecho creo que existe un piso de abajo de mi A partir de esto, viene la detallada descripción que ción el que cerca de ¡40 cuartillas de las casi 60 ¡del capíad de predecir. ¿Cómo se que “se” esto? Bueno, sin entrar casa (aunque desde mi ubicación actual no tengo evidenva del nervio óptico, el ojo primitivo, hasta el ojo de los tulo siete, estén dedicadas a contestar a George Mivart, un en un largo discurso auto-referente lo suficientemente cia sensorial de su existencia) y creo que recuerdo haber vertebrados, con citas a Wallace, Owen y por supuesto a distinguido biólogo londinense que rivalizó fuertemente complejo como para enorgullecer a Jean Paul Sartre, un hecho dichos recorridos anteriormente. ¿Tengo absoluta Virchow. No falta la comparación del ojo con un telesco- con Darwin y sus ideas, y que incluso publicó en 1871, el argumento excesivamente simplificado de esta equivalen- certeza de que existe un piso de abajo de mi casa? No. pio. En otro pasaje, ampliamente citado y celebrado por libro titulado On the genesis of species –sobre la génesis cia es como sigue: ¿Hay alguna vez en la que sepa algo sin ¿He alguna vez soñado algo que pensaba era verdad y no los darwinistas modernos, y para referirse a la variación de las especies-, una férrea oposición a Darwin, ya que, embargo este conocimiento no tenga implicaciones de pre- lo era? Sí, tal vez estoy soñando y de hecho vivo en una de los órganos, Darwin nos cita “la vieja y algo exagerada según Mivart, la teoría de la selección natural no explicaba dicción? Sospecho, al reflexionar, que habrá de llegarse a tienda de campaña en Arizona. ¿Es infalible mi memoria? regla de Historia Natural, de Natura non facit saltum, la del todo los estadios incipientes de estructuras que serían la conclusión de que si el conocimiento no tiene valor de No, con miles de millones de señales sensoriales entrando naturaleza no trabaja haciendo saltos”. Asimismo, Darwin más tarde de gran utilidad. predicción, no hay uso que darle al conocimiento ni habi- a mi cerebro, sólo tengo un pequeño porcentaje de ellas reflexiona: “la selección obra solamente aprovechando lidad para clasificarle. Aún verbalizar el conocimiento, o dentro de mi procesamiento consciente; incluso aquellas pequeñas variaciones sucesivas; no puede dar nunca un cuantificarle de forma alguna, implica predicción. Porque que puedo recordar son por necesidad distorsionadas por gran salto brusco, sino adelanta por pasos pequeños, secualquier cantidad y cualidad tiene propiedades y con las mi aparato físico, y yo añado a esta distorsión inherente guros, lentos”. propiedades viene la predicción. Así que, con un tentativo dobleces de mi propia creación. ¿Sé incluso con certeza Una de las más importantes dificultades abordadas “gesto de mano”, todo conocimiento implica predicción; que el pasado existe? No, tan sólo lo recuerdo. Puedo por Darwin en este capítulo, tiene que ver con una interaún la gnosis más allá de los sentidos tiene expresión y la obtener verificación de otras personas, pero la verificación pretación de la variación y gradualidad en la conformación no asegura la veracidad—¡ciertamente hay incertidumbre expresión tiene propiedades. de los órganos y las estructuras, más que con su origen; al ¿Toda predicción implica conocimiento? Si puede Ud. aquí!—y ningún par de personas recuerda la misma cosa encontrar que algunos órganos no tienen ningún beneficio predecir algo, en un sentido muy normal, se considera que exactamente de la misma forma. aparente para su poseedor, como lo marcaría la doctrina Así es que, estoy sentado aquí sólo, formándome una lo sabe. utilitaria, algunos naturalistas manifiestan entonces que Siendo que tanto el conocimiento implica predicción hipótesis a partir de mi memoria inexacta de que existe los órganos han sido creados bellos para deleitar al homcomo la predicción implica conocimiento se puede decir un piso de abajo de mi casa y con la esperanza de que mi bre o al creador. que son equivalentes; por supuesto esto asume que acep- experiencia defectuosa me sirva lo suficientemente bien ta Ud. varios axiomas, entre ellos la lógica. Aceptar axi- para de hecho ser capaz de salirme de esta silla. Para EL SENTIDO DE BELLEZA, ALGO SUBJETIVO añadir más incertidumbre, recuerdo por lo menos una vez omas—artículos de fe sin prueba—es misticismo. Darwin argumenta brillantemente: “el sentido de la belleen que intenté salirme de una silla sin darme cuenta de za depende de la naturaleza de la mente, del observador, que mi pié o pierna se había “dormido”; estaba extremadaindependientemente de toda cualidad real en el objeto u mente sorprendido cuando mi cuerpo no llevó a cabo mi órgano admirado; la idea de lo que es hermoso no es innahipótesis de movimiento. ta o invariable. Vemos esto, por ejemplo, en que los hombres de las diversas razas admiran un tipo de belleza por Tal vez yo solo vivo en una casa de un piso; de pronto completo diferente en sus mujeres. Si los objetos bellos estoy menos seguro. hubiesen sido creados únicamente para satisfacción del hombre, habría que probar que, antes de la aparición del Por supuesto que nuestros recuerdos sí parecen tener hombre, había menos belleza sobre la tierra”. veracidad así que los usamos. Nuestra lógica funciona Una tercera dificultad es analizada por Darwin al refebien en muchas circunstancias—no todas—así que la usarirse a los instintos. Se pregunta si éstos pueden modifimos. Y, aunque no estamos realmente seguros de que las carse por selección natural, tema que abordará en el capídemás personas existen, con frecuencia dedicamos una tulo octavo. buena porción de nuestras vidas a buscar tener intimidad La última de las dificultades se refiere al importante con estas “cosas” que percibimos son otras personas como tema de la producción de descendencia, particularmente nosotros. Caminan como nosotros, hablan como nosotros; la dificultad de explicar por qué, a diferencia de la descenpero ¿son realmente como nosotros por dentro? dencia fértil, resultado del cruce entre variedades, en el cruce de las especies se puede observar eventualmente Tal vez no podemos estar absolutamente seguros. producción de descendencia estéril.

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

9

97

se asoma describiendo el comportamiento instintivo. Pero SU DEFENSA, CON EVIDENCIAS Poniendo los pensamientos anteriores en el contexto En esta esquina, como la promovió el pensamiento Así que, en la sexta edición del Origen, Darwin, respetuo- ciertamente es, nuevamente, en el análisis detallado y descripde la ciencia, todas nuestras teorías pueden ser vistas popular, tenemos a la Teoría de la Evolución con la ciencia tivo de algunos instintos especiales, como se puede apreso de los rivales y sobre todo con todo el poder que iba como verdaderas en base a ciertos supuestos (incluso como entrenadora. En esta otra, traída a Ud. por demanda ciar mejor cómo han llegado a modificarse por selección ganando su teoría, se lanza al campo de batalla para deeste enunciado es cierto sólo basado en ciertos supuesespecializada, tenemos al Diseño Inteligente con el mistinatural. fenderse con su mayor fortaleza: las evidencias. tos). Si nuestros supuesto parecen no corresponder con cismo como fundamento. Si la escuela del entrenamiento Y es precisamente aquí, desde mi muy personal Darwin es el naturalista generoso y hábil que nos la realidad, entonces nuestras conclusiones (asumiendo científico gana, el misticismo—el requerimiento para un permite sopesarlas y, sobre todo, aceptar obviamente las punto de vista, donde Darwin y el origen alcanzan el esque aceptamos la lógica) serán inconsistentes. Podemos creador sobrenatural—será desterrado de nuestra eduplendor descriptivo e incluso narrativo; la anidación de suyas; las malas interpretaciones de las lecturas de Darexaminar la mayoría de los conjuntos de axiomas y reforcación. Si el fundamento del misticismo obtiene la vicun pequeño pájaro (el cuclillo), la esclavitud de hormiwin; el origen de la jirafa africana; el mimetismo de los marlos en un conjunto de axiomas más fino, más preciso. toria, será insertado en nuestros sistemas escolares y la gas por otras hormigas, y la construcción de las celdas insectos (con citas de Wallace); las barbas de la ballena, reDe esta forma tomamos axiomas que conducen a resultabase de la ciencia será destruida: si incluso la más pequespuestas ya dadas a los objeciones de Mivart –como la de en los panales por la abeja, son tres estupendas desdos inconsistentes y los reformamos en teorías más conña noción de este misticismo es aceptada, por naturaleza cripciones conductuales que merecen una lectura atenta. Malm en 1867-; la cola prensil de los monos americanos: sistentes; este es el proceso de la ciencia. Pero en todos socava la integridad de toda ciencia. Me atrevería a señalar que ninguna de las actuales filla aparición de las glándulas mamarias en los mamíferos y los casos, la existencia y la realidad son hipótesis basadas el ornitorrinco; los estudios sobre la estrellas de mar, del maciones de la conducta animal, con toda su sofisticación en la experiencia, percepción y pensamiento; en el mo¡Espere! ¿Qué no acabamos de establecer que toda respetado Agassiz; una estupenda serie de descripciones técnica posmoderna, alcanzan a opacar estas tres joyas mento. Esto significa que todo lo que de hecho tenemos ciencia está basada en axiomas, los cuales son en esenfundacionales de la etología animal. El poder narrativo sobre la posible evolución de la capacidad de trepar en la es nuestra existencia de momento a momento; nuestra excia misticismo? ¿Qué no es cuestionar todo supuesto y plantas, son algunos de los ejemplos contundentes que de Darwin sólo se entiende por su poder de observación. periencia instantánea, y las memorias a las que parecemos teoría—incluyendo la de la Evolución—parte de la ciencia? Darwin opone a Mivart, en el párrafo final del capítulo. Perplejo ante la naturaleza, Darwin, el colector de estener acceso a través de un sentido del paso imaginario Parece haber una confusión en este conflicto. carabajos, el cazador, el criador de palomas, es el más Al referirse directamente a las creencias de Mivart, nos del tiempo: sin memoria no hay sentido del tiempo. dice: “admitirlas es, a mi parecer, entrar en las regiones exacto y minucioso de sus relatores. Así como se recomendaban catalejos para ver los liendel milagro y abandonar las de la ciencia”. Sí, lo que es es; verdaderamente parecemos pasar a Estúpido es como estúpido hace Para el capítulo octavo, Darwin ha reservado la amplia zos de los pintores de la escuela del río Hudson o de Barbitravés del tiempo con un “algo externo”—la realidad fízon, para leer este maravilloso capítulo, un lienzo descripexplicación que requería una de la objeciones marcadas en sica—justo afuera de nuestra prisión de la percepción, el capitulo anterior, a saber, si los instintos pueden modi- tivo del comportamiento animal en la naturaleza, bien se aunque sólo experimentamos un momento a la vez; muy Para ayudar a clarificar este conflicto, necesitamos expuede evocar la presencia de una lupa, de un microscopio; ficarse también por selección natural. Advierte Darwin extrañamente, el tiempo es a la vez instantáneo y cumulaaminar la estupidez. ¿Qué es la estupidez? pero no, son la mano y el ojo de Darwin los que nos dan que no ha intentado, con su teoría, explicar el origen tivo; evoluciona. de la vida; asimismo, no intentará ocuparse del origen esta visión; generoso conocimiento, lienzo de letras y desA veces usar las experiencias y conceptos más comunes cripción de maravillas. de las habilidades mentales –a las que sin duda Darwin nos puede ayudar a obtener una perspectiva filosófica que es bastante profunda. Con respecto a la estupidez, sos¿Es suficiente la física? pecho que una definición común es ‘respuesta ineficiente o inefectiva’. Cuando nos imaginamos haciendo algo estúpido (yo Actualmente somos testigos de un concurso entre dos me imagino la vez que jalé tan fuerte una puerta cerrada oponentes disparejos: el ganador se queda con nuestras de débil madera, que se abrió tan abruptamente que no mentes. Lo disparejo sería cómico si el resultado de la pude detener su fuerte impacto contra mi cabeza) nuestro competencia no fuera tan crítico. Mientras un oponente objetivo deseado no coincide con la física del universo; es un luchador que piensa que está luchando, el otro oponuestra ignorancia humana local nos deja ciegos. La esnente se considera un bailarín. ¡Qué colisión más desastupidez falla en la tarea de asociar completamente cautrosa! sas con efectos; la asociación de causas con efectos es la disciplina que conocemos como la física. En un sentido muy amplio, es posible ver a la inteligencia como la física; algunos se refieren a la comprensión máxima de la física como la mente de Dios. Si uno no cree en Dios, nuestra estupidez o inteligencia es evaluada en base a qué tan bien nos va en el universo físico. Si uno cree que Dios sí existe, la mente de Dios es su dirección activa o inactiva del universo, también una especie de física. En ambos casos, hay una razón para todo—una “física” si gusta—aún si nosotros, como humanos, no podamos comprenderla. Inteligencia es física.

10

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

Ecofisiología Yvon Le Maho Ecofisiólogo, director de investigación en CNRS Cada especie es una innovación y con mayor razón aquéllas que deben hacer frente a condiciones ambientales extremas. Así pasa con el pájaro bobo real. En la Isla de la Posesión (Archipiélago de Crozet) hemos descubierto que el macho, una vez que regresa del mar para asegurar las últimas semanas de la incubación del huevo, transporta en su estómago alimento no digerido. En la regurgitación asegura la supervivencia para una decena de días, en caso de que la hembra, retrasada por problemas climáticos, no regrese oportunamente para la eclosión. Pero, ¿cómo puede el macho guardar alimento intacto durante tanto tiempo en su estómago, a una temperatura de 37 grados centígrados? Lo que ocurre es que su estómago contiene una pequeña proteína antibiótica y fungicida, que ha demostrado ser muy eficaz contra bacterias y contra hongos que resultan patógenos para el hombre. Es así como un mecanismo adaptativo sofisticado, aparecido en el curso de la evolución, podría tener repercusiones agroalimentarias y biomédicas.

Darwin: su legado
(Tomado de Le Monde, del sábado 7 de febrero de 2009. Traducción del francés de Félix Ramos Gamiño). ace 200 años nació Charles Darwin. Medio siglo después, su obra El origen de las especies, revolucionaba las ciencias vivas. Con motivo de estos aniversarios, diversos investigadores testimonian la enorme influencia de la teoría de la evolución en sus respectivas disciplinas.

H

Genética Pierre Tambourin Director General de Génopole ¿Qué hay de común entre un peligroso pececillo llamado fugu, el ácido desoxirribonucleico (ADN) y Darwin? Éste planteaba en su obra una pregunta central: ¿Qué sistema de información, presente en cada una de nuestras céluFue en el curso de mis investigaciones sobre el “suicidio las, permite comprender la evolución de las especies y la celular” cuando descubrí realmente la riqueza del pensa- transmisión hereditaria de estos caracteres evolutivos de miento de Darwin. ¿Cómo es que nuestras células tienen una generación a otra? Siglo y medio más tarde se conoce el papel fundamenla capacidad de autodestruirse? Darwin atribuía un papel esencial en la evolución a la destrucción y a las “guerras de tal del ADN, y le debemos a Jean Weissenbach (Génopole Rodrigo Soto la naturaleza”, pero no decía nada de la muerte que surge d’Evry, medalla del CNRS 2008) el haber estudiado el genodesde el interior. A través de sus ojos he contemplado ma del fugu para aprender más sobre el hombre. El genoma o era posible lo que los ojos de George Taylor obser- duo femenino que vivió en África hace unos 140 mil años, algo más allá de lo que él había podido explorar, ya que él de esta especie es dos veces más pequeño que el nuestro. vaban. ¿Cómo era posible que un animal tan estúpido todo basado en estudios del ADN. Al compararlos, Jean Weissenbach y su equipo han podido casi no sabia nada del universo de las células. Pero vayamos más allá de lo que ven los ojos y de lo e ínfimo en comparación con el hombre hubiese poHe pensado que, desde el origen, la capacidad de au- precisar que el genoma del hombre comprende treinta mil dido lograr ese avance evolutivo? Pareciese que un virus que el corazón no quiere sentir. Si quisiéramos definir el todestruirse había podido ser una de las consecuencias genes menos de los que preveían los científicos en virtud hubiera transformado el papel que monos y hombres ju- objetivo de la vida del hombre, podríamos observar a cualineludibles del poder de autoorganización que caracteriza de su talla, lo que demuestra que entre las evoluciones del gaban entre sí en el planeta Tierra. Todo eso alteró fuerte- quier ser humano o simplemente introducirnos en nuestra a la vida. He descubierto que la “muerte programada” exis- genotipo y las del fenotipo pueden presentarse serias dismente por un segundo. De esa forma, claramente veríamente a Taylor y no se pudo contener. tía en los organismos unicelulares desde un origen muy cordancias… cuyo origen sigue siendo un misterio. “Quítame de encima tus sucias manos, mono asquero- mos que somos un mar de emociones y necesidades, que remoto; y he propuesto la idea de que no existen “genes Maestro so”, gritó Charlton Heston, en su papel de George Taylor, van peleando para ser satisfechas. Rodrigo Soto de muerte”, sino que una implicación ancestral entre los De acuerdo con el artículo “Why we are as we are?”, de El Planeta en 1968, que muConsultor / mecanismos quede los Simios, la vida y exclamación en el determinan la muerte, Economía de las chas personas quisieran expresar cuando se les compara de The Economist, apoyado en la teoría de la evolución, corazón de cada célula, ha jugado un papel esencial en la Ideas con un simio o se les dice que provenimos de un antepa- de Darwin, la vida humana se centra en “supervivencia rsotomoreno@ evolución y en la complejidad de la vida. sado común, que, según Pamela Weintraub, es un indivi- y reproducción”. Vivimos vidas sometidas al deseo de yahoo.com Inmunología Jean-Claude Ameisen Universidad de París-Diderot Facultad de Medicina Xavier-Bichat

Atrapado entre bestias y dioses

Breve historia de la evolución del hombre

N

CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES

1 1

Continuando el análisis de cómo percibimos la vida, y según escribe Corey S. Powell en la publicación Discover Magazine, en su artículo de “The long shadow of Darwin”, Lingüística existen tres descubrimientos que han creado una revoluUN EJEMPLO Mahé Ben Hamed ción en sus campos científicos particulares y cambiaron Tomemos un ejemplo visual simple del mundo animal. Filogenetista, CNRS, Universidad de Lyon-II paradigmas en la forma en que el ser humano percibe la Pensemos en la imagen, de National Geographic o DiscoBiología Molecular vida y lo que espera de ella. very Channel, de un depredador. Pueden ser las leonas en Los métodos desarrollados por la biología evolutiva en Jean-Jacques Kupiec África, que se agrupan cautelosas, sin hacer ruido, para la continuación de las teorías darwinianas constituyen una Escuela Normal Superior FREUD, EINSTEIN, DARWIN rodear a la manada de gacelas y escogen a su víctima del gran aportación a la lingüística histórica, que busca trazar El primer aspecto que menciona Powell, es La Interpredía, para separarla de la manada, arrinconarla, atraparla, la evolución de las lenguas. El mismo Darwin había notado Es paradójico que en la actualidad pueda uno realizar tación de los Sueños, de Sigmund Freud en 1899, que abrió matarla y empezar a devorarla. Aquí podríamos pregunun curioso paralelismo entre la formación de las especies estudios de biología sin estar confrontado directanuevas puertas para la interpretación psicológica de los tar: ¿quién culpa a las leonas cuando arremeten en contra y la de las lenguas. El principio de la descendencia con mente con la obra original de Darwin. Por mi parte, yo rincones de la mente humana; el segundo es la Teoría Esde su presa para comerla? modificaciones se ilustra por palabras que, desde el latín la he leído al fin de mis estudios, y esto ha constituido pecial de la Relatividad, de Albert Einstein, en 1905, que vulgar hasta el francés antiguo, por ejemplo, presentan para mí una conmoción intelectual. Yo estaba interelogró aumentar lo descrito por Newton y transformar la una filiación, sin que se hayan conservado idénticas. sado en la diferenciación de las células. Elaborando un concepción del espacio–tiempo, y, por último, El Origen de Igualmente, la influencia de factores sociales sobre el nuevo modelo, he constatado que también él se refería las Especies, de Charles Darwin, en 1859, que, aunque no es léxico o la pronunciación presenta una similitud con la al azar sometido a impulsos selectivos: las células funtotalmente aceptada como las anteriores, sigue aportando selección natural de los caracteres biológicos a causa del cionan de manera aleatoria y son seleccionadas por su nuevos datos para diferentes ramas del conocimiento del medio ambiente. Los préstamos lexicológicos entre idiomas microambiente. hombre y de su entorno. son igualmente comparables con los intercambios de maDarwin escribió que la noción de especie depende Empero, Darwin no fue el primero en proponer una terial genético entre las especies, ya sean plantas o bactedel clasificador: este aspecto es asimismo revolucionateoría evolutiva. Gary Stix, en su artículo “Darwin´s Lirias. Estas analogías han conducido a la utilización de mério, porque si uno aborda la objetividad de la especie, ving Legacy”, comenta que Anaximandro, filósofo griego todos de la biología evolutiva para reconstituir la historia esto vale también para el hombre. Esto constituye un que vivió entre los años 610 y 546 a.C., sostiene que de las lenguas mediante un árbol o una red filogenética, punto ciego de la biología, que se ha visto obligada a todas las especies, incluido el hombre, descienden de la igual que se hace para las especies vivientes. abandonar una forma de determinismo, la del “provida en el mar o de los peces y que, sufriendo diversas grama genético”. Esta noción se resiste a la idea, contransformaciones y modificaciones, llegó a ser lo que es siderada antihumanista, de que el organismo es el reahora. La desesperación de Darwin para sacar sus ideas a sultado aleatorio de un proceso sin finalidad. la luz fue beneficiosa, ya que él fue el primero en publicar su libro para reclamar la idea como suya. nuestros genes, al igual que reaccionamos con impulsos primitivos impresos en nuestro código genético.

Neurobiología Catherine Vidal El punto que nos llama la atención es complicado, al Neurobióloga, directora de investigación en el Instiigual que la pregunta es difícil de responder, pues pentuto Pasteur semos: ¿quién puede explicar mejor la situación anterior? ¿Es el designio de Dios? ¿O es la evolución de Calamares, babosas, cucarachas, langostas y peces: Darwin? Desde luego, la respuesta es indiferente para la todos estos animales tienen en común el poseer neugacela, que, movida por el instinto de conservación, sólo ronas gigantes, en ocasiones hasta de un milímetro de trata de correr más velozmente que su depredador para diámetro. Por lo tanto resulta más fácil colocar elecpoder ver el sol un día más, pastar para alimentarse y bustrodos en estas neuronas que en las de ratas, ratones car dejar su herencia genética en el planeta antes de cesar y primates, cuyo grosor no pasa de algunas centenas de existir. de milímetro. Gracias a ellos se ha hecho un descuA la vez, entrando en el campo teológico, creo que uno brimiento extraordinario: los mecanismos elementales de los mejores regalos que Dios nos dio fue el “libre albede transmisión de influjos nerviosos son comunes a drío”: la capacidad de escoger caminos entre las bifurcatodas las especies de animales, ya sea que tengan un ciones que se nos presentan en nuestro andar como seres sistema nervioso rudimentario o que estén dotadas, humanos. Ahora bien, ¿realmente escogemos el camino o como es el caso del hombre, de un cerebro muy comsomos llevados por el código que se encuentra en nuestro plejo compuesto por millones de neuronas. ADN para discernir entre una situación x o y? En esta forma, en el curso de la evolución, se ha puesto en marcha un mecanismo de selección muy EL HOMBRE, EN LUCHA CONSTANTE poderoso, que ha privilegiado las células neuronales, Para mi particular punto de vista, ambas posiciones ofrecuyas propiedades han sido explotadas por numerosas cen explicaciones fehacientes, pero para este caso vamos especies. ¡Con su capacidad única de comunicación, a tomar la ruta de base científica. Explicando más a fondo, las neuronas son un éxito evolutivo! creo que el hombre se encuentra atrapado entre bestias y dioses; es decir, entre su lucha constante que tiene, de suprimir sus instintos animales y su anhelo de ser la imagen y semejanza que su Dios quiere que sea.

CRONOLOGÍA
1809: Nacimiento, el 12 de febrero, en Shrewsbury, Inglaterra, de Charles Darwin. Lamarck presenta su teoría transformista. 1831: El 27 de diciembre, Darwin se embarca, como naturista, en el Beagle, para un viaje alrededor del mundo que durará cinco años. 1835: El Beagle hace escala en las Galápagos, donde Darwin observa variaciones en la forma de los picos de los pinzones, que inspirarán su teoría. 1837: Primer bosquejo de Darwin de un árbol evolutivo que figura en sus Apuntes de la transmutación de las especies. 1858: Presentación, el 1 de julio, en Londres, de artículos elaborados conjuntamente con Wallace sobre la “Perpetuación de variedades y especies por los medios naturales de la selección”.

92

12

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

La teoría de la evolución y su impacto en el pensamiento occidental moderno

E

Doctora Patricia Liliana Cerda Pérez Coordinadora del Centro de Investigaciones FCC / UANL cerda35@hotmail. com

La teoría de supervivencia de Darwin por la mejor adaptabilidad de una especie a su entorno, así como la proliferación de sus genes es lo más conocido, pero es necesario que revisemos otro de sus escritos, titulado “La Descendencia del Hombre, y la Selección en Relación al Sexo”. La parte de la supervivencia del más sexy como lo han proclamado, entre otros, los doctores Kjell Nordstrom y Jonas Ridderstrale, es una característica evolutiva que ha Patricia Liliana Cerda Pérez las ideas de Darwin y que debe pasado desapercibida en ser abordada para comprender mejor nuestro comportantre Darwin, Wallace y las leyes de Mendel, la Teoría miento. Evolucionista y Nordstrom y paradigmas son la base Sobre todo, sus diversos Ridderstrale nos recuerdan científica en la cual se que su legado descansa enteque si Darwin nos dicehan forjado generacionesen sobreras por más de un siglo. esta última parte no se concreta si no vivir y reproducirse, En medio de crecientes esquemas teóricos que polemizan sobre la comprensión de los fenóexiste “atracción” para conseguir una pareja. menos evolutivos, la sociedad de hoy vive bajo oscilantes esquemas, que van de las creencias de la fe, al análisis EL CASO DEL PAVORREAL racional propuestocola El Origen de las Especies. siendo moPor ejemplo, la en del pavorreal macho sigue Desde 1859, al publicar desde la El Origen de las la supertivo de sorpresa, pues Darwin perspectiva de Especies, sacudió a toda apto, no es unacientífica y marcóproporvivencia del más la comunidad herramienta que un hito, no sólo porque explicaba para su teoría los procesos cione ventaja comparativa con procrear; pero la hembra quese ve atraída diversidad del mundo vivo, sino porqueque originan la por ese macho, que tiene mejores genes al revolucionar si sigue vivo a pesar de esa cola el pensaotros, pues hasta la biología, impactó todo que pudiera miento occidental moderno. atraer más que a una hembra a un depredador, es porque Quienes asistieron a las aulas de colegios confesiocuenta con algo especial. nales de primaria y secundaria en el México de los 70 actualiPor más ridículo e increíble que parezca, en la podrán entender lo describe “Why we are as we are” del Econodad, como tal revolución. En esa época, en laprefieren a un eufemísticamente de mist, las mujeres clase llamada hombre sexy traducido “moral”, -que no eracon dinero. Los científicos religión-, en un hombre otra cosa que lecciones de darwinianos pudieron y pudimos ver las discusiones entre niñas-adoexplican que el dinero no es solamente para proveer segulescentes y el sacerdote-profesor y su insistía en presentarque ridad material para la mujer que descendencia, sino a Adán y Eva comose centra en los genes. la competencia fuente primaria de nuestro ser, y, de paso, descalificaba a Darwin, a Juárez y hasta a los maEl pensamiento tradicional es que los seres humanos sones, como enemigos acérrimos pueden promover genes sacon dinero son personas que del Papa, de la Iglesia y CONTEMPORIZA LA IGLESIA CON LA TEORÍA EVOLUCIONISTA de Dios mismo. ludables e inteligentes y atraen con mayor facilidad a in- habilidades, también genera algo ineludible, que son las El clases de esta que en la evolución en el sistema sodividuos del sexo opuesto. Aunque muchos podemos no impactosociales, teoría se dio no sólode Darwin se encuencial del presentes en las diferentes especies de animales. DOGMATISMO Y EVOLUCIÓN estar de acuerdo con esta postura, tratando de privilegiar tranhombre del siglo XIX y del XX, sino incluso dentro Hasta el siglo XIX, en que iniciara el despegue de la geo- in- la propia Iglesia Católica: se ha metido en la economía; otros atributos más importantes, como la mente, es de Es así como Darwin Pío XII estableció, en 1950, logía, las religiones hombre con mayor poder dedinero tiene incluso seno prohíbe elun área de la doctrina evolu- del negable que un occidentales condenaban o manera que la Iglesia ha creado estudio llamada “Economía unánime y dogmática toda explicación que propusiera que cionista en cuanto busca el origen del cuerpo humano en mayores oportunidades de procrear. Comportamiento”, que se comenta en el artículo “Unfimateria viva , siempre y cuando se asuma desde la la vida es el resultado de un proceso juego del ingresopue- unanished Business” de la misma publicación, para comprenLa mujer toma parte en este evolutivo donde obtenife der las que las almas realiza una única y en materia dendo, pues a pesar de que siempre pensamos de nuevosmu- católica decisiones queson creadas persona exclusiva- de intervenir la ascendencia, el nacimiento en que la caracteres y menos que elespecíficos, medianteha encontrado economía. Para traer a la luz esto, contamos con el Efecto jer gana mecanismos hombre, cuando no los cuales mente por Dios. algunas características persisten, mientrasaños)otras des- es Juan Pablo IIque nos sorprende al verMagisterioindividuo pareja (regularmente entre los 22 y 29 que su ingreso de Dotación expuso en 1996 que el cómo un de la Iglesia está interesado en la Teoría de la de su propiedad aparecen.que el del hombre o por debajo de éste por sólo uno es renuente a cambiar un artículo Evolución, porque por igual influye similar que no lo es. hombre; Benedicto XVI que por ciento de diferencia, según datos del Institute of Eco- uno en la concepción del Lo que esto nos dice es su- la Hoy, el origen de la vida es analizado en el Economist. braya la importancia de las pruebas bienes en el libre mercado desde múltinomic Affairs de Inglaterra encontrados clásica decisión de intercambiar científicas en favor de ples ámbitos: desde los comportamientospunto. Tomando en evolución, las dominada por el raciocinio como predecirían moleculares del la no está sólo cuales enriquecen el conocimiento de la Ahora, no nos quedemos en este ADN; las entidades persistentes llamadas genes; las muta- vida y del ser; empero, distingue: “la doctrina de la evolucuenta lo anterior, la evolución vista por Darwin pro- los economistas. responde al gran interrogante que nos como es ciones y recombinaciones económico de las naciones, y cada mueve el crecimiento de los genes; la selección natu- ción noPor otro lado, algo innegable, filosófico ha definido ral; persona compite, esperando demacro evolución de las saber de dónde viene esto y cómo todo toma un no deberíala deriva genética y la micro y manera leal, con sus habi- como especie, es una característica de la cual camino desemboca finalmente en el hombre”. poblacionesydurante el transcurso de varias generaciones. quemos estar muy orgullosos: estoy hablando de la violenlidades capacidades para generar riqueza para proveer Tal interrogante,sobre asesinatos y sobre los perpetradoA ello debemos añadir las compañera y sus hijos. la nuevas corrientes de seguridad a su compañero o cia. Los estudios hasta hoy, es el gran problema por biología evolutiva -resultado de la Teoría de la Síntesis resolver de toda la ciencia en su conjunto, y es, por Wilson res de los mismos, por parte de los doctores Margo así Evolutiva Moderna-, y los estudios que permanentemente decirlo, la gran duda filosófica del de Canadá, de la muCLASES SOCIALES y Martin Daly, de la Universidad hombre y mencionados efectúan no todo queda ahí, el mundomarca el escrito del Eco- del el artículo de “Why we are as we are”, han arrojado que Pero científicos de todo como lo sobre las evidencias jer en Medioevo; de los ilustrados del Siglo XVIII; de los de la evolución desde elesfuerzopaleontológico, anatómi- en el 86 pory científicos del XIX y son y del posmoderno nomist, sino que ese ámbito de cada persona, pagado industriales ciento de las víctimas XX, del género masculino, siglo XXI. co, embriológico, bioquímico y biogeográfico. capacidades y jóvenes, solteros, y algunas veces desempleados. relación al trabajo hecho de acuerdo a sus

92y13.indd 1

CONOCIMIENTO CONOCIMIENTO
Pero lo más interesante en los hallazgos de Daly y Wilson es que, aplicando los patrones evolutivos definidos por Darwin, se piensa que en la mayoría de los crímenes perpetrados se deben a que estos hombres están compitiendo por estatus o por una mujer, y específicamente en este último punto, compiten por tener relaciones sexuales y/o procrear.

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

13

93

En el caso fue posible por el oxígeno Pasar de los organismos unicelulares a los multicelulareshumano, difícilmente una madre perdonaría eso de otro ser humano, y haría todo a su alcance

COMPORTAMIENTO CRIMINAL Curiosamente, cuando el individuo masculino se casa u obtiene éxito en el sexo, entonces el comportamiento criminal disminuye. Ahora que, si el hombre en cuestión se casa y tiene hijos, entonces el comportamiento criminal desaparece. Estamos hablando de cómo el matrimonio y tener descendencia elimina a potenciales criminales, según este estudio. Otra característica que tenemos impresa en nuestro código genético es el placer de la venganza, pues, como recordamos en el artículo “The Pleasure of Revenge”, de Scientific American, ésta estimula los mismos centros de ¿Y EL FUTURO? recompensa en el cerebro igual que cuando tomamos algu¿Qué nos depara el futuro como especie? El doctor Peter na droga o comemos nuestro postre favorito. La venganza Ward propone tres caminos, sin contar la posibilidad de y el castigo para una persona o ser que lo merece, de acuerque nos extingamos, claro. Son los siguientes: do a las normas sociales y legales de un determinado esa) Estasis. Nos mantenemos como somos ahora, salvo tado o nación, descansan, al parecer, únicamente dentro con pequeñas afinaciones o especializaciones, como sude la mente humana. (Tomado de clásico para demostrar lo anterior es volcede enLas bacterias planeta en liberar oxígeno en los océalas razas del pudieron la actualidad. Un ejemplo La Prensa, de La Paz, Bolivia) viendo alMundo.- de “Why we areen tres mil para recordar de b) Especiación. Una llegó a especie de seres humanos nos y éste a su vez nueva la atmósfera. BBC artículo Sabemos que as we are”, 500 millones evoluciona idea erao ver otro planeta. queaños leona defenderá a ha evolucionado desde organismos una la vida en la Tierra sus cachorros del infanticidio, “La en éste en cómo aumentó la talla máxima de unicelulares a gigantescas secuoyas y ballenas azules. c) Simbiosis con medida en términos de biovolumen”. pero si no lo puede evitar, ciertamente puede sufrir, pero los organismos, las máquinas. Se produce una integración del cerebro hombre el la máquina, para las caracteseguirá Hace tres milincluso es normal que tenga hijos y su camino; 500 millones de años sólo había organis- El tamaño, como explicaconexperto, es una deproducir mos unicelulares y no existía oxígeno una inteligencia colectiva, de los organismos y un las caprocree con el infanticida de sus cachorros. en la atmósfera. rísticas fundamentales que puede o no retenerimportante Se pensaba que esa transformación había ocurrido parámetro para estudiar su ecología, evolución y comporgradualmente. Pero ahora una nueva investigación afirma que tamiento. Hasta ahora, el conocimiento que tenemos de cómo la evolución ocurrió en dos grandes “oleadas”. Según los científicos de las universidades de Stanford, ha cambiado el tamaño de los organismos está basado en Colorado y el Virginia Tech, en Estados Unidos, estas dos estudios llevados a cabo hace 40 años. Fue por eso que los oleadas “estuvieron vinculadas a la evolución geológica científicos decidieron explorar cómo han ocurrido estos del planeta”. cambios, y a medida que analizaron los datos del registro Es decir, estos dos “saltos evolutivos” coincidieron fósil, descubrieron lo que llaman “un patrón extraordicon grandes aumentos en la cantidad de oxígeno en la nario”. atmósfera de la Tierra. “Nos sorprendió encontrar que casi todo el aumento La primera oleada, que trajo un enorme aumento en la talla y complejidad de los organismos, ocurrió hace dos en el tamaño de los organismos ocurrió en dos distintos mil millones de años. Fue entonces cuando los organismos intervalos de tiempo”, dice Jonathan Payne, otro de los aude una sola célula desarrollaron membranas celulares. tores del estudio. Y la segunda, dice la investigación publicada en Proceedings “Más sorprendente fue el hecho de que esos interof the National Academy of Sciences (PNAS) (Actas de valos ocurrieron después de dos grandes eventos de la Academia Nacional de Ciencias), se llevó a cabo hace 540 millones de años, cuando aparecieron las primeras oxigenación en el planeta”. Según científicos, la relación entre aumento en el tamaño y los eventos de oxigenación criaturas multicelulares. es muy clara. HISTORIA DE LA VIDA “Buscando a los organismos más grandes, revisamos EL ESTUDIO el conocimiento que tenemos de la historia de la vida En los primeros mil 500 millones de años había orgaen nuestro planeta”, dice Michal Kowalewski, profe- nismos parecidos a bacterias. Esto sucedió en un sor de geofísica y principal autor de la investigación. período pasado entre tres mil 500 millones y dos mil “Revisamos desde el organismo que se cree es el más anti- millones de años. La llegada de los organismos más guo, las bacterias fósiles en rocas de tres mil 500 millones complejos ocurrió hace dos mil millones de años. de años, hasta los animales y plantas más grandes que Ello pasó cuando algún tipo de bacteria primitiva inventó un metabolismo. viven hoy”.

La evolución de la Tierra se dio en dos oleadas de oxigenación
Se creía que la transformación de la vida en la Tierra se produjo las universidades de Stanford, se produjo en dos grandes momentos gradualmente, pero un estudio de
para no procrear con él; por lo contrario, esperaría el momento para tener su venganza. Aquí vale la pena hablar de Richard Dawkins y sus memes, que, de acuerdo a él, son la unidad de transmisión cultural o unidad de imitación, como una especie de replicadores. La explicación de Dawkins, por aventurada que suene, se sustenta en que cada vez que se plantea una idea o un concepto de un cerebro a otro, gracias a la imitación, se está convirtiendo en un vehículo más para la propagación de ese “meme” en particular. Todos los días estamos influenciados por ciertos arquetipos de conducta y comportamiento que van moldeando nuestra forma de actuar en la vida diaria. Pero aquí debemos transmitir, aparte de los genes, los memes que nos componen, con el fin último de preservar nuestra especie y no dañar a los demás seres vivos que habitan y comparten el medio ambiente.

Colorado y Virginia indica que esto

17/02/2009 05:30:20 p.m.

14

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

racterísticas y cualidades que reconocemos como humanas. Ward sugiere que, en un futuro, tal vez próximo, continuando con la exploración genética celular, podremos imaginar la Utopía de que los padres puedan pedir una programación especial de nivel de IQ de sus hijos, y, ¿por qué no?, pedir que se especialicen en cierta área del conocimiento, pensando que también podremos evitar que el individuo por nacer venga con un defecto genético que le impida continuar el ciclo de su vida; es decir, eliminar enfermedades genéticas y aumentar la esperanza de vida. Además, pensemos en que se pueda engañar a las células programadas para morir (apoptosis) y que les digamos que el cuerpo celular puede durar más de cien años con una perfecta salud, o, ¿por qué, no pedir alcanzar los 150 años, como piensa el doctor Ward? LA EVOLUCIÓN CONTINÚA Para Kathleen McAuliffe, el ser humano sigue evolucionando, pero alejándonos entre razas; es decir, que cada vez nos parecemos menos y no nos estamos fusionando en una humanidad mixta, como ella le llama. Hoy en día, el grito de Taylor en El Planeta de los Simios se pierde y casi no se escucha, gracias a que hemos comprobado, como nos lo dice McAuliffe en su artículo “Are we still evolving?”, que el ADN entre todos los seres humanos sólo varía en un 0.5 por ciento y que el genoma del ser humano y el del chimpancé varían sólo entre uno y dos por ciento. A Darwin lo cambió ese viaje en el Beagle. Fue uno al subirse y otro al bajarse de la embarcación, y su teoría evolutiva se sigue aplicando y fusionando con diversas áreas del conocimiento. También nosotros somos unos antes de Darwin y otros después de sus conclusiones sobre nuestra especie. Así que, más que criticar destructivamente a Darwin, deberíamos abrazar sus conocimientos y seguir obteniendo información de ellos, con el fin de aplicarlos en comprender de dónde venimos y hacia dónde vamos. Tal vez así podamos lograr hacer de éste un mejor mundo para todos.

REFERENCIAS
“Why we are as we are, Darwinism”, The Economist, December 20th 2008. Unfinished Business, Evolution. The Economist, February 7th 2009. Quammen, David. The Darwin Bicentennial, National Geographic, February 2009. McAuliffe, Kathleen. Are we still evolving?, Discover, March 2009 Powell, Corey S. The Long Shadow of Darwin, Discover, March 2009. Stix, Gary. Darwin´s Living Legacy, Scientific American, January 2009. Ward, Peter. What will become of homo sapiens?, Scientific American, January 2009. Ridderstrale, Jonas; Nordstrom Kjell. Karaoke Capitalism, Pearson Educación, Madrid 2004.

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

15

91

El problema del diseño y la revolución darwiniana
Más allá de que hubiera comprobado su teoría -contrariamente a sus colegas- con datos minuciosos sobre las similitudes y diferencias de la flora y fauna que observó en un viaje de cinco años a bordo del “Beagle”, fue el primero en inferir el génesis de las especies, resumida en la transición de seres vivos unicelulares a formas de vida complejas. GENIALIDAD DE DARWIN Pero su grandeza reside, sin lugar a dudas, en su genialidad sin límites, una genialidad como ha habido pocas; un modo de Ana Barahona pensamiento que no sólo impactó al mundo científico, sino que sacudió muchas disciplinas de la humanidad. Ya Ernst Haeckel –influido por el pensamiento INTRODUCCIÓN darwinista- declaraba que “la evolución no quedaba resn el año 2009 celebramos el bicentenario del nacimientringida a la biología, sino que la evolución va del átomo to de Charles Darwin (1809-1882) y los 150 años de la al hombre”. publicación de su libro El Origen de las Especies, cuya Es así como, en efecto dominó, diversos pensadores influencia fue decisiva para el estudio y comprensión de del mundo se contagiaron de la corriente darwiniana. los seres vivos, y sobre todo, del lugar del ser humano en Spencer introdujo la expresión de la supervivencia del más la naturaleza. fuerte, para apoyar la tesis de la economía liberal inglesa, La revolución científica que dio lugar a la ciencia moy escribió que los individuos con esfuerzos conscientes y derna, inició cuando Copérnico desplazó a la Tierra de su exitosos son capaces de adaptarse a las cambiantes necelugar como centro del Universo y la colocó en un lugar sidades del medio social, y serían éstos quienes sobrevisubordinado entre otros planetas, dando vueltas alredevirían y dominarían. dor del Sol, y cristalizó cuando Darwin, siglos más tarde, También impregnado de evolucionismo, el mismo desplazó a los humanos de su posición central dentro de psicoanálisis de Freud identifica momentos evolutivos o todas las formas de vida, y los colocó como una especie etapas, tanto en la trayectoria de crecimiento del indivimás entre muchas. De esta forma, los humanos estaríaduo, como en la formación cultural de la humanidad. mos relacionados con los chimpancés, los gorilas, y otras especies que comparten un ancestro común. CREACIONISMO Y EVOLUCIONISMO Los hallazgos de Copérnico, Kepler, Galileo, Newton y En la religión, el pensamiento darwinista se clavó como otros, en los siglos XVI y XVII, condujeron gradualmente a una daga, creando un hondo conflicto entre el creacionisuna concepción del universo como materia en movimienmo dogmático y el evolucionismo. Nietzsche le imprimiría to, gobernada por leyes naturales, mientras que Darwin su sello muy personal a la filosofía existencialista, al demostró que los organismos evolucionan, que descienden clarar la presencia del “súper hombre”. de antepasados muy diferentes a ellos, y que las especies Ni qué decir del transcurso de la historia del mundo, están relacionadas entre sí, porque tienen antepasados cosi Hitler no se hubiera apropiado de las ideas darwinistas munes. para proclamar a la sangre aria como la raza excelente y apta para sobrevivir a cualquier guerra, así fuera la más sanguinaria de todas. Karl Marx encontró una versión social de las teorías biológicas de Darwin, considerando que la evolución social respondía a las leyes de transformación que el marxismo buscaba para alcanzar una sociedad mejor. Es por eso que Darwin es celebrado con tanto bombo y platillo; porque su pensamiento resulta más vigente que nunca. Nosotros, sin siquiera decidirlo, somos de naturaleza darwinista, puesto que luchamos por adaptarnos y sobrevivir en un mundo que se antoja cada vez más competitivo y demandante. Ahora, como nunca, el pensamiento darwiniano cobra fuerza y resulta más franco y honesto. Nos guste o no, quien mantiene un trabajo, un matrimonio o una relación social es aquél que se adapta mejor y sobrevive al cambio. Somos seres de naturaleza cambiante, y estamos en constante evolución. Ninguno de los pequeños o grandes aciertos y descalabros de la humanidad hubieran sucedido sin su pensamiento, que ha sido, de manera inevitable, un parteaguas en la historia del mundo.

1

E

Pero, más importante aún, Darwin proporcionó una explicación causal del origen de los organismos: la selección natural. Con ella, Darwin extendió al mundo orgánico el concepto de naturaleza derivado de la astronomía, la física y la geología; la noción de que los fenómenos naturales pueden ser explicados como consecuencia de leyes inmanentes, sin necesidad de postular agentes sobrenaturales. La revolución darwiniana redujo al dominio de la ciencia los únicos fenómenos naturales que todavía quedaban fuera de ella; a saber, la existencia y la organización de los seres vivos. LAS EXPLICACIONES TELEOLÓGICAS Y EL PROBLEMA DEL DISEÑO La teleología o el pensamiento teleológico ha estado presente en las discusiones acerca de las explicaciones biológicas en la historia de la biología, desde Aristóteles hasta nuestros días, y representa un problema fundamental para la filosofía de la biología. La idea de un propósito o fin en la naturaleza, de un telos, no es original de Aristóteles. Sócrates y Platón sostenían que nada en la naturaleza y en el mundo puede explicarse por el azar o la casualidad, como lo había sostenido Demócrito, sino que las creaciones de la naturaleza se dan porque son necesarias y porque son lo mejor.

Doctora Ana Barahona Catedrática de la UNAM Especialista en historia y filosofía de la biología, evolución y enseñanza de las ciencias Presidenta-electa de la International Society for the History, Philosophy and Social Studies of Biology abe@hp.fciencias. unam.mx

17/02/2009 05:30:09 p.m.

88

16

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

Para Platón, el mundo natural es el producto final de un diseñador o conciencia universal que ordena todo en el mejor lugar posible, un artesano del cosmos, el Demiurgo. El énfasis de Platón en un demiurgo del universo permitió a los neoplatónicos conectarse con el pensamiento cristiano dominante durante el siglo XVII. Una de las principales inquietudes de Aristóteles fue la búsqueda de explicaciones de los procesos naturales, atendiendo a sus causas; es decir, para Aristóteles, sólo conocemos una cosa o un proceso cuando conocemos sus causas. CAUSA FINAL O TELOS Para Aristóteles, conocer la causa final o telos era el objetivo principal de toda investigación. Sólo se pueden conocer las cosas y los acontecimientos individuales cuando comprendemos la causa de cada uno de ellos. Bajo esta visión teleológica del mundo, pensaba que existía una finalidad en la naturaleza; que lo mejor era lo que realmente ocurre en ella, pues la finalidad es la que ordena todo. Aristóteles no creía en una teleología universal aplicable a todos los fenómenos naturales, sino que algunas cosas y procesos Platón y Aristóteles. naturales son para un fin.2 “...Así pues, si la golondrina hace su nido en vistas de natural fueron incorporadas a los dogmas de la igleun fin, la araña su telaraña, las plantas producen hojas en sia; sin embargo, la teleología lo hizo con un énfasis vistas de sus frutos y ellas reafirman sus raíces debajo del platónico. Dios, además de ser la causa primera y la alimento y no arriba, es evidente que una causa semejante causa final, participa activamente en el mundo. Copérnico y Galileo se opusieron a la física de Arisdebe haber en los entes que se generan y son por naturaleza. Y puesto que la naturaleza puede entenderse en dos tóteles, pero sin hacer mención a la visión teleológica sentidos, como materia y como forma, y dado que esta de la iglesia. Posteriormente a ellos, las leyes de la físiúltima es el fin, y todo lo demás es en vistas de un fin, la ca de Newton requerían la operación continua de Dios, en clara reconciliación de la física con la teología.4 La forma tiene que ser causa final”. 3 En los siglos posteriores, la influencia de las ideas visión neo-platónica del mundo newtoniano impactó teleológicas de Platón fueron permeando hasta el Re- de manera sobresaliente a la biología, en los trabajos nacimiento. En el siglo XVII, sin embargo, las explicaciones de Georges Cuvier, Richard Owen, Louis Agassiz y Karl teleológicas fueron muy discutidas, en gran parte por las Ernst von Baer, por mencionar a los más preeminendiferentes acepciones del término. Gracias a santo Tomás tes. que diferenciaban sus posiciones es el de las jirafas, que, En el siglo XIX, particularmente en Inglaterra, exde Aquino, la metafísica aristotélica, la física y la historia de acuerdo con Lamarck, tenían el cuello largo porque las istía consenso acerca de los alcances de las explicacioIsmael Vidales primeras lo estiraron continuamente para alcanzar su alines científicas y el dominio de la teología que permitía mento; pero, según Darwin, algunas jirafas nacidas al azar una cómoda coexistencia entre ésta y la ciencia. iertamente la ciencia ha experimentado grandes, sor- con el cuello largo, fueron las que mejor se adaptaron al La teología natural de William Paley, Thomas Malprendentes y abundantes cambios en los años recien- medio y engendraron más descendencia. thus y John Herschel, en el siglo XIX, era una forma tes; digamos que ha evolucionado; sin embargo, llama cristiana de la tradición platónica de teleología exterla atención que en cuanto a teorías de la evolución no haya MENDEL Y5LA HERENCIA GENÉTICA nalista. Los animales están estructurados y se comJunto a estos dos grandes sabios, debemos mencionar a evolucionado significativamente. portan como lo hacen pues son el resultado del diseño Los libros de texto consignan alguno que otro detalle Mendel y sus leyes sobre la herencia genética (1865), cude un Creador benevolente, de acuerdo a un propósito. anecdótico de contexto, pero la teoría darvinista, ex- yos elementos fundamentales son la combinatoria de los En su libro Teología Natural, Paley expone que a través puesta por el célebre naturalista inglés Charles Robert genes y su carácter dominante o recesivo. O sea, que las del estudio meticuloso de la adaptación de los seres Darwin en su obra El Origen de las Especies (1859) sigue ideas expuestas por Darwin, Lamarck y Méndez siguen vivivos a su medio, se descubren los propósitos divinos gentes en cuanto a evolución biológica o evolución de las siendo la más aceptada. y las buenas intenciones.6 especies. La versión inglesa de la teología natural profesa Profesor Ismael Sin embargo, junto a Darwin deberíamos recordar William Paley,DARWIN Y LAMARCK una armonía perfecta en toda la naturaleza, dando Vidales recordado porDe acuerdo con la teoría evolucionista de Darwin, las plantambién a Alfred Rusell Wallace, que dedicó varios Director del del su analogía lugar al estudio del diseño en todas las adaptaciones. años a realizar estudios similares a los del primero, y relojero y sustas y animales presentan variaciones o mutaciones aleatoProyecto La teología natural permitió tratar a la ciencia y a hacia 1858 había llegado a las mismas conclusiones, coargumentosrias, y su evolución viene por selección natural; es decir, Centro de Altos la teología como un mismo problema, y “durante la para demostrarno dirigida. Esta teoría se impuso a la de Jean-Baptiste Estudios municándoselas a Darwin en una carta, por lo que ambos la existencia primera mitad del siglo XIX muchos naturalistas, como e Investigación llegaron al acuerdo de publicar sus respectivas teorías en de Dios en Pierre Lamarck, según la cual los caracteres adquiridos duPedagógica su Agassiz y Charles Lyell, pensaban que sus tratados obra Teologíarante la vida pasaban a la descendencia. El ejemplo con el la revista Journal of the Linnean Society, acompañados de ividales@att.net.mx científicos eran meros ejercicios de teología natural.”7 Natural.

Las teorías de la evolución no han evolucionado

C

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

17

89

Pie de Página cómo las innumerables especies que habitan el mundo se Su teoría se formula de modo sencillo en la Introducción: han ido modificando, hasta adquirir esta perfección esComo de cada especie nacen muchos más individuos 1 tructural y esta adaptación mutua”. Una versión de los que pueden sobrevivir, y como, en consecuencia, más extensa de Ciertamente, buena parte de los cambios pueden hay una lucha por la vida, que se repite frecuentemente, este artículo está atribuirse a variaciones climatológicas, a desequilibrios por aparecer se sigue que todo ser, si varía, por débilmente que sea, en un volumen ecológicos o, incluso, como hace Cuvier, a grandes catade algún modo provechoso para él bajo las complejas y especial dedicado clismos naturales. Sin embargo, no puede sostenerse que a Charles Darwin y a veces variables condiciones de la vida, tendrá mayor la evolución, de la la responsabilidad de tales cambios sea sólo de las causas probabilidad de sobrevivir y, de ser así, será naturalmente Revista Ciencias, externas. de la Facultad seleccionado. Según el poderoso principio de la herencia, de Ciencias de la toda variedad seleccionada tenderá a propagar su nueva y UNAM. MECANISMOS DE MODIFICACIÓN modificada forma”. 2 Guthrie, W. K. Afirma Darwin: “Los naturalistas continuamente aluden a C. 1981. Historia condiciones externas, tales como el clima, alimentación, de la Filosofía ORIGEN COMÚN Griega. Vol. VI. etcétera, como la causa única de variación; en un sentido Darwin argumentó contundentemente en favor de un ori- Introducción limitado, esto puede ser verdad. Pero es absurdo atribuir gen común de las especies, pero evitó el entonces contro- a la Filosofía de Aristóteles. a causas puramente externas la estructura, por ejemplo, vertido término “evolución”, y al final del libro concluyó Traducción del pájaro carpintero, tan admirablemente adaptado para española. Madrid: que: capturar insectos bajo la corteza de los árboles, e igualGredos; Jaeger, Hay grandeza en esta concepción de que la vida, con W. W. 1997. mente absurdo explicar la estructura de un parásito y sus sus diferentes fuerzas, ha sido alentada por el Creador en Aristóteles. relaciones con varios seres orgánicos distintos, por efecto Traducción un reducido número de formas o en una sola, y que, mien- española. México: de las condiciones externas, de la costumbre o de la votras este planeta ha ido girando según la constante ley de Fondo de Cultura luntad de la misma planta.” Económica. 4ta. la gravitación, se han desarrollado y se están desarrollan- Reimpresión; Lear, Así, para Darwin, “es de la mayor importancia alcando, a partir de un principio tan sencillo, una infinidad de J.1994. Aristóteles. zar un juicio claro acerca de los mecanismos de modifiTraducción las formas más bellas y portentosas. española. Madrid: cación y adaptación mutua”. Darwin, primo de Sir Francis Galton, tuvo diez hijos, Alianza Editorial. Autores como Ayala consideran que “la principal modos de los cuales murieron tempranamente; los ocho 3 Aristóteles. tivación de El Origen de las Especies era la de proveer una 1993a. Física. mejores sobrevivieron. solución al problema de Paley; a saber, demostrar cómo Libros I y II. Traducción su descubrimiento de la selección natural daba cuenta del española. Buenos diseño de los organismos, sin la necesidad de recurrir a Aires: Biblos. p. 96. agentes supernaturales.”8
la presentación firmada por Charles Lyell y Jospeh Hooker DARWIN Y EL PROBLEMA DEL DISEÑO y un resumen de la carta que Darwin había enviado el 5 de Paley fue leído por Darwin cuando éste era estudiante, enseptiembre de 1857 al botánico estadounidense Asa Gray, tre 1827 y 1831. Darwin leyó y disfrutó la Teología Natuen la que hablaba de su teoría. Al año siguiente Darwin ral en sus años de estudiante en Cambridge, y encontró publicó en 1859 un resumen de sus ideas con el nombre el argumento bastante sugerente, aunque posteriormente de El origen de las especies. cambiaría de opinión. La motivación principal de Darwin Charles Robert Darwin nació el 12 de febrero de 1809 en El Origen de las Especies era dar una solución al proy murió el 19 de abril de 1882. En alcance a su primera blema de Paley; es decir, mostrar cómo su descubrimiento publicación, vieron también la luz pública las obras El oride la selección natural podría dar cuenta del diseño de los gen del hombre y de la selección en relación al sexo, y La exorganismos, sin la necesidad de agentes supernaturales. presión de las emociones en los animales y en el hombre. Darwin, desde su viaje alrededor del mundo a bordo del barco inglés HMS Beagle (viaje que duró de 1831 a EL ORIGEN DE LAS ESPECIES 1836), planteó el problema de la adaptación al descubrir El origen de las especies mediante la selección natural o la ciertas diferencias y variaciones existentes entre los pinzoconservación de las razas favorecidas en la lucha por la nes de las Islas Galápagos, como lo era la forma del pico vida (mejor conocido como El origen de las especies) desde y la forma de alimentación, entre otras. Estas diferencias su primera edición fue un best seller, pues el primer tiro, fueron explicadas por medio del concepto de adaptación, de mil 250 copias, tenía un número de suscriptores supesin recurrir a la teoría de la herencia de los caracteres adrior cuando salió a venta a los libreros el 22 de noviembre quiridos de Lamarck ni, menos aún, a la doctrina del dide 1859. seño o de la adaptación perfecta de la teología natural. Contra lo que afirman sus detractores, en el libro, En la introducción a El origen de las especies, Darwin Darwin no se refiere al origen del hombre; expone una reflexionó sobre las afinidades entre las diversas especies, “extensa argumentación” a partir de observaciones desu distribución geográfica, su sucesión geológica y otros talladas e inferencias, y considera con anticipación las hechos semejantes. Concluyó que las especies no han objeciones a su teoría. Su única alusión a la evolución husido creadas de manera independiente, sino que se han mana fue un comentario moderado en el que se hablaba originado unas de otras. “Sin embargo, esta conclusión... de que “se arrojará luz sobre el origen del hombre y su no sería satisfactoria mientras no se pueda demostrar Rhinoderma darwini. historia.”
4 Hull, 1973. Hull, D. 1973. Darwin and his Critics. The Reception of Darwin’s Theory of Evolution by the Scientific Community. Chicago: The University of Chicago Press. 5 Hull, D. 1973. Darwin and his Critics. The Reception of Darwin’s Theory of Evolution by the Scientific Community. Chicago: The University of Chicago Press.

Jean-Baptiste Lamarck

86

18

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

Una de las principales aportaciones de la bioinformática para el entendimiento de la evolución es su ayuda en la reconstrucción de árboles filogenéticos con base en secuencias proteicas o de ácidos nucleicos y así ayuda a rastrear la historia evolutiva de las especies.

Pie de Página
6 Mayr, E. 1982. The Growth of Biological Thought. Diversity, Evolution and Inheritance. Cambridge: Harvard University Press; Lennox, J. G. 1992. Teleology. En: Keller, E.F. and Lloyd, E. (eds.). Keywords in Evolutionary Biology. Cambridge: Harvard University Press. pp.324-333.

BIOINFORMÁTICA, PINZONES Y LIGAS EXTRAÑAS En algunos ejemplos que veremos a continuación y que revelan el valor del paradigma darwiniano, han participado en forma decisiva la bioinformática, los pinzones y más ligas extrañas. Las aves llamadas pinzones son emblemáticas en el trabajo de Darwin. Al estudiar los pinzones de las Islas Galápagos, concluyó que todos tenían un origen común y que sus diferencias obedecían a la selección en los diferentes ambientes. Una de las diferencias 7 Mayr, E. 1982. que observó fue la forma de los picos, que se relacionaThe Growth of ban directamente con sus fuentes de alimento. Biological Thought. Diversity, Evolution La genómica ha ayudado a clarificar esta diversidad. and Inheritance. Se han identificado ya algunos genes relacionados con Cambridge: Harvard University la forma de los picos. Uno de ellos es el llamado BMP4, Press. P. 373. cuyo nivel de expresión modifica la forma del pico. Así, 8 Ayala, F. J. el pinzón grande de Darwin (Geospiza magnirostris), con 1970. Teleological un pico robusto que le permite abrir semillas duras, tiene Explanations in Evolutionary la máxima expresión de dicho gen. Biology. Y he aquí la liga extraña: el mismo gen, BMP4 es el Philosophy of Science, 37:1-15, responsable de la variación en forma y tamaño de las VARIACIÓN CONTINUA E IMPERCEPTIBLE concepción acerca del diseño, en donde aparentemente p. 10. mandíbulas en unos peces de la familia de los cíclidos. En la teoría de la evolución por selección natural de Darwin, se eliminaba toda visión teleológica. La teoría de Darwin 9 Esto ilustra de forma contundente la idea de Darwin soDarwin, C. la variación en la naturaleza ocurre de forma continua e apareció como una negación tajante de ese tipo de teleo1968 [1859]. The bre la estrecha relación que existe entre todos los seres Origin of Species. imperceptible, y aparece de acuerdo a leyes desconocidas logía, en la medida en que introdujo en el mundo natural vivos. London: Penguin. (que serán postuladas hasta el siglo XX). Sobre esta variala dinámica de los seres vivos y echó fuera de su seno las p. 132. Otro ejemplo de una liga extraña entre los seres vivos ción individual actúa la selección natural, produciendo un deidades y entelequias. 10 es un gen: el FOXP2. Esta secuencia de ADN es crucial en Darwin, C. patrón continuo de evolución. Así, la adaptación de los orEsta teoría cambió radicalmente el mundo del ser 1968 [1859]. The el habla de los seres humanos, y, cuando se encuentra Origin of Species. ganismos a su medio se debe a la actuación predominante humano. A pesar de que Darwin no fue el primero en alterada, puede afectar el uso del lenguaje oral. Sucede, London: Penguin. de la selección natural a través de las generaciones. hablar de la transmutación de las especies, su teoría p. Darwin en esquema de la selección natural descrita por 283. sorprendentemente, que el mismo gen es crucial en el canto de los pinzones. En este proceso evolutivo continuo, Darwin niega la tuvo muchísimo impacto al presentar evidencia contunsu libro. Un punto de vital importancia en cuanto a la muidea de un diseño debido a la existencia de un ser divino y dente. De igual forma, su teoría tenía implicaciones más tación para ojos azules es que se encuentra dentro de una SELECCIÓN SEXUAL omnipotente. Según Darwin, si su explicación era correcta, allá de la biología, al trastocar creencias y comportamienUna de las grandes aportaciones de Darwin a la teoría de la evolución fue el con- secuencia reguladora; es decir, una que modula la exprela evolución biológica podría tener lugar; los organismos tos arraigados en el siglo XIX. cepto de selección sexual. Con esto se refería a la preferencia de las hembras por sión de otros genes. podrían haber cambiado y diversificado en el tiempo, ciertos machos y, en las especies eminentemente polígamas, a la batalla de los como respuesta a la diversidad de condiciones en diferenmachos por el harem más grande. Estos fenómenos, de acuerdo con su teoría, EL ADN QUE MODULA LOS GENES tes lugares y momentos. Para Darwin, entonces, la evidenCon el conocimiento de la función de los diferentes segconstituyen un mecanismo importante en el proceso evolutivo. cia de la evolución corroboraba su explicación del diseño Se conocen actualmente muchos datos contundentes sobre el papel de la mentos de ADN, se ha hecho patente el papel fundamental como resultado de la selección natural. selección sexual en la evolución. Por ejemplo, los peces cíclidos machos del Lago de las secuencias reguladoras en la evolución. Así, las jiraEn El Origen de las Especies, Darwin expresó una visión Victoria presentan diferentes tonalidades, de acuerdo a la profundidad en la que fas no tienen un gen especial para el crecimiento, adiciode la evolución como un proceso dirigido. “El hombre sehabitan, lo cual les permite ser llamativos para las hembras. Así, aquéllos que vi- nal a lo que tienen por ejemplo los ratones. La diferencia lecciona para su beneficio; la naturaleza sólo para el bien ven en las profundidades presentan tonos rojos, mientras los que medran cerca fundamental entre el tamaño de las dos especies no está del individuo.”9 “La selección natural no puede producir precisamente en los genes que intervienen directamente de la superficie los tienen azules. ninguna modificación en ninguna especie exclusivaUn carácter humano que pudo haberse extendido inicialmente por selec- en el crecimiento, sino en los que regulan su expresión. mente para el bien de otra. Pero la selección natural pueEste tipo de fenómenos se mencionan en el número ción sexual es el de ojos azules. Esta mutación apareció como el simple camde y a veces produce estructuras para herir directamente bio de una base a otra en el ADN: el paso de adenina a guanina. Esto ocurrió más reciente de la revista Science, dedicado a la especiaa otras especies.”10 De esta forma, Darwin piensa que la hace entre seis mil y diez mil años, en algún lugar cerca del Mar Muerto. ¿Cómo ción, como una conmemoración por el bicentenario del selección natural guía a las especies de acuerdo al criterio fue que esta mutación se dispersó hasta alcanzar una frecuencia mundial cer- nacimiento de Charles Darwin. Un artículo señala que obde lo que es bueno para ellas. La selección natural es una servaciones recientes indican que no todos los genes cana al nueve por ciento? fuerza imperceptible que orienta el cambio evolutivo. Una respuesta verosímil es la selección sexual, que permitió a quienes mani- son iguales a los ojos de la evolución. Las mutaciones festaban esta mutación tener más posibilidad de aparearse y procrear. Hay otras relevantes tienden a acumularse en unos llamados “punCONCLUSIONES explicaciones posibles: por ejemplo, la estrecha relación entre los ojos claros y tos calientes” del genoma. La evolución genética está Antes de la publicación de El Origen de las Especies, las la piel con poca pigmentación, y su efecto en el uso de la radiación solar para condicionada por la función de los genes, la estructura de concepciones teleológicas eran dominadas por la exisla síntesis de la vitamina D. Sin embargo, esta explicación entra también en el las redes genéticas y la biología de las poblaciones. tencia de Dios. Darwin definitivamente puso de lado esta

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

19

87

DARWIN WAS HERE El legado de Charles Darwin sigue siendo de mucha actualidad, y su paradigma es básico para dar sentido a la gran cantidad de información molecular de que disponemos actualmente. La serie de símbolos que anoto a continuación representa la secuencia proteica de un factor de transcripción en una planta que es modelo en los estudios genéticos: Arabidopsis taliana. Los factores de transcripción son moduladores de la expresión de los genes y, por lo tanto, altamente importantes en la evolución. He aquí la secuencia de aminoácidos de ese factor, con el código convencional de una letra: MALFSPPISSSSLQNPNFIPKFSFSLLSSNRFSLLSVTRASSDSGSTSPTAAVSVEAPEPVEVIVKEPPQSTPAVKKEETATAKNVAVEGEEMKTTESVVKFQDARWINGTWDLKQFEKDGKTDWDSVIV AEAKRRKWLEENPETTSNDEPVLFDTSIIPWWAWIKRYHLPEAELLNGRAAMIGFFMAYFVDSLTGVGLVDQMGNFFCKTLLFVAVAGVLFIRKNEDVDKLKNLFDETTLYDKQWQAAWKNDDDESLGSKKK Si. Ahí está la palabra Darwin... ¿Casualidad? Sí... pero una casualidad deliciosa, para mi gusto.

Efemérides en el pensamiento darwiniano
el pensamiento humano fue tan impactante, que generó un profundo cambio en la concepción de la naturaleza de la sociedad medieval y particularmente en la situación de nuestro planeta en el cosmos. En su momento, las ideas de Darwin echaron por tierra la cosmovisión concebida durante la Edad Media, cuyo inicio se remonta al año 529, cuando el emperador romano, Justiniano I, ordenó el cierre de la Academia de Platón por considerarlo un establecimiento pagano; según su edicto: Prohibimos que enseñen ninguna doctrina aquéllos que se encuentran afectados por la locura de los impíos paganos. OSCURANTISMO Este hecho simboliza el inicio de una época oscura para la ciencia, que dejó atrás las ideas de los filósofos griegos como Anaximandro: el ancestro de los humanos debió ser un organismo marino, y Empédocles: los hombres, como todos los animales y plantas, están compuestos de los mismos elementos en diferentes proporciones, por lo que hay la misma naturaleza en todos ellos, ideas concebidas entre los siglos VII y V antes de nuestra era, y que fueron, sin duda, precursoras incipientes de la teoría moderna de la Evolución. La fundación de la primera universidad en la historia, hace mil 150 años, marcó el inicio del lento proceso

César Cantú Ayala

E REFERENCIAS

l año 2009 es de gran importancia para la Biología, ya que se conmemora el bicentenario del natalicio de Charles Darwin y el aniversario 150 de la publicación de su más importante obra: El origen de las especies por Darwin, Charles (1859), medio de la selección natural. On the origin of species by means of natural selection, or the preservation of Elfavoured races in the struggle for life (1st ed.), London: 12 de febrero de 1809 nació en Inglaterra Charles John Murray, http://darwinonline. Robert Darwin, quien se convertiría en el biólogo más org.uk/content/frameset?itemID=F373&viewtype=text ilustre de la historia, al sentar las bases para el estudio &pageseq=1, retrieved on 2009-01moderno no sólo de los seres vivos, sino de la natura09 leza en general, con su teoría evolutiva publicada el 24 Longa-Martínez VM. 2006. que el significado del de noviembre de 1859 en el libroSobre revolucionó no sólo descubrimiento del gen FOXP2. ELUA la cosmovisión el pensamiento científico de su época, sino177-207 Quammen D, 2009. Primeras pistas de Darwin. de la National Geographic 24: 10-21. humanidad. Darwin planteó que nuestra especie, al igual que el resto de los seres vivos, tiene un origen natural y Ridley M, 2009. Los nuevos Darwin. National de su no divino, como lo imponía el Establishment Geographic 24: 32-17. época. Pese a ello, C. E. 1948. A mathematical theory of Shannon, 2009 ha sido declarado Año Internacional de la communication. Bell System Technical Journal 27, de Astronomía, dado que se conmemoran 400 años 379-423, 623-656. que el astrónomo Galileo Galilei dirigió por primera vez un telescopio al cielo para observar los astros, lo que le Stern DL and Orgogozo V, 2009. Is genetic evolution llevó predictable? Science heliocéntrica, con lo que cambió a plantear la teoría 323:746-751. el paradigma planteado por Ptolomeo en el siglo I de nuesThe Chimpanzee Sequence Analysis Consortium. tra era, queInitial sequence of the chimpanzee genome 2005. concebía a la Tierra en el centro del universo. No obstante que la idea de Galileo era errónea, pues and comparison with the human. Nature 437:69-87. Wright R, 1995. The moral animal. su influencia en ubicaba al Sol en el centro del universo,Ed. Vintage, USA.

Arabidopsis taliana.

Doctor César Cantú Ayala Profesor de Conservación Ecológica Facultad de Ciencias Forestales, UANL ccantua@prodigy. net.mx

84

20

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

de cambio de las ideas medievales. En el año 859, los árabes crearon la Universidad de Karaouiyne, en el seno de una mezquita musulmana, en la ciudad de Fes, en Marruecos. Esta universidad es la más antigua del mundo, y permanece activa en nuestros días. A partir de ese momento, se desencadenó la creación de las primeras universidades en Europa, entre las que destaca la Universidad de Cambridge, en Inglaterra, en el año 1209, Alma Mater de Charles Darwin, donde aprendió Geología y Botánica, entre otras ciencias, bajo la tutela de dos excelentes profesores: Adam Sedgwick y John Henslow. El año 1789 marcó otro importante cambio en el rumbo de la historia de la M. Humbertocon la Revolución Francesa. humanidad, Reyes Valdés Un aspecto fundamental de este movimiento social, que abrió paso a un nuevo paradigma para la época, fue el que laude Shannon (1916-2001) trabajaba en los Laboramarcaron los pensadores liberales Juan Jacobo Rosseau, torios Bell cuando desarrolló las bases de la teoría de Voltaire, John Locke, David Hume y el mismo zoólogo Jean la información, donde describía por primera vez una Baptiste Lamarck, proponiendo el deísmo como corriente medida de incertidumbre, la que hoy conocemos como enfilosófica cuya idea central establece que ni la naturaleza tropía de Shannon. Los cimientos construidos por Shanni los seres humanos están regidos por una fuerza divina non para la teoría de la información son hoy en día básicos superior, sino por principios y leyes naturales accesibles a en las medidas de capacidad de memoria electrónica, en la nuestro entendimiento; lo que determinó el derrocamiento compresión de archivos, intercambio de mensajes y codidel teísmo, derivado de la tradición judeo-cristiana, cuyas ficación. ideas creacionistas y fijistas dominaron el pensamiento Sus aportaciones, junto con otras vertientes de las Universidad de Cambridge, Inglaterra. occidental por más de nueve siglos. ciencias, han convergido en lo que ahora podríamos llamar era de la información, donde se tiene una capacidad ESTUDIO DE LA NATURALEZA de almacenamiento, transmisión y manejo de datos inSería Darwin, con su magnifica teoría evolutiva, el que finalmente consolidaría imaginable hasta hace unas cuantas décadas. Esta capacilas bases conceptuales para el estudio de la naturaleza, no sólo en el campo de la dad de manejo informático ha sido, como veremos más biología, sino también en las áreas de la filosofía y la sociología, entre otras. adelante, decisiva en la validación y desarrollo del paraJean Baptiste Lamarck quien participó activamente en la Revolución Frandigma darwiniano. cesa, publicó en 1809, precisamente el año del natalicio de Charles Darwin, Charles Darwin, durante su memorable viaje en el Beael libro Philosophie Zoologique, en el que plasmó la hipótesis evolutiva más gle, tenía como fuente de datos unos cuantos libros que llesignificativa hasta entonces, lo que sentaría las bases para que, años más tarde, vaba en su pequeño camarote, algunos de los cuales leyó Darwin desarrollara, paralelamente con Alfred Russel Wallace, las ideas acerca y releyó en medio del mar; su otra fuente de datos, más de la teoría de la Selección Natural, que fueron presentadas por primera ocasión importante por cierto: los animales y plantas que observó a mediados de 1858, en la Sociedad Linneana de Londres. mar adentro, en las costas continentales y en los islotes, y también la gran cantidad de fósiles que desenterró. Su VON HUMBOLDT CPU era un cerebro de observación aguda, y con la idea Alexander von Humboldt, el naturalista alemán padre de la geografía, quien no común en aquella época, de que todos los seres vivos nació hace 240 años, en 1769, y falleció el año de la publicación de El origen de están conectados entre sí. Claude Shannon. las especies, de Darwin, inició en 1799 una expedición científica de cinco años por el continente americano. Humboldt influyó marcadamente en el pensamiento de Darwin, a través de su obra monumental Cosmos, cuyo primero de cinco FUNDAMENTOS DE LA SELECCIÓN NATURAL volúmenes apareció en 1845. En 1836, cuando Darwin concluyó la expedición de Estas fuentes y su relación con otros estudiosos, como cinco años en el Beagle alrededor del mundo, aún conservaba las ideas creacionisAlfred Russell Wallace y Richard Owen, lo llevaron a la tas, por lo que tuvieron que pasar más de 20 años de análisis concienzudo descripción de la idea y los fundamentos del origen de las de los especímenes colectados en su viaje, y la lectura de múltiples trabajos especies através de la selección natural; un concepto que científicos de influyentes naturalistas, para que estructurara su teoría evole da sentido a la diversidad biológica en el mundo y que Doctor lutiva por medio de la selección natural. Dicha proeza la consiguió a pesar de M. Humberto ha tenido impacto en muchos campos del conocimiento y las lagunas de conocimiento existentes en su época, tales como la forma en que Reyes Valdés en la vida humana. Miembro del surge la vida, ya que entonces se aceptaba la teoría de la Generación Espontánea. Un ejemplo es la nueva ciencia de la Psicología EvoSistema Nacional De la misma manera, se desconocían los mecanismos de transmisión de los calutiva, que pone en un marco consistente hechos como de Investigadores racteres hereditarios, descritos hasta 1866 por Gregor Mendel y rescatados del Profesor la sensación de autosuficiencia de los adolescentes, o la Investigador / olvido hasta ya iniciado el siglo XX cuando fueron redescubiertos. No fue sino mentira que prevalece en las especies vivas y que tiene UAAAN hasta 1909, dieciséis años después de la muerte de Darwin, cuando el biólogo a su mayor exponente en el ser humano, con la poderosa mathgenome@ Danés Wilhem Johannsen acuñó el término gene para denotar a las unidades gmail.com herramienta del lenguaje. Alexander von Humboldt, pintado por Joseph Stieler. básicas transmisoras de la herencia.

Darwinismo en la era de la información
C

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

21

85

quien, estudiando la Biblia, dedujo que la creación ocurrió revela la gran similitud que existe entre el genoma humael año 4004 antes de nuestra Era, por lo que el Universo, no y el del chimpancé, con lo que se corrobora que se trata según su interpretación, no tenía más de seis mil años de de nuestro pariente biológico más cercano. existencia. Los estudios indican una similitud del 96 por ciento No sólo contra este tipo de hechos dogmáticos tuvo o mayor entre ambos genomas, y que el antecesor común que lidiar Darwin, sino con su fuero interior, ya que en su del humano y el chimpancé se ubica en una antigüedad de formación original en el Christ´s College, de la Universientre cinco y siete millones de años. Obviamente, quienes dad de Cambridge, había recibido, además de las cátedras caricaturizaron a Darwin con cuerpo de mono jamás imade geología y botánica, la cátedra en teología, por lo que, ginaron en realidad el grado de parentesco entre el ser de no haber realizado la expedición en el Beagle, muy humano y otros respetables primates. probablemente se hubiera convertido en pastor anglicano, como era el deseo de su padre. EL MUNDO DE LA INFORMÁTICA La respuesta social en rechazo a su teoría evolutiva, Análisis como la comparación entre el genoma humano y cuando ésta fue presentada en la primera edición de El el del chimpancé, o el trazo de árboles filogenéticos para origen de las especies, fue atemperada por la intervención las plantas con flores, o la dilucidación de la función de LIGAS EXTRAÑAS de científicos amigos de Darwin, entre los que destacan nuevas secuencias que se detectan día a día, serían virUn zapatero y naturalista aficionado, de nombre Walter Thomas Huxley y Ernst Haeckel, quienes apoyaron su tualmente imposibles sin la ayuda de las tecnologías de Drawbridge Crick, le envió al eminente naturalista Charles teoría y permitieron su aceptación en buena parte de los información. La fusión entre las ciencias biológicas y la Darwin un escarabajo que recolectó de una laguna. Unos círculos científicos de su tiempo. informática se denomina bioinformática, y podría llacuantos días antes de su muerte, Darwin escribió un enEn noviembre próximo se cumplirán 150 años de la mársele biología in sílico. sayo sobre una almeja que encontró pegada a la pata de publicación del libro que causó tanta controversia, por lo Tiene sus raíces en la computación, la estadística este insecto. La conexión extraña consiste en que Walter que podríamos pensar que, tras este prolongado periodo, y la biología molecular, y permite, entre otras cosas, la Crick tuvo un hijo de nombre Harry Crick, quien a su vez y tantos avances científicos y tecnológicos de que ahora predicción de la función de secuencias de ADN, el descufue padre de Francis Crick, ni más ni menos que el cientídisfruta la sociedad, se debería aceptar la idea fundabrimiento de genes, el análisis filogenético, el diseño de fico que junto con James Watson describió el modelo de la mental de Darwin sobre el origen de las especies, pero iniciadores para reacción en cadena de la ADN polimerasa, doble hélice para la molécula de ADN, el material genético, desgraciadamente no es así. la predicción de funciones proteicas y la construcción de la base de la vida. En Inglaterra, hoy en día, 40 de cada 100 personas reDARWIN Y EL ESCLAVISMO mapas genéticos. Tiene como herramientas la prograEste descubrimiento fue seguido de muchos otros Abraham Lincoln nació en la misma fecha que Charles Darwin, y al igual que él chazan la teoría de la evolución y aceptan las ideas del mación (Perl, Java, etcétera), las bases de datos genómicas revolucionarios en la biología molecular, como el código era antiesclavista. El joven Darwin, que en 1832 contaba con sólo 24 años de creacionismo, y consideran que la Tierra cuenta apenas (GenBank, Suiss-Prot, nr, etcétera), las matemáticas y la genético, el mecanismo de transcripción, la síntesis de edad, apuntó en el libro de viaje sus impresiones acerca del esclavismo, que en con seis mil años de existencia. En los EUA, no obstante estadística, entre otras. proteínas y la regulación genética. La biología molecusu tiempo era considerado normal por la conciencia social imperante: Aquéllos que es el país cuya población consume el 22 por ciento del Probablemente el principal algoritmo bioinformático lar en combinación estrecha con la explosión informática que sienten simpatía por el amo y frialdad de corazón por el esclavo, no pare- producto interno bruto mundial, y que es considerado uno es el BLAST, cuyas siglas vienen del inglés “basic local de los tiempos modernos, ha permitido validar y explicar cen ponerse nunca en el lugar de este último; ¡qué sombrías perspectivas, sin la de los principales estereotipos de desarrollo tecnológico alignment search tool”. Con la ayuda del BLAST se pueden mucho de lo que sabemos de la evolución, y también nos menor esperanza de cambio! Imagínese a usted mismo ante la posibilidad, siem- del planeta, 60 de cada 100 personas son creacionistas, buscar alineaciones y similitudes entre secuencias de nuha enfrentado con nuevos misterios. pre planeando sobre su cabeza, de que su mujer y sus hijos (aquellos objetos que por lo que existe una clara desvinculación entre el avance cleótidos de ADN o entre las secuencias de aminoácidos La síntesis de la informática y la tecnología molecular la naturaleza empuja a llamar propios incluso a un esclavo) sean arrancados de tecnológico y cultural de la población. de las proteínas, y así dilucidar parentescos filogenéticos relacionada con los ácidos nucleicos, especialmente en lo ¿Qué porcentaje de la población en México aceptará las su lado y vendidos al mejor postor como si fueran ganado. ¡Y también los actos y posibles funciones de genes o proteínas. que se refiere a la secuenciación, ha gestado una rama de son perpetrados por hombres que profesan amar al prójimo tanto como a sí mis- ideas creacionistas para explicarse la realidad? Es evidente la ciencia de mucha actualidad: la genómica. mos, hombres que creen en Dios y que rezan para que se haga su voluntad en la que aún queda mucho por hacer para transmitir “La idea Tierra! Le enciende a uno la sangre, pero también le encoge el corazón pensar más poderosa jamás concebida” como ha sido calificada RECURSOS TECNOLÓGICOS que los ingleses y nuestros descendientes americanos, con su orgulloso grito de por los científicos la teoría evolutiva. Una serie de técnicas clave permitieron el desarrollo de libertad, hemos sido y somos tan culpables. la genómica: la electrofóresis de ADN, que permite sepaEste pasaje denota su gran sensibilidad y preocupación por los grupos sociarar las moléculas por tamaños en un campo eléctrico; las les marginados, con agudos cuestionamientos a la ética de su época, como más IN MEMORIAM enzimas de restricción, bisturíes bioquímicos que cortan tarde lo volvería a referir a su paso por la Patagonia y Tahití, cuando contactó a El 11 de febrero de 2009 falleció el esa misma molécula en sitios específicos; la clonación de los habitantes nativos y observó su relación con las personas de occidente. doctor Salvador Contreras Balderas, ADN; es decir, la elaboración de copias con la ayuda de los Otro pasaje de su bitácora de viaje, que ilustra acontecimientos que marcapionero de los estudios ictiológicos en llamados vectores de clonación y con la maquinaria de los ron un cambio en la visión de Darwin acerca de la sociedad y la naturaleza, se el Norte de México, y reconocida automicroorganismos; las bibliotecas genómicas, conjuntos de dio al contactar en diversas ocasiones a los habitantes nativos de la Patagonia: ridad mundial en la materia. Profesor cepas de microorganismos que mantienen representado el los fueguiños, grupo étnico ahora extinto, cuya forma de vida fue descrita por de la cátedra de Evolución por más genoma de una especie; y la reacción en cadena de la ADN Darwin como extremadamente rústica, exigida por las condiciones climáticas en de 25 años en la Facultad de Ciencias Biológicas de polimerasa, inventada por Kary Mullis en 1986, y que geuna de las regiones habitadas por humanos más inhóspitas del mundo, lo que lo la Universidad Autónoma de Nuevo León, Salvador nera millones de copias de sitios específicos de la molécullevó a cuestionar la perfección de la Creación Divina. Contreras falleció a los 73 años, a la misma edad que la sin necesidad de clonación. Charles Darwin. Es un ejemplo para las generaciones Finalmente menciono la informática, que, con toda la ESTRUCTURA Y FUNCIONAMIENTO DE LA NATURALEZA actuales y futuras, por su responsabilidad, dedicación capacidad electrónica de almacenamiento de datos, perPor otra parte, Darwin tuvo que sobreponerse al clima cultural e intelectual de y amor a su profesión, que conservó hasta los últimos mite su manejo y análisis a través de la internet. En su su época, que encontraba en el creacionismo respuesta a las preguntas fundadías de su vida. conjunto, las técnicas de la genómica han arrojado una mentales acerca de la estructura y funcionamiento de la naturaleza. Una base, nueva luz sobre la evolución y en general sobre la natuentonces incuestionable, la había fijado el arzobispo irlandés James Ussher, raleza de los seres vivos. Uno de estos descubrimientos CRECIMIENTO DE LA POBLACIÓN Una de las piezas decisivas en el desarrollo teórico de Darwin fue la idea de Thomas Malthus sobre el crecimiento geométrico de las poblaciones humanas, en comparación con el incremento aritmético de los recursos disponibles para su sostenimiento, y el arribo a un punto de crisis, donde solamente sobreviviría una fracción de la población. Para Darwin esto encajaba perfectamente con la idea de “supervivencia del más apto”. Su obra magna, El origen de las especies a través de la selección natural, publicada en 1859, describe los fundamentos de su paradigma.

82

22

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO
su hábitat a mediados del siglo pasado. En resumen, pareciera que la vaquita ha evolucionado más influenciada por el azar que por la selección natural, escapando en el camino de alguna manera de la extinción por falta de variación y de los problemas de la depresión por endogamia. La teoría neutral de la evolución molecular propuesta por M. Kimura en la década de 1980 demostró que cuando una población aislada como la de la vaquita es lo suficientemente pequeña, la selección natural es verdaderamente inefectiva, y se ve sobrepasada por la deriva genética. En general, la neutralidad de una variante genética se puede asumir cuando el coeficiente de selección (ya sea la desventaja selectiva de un alelo detrimental o la ventaja de un alelo adaptativo) es menor que 1/2Ne. Así, la fijación de genes bajo selección ocurre principalmente para aquéllos con coeficientes de selección pequeños relativos al tamaño efectivo de la población, y la teoría también predice que aquellos genes sujetos a coeficientes mayores deberían estar gobernados aún por la selección. Un grupo de investigadores mexicanos, incluyendo los autores, probaron esta hipótesis. Lo que encontraron fue que, efectivamente, el gen con el coeficiente de selección mayor dentro del MHC encargado de responder ante bacterias y otros parásitos extracelulares (DRB) presenta variación funcional en la vaquita. El coeficiente de selección del DRB es aproximadamente el doble, comparado con el DQB (1 por ciento). Además, los únicos dos alelos encontrados no son típicos, sino que al ser expresados tienen la capacidad (descrita previamente in-vitro en moléculas MHC humanas) de formar súper-dimeros que potencializan la respuesta inmune, de manera que con sólo dos alelos, el MHC de la vaquita sería capaz de reconocer una diversidad de patógenos, una forma de “economía en tiempos de crisis”.

OTRAS ESPECIES ENDÉMICAS Cabe mencionar que el patrón observado (DQB monomórfico, DRB polimórfico) lo comparten otras especies de mamíferos endémicos de islas con historias demográficas y de aislamiento similares, tal como el zorro (Urocyon littoralis) endémico de las islas Santa Rosa y San Nicolás frente a California. Así, Darwin, al final, se ve reivindicado, pues al parecer sólo aquellos caracteres que no son cruciales se pueden dar el lujo, tan sólo en poblaciones pequeñas de distribución restringida, de escapar de la selección natural. En ese sentido, el hecho de que todos los indivi-duos POBLACIÓN REDUCIDA Para responder teológicamente a este interrogativo, ara celebrar el 200 aniversario del nacimiento de Simulaciones demográficas del proceso de coalescencia presenten polidactilia sugiere que su efecto deletéreo intentaré y asimismo, los alelos deletéreos de mayor Charles Darwin, se le otorgan como homenaje estos casi nulo, recorrer tres etapas ascendentes: la etapa cientíhan demostrado que la fijación de estos alelos en la espe- es estudios, reconociendo la importancia que ha tenido fica, la etapa filosófica y la etapa teológica. El método que cie es resultado de la deriva genética, debido a un tamaño efecto, causantes de la depresión endogámica observada usaré parte del sentido de purgados por la selección en el ramo de las ciencias biológicas. Pienso que el debate otras especies, habrían sidola fe del pueblo de Dios sobre poblacional (Ne) reducido (quizá unos pocos miles de indi- en surgido a través de los años entre Creacionismo y Evolu- la vida, que es dePodríamos decir entonces que lasentido tiempo. todos conocido, y desde este vamiles de años. A Cardenal Javierviduos) durante cientos delugar, puesto que diferencia de durante largo enunciar solamente algunos postulados elemencionismo no tiene ya no se excluyen, trataré de lo que algunos pudieran suponer, la escasa variación gené- quita es una especie adaptada a niveles de endogamia Lozano Barragán recta perspectiva. Su estudio más tales de la ciencia de la vida, la especie tiene justo la Presidente deltica entendiéndolos en una disminución reciente de la po- pocas veces vistos antes, y que para luego reflexionar sobre no es resultado de la Consejo Pontificio la luz de algunos para sobrevivir acorde a que divulgado fue El origen de las especies. Quiero colaborar ellos agenética necesaria puntos filosóficos. blación relacionada con las actividades humanas, pues tan variación para la Pastoral de Desde estas sido una especieprevias como bases, indos reflexiones de distribución remodestamente a esta conmemoración, ensayando ya no la Saludsólo han pasado alrededor de seis generaciones de vaquita históricamente ha reflexionar sobre sólo algo sobre el origen de las especies, sino poniéndome tentaré escasa abundancia. la vida desde la analogía con jlozano@hlthwork.desde que las redes de pesca comenzaron a utilizarse en stringida y el misterio de la Santísima Trinidad y de la Encarnación otro interrogativo: el origen de la misma vida. va

embargo, la vaquita carece casi completamente de variación genética, pues se ha demostrado que todos los individuos tienen una única variante (alelo) en la región control del ADN mitocondrial y en el gen nuclear DQB. Este último forma parte del complejo principal de histocompatibilidad (MHC por sus siglas en ingles) y, encargado de la respuesta inmune contra patógenos, es extremadamente polimórfico en cualquier otra especie, debido a que la selección natural mantiene un número elevado de alelos y una alta heterocigocidad. • Además, se ha observado que, a diferencia de los demás tetrápodos, todas las vaquitas poseen seis dedos en ambas aletas pectorales (polidactilia), además de otras malformaciones vertebrales típicas de síndromes causada por alelos recesivos en genes encargados del desarrollo embrionario (ejemplo de la familia HOX), que normalmente la selección natural mantiene en baja frecuencia, pero que en este caso se ha convertido en una característica de la Javier Lozano Barragán especie.

VIDA:
P

DONACIÓN DE AMOR

CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES

23

redentora. Especialmente, al tratar de la base científica, soy consciente de no aportar nada nuevo, si no es el enfoque bajo el cual sintetizo toda esta base, que nos abre la puerta para, desde la misma, intentar ahora elaborar la base filosófica, misma que permitirá fincar una analogía de aproximación teológica para comprender; o, más bien dicho, para balbucear algo sobre el misterio de la vida humana.

I. BASE CIENTÍFICA Séame permitido enunciar algunos rudimentos científicos sobre el origen de la vida humana. Lo hago sólo en cuanto me sirven como datos elementales desde los cuales deseo hacer partir mi reflexión sobre la vida como donación de amor. INICIO DE LA VIDA HUMANA La vida humana se inicia en una célula que está formada por membrana celular, citoplasma, membrana nuclear y núcleo. En el citoplasma hay una serie de estructuras con diversas funciones, como los ribosomas, donde se sintetizan las proteínas, consideradas el producto primario de la actividad genética. La membrana nuclear separa al citoplasma del núcleo, dentro del cual se encuentran los cromosomas, en los que están colocados el ADN y los genes, que a su vez se encuentran ubicados en el ADN. Desde los cromosomas brota la vida humana mediante la energía del ADN con sus genes. ¿Cómo sucede?:

ELEMENTOS INICIALES DE LA VIDA HUMANA 1. ACTORES Tenemos cinco actores, a saber: los cromosomas –23 pares, 46 en total-; el ADN –ácido desoxidoribonucleico, donde se ubican los cromosomas, que los envuelve a manera de hélice con una vuelta y tres cuartos-; el ARN –ácido ribonucleico, tanto mensajero como traductor del ADN: ADNm y ADNt-; genes –mínima porción del ADN que determinan la vida; para ello, deben ordenarse de tres en tres, conjuntos que se denominan “tripletas”-; proteínas –que, si tienen una función de metabolismo, se llaman “enzimas”. Son 20 aminoácidos que son ordenados por el ADN-. La función de los genes se explicita más adelante. De los 23 pares de cromosomas humanos, 22 se llaman autosomas y un par, el número 23, se llama gonosoma o cromosoma X. Cuando el par tiene dos cromosomas X, porta el sexo femenino; cuando contiene un cromosoma X y otro Y, origina el sexo masculino. Los genes residen en el ADN, que a su vez se ubica en estos cromosomas, como ya se ha dicho. El movimiento básico del ADN se realiza desde el núcleo de la célula hasta su citoplasma. Para ello atraviesa la membrana del núcleo y se encuentra en el citoplasma con las proteínas que va a ordenar. El ADN se replica en el núcleo, se transcribe en el mismo núcleo y se traduce fuera del núcleo, en el citoplasma en el Ribosoma, y, traducido, llega a las proteínas, ubicadas como se ha dicho en el mismo citoplasma. Manda su información desde el núcleo; esta información se transcribe y se traduce para llegar así a las proteínas. La recepción de la información, su transcripción y traducción se hace en el ácido ribonucleico, ARN, que se llama “mensajero” ARNm, hasta salir del núcleo de la célula; y se llama “traductor”, ARNt, cuando hace la traducción del ADN en el citoplasma, en el Ribosoma, para que así se puedan ordenar los aminoácidos de las proteínas. Los 20 aminoácidos de la proteína que ordena el ADN son: arginina, cisteína, asparagina, ácido glutónico, fenilalamina, glicide, histidina, isoleucina, lijaide, licina, mediodine, prolina, glutomina, serina, treandine, valine, triptófano, tirocina, argidina y apartica.

2. ESTRUCTURA DEL ADN La estructura del ADN consta de cuatro elementos que se combinan, pero que en su expresión más simple son: una base nitrogenada, dos ácidos y una proteína. La base nitrogenada puede ser “púrica” o “primídica”: La base púrica consta de adenina y guanina; la base primídica, de citosina y tiamina. Las bases púricas y primídicas se unen por ligamentos de hidrógeno. Los ácidos son el ácido fosfórico y la desoxidoribosa (azúcar). La proteína es la histona. El conjunto de estos cuatro elementos forma un nucleótido. El conjunto de nucleótidos se encadenan y sus cadenas forman el ADN.

80

24

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

bioquímicas, paleontológicas y embriológicas, la única teoría (explicación) científica de la diversidad biológica es la evolución. Por supuesto, el creacionista dirá que Dios tuvo razones inescrutables para crear órganos imperfectos e incluso vestigios inútiles, como nuestro apéndice vermiforme; causas desconocidas para diseñar la biodiversidad de manera que pudieran reconstruirse árboles genealógicos de las especies; motivos inimaginables para hacernos 99 por ciento iguales, genéticamente, al chimpancé y al gorila; fundamentos incognoscibles para sembrar fósiles de seres intermedios entre el hombre y los antropoides, etcétera. No obstante, hay un principio epistemológico (es decir, de búsqueda de la verdad) que el creacionismo viola de entrada: “entre todas las explicaciones posibles de un hecho, hay que escoger la más simple”. ¿Por qué pensar en un dios que crea una por una a todas las especies del planeta, si existe una explicación terrenal para el origen de las especies? Como decía Carl Sagan: “¿para qué inventar a un dios increado, hacedor del universo, cuando es más sen3. ESTRUCTURA DEL ARN cillo pensar que el increado (o autocreado) es el universo El ARN se distingue del ADN en que el primero tiene una sola banda en lugar mismo?” de las dos que tiene la “hélice” del ADN. En esta banda tiene las mismas bases Nadie vio al primer mero, satisfecho por una buena nitrogenadas del ADN, excepto la tiamina, que suple por otra base denominada comida, en el momento de permitir a los primeros gobios “uracilo”. Queda así constituido por adenina, citosina, guanina y uracilo. El ARN valientes, hambrientos de parásitos, entrar en su boca limensajero (ARNm) “fotografía” al ADN en el núcleo, y así transcribe y transmite bremente. Pero, ¿no es más sencillo pensar que eso es lo la información del ADN al citoplasma para ordenar los aminoácidos de las proque sucedió, y no que Alguien lo diseñó desde el cielo para teínas. La información “fotografiada” por el ARNm se lee en las secuencias de deleite de los biólogos marinos? tres genes de las que hablábamos y que decíamos que se denominaban “tripleEl científico no asegura que sus teorías sean dogmas tas”; estas tripletas se llaman a su vez “codones” y sirven como molde para que o que puedan explicarlo todo (y ésta es la gran diferencia en ellas se ubiquen las proteínas y así se haga su síntesis; junto con los codones entre ciencia y religión). La ciencia puede a menudo esse encuentra otra sustancia del ARN, que se denomina “anticodón”; los anticotar hecha de errores (errores que es preciso cometer para dones son los que se encargan de dar la secuencia correcta a los aminoácidos de acercarse paulatinamente a la verdad), pero una teoría no las proteínas que se han amoldado en los codones. Aquí el ARN se convierte en se refuta gratuitamente. Incluso la existencia de casos in“traductor”, ARNt, y realiza una transferencia de familias de moléculas, cada una explicables no basta para derrumbar una teoría. Para ello para un aminoácido distinto de la proteína. Ahora se realiza la codificación de la es necesario no sólo acumular incongruencias de la teoría, secuencia de las mismas proteínas, que lleva a cabo otro elemento que aquí se sino proponer una de mayor poder explicativo. origina desde el ARN. Este elemento se llama “exón”. Junto con éste viene otro más, el “intrón”. Del intrón se sabe poco. Algunos dicen que ayuda al exón en la FENÓMENOS EVOLUTIVOS codificación. Sin embargo, cuando el ARN llega al Ribosoma, que como decíamos En el caso de la evolución, la teoría ha ganado muchísise ubica en el citoplasma de la célula, elimina a los intrones y deja sólo operar mo en poder explicativo desde los tiempos de Darwin. a los exones. Por ejemplo, en los años 30 se consideraba que la selección natural era la única fuerza evolutiva de peso; hoy se sabe que fenómenos evolutivos, tales como la pérdida de los ojos en los peces cavernícolas se explican mejor por cambios genéticos aleatorios (si los ojos no sirven en la oscuridad, una mutación que los reduzca no tendrá efecto selectivo alguno). Suponer que el arrecife coralino es un escenario montado por una inteligencia sobrehumana es gratuito: el creacionismo es un intento dogmático de robar al ser humano y a la vida en la tierra la gloria de sus orígenes naturales. En cambio, pensar en la compleja historia evolutiva detrás de cada uno de los organismos del arrecife y sus interacciones provoca un genuino sentimiento de maravilla. No hace falta inventar algo sobrenatural: lo na-tural es más maravilloso.

4. LOS GENES Los genes son la unidad de la herencia colocada en línea en el núcleo celular como una partecita del ADN (entre el dos y el tres por ciento del ácido). Cada gene tiene muchos nucleótidos. Un nucleótido está formado por azúcar de cinco carbones, ácido fosfórico y una base nitrogenada. La base nitrogenada a su vez está formada por cuatro componentes, a saber: adenina, citosina, guanina y tiamina. Es muy importante notar que la secuencia y proporción de estos elementos determina las propiedades del gene. Los genes actúan a través de las moléculas del ácido ribonucleico para el metabolismo del organismo, o bien para la producción de las proteínas. Las proteínas a su vez están formadas por cadenas de veinte aminoácidos. La secuencia de los aminoácidos en una proteína específica determina si esta proteína formará parte de la estructura de un organismo o bien de su metabolismo. Hay otros componentes de los genes en los animales y en las plantas, que se encuentran en proporción de diez a una en relación con la base nitrogenada; pero todavía no se conocen muy bien. La secuencia interna en el nucleótido es la secuencia de las bases nitrogenadas purídicas y primídicas que a su vez están formadas en grupos de tres, que reciben el nombre de tripletes o cod genes. Es muy importante notar que la secuencia interna y externa de estas bases y su proporción es la que marca la diferencia entre todos los seres vivientes. Un ejemplo de secuencia de tripletes podría ser: ATT---CGC---CGA---AAC---ACG---AAA. 5. CÓDIGO GENÉTICO El Código genético es la información genética cifrada de la secuencia de los nucleótidos. La información del Código genético del ADN se transcribe en una información complementaria en los tripletes del RNA mensajero, que reciben el nombre de codones, y finalmente ésta se traduce para ordenar los aminoácidos de la proteína. Realizado todo el proceso, se ha llegado a determinar el lugar donde su ubican los genes en los cromosomas humanos. Estos lugares les dan la denominación latina: “loci”. Se ha llegado así a poder determinar el trabajo que cada gene realiza con cada aminoácido de las proteínas. Así se ha podido trazar el mapa del genoma humano, su código genético.

CONOCIMIENTO CONOCIMIENTO
6. REPRODUCCIÓN Las células así formadas se dividen y se reproducen por la “mitosis” en proporciones geométricas; cada una con sus 46 cromosomas; excepto la reproducción de las células de las gonadas, las que se reproducen por otro proceso llamado “meiosis”, según el cual la cadena de cromosomas que formaba una hélice de 46 se parte en dos por la mitad. Una mitad va al óvulo y otra al espermatozoo. Cuando el óvulo es fecundado por el espermatozoo, éste se reproduce ya con los 46 cromosomas normales por mitosis; forma así el blastocito, el embrión y el feto.

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

25

81

II. BASE FILOSÓFICA 1. ANTIGUA DEFINICIÓN DE LA VIDA Según la definición clásica, la vida es moverse a sí mismo. Esto es, la vida, nos decían los antiguos, es el ser o actuar de la sustancia, que, según su naturaleza o su operación natural, se relaciona con el movimiento o con alguna operación. Se trata de un ser constituido en sus partes esenciales que ahora se lanza a la vida; esto es, a su movimiento interno. Pero, ¿qué es este movimiento? Se nos responde: es aquello que es en capacidad y potencia en cuanto tal. Por tanto, la vida sería la capacidad primordial de ser y de actuar. 2. MOVIMIENTO ORGÁNICO Precisando más este movimiento orgánico o finalísimo, se puede comprender mejor contraponiéndolo a cierta concepción de la vida que se coloca dentro de un parámetro mecanicista, concibiendo el movimiento vital como una colisión cuántica. El movimiento orgánico que constituye la vida no es un choque de cantidades de la “res extensa” cartesiana, sino una expansión finalística que trasciende la cantidad, aunque no prescinda de ella, y que precisamente gracias a esta finalidad, el movimiento vital es un movimiento que se encuentra en el campo de las relaciones y apunta a una finalidad definida que hace que la vida orgánica sea unidad y que la desintegración vital constituya la muerte.

3. ORGANICIDAD Ser actuando, y actuando siendo. Pero en todo movimiento hay dos términos: uno, del que se procede, y otro, al cual se tiende; y aquél al cual se tiende es su finalidad, lo que especifica y define todo el movimiento. ¿Hacia dónde, pues, Escapando a Darwin y a la extinción tiende la vida? Pienso que la respuesta es que la vida tiende hacia la unidad. La organicidad es lo que especifica la vida; hay una unidad que organiza al ser CONCLUSIÓN DEL MUESTREO BIOGENÉTICO viviente desde dentro y hay una unidad que lo organiza desde fuera; esto es, con De acuerdo a lo anterior, podemos sacar las siguientes relación a otros seres. conclusiones: Pero para que haya organicidad, debe haber distinción de partes, distinción • La vida aparece como un movimiento de órganos, tanto interna como externa; si no, no puede haber unidad. La unidad • Como un movimiento orgánico interna, la organicidad del ser vivo lo constituye presente en la vida; generar • Como un movimiento orgánico complementario que prola propia organicidad es generar la propia vida. Sin embargo, esta organicidad cede siempre a base de intrincadas relaciones delfín de rio chino (Lipotes vexillifer), ocupa el difícil lugar no se agota en lo interno, sino que mira a la organicidad externa, mira hacia la • Y tiene siempre una finalidad. Maestro Adrián del cetáceo en mayor peligro de extinción en el mundo. unidad con los demás seres vivos. La unicidad interna da la individualidad; sin Munguía Vega Adrián Munguía Vega La especie no fue científicamente descrita sino hasta embargo, esta unicidad interna no es vital si no está íntimamenteEstudiante de transformada Se perfila así la vida como “Un movimiento orgánico Ricardo Vázquez Juárez Doctorado 1958, y no hubo disponible una descripción completa de por la unicidad externa, la relación con otros seres vivos. complementario de relaciones y finalidad”. Laboratorio de su morfología externa, sino hasta 1987. Su población tiene La organicidad externa afecta en tal manera la individualidad, Genética de la que ésta no se arwin propuso un nuevo paradigma, totalmente radi- la distribución más restringida de cualquier mamífero Conservación puede cerrar en sí misma para ser vida individual, sino que su riqueza la obtiene cal en su tiempo, acerca de cómo funciona el mundo marino, pues habita un área de alrededor de dos mil 700 Universidad de cuando se abre hacia los demás y se realiza la unidad, la armonía, la convergenArizona, Tucson natural en términos de sus mecanismos y patrones kilómetros cuadrados en las aguas ricas y someras del alto cia de distintos. Podríamos así decir que la vida es la convergencia de distintos. airdrian@email. históricos. También formuló las preguntas más impor- Golfo de California, México. Así, la organicidad externa se vuelve en cierta manera organicidad interna sin arizona.edu tantes que aún hoy definen nuestro entendimiento de la dañar la distinción de los seres vivos. evolución. La influencia en el mundo occidental de su libro SELECCIÓN NATURAL Y EXTINCIÓN El origen de las especies ha sido comparada con el de la Darwin, junto con Alfred Russel Wallace, propuso la idea de que, dado que los recursos son limitados, aquellos inBiblia. En este año en que celebramos a Darwin en el mun- dividuos que están mejor adaptados a su ambiente tienen do entero, nos dimos a la tarea de visitar algunas de sus una mayor sobrevivencia y mayor probabilidad de tener contribuciones más importantes, acompañados de una descendencia. especie marina única en todos los aspectos, para ejempli- En la década de 1930, R. Fisher, S. Wright y J.B.S. Haldane ficar el impacto de las ideas de Darwin a 200 años de su desarrollaron la Síntesis Moderna, y extendieron los procesos selectivos a genes individuales. Además, fue Darwin nacimiento. Doctor Ricardo Vázquez Juárez La marsopa del Golfo de California Phocoena sinus, quien reconoció la presencia e importancia de la extinInvestigador Titular también conocida como “vaquita” es uno de los cetáceos ción de las especies en la historia natural. Centro de En algunos aspectos, la vaquita pareciera ser anti-darmás pequeños (con una longitud máxima de 150 centímeInvestigaciones Biológicas tros). La única población que se ha conocido de la especie winiana (aunque más por necesidad que por convicción): del Noroeste, S.C. • Tal y como Darwin reconoció en un principio, los se estimó en 576 individuos en 1999, y en 150 en 2007. La Paz, BCS La razón de su declive ha sido su muerte incidental en re- procesos de selección natural actúan sobre la variación rvazquez04 des de pesca, y tras la reciente (2007) extinción del Baiji o (morfológica, de comportamiento, genética, etcétera). Sin @cibnor.mx

La vaquita (Phocoena sinus), marsopa endémica del Golfo de California

D

78

26

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

gos de Jehová o los “antropólogos gnósticos”), que a estas 4. SERES DISTINTOS alturas de la historia siguen poniendo en duda la realidad Ahora bien, alguien se puede decir distinto en cuanto tenga lo que otro no tiene de la evolución biológica. y no tenga lo que otro tiene. Hay un aspecto de la vida que implica negación y La diversidad misma de los seres vivos ha sido tamque a través de esta negación se produzca la vida. Esta negación implica una bién utilizada como argumento por estos grupos reliafirmación que exige la organicidad, la convergencia misma en la unidad de digiosos. Señalan la plétora de peces arrecifales, su belleza versos seres, la vida. y sus increíbles adaptaciones al medio (como el mutuaEsta convergencia de distintos, que en último término constituye la vida en lismo del mero y los gobios), y preguntan: “¿Se debe esta su totalidad, ha sido pensada o negada de diversas maneras a través de la histobiodiversidad a la casualidad ciega, a que la naturaleza ria del pensamiento. Una manera de hacerlo ha sido el Panteísmo en todas sus ‘haya tenido suerte millones de veces’ [sic], o ha sido una formas; otra, la Participación. Ha habido también un pensamiento que estructura ‘cuestión de diseño’”? muchas corrientes contemporáneas y ha sido la negación básica de la organicidad externa, al menos al llegar al hombre en la llamada cultura o anticultura de LA EVOLUCIÓN, ¿UN JUEGO DE AZAR? la muerte. La primera tergiversación está en la idea de que la evolución actúe por puro azar. La materia prima de la evolución, 5. NEGACIÓN DE LA DISTINCIÓN: PANTEÍSMO la variación genética ciertamente es aleatoria: las mutaEn el Panteísmo realmente no existe organicidad distinta, pues las barreras se ciones no son intencionales, y la recombinación genética suprimen y el uno es el todo y el todo es uno. Por lo tanto, el Panteísmo no exque acompaña a la reproducción sexual es comparable a plica la vida, pues en él no hay verdaderamente coincidencia de distintos, sino barajar las cartas disponibles. Pero la selección natural un todo amorfo y, por tanto, sin vida. Verdaderamente en el Panteísmo no existe no ejerce su fuerza sobre esta materia prima de manera una auténtica oposición entre privación y posesión, pues todo es todo. fortuita; la eliminación de las mutaciones dañinas no es cuestión de simple suerte, sino que se debe a la desventaja que dichas mutaciones le acarrean al mutante. I. VIDA COMO OPOSICIÓN Del mismo modo, la herencia de una mutación benefiEn concepciones ajenas del Panteísmo, en cambio, existe la oposición, pero ciosa no es casual, sino consecuencia clara de la ventaja atendamos a la clase de oposición que se piensa: La vida es oposición; la (mayor éxito reproductivo, mayor capacidad de sobreoposición, según la Lógica, puede ser oposición de contrariedad u oposición de vivencia) que dicho cambio genético pueda conferir a los contradicción. Si es de contrariedad, nos encontramos en el ámbito de la vida. Si descendientes. es de contradicción, nos lleva a la muerte. La oposición de contrariedad une los Otra palabrería mañosa se esconde en el implicar que contrarios con una partícula copulativa: esto y esto; la oposición de contradicsi algo no ocurre por suerte, entonces sólo puede deberse ción excluye a uno de los opuestos para afirmar al otro. Al excluir uno de los a diseño. Decir que la selección natural no es azarosa no opuestos, no se da más organicidad, y así no se puede hablar de la vida. es lo mismo que decir que es intencionada. Por ejemplo, Abundando más en lo anterior, podemos decir que hay oposición entre el camuflaje de los lenguados (peces planos que se condos contenidos cuando la posición de uno excluye en cierta manera la del otro. funden con la arena) no evolucionó para protegerlos de la Según sea la índole de esta exclusión, resultan diversas clases de oposición. La oposición de contradicción es irreductible; se da entre el ser y el no ser, no tolera término medio. La oposición de contrariedad u oposición contraria hace que dos contenidos se excluyan en un campo particular del ser, y por tanto acepta que haya un término medio en el campo universal del ser. La oposición contraria puede ser privativa o bien relativa, según se opongan los dos contenidos por privación–posesión, o bien por mera relación. 1. OPOSICIÓN DE CONTRADICCIÓN EN EL CONCEPTO DE LA VIDA Hay una mentalidad que en la modernidad se basa fuertemente en la oposición de contradicción. Y es la mentalidad evolucionística aplicada al hombre directa y plenamente. En efecto, en la mentalidad evolucionística, la supervivencia de las especies se da por la lucha a muerte, que es una oposición de contradicción, y así por la supervivencia del más fuerte. Se trata de una concepción mecanicista que concibe la vida como simple movimiento contradictorio, de colisión cuántica. Posiblemente muchos pasos de la evolución de los seres inferiores al hombre se puedan explicar en algunos sectores por esta lucha por la vida, la famosa “struggle for life”. Pero no puede ser aplicada en su totalidad, pues si bien es cierto que existe una graduación en la existencia actual de las especies en el mundo vivo infrahumano, persiste hoy la gradualidad de las mismas; no han desaparecido las inferiores. Y en su conjunto forman la esfera infrahumana orgánica. Sin embargo, el problema aparece fuertemente cuando esta explicación de la vida por la oposición contradictoria se aplica a la misma vida en su esfera humana. Entonces se llega a la opinión de la prevalencia y supervivencia del más

fuerte como norma, y de allí se generan todas las opiniones maltusianas y de súper razas, en las cuales alguien se afirma tratando de matar a los demás, de una manera salvaje en estadios primitivos, y de una manera sofisticada en la actualidad. Ésta es la cultura de la contradicción o, lo que es lo mismo, la cultura de la muerte o la anticultura propiamente tal. En esta posición no hay propiamente organicidad; la vida como organicidad desaparece; no hay término de oposición al cual oponerse, pues se ha destruido. Y el problema es que como el término de oposición es absolutamente indispensable para la vida, al no existir más éste, la vida se marchita y cabalmente se llega a la cultura de la muerte. No hay el término contra el cual afirmarse, y como éste pertenece también internamente a la propia organicidad, la misma vida individual perece. Nuevamente, incluso desde la misma Lógica, nos enfrentamos a la cultura de la muerte. depredación, aunque a veces sea más cómodo y breve decirlo así. En realidad, la protección ante los depredadores es consecuencia, no causa, de la aparición del camuflaje. ABRACADABRA: DE LA NADA APARECE UN OJO La selección natural, sobrevivencia del más apto, parece un fenómeno dramático; empero, no hace falta imaginar sangre derramada. La selección es consecuencia inevitable de que los organismos sean diferentes en su éxito reproductivo, así se trate de una diferencia muy pequeña. Las diferencias (ventajas) pequeñas, al acumularse de generación en generación, llevan a adaptaciones todavía más pasmosas que el camuflaje del lenguado. Tomemos, como un ejemplo clásico, el ojo de los 2. OPOSICIÓN DE CONTRARIEDAD vertebrados. Los creacionistas dicen que es un órgano EN EL CONCEPTO DE LA VIDA perfecto, y que no pudo evolucionar por modificaLa auténtica oposición, que es la que puede garantizar la ciones pequeñas y graduales. “¿Para qué sirve medio vida, es la oposición de contrariedad, que, como decíamos ojo?”, preguntan con sorna; la complejidad de un óranteriormente, se expresa mediante una partícula copugano tan maravilloso parece irreductible. lativa, “esto y esto”. En otras palabras, la vida es complePara empezar, el ojo no es perfecto, ni siquiera el mentariedad orgánica, alguien vive en cuanto se opone ojo humano. El punto ciego que se presenta donde a otro ser vivo porque no tiene lo que este otro ser vivo nace el nervio óptico es un defecto evidente, el cual posee, pero quiere participar de su riqueza. Y a la vez, el podría haberse evitado si el ingeniero imaginario huotro ser vivo vive en cuanto que, permaneciendo distinto, biera puesto los axones de las células de la retina hacia participa de la riqueza del primero. El ideal es que esta fuera del ojo y no hacia dentro (un “diseño” bastante participación sea sin mengua ajena; esto es, sin restar para torpe). nada lo que cada uno de los seres vivos posean de por Pero lo importante es que tener “medio ojo” sí es sí. Aquí nos encontraremos con la oposición por mera remejor que no tener ojos. Un área de piel fotosensible, lación. que ya de por sí es útil para distinguir el día y la noche, La conclusión filosófica es que la vida es el movimiento mejora si adquiere cierta curvatura que concentre la de oposición contraria y no contradictoria entre necesidad luz. Este ojo primitivo existe en las planarias, gusanos y satisfactor. platelmintos. Si esa concavidad crece, se puede lograr la óptica de una cámara lúcida; esta situación se preIV. REFLEXIÓN TEOLÓGICA senta en algunos anélidos. Si ahora nos preguntamos: ¿qué hay más allá de la Filosofía Si la concavidad que ya ha formado una esfera con para entender la vida?, la respuesta la encontramos en el un agujero se ve recubierta de piel transparente, se capítulo 11 del Evangelio de San Juan, en la narración de la adquiere otra pequeña ventaja, y cualquier incremento resurrección de Lázaro: Cristo le dice al muerto: “Lázaro:

CONOCIMIENTO CONOCIMIENTO
“Lázaro, ¡ven fuera!” Y el paso de la muerte a la vida se da visiblemente por el movimiento: Lázaro, inmóvil y cubierto de vendas, empieza a moverse, camina; camina fuera. Una vez más aparece el movimiento que observamos en la Biogenética y en la Filosofía para entender la vida: Lázaro sale de la muerte a la vida. Se trata, es verdad, de un movimiento, pero de un movimiento muy especial en el cual el “terminus a quo” es la muerte. ¿Qué hay de vital dentro de este movimiento?

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

27

79

que se realiza en la fuente de la vida de todo lo creado, que es la Santísima Trinimedible, en términos de cambios en las frecuencias dad. La Santísima Trinidad, según nos lo ha revelado el mismo Dios, se constigenéticas entre las generaciones (desde luego, esto es tuye por una oposición relativa y una coincidencia absoluta. Esto es lo que quiere factible sólo si las generaciones son muy breves). Un decir que Dios sea uno en tres personas distintas. En Dios, la oposición entre ejemplo cotidiano es la adaptación de las bacterias a los las divinas personas es la oposición de relación, sin que la privación signifique antibióticos, o de las plagas a los plaguicidas: la resistenmengua y sin que la posesión signifique cualquier resta a la otra persona. La cia aumenta porque los individuos que sobreviven son los oposición entre las divinas personas es una oposición de contrariedad relativa. que tienen los genes adecuados, y la frecuencia de estos Esto es, lo que una persona tiene se relaciona con lo que la otra persona posee, genes aumenta rápidamente en la población, dado que los de tal manera que la privación permanece en una posesión infinita. hijos sustituyen a los padres en cuestión de horas o días. Y esta aparente contradicción se aclara viendo las tres personas en concreto: Sin embargo, el camino evolutivo que llevó al ojo huEl Padre no tiene la filiación; sin embargo, es Padre por la filiación. El Hijo no mano o a la simbiosis del mero y los gobios trasciende tiene la paternidad; sin embargo, es Hijo por la Paternidad. El Espíritu no tiene la con mucho una vida humana, incluso la vida de toda la inspiración activa; sin embargo, es Espíritu por la Inspiración activa del Padre y humanidad, de modo que se trata de un fenómeno no obdel Hijo. La vida infinita de las tres divinas personas se realiza por una donación servable directamente. Lo que vemos hoy evolucionó en absoluta y total de dicha vida, del Padre al Hijo, del Hijo al Padre, del Padre y el pasado, y como todavía no se cumple el sueño de H. G. del Hijo al Espíritu y del Espíritu al Padre y al Hijo; por eso son un solo Dios. Wells, de la máquina del tiempo, no nos queda sino inferir La distinción de las tres divinas personas es sólo por oposición de contrariedad el pasado a partir del presente. relativa y por su oposición de contrariedad relativa son la vida en sí; esto es, un solo Dios, a la vez que tres personas distintas. EL ORIGEN DE LAS ESPECIES El creacionista revisa su arsenal y ahora lanza: “¡Nadie ha Se trata de un movimiento de oposición plena entre la visto una especie a medio formar en la naturaleza! ¡Las muerte y la vida, un movimiento que hemos definido “de quimeras, sirenas y centauros no existen!” contradicción”. Pero, ¿será la contradicción la fuente de la Claro que no puede haber cruzas de perros con gatos, vida, cuando filosóficamente la hemos definido más bien peces con mujeres o caballos con hombres, pero es falso como muerte? que no existan “especies a medio formar”. La línea entre lo en la concentración de proteínas en esa piel aumentará el que son poblaciones diferentes de una misma especie y lo índice de refracción del lente. Este ojo miope es mejor que que son especies plenamente distintas es tan tenue, que a una cámara lúcida, y cualquier incremento ulterior en la menudo la decisión taxonómica es arbitraria. Los llamados “hamlets”, peces arrecifales del género agudeza visual será una ventaja importante. En resumen: el ojo es un órgano complejo, pero ge- Hypoplectrus, llegaron a ser considerados miembros de nerable por selección natural que actúe sobre mutaciones una sola especie, H. unicolor, por su enorme semejanza genética. Sin embargo, hoy se acepta que cada hamlet pequeñas. es una especie válida, no sólo con su propia coloración, sino con su propio sistema de reconocimiento sexual, el JALISCO NUNCA PIERDE Cuando los órganos “perfectos” no le sirven, el creacio- cual mantiene su identidad como especie. El caso contrario: entre los peces dulceacuícolas hay nista voltea completamente su argumento y pregunta con sarcasmo: “Si la selección natural siempre mejora, ¿por especies consideradas válidas, habitantes de lagunas aisladas, que se han extinguido al entrar en contacto con otras qué no son perfectas las adaptaciones?” La falacia ahora radica en pensar que la evolución ne- especies, de distribución amplia. Esa extinción de la escesariamente optimiza las adaptaciones. Las planarias llevan pecie antes aislada se debe al fenómeno conocido como millones de años sobreviviendo con sus ojos “imperfec- introgresión genética. Es como si el acervo genético de la De hecho, la oposición ideal para que haya vida sería la tos”; para su tipo de vida resultan suficientes y no hay especie endémica se “disolviera” en el de la de distribuoposición de contrariedad donde la privación no existiese. ción amplia, cuando se dan las circunstancias que les perninguna “fuerza vital” que las obligue a “perfeccionarse”. ¿Es posible esta oposición ideal que generase una mera Otro error del argumento es olvidar que el ambiente miten cruzarse. relación de oposición sin privación alguna? La respuesta Se infiere que la especie endémica (aislada) se originó a cambia, de manera que, cuando los organismos logran podrá venir si se asume la oposición de contradicción y se adaptarse a un ambiente determinado, puede ser que el partir de la otra y pudo diferenciarse gracias al aislamienconvierte en oposición de mera contrariedad. La reflexión ambiente ya no sea exactamente el mismo: es la metáfora to geográfico, pero su diferenciación genética no llegó a siguiente desea esbozar algunas pistas para lograr esta de la Reina Roja, en cuyo país de fantasía Alicia tenía que ser tan grande que pudiera impedir la reproducción sexual asunción. correr mucho para poder mantenerse en el mismo lugar. entre ella y la que le dio origen. En otras palabras, quien Partiremos de la oposición ideal meramente relacional Puede ocurrir que lo que ayer (en términos evolutivos) era observe a estos peces verá, sin metáfora alguna, “una esen la Santísima Trinidad, que es la fuente primigenia de la pecie a medio formar”. un rasgo adaptativo, hoy no sea sino un vestigio inútil. vida, para luego converger en la asunción de la oposición de contradicción causada por la historia del hombre en la ¿SÓLO UNA TEORÍA? COMO SANTO TOMÁS: VER PARA CREER Encarnación pascual, que se convierte por la acción del EsNuestro creacionista, después de revisar si su Biblia dice ¿Es la evolución “sólo” una teoría? Lo es, pero eso no sigpíritu en mera oposición de contrariedad en plena mutua algo sobre Lewis Carroll, nos mira incrédulo y nos espeta: nifica que no sea real. La evolución es un hecho cientídonación. “¿Quién estuvo allí para ver la evolución del ojo? ¿Quién fico, tanto como la gravedad de Newton o la relatividad presenció un establecimiento gradual de la simbiosis en- de Einstein, las cuales también son teorías; es decir, expli1. LA VIDA EN LA SANTÍSIMA TRINIDAD tre el mero y sus gobios limpiadores?” En realidad, la evo- caciones de fenómenos observados. A la luz de evidenExactamente el ideal de oposición por mera relación es el lución a corto plazo no sólo es observable, sino hasta cias tan independientes entre sí, como las anatómicas,

76

28

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

Ejemplo 2. Los bloques haplotípicos se definen has- blico y privado para el equipamiento de tecnología de Desde este modelo divino podemos intuir que la vida es moverse a sí mismo 3. LA CONTRADICCIÓN ta el momento como un conjunto de marcadores conti- punta en todos los laboratorios de Centros de Salud. en un conjunto de relaciones hacia la plena donación. Se dona lo que se tiene ASUMIDA EN LA CONTRARIEDAD nuos (SNP1-SNP2-... -SNPn) para los cuales todos los pares y se recibe lo que no se tiene en un proceso incesante que enriquece y que pre- Siguiendo el hilo conductor de nuestra reflexión, Cristo muestran desequilibrio de ligamiento (D) > 0.8. cisamente es el proceso vital. Los puntos fundamentales son las relaciones, que asume la contradicción y la vuelve contrariedad de relaSupongamos que tenemos 10 SNPs y mediante el fundan la oposición contraria, no para encerrarse en la propia posesión o en ción de máximo amor, y así de máxima vida, contrariedad análisis de desequilibrio de ligamiento encontramos que la propia privación, sino para abrirse en total donación. Así, la vida es relación Akey la que se opone relativamente al hombre como a un suen JM, Zhang G, Zhang K, Jin L, Shriver MD. Interrogating existe un bloque (B) en una agrupación (clúster) de 150 kb fecunda de donación amorosa. Ésta es la vida en sí, y cuando Dios la participa a a high-density SNP map lo que le hace falta enselection. la vida. jeto al que le dona for signatures of nature totalidad, en el cromosoma 4: B (1-4) con 69 kb y con D > 0.8. Este Genome Res, 12:1805-1814, 2002. su creación; en especial cuando la participa al hombre, la da de este talante. Dios La vida trinitaria de oposición contraria de pura donación análisis está en función de los intervalos de distancia de inscribe esta donación dentro de la libertad humana. Y precisamente cuando el Blazej RG, Paegel través de la RA. Polymorphism la muerte para pasa ahora a BM, Mathies contradicción de la distribución de los SNPs en el genoma específico de un hombre no quiere más proceder a esta donación, entonces se cierra en sí mismo, ratio sequencing: amisma muerte ysingle nucleotide donación en vencer a esta new approach for volverla pura polymorphism discovery and genotyping. Genome Res, 13:287cromosoma. se opone a los demás en contradicción. Esto es el pecado, y, lo que es lo mismo, 293, 2003. el Espíritu. La convierte en donación de puro amor. Se sula muerte. pera la contradicción de la muerte en la oposición relativa BLOQUE 1 Botstein D, Risch N. Discovering genotypes underlying human de contrariedad, que for mendelian disease, Habíamos dicho phenotypes: past successes es relación de amor.future approaches for complex disease. Nat Genet, 33:228-237, 2003. cómo la oposición de contradicción genera la cultura de 2. LASNP2 SNP3 SNP4 SNP5 SNP6 HISTORIA DE LA SALVACIÓN SNP1 SNP7 SNP8 SNP9 SNP10 la muerte; en MA, Rieder MJ, Smith JD, Kruglyak la Dentro de estas coordenadas, se escribe la Historia de la Salvación como una Carlson CS, Eberle Cristo, esta oposición lo llevó a L, máxima muerte, por decirlo así, y and linkage-disequilibrium historia de la libertad. Y como el hombre eligió la oposición de contradicción, el Nickerson DA. Additional SNPs la Redención consistió en volver analyses are necessary for whole-genome association studies in esta Nature muerte en máxima vida; volver la contradicI n pecado ya lmuerte, e a pesar de a n c i a no le retiró el que desde dentro siga humans.máximaGenet, 33:518-521, 2003. t e r v la o d y d i s t ello Dios siendo su imagen, la historia de la humanidad viene a ser una historia que se ción a través del Espíritu en pura relación de amor, como Cavalli-Sforza LL, Feldman MW. The application of molecular SNP1 donación total. the es el human último Nature realiza dentro de dos términos: contradicción-contrariedad; muerte-vida; odio- genetic approaches toÉste study ofsentido evolution.de la resurrecGenet, 33:266-275, 2003. ción. amor; egoísmo-donación. 1.00 SNP2 Si, como Villalobos-Torres es Barrera-Saldaña HA, 5.59 Cerda-Flores RM,decíamos, la vidaMC, la capacidad de ser y de Cortes-Prieto LM, podemos concluir que la vida es la capacidad actuar, ahora Barajas LO, Rivas F, Carracedo A, Zhong Y, 3. LA ENCARNACIÓN PASCUAL 1.00 1.00 SNP3 Barton SA, Chakraborty R. Genetic admixture in three Mexican de ser y de actuar a través de una oposición contradictoEn este ámbito, la 22.21 Encarnación pascual viene a realizar el rompimiento de la Mestizo populations based on D1S80 and HLA-DQA1 loci. Am J 5.59 ria; esto es, la muerte; contradicción en una construcción amorosa de contrariedad de relación. Esto es, Hum Biol 14:257-263, 2002a. la oposición contraria como rela1.00 1.00 1.00 SNP4 ción de donación amorosa L, Barton en la que la muerte viene a ser vencida por la resurrección. Cristo asume la contradicción Cerda-Flores RM, Budowle B, Jin absoluta SA, Deka R, se recibe la 21.48 7.19 21.48 vida participada de la Santísima Trinidad. La vida in del hombre que significa su pecado y su muerte, y esta contradicción la lleva Chakraborty R. Maximum likelihood estimates of admixture es así la 0.54 0.19 0.54 0.45 SNP5 Northeastern México using 13 short tandem repeat loci. Am J Resurrección. hasta sufrirla en sí mismo con el sufrimiento de la muerte. Pero esta muerte, por Hum Biol 14:429-439, 2002b. 1.21 0.20 1.21 0.97 el amor del Espíritu Santo se torna en fuente de vida, en resurrección. La muerte JD, Schaffner SF, Hudson TJ, Lander ES. se coloca como la mayor prueba de amor, la mayor prueba de donación. Y así, Daly MJ, Rioux haplotype structure in the human genome. Nat High-resolution Cristo, de la nada culpable; esto es, de la contradicción absoluta del hombre, Genet, 29:229-232, 2001. Cada haplotipo equivale a la “firma” de SNPs con que recrea al nuevo hombre en la relación de justicia y santidad. Ésta es la profunse puede reconocer a cada bloque genómico. Esta obserEscoffier L, Slatkin M. Maximum likelihood estimation of didad ilógica de la historia que sólo la Omnipotencia de Dios-Amor pudo hacer molecular haplotype frequencies in a diploid population. Mol vación resulta de gran interés científico y práctico, ya que lógica, como la expresión humana máxima de la Verdad: esto es Cristo, el Verbo Biol Evol, 12:921-927, 1995. el conocimiento de dichos bloques reduciría la necesidad de Dios encarnado. Gibson G, Mackay TF. Enabling population and quantitive de analizar a cada una de las variaciones en el genoma genomics. Genet Res Camb, 80:1-6, 2002. humano, a menos del 10 por ciento de ellas, ofreciendo Goldstein DB, Weale ME. Population genomics: Linkage la posibilidad de llevar a cabo proyectos de investigación disequilibrium holds the key. Curr Biol, 11:R576-R579, 2001. genómica en forma más precisa, rápida y a menor costo. Greely HT. Informed consent and other ethical issues in human Sin embargo, este nuevo conocimiento enfrenta el gran population genetics. Annu Rev Genet, 35:785-800, 2001. reto de identificar las características de dichos bloques Jorde LB, Watkins WS, Bamshad MJ. Population genomics: a que, al parecer, tienden a variar entre cada población.

REFERENCIAS

bridge from evolutionary history to genetic medicine. Hum Mol Genet, 10:2199-2207, 2001. Kwok P-Y. Methods for genotyping single nucleotide polymorphisms. Annu Rev Genomics Hum Genet, 2:235-258, 2001. Marth GT. A general approach to single-nucleotide polymorphism discovery. Nature Genet, 23:452-456, 1999.

SEGUNDA FASE DEL PROYECTO DEL GENOMA HUMANO La gran importancia que reviste el conocimiento de los bloques de recombinación en diferentes poblaciones mundiales ha servido como base para el desarrollo de la fase II del proyecto del Genoma Humano (Haplotype Map of Human Genome:, por lo que México no puede quedar atrás de los avances de la nueva ciencia y tecnología. Para finalizar, es claro que la investigación en el área de las ciencias genómicas pone de manifiesto la necesidad de: 1. Formar en México equipos de trabajo con científicos expertos en la genómica comparada, genómica funcional, bioinformática, biología computacional, salud pública, genética de poblaciones, farmacogenómica y terapia génica. 2. Proporcionar el apoyo económico de los sectores pú-

Niu T, Qin ZS, Xu X, Liu J. Bayesian haplotype inference for la Biogenética que describen el inicio de la Hum multiple linked single-nucleotide polymorphisms. Am Jvida humana, Genet, 70:157-169, 2002. hacíamos una primera conclusión: encontrábamos que

CONCLUSIÓN En la reflexión que hacíamos sobre algunos elementos de

la vida C. Hitchhiking mapping-functional genomics from Schlottereraparecía como “un movimiento orgánico complethe population genetics perspective. Trends in Genetics, 19:32mentario de relaciones y finalidad”. Cuando avanzábamos 38, 2003. desde el aspecto filosófico, confirmábamos lo anterior, y
Weiss KM, Buchanan vidaEvolution by phenotype: a decíamos que la AV. es “moverse a sí mismo”, y que esto biomedical perspective. Perspect Biol Med 46:159-182, 2003.

implica una oposición vital, que para ser tal debe ser no de contradicción sino de contrariedad; esto es, de integración. Teológicamente avanzábamos a la luz de la resurrección de Lázaro y veíamos que la vida no puede ser más que una oposición de contrariedad; esto es, de integración,

CONOCIMIENTO CONOCIMIENTO
pero que pasa a través de la contradicción de la muerte, en la historia de la salvación. Para concluir, pudiéramos decir que la vida es amor. Sólo el amor rompe la contradicción de la muerte y su absurdo de destrucción total lo vuelve fuente inagotable de vida. Lo ilógico se torna en plena y única racionalidad. Es la lógica histórica del Amor que irrumpió en el mundo en el Misterio de la Encarnación pascual. Así entendemos el aforismo de Tertuliano: Credo quia ineptum (creo porque es inepto); a quien replicaríamos: Sed historicum( pero histórico, así aconteció). Así, la vida, que es donación de amor, fluye victoriosa iluminando la oscuridad de la muerte, apoyada en la plena confianza en Aquél que la hizo triunfar en la resurrección de Jesucristo. El máximo movimiento vital es el movimiento de la Encarnación que se va desarrollando hasta llegar a través de la pasión y muerte de Cristo a la plenitud de vida en la resurrección, en la Ascensión y la vida gloriosa del Señor Jesús. La conclusión plena es que la vida es la máxima donación de Dios al hombre, que a partir de la nada de la muerte, realiza la nueva creación de la plenitud de la vida en el triunfo glorioso del Cristo total.

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

29

77

Los arrecifes coralinos: evolución biológica, no creación divina
Juan Jacobo Schmitter-Soto

U REFERENCIAS

n gigantesco mero se desplaza con elegancia Ciudad del Vaticano, febrero de 2009. por el arrecife. De pronto, se detiene junto a un cabezo de coral, y un grupo de peces góbidos salen como dardos, se meten en su cavidad branquial y en su boca misma, y se comen Aristóteles, Metafísica, vol 10, X, En unos momentos, el pez los parásitos del mero. 3;b. De Anima II,1-2 Sto. Tomás de Aquino, Summa Contra Gentiles, 4,11; grande reanuda su paseo, más sano que antes, y los Summa Theologica I q.18 aa.1-2 . gobios regresan a esconderse entre los resquicios R. Guardini, Der Gegensatz, 1925 C. Nink, Sein, Einheit, satisfechos que antes. 17 (1942) del coral, más Gegensatz, en Scholastik 504-522 ¿Cómo pudo (índice) M. Honecker. Logik 1927evolucionar semejante asociación? J. Fröbes, Tractatus Logicaedado el primer1940, 70 ymero se Si el gobio hubiese Formalis, Roma paso, el ss. 156 y ss. lo habría comido; formelle 3 vols, Lovaina 1950. J. Dopp, Lecons de Logique si el mero hubiera tenido la iniM. Grabmann, los gobios habrían preferido ocultarse. ciativa, Die Idee des Lebens in der Theologie der hl.
Thomas, 1922. H. Driesch-R Woltereck, Das Lebens Problem in der Lichte der modernen Forschung. 1931 LA GALLINA O EL HUEVO C. Burdo y otros, La vie et l,’evolution, en “Archives de Este tipo de planteamientos de “¿qué fue primero: Philosophie”6, (1928) Fase. Links,el huevo o la gallina?” están entre los sofismas faBiogenética, México 2000.

voritos de los creacionistas (gente como los testi-

Biólogo Juan Jacobo Schmitter-Soto DoctorInvestigador del Área de Conservación de la Biodiversidad Colegio de la Frontera Sur Unidad Chetumal juan.schmittersoto@ fulbrightmail.org

74

30

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO
Un gran número de proteínas diversas son utilizadas como marcadores genéticos, cuya utilidad depende de la variabilidad heredable del DNA que las codifica. Actualmente, la tipificación del DNA se utiliza como una herramienta poderosa para la identificación de individuos con mayor poder predictivo que el de las pruebas serológicas. Gran cantidad de genes se caracterizan por tener un número relativamente común de alelos, que permiten clasificar a los miembros de una población originada naturalmente dentro de fenotipos finamente distinguibles. Un polimorfismo genético se define cuando un gen tiene múltiples alelos y al menos dos de ellos tienen frecuencias mayores al uno por ciento entre la población y cuando la frecuencia de heterocigotos en la población es de al menos dos por ciento. No obstante, debido a que muchos locipolimórficos se caracterizan por tener un alto número de alelos diferentes, la proporción de heterocigotos es mucho mayor. A los alelos con frecuencias menores de uno por ciento se les llama variantes raras. (http://uwadmnweb.uwyo.edu/zoology/mcdonald/molmark/index.html#Fdemo).

La identificación de individuos se ha realizado tipificando diferentes marcadores genéticos no moleculares (antígenos de los grupos sanguíneos, los del complejo mayor de histocompatibilidad, isoenzimas y proteínas séricas) y moleculares (VNTRs, RFLPs, RAPDs, SNPs, CNVs) los cuales tienen un alto grado de discriminación e identificación.

Frecuencias alélicas (%) para el marcador D1S80 en mestizos.
Alelo N 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 34 35 36 37 38 41 Heterocigocidad Nuevo León 103 0.97 3.88 0.48 23.30 3.40 0.98 2.43 1.46 1.94 20.39 7.77 2.43 0.00 7.28 5.34 7.28 7.77 0.97 0.97 0.00 0.48 0.00 0.00 0.48 0.878 Jalisco 63 0.00 1.16 0.39 30.21 0.39 1.55 2.33 1.55 0.39 29.07 6.98 1.16 0.78 5.04 2.33 5.81 9.30 0.39 0.00 0.39 0.39 0.39 0.00 0.00 0.806 México 230 0.00 2.20 0.40 32.20 0.40 0.90 1.30 1.50 0.20 20.90 9.60 1.70 1.50 5.90 5.00 8.00 6.30 0.70 0.70 0.20 0.20 0.00 0.20 0.00 0.827

Frecuencias alélicas (%) para el marcador HLA-DQA1 en mestizos.
Allele N 1.1 1.2 1.3 2 3 Carlos Mendoza-Álvarez Nuevo León Jalisco

Creación y evolución: azar y necesidad
México

103 63 230 PARA IR MÁS ALLÁ DE LOS PREJUICIOS 8.74 15.87 8.50 ciento de la 10.19 cincuenta años 3.97 publicación de la obra de 8.50 4.85 3.18 2.00 Charles Darwin: El origen de las especies por medio de 13.59 10.32 5.40 la selección natural, se realizan en todo el mundo con24.27 26.98 31.70 memoraciones científicas, intelectuales y culturales, con 4 38.35 marcadas por 39.68 43.9 frecuencia la ideología de grupo, sea para afirmar la superación de 0.737 la “edad oscura” de la humaniHeterocigocidad 0.759 0.691 dad, liberada al fin por la ciencia empírica de sus ataduras religiosas; sea, por el contrario, para defender “los dereProbabilidad de un simple locus: de Dios” ante los ataques de una racionalidad atea y chos D1S80 heterocigoto 16/18 = manipuladora. = 0.0180808 2(0.0388)(0.2330) HLA-DQA1 heterocigoto 1.1/1.2 = 2(0.0874)(0.1019) = 0.01781212 Darwin mismo escribió el objetivo de su investigación Probabilidad para un perfil de DNA siguientes términos: en los multilocus: (0.0180808) (0.01781212) = 0.000322 Al considerar el origen de las especies se concibe perfectamente individuos en Nuevo reflexionando sobre En otras Doctor Carlosde cada diez mil que un naturalista, León tendrán el mismo las palabras, tres perfil Mendoza-Álvarez para estos dos marcadores genéticos, que están en equilibrio de Hardy-Weinberg afinidades mutuas de los seres orgánicos, sobre sus relay en equilibrio de fase gamética. Las frecuencias génicas fueron obtenidas de CerdaUniversidad ciones embriológicas, su distribución geográfica, sucesión Flores yIberoamericana Cols., 2002a para D1S80 y HLA-DQA1. Si utilizáramos 13 STRs, el poder de geológica y otros hechos semejantes, puede llegar discriminación sería de 1 en 2,830,000,000,000,000 de individuos, y la probabilidad dea la Ciudad de México exclusión, en caso de paternidad, de 1 en 8,900,000 (Cerda-Flores han sido independientecarlos.mendoza conclusión de que las especies no y Cols., 2002b). @uia.mx mente creadas, sino que han descendido, como las varie-

A

dades, de otras especies. […] Estoy completamente convencido de que las especies no son inmutables y de que las que pertenecen a lo que se llama el mismo género son descendientes directas de alguna otra especie, generalmente extinguida, de la misma manera que las variedades reconocidas de una especie son las descendientes de ésta. Además, estoy convencido de que la selección natural ha sido el medio más importante, pero no el único, de modificación.1 El famoso científico y viajero no desconocía la posibilidad de que su teoría de la evolución de las especies fuese compatible con la afirmación teológica de un Dios creador, como lo atestigua al final de su obra No veo ninguna razón válida para que las opiniones expuestas en este libro ofendan los sentimientos religiosos de nadie. Es suficiente, como demostración de lo pasajeras que son estas impresiones, recordar que el mayor descubrimiento que jamás ha hecho el hombre, o sea la ley de la atracción de la gravedad, fue también atacado por Leibnitz ‘como subversiva de la religión natural y, por consiguiente, de la revelada’. Un famoso autor y teólogo me ha escrito que ‘gradualmente ha ido viendo que es una concepción igualmente noble de la Divinidad creer que Ella ha creado

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

31

75

un corto número de formas primitivas capaces de transpoblaciones mestizas (contribución de poblaciones cauMARCADORES GENÉTICOS formarse por sí mismas en otras formas necesarias, como cásicas, indígenas y africanas) sino también las indígenas. Los polimorfismos se utilizan como marcadores genéticos creer que ha necesitado un acto nuevo de creación para Los estudios de genómica de poblaciones requieren, que permiten distinguir el patrón de herencia de un gen en 2 llenar los huecos producidos por la acción de sus leyes’. para el desarrollo de la medicina genómica, de dos asestudios familiares. Tienen aplicación práctica en: Sin embargo, la discusión que aquella publicación pectos: primeramente, del conocimiento de la estructura a) Localización y mapeo de genes en cromosomas indimemorable hizo posible a mediados del siglo XIX, está haplotípica de la población humana a estudiar, y, posteviduales mediante estudios de análisis de ligamiento. aún lejos de haber concluido en nuestros días. Como lo riormente, de estudios de asociación que identifiquen los b) El diagnóstico presintomático y prenatal, así como en recordaba hace poco un rector de una universidad eurofactores de riesgo genético para determinada enfermedad, la detección de portadores (heterocigotos) de enfermepea, al conmemorar el debate abierto por Darwin -y hay con fines de diagnóstico y tratamiento. dades genéticas. que precisar que se trataba de un teólogo que hablaba a c) La evaluación del riesgo en personas con prediscientíficos y humanistas- muchas preguntas siguen penTAREA COMPLEJA Y COSTOSA posición a desórdenes, como enfermedades coronarias, dientes: La secuencia del genoma humano, si bien permite conocer cáncer y diabetes, entre otras. Todo comenzó probablemente, Mister Darwin, con la secuencia de los genes humanos y su ubicación dentro d)Estudios de paternidad, forenses y casos de inmisu vecino en la Abadía de Westminster, Sir Isaac Newton. del genoma humano, también ha hecho evidente la gran gración. Usted mismo había llamado a su ley de la gravitación, ‘el variabilidad que existe en la secuencia entre individuos. e) Establecer la compatibilidad donador-receptor para más grande descubrimiento que jamás hombre alguno ha Esfuerzos adicionales hicieron posible conocer que exrealizar transplantes de tejidos y órganos. hecho’. Newton presentaba una interpretación mecaniisten entre seis y diez millones de posiciones en el gef) La identificación de gemelos idénticos. cista de la naturaleza: su modelo era determinista y él lo noma humano en que puede haber variaciones de un solo g)Recientemente, el uso de bloques haplotípicos que entendía como una explicación completa del mundo. Un nucleótido (SNPs). Algunas de estas variaciones confieren serán de gran utilidad en la medicina genómica [New eco semejante se encuentra en la autobiografía que usted susceptibilidad o resistencia a enfermedades comunes; England Journal of Medicine (http://content.nejm.org/ escribió, en la cual varias veces encontré esta frase: ‘Everyotras sirven como marcadores dentro de la secuencia del misc/genmed.shtml). Aquí se puede buscar más inforthing in nature is the result of fixed laws’. No solamente genoma humano. La identificación de estas variaciones en mación sobre medicina genómica, en forma gratuita, por los teólogos se sintieron incomodados, dado que veían en cada individuo resulta de gran importancia para el desalos editores Alan E. Guttmacher y Francis S. Collins]. esa expresión la expulsión del Dios vivo de aquella natu- tear en México el debate entre científicos y humanistas, rrollo de la fase aplicativa de la medicina genómica; sin raleza determinada, sino también la libertad del espíritu de manera que contribuyamos todos a una más acabada embargo, la tecnología disponible hasta el momento hace Es sabido que la respuesta del ser humano ante cualhumano quedaba maltrecha. La teología no veía entonces percepción de la compleja realidad del cosmos y de su de esta una tarea extraordinariamente compleja y altaquier estímulo, sea positivo o pernicioso, viene condiciootra solución sino la de salir de escena y retirarse; por una sentido trascendente, donde el ser humano tiene un papel mente costosa. nada por dos elementos fundamentales. De una parte, inparte, hacia el comienzo absoluto; por otra, hacia el más irreemplazable para el cuidado del planeta y su preservaRecientemente, se ha identificado que la recombinación fluye la información contenida en los genes. De la otra, los allá del cielo. Pero se pagó muy alto el precio: la soberanía ción como un sistema de mecanismos, pero también de del material genético (durante la producción de gametos) llamados factores ambientales. La suma de ambos, junto sobre la interpretación del mundo y de la historia fue ce- sentidos y significados que nos orientan a una realización no ocurre al azar, sino que ocurre en sitios específicos, lo con los procesos de carácter infeccioso, desencadenará la dida con demasiada ligereza a las demás ciencias. ¿Cuál integral. que da lugar a bloques conservados de material genético presencia o no de la enfermedad. Los factores ambientales podría ser entonces el significado de una fe que no tiene que se heredan de generación en generación. Esto significa responden a un sinfín de formulas. Los estilos de vida, la nada que ver con el mundo y con la historia? La teología, 1. ¿UN CONFLICTO DE INTERPRETACIONES? que en lugar de tener que conocer todos los SNPs de un exposición a sustancias tóxicas para el cielo; las demás ciencias, para la tierra. A la larga, Buena parte del conflicto entre ciencia moderna y fe resegmento de DNA; por ejemplo, alguno con 100 SNPs, el (), la nutrición (nutrigenomics) o la higiene, son algu3 esto no podría conducirnos por buen camino. ligiosa nació en el siglo XVI, cuando Galileo sostuvo el conocimiento de seis u ocho SNPs en ese bloque serviría nos de ellos. Identificar en un individuo los genes que preEn un segundo grado de reflexión, podemos encontrar heliocentrismo, junto con la tesis de la inmutabilidad de para conocer el resto de los SNPs que se heredan en cada disponen a enfermedades coronarias, diabetes o a algunas debates más fundamentados, donde se plantean los ele- los principios filosóficos y la falsedad de los enunciados bloque o haplotipo. formas de cáncer, puede ayudar a prevenirlas o a limitar mentos críticos de la teoría de la evolución de las especies, teológicos. Su hipótesis astronómica fue celebrada sisu impacto, modificando este tipo de factores. sus aportes para la comprensión de las leyes de la sele- glos después como triunfo de la razón sobre el prejuicio, cción natural, así como sus límites y callejones sin salida, aunque sus otras tesis no fueron criticadas por los heredeGRADO DE PROTECCIÓN DE LAS VACUNAS como por ejemplo la cuestión del salto cualitativo entre ros de esta civilización empiricista naciente. Esa misma información va a ser útil para determinar el En efecto, una parte de los diálogos de Galileo con una especie y otra, que aun la ciencia contemporánea no grado de protección de vacunas o qué poblaciones son ha logrado descifrar del todo. En este mismo tenor, desde el cardenal Barberini, por ejemplo, tenía que ver con la más o menos susceptibles ante determinadas infecciones. el punto de vista tanto filosófico como teológico, algunas distinción entre las observaciones astronómicas y la rePor ejemplo, la vacuna que se emplea para la tuberculosis hipótesis se han planteado en las últimas décadas para futación de la verdad de la Biblia que, a juicio de Galieo, se es sumamente efectiva en los países europeos. No ocurre comprender, junto con la pertinencia de la necesidad pro- implicaban mutuamente. lo mismo, sin embargo, para amplias capas de la población Sin embargo, contra la opinión generalizada aun en pia de ciertos principios de la evolución, el margen de africana. Curiosamente, esa misma vacuna es eficaz para azar, libertad y alteridad que supone la naturaleza como nuestros días, la tesis evolucionista de Darwin no fue reprevenir la lepra en Malawi. una realidad referida a un principio “ordenador” y, más futada en sí misma por el magisterio de la Iglesia como La genética que se ha desarrollado hasta ahora se difeaún, “amoroso”, que da consistencia y finalidad al cosmos. se piensa, sino que fue vista como parte de una nueva rencia de la genómica, en que la primera estudia un gen En este artículo proponemos al lector algunos elemen- racionalidad que era necesario discernir para buscar la que causa una enfermedad (como la hemofilia), mientras tos para que realice su propio juicio, de manera que verdad. Así lo muestran las declaraciones del Papa Pío XII que la segunda trabaja con varios genes que operan en pueda entenderse, en primer lugar, el papel imprescin- en la Encíclica “Humani Generis”, de 1950, quien a pesar forma simultánea en enfermedades complejas, que son las dible de la teoría de la evolución para la explicación de del tono antimodernista, no deja de entreabrir una puerta más comunes, como hipertensión, diabetes, asma, osteociertos fenómenos, así como el lugar irrenunciable de al análisis crítico de la cuestión, tanto en su dimensión porosis, etcétera. la filosofía y la teología como disciplinas que buscan científica, como filosófica y teológica: El conocimiento de la genética/genómica de poblaDando una mirada al mundo moderno, que se halla comprender lo real en su horizonte de trascendencia, alciones permitirá ampliar específicamente el abanico de teridad y donación. Este argumento pensamos que puede fuera del redil de Cristo, fácilmente se descubren las prinla prevención y el diseño de vacunas mucho más espeexplicar ade- cuadamente la urgente necesidad de plan- cipales direcciones que siguen los doctos. Algunos ad cíficas, de acuerdo con los rasgos genéticos no sólo de las

72

32

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

Aplicaciones de la genética de poblaciones en las ciencias genómicas
Doctor Ricardo M. Cerda-Flores Genetista de Poblaciones Investigador Titular del CIBIN-IMSS Maestro de la Facultad de Enfermería / UANL. ricardocerda_ mx@yahoo.com.mx Ricardo M. Cerda-Flores La síntesis evolutiva moderna (también llamada simplemente nueva síntesis, síntesis moderna, síntesis evolutiva, teoría sintética, síntesis neodarwinista o neodarwinismo), en general significa la integración de: 1. La teoría de la evolución de las especies por selección natural de Charles Darwin. 2. La teoría genética de Gregor Mendel como base de la herencia biológica. 3. La mutación genética aleatoria como fuente de variación. 4. La genética de poblaciones matemática.

Las figuras importantes en el desarrollo de la síntesis moderna incluyen a Thomas Hunt Morgan, Ronald A. Fisher, Theodosius Dobzhansky, J.B.S. Haldane, Sewall Wright, William Donald Hamilton, Cyril Darlington, Julian Huxley, Ernst Mayr, George Gaylord Simpson, y G. Ledyard Stebbins. Esencialmente, la síntesis moderna introdujo la conexión entre dos descubrimientos importantes: la unidad de la evolución (los genes) con el mecanismo de la evolución (la selección). También representa la unificación de varias ramas de la biología que anteriormente tenían poco en común, especialmente la genética, la citología, la sistemática, la botánica y la paleontología.

miten de hecho, sin discreción y sin prudencia, el sistema evolucionista, aunque ni en el mismo campo de las ciencias naturales ha sido probado como indiscutible, y pretenden que hay que extenderlo al origen de todas las cosas, y con temeridad sostienen la hipótesis monista y panteísta de un mundo sujeto a perpetua evolución.4 Y más adelante, en el número 29, el mismo Pío XII llega a recomendar incluso la necesidad del debate con esas ideas “evolucionistas”: Por todas estas razones, el Magisterio de la Iglesia no GENÉTICA DE POBLACIONES prohíbe el que —según el estado actual de las ciencias y La genética de poblaciones es la rama de la genética cuya la teología— en las investigaciones y disputas, entre los problemática es describir la variación y distribución biohombres más competentes de entrambos campos, sea oblógica, con el objeto de dar explicación a fenómenos evolujeto de estudio la doctrina del evolucionismo, en cuanto tivos. Para ello, define a una población como un grupo de busca el origen del cuerpo humano en una materia viva individuos de la misma especie que están aislados repropreexistente —pero la fe católica manda defender que las ductivamente de otros grupos afines. Estas poblaciones almas son creadas inmediatamente por Dios—. Mas todo están sujetas a cambios evolutivos, en los que subyacen ello ha de hacerse de manera que las razones de una y cambios genéticos, los que a su vez están influenciados otra opinión —es decir la defensora y la contraria al evolupor factores como la selección natural y la deriva genética, cionismo— sean examinadas y juzgadas seria, moderada y que actúan principalmente disminuyendo la variabilidad templadamente; y con tal que todos se muestren dispuesde las poblaciones, o migración y mutación, que actúan tos a someterse al juicio de la Iglesia, a quien Cristo conaumentándola. firió el encargo de interpretar auténticamente las Sagradas Escrituras y defender los dogmas de la fe. Lo que parecía estar en juego en esta áspera disputa de mediados del siglo pasado era la confrontación entre una visión crítica de la realidad empírica en pos de las leyes que rigen la relación de las especies biológicas por una parte, y una interpretación filosófica y teológica que defendía el azar y la libertad de la creación y del Creador por otra. ¿Se trataba realmente de una visión opuesta de la realidad contra otra? ¿O acaso en esos mismos debates existía una posibilidad de conceder a cada una su significado propio en la ardua tarea de dar razón de lo real en su complejidad? Un siglo atrás, tanto Darwin como el téologo Hodge apelaban a la verdad de su propia interpretación, y a lo más que llegaron en ese momento fue a conceder que cada uno era un ámbito autónomo del conocimiento. Esa tajante distinción entre el conocimiento crítico y la creencia religiosa como dos mundos separados ha sido el traumatismo de la razón occidental, que sumió a las sociedades modernas en una disociación estéril entre racionalidad y creencia. Tal ruptura, a principios del siglo XXI, parece ser reeditada en una nueva versión que opone ambos Cabe destacar que la pérdida de variabilidad genética enfoques en una beligerancia que fomenta la discordia. en las poblaciones trae consigo dos graves problemas: 1. Coarta la posibilidad de que el hombre realice mejo2. DETERMINISMO VERSUS FUNDAMENTALISMO ramiento genético en especies de interés comercial y/o El reduccionismo de la ciencia experimental moderna rarecreativo, y dica en la pretensión de interpretar lo real según sus coor2. Disminuye la eficacia biológica (fitness) de las espedenadas espacio-temporales y, en consecuencia, a la matecies ante nuevos cambios ambientales. matización de la realidad como único criterio de verdad. Sus albores especulativos se remontan al Renacimiento Por otra parte, la presencia de variabilidad genética italiano, pero adquirirá carta de ciudadanía con el triunfo es deseable no sólo para el mejoramiento genético o la de la medición empírica sobre las deducciones metafísicas conservación de las especies, ya que el rol fundamental que entraban en contradicción con los datos de la expede la variabilidad genética es ser la materia prima para riencia; por ejemplo, en el caso de la diversidad y correlos procesos evolutivos: sin variabilidad no hay evolución. lación de las especies biológicas que hoy nos ocupa. Cierta La interacción de estos factores con las poblaciones en el idea mecanicista como principio de explicación del uni-

CONOCIMIENTO CONOCIMIENTO
verso se iba imponiendo en la experimentación científica; tiempo, permite la existencia de gran número de espepero cuando se transfirió al plano ontológico y de la caucies con variadas estructuras poblacionales y formas de salidad filosófica, generó una ruptura epistemológica que vida. Así, la genética de poblaciones es un elemento esperdura hasta nuestros días. encial de la síntesis evolutiva moderna. En un sentido más positivo, el descubrimiento de la ley de La especie humana, de más de seis mil millones de inla evolución puso en entredicho prejuicios “creacionistas” dividuos en la actualidad, se divide en caucásicos, negros que afirmaban un intervencionismo divino para garantizar y asiáticos. Estos tres grandes grupos, con características la libertad de la causalidad. Pero no resolvió el problema genéticas claramente distinguibles, se denominan razas, y del azar y la libertad como parte de la creación. Por ese cada una de ellas está formada por numerosos subgrupos motivo, podemos decir que la insuficiencia del planpoblacionales, con ligeras diferencias genéticas entre sí, teamiento evolucionista radica en extrapolar su hipótedenominados grupos étnicos. sis al orden ontológico de los seres; es decir, que, en cuanto saber, la correlación filosófica queda entrecortaSELECCIÓN DE MUTACIONES da, más aún la correlación con el estatuto trascendente La diversidad genética entre razas y subpoblaciones de lo real. tiene su origen en las mutaciones. El establecimiento de Por otra parte, el cristianismo moderno rechazó en su las diferencias genéticas entre las poblaciones se produce momento la teoría de la evolución, porque veía en ella una como resultado de la selección de mutaciones, en respuescomprensión atea del cosmos, en la lógica de la seculata a condiciones ambientales regionales, a la perpetuación rización del pensamiento occidental ilustrado, contraria de mutaciones neutrales específicas y aun de mutaciones a la afirmación de fe que reconoce que el mundo es fruto nocivas, además del grado de reproducción aislada entre de un deseo amoroso del Dios vivo y que tiene su fuente y los grupos. término en ese Misterio de donación. No fue capaz en su Existen diferencias muy marcadas entre grupos pomomento, el cristianismo occidental de inicios del siglo blacionales en las frecuencias alélicas, tanto para genes XX, sobre todo católico, pero también protestante, de discausantes de enfermedades, como para marcadores genétinguir entre teoría de la evolución y presupuestos filosóticos neutrales selectivos, como lo son ciertos grupos sanficos. Tal vez porque no se pueden separar del todo. guíneos, algunos polimorfismos proteicos y de DNA. Los Pero lo que hoy sí podemos apreciar, a siglo y meprimeros son muy significantes para la determinación de dio de distancia, es que la teoría de Darwin requiere ser riesgos de recurrencia de enfermedades genéticas en pocompletada en un orden filosófico y en otro teológico, blaciones específicas, y los últimos son importantes como de manera que pueda irse más allá de la visión fundamarcadores de la evolución humana reciente. mentalista de la creación, que no fue sino simple reacción alérgica a un planteamiento que cimbró las bases ideológicas del orden establecido. En tiempos más recientes, la teoría del intelligent design, en boga sobre todo en ciertos círculos fundamentalistas estadunidenses, pretende servir a la idea de creación, rebatiendo la idea de evolución como ley fatal de la rivalidad, sin distinguir de nueva cuenta que lo verdaderamente esencial de la fe cristiana no es la afirmación de un intervencionismo divino en la creación, sino el reconocimiento de la finalidad libre y gratuita con la que Dios ha deseado planificar su obra por la participación de su ser y la encarnación de su Verbo. 3. POR UNA COMPLEMENTARIEDAD DE LAS CIENCIAS Y LAS HUMANIDADES La modernidad tardía, a cien años de la teoría de la evolución y de la crisis modernista en el mundo católico, se encuentra en posibilidades de superar la vieja oposición, para dar paso a un debate crítico en ambos sentidos, de manera que la ciencia empírica dé sus aportaciones pertinentes sobre los mecanismos de evolución de las especies, al mismo tiempo que la filosofía y la teología, junto con las demás ciencias sociales, debaten críticamente la problemática del sentido, la alteridad, la libertad y la apertura a la trascendencia, propias de la creación. En este sentido, el Papa Juan Pablo II, en su Discurso a la Academia Pontificia de Ciencias en 1996, afirmaba:

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

33

73

INDIVIDUALIDAD GENÉTICA Cada individuo es genéticamente único. Esta individualidad radica en las variaciones que se presentan dentro de su secuencia nucleotídica de manera silenciosa; es decir, sin provocar enfermedad. Sin embargo, cada individuo mantiene las características genéticas de la raza y subpoblación (grupo étnico) al cual pertenece. Las mutaciones nocivas que producen cambios fenotípicos son fácilmente detectables. Pero un gran número de mutaciones son selectivamente neutras, no causan daño y no se manifiestan fenotípicamente. En estas últimas, la variación se localiza en regiones extragénicas o no codificantes o en regiones heterocromáticas de los cromosomas. En el transcurso de la evolución, el flujo constante de nuevas variaciones nucleotídicas ha asegurado un alto grado de diversidad e individualidad genética. Ésta puede manifestarse como cambios en el patrón de tinción de los cromosomas (heteromorfismos cromosomales), variaciones proteicas (Ejemplo: grupos sanguíneos), o cambios nucleotídicos en diversas regiones del genoma (SNPs). Estos cambios se observan en color gris: T T A A T T C C G G C C G G T T A A C C A A G G

T T

A A

T T

C C

G G

T T

G G

T T

A A

C C

A A

G G

La identificación de individuos se ha realizado tipificando diferentes marcadores genéticos no moleculares (antígenos de los grupos sanguíneos, los del complejo mayor de histocompatibilidad, isoenzimas y proteínas séricas) y moleculares (VNTRs, RFLPs, RAPDs, SNPs, CNVs) los cuales tienen un alto grado de discriminación e identificación.

70

34

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

resultados de la observación, pero que es homogénea con ellos. Gracias a ella, una serie de datos y de hechos independientes entre sí pueden relacionarse e interpretarse en una explicación unitaria. La teoría prueba su validez en la medida en que puede verificarse; se mide constantemente por el nivel de los hechos; cuando carece de ellos, manifiesta sus límites y su inadaptación. Entonces, es ne-cesario reformularla. Además, la elaboración de una teoría como la de la evolución, que obedece a la exigencia de homogeneidad con los datos de la observación, toma ciertas nociones de la filosofía de la naturaleza. Y, a decir verdad, más que de la teoría de la evolución, conviene hablar de las teorías de la evolución. Esta pluraliFoto 4. Hombre del Metro Balderas. dad afecta, por una parte, a la diversidad de las explicaciones que se han propuesto con respecto al mecanismo RASGOS MORFOLÓGICOS FEMENINOS de la evolución, y, por otra, a las diversas filosofías a las En lo referente a los esqueletos femeninos, son pocos los que se refiere. Existen también lecturas materialistas y caracteres morfológicos que están relacionados con su anreduccionistas, al igual que lecturas espiritualistas. Aquí tigüedad. Foto 2. Hombre de Tlapacoya I. el juicio compete propiamente a la filosofía y, luego, a la teología.5 Luego de enunciar el meollo epistemológico de la cuestión, enseguida plantea un argumento de antropología filosófica a ser tenido en cuenta en el debate: El Magisterio de la Iglesia está interesado directamente en la cuestión de la evolución, porque influye en la concepción del hombre, acerca del cual la Revelación nos enseña que fue creado a imagen y semejanza de Dios (cf. Gn 1, 28-29). La constitución conciliar Gaudium et spes ha expuesto magníficamente esta doctrina, que es uno de los ejes del pensamiento cristiano. Ha recordado que el hombre es ‘la única criatura en la tierra a la que Dios ha amado por sí misma’ (n. 24). En otras palabras, el homTeniendo en cuenta el estado de las investigaciones cientí- bre no debería subordinarse, como simple medio o mero ficas de esa época y también las exigencias propias de la instrumento, ni a la especie ni a la sociedad; tiene valor teología, la encíclica Humani generis consideraba la doc- por sí mismo. Es una persona. Por su inteligencia y su trina del ‘evolucionismo’ como una hipótesis seria, digna voluntad, es capaz de entrar en relación de comunión, de de una investigación y de una reflexión profundas, al igual solidaridad y de entrega de sí con sus semejantes. Santo Foto 3. Hombre de Santa María Aztahuacan. que la hipótesis opuesta. Pío XII añadía dos condiciones Tomás observa que la semejanza del hombre con Dios rede orden metodológico: que no se adoptara esta opinión side especialmente en su inteligencia especulativa, porque robusticidad son causados por fuertes inserciones musculares. En cuanto a como si se tratara de una doctrina cierta y de-mostrada, su relación con el objeto de su conocimiento se asemeja a las piezas dentarias, son grandes y presentan un pronunciado desgaste oclusal, y como si se pudiera hacer totalmente abstracción de la la relación que Dios tiene con su obra (cf. Summa Theol., Iel cual puede causar la desaparición del esmalte; en algunos casos llega hasta la Revelación a propósito de las cuestiones que esa doctrina II, q. 3, a. 5, ad 1). Pero, más aún, el hombre está llamado a raíz, quedando expuesta la dentina, misma que puede presentar una coloración plantea. Enunciaba igualmente la condición necesaria para entrar en una relación de conocimiento y de amor con Dios café oscuro. En estos esqueletos, es notoria la ausencia del apiñamiento o roque esa opinión fuera compatible con la fe cristiana; sobre mismo, relación que encontrará su plena realización más tación de piezas dentarias, al igual que de afectaciones patológicas como caries allá del tiempo, en la eternidad. En el misterio de Cristo este aspecto volveré más adelante. y abcesos. Foto 5. Mujer del Peñón III Hoy, casi medio siglo después de la publicación de la encí- resucitado se nos ha revelado toda la profundidad y toda La mandíbula de estos especímenes es grande, robusta, con forma de heclica, nuevos conocimientos llevan a pensar que la teoría la grandeza de esta vocación (cf. Gaudium et spes, 22). En rradura y con marcadas inserciones musculares, sobre todo en la región goEstos especímenes presentan un cráneo de forma dolide la evolución es más que una hipótesis. En efecto, es virtud de su alma espiritual, toda la persona, incluyendo nial. El tubérculo sinfisial se encuentra poco desarrollado, contrariamente a los coide; no se presenta el torus orbitario desarrollado como notable que esta teoría se haya impuesto paulatinamente su cuerpo, posee esa dignidad. Pío XII había destacado tubérculos laterales. Las ramas ascendentes son anchas y altas, el ángulo gonial en los masculinos; al igual que las poblaciones más recienal espíritu de los investigadores, a causa de una serie de este punto esencial: el cuerpo humano tiene su origen es recto, los cóndilos son grandes y la sínfisis es alta. Las piezas dentarias se tes, presenta un frontal abombado, con bordes supraordescubrimientos hechos en diversas disciplinas del saber. en la materia viva que existe antes que él, pero el alma comportan de la misma forma que las del maxilar. bitarios cortantes y demás rasgos propios de su sexo. Sin La convergencia, de ningún modo buscada o provocada, espiritual es creada inmediatamente por Dios (‘animas El esqueleto poscraneal en general presenta rasgos de robustez, con evi- embargo, en algunos casos también se puede observar una de los resultados de trabajos realizados independiente- enim a Deo immediate creari catholica fides nos retinere dencia de fuertes incisiones musculares, ocasionando la presencia de rebordes quilla ósea en la parte media del cráneo, como en el caso mente unos de otros, constituye de suyo un argumento iubet’: encíclica Humani generis: AAS 42 [1950], p. 575). óseos, sobre todo en zonas articulares como la cintura pélvica, miembros supe- de los masculinos. En consecuencia, las teorías de la evolución que, en significativo en favor de esta teoría. riores e inferiores. Esto se debe, probablemente, a las actividades que desarroEl maxilar es un poco robusto, con prognatismo y en ¿Cuál es el alcance de dicha teoría? Abordar esta cuestión función de las filosofías en las que se inspiran, consideran llaban estos individuos. Finalmente, la estatura promedio de esta población de las piezas dentarias también presenta desgaste, menos significa entrar en el campo de la epistemología. Una que el espíritu surge de las fuerzas de la materia viva o masculinos se encuentra alrededor de 1.70 metros. pronunciado que en los masculinos; sin embargo, en al teoría es una elaboración metacientífica, diferente de los que se trata de un simple epifenómeno de esta materia,

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

35

71

mientos diferentes, creación y evolución pertenecen a mason incompatibles con la verdad sobre el hombre. Por otra gunos casos queda expuesta la dentina; tampoco hay roterias diferentes en la educación: la teoría de la evolución parte, esas teorías son incapaces de fundar la dignidad de tación de piezas dentarias. a la materia Realia’ y la doctrina de la creación a la materia la persona. La mandíbula es grácil; la sínfisis es corta y poco proReligión y cultura. Porque soy teólogo, y no a pesar de Y Juan Pablo II culmina especificando una arquitectura del minente; el desarrollo de los tubérculos laterales es ligero; serlo, también me hubiese unido al rechazo de este postuconocimiento, pertinente a nuestro juicio en tiempos pospor arriba de éstos se forman dos pequeñas fositas. lado. Alberto el Grande, cuya fiesta constituye el marco de modernos y postseculares: En general, los esqueletos femeninos son mucho más nuestro Dies Academicus, estimado Mister Darwin, habría Así pues, refiriéndonos al hombre, podríamos decir que gráciles que los masculinos y la estatura promedio para encontrado en usted un espíritu emparentado con el suyo. nos encontramos ante una diferencia de orden ontológiesta población es de 1.53 metros. Baste recordar sus observaciones sobre la naturaleza, las co, ante un salto ontológico. Pero, plantear esta disconEn conclusión, se puede decir que los esqueletos huplantas y las aves. Él también se habría indignado y habría tinuidad ontológica, ¿no significa afrontar la continuidad manos son evidencias tangibles, con lo que se puede conorechazado tal alternativa. Si la teoría de la evolución es física, que parece ser el hilo conductor de las investigacer una serie de características biológicas y culturales. verdadera, ella obliga a la teología también. Pero, ¿acaso ciones sobre la evolución, y esto en el plano de la física Los esqueletos de estos individuos estudiados presenes verdadera? ¿Es ella toda la verdad?”6 y la química? La consideración del método utilizado en tan rasgos morfológicos propios de su temporalidad, prinlos diversos campos del saber permite poner de acuerdo Tal vez convenga promover en la universitas poscipalmente en el cráneo, como la forma, el torus orbitario, dos puntos de vista, que parecerían irreconciliables. Las moderna una síntesis cognitiva que intregre la apertura la quilla ósea, la excesiva abrasión dental y la notable rociencias de la observación describen y miden cada vez con crítica y al mismo tiempo permita distinguir órdenes del bustez, esta última, particularmente en los del sexo masmayor precisión las múltiples manifestaciones de la vida y conocimiento sobre una realidad compleja pero unitaria, culino. las inscriben en la línea del tiempo. El momento del paso a con rigor de análisis empírico y lógico, pero también con lo espiritual no es objeto de una observación de este tipo capacidad especulativa para discernir los sentidos de la VARIACIÓN ANATÓMICA REGIONAL que, sin embargo, a nivel experimental, puede descubrir verdad. Tomando como referencia la forma del cráneo, se puede una serie de signos muy valiosos del carácter específico En suma, la educación ha de generar habilidad sainferir que las poblaciones prehispánicas no descienden del ser humano. piencial en estudiantes y profesores, como personas inde estos primeros grupos, o que en 12 mil 700 años se diePero la experiencia del saber metafísico, la de la conteligentes y libres, conscientes de un mundo complejo ron algunos cambios en la estructura anatómica de estas ciencia de sí y de su índole reflexiva, la de la conciencia y maravilloso que hemos de preservar como habitat y poblaciones, lo que se puede considerar como una variamoral, la de la libertad o, incluso, la experiencia estética como don. ción anatómica de tipo regional. y religiosa, competen al análisis y la reflexión filosóficas, Otro de los aspectos que llama la atención es la esmientras que la teología deduce el sentido último según tatura promedio de estos individuos, en los masculinos los designios del Creador. 1.70, y 1.53 metros para los femeninos. Estos valores difieren con los de la población prehis4. EDUCACIÓN CON SENTIDO CRÍTICO pánica, en los que la talla es menor. Al respecto, se puede Y EDUCACIÓN RESPONSABLE decir que, probablemente, en esta época existió una mejor Una vez reconocidos ambos campos de conocimiento de alimentación, a diferencia de los individuos del periodo la única realidad, entonces podremos distinguir órdenes prehispánico, si es que una buena alimentación es la detode conocimiento y de acción, donde la humanidad vuelva nadora de la estatura o bien, si ésta tiene una relación con a comprender su papel de cuidadora de este mundo en la carga genética. evolución, promoviendo primero su preservación como En cuanto a la dentición, los individuos masculinos son ecosistema, para luego plantearse en el corazón de ese los que presentan un mayor desgaste, en algunos casos en proceso, la pertinencia de la libertad y la inteligencia huforma de bisel, por lo que no generó infección alguna que manas, mediante el uso crítico y responsable, para enconprovocara la pérdida de alguna pieza o más; lo que se puetrar el sentido trascendente de lo real. de apreciar es una periodontitís. Volvamos al discurso de aquel rector europeo con el En las mujeres sólo existe un desgaste muy marcado que iniciamos esta reflexión: sin presentar el tipo de bisel. Esto puede indicar que am“En el creacionismo, la teoría de la evolución encontró bos comían el mismo tipo de alimentos. un adversario que buscaba una disputa sobre un terreno El biselado en los hombres posiblemente se deba a común; es decir, el origen de las especies. Pero no tenía que los utilizaron para elaborar algunos de sus instruargumentos que fuesen del mismo valor intelectual. La mentos de trabajo, lo que indicaría que desde estos tiemoposición dura permanece: o bien creación en siete días, o pos ya había una división del trabajo en estos grupos de bien evolución. O bien uno de los dos contrincantes es dela cuenca de México. rrotado, muerto, o bien asistimos a la reedición de la teoría Finalmente, en esta muestra esquelética no existe medieval de la doble verdad. Una variante moderada de evidencia de alguna enfermedad que dejara huella en el esta querella fue expresada recientemente en Zurich. Creahueso, con excepción de procesos artríticos que probableción y evolución serían enseñadas en las escuelas de ese mente fueron ocasionados por una sobrecarga de trabajo cantón, según la propuesta de algunos legisladores. Pero físico en las articulaciones, que es donde principalmente el postulado fue rechazado por el gobierno cantonal. En la se presenta. prensa podía leerse: ‘La doctrina de la creación se basa en Sin embargo, sí es frecuente encontrar vestigios de fundamentos religiosos, mientras que la teoría de la evotraumatismos en el cráneo y fracturas en costillas, huesos lución intenta, sobre una base científica, dar respuestas del pie y manos, que pudieron ser provocados por la aclo más precisas posibles a la pregunta por el origen y el tividad que desarrollaban, como la caza y la recolección, o desarrollo del mundo y de la vida. A causa de tales acercabien fueron causados por enfrentamientos. Cuenca de México.

Pie de Página
1 DARWIN Charles. El origen de las especies por medio de la selección natural (Londres: John Murray 1859), tomo I, Introducción. URL: http://www. cervantesvirtual. com/servlet/ SirveObras/1355 96202120264952 22202/p0000001. htm#1 [Fecha de consulta: 5 de febrero de 2009]. 2 Íbid., tomo III, cap. XV. URL: http://www. cervantesvirtual. com/servlet/ SirveObras/1355 96202120264952 22202/p0000016. htm#20 [Fecha de consulta: 5 de febrero de 2009]. 3 VERGAUWEN Guido. Zufällig geworden - nés à l’aventure. Darwin revisited, n. 1. URL: http://www.unifr.ch/ iso/iso020105de. htm#darwin [Fecha de consulta: 4 de febrero de 2009]. 4

PIO XII. Carta Encíclica Humani Generis. Sobre las falsas opiniones contra los fundamentos de la fe católica (12 agosto de 1959). URL: http://www. vatican.va/holy_ father/pius_xii/ encyclicals/ documents/hf_pxii_enc_12081950_ humani-generis_ sp.html [fecha de consulta: 4 de febrero de 2009].

5 JUAN PABLO II. Discurso a la Asamblea Pleanaria de la Academia Pontificia de Ciencias (22 de octubre de 1996). URL: http://www. vatican.va/holy_ father/john_paul_ii/ messages/pont_ messages/1996/ documents/hf_jpii_mes_19961022_ evoluzione_sp.html [Fecha de consulta: 4 de febrero de 2009]. 6 VERGAUEN Guido. Op. Cit., n. 2.

68

36

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

La morfología de los primeros humanos de la cuenca de México
José Concepción Jiménez López Gloria Martínez Sosa Rocío Hernández Flores n este trabajo se presentan las características morfológicas de una muestra de esqueletos que pertenecen a los primeros grupos humanos que poblaron la Cuenca de México. Para entender los procesos biológicos que han experimentado estos individuos, es importante interpretarlos como parte del origen y evolución del Homo sapiens sapiens en diferentes partes del mundo. Recordemos que cualquier población humana es parte del proceso evolutivo que se generó en África. Parte de este trabajo consiste en explicar, de manera general, qué eventos biológicos acontecieron en las poblaciones del Nuevo Mundo. No cabe duda que este tema es interesante, y la razón de por qué se han formulado una serie de teorías e hipótesis en relación con la evolución, origen y antigüedad de la población humana en América.

E

Antropólogo Físico Investigador José Concepción Jiménez López josejimenez_ daf@hotmail.com

Un polizón llamado Charles Darwin

POLIZÓN EN ROMA Ajenos a esas proclamas evolutivas, los inspectores del sistema de transporte público nunca se percataron de que, durante varias semanas, Charles Darwin viajó de polizón Antonio DE LA Araujo PRINCIPIOSLazcanoEVOLUCIÓN HUMANA por toda Roma. En el estudio de cualquier grupo humano, se debe tomar ginó una serie de transformaciones evolutivas, las cuaLa teoría de la evolución nos permite comprender el asta hace un par de meses, los autobuses urbanos que en cuenta el proceso evolutivo, debido a que se trata de les ocasionaron nuevas modificaciones anatómicas imporcirculaban por las calles y avenidas de Roma llevaban origen de la resistencia a los antibióticos, el surgimiento un fenómeno natural que permitió la adaptación, la cual tantes. Antropólogo en sus costados unos letreros de colores llamativos, de la gripa aviar en Asia, así como el éxito (y los fracasos) Físico determina que una especie sea exitosa. La evolución del Esto le permitió desarrollar una capacidad para exde las terapias con antirretrovirales que se aplican a las en donde se leía: “Antibióticos sí, pero con cautela…” Investigador hombre, a diferencia de los demás organismos, presenta plotar nuevos nichos ecológicos, con lo que adquirió los Gloria Martínez Es fácil comprender el origen de dicha campaña pu- personas infectas con el virus del SIDA, pero también nos dos principios que la han caracterizado: el principio bio- elementos necesarios para sobrevivir fuera de África, en Sosa blicitaria, que refleja la preocupación de médicos y autori- permite reconstruir la forma en que durante miles de miAntropólogo Físico lógico y el principio cultural. El primero de ellos se da a lugares como Europa y Asia, así como en diversas islas que dades de salud por la rapidez con la que un número cada llones de años los microorganismos se fueron diversificanInvestigador través de la herencia genética, y el segundo se transmite a se encontraban separadas de la plataforma continental. vez mayor de especies y cepas de microorganismos se ha do hasta dar origen a un número abrumador de especies través del aprendizaje. En estos territorios, se produjeron ligeras modificaciones que se adaptaron a una enorme diversidad de ambientes y vuelto resistente a la acción de los antibióticos. Para comprender de manera más puntual la evolu- anatómicas. Prácticamente a éstas se les ha considerado La producción industrial de la penicilina, que comen- terminaron modificando para siempre al planeta mismo. ción humana, se han desarrollado diferentes modelos que como regionales, lo que distinguió a unos de otros. Estos grandes periodos evolutivos, que son el equizó hace apenas 70 años, inauguró una etapa nueva en explican de forma detallada el origen del Homo sapiens; la lucha contra las enfermedades infecciosas, pero no valente biológico a lo que Fernand Braudel llamó “la uno de ellos es el llamado multirregional, que plantea que APARICIÓN DEL HOMO SAPIENS historia de larga duración”, al describir el mundo meditardaron en surgir bacterias resistentes. hubo un proceso por el cual nuestra especie es el resul- El Homo erectus europeo muestra rasgos que posteriorEl uso indiscriminado de los antibióticos, que en Méxi- terráneo, comenzaron hace unos cuatro mil millones de tado de una transformación filogenética. A partir de las mente caracterizaron al Homo sapiens de Neandertal; y co y en muchos otros países se pueden adquirir y con- años, al aparecer la vida en la Tierra. poblaciones ancestrales, el género Homo evolucionó gra- por otro lado, los Homo erectus africanos reflejan formas Doctor Antonio sumir sin supervisión médica, nos ha permitido atestiguar Lazcano Araujodualmente, hasta llegar a convertirse en Homo sapiens típicas del Homo sapiens del tipo Cro-Magnon, que postela rapidez con la que la Rocío Facultad dearcaico, y posteriormente en selección natural ha llevado a la LOS GRANDES AUSENTES sapiens sapiens. Los restos el hombre moderno. riormente dio origen al Homo Hernández Flores Los microbios son los grandes ausentes de la obra de Daraparición de patógenos resistentes. Ciencias Otro de los aspectos importantes es la migración que de este último han sido localizados en África, Europa y Dirección de Universidad Es decir, los letreros de los autobuses romanos no eran win, que nunca discutió ni su evolución ni el origen de la Antropología Autónomase dio, desde el centro de su origen, hasta las diferentes en parte de Asia Occidental. De acuerdo a los registros Nacional Física nada más un llamado de atención en pro de la salud públi- vida. Sin embargo, su teoría se convirtió en la inspiración Instituto Nacional de Méxicoregiones del mundo. La dispersión del género Homo se arqueológicos, el Homo sapiens sapiens apareció hace dealar@correo.unam. Antropología e ca, sino también una declaración del poder explicativo de básica que llevó a Alexander I. Oparin, un joven bioquímicon la salida del continente africano, lo que ori- aproximadamente cien mil años, y hace unos 60 mil ó Historia mxinició teoría de evolución. co soviético, y a John B. S. Haldane, un genetista inglés, a la

H

CONOCIMIENTO CONOCIMIENTO
proponer de manera independiente en los años 1920 la 70 mil llegó a varios rincones del planeta. Uno de los sihipótesis de que los primeros seres vivos eran el resultado tios distantes a donde llegaron los hombres fue Oceanía, de la evolución de moléculas orgánicas que se sintetizaron durante el Pleistoceno superior. En esa época hubo un auen la Tierra primitiva. mento de las masas polares, que permitieron el tránsito Haciendo caso omiso de las barreras que separan las de estos grupos entre el sudeste de Asia y Australia. Las distintas disciplinas científicas, estudiaron y analizaron dos plataformas continentales que emergieron del mar y observaciones, reportes, experimentos y teorías de la que fueron conformadas por varias islas, se conocen como astronomía, la geología, la química orgánica, la paleonSunda y Sahul, donde se establecieron las posibles rutas tología y la biología, para desarrollar no sólo una teoría de acceso al continente oceánico, hace alrededor de 40 sino, sobre todo, un programa de investigación científica mil años. El último de los continentes en ser poblado fue multidisciplinario que dio origen no solamente a los estuAmérica. Sabemos que la llegada del hombre a este lugar dios contemporáneos sobre la aparición de la vida, sino ha generado una serie de polémicas entre los especialistas, que también contribuyó a ver a los microbios no sólo bajo sobre el origen, la antigüedad y las rutas que siguieron la óptica del microscopio sino también desde una perspecestos primeros grupos para ingresar al continente. tiva evolutiva. Las ideas de Oparin y Haldane tardaron mucho en ser RUTA DE INGRESO estudiadas experimentalmente. No fue sino hasta 1952 Se ha planteado que fueron tres las posibles rutas que uticuando Stanley L. Miller, un joven estudiante que había colizaron estos grupos para ingresar al Nuevo Mundo. En este menzado sus estudios de doctorado en la Universidad de caso, sólo mencionaremos la que tiene más aceptación, la Chicago, escuchó al Premio Nobel Harold Urey hablar de la cual argumenta que la migración fue por el Estrecho de Tierra primitiva y de los trabajos de Alexander I. Oparin. Bering, debido a que durante esa época las condiciones Al cabo de unas cuantas semanas, Miller se acercó a medioambientales formaron en este lugar un puente de Urey y le pidió que lo asesorara para llevar a cabo una tierra que conectó la zona oriental de Siberia con Alaska. simulación de los procesos químicos que habían llevado a Las fechas que se han sustentado son entre los 30 mil la síntesis de compuestos orgánicos necesarios, según las y 20 mil años antes del presente, por lo que podemos ideas de Oparin, para la aparición de la vida. decir que el Estrecho de Bering fue el punto de partida que tuvieron estos grupos humanos para poblar el conEXPERIMENTO DE MILLER tinente americano. Miller diseñó un aparato en donde buscó simular las condiPara conocer el origen de los primeros hombres ameciones de Tierra primitiva, con una mezcla de gases que ricanos, se ha sumado a estas investigaciones el estudio incluía metano, amoníaco, hidrógeno y vapor de agua, a genético de las bases moleculares de los humanos, a trala que sometió a la acción de descargas eléctricas. Al cabo vés del ADN, con lo cual podemos conocer parte de la inde pocos días, observó que se habían sintetizado diversas formación de la historia de la evolución humana en dimoléculas orgánicas, incluyendo varios aminoácidos preferentes niveles, que puede ser desde un individuo hasta sentes en las proteínas de todos los organismos. una población. Miller publicó los resultados de su trabajo en 1953, el mismo año en que Watson y Crick propusieron el INFORMACIÓN GENÉTICA ANCESTRAL modelo de la doble hélice del DNA, y a lo largo de los Los estudios del ADN han llegado a establecer cuatro siúltimos cincuenta años se ha demostrado la facilidad con tios, dentro de la estructura donde se vincula la informala que podemos sintetizar un sinnúmero de moléculas de ción genética ancestral de los nativos americanos. Esto interés biológico, lo que apoya, por supuesto, la idea de se encuentra en cuatro linajes maternos que son el A- Bque en la Tierra primitiva hubo una sopa primitiva. C- D, los cuales se han rastreado y comparado con otras Ignoramos cómo surgió la vida en la Tierra, pero se puepoblaciones de diferentes partes del mundo, con el fin de de comprender cómo ocurrió. Como dice Octavio Paz en conocer si existe una filiación biológica con otros grupos. uno de sus poemas más bellos, “sin entender comprendo”. Con los resultados de estos estudios se ha llegado a estaEsa comprensión nace de la herencia extraordinaria que blecer que los pueblos del noreste de Asia comparten la nos dejó la obra de Charles Darwin. Es cierto que en 1887 información genética con la población americana. Darwin escribió que “por ahora no vale la pena pensar soEsta información genética apoya los resultados que bre el origen de la vida; igual podríamos estar pensando se han obtenido de los estudios morfológicos que se han en el origen de la materia misma”. llevado a cabo en los esqueletos que pertenecieron a los primeros grupos que llegaron a la Cuenca de México. PROBLEMAS PENDIENTES La Cuenca de México es un lugar dentro del territorio Sin embargo, como señaló en 1944 John D. Bernal, en un nacional en donde se han localizado más evidencias esquepequeño volumen titulado The Physical Basis of Life, la léticas. De este sitio se tiene una muestra de 20 esqueleafirmación de Darwin “no significa que debamos disfrazar tos humanos adultos y de ambos sexos. Para sustentar nuestra ignorancia con hipótesis absurdas sobre el origen el origen y la antigüedad de estas evidencias humanas, se de la vida o de la materia, sino que, por el contrario, debehan aplicado métodos de distintas disciplinas, como la armos intentar, desde un principio, proponer en forma cuiqueología, genética, lingüística, geología, química y antrodadosa secuencias de eventos que sean lógicas, pología física, entre otras.

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

37

69

ESTUDIO DEL ESQUELETO HUMANO El estudio del esqueleto humano reviste una importancia crucial, debido a que es el único medio para conocer las características anatómicas, genéticas, nutricionales y culturales, puesto que es el único material que se tiene de las poblaciones pretéritas. De esa forma, en este trabajo se presentan de manera general las características morfológicas que caracterizan a los esqueletos de los primeros pobladores de la Cuenca de México. Los rasgos morfológicos que se presentan con mayor frecuencia en restos esqueléticos del período precerámico, son más observables en los individuos del sexo masculino, ya que en el caso de los femeninos muestran características gráciles propias de su sexo. RASGOS MORFOLÓGICOS MASCULINOS Uno de los aspectos que se presentan y que pueden caracterizar a un espécimen americano antiguo, es la forma alargada del cráneo, conocida como dolicoide, ya que esta forma no se encuentra en las poblaciones prehispánicas. Sin embargo, es importante mencionar, que en estos grupos algunos individuos pueden tener el cráneo longitud media (mesocráneo).

Foto 1. Hombre de Texcoco.

En muchos casos, el hueso frontal es grande, con un torus orbitario prominente, lo que hace que se torne más huidizo. A nivel medio de esta zona, se encuentra desarrollada una quilla ósea que se dirige hacia atrás. Los arcos superciliares son muy marcados, con crestas laterales desarrolladas, órbitas de forma cuadrada con bordes redondeados y macizos; las escotaduras supraorbitarias e infraorbitarias son grandes. El maxilar es amplio y robusto, con prognatismo pronunciado. En los parietales, las líneas curvas son muy evidentes. En relación al hueso temporal, la cresta supramastoidea es prominente, la apófisis mastoides es grande y los arcos cigomáticos son muy pronunciados. Estos rasgos de

66

38

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO
entre otros, ilustran procesos exitosos de divergencia funcional por duplicación de genes (Figura 5).

con las cuales intentamos demostrar que unas etapas biosfera ha convencido a muchos científicos de la necedeben anteceder a otras, e ir construyendo con esas sidad de identificar moléculas de origen biológico en los secuencias parciales una historia coherente. Segura- planetas que giran alrededor de otras estrellas. mente existirán lagunas que no podremos llenar, pero hasta que no intentemos construir estas secuencias no ¿VIDA EXTRATERRESTRE? las podremos identificar ni podremos encontrar solu- ¿Existe vida en otras partes del Universo? Los escritos de Darwin no discuten esta cuestión, pero sabemos que el ción a los problemas pendientes.” El descubrimiento de las propiedades catalíticas origen de la vida en la Tierra no es resultado ni de un miladel RNA ha venido a llenar una de las lagunas de las gro ni de la casualidad, sino de un proceso de evolución. que habló Bernal, y nos permiten reconocer la existen- Las moléculas que sirven de precursores en experimentos cia del llamado mundo del RNA, que antecedió tanto a como los de Miller son extraordinariamente abundantes en cometas y en las nubes de material interestelar de la las proteínas como al DNA mismo. ¿Qué ocurrió después? Desde su origen mismo, Vía Láctea, en donde observamos la formación de estrela evolución de la biosfera y la del planeta han ido llas, a menudo acompañadas de grupos de planetas. ¿En cuántos de estos cuerpos ha surgido la vida? mano a mano. Hay un diálogo constante entre los organismos y su entorno, como lo muestra la aparición ¿Existen, como creen algunos astrónomos como Frank de la fotosíntesis, un fenómeno biológico que eventual- Drake, otras civilizaciones en la Galaxia? O bien, como Figura 3. Posible destino de los genes duplicados. (Tomado de Louis, 2007, Nature). mente transformó la atmósfera terrestre, enriquecién- han sugerido Peter D. Ward y Donald Brownlee en su libro dola en oxígeno. La acumulación del oxígeno permitió, Rare Earth, ¿la aparición de formas inteligentes en el UniFigura 4. Modelo que propone la posible evolución por a su vez, el surgimiento de nuevas rutas metabólicas, verso es poco probable? que pueden tomar los genes duplicados (i.e. inactivación, duplicación génica de dos enzimas (HisA y HisF) las cuales En realidad, no tenemos respuesta a estas preguntas. incluyendo la biosíntesis del colesterol. subfunción, especialización, etcétera), puede aumentar la participan en la biosíntesis de histidina. (Tomado de Lang et al., A pesar de su mala fama, el colesterol es un com- Es posible que no estemos solos en el Universo, pero pueoligomerización de diversas proteínas sobre motivos par- 2000, Science). ponente esencial de las membranas de células como de haber factores que nos hacen sobreestimar la probaticulares y producir nuevas estructuras topológicas, melas de hongos, plantas y animales, y su presencia ha bilidad del surgimiento de la vida. Como escribió alguna diante la fusión de marcos de lectura abiertos; escenario permitido el desarrollo de un complejo laberinto de vez el filósofo francés Blas Pascal: si la nariz de Cleopatra que se ha contemplado para uno de los andamiajes más membranas que incluye al núcleo de nuestras células. hubiera sido más grande, la historia del mundo hubiera estudiados en la actualidad: los llamados barriles (βα)8 o De hecho, la coevolución de la atmósfera terrestre y la podido ser diferente. TIM barrels. Este tipo de enzimas pueden identificar diferentes sustratos y llevar a cabo diversas reacciones con una pequeña cantidad de cambios en los residuos que intervienen en la catálisis. Debido a su capacidad catalítica, los barriles (βα)8 han sido una fuente importante de los estudios evolutivos actuales. Algunos de ellos sugieren que su origen fue a través de eventos de duplicación genética, los cuales determinaron a lo largo del tiempo la diversificación y especificidad de sustrato características de cada enzima. Figura 5. Árbol filogenético que ilustra la divergencia por De tal forma, una posibilidad que explica el sur- duplicación génica de la tubulina ancestral hacia la tubulina gimiento de enzimas con topología (βα)8 se centra en un y . Se observan las relaciones entre genes parálogos (aquéllos homodímero formado por dos medios barriles idénticos que se originan de una duplicación y se encuentran en el mismo organismo) y genes ortólogos (se encuentran en diferentes que, después de adaptaciones funcionales y estructurales, organismos y provienen de un mismo ancestro). (Tomado de se especializaron hasta constituir los diferentes barriles Lodish et al. 2002, en Molecular Cell Biology). (βα)8 que se conocen en la actualidad (Figura 4). Lupas et alii (2001) han considerado que ciertos even- SACCHAROMYCES CEREVISIAE: tos que recaen sobre el ADN pueden producir profun- UN CASO ESPECÍFICO dos cambios en las estructuras de las proteínas. Tal es Como se ha mencionado, existen un sinfín de evidencias el caso de la permutación cíclica, fenómeno relacionado que proponen que la existencia de genes duplicados es también con la duplicación de genes, su posterior fusión y una característica de todas las especies hasta ahora sela presencia de deleciones parciales. Este proceso de per- cuenciadas. Después de la secuenciación de la levadura mutación lleva a modificaciones topológicas en las proteí- Saccharomyces cerevisiae, se concluyó que existía una nas y puede ser que en un pasado remoto fuera una vía gran cantidad de elementos repetidos en su genoma, el importante en la innovación de nuevas proteínas, a partir cual está compuesto por 12 mil 068 kilobases, y la cantide segmentos de ADN que codificaran para unos cuantos dad de genes que potencialmente codifican para diversas aminoácidos. proteínas asciende a casi seis mil. Ejemplos como los de la mioglobina y la hemoglobina, Análisis posteriores llevaron a considerar que la canla historia molecular del citocromo C y de las tubulinas, tidad de genes redundantes en Saccharomyces cerevisiae

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

39

67

CONCLUSIÓN Los productos de los genes duplicados se encuentran en el centro de procesos biológicos de suma importancia en las especies, tales como el metabolismo del carbono, del nitrógeno, la biosíntesis de aminoácidos, o bien, actuando como activadores transcripcionales, definiendo López Geovani vías de señalización, incluso en el surgimiento de patologías. Con todo esto, se puede considerar que uando se habla de evolución, tal y como decía Opamás allá de ser los genes duplicados una tautología rin, se tiene que contemplar irremediablemente el biológica, han sido factores trascendentales en la origen de la vida en términos materialistas; es decir, evolución de los organismos, y han llevado a cabo la formación precedente de compuestos orgánicos que una gran diversidad de funciones, muchas de éstas dieron paso a los primeros organismos vivientes. Desde prácticamente desconocidas en la actualidad. que Virchow produjo su famosa frase Omnis cellula a cellula -toda célula proviene de una célula-, dejó en claro la imposibilidad de la generación espontánea, mas no así la interrogante acerca del origen de la vida. La teoría de la panspermia, formulada por Arrhenius en 1903, apenas trasladó a un contexto exobiológico diLang, D., Thoma, R., Henn-Sax, M., Sterner, R. and cha interrogante; si bien es cierto existen evidencias que Wilmanns, M. (2000). Structural evidence for evolution soportan una posible evolución molecular a partir de comof the β/α barrel scaffold by gene duplication and ponentes hallados en meteoritos denominados condritos fusion. Science 289(5484): 1546-1550. carbonáceos, estas consideraciones no profundizan en la Li, W.-H.and el origen (1991). Fundamentals explicación sobre Graur, D.de los organismos vivos. of molecular evolution. Sinauer Associates, que En 1933, Oparin propuso una teoría en la Inc. estaSunderland Massachusetts. bleció claves moleculares para el origen de la vida sobre Ohno, S. Evolution by por Duplication. los organisla tierra; manifestaba que,Gene poseer todosHeidelberg, Springer-Verlag. 1970. mos sustancias orgánicas, sin las cuales la vida sería inconcebible, la formación deJ. (2004). Duplicationtuvo que Taylor, J. S. and Raes, esos componentes and haber sido el primer paso hacia of New Genes and Old Ideas. Divergence: The Evolution el origen de la vida. Todas esas Annu. Rev. Genet. 38:615–43. sustancias partieron de compuestos simples como

Aproximaciones al origen de la vida y la evolución de vías metabólicas C
REFERENCIAS

difícilmente podía atribuirse a innumerables procesos de duplicación. De tal forma, la explicación plausible para esa interrogante era considerar que, paralelamente a duplicaciones independientes de genes, presentaba una duplicación total de su genoma. Wolfe y Shields (1997), al analizar regiones duplicadas sobre esta levadura, encontraron que existe un 16 por ciento de genes duplicados a lo largo de su genoma, los cuales corresponden a esa duplicación total acaecida hace 100 millones de años; la importancia fisiológica y evolutiva de tal duplicación pudo haberle concedido a Saccharomyces cerevisiae la adquisición de un metabolismo facultativo; esto es, la capacidad para sobrevivir en condiciones fermentativas y respiratorias, lo cual indicaría que determinados genes duplicados son regulados dependiendo del contexto metabólico, en este caso en especifico, de la fuente de carbono y de las condiciones respiratorias.

Fig. 1. Experimento de Miller y Urey (1953) en el que se pretendía recrear artificialmente las condiciones de la Tierra primitiva -tal como Oparin había propuesto- y la creación de ciertas moléculas claves en el origen de la vida. Después de pocos días de haber colocado diversos compuestos y en presencia de descargas eléctricas, se sintetizaron moléculas orgánicas como aminoácidos, carbohidratos, lípidos, entre otras. (Modificado de Panno, 2005).

Licenciado Geovani López Estudiante de doctorado / Instituto de Fisiología Celular / UNAM glopez@ifc.unam. mx

64

40

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

Duplicación de genes: Tautología biológica o evolución molecular hacia la diversificación de funciones?

amoníaco, agua, metano, entre otros. Cabe mencionar que los procesos de polimerización, la ruptura de tales polímeros, la combinación de moléculas orgánicas y la oxidación, fueron esenciales en el diseño de los primeros cuerpos proteinoides (Figura 1).

INICIO DE LA VIDA Se ha propuesto que la vida comenzó a partir de unos cuantos compuestos simples, los cuales, por procesos de oligomerización, fueron implementando un mayor grado de complejidad, hasta conformar “un mundo ancestral de ácidos ribonucleicos” (ARN). Éste, a su vez, sirvió de precedente en la creación de los primeros organismos enzimáticos y autorreplicantes. Mucho se ha discutido sobre este aspecto, y la razón para considerar un mundo de ARN es debido a que las primeras biomoléculas en existir debían presentar dos características principales: la primera de ellas era que puGeovani López diesen llevar a cabo reacciones enzimáticas, y la segunda, que fueran capaces de auto replicarse. Como bien se sabe, CONTEXTO HISTÓRICO el ADN puede replicarse exitosamente, aunque no puede harles Darwin, en su libro Sobre el origen de las especies (1859), propuso A simple vista, la duplicación de genes pudiera ser conllevar a cabo catálisis alguna. que la variabilidad era la materia prima de la evolución; sin embargo, no de- siderada como un aumento inútil del material genético, Por otra parte, las biomoléculas catalíticas por excelensestimó que la modificación de ciertos órganos a través del tiempo tuviera como un lastre energético para el organismo que presenta cia son las enzimas. El problema con éstas es que son insu génesis sobre elementos primordiales muchas veces repetidos, los cuales dicha duplicación. ¿Por qué existen genes por duplicado, capaces de auto replicarse. Hasta 1983, parecía que no iba cambiarían continuamente hasta constituir nuevos órganos y sistemas. cuando podría bastar con uno solo? -una pregunta apaa existir molécula alguna que pudiera presentar esa doble Esta primera aproximación sobre la multiplicidad de estructuras que diver- rentemente obvia-. El gen duplicado es un elemento que función; sin embargo, Thomas Cech, de la Universidad de gen a través del tiempo, sirvió de precedente en la concepción de la duplicación se tiene que replicar y cuya conservación puede ir en deColorado, y Sidney Altman, de la Universidad de Yale, desgénica. Hacia 1918, Calvin postuló que pueden existir diversos elementos re- trimento del organismo, pues existe una regla muy simple: cubrieron algo que denominaron ribozima: una molécula dundantes a nivel de cromosomas, los cuales a su vez podrían mutar y realizar a mayor cantidad de bases nitrogenadas, mayor inversión de ARN con capacidad catalítica. funciones distintas de las que alguna vez presentaron. de energía para su mantenimiento; sin embargo, y aunque Los experimentos de Müller (1935), al insertar parte del cromosoma X en el pareciera una contradicción, se sabe que todos los orgaUN MUNDO DE ARN cromosoma 2 de moscas Drosophila melanogaster, que tenían sus cromosomas nismos hasta ahora secuenciados presentan invariableEste gran descubrimiento llevó a considerar que las priíntegros, mostraron la viabilidad de estos organismos al adquirir elementos cro- mente duplicaciones de su material genético (Figura 1). meras células en existir provenían de un mundo de ARN. mosómicos repetidos. Lo que es más, Müller postuló -al igual que Calvin- que ¿A qué responde esta paradoja? ¿Son las duplicaciones El paradigma sintáctico sobre un mundo de ARN ha tenido algo similar podía pasar naturalmente y que ese evento de duplicación generaría génicas una simple redundancia funcional o son el punto desde hace tiempo un gran impulso, pero se han encona la postre genes que en la actualidad serían considerados no homólogos, aun de partida hacia la diversificación de genes y proteínas? trado, algunas veces, discrepancias al tratar de fundamencuando provinieran del mismo ancestro. tar el origen de la vida sobre la base exclusiva de ácidos Fig. 2. Esquema que representa la interrelación de los primeros compuestos orgánicos en la aparición y evolución ribonucleicos. de rutas metabólicas a través del tiempo. Los organismos En suma, se estima que el origen de la vida surgió sobreviven debido a su capacidad de transformar ciertos hace tres mil 800 millones de años, a partir de unos cuantos precursores de biomoléculas que intervienen en el metabolismo primario. elementos que fueron ensamblándose hasta constituir polímeros de diferente naturaleza (i.e. proteínas, lípidos y ácidos nucleicos). Todo esto contribuyó a una especia- De esta manera, los organismos que fueran capaces de lización de las diversas rutas metabólicas, así como a la adaptarse a esas condiciones de compuestos limitados y que fueran capaces de sintetizar sus propios recursos complejidad y diversidad de biomoléculas actuales. La abundancia de recursos y la ausencia de competi- a partir de componentes más sencillos, presentarían una dores eran características inherentes a la Tierra primiti- mayor ventaja selectiva y esto sólo fue posible al instaurar va; el surgimiento de organismos que fueran capaces de diversas rutas metabólicas (Figura 2). utilizar los nutrientes disponibles tuvo que haber sido el siguiente paso en la evolución biológica, y esto sólo podía EVOLUCIÓN RETRÓGRADA ser visualizado en virtud de procesos metabólicos que Lo anterior plantea dos escenarios posibles en la evolución relacionaran los sistemas coloidales y los sistemas en- de vías metabólicas, ambos contemplados en el siglo paFigura 1. Ejemplos de genes Licenciado Geovani López sado: el primero de ellos,duplicados en diferentes en 1945, propuesto por Horowitz zimáticos en formación. especies; se ilustran valores que Estudiante de hace hincapié en el modelo denominado “stepwise” o “evovan desde el 11.2 por ciento, doctorado / Instituto lución retrógrada”, el cual explica que la evolución de las VÍAS METABÓLICAS como en el caso del patógeno de Fisiología humano fue precedida por una Celular / UNAM Al establecer que los estudios evolutivos se fundamenta- primeras moléculas enzimáticas Haemophilus influenzae, sehasta un 65 por ciento en glopez@ifc.unam. ban en similitudes y diferencias en los diferentes planos rie de pasos en orden inverso a su producto final; es decir, Arabidopsis thaliana. mx de organización celular y taxonómica, este mismo esque- en un proceso biosintético secuencial, que da como resul-

ma inductivo podía servir en la reconstrucción filogenética del metabolismo, a través de análisis comparativos que sirvieran de evidencia en la explicación del surgimiento de vías metabólicas. Una primera aproximación al respecto se relaciona con ciertos aspectos mencionados anteriormente; la cantidad de recursos disponibles en la Tierra primitiva, si bien fue abundante, no fue ilimitada. Esto hizo que a la postre -tal vez después de cientos de miles o millones de años-, los recursos decrecieran. A partir de esos momentos, la vida sobre la Tierra estuvo supeditada a recursos limitados, como aminoácidos, carbohidratos, nucleótidos, entre otros.

C

?

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

41

65

tado un producto (i.e. aminoácido). La última enzima de de utilizar diferentes sustratos para dar lugar a duplicación o interna; duplicación completa de genes; diversos ORIGEN COMÚN DE LOS SERES VIVIENTES la vía fue la primera en surgir; la segunda, la penúltima, productos; con el tiempo, se especializaron hasta presentar cromosomal parcial; En 1953, tras el descubrimiento de Watson y Crick, de la catálisis altamente específicas.aneuploidía o duplicación cromoesy así sucesivamente. Para tal efecto, los diversos intermesomal y, finalmente, poliploidía o duplicación total del tructura del ADN, se confirmaron plenamente los postulados diarios de las diferentes rutas se encontraban presentes genoma. evolutivos de un origen común para todos los seres vivientes en la denominada Tierra primitiva. Esto surge al asumir Los estudios de Ohno sobre este aspecto en par(Figura 2). La caracterización estructural del ADN abrió una que, cuando el precursor de un metabolito disminuye, ticular fueron preponderantes, según él -basándose ventana en las investigaciones filogenéticas y estructurales se requiere una nueva enzima para sintetizarlo a partir en las consideraciones teóricas de Serebrosky (1938). de las especies, lo cual llevó a contextualizar la evolución en de moléculas disponibles; esta nueva enzima poseerá la Tras la duplicación de genes, mientras una copia términos moleculares y genéticos. capacidad para interactuar con dichas moléculas. Sin emcontinúa realizando su misma función, la otra puede Con esto, se concluyó que los procesos evolutivos no se bargo, su mecanismo de acción no necesariamente estará modificarse mediante mutaciones para “asignar” restringen únicamente a las especies en cuanto a caracterelacionado con la primera enzima. una función diferente al producto que sintetiza. Esto rísticas fenotípicas se refiere, sino que abarcan los diferentes Esta postura es sumamente interesante y guarda cierpuede conferir una ventaja selectiva para el organisplanos de organización estructural de los organismos. De tal ta secuencia lógica, si se analiza en un cierto contexto la mo en cuestión, evidenciando una máxima evolutiva: forma, órganos, tejidos, genes y proteínas se han modificado Tierra primitiva, ya que en un pasado remoto los únicos el surgimiento de una gran diversidad, a partir de esa lo largo del tiempo. Esto ha sido un factor importante para compuestos disponibles eran biomoléculas ya formadas; tructuras preexistentes; la frase de Milne Edwards la explicar los cambios macroevolutivos en términos de pasos los primeros organismos utilizaron estas moléculas como naturaleza es prodiga en variedad, pero tacaña en inmicroevolutivos. novación, podría adquirir una connotación más amplia si se contempla este aspecto de la evolución. DUPLICACIÓN DE GENES Y EVOLUCIÓN DE NUEVAS FUNCIONES Como se mencionó con anterioridad, se ha establecido que la redundancia génica es un primer paso en la creación de genes con propiedades catalíticas y estructurales diferentes a los establecidos por un primer homólogo. Pues bien, tras una duplicación, pueden presentarse los siguientes escenarios: Figura 2. Todos los seres vivos presentan las mismas cuatro Pseudogenización: ocurre cuando hay pérdida bases nitrogenadas como parte constitutiva de su genoma, lo de función del gen duplicado, ya sea porque acumuló cual muestra una evidencia sólida de una diversificación en la que todos los organismos, como dijera Darwin, se encuentran mutaciones sobre su región codificante o regulatoria o “dentro de la misma red”. Las similitudes y diferencias de porque hay un silenciamiento debido a su localización nucleótidos que puedan presentar dos especies distintas, pueden telomérica. emparentarlas o alejarlas filogenéticamente. Subfuncionalización: ambos genes resultan ser necesarios para llevar a cabo la función original, deDUPLICACIÓN DE GENES, DETERMINANTE bido a que han acumulado mutaciones ya sea sobre su EN LA EVOLUCIÓN MOLECULAR región codificante, regulatoria, ambas, o simplemente En 1965, Zuckerkandl y Pauling propusieron que enzimas Figura 5. La duplicación génica puede estar relacionada con la reduplicación de vías metabólicas. Se observan dos enzimas que del su patrón de expresión es diferente, dependiendo lacionadas respecto a su catálisis o rutas metabólicas podían catalizan pasos sucesivos en la biosíntesis de un metabolito contexto metabólico en el cual se encuentra el orgaestar emparentadas filogenéticamente y, por consiguiente, en particular, las cuales, después de duplicarse, realizan la nismo en cuestión. pudieron haber evolucionado a partir de proteínas ancestramisma catálisis, pero la especificidad por el sustrato cambia; los primeros pasos en la biosíntesis de leucina y lisina sugierenque un Duplicación por dosis génica: después de una les. Dicha hipótesis adquirió una gran relevancia, y posteriorposible duplicación de este tipo. organismo haya presentado una aneuploidía o polimente se convirtió en una herramienta imprescindible en los ploidía, la carga metabólica hacia la síntesis de eleanálisis filogenéticos. concentraciones pequeñas de genes, tenían cantidades mentos tiene que repartirse entre las nuevas copias, También en 1965, Horowitz amplía su teoría de la evolimitadas de enzimas; para contrarrestar esta disposición como un efecto amortiguador ante dicho aumento de lución retrógrada, y manifiesta que las retrógrada, que Figura 3. Modelo de Horowitz, de evolución enzimas pueden evolimitada de enzimas, enzimas “primitivas” debieron de ilustra la formación de vías la duplicación genética, por retención genes, o simplemente el excedente de un producto relucionar después de metabólicas. poseer una amplia especificidad en la captación de sustrasulta ser una ventaja. de su especificidad al sustrato y modificación de sus capacitos; es decir, la formación fortuita de metabolitos ofreció parte fundamental de su metabolismo heterótrofo. Un tercer aspecto concerniente a los genes, el dades catalíticas. Al presentarse un decremento de las mismas, lo obvio a esas células ancestrales una gran flexibilidad bioquímica cual resulta ser controversial, es el de la NeofuncioLas diversas posturas sobre la duplicación de genes y su sería considerar que en vez de generar todos los pasos con un mínimo contenido de genes. Estas enzimas fueron nalización, según la cual un gen duplicado cambia lo importancia en la evolución molecular encontraron eco en los de una ruta metabólica para la síntesis de compuestos re- altamente inespecíficas y tenían una gran capacidad de suficiente como para presentar una nueva función trabajos de Ohno (1970) según el cual, la duplicación genética queridos, los organismos utilizaran los precursores más catalizar reacciones químicas similares en diferentes vías completamente diferente a la del gen del cual proviene es el mecanismo principal en la innovación de genes y de funinmediatos para formar la última reacción requerida en metabólicas (Figura 4). (Figura 3). Sin embargo, tal cambio puede impedir una ciones asociadas a sus productos. Las hipótesis de Horowitz y de Jensen son compledicha síntesis (Figura 3). correcta asociación entre el gen que se neofuncionamentarias, y responden a tiempos evolutivos diferentes; lizó y su ancestro, ya que la cantidad de cambios sobre RELEVANCIA DE LA DUPLICACIÓN GÉNICA en el caso de la primera, hay una gran cantidad de ejemHIPÓTESIS DEL MOSAISISMO su secuencia imposibilita un análisis filogenético entre La preponderancia de la duplicación génica adquirió relevanOtro de los argumentos importantes en la evolución y el plos donde enzimas adyacentes presentan homologías; dichos genes y, por lo tanto, una relación evolutiva. cia una vez que existieron metodologías moleculares que surgimiento de las vías metabólicas fue propuesto por tales enzimas homólogas conforman las denominadas supermitieron la caracterización específica de los genes; esto Jensen en 1976, denominado hipótesis del mosaisismo prafamilias, que se encuentran ligadas metabólicamente, NUEVAS ESTRUCTURAS TOPOLÓGICAS llevó a la comprensión sobre la relación entre los tipos de du(Patchwork), según el cual, células ancestrales, al poseer mientras que la segunda manifiesta un claro ejemplo de Por otra parte, además de los diferentes derroteros plicación y el ADN, tales como: duplicación de genes parcial

Figura 4. Hipótesis de Jensen. Enzimas ancestrales eran capaces

62

42

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

cáncer de piel [15]. Similarmente, los individuos que se IMPLICACIONES DE LA PIGMENTACIÓN lo que ha ocurrido con una gran diversidad de familias de queman fácilmente y que no se broncean tienen mayor PARA LA SALUD PÚBLICA proteínas. riesgo de cáncer de piel que los individuos con otros tipos En la sección anterior resumí las principales hipótesis evoCualquiera que sea el argumento utilizado para definir de piel. lutivas que han sido presentadas para explicar la distribula evolución de las vías metabólicas, algo patente es que ción de la pigmentación en poblaciones humanas. Aunque las enzimas evolucionan a través de procesos donde la caPIGMENTACIÓN OSCURA existen todavía algunos debates en relación con los factopacidad catalítica permanece inalterable, mientras la espeE INSUFICIENCIA DE VITAMINA D res selectivos involucrados, se acepta generalmente que cificidad por los sustratos es modificada. Pudiese existir La síntesis de vitamina D a través de la exposición de la la fuerte asociación entre la latitud y la pigmentación en otro punto de partida que apunta al surgimiento de las piel a la luz solar es la fuente más abundante de vitamina humanos es principalmente resultado de la acción de la vías metabólicas, asociado con la duplicación de genes, la D para la mayoría de la gente [8]. Dadas las propiedades selección natural que promueve la adaptación de las pooligomerización y hetero-oligomerización de sus producde la melanina como un filtro natural de la UVR, no es blaciones humanas a las condiciones del ambiente natutos. sorpresa que la cantidad de melanina esté inversamente ral (en particular a la incidencia de UVR), un proceso que relacionada con la producción de vitamina D en la piel. probablemente tomó cientos de generaciones. DUPLICACIÓN DE GENES De acuerdo con Holick et alii [8], una persona con piel Sin embargo, como consecuencia de las migraciones Jensen, al igual que Horowitz, pone de manifiesto la imoscura requiere al menos 10 veces más exposición a la humanas recientes, muchos individuos viven ahora en portancia de la duplicación de genes y asegura que basta luz solar que una persona con piel clara para producir la regiones geográficas con diferentes condiciones ambienuna nueva enzima -producto de una duplicación- para que misma cantidad de vitamina D en su piel. Por lo tanto, la tales a las que imperaban cuando la población evolucionó. a la postre pueda instaurarse una nueva vía metabólica. síntesis de vitamina D puede obstruirse con cantidades Debido al importante papel que la pigmentación juega en Existe evidencia que sugiere que, paralelamente a la grandes de melanina, particularmente bajo condiciones de la fotoprotección y la síntesis de la vitamina D, estas miduplicación de genes, pueden existir también duplicacioexposición limitada a la UVR. Tal es el caso en las regiograciones recientes tienen implicaciones importantes en la nes de vías metabólicas. Los casos relacionados con la biones de alta latitud, en donde no existe suficiente UVR para salud pública: individuos de piel clara tienen mayor riessíntesis de leucina y lisina por un lado y de histidina y sintetizar la vitamina D durante un periodo sustancial del go de cáncer de piel, particularmente en regiones con triptófano por otro son una muestra de ello (Figura 5). año. alta incidencia de UVR, e individuos de piel oscura que Investigaciones recientes indican que existe una inciviven en regiones de alta latitud tienen mayor riesgo de CONSIDERACIONES dencia sorprendentemente alta de deficiencia de vitaenfermedades generadas por la deficiencia o insuficienIndependientemente del origen de la vida y la instauración mina D en países de alta latitud, aun entre individuos cia del nivel de vitamina D. Estos asuntos se discuten en de diversas vías metabólicas a lo largo de la evolución, de piel clara. Sin embargo, la incidencia de insuficiencia la siguiente sección. existe un punto de coincidencia en todas las especies que de vitamina D es mayor en grupos poblacionales con altos las hermana químicamente: un origen en común que se niveles promedio de melanina. PIGMENTACIÓN CLARA Y AUMENTO mantiene vigente y que, oculto a simple vista, relata poco La actual epidemia de insuficiencia de vitamina D es DEL RIESGO DE CÁNCER DE PIEL a poco una historia molecular cuyo fin está ligado al fin de relevancia en la salud pública, no sólo por el bien conoLa mayoría de los efectos dañinos de la luz solar (p.e. erde la existencia misma… cido efecto de la vitamina D en el metabolismo óseo, sino itema y daño al ADN) provienen de la exposición a lontambién por su papel importante en la protección contra gitudes de onda UV. Las melaninas son un bloqueador muchas condiciones crónicas. Aparentemente, niveles natural de la luz solar, particularmente en el espectro UV, adecuados de vitamina D son importantes no sólo para por lo que no es sorprendente que el riesgo de desarrollar protección contra el raquitismo, la osteomalacia u osteocáncer en la piel está fuertemente relacionado con el color porosis, sino también para la protección contra varios tide la piel [14]. pos de cáncer (p.e. cáncer de seno, colon y próstata); enLa incidencia del cáncer en la piel y la mortalidad por fermedades autoinmunes (p.e. artritis reumatoide, lupus el cáncer de piel se correlacionan fuertemente con la latiHorowitz, N. H. (1945). “On the evolution of eritematoso sistémico, esclerosis múltiple); enfermedades tud, y ambas disminuyen lejos del ecuador. Además, en la cardiovasculares e infecciones microbianas (p.e. tubercumisma biochemical syntheses.” Proc Natl de piel es mayor latitud, la incidencia del cáncer Acad Sci U S A 31: 153-7. losis) [8,16,17] en poblaciones de piel clara que en poblaciones de piel oscura.Jensen, R. A. (1976). “Enzyme recruitment in que En ningún otro lugar esto es más evidente evolution of new function.” Annu Rev Microbiol de CONCLUSIONES en Australia, el país con mayor incidencia de cáncer 30: 409-25. He revisado nuestro entendimiento actual de la evolupiel del mundo. ción de la base genética de la pigmentación de nuestra Esto se aplica tanto Antonio. El de piel de la vida: Lazcano-Araujo, al cáncer origen no-melanoma evolución química y evolución biológica. 3a ed. especie. La pigmentación muestra una notable diversidad (carcinoma de células basales y carcinoma de células esMéxico. al de melanoma maligno. La incidencia de en poblaciones humanas, y en este sentido es un rasgo camosas) como Trillas. 2007. atípico; numerosos estudios genéticos han indicado que estos tres tiposI. A.cáncer en de la vida. cerca de 10 veces Oparin, de El origen la piel es Grijalbo. México. la proporción promedio de variación genética debida a las 1968. mayor en Australia (particularmente en las regiones del diferencias entre los principales grupos continentales es norte, tales como Queensland y el Territorio Norte) que en Panno, J. THE CELL: Evolution of the First sólo de 10-15 por ciento del total de la variación genética. el norte de Europa. Se ha estimado E.U.A. 2005. cada dos que uno de Organism. Facts On File. Inc. En contraste, la pigmentación cutánea muestra grandes australianos desarrollará alguna forma de cáncer de piel diferencias entre las poblaciones continentales. La razón durante su vida (http://www.cancercouncil.com.au/) de esta discrepancia puede ser explicada principalmente Sin embargo, el cáncer de piel afecta en forma despropor la gran influencia de la selección natural, la cual ha porcionada a los individuos de piel clara, y los aborígenes conformado la distribución de la pigmentación de acuerdo australianos tienen una incidencia mucho menor de esta a un claro gradiente latitudinal. Es erróneo, por lo tanto, enfermedad. Un estudio reciente ha indicado que la pigsuponer que las grandes diferencias observadas en la pigmentación constitutiva está asociada con el riesgo de

REFERENCIAS

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

43

63

mentación cutánea pueden ser extrapoladas a la mayoría o la presión arterial, y esto proporciona una oportunidad de los rasgos humanos. De hecho, rasgos que han sido única para estudiar interacciones gen-gen sin el efecto de fuertemente conformados por la selección natural son no- factores ambientales que confunden la situación. 3) La toriamente inapropiados para descifrar relaciones entre pigmentación es relevante desde la perspectiva de la las poblaciones. Clasificaciones basadas en rasgos sujetos salud pública, por su papel crítico en la fotoprotección y a una fuerte selección natural reflejan los factores ambien- la síntesis de la vitamina D. Nuestro entendimiento de los genes involucrados en tales subyacentes. En este caso particular, una clasificación derivada de la variación normal de la pigmentación ha aumentado la pigmentación cutánea principalmente captura las dife- considerablemente en los últimos cinco años, y estudios rencias de exposición a la UVR entre las poblaciones, y recientes han identificado algunos genes candidatos que muestra muy pobre concordancia con las clasificaciones muestran clara evidencia de selección natural y por lo basadas en marcadores neutrales, los cuales son las he- tanto pueden ser funcionalmente importantes en la pigrramientas apropiadas que se utilizan para mapear la his- mentación. A la velocidad actual de los descubrimientos, la prótoria humana. Es por lo tanto desafortunado decir que la pigmen- xima década esclarecerá muchos de los vacíos que quedan tación haya sido un rasgo omnipresente en las clasificacio- en nuestro conocimiento de la arquitectura genética y la nes “raciales” que explican de modo inadecuado la diver- historia evolutiva de este fascinante rasgo. sidad observada en la especie humana. El estudio de los genes responsables de la diversidad de la pigmentación RECONOCIMIENTOS: humana pone de manifiesto la naturaleza tipo mosaico de EJP posee apoyo para la investigación del Consejo Canadiense para la Investigación de las Ciencias Naturales y la variación genética. Nuestro genoma está compuesto de miríadas de seg- la Ingeniería (NSERC), de la Fundación Canadiense para la mentos con diferentes patrones de variación e historias Innovación (CFI), el Fondo para la Innovación de Ontario evolutivas. Debido al reciente origen de nuestra especie, la (OIT) y el Premio de Investigación Temprana (ERA) del Gomayoría de los segmentos muestran pequeñas diferen- bierno de Ontario. cias entre poblaciones humanas, pero algunas regiones genómicas, particularmente aquéllas bajo la influencia de la selección natural, se separan considerablemente del patrón promedio del genoma humano y muestran mayores diferencias entre poblaciones. [1] Barsh GS. 2003. PLoS Biol. 1:19-22. Esas regiones genómicas probablemente jugaron un [2] Relethford JH. 2002. Am. J. Phys. Anthropol. papel clave en el proceso de adaptación de las poblaciones o neutras y aceptaron la selección natural como el prin118:393-398. humanas a los diferentes ambientes, y también podrían [3] Tishkoff SA, Kidd como fuerza que orienta la cipal mecanismo evolutivo y KK. 2004. Nat. Genet. 36 (11 Suppl):S21-S27. explicar algunas de las diferencias poblacionales que han evolución, sin negar el papel que juegan otros procesos [4] Sturm RA, Frudakis TN. 2004. Trends Genet. sido descritas en los riesgos de enfermedad o en el mecomos la deriva genética, por ejemplo. La selección natuRosaura Ruiz Gutiérrez 20:327-332. tabolismo de fármacos. Por lo tanto, en la misma forma [5] Robins AH. 1991. Biological reproducción diferal puede definirse como el proceso de perspectives on que es erróneo extrapolar los patrones de variación obserde variantes genéticos alternativos. n este artículo se revisan dos de las polémicas re- rencial human pigmentation. Cambridge University Press: Cambridge, New York. vados en los rasgos superficiales, tales como la pigmenPor [6] Jablonski espacio, me referiré en particular a cuestión de NG. 2004. Annu. Rev. Anthropol. cientes más relevantes que han surgido en torno al tación al resto del genoma, es incorrecto sugerir, basados darwinismo, visto desde la llamada teoría sintética, las críticas derivadas de los planteamientos del equilibrio 33:585-623. en el marco genómico “promedio” que la variación entre [7] Jablonski NG, Chaplin G. 2000. J. dichos cuesque articula la teoría darwinista con las explicaciones puntuado y del neutralismo. Considero que Hum. Evol. 39:57-106 poblaciones humanas es irrelevante. modernas sobre la herencia iniciadas por Mendel. La sín- tionamientos constituyen retos para la teoría sintética que [8] Holick MF. 2003. J. Cell. Biochem. 88:296-307. En mi opinión, es paradójico que en el Siglo 21 y con el tesis moderna, como también se conoce a la teoría sinté- merecen ser tomados1871. Thepero no son los únicos. [9] Darwin C. en serio, descent of man. Murray: proyecto del genoma humano ya finalizado, tengamos un London. tica de la evolución, se inició con los trabajos de Ronald conocimiento tan incompleto sobre la base genética de la [10] PUNTUADO A. Fisher (1890-1962), J.B.S. Haldane (1892-1964) y Sewal EQUILIBRIOAoki K. 2002. Ann. Hum. Biol. 29:589-608. [11] Diamond J. 1991. The rise and fall of the pigmentación de los ojos, el cabello y la piel. Hay muchas Wright (1889-1988) que entre los años veinte y treinta del Con respecto a la teoría Radius: equilibrios puntuados o third chimpanzee. de los London. razones por las cuales elucidar la base genética y la histointermitentes, la controversia 1965. Health. 11:691-694. siglo pasado dieron inicio a la genética de poblaciones. [12] Wassermann HP. central se refiere a su planria evolutiva de la pigmentación es importante. 1) [13] Post PW, Daniels F, Binford RT. 1975. Hum. Una segunda etapa de la constitución de la teoría sin- teamiento de que microevolución y macroevolución no Biol. 39:131-143. La pigmentación es un rasgo que debería ser usado tética fue guiada por los trabajos del genetista Theodo- están acopladas. (Véase Gould, 2002). Desde la teoría sin[14] Rees JL. 2004. Am. J. Hum. Genet. 75:739-51. como ejemplo de los problemas que se pueden derivar sius Dobzhansky (1900-1975), el paleontólogo George G. tética se considera que los 2002. Am. J. Epidemiol. [15] Dwyer T et al. procesos microevolutivos -que Doctora de una interpretación simplista de la variación humana, y 155:614-621. Simpson y el sistemático y taxónomo Ernst Mayr (1904- producen cambios en las poblaciones y pueden o no llevar Rosaura Ruiz para educar al público en general sobre la importancia de [16] nuevas M, Cross HS. 2005. Eur. J. Clin Invest. Gutiérrez 2004). Los tres últimos, apoyados en los conocimientos al origen dePeterlik variedades o de nuevas especies- dan 35:290-304. estudiar la variación utilizando un enfoque evolutivo en Secretaria de los Giovannucci E. 2005. Cancer producen camde sus antecesores y conjuntamente con otros especialis- lugar a [17] procesos macroevolutivos queCauses Control Desarrollo lugar de tipológico. 2) La pigmentación puede ser muy útil categorías tas, definieron como tesis centrales del evolucionismo bios en16:83-95. arriba del género. En este sentido, la Institucional / para entender la arquitectura genética de rasgos comple[18] Hollis la evolución es 2006. Canadian mo-derno el surgimiento de las variaciones hereditarias teoría sintética de BW, Wagner CL.capaz de dar cuenta de UNAM Medical Association Journal 174:1287-1290. jos. Presidenta de la como eventos al azar en el sentido de que no tienen di- ambos procesos, estableciendo como la diferencia central La pigmentación de las áreas no expuestas de la piel Academia rección con respecto a los problemas del organismo; es entre micro y macroevolución el que los principales meMexicana de (pigmentación constitutiva) está relativamente poco decir, las variaciones no son adaptativas en sí mismas; en canismos evolutivos, como selección natural, mutación, Ciencias afectada por las influencias ambientales cuando se comrelación con el ambiente, pueden ser positivas, negativas, deriva genética y recombinación, tienen distintos grados rosaura@unam.mx para con otros rasgos complejos, tales como la diabetes

La teoría sintética de laREFERENCIAS evolución y sus críticos

E

60

44

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO
vitamina D [8]. La vitamina D juega un papel clave en el de acción y los huesos, y su deficiencia produce rametabolismo dede peso específico en micro y en macroevolución. quitismo en los niños y osteomelacia en los adultos. En Esta polémica han reconocido otras se basa en la la viaños recientes, se con la Teoría Sintética funciones de dualidad del D (Figura 3), incluyendo es puesto en duda por y hipótamina proceso evolutivo, el cual la inmunorregulación la la tesis de los diferenciación y la proliferación celular. regulación de laequilibrios puntuados. Como otras polémicas en evolución, de la su desarrollo, en gran parte, a partir de La hipótesis tiene vitamina D explica la distribución una problemática que surge al analizar los procesos que moderna de la pigmentación humana, como resultado de caracterizan la selección natural En este caso, proun balance entrea los sistemas vivos.que favorece la se trata del sentido que se les da términos destrucción del tección contra las quemaduras solares y lacomo gradualismo y en regiones y lo que se entiende por tasas rápidas folatoconstancia, con alta exposición a UVR, y la selección o quelentas enla pigmentación clara en regiones lejanas del en favorece evolución. Esto parece llevar a diferencias tiempos y modos la evolución, vitamina D. ecuador para facilitaren síntesis de siendo que se trata fundamentalmente de un asunto de orden semántico. Una persona de piel oscura requiere al menos 10 A partir de interpretaciones diferentes persona veces mayor exposición a la luz solar que unade un registro fósil, paleontólogos modernos llegan a conclusiones de piel clara para producir la misma cantidad de vitaun [8]. Esto sugiere que individuos con la más oscumina Dtanto distintas. Algunos cuestionanpielinterpretación de Darwin y de Simpson del para sintetizar vitamina ra estarían en desventaja selectiva registro fósil, en relación a que muestra baja UVR. Es posible que el mecanismo D en regiones de huecos que son consecuencia, sobre todo, de tendencias en el proceso de fosilización y de fallas selectivo más importante fuera el efecto bien conocido de en su estudio. Sostienen que, por de los huesos y el dela vitamina D sobre el crecimiento el contrario, los vados del registro se deben a que la evolución morfológica ocurre sarrollo. frecuentemente de manera abrupta, precedida y sucedida Sin embargo, es importante hacer notar que investigapor largos periodos con poco o ningún cambio. ciones realizadas en la última década indican claramente Es decir, se cree que va más allá de registro fósil que el papel de la vitamina Dlas brechas del la homeosta- no son calcio. Los creados, porque no hubo fosilización, sino sis del artefactos receptores de la vitamina D están preque son resultado de la forma en que se da el origen sentes en el riñón, los queratinocitos, los osteoblastos, los de las especies. No T y B, qué esperar formas intermedias, linfocitos activados hay porlas células beta del páncreas, dado que éstas apenas existieron. En esta concepción, el intestino delgado, la próstata, el colon, y la mayoría deuna nueva especie surge de una población marginal, separada los órganos del cuerpo (incluyendo el cerebro, el corazón, geográficamente la la progenitora. la piel, las gónadas, de próstata y el busto), y la vitamina D juega un papel importante en la prevención de enferFÓSILES VIVIENTES medades autoinmunes, el control de patógenos invasores y laLos llamados fósiles vivientes, diferenciación carece de regulación del crecimiento y la cuya historia de las cambio estructural (estasis), por ejemplo los linajes, recélulas [8]. presentan casos típicos, aun cuando son especialmente largos. La teoría SELECCIÓN SEXUAL del equilibrio puntuado defiende que la evolución ocurre en dos sexual podría ser la responLa idea de que la selecciónetapas: una rápida, en la que surge una la variación del color de la lugar la mayoría de sable denueva especie, cuando tienen piel tiene una larga los cambios morfológicos (especiación), y una subsecuente, historia. En el libro El descenso del hombre, Charles Darwin en que las diferencias observadas para algunas carac[9] dijola que los cambios son virtualmente inexistentes (estasis). En consecuencia, esta teoría rechaza que podrían terísticas humanas, incluyendo la pigmentación, la evolución ser sea gradual. de la selección sexual. el resultado La Teoría Sintética mantiene, por el contrario, que De hecho, existe evidencia que indica que la pigmen- las etapas un criterio importante para la selección de la tación es sin cambio se deben no a que no haya evolución, sino a que la selección natural está a varios autores a pareja en los humanos, lo cual condujofavoreciendo una forma que ha selección un nivel sido un factor imporpostular que la alcanzado sexual ha alto de adaptación (selección equilibradora, Dobzhansky, 1937, Williams, 1992). tante de la distribución no sólo de la piel, sino también del Por lo tanto, los ojos en los apareciendo 11]. pelo y el color de aunque siguen humanos [10, variantes en el nivel genético,la selección natural y la selección sexual Por supuesto, no hay cambios morfológicos. Los puntualistas no niegan que pueda ocurrir la evolución gradual no son mutuamente excluyentes, y es posible que ambas ni conformado las distribuciones actuales de la pighayan los gradualistas rechazan que pueda haber eventos de especiación rápida; en ambos casos primarios o como mentación humana, ya sea como factores se mantieneseproceso raro el adverso de cada teoría. cundarios. Esta posibilidad ha sido sugerida por varios auEl debate es sobre la más énfasis la que ocurren tores, aunque algunos ponenfrecuencia enen la selección la evolución filética selección sexual un papelespeciación. En natural y asignan a la y los eventos rápidos de secundario [7], la resolución de esta controversia poco ha ayudado el tramientras que otros creen que la selección sexual posee bajo más prominente [11]. se cerrar es sobre todo un papel empírico. Como antesParaseñala, esta sección, esuna polémica conceptual, teórica. hipótesis empíricos no necesario mencionar que hay otrasLos datos para explicar la resuelven, pues, tal como se han encontrado hasta ahora,

sorbe UVR, sería grandemente ventajosa, mientras que la piel clara, sujeta a quemaduras solares, daño a las glándulas sudoríparas e infecciones, sería desfavorecida por la selección natural. También es bien conocido que la exposición al sol por tiempo prolongado puede generar cáncer en la piel cuando la UVR daña los genes que normalmente inhiben el crecimiento canceroso. Existe evidencia que indica que existen diferencias importantes en el riesgo de cáncer de piel, dependiendo del tipo. La piel oscura es mucho menos susceptible a este tipo de cáncer. PROTECCIÓN CONTRA LA FOTÓLISIS DE LOS NUTRIENTES La luz solar, particularmente la radiación ultravioleta, no solamente es dañina para la piel de los humanos, sino que también puede afectar a algunos nutrientes esenciales, particularmente al folato. El folato es necesario para la síntesis y la reparación del ADN, y la deficiencia de folato puede generar complicaciones durante el embarazo y una multitud de anormalidades fetales, incluyendo los defectos en el tubo neural, tales como la espina bífida y la anencefalia. La deficiencia de folato fue una causa importante de mortalidad perinatal y posnatal en algunas poblaciones antes de la introducción de suplementos preventivos [7]. El folato también juega un papel clave en la espermatogénesis. Central a esta discusión es el hecho de que el folato es extremadamente sensible a la UVR [7]. Esto sugiere que en áreas geográficas con altos niveles de UVR, individuos de piel clara sufrirán más de deficiencia de folato que aquéllos con piel oscura. Debido al papel importante del folato en varios procesos biológicos clave, es probable que el mantenimiento de los niveles óptimos de folato ha estado bajo la influencia de la selección natural. Es importante mencionar que las dos hipótesis descritas anteriormente son compatibles y, ya sea individualmente o combinadamente, pueden explicar la pigmentación oscura rica en eumelanina observada en regiones con alta incidencia de UVR. Sin embargo, esas hipótesis son insuficientes para explicar la distribución geográfica global de la pigmentación cutánea (Figura 2). Para explicar la fuerte correlación entre la pigmentación cutánea con la latitud (o con la UVR), es necesario clarificar los factores evolutivos responsables de la reducción de la pigmentación de la piel en las regiones con poca UVR. En la siguiente sección, sumarizo las dos hipótesis más importantes. LA MELANINA Y LA SÍNTESIS DE VITAMINA D Aun cuando los efectos de la UVR sobre la piel son generalmente dañinos, hay una excepción importante: la radiación UVR es esencial para la síntesis de vitamina D en la piel. Aunque algunas fuentes nutritivas tienen cantidades sustanciales de vitamina D (particularmente el pescado graso y el aceite de pescado, la yema de huevo y las carnes de los órganos) la síntesis cutánea es la principal fuente de

CONOCIMIENTO CONOCIMIENTO
son susceptibles de las dos explicaciones. Un caso interesante es el depósito fosilífero de moluscos del lago Turkana, que primero se consideró una evidencia contundente a favor del puntualismo (Williamson, 1981) y después se presentó como un proceso que tuvo lugar en 50 mil generaciones (Williamson, 1985), un proceso no rápido ni mucho menos (véase, Hoffman, 1989). Por otro lado, la interpretación de Williamson (1981) de que el registro de Turkana puede ser considerado evidencia a favor del equilibrio puntuado, es cuestionable, pues, por ejemplo, se ha mostrado que lo que él consideró especies diferentes -un punto central en la polémica, pues para apoyar la tesis del equilibrio puntuado, Williamson (1981) interpreta el registro como resultado del surgimiento de nuevas especie, iniciado por aislamiento peripátrico y subsecuente estasis- pueden ser sólo variedades resultantes de la adaptación a condiciones cambiantes, tal como se ha observado en las especies vivientes (véase Collingridge y Earthy, 1990).

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

45

61

EVOLUCIÓN GRADUAL O PUNTUAL En este sentido, la discusión fundamental es si el registro fósil evidencia en mayor proporción evolución gradual o evolución puntual. Sin embargo, cuando se encuentra un registro continuo con cambios graduales, se trata de demostrar que hubo un proceso de evolución gradual, pero si hay vados, no es fácil saber si así fue el proceso o si hay faltantes. Otro aspecto que critican los puntualistas es la su- rivados en la exposición de su teoría, los puntualistas puesta preeminencia de la selección natural en todos los especialmente en los inicios de su planteamiento- tienen niveles evolutivos. Eldredge (1995) considera una “extra- mucho en común con corrientes saltacionistas. El pareFigura 3. Órganos y tejidos capaces de sintetizar la forma activa polación innecesaria” el extender el modelo darwiniano de cido, es obvio, se debe1,25(OH2)D, que muestran sus múltiples de la vitamina D, a que ambos grupos cuestionan la la distribución de la pigmentación de la piel. Por ejemplo, papeles fisiológicos. Fuente: Hollis and Wagner [18]. cambio evolutivo de generación en generación a la evolu- gradualidad de la evolución. De hecho, la mayor parte de Wasserman [12] relacionó la pigmentación oscura de la ción en el tiempo geológico. El punto, afirma Eldredge, es sus lectores afines o de sus críticos (por ejemplo, Delsol, piel con la resistencia a las infecciones bacterianas, paraque la selección natural es ante todo un filtro y no un 1991) los han caracterizado como tales, de manera que sitarias y virales, y Post et alii [13] sugirieron que la delas más recientes presentaciones de la concepción punagente que moldea los organismos en tiempo. Dada la herencia poligénica de la pigmentación, y la pigmentación de la piel podría generar resistencia al daño Esta crítica, como la anterior, es conceptual. ¿Qué en- tualista donde Gould y Eldredge rechazan el calificativo de complejidad del sistema pigmentario, no es sorprendente por el frío. tiende Eldredge por “moldear”? Cuando afirma que la se- saltacionistas, aún no logra la repercusión que tuvo la verque haya sido muy complicado identificar los genes responlección natural es una y que no puede moldear, lo dice sión anterior, en la que, por ejemplo, Gould (1985) habló sables de la variación de la pigmentación de la piel, el caBASE GENÉTICA DE LA VARIACIÓN como si la selección natural eliminara o moldeara pero, de reivindicar la noción de “monstruo esperanzado” de bello y el iris. NORMAL DE LA PIGMENTACIÓN por más seleccionista que sea un evolucionista, todos sa- Goldschmidt o cuando ambos señalaron su acuerdo con el Sin embargo, la situación ha cambiado drásticamente A pesar de los adelantos recientes en nuestro conocimienbemos que la selección natural sólo puede actuar elimi- saltacionismo de Huxley (Gould, 1985). to del sistema pigmentario, y de la importancia fisiológica en la última década, y varios genes han sido asociados Eldredge (1982, 1995, 1998) utiliza incluso los términando organismos, dejándolos vivos y favoreciendo su y evolutiva de la pigmentación, nuestro conocimiento de con la variación natural de la pigmentación, incluyendo nos “aparición brusca o súbita” y “sin transición”, que en reproducción. las bases genéticas de la variación normal de la pigmen- genes que regulan la síntesis de las diferentes formas Cuando se dice que la selección moldea o diseña los cualquier concepción significan salto: “Esta noción está tación en humanos es muy incompleto [1]. La pigmentación de la melanina (eumelanina vs feomelanina), tales como organismos, se da por sentado que lo hace al dejar pasar basada en la observación, conocida desde mucho antes de las áreas no expuestas de la piel (pigmentación consti- los genes MC1R y ASIP, genes que codifican proteínas unos organismos y eliminar otros; es decir, actúa como por los paleontólogos, de que cada especie nueva aparece tutiva) es bastante estable durante la vida de un individuo que se expresan dentro de los melanosomas, tales como filtro. Aunque se haga hincapié en la eliminación, no pue- bruscamente en las secuencias fósiles, para despu é s p e r y no cambia mucho debido a factores ambientales [5]. La SLC24A5, MATP, TYR y OCA2, y otros genes reguladores de negarse que, al eliminar a unos, deja vivos a otros y m a n ecer inalterada por grandes periodos (de 5 a 10 mipigmentación constitutiva es un rasgo poligénico, pero importantes tales como KITLG. que éstos transmiten sus características a la siguiente llones de años). Después, una especie dada es reemplazada Es interesante mencionar que análisis realizados soel número de genes y la naturaleza exacta de las gene-ración. En este sentido, la selección natural va “mol- por otra bruscamente, sin transición, por otra” (cursivas variantes alélicas que determinan el contenido de mela- bre el genoma han indicado que muchos genes de la pigdeando” un carácter, va dejando vivos a los organismos nuestras). men-tación han sido fuertemente influenciados por la senina permanecen poco conocidos. cuyo carácter es más adecuado a cada momento. Es éste Investigaciones en los desórdenes de la pigmentación lección natural. Estos datos preliminares apuntan hacia un el sentido que tiene la noción de la selección como fuerza GRADUALISMO Y SALTACIONISMO humana, tales como el albinismo, combinadas con estudios marco complejo en donde la selección positiva ha actuado creadora, pues en tanto puede favorecer la reproducción de Como antes se señala, uno de los problemas al hablar de de la pigmentación en modelos animales, han aumentado en diferentes lugares del genoma, y para algunos genes algunos organismos en vez de otros, puede generar nove- gradualismo y saltacionismo es, como en otras polémicas considerablemente nuestro conocimiento sobre el sistema solamente en ciertos grupos poblacionales. dades genéticas adaptativas que sin su acción serían con- en evolución y biología, de carácter semántico. El límite Estos resultados ilustran la historia evolutiva compleja pigmentario y han generado un nuevo entendimiento de exacto entre lo que es gradual y lo que es saltacional es siderablemente improbables (Ayala, 1997). las diferentes trayectorias que guían la producción y regu- de la pigmentación de la piel en poblaciones humanas, la Aunque nunca han utilizado la palabra “salto” o sus de- difícil de definir. En general, se habla de salto en morcual estamos sólo empezando a entender. lación de la melanina.

58

46

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

yoría de los marcadores genéticos. En el año 2002, Relethlos queratinocitos eventualmente migran a las capas suimpredecibles del comportamiento de las entidades del fología cuando no hay evidencia de la existencia de un ford [2] estimó que el 88 por ciento del total de la variaperiores de la epidermis. Dentro de los queratinocitos, los nivel inmediato inferior. Sin embargo, lo que los puntuaestado intermedio entre dos estados de un carácter. Evición en la pigmentación de la piel puede ser explicado por melanosomas se encuentran agregados en torno al núcleo, listas han hecho hasta ahora es mostrar que los diferentes dentemente, la ausencia de tal estado intermedio puede las diferencias de la pigmentación entre los principales y proporcionan protección contra los efectos dañinos de mecanismos evolutivos (selección, deriva, recombinación, interpretarse como que nunca ha existido. Ésta se debe a grupos geográficos. Este valor contrasta con el que se ha los rayos ultravioleta. etcétera) actúan de manera diferenciada en los distintos una interpretación saltacionista, o simplemente a que no descrito en numerosos estudios genéticos autosómicos, En el cabello, los melanocitos también transfieren meniveles. Por ejemplo, aceptan -con los neutralistas- que en se ha encontrado evidencia de que haya existido. Eldredge los cuales indican que para un marcador genético promelanosomas a queratinocitos, que a su vez migran y se difeel nivel molecular hay determinada preponderancia de la (1989) ha aclarado que los modelos de transformación dio en los humanos, la variación entre los principales grurencian para formar el tallo del cabello. En contraste con la deriva genética y un papel mínimo para la selección natumorfológica de tipo saltacional comparten la característipos geográficos típicamente explica sólo entre 10 y 15 por piel y el cabello, en el iris los melanosomas se encuentran ral, igual que en la evolución cladogenética. ca de considerar que los cambios de gran escala ocurren ciento de la diversidad total [3]. únicamente dentro de los melanocitos, y el tipo de melaPara Gould, la jerarquía depende de la individuacomo eventos de un solo paso. Las extinciones masivas, Claramente, la pigmentación de la piel muestra una nina y la densidad y distribución de los melanosomas lización, pues cada nivel debe estar basado en entidades señala, no pueden ser explicadas por los agentes normales distribución atípica, especialmente considerando el orison los principales determinantes del color de los ojos. suficientemente estables para adquirir características en tanto que “rompen el continuo causal que requiere el gen reciente de los humanos anatómicamente moderAunque existen diferencias en la densidad de melaevolutivas propias. El equilibrio puntuado defiende que sentido uniformitarista de Darwin”. nos (ca 200,000 años). La Figura 2 muestra la distribución nocitos en función del lugar en el cuerpo, la variación en las especies son individualidades legítimas y, por lo tanto, Otro aspecto es la idea de reconstrucción jerárquica global de la pigmentación de la piel, basada en el mapa del el número de melanocitos no parece ser el principal faccapaces de desplegar propiedades irreductibles, emerde la teoría de la selección natural. Es un tema central, geógrafo italiano Renato Biasutti. El color de la piel tiende tor responsable de las diferencias de pigmentación entre gentes, pero no ha podido mostrar la existencia de tales en tanto que Gould sostiene la necesidad de teorización a ser más oscuro en las áreas ecuatoriales y tropicales las poblaciones humanas. Más bien, las diferencias en pigpropiedades. de los fenómenos que estudia la paleontología, fenóme(áfrica Subsahariana, Asia del Sur, Australia y Melanesia) mentación se deben a dos factores importantes: la cantiMás recientemente (1995), Gould señaló que el punnos, por definición, macroevolutivos. En este sentido, que en las áreas alejadas del ecuador. dad y el tipo de melanina sintetizada en los melanocitos, y tualismo se relaciona con la reforma “posmoderna”, que considera indispensable la elaboración de una teoría de la El factor subyacente que explica esta importante rela forma y la distribución de los melanosomas (Figura 1). resalta los temas del pluralismo, la causalidad de niveles selección natural, como un proceso más general que tralación entre la pigmentación cutánea y la latitud parece La piel con poca pigmentación es rica en las formas múltiples, las virtudes de la complejidad, la individualidad baja de manera simultánea en objetos biológicos en los ser la intensidad de radiación ultravioleta (UVR), la cual es más claras de la melanina (eumelanina café y feomelaniy el juego, a diferencia del modernismo, que atribuye a la diferentes niveles de una jerarquía genealógica: mayor en el ecuador y disminuye progresivamente al aunas amarillo/rojo), y los melanosomas tienden a ser menos teoría sintética y que, de acuerdo con él, se caracteriza por “Puesto que muchos de los niveles reconocidos rementar la latitud. Los datos disponibles indican con claripigmentados, de menor tamaño y empacados en grupos. una idea universal de reducción a principios de niveles cientemente son intrínsecamente macroevolutivos (selecdad que la distribución de la pigmentación cutánea en la La piel más oscura tiene más melanina, enriquecida con inferiores y por su énfasis en lo simple, abstracto y unición de especies, selección de clados y algunas más de especie humana ha sido grandemente influenciada por los las formas más oscuras de la melanina. Adicionalmente, versal. selección interdémica), y puesto que sus caminos y moniveles de UVR. Discutiré este hecho en más detalle en la los melanosomas de los individuos de piel oscura son más El punto medular en contra de este planteamiento es dos son distintos de la selección natural en individuos, la próxima sección, que está dedicada a la evolución de la pigmentados, más grandes y distribuidos en unidades aisque, tal como son conocidos actualmente, los procesos miteoría jerárquica también asegura un espacio teórico para pigmentación cutánea en los humanos. ladas [1]. croevolutivos son compatibles con los modelos de macrola macroevolución y sus bases paleontólogicas” (Gould, evolución -puntualismo y gradualismo-. Del conocimiento 1995). Como otras concepciones, el puntualismo se ha ido DISTRIBUCIÓN DE LA PIGMENTACIÓN de la 1. Diferencias de población en patrones de tamaño transformando. En sus primeros artículos sobre el equi- Figuramicroevolución, no se puede inferir cuál de esos dos EN POBLACIONES HUMANAS y distribución de melanosomas en la piel. Reproducida de patrones macroevolutivos prevalece, en el color de la librio puntuado, Gould declaró que el darwinismo estaba Barsh, 2003. ¿Qué controla la variación ni obtener respuesLa distribución de la pigmentación de la piel difiere de la tas humana? PLoS Biology 1:19-22, con permiso de PLoS muerto y que se requería una nueva síntesis. En trabajos piel para muchos otros temas macroevolutivos distintivos, observada en otras características fenotípicas y en la matales como la evolución morfológica, patrones de extinmás recientes, Gould precisa que más que la teoría sinté- Biology. tica en general, se trata de lo que él llama “ultradarwinismo”, a cuyos defensores identifica como fundamentalistas contrarios al pluralismo que él, como Darwin, defiende. Coyne y Charlesworth (1996 y 1997) también se refieren a la transformación del equilibrio puntuado, aunque su punto de vista es más crítico: “Para que una teoría científica tenga valor en la exploración del mundo real, debe tener cierta estabilidad como un conjunto de proposiciones abiertas a la comprobación empírica. EI equilibrio puntuado ha sufrido tantas transformaciones, que es difícil distinguir su núcleo de verdad de la “afirmación de que la evolución morfológica a veces ocurre episódicamente”. JERARQUÍAS EN EVOLUCIÓN El equilibrio puntuado sostiene mecanismos de evolución distintos para los diferentes niveles evolutivos (a cada nivel correspondería una unidad de evolución: moléculas, incluidos los genes, organismos, poblaciones y especies), como una necesidad del mundo empírico, no metodológica. De ahí que se precisen jerarquías en evolución. Según Gould, el punto de vista contrario es reduccionista. Igualmente, ha señalado que para hablar de jerarquías en evolución; es decir, de mecanismos distintos para diferentes niveles de evolución, se requiere la emergencia de propiedades

CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES

47

ción de especies y factores históricos que regulan la diversidad taxonómica. En conclusión, los procesos macroevolutivos están cubiertos por fenómenos microevolutivos y son compatibles con teorías microevolutivas, pero los estudios al respecto requieren la formulación de hipótesis y modelos autónomos (que deberían ser contrastados usando evidencia macroevolutiva). En el sentido epistemológico, es fundamental que la macroevolución sea vista desacoplada de la microevolución; es decir, la macroevolución es un campo autónomo del estudio evolutivo. TEORÍA NEUTRALISTA O DE EVOLUCIÓN MOLECULAR AL AZAR Una de las críticas a la teoría sintética proviene de estudios de la evolución en el nivel molecular. La llamada teoría neutralista de la evolución sostiene que la inmensa mayoría del cambio molecular es adaptativamente neutro; es decir, que las nuevas variantes no son ni más ni menos adaptadas que las preexistentes; por lo tanto, son selectivamente neutras. Como desde el punto de vista funcional las variantes son equivalentes, la selección natural no podría actuar favoreciendo a unas sobre otras. En consecuencia, otra fuerza distinta debería ser la que gobernara el cambio. En concreto, el neutralismo propone que la mutación genética y la deriva genética al azar son las fuerzas fundamentales en el proceso de cambio molecular. (Véase Álvarez-Valin, 2002.) De acuerdo con esta visión, la selección jugaría un papel muy importante al eliminar las variantes deletéreas (selección negativa), pero la fijación de variantes be-neficiosas mediante selección natural seria un evento muy poco frecuente. Una evidencia en favor de que las sustituciones selectivamente neutras son predominantes en muchos genes, la ofrece la siguiente observación: cuando alineamos y comparamos las secuencias proteicas o de ADN entre genes homólogos provenientes de distintas especies, podemos observar que existen zonas más conservadas (de nulo cambio) y zonas más divergentes. Las zonas conservadas coinciden con los aminoácidos funcionalmente importantes, como lo demuestran varios estudios de mutaciones. Ciertamente, se conoce la secuencia nucleotídica de las versiones mutantes de varios alelos que producen alteraciones genéticas, tanto en el hombre como en otros organismos. Dichas mutaciones se ubican, en su inmensa mayoría, en las regiones del gen que se encuentran evolutivamente conservadas, indicando entonces que tales aminoácidos son funcionalmente importantes, pues las mutaciones que sufren dan lugar a alelos deletéreos. CUESTIONAMIENTOS A LA TEORÍA NEUTRALISTA Existen diversos cuestionamientos a la validez de la teoría neutralista. Por ejemplo, al poner a prueba la hipótesis del reloj molecular, se ha visto que las variaciones en las tasas de evolución molecular son significativamente más grandes de lo que se esperaba con base en la teoría neutral. Es decir, las diferencias entre las tasas de sustitución de aminoácidos en diferentes proteínas son demasiado grandes como para hacer válido un promedio y decir que dicha tasa es una constante.

56

48

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

MÉTODOS FILOGENÉTICOS A partir de otro tipo de pruebas, se han revelado difeDE RECONSTRUCCIÓN rencias significativas entre la cantidad de polimorfismo Aplicando el modelo evolutivo especifico que explique genético encontrado en poblaciones de determinada eslas sustituciones de aminoácidos observada en un alineapecie, y la cantidad predicha por la teoría. Pero sus demiento múltiple de secuencias; es decir, la comparación fensores argumentan que esas diferencias pueden ser exmasiva de varias secuencias, podemos calcular la distancia plicadas modificando la teoría, asumiendo, por ejemplo, evolutiva entre pares de moléculas. La distancia evolutiva que los alelos no son estrictamente neutrales, sino que sus es el reflejo del número promedio de cambios por sitio diferencias en valor selectivo son muy pequeñas. Siendo que han ocurrido entre dos secuencias que divergieron de así, la teoría neutralista provee una “hipótesis nula” o punun ancestro común, cuando utilizamos métodos de disto de partida para medir la evolución molecular. tancia (Neighbor Joining). La tesis fundamental del neutralismo es, según Una aproximación distinta para hacer estas inferenKimura y Ohta (1971, 1987), que el cambio evolutivo cias son los métodos de Máxima Verosimilitud, que en en el nivel molecular, esto es, en el material genético esencia son métodos probabilísticos que utilizan las Camismo, se debe a la fijación de mutantes selectivamente denas Ocultas de Markov y los algoritmos de Monte Carlo, neutros o casi neutros, más que a la selección positiva para hacer una búsqueda más precisa de la mutación que darwiniana (Kimura, 1979, 1987). El primer artículo en debió haber ocurrido en cada reconstrucción. Además, el que se expusieron este tipo de ideas fue el de Kimura existen los métodos de Máxima Parsimonia, los cuales re(1968). En 1969, apareció “Non-Darwi-nian evolution” en el construyen las topologías con el menor número posible de que J. L. King y T. H. Jukes midieron la tasa de sustitución pasos que expliquen las diferencias. de aminoácidos en siete proteínas. Según sus cálculos, esta tasa es de 0.33 X 10-10 en insuRELOJ MOLECULAR lina a 4.29 X 10-9 en fibrinopéptido A; a partir de ahí llegaEn otro aspecto, y hablando de proteína, Zuckerkandl y ron a conclusiones similares a las de Kimura (1968) respecto Pauling revelaron en varios experimentos que la variación a que, en evolución molecular, la selección natural no es la en la composición de las proteínas era demasiado grande principal fuerza, sino la deriva genética. La única difereny uniformemente espaciado en el tiempo para ser explicia, afirma Kimura, es que King y Jukes no destacan la imcado sólo por la selección natural. Las observaciones en el portancia del mantenimiento del polimorfismo proteico, número de sustituciones de aminoácidos en la hemoglo- todo el mundo. La sistemática y la taxonomía microbiolo cual, según él, es fundamental para la teoría. bina fueron proporcionales a los tiempos de divergencias lógica son dos de las áreas que se han visto fuertemente Los hallazgos más destacados que, de acuerdo con filogenéticas construidas de las secuencias que fueron influenciadas por la evolución molecular, cuyos estudios los neutralistas, dan apoyo a su teoría son: 1) para una calibradas con registros fósiles. Estos estudios sirvieron han permitido la clasificación de especies, aun sin tener proteína determinada, la tasa de sustitución de un amial microorganismo cultivado, y han favorecido la reclasifide base para la hipótesis del reloj molecular. noácido por otro es aproximadamente igual en muchas Smith y Margoliash ampliaron esta hipótesis, utili- cación de especies con problemas en su taxonomía. líneas filogenéticas distintas; 2) estas sustituciones, en zando el análisis de la citocromo C. Ambos estudios convez de seguir un modelo, parecen ocurrir al azar; 3) la cuerdan bastante bien con las diferencias encontradas en tasa total de cambio a nivel de ADN es muy alto, del la evidencia paleontológica. Esto significa que en cada orden de la sustitución de por lo menos una base nucleoproteína la tasa de sustitución (cantidad de sustituciotídica por genoma cada dos años, en una línea evolutiva nes por residuo aminoacídico por unidad de tiempo) es de mamíferos. constante. Desde un punto de vista de la genética de poblaciones, Diferentes proteínas pueden presentar diferente limiel proceso de evolución consiste en una serie de sustitutación a variar (limitación funcional); es decir, pueden ciones génicas. Para cada sustitución génica, un alelo mupresentar diferente tolerancia a los cambios aminoacíditante que es inicialmente raro, incrementa su frecuencia cos. En aquellas proteínas con gran limitación funcional, y se extiende a la población (especie) entera, alcanzando la mayoría de cambios alteran la función proteica y disfinalmente el estado de fijación (Kimura y Ohta, 1971). minuyen la eficacia biológica de los individuos portadores. La concepción de evolución como sustitución de genes, En contraposición, en aquellas proteínas con menor limio secuencias nucleotídicas, se origina con Ronald A. Fisher, tación funcional, la proporción de cambios aminoacídicos que demostró matemáticamente que en un locus con dos que alteran la función es menor. Las proteínas con mayor alelos, si la selección favorece uno de los homócigos, el limitación funcional tienen una menor tasa de mutación gene alternativo será eliminado, y si la selección favorece neutra y, por lo tanto, una menor tasa de sustitución. al heterócigo, se dan las condiciones para un equilibrio Me gustaría terminar con una frase de Theodosius estable y ambos alelos permanecen en el acervo. En este Dobzhansky quien afirmaba: Nada en biología tiene sensentido, la evolución para Fisher es estrictamente adaptatido excepto a la luz de la evolución. Actualmente, el más tiva y fuerzas estocásticas, como la deriva genética, dessimple de los análisis evolutivos utiliza la comparación empeñan un papel secundario. de secuencias entre especies, para determinar la función biológica de una nueva secuencia. Más aún, muchos y POSTURAS DIVERGENTES diferentes son los conceptos de evolución molecular o de Fisher, uno de los fundadores de la genética de poblareconstrucción filogenética que hoy se utilizan con maciones, y los neutralistas, aparentemente sostienen ideas yor o menor conocimiento en los diversos laboratorios en similares sobre el proceso de evolución. Otro pionero en

CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES

49

la materia, Sewall Wright, (1931, 1932, 1982) difiere de Fisher en Éste y en otros aspectos. Desde su punto de vista, la deriva genética es tan importante en la evolución como la selección natural. Las implicaciones de cada postura conducen a planteamientos evolucionistas muy diferentes. Para Fisher, la selección natural es el mecanismo fundamental que provoca el cambio en las frecuencias génicas, dirigiendo así el proceso de evolución, mientras entiende a la mutación como un mecanismo que también cambia las frecuencias génicas, pero que no da orientación. La mutación es un proceso estocástico; la selección es un proceso determinístico que conduce necesariamente a la adaptación (Fisher, 1930). Ayala (1977) ha precisado la significación del determinismo de la selección natural: “Primero, la selección natural es un proceso dirigido hacia un fin cuyo resultado es el incremento de la eficiencia reproductiva. La adecuación reproductiva es, entonces, el resultado u objetivo de la selección natural. Segundo, la selección natural [...] produce y mantiene órganos y procesos dirigidos hacia un fin, cuando las funciones o los estados finales realizados por el órgano o el proceso, contribuyen a la adecuación reproductiva del organismo. Sin embargo, el proceso de selección natural no es determinístico en un sentido diferente. No tiende de ninguna manera hacia la producción de tipos específicos de organismos ni hacia organismos que tengan ciertas propiedades específicas.” La discrepancia de Kimura y Ohta con el neodarwinismo radica en la afirmación de que la evolución es un proceso dirigido por la selección natural, que elige entre aptos y no aptos. Ellos trataron de demostrar que, por lo menos en el nivel molecular, es la deriva genética la que conduce la evolución. Se trata de un evento aleatorio que no está determinado por tendencias adaptativas. Ésta es la polémica con los seleccionistas. Por seleccionismo se entiende la defensa de la selección natural como única fuerza evolutiva que dirige la evolución. La mayor parte de quienes sostienen la teoría sintética no son seleccionistas, en tanto que admiten que la deriva genética también participa de manera importante en la evolución. Sin embargo, ésta y otras polémicas en evolucionismo se refieren sobre todo a un problema de frecuencias. Ni los neutralistas niegan que en el nivel molecular puede haber selección darwiniana positiva, ni los seleccionistas que la deriva genética desempeña un papel significativo. El problema central radica en la importancia para cada una de estas fuerzas. La evidencia presentada por los seguidores de esta teoría es consistente con la hipótesis de que procesos no aleatorios están involucrados en la evolución de las proteínas; sin embargo, también hay pruebas directas que corroboran la participación de la selección natural de la variación proteica. La selección natural aparece como el proceso no aleatorio que dirige la evolución de las proteínas, de manera similar a lo que ocurre en la evolución de las características morfológicas, funcionales y del desarrollo de los organismos.

REFERENCIAS
Alvarez-Valin (2002) Neutral Theory, en Encyclopedia of Evolution. Pp 815-821. Oxford University Press. Ayala, F.J., (1977), “Protein Evolution in Different Species: Is it a Random Process?, en Molecular Evolution and Polymorphism, publicado por M. Kimura, Mishima Japón, pp. 93-102. (1997), La teoría de la evolución. De Darwin a los últimos avances de la genética, Bolsistemas, Madrid Collingridge, D. y M. Earthy, (1990), Science Under StressCrisis in Neo-Darwinism, Hist. Phil. Life Sci., 12:3-26 Coyne, J.A. y B. Charlesworth, (1996), “Mechanisms of punctuated evolution”, Science, 274:1748-1749 (1997), “Response (to Eldredge and Gould, 1997)”, Science, 276: 113-122 Delsol, M., (1991), L’Evolution biologique en vingt propostions, Vrin, París Dobzhansky, Th., (1937), Genetics and the Origin of Species, Columbia Biological Series Eldredge, N., (1982), “La macroevolution”, La recherché, 13 (133):616-626 (1989) Macroevolutionary Dynamics: Species, Niches and Adaptive Peaks. McGraw Hill, New York. Japanese edition: McGraw Hill Publishing Co., Japan, Ltd. (1995), Reinventing Darwin: The Great Debate at the High Table of Evolutionary Theory, John Wiley (1998), “Life in the Balance”, Natural History, June 1998:48-55 Fisher, R.A., (1930), The Genetical Theory of Natural Selection, Oxford University Press Gould, S.J., (1985), “La naturaleza del cambio episódico”, en El pulgar del panda, Biblioteca de la Divulgación Científica, Ed. Orbis, España (1995), “Can we complete Darwin’s Revolution?” en Dinosaur in a Haystack, Harmony Books, New York, pp.125-144 (2002) The Structure of Evolutionary Theory. Belknap, Harvard, USA Hoffman, A. (1989). Arguments on evolution, a paleontologists perspective. Oxford University. New York. US. Kimura, M., (1968), “Evolutionary rate at the molecular level”, Nature, Londres, 217:624-626 (1979), “The neutral theory of molecular evolution”, Scientific American, 241 (5):94-104 (1987), The neutral theory of molecular evolution, Cambridge, Cambridge University Press Kimura, M. y Ohta, T., (1971), Theoretical Aspects of Population Genetics, Princeton, Princeton University Press King, J.L. y T.H. Jukes, (1969), “Non Darwinian evolution”, Science, 164:788-798 Williams, G.C., (1992), Adaptation and Natural Selection, Princeton, Princeton University Press Williamson, P.G., (1981), “Morphological stasis and developmental constraint: real problems for Neodarwinism”, Nature, 297:214-215 (1985), “Punctuated equilibrium, morphological stasis and the paleontological documentation of speciation: a reply to Fryer, Greenwood and Peake’s critique of the Turkana Basin mollusk sequence”, Biol. J. Linn. Soc., 26:307-324 Wright, S., (1931), “Evolution in Mendelian populations”, Genetics, 16:97-159 (1932), “The roles of mutation, inbreeding, crossbreeding and selection in evolution”, Proceedings of the Sixth International Congress of Genetics, 1:356-366 (1982), “Character change, speciation and the higher taxa”, Evolution, 36:427-443

54

50

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO
las poblaciones, generalmente a costa de otros genes y a pesar de ser deletéreos para la especie. Un ejemplo de éstos son las duplicaciones de los cromosomas denominados cromosomas supernumerarios, accesorios o cromosomas B, evento que se ha denominado parasitismo intragenómico. Estos elementos tienen una historia evolutiva y procesos de diferenciación totalmente distintos a la especie que los contiene. La presencia de cromosomas B ha sido descrita en más de mil 300 especies de plantas, en casi 500 especies de animales y en varias especies de hongos. Éstos suelen tener efectos notorios en el fenotipo de de la comunidad de estudiosos de la biología, particulas especies. larmente en Norteamérica. Pero, dado que en su presenAlgunos científicos piensan que la estructura de los tación y desarrollo recurre a las ecuaciones de difusión de genes en exones e intrones de los genomas de eucariotes calor, modificadas por su autor, lentamente fue ganando y algunos procariotes pueden ser el resultado de duplicael aprecio de los genetistas, debido a sus posibilidades exciones de los genes ancestrales, posiblemente con un solo perimentales. Sin embargo, las discrepancias continuaron exón y la subsiguiente combinación de un solo gen de las presentes. Uno de los aspectos que la teoría neutralista copias diferentes de estos genes iniciales intenta explicar es el de los llamados polimorfismos proteicos (diferencias específicas en las proteínas de cada inVARIABILIDAD GENÉTICA dividuo, aun dentro de una misma especie), un concepto Por otro lado, Weisman fue el primero en comprender clave para explicar la especificidad biológica, que es la el extraordinario poder de la recombinación sexual para base de la biodiversidad incluso entre individuos de la producir variabilidad genética. Sin embargo, existen otros misma especie. procesos moleculares capaces de incrementar la variabiLa especificidad biológica está dada por los cambios lidad de las especies, como son la conjugación, la transen las cadenas de ADN que a su vez determinan cambios posición, la transducción, la capsducción y, por supuesto, en la secuencia de aminoácidos, lo cual suele afectar a la la transformación, en donde se adquiere material genéproteína resultante. En ocasiones, estos cambios resultan tico exógeno que posteriormente es incluido en el genoma perjudiciales, pero en muchos casos lo que sucede es que de su nuevo portador. las proteínas resultantes son equivalentes pues continúan siendo funcionales y esto explica en parte la diferencia entre individuos. RECOMBINACIÓN DE GENES Las dificultades en el empleo de órganos y tejidos de donadores para ser implantados en un sujeto receptor están relacionadas con la especificidad individual explicable a través de los procesos de la deriva genética en el nivel molecular, además de los mecanismos conocidos de recombinación de genes traídos por el proceso de la formación de células sexuales y la reproducción sexual en donde se lleva a efecto la llamada recombinación de genes.

FUENTES DE LA VARIACIÓN GENÉTICA Podemos mencionar ahora que cualquier cambio en el material genético que surge en un gameto o en un genoma, se considera una mutación. Los errores en el proceso de copia del ácido nucleico, que resultan en el cambio de un nucleótido por otro, se denominan sustitución nucleotídica, y pueden ser de dos tipos: 1) transversiones y 2) transiciones, si se cambia o no la base púrica del nucleótido. Debido a la degeneración del código genético, esta sustitución puede dar lugar, o no, a un cambio de aminoácido. Si la sustitución no cambia, el aminoácido se denomina sustitución sinómina. Por el contrario, si se cambia el aminoácido, hablaremos de una sustitución no sinómina o de reemplazo. Cuando se cambia un solo par de bases o pocas bases, hablamos de mutaciones puntuales, que a su vez pueden ser: delecciones, si se elimina la base, o inserciones, cuando se adiciona. Este tipo de mutaciones son especialmente nocivas para la especie, porque pueden modificar el marco de lectura de la proteína, generando proteínas sin actividad biológica o pueden no producir la proteína. Las mutaciones que afectan cantidades mayores de material genético y que son observables al microscopio óptico son delecciones, inserciones o translocaciones de fracciones de cromosomas, y, en algunos casos, duplicación o multiplicación de cromosomas completos. Los genomas pueden albergar una enorme variedad de elementos genéticos, cuya principal función es procurar su propia transmisión, y multiplicarse en los genomas y en
Genetista japonés Motoo Kimura.

La teoría neutralista de la evolución molecular

David Eduardo González Femat

Maestro David Eduardo González Femat Profesor de cátedra / ITESM Candidato a doctor por la Universidad Complutense de Madrid, España dadd25@gmail. com

a teoría neutralista de la evolución molecular se debe al genetista japonés Motoo Kimura (1924-1994). Fue presentada por primera vez en occidente, por este influyente biólogo matemático, en 1968, en la prestigiada revista Nature. En su versión original, la teoría neutralista de la evolución molecular se opone a la teoría sintética del neo-darwinismo encabezada por el biólogo T. Dobzhansky, en los E. U. A. La teoría neutralista afirma que, en el campo molecular, es más importante la llamada deriva genética al azar1 como mecanismo por medio del cual se acumulan mutaciones o cambios en las unidades (nucleótidos) de la cadena del ADN. Kimura descubrió que la tasa de sustitución de nucleótidos es alta en mamíferos y otros grupos, y se eleva hasta en un par de nucleótidos cada dos años. La teoría sintética o neo-darwinista, como se la conoce también, fue creada durante las primeras décadas del siglo XX y afirma que la selección natural es más importante que la deriva genética al azar, pues en principio sería difícil aceptar que los genes neutros permanezcan como genes equivalentes sin que necesariamente confieran ventajas adaptativas a los individuos portadores. POCA ACEPTACIÓN INICIAL La teoría neutralista, en sus inicios, a fines de la década de los años sesenta, obtuvo muy mala recepción por parte

L

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

51

55

El polimorfismo es explicado por la teoría neutralista, Algunos de estos mecanismos son exclusivos de los admitiendo que, una vez que los genes se han difundido procariotes y otros se pueden presentar en ambos tipos en una población, la selección natural darwiniana actúa celulares. Podríamos agregar la transferencia horizontal y sobre los individuos promoviendo a todos aquéllos que la simbiosis como otras formas de adquirir, y por lo tanto sean portadores de ciertas ventajas adaptivas. Tales vende modificar, el material genómico de las especies y con tajas se harían patentes en el incremento en el número de ello su historia. descendientes en la población. Todas estas nuevas variantes surgidas por mutación El punto de vista que Kimura pretendía introducir, se encuentran inicialmente en un único individuo de la como una reinterpretación de la variabilidad genética, especie. Con el transcurso del tiempo, esta variante pueacorde con la evidencia experimental en los estudios de de tener una frecuencia de cero, con lo que se considera genética poblacional acerca de la evolución biológica en que se perdió, o del cien por ciento, a lo que se denomina el nivel molecular, no contemplaba rechazar el principio como fija. En algunos casos puede permanecer en la pode la selección natural, sino más bien pretendía ubicar los blación con una frecuencia intermedia, a lo que se denolímites de dominio de esta teoría conduciendo a su fortamina polimorfismo. lecimiento explicativo y, tal como Darwin lo propuso, ser Así, las mutaciones que permanecen en la población asumida como un principio capaz de actuar sobre los indi–ya sean las que se han fijado (sustituciones) o las que se viduos modelándolos como unidades. encuentran en las frecuencias intermedias-, son susceptibles de ser observadas, y son las más frecuentemente RELOJ BIOLÓGICO DE LA EVOLUCIÓN utilizadas en la reconstrucción de los eventos evolutivos La teoría neutralista propone también que los genes neude la especie. tros y aquéllos que producen cambios patentes en el fenotipo (apariencia exterior de un organismo) se difunden en rasgos se vean favorecidos en un nivel, pero seleccionados FUERZAS EXTERNAS la población con cierto ritmo. La velocidad de difusión de en otro, o que diferentes genes que afectan a una caracDEL CAMBIO MOLECULAR los genes neutros, para alcanzar fijación en una población, Cada nueva variante surgida en la especie puede afectar terística concreta reciban presiones selectivas contradicestaría dada por el tiempo necesario para que se produzca la capacidad relativa de supervivencia y reproducción del torias, como consecuencia de que se están trasmitiendo cuatro veces el grupo fértil (población eficaz) dentro de la individuo, lo que conocemos como eficacia biológica. Una en distintos niveles, por lo que en una especie podrán historia natural de esa población; recordemos que el grupo mutación se considera selectivamente ventajosa si incre- existir genes que son afectados por la selección natural, fértil resulta ser más pequeño que el total de la población menta la eficacia del individuo portador, y selectivamente y genes neutrales. y es aquél que es capaz de enviar genes a la siguiente gedeletérea si la disminuye. Esto lo podemos observar en neración. Debido a esta razón, la teoría neutralista ha la frecuencia que tiene esta mutación o alelo en la po- CLASIFICACIÓN DE LOS ORGANISMOS sido considerada como una especie de reloj biológico La caracterización y cuantificación de la variabilidad moblación. de la evolución. Tendrá un valor de cien a cero por ciento según el lecular en las especies ha permitido utilizar este atributo El intento de Kimura y sus colaboradores habría sido caso. En caso de no afectar la eficacia biológica, la mu- como criterio de ordenación, de tal suerte que una disgenerar una hipótesis complementaria para alentar una tación es selectivamente neutra, por lo que las frecuen- posición que ha tenido mucho éxito y se ha aceptado casi reforma que permitiera incorporar el caudal de los nuevos cias de los alelos serán fluctuantes en la población y es- completamente, es la realizada por Woese y Fox, utilidescubrimientos, producto de la investigación en microtarán sujetas a la deriva génica (azar). Ficher y Haldene zando la secuencia de la subunidad pequeña que codifica biología, genética y biología molecular, estableciendo un demostraron matemáticamente cómo alelos que diferían para el ARN ribosomal de las especies. Con esta molécula límite al alcance de la selección natural y así promover el muy ligeramente en un valor selectivo, podían reempla- establecieron un arreglo que agrupa a los cinco Reinos de desarrollo de un nuevo paradigma evolutivo. la clasificación de Whitaker dentro de tres Dominios. zarse muy rápidamente en el curso de la evolución. tarde la teoría sintética o el llamado neo-darwinismo. Uno de los creadores de La sistemática filogenética basa sus ordenaciones Wright postula que las poblaciones pequeñas pueden NEODARWINISMO esta tendencia lo fue el famoso genetista y matemático Sewall Wright, quien, estructurarse en sub-poblaciones, por efecto de la deriva jerárquicas principalmente en los cambios encontrados En su momento, los representantes del neo-darwinismo junto con Ronald Fisher y J. B. S. Haldane, consolidó esta tendencia. Theodosius genética, mientras que Kimura hace hincapié en la existen- en las moléculas de ADN. Cuando se utilizan los genode la teoría sintética habrían de rechazar esta pretensión. Dobzhansky y Ernst Mayr contribuirían de manera definitiva a la consolidación cia de variación genética neutra para la selección natural. mas completos de las especies, hablamos de filogenómica Tal vez porque la inercia del pasado obró como un clima de la teoría sintética hasta la década de los años sesenta. Esto es, la teoría neutral sostiene que la inmensa mayoría como sistema especializado. Sin embargo, la comparación intelectual en aquel momento que indujo a defender nueA pesar de que la deriva genética al azar, modelo de evolución en poblaciode los cambios moleculares son adaptativamente neutros; de proteínas homólogas también puede dar información vamente al neo-darwinismo como doctrina unitaria cuya nes aisladas, fue promovida por S. Wright, si era aceptada en su enunciación es decir, que las nuevas variantes no son ni más ni menos acerca de cómo se ha producido la evolución de los orgaconstitución y ulterior desarrollo únicamente pudiera ser poblacional por los representantes de la teoría sintética, lo fue después cuando adaptadas que las variantes preexistentes; por tanto, son nismos y de las mismas proteínas. alentado desde occidente2. este modelo fue empleado, con modificaciones, por Kimura a escala molecular, Las proteínas codificadas en un genoma completo (proselectivamente neutras. De esta forma, se propone que la reivindicándolo como la principal fuerza creadora de variabilidad. Las discrepancias entre estas teorías están centradas deriva genética al azar es la fuerza fundamental en el pro- teoma), han sido utilizadas para generar clasificaciones. A pesar de todo el rechazo que esta teoría despertó en sus inicios, hoy es en la interpretación de la variabilidad genética. En El OriAsí, el estudio de las relaciones evolutivas entre secuenceso de cambio molecular. aceptada en los libros de texto, por ser un planteamiento serio y científico gen de las especies por medio de la selección natural, si cias de moléculas biológicas es una de las primeras apliacerca de la evolución molecular de las especies. Ejemplos de ello lo son la bien Darwin no incluyó una teoría genética que explicara caciones de la bioinformática. El uso de la bioinformática NIVEL DE ACCIÓN DE LA SELECCIÓN nueva interpretación acerca del sustrato genético en las razas humanas. la relación de la herencia con la selección natural, sí recoWilliams, y más tarde Dawkins, argumentaron que la se- en general y de la filogenética en particular ha permitido Con el advenimiento de la secuenciación del código genético en 2002 por noció a la variación y la herencia en los organismos como lección actúa principalmente en los genes. Dawkins, en su el estudio de la evolución de los genes y los genomas, y de Craig Venter3, hoy sabemos que la división racial humana estaba basada en tan el material sobre el que actuaría la selección natural sobre famoso libro El gen egoísta, proponía que la unidad fun- las proteínas y los proteomas de las especies. el individuo como unidad; sin embargo los trabajos de G. sólo el tres por ciento de la información genética que controla los rasgos exterioActualmente los abordajes moleculares con cantidamental de la evolución no era el individuo, sino el gen. Mendel le fueron desconocidos a pesar de ser contemporáres en que se basa la clasificación de los tres tipos básicos raciales. Actualmente se acepta que la selección actúa en diversos dades masivas de datos son muy utilizados para intenneos. El darwinismo rescatado en las primeras décadas Esta clasificación racial dejaba fuera el 97 por ciento de la información genéniveles en el proceso de cambio, evento denominado selec- tar explicar la diversidad metabólica de las especies y del siglo XX fue articulado al mendelismo para crear más tica. Si tomamos en cuenta ese 97 por ciento, nos daremos cuenta de que en ción multinivel. Ésta implica la posibilidad de que algunos entender sus procesos de divergencia y especiación.

52

52

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

Pie de Página Pie de Página
1 Modelo 1 Modelo evolucionista evolucionista introducido por introducido Sewall Wright por Sewall en los añosWright en los años treinta del siglo treinta del siglo XX para explicar XX para la dinámica explicar la dinámica genética de una genética de población una población relativamente relativamente pequeña y pequeña aislada que y aislada conduce al que conduce surgimiento al surgimiento de una raza de de una individuos. raza de individuos. 2 González 2 González Femat, D. (2002) Femat, D. Historicismo y(2002) Historicismo neopragmatismo y neopragmatismo en la dialéctica en la dialéctica de la biología de la biología contemporánea, contemporánea, p. 19 p. 19 3 Davies, K. (2002) 3 Davies, del La conquista K. (2002) La conquista genoma humano, del genoma humano, p. 77 p. 77 4 Weiner, 4 Weiner, Jonathan (2002) Jonathan (2002) El pico del El pico del pinzón. pinzón. 5 Kimura, M. 5 (1968,Kimura, M. february, (1968, february, p.626) p.626)

ocasiones existen más diferencias entre individuos de un cer una especie desarrolla un nicho ecológico (un “puesto” ocasiones existen más diferencias entre individuos de un cer una especie desarrolla un nicho ecológico (un “puesto” mismo grupo racial que entre individuos de grupos dife- en el ecosistema) similar al de otra especie, en otro ecomismo grupo racial que entre individuos de grupos dife- en el ecosistema) similar4 al de otra especie, en otro ecosistema, en un lugar distinto . 4 rentes. sistema, en un lugar distinto . rentes. APORTACIÓN DE LA TEORÍA NEUTRALISTA REIVINDICACIÓN DE LA TEORÍA NEUTRALISTA APORTACIÓN DE LA TEORÍA NEUTRALISTA REIVINDICACIÓN DE LA TEORÍA NEUTRALISTA Otra interesante aportación derivada de la influencia de Hoy es posible reivindicar la Teoría neutralista de la evoOtra interesante aportación derivada de la influencia de Hoy es posible reivindicar la Teoría neutralista de la evola teoría neutralista de la evolución molecular la podemos lución molecular y recoger las palabras de su autor al sela teoría neutralista de la evolución molecular la podemos lución molecular y recoger las palabras de su autor al seencontrar en la obra de Stephen P. Hubbell, The Unified ñalar que: encontrar en la obra de Stephen P. Hubbell, The Unified ñalar que: Neutral Theory of Biodiversity and Biogeography (La teoría “Finalmente, si mi conclusión fundamental es correcta, y Neutral Theory of Biodiversity and Biogeography (La teoría “Finalmente, si mi conclusión fundamental es correcta, y neutralista unificada de la biodiversidad y la biogeografía). si las mutaciones neutrales o casi-neutrales son producineutralista unificada de la biodiversidad y la biogeografía). si las mutaciones neutrales o casi-neutrales son produciEsta obra es el modelo análogo ecológico de la teoría neu- das en cada generación a una tasa más alta de la antes conEsta obra es el modelo análogo ecológico de la teoría neu- das en cada generación a una tasa más alta de la antes contralista de la evolución molecular de Motoo Kimura, ba- siderada, luego debemos reconocer la gran importancia tralista de la evolución molecular de Motoo Kimura, ba- siderada, luego debemos reconocer la gran importancia sada en la deriva genética al azar. Uno de los aspectos de la deriva genética al azar debida al número en poblasada en la deriva genética al azar. Uno de los aspectos de la deriva genética al azar debida al número en poblamás destacados de la teoría neutralista de Hubell es que, ciones finitas que forman la estructura genética de las más destacados de la teoría neutralista de Hubell es que, ciones finitas que forman la estructura genética de las siendo una teoría matemática en el campo de la ecología, poblaciones biológicas. El significado de la deriva genésiendo una teoría matemática en el campo de la ecología, poblaciones biológicas. El significado de la deriva genéla biogeografía y la biodiversidad, tiene como eje el con- tica al azar ha sido despreciado durante la pasada década la biogeografía y la biodiversidad, tiene como eje el con- tica al azar ha sido despreciado durante la pasada década siderar a los individuos dentro de su población como [años sesenta]. siderar a los individuos dentro de su población como [años sesenta]. sujetos equivalentes dentro de los modelos estadísticos Esta actitud ha sido influenciada por la opinión de que sujetos equivalentes dentro de los modelos estadísticos Esta actitud ha sido influenciada por la opinión de que empleados. casi no hay mutaciones neutrales, y también porque el empleados. casi no hay mutaciones neutrales, y también porque el La equivalencia asumida en términos de especies que número de individuos que forman una especie es usualLa equivalencia asumida en términos de especies que número de individuos que forman una especie es usualse suceden en diferentes regiones del mundo ya había mente elevado y el muestreo al azar de sus gametos debe se suceden en diferentes regiones del mundo ya había mente elevado y el muestreo al azar de sus gametos debe sido detectada por Darwin en las islas Galápagos. Baste ser obviado al determinarse el curso de la evolución, exsido detectada por Darwin en las islas Galápagos. Baste ser obviado al determinarse el curso de la evolución, exrecordar el ejemplo del pinzón que se alimenta de larvas cepto posiblemente a través del “principio fundante” [serecordar el ejemplo del pinzón que se alimenta de larvas cepto posiblemente a través del “principio fundante” [seextraídas de los tallos de ciertas cactáceas. Para ello, el lección natural]. extraídas de los tallos de ciertas cactáceas. Para ello, el lección natural]. pinzón desarrolla la habilidad de emplear una espina de Enfatizar el “principio fundante” pero rechazar la impinzón desarrolla la habilidad de emplear una espina de Enfatizar el “principio fundante” pero rechazar la imnopal. El paralelismo resulta interesante, pues pareciera portancia de la deriva genética al azar debido al tamaño nopal. El paralelismo resulta interesante, pues pareciera portancia de la deriva genética al azar debido al tamaño que el pinzón imitara el comportamiento del pájaro car- finito de la población es, en mi opinión, muy parecido a que el pinzón imitara el comportamiento del pájaro car- finito de la población es, en mi opinión, muy parecido a pintero de otras latitudes, que es capaz de alimentarse de asumir la existencia de un gran río para explicar la forpintero de otras latitudes, que es capaz de alimentarse de asumir la existencia de un gran río para explicar la formodo similar, pero empleando su aguda lengua, similar a mación de un profundo valle; pero rechazar un proceso modo similar, pero empleando su aguda lengua, similar a mación de un profundo valle; pero rechazar un proceso la espina de esas plantas. Es éste un fenómeno ecológico y gradual, de larga duración de erosión por agua como insula espina de esas plantas. Es éste un fenómeno ecológico y gradual, de larga duración de erosión por agua como insubiogeográfico conocido como “vicarismo”, donde al pare- ficiente para producir tal resultado”5. 5 biogeográfico conocido como “vicarismo”, donde al pare- ficiente para producir tal resultado” .

E

Crutchfield, James P. y Peter Schuster (2003) Crutchfield, James Exploring the Interplay of Evolutionary Dynamics. P. y Peter Schuster (2003) Evolutionary Dynamics. Exploring the Interplay of Selection, Accident, Neutrality, and Function. A volume Selection, Accident, Neutrality, the Function. A in the Santa Fe Institute Studies inand Sciences of volume in the Santa Fe Institute Studies in the Sciences of Complexity. Oxford, New York. Complexity. Oxford, conquista Davies, Kevin (2002) La New York. del genoma Davies, Kevin (2002) La conquista del genoma humano. CDL, Madrid. humano. CDL, Madrid. González Femat, David Eduardo (2002) Historicismo González Femat, la dialéctica de la biología y neopragmatismo enDavid Eduardo (2002) Historicismo y neopragmatismo en la dialéctica de la biología contemporánea. Tesis de grado, UCM, Madrid, contemporánea. Tesis The Unified Neutral Theory Hubell, Stephen P. (2001) de grado, UCM, Madrid, Hubell, Stephen P. (2001) The Unified Neutral Theory of Biodiversity and Biogeography. Princeton University of Princeton and Oxford, UK. Press, Biodiversity and Biogeography. Princeton University Press, Princeton and Oxford, UK. Kimura, Motoo (1990) The Neutral Theory of Kimura, Motoo Cambridge University Press, Molecular Evolution.(1990) The Neutral Theory of New Molecular Evolution. 217, February 17. York (1968) Nature,VOL.Cambridge University Press, New York (1968) Nature,VOL. 217, February Una Weiner, Jonathan (2002) El pico del pinzón. 17. Weiner, Jonathan (2002) El pico del Galaxia historia de la evolución en nuestros días.pinzón. Una historia Barcelona. Gutemberg, de la evolución en nuestros días. Galaxia Gutemberg, Barcelona.

REFERENCIAS REFERENCIAS

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

53

53

Evolución molecular Evolución molecular
Amada Torres Salazar Amada Torres Salazar a evolución molecular estudia los cambios ocurridos a evolución molecular estudia los cambios ocurridos en las moléculas, ya sean ácido nucleico o proteínas. en las moléculas, ya sean ácido nucleico o proteínas. Estos cambios se denominan mutaciones; pueden ser Estos cambios se denominan mutaciones; pueden ser percibidos en los caracteres fenotípicos de las especies; se percibidos en los caracteres fenotípicos de las especies; se acumulan a través de grandes periodos de tiempo y peracumulan a través de grandes periodos de tiempo y permiten la diversificación y formación de las especies. miten la diversificación y formación de las especies. Uno de los principales objetivos de la evolución moleUno de los principales objetivos de la evolución molecular ha sido aclarar los papeles que desempeñan la deriva cular ha sido aclarar los papeles que desempeñan la deriva y la selección en el moldeado de los patrones de cambio y la selección en el moldeado de los patrones de cambio observados de las secuencias existentes. Esta disciplina observados de las secuencias existentes. Esta disciplina permite comparar organismos tan diferentes fenotípicapermite comparar organismos tan diferentes fenotípicamente como los microorganismos, las plantas y los animente como los microorganismos, las plantas y los animales. Una excelente revisión de las técnicas de estudio de males. Una excelente revisión de las técnicas de estudio de la variación genética molecular se puede encontrar en los la variación genética molecular se puede encontrar en los trabajos de Avise. trabajos de Avise. La evolución per se ha sorteado una serie de dificulLa evolución per se ha sorteado una serie de dificultades para ser aceptada; entre ellas se encuentran el contades para ser aceptada; entre ellas se encuentran el concepto de especie, la clasificación de los organismos y la cepto de especie, la clasificación de los organismos y la fuente de la variación, por mencionar algunos. En el caso fuente de la variación, por mencionar algunos. En el caso de la evolución molecular, describiremos algunas de las de la evolución molecular, describiremos algunas de las respuestas que ha dado a estas interrogantes. respuestas que ha dado a estas interrogantes. MATERIAL GENÉTICO MOLECULAR de un codón, a lo que se denomina degeneración del códiMATERIAL GENÉTICO MOLECULAR de un codón, a lo que se denomina degeneración del códiAunque la evolución molecular estudia la variación de go genético. Los codones pueden ser utilizados de maneAunque la evolución molecular estudia la variación de go genético. Los codones pueden ser utilizados de manelas diversas moléculas de las especies, hasta la fecha es ra preferencial unos sobre otros en diferentes especies. las diversas moléculas de las especies, hasta la fecha es ra preferencial unos sobre otros en diferentes especies. la molécula de ADN la que sabemos contiene las tres En esta definición, consideraremos las secuencias de los la molécula de ADN la que sabemos contiene las tres En esta definición, consideraremos las secuencias de los propiedades necesarias para ser considerada como la plásmidos, los transposones, los pseudogenes e intrones propiedades necesarias para ser considerada como la plásmidos, los transposones, los pseudogenes e intrones portadora de la información genética; esto es, presenta como parte del genoma de la especie. portadora de la información genética; esto es, presenta como parte del genoma de la especie. variabilidad. Las diferentes variables tienen diferente efiUna característica importante de la organización variabilidad. Las diferentes variables tienen diferente efiUna característica importante de la organización cacia biológica, que es heredable. genómica, y que ha generado mucha polémica, es la precacia biológica, que es heredable. genómica, y que ha generado mucha polémica, es la prePor ello, estableceremos inicialmente que el genoma sencia de zonas o regiones que difieren significativamente Por ello, estableceremos inicialmente que el genoma sencia de zonas o regiones que difieren significativamente de las especies está compuesto por los nucleótidos A, G, entre sí en la frecuencia relativa de las cuatro bases que de las especies está compuesto por los nucleótidos A, G, entre sí en la frecuencia relativa de las cuatro bases que C, T y U. Está ordenado de manera secuencial, siguiendo constituyen el ADN, en vertebrados y otros organismos. C, T y U. Está ordenado de manera secuencial, siguiendo constituyen el ADN, en vertebrados y otros organismos. un orden que contiene un mensaje. El ARN regularmente Estas regiones se han llamado “isocoros”. un orden que contiene un mensaje. El ARN regularmente Estas regiones se han llamado “isocoros”. Doctora Amada se conforma con una sola cadena que puede plegarse en Doctora Amada se conforma con una sola cadena que puede plegarse en Torres Salazar sí misma. Ésta sería la molécula traductora del mensaje CONCEPTO DE ESPECIE Torres Unidad de Salazar sí misma. Ésta sería la molécula traductora del mensaje CONCEPTO DE ESPECIE genético. Dos conclusiones del darwinismo fueron confirmadas por Unidad de Investigación genético. Dos conclusiones del darwinismo fueron confirmadas porMédica Investigación En el caso del ADN, éste está compuesto por dos cala biología molecular, y forman parte principal de la evoMédica En el caso del ADN, éste está compuesto por dos cala biología molecular, y forman parte principal de la evo-en Enfermedades denas de nucleótidos. Cada base nucleotídica se aparea lución molecular; éstas son: que todos los organismos vien Enfermedades denas de nucleótidos. Cada base nucleotídica se aparea lución molecular; éstas son: que todos los organismos vi-Infecciosas y con su contraparte en la cadena complementaría. El ADN vos compartimos el mismo código genético (ascendencia Infecciosas y con su contraparte en la cadena complementaría. El ADN vos compartimos el mismo código genético (ascendenciaParasitarias Parasitarias forma paquetes compactos denominados cromosomas, común) y que los cambios en las proteínas no afectan al Hospital de forma paquetes compactos denominados cromosomas, común) y que los cambios en las proteínas no afectan alPediatría, CMN Hospital de que se almacenan en algunos organelos celulares, como ADN. Pediatría, CMN Siglo XXI que se almacenan en algunos organelos celulares, como ADN. el núcleo, la mitocondria, los cloroplastos y los cinetoEntonces, el ADN se convirtió en la descendencia Siglo XXI el núcleo, la mitocondria, los cloroplastos y los cinetoEntonces, el ADN se convirtió en la descendenciaDepartamento de plastos de las células eucarióticas. Se encuentra libre y común, al ser compartido por casi todos los organismos Departamento de Genética plastos de las células eucarióticas. Se encuentra libre y común, al ser compartido por casi todos los organismosde Poblaciones y Genética generalmente en forma de círculo cerrado en las células vivos. Por ello, el concepto de especie más aceptado hasta de Poblaciones y generalmente en forma de círculo cerrado en las células vivos. Por ello, el concepto de especie más aceptado hastaBioinformática / procarióticas, mientras que los virus de ADN pueden conel momento, es el denominado “concepto filogenético de Bioinformática / procarióticas, mientras que los virus de ADN pueden conel momento, es el denominado “concepto filogenético deIMSS tener varios fragmentos de la cadena de forma lineal. especie”, que enuncia: los organismos emparentados comIMSS Instituto de tener varios fragmentos de la cadena de forma lineal. especie”, que enuncia: los organismos emparentados comInstituto de Cada aminoácido de una proteína está codificado por parten rasgos porque comparten antepasados. Hay orgaBiotecnología Cada aminoácido de una proteína está codificado por parten rasgos porque comparten antepasados. Hay orga-Facultad de Ciencia Biotecnología una combinación de tres nucleótidos, denominada codón. nismos que forman grupos que no pueden dividirse más. Facultad de Ciencia una combinación de tres nucleótidos, denominada codón. nismos que forman grupos que no pueden dividirse más.Biológicas / UANL. El código genético relaciona los codones con un determiSegún el concepto filogenético de especie, esos grupos son Biológicas / UANL. mandintor@yahoo. El código genético relaciona los codones con un determiSegún el concepto filogenético de especie, esos grupos son mandintor@yahoo. nado aminoácido. A cada aminoácido le corresponde más las especies: Linajes evolutivos diferenciados. com.mx nado aminoácido. A cada aminoácido le corresponde más las especies: Linajes evolutivos diferenciados. com.mx

LL

50

54

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

las poblaciones, generalmente a costa de otros genes y a FUENTES DE LA VARIACIÓN GENÉTICA Podemos mencionar ahora que cualquier cambio en el ma- pesar de ser deletéreos para la especie. Un ejemplo de éstos son las duplicaciones de los croterial genético que surge en un gameto o en un genoma, se considera una mutación. Los errores en el proceso de mosomas denominados cromosomas supernumerarios, accesorios o cromosomas B, evento que se ha denominado copia del ácido nucleico, que resultan en el cambio de un nucleótido por otro, se denominan sustitución nucleotídi- parasitismo intragenómico. Estos elementos tienen una historia evolutiva y proca, y pueden ser de dos tipos: 1) transversiones y 2) transicesos de diferenciación totalmente distintos a la especie ciones, si se cambia o no la base púrica del nucleótido. Debido a la degeneración del código genético, esta que los contiene. La presencia de cromosomas B ha sido sustitución puede dar lugar, o no, a un cambio de ami- descrita en más de mil 300 especies de plantas, en casi noácido. Si la sustitución no cambia, el aminoácido se 500 especies de animales y en varias especies de honde la comunidad de estudiosos de la biología, particudenomina sustitución sinómina. Por el contrario, si se gos. Éstos suelen tener efectos notorios en el fenotipo de larmente en Norteamérica. Pero, dado que en su presencambia el aminoácido, hablaremos de una sustitución no las especies. tación y desarrollo recurre a las ecuaciones de difusión de Algunos científicos piensan que la estructura de los sinómina o de reemplazo. calor, modificadas por su autor, lentamente fue ganando Cuando se cambia un solo par de bases o pocas bases, genes en exones e intrones de los genomas de eucariotes el aprecio de los genetistas, debido a sus posibilidades exy algunos procariotes pueden ser el resultado de duplicahablamos de mutaciones puntuales, que a su vez pueden perimentales. Sin embargo, las discrepancias continuaron ciones de los genes ancestrales, posiblemente con un solo ser: delecciones, si se elimina la base, o inserciones, cuanpresentes. Uno de los aspectos que la teoría neutralista do se adiciona. Este tipo de mutaciones son especial- exón y la subsiguiente combinación de un solo gen de las intenta explicar es el de los llamados polimorfismos promente nocivas para la especie, porque pueden modificar copias diferentes de estos genes iniciales teicos (diferencias específicas en las proteínas de cada inel marco de lectura de la proteína, generando proteínas dividuo, aun dentro de una misma especie), un concepto sin actividad biológica o pueden no producir la proteí- VARIABILIDAD GENÉTICA clave para explicar la especificidad biológica, que es la Por otro lado, Weisman fue el primero en comprender na. base de la biodiversidad incluso entre individuos de la Las mutaciones que afectan cantidades mayores de el extraordinario poder de la recombinación sexual para misma especie. material genético y que son observables al microscopio producir variabilidad genética. Sin embargo, existen otros La especificidad biológica está dada por los cambios óptico son delecciones, inserciones o translocaciones de procesos moleculares capaces de incrementar la variabien las cadenas de ADN que a su vez determinan cambios fracciones de cromosomas, y, en algunos casos, dupli- lidad de las especies, como son la conjugación, la transen la secuencia de aminoácidos, lo cual suele afectar a la cación o multiplicación de cromosomas completos. Los posición, la transducción, la capsducción y, por supuesto, proteína resultante. En ocasiones, estos cambios resultan la transformación, en donde se adquiere material genégenomas pueden albergar una enorme variedad de eleperjudiciales, pero en muchos casos lo que sucede es que tico exógeno que posteriormente es incluido en el genoma mentos genéticos, Kimura. Genetista japonés Motoo cuya principal función es procurar su las proteínas resultantes son equivalentes pues continúan de su nuevo portador. propia transmisión, y multiplicarse en los genomas y en siendo funcionales y esto explica en parte la diferencia enDavid Eduardo González Femat tre individuos. a teoría neutralista de la evolución molecular se debe al genetista japonés Motoo Kimura (1924-1994). Fue presentada por primera vez en occidente, por este influyente biólogo matemático, en 1968, en la prestigiada revista Nature. En su versión original, la teoría neutralista de la evolución molecular se opone a la teoría sintética del neo-darwinismo encabezada por el biólogo T. Dobzhansky, en los E. U. A. La teoría neutralista afirma que, en el campo molecular, es más importante la llamada deriva genética al azar1 como mecanismo por medio del cual se acumulan mutaciones o cambios en las unidades (nucleótidos) de la cadena del ADN. Kimura descubrió que la tasa de sustitución de nucleótidos es alta en mamíferos y otros grupos, y se eleva hasta en un par de nucleótidos cada dos años. La teoría sintética o neo-darwinista, como se la conoce también, fue creada durante las primeras décadas del siglo XX y afirma que la selección natural es más importante que la deriva genética al azar, pues en principio sería difícil aceptar que los genes neutros permanezcan como genes equivalentes sin que necesariamente confieran ventajas adaptativas a los individuos portadores. POCA ACEPTACIÓN INICIAL La teoría neutralista, en sus inicios, a fines de la década de los años sesenta, obtuvo muy mala recepción por parte

La teoría neutralista de la evolución molecular

L

RECOMBINACIÓN DE GENES Las dificultades en el empleo de órganos y tejidos de donadores para ser implantados en un sujeto receptor están relacionadas con la especificidad individual explicable a través de los procesos de la deriva genética en el nivel molecular, además de los mecanismos conocidos de recombinación de genes traídos por el proceso de la formación de células sexuales y la reproducción sexual en donde se lleva a efecto la llamada recombinación de genes.

Maestro David Eduardo González Femat Profesor de cátedra / ITESM Candidato a doctor por la Universidad Complutense de Madrid, España dadd25@gmail. com

CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES

55

Algunos de estos mecanismos son exclusivos de los procariotes y otros se pueden presentar en ambos tipos celulares. Podríamos agregar la transferencia horizontal y la simbiosis como otras formas de adquirir, y por lo tanto de modificar, el material genómico de las especies y con ello su historia. Todas estas nuevas variantes surgidas por mutación se encuentran inicialmente en un único individuo de la especie. Con el transcurso del tiempo, esta variante puede tener una frecuencia de cero, con lo que se considera que se perdió, o del cien por ciento, a lo que se denomina como fija. En algunos casos puede permanecer en la población con una frecuencia intermedia, a lo que se denomina polimorfismo. Así, las mutaciones que permanecen en la población –ya sean las que se han fijado (sustituciones) o las que se encuentran en las frecuencias intermedias-, son susceptibles de ser observadas, y son las más frecuentemente utilizadas en la reconstrucción de los eventos evolutivos de la especie. FUERZAS EXTERNAS DEL CAMBIO MOLECULAR Cada nueva variante surgida en la especie puede afectar la capacidad relativa de supervivencia y reproducción del individuo, lo que conocemos como eficacia biológica. Una mutación se considera selectivamente ventajosa si incrementa la eficacia del individuo portador, y selectivamente deletérea si la disminuye. Esto lo podemos observar en la frecuencia que tiene esta mutación o alelo en la población. Tendrá un valor de cien a cero por ciento según el caso. En caso de no afectar la eficacia biológica, la mutación es selectivamente neutra, por lo que las frecuencias de los alelos serán fluctuantes en la población y estarán sujetas a la deriva génica (azar). Ficher y Haldene demostraron matemáticamente cómo alelos que diferían muy ligeramente en un valor selectivo, podían reemplazarse muy rápidamente en el curso de la evolución. Wright postula que las poblaciones pequeñas pueden estructurarse en sub-poblaciones, por efecto de la deriva genética, mientras que Kimura hace hincapié en la existencia de variación genética neutra para la selección natural. Esto es, la teoría neutral sostiene que la inmensa mayoría de los cambios moleculares son adaptativamente neutros; es decir, que las nuevas variantes no son ni más ni menos adaptadas que las variantes preexistentes; por tanto, son selectivamente neutras. De esta forma, se propone que la deriva genética al azar es la fuerza fundamental en el proceso de cambio molecular. NIVEL DE ACCIÓN DE LA SELECCIÓN Williams, y más tarde Dawkins, argumentaron que la selección actúa principalmente en los genes. Dawkins, en su famoso libro El gen egoísta, proponía que la unidad fundamental de la evolución no era el individuo, sino el gen. Actualmente se acepta que la selección actúa en diversos niveles en el proceso de cambio, evento denominado selección multinivel. Ésta implica la posibilidad de que algunos rasgos se vean favorecidos en un nivel, pero seleccionados en otro, o que diferentes genes que afectan a una característica concreta reciban presiones selectivas contradictorias, como consecuencia de que se están trasmitiendo en distintos niveles, por lo que en una especie podrán existir genes que son afectados por la selección natural, y genes neutrales. CLASIFICACIÓN DE LOS ORGANISMOS La caracterización y cuantificación de la variabilidad molecular en las especies ha permitido utilizar este atributo como criterio de ordenación, de tal suerte que una disposición que ha tenido mucho éxito y se ha aceptado casi completamente, es la realizada por Woese y Fox, utilizando la secuencia de la subunidad pequeña que codifica para el ARN ribosomal de las especies. Con esta molécula establecieron un arreglo que agrupa a los cinco Reinos de la clasificación de Whitaker dentro de tres Dominios. La sistemática filogenética basa sus ordenaciones jerárquicas principalmente en los cambios encontrados en las moléculas de ADN. Cuando se utilizan los genomas completos de las especies, hablamos de filogenómica como sistema especializado. Sin embargo, la comparación de proteínas homólogas también puede dar información acerca de cómo se ha producido la evolución de los organismos y de las mismas proteínas. Las proteínas codificadas en un genoma completo (proteoma), han sido utilizadas para generar clasificaciones. Así, el estudio de las relaciones evolutivas entre secuencias de moléculas biológicas es una de las primeras aplicaciones de la bioinformática. El uso de la bioinformática en general y de la filogenética en particular ha permitido el estudio de la evolución de los genes y los genomas, y de las proteínas y los proteomas de las especies. Actualmente los abordajes moleculares con cantidades masivas de datos son muy utilizados para intentar explicar la diversidad metabólica de las especies y entender sus procesos de divergencia y especiación.

48 56

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

A partir de otro tipo de MÉTODOS FILOGENÉTICOS pruebas, se han revelado diferencias significativas entre la cantidad de polimorfismo DE RECONSTRUCCIÓN genético el modelo evolutivo especifico que explique Aplicando encontrado en poblaciones de determinada especie, y la cantidad predicha por la teoría. Pero sus delas sustituciones de aminoácidos observada en un alineafensores argumentan que esas es decir, la comparación miento múltiple de secuencias; diferencias pueden ser explicadas varias secuencias, podemos calcular la distancia masiva de modificando la teoría, asumiendo, por ejemplo, que los entre pares estrictamente neutrales, sino que sus evolutivaalelos no son de moléculas. La distancia evolutiva diferencias del número promedio de cambios por sitio es el reflejo en valor selectivo son muy pequeñas. Siendo así, la teoría neutralista provee una “hipótesis nula” o punque han ocurrido entre dos secuencias que divergieron de to de partida para medir la utilizamos métodos un ancestro común, cuandoevolución molecular. de disLa tesis fundamental del neutralismo es, según tancia (Neighbor Joining). Kimuraaproximación distinta para hacer estasevolutivo Una y Ohta (1971, 1987), que el cambio inferenen son los molecular, Máxima Verosimilitud, que en cias el nivel métodos deesto es, en el material genético mismo, se métodos probabilísticos que selectivamente esencia sondebe a la fijación de mutantesutilizan las Caneutros o casi Markov más que a la selección positiva denas Ocultas deneutros, y los algoritmos de Monte Carlo, darwiniana (Kimura, 1979, precisa de la mutación que para hacer una búsqueda más1987). El primer artículo en el que se expusieron en tipo reconstrucción. Además, debió haber ocurrido estecada de ideas fue el de Kimura (1968). En métodos de Máxima Parsimonia, los cuales reexisten los 1969, apareció “Non-Darwi-nian evolution” en el que J. L. King topologías con el menor tasa de sustitución construyen las y T. H. Jukes midieron lanúmero posible de de aminoácidos en las diferencias. pasos que expliquensiete proteínas. Según sus cálculos, esta tasa es de 0.33 X 10-10 en insu-9 lina a MOLECULAR RELOJ 4.29 X 10 en fibrinopéptido A; a partir de ahí llegaron a conclusiones hablando las de Kimura (1968) respecto En otro aspecto, y similares a de proteína, Zuckerkandl y a que, revelaron en varios experimentos que la variación Pauling en evolución molecular, la selección natural no es la principal fuerza, de las deriva genética. La única diferenen la composición sino la proteínas era demasiado grande ycia, afirma Kimura, es que King el Jukes nopara ser expliuniformemente espaciado en y tiempo destacan la importancia della selección natural. Las observaciones en el cado sólo por mantenimiento del polimorfismo proteico, lo cual, según él, es fundamental para la en la número de sustituciones de aminoácidosteoría. hemoglobina Los hallazgos más destacados que, de divergencias fueron proporcionales a los tiempos de acuerdo con los neutralistas, dan apoyo su teoría son: 1) para una filogenéticas construidas de alas secuencias que fueron proteína con registros fósiles. Estos estudios sirvieron calibradas determinada, la tasa de sustitución de un aminoácido por otro es aproximadamente igual de base para la hipótesis del reloj molecular. en muchas líneas filogenéticas distintas; 2) estas sustituciones, en Smith y Margoliash ampliaron esta hipótesis, utilivez de análisis de la citocromo C. ocurrir al azar; 3) la zando el seguir un modelo, parecenAmbos estudios contasa total de cambio a nivel de ADN encontradas del cuerdan bastante bien con las diferenciases muy alto, en orden de la paleontológica. Esto significa que en cada la evidencia sustitución de por lo menos una base nucleotídica por tasa de sustitución (cantidad línea evolutiva proteína la genoma cada dos años, en una de sustituciode por residuo nes mamíferos. aminoacídico por unidad de tiempo) es Desde constante. un punto de vista de la genética de poblaciones, el proceso de proteínas pueden presentarserie de sustituDiferentes evolución consiste en una diferente limiciones variar (limitación funcional); es decir, pueden tación agénicas. Para cada sustitución génica, un alelo mutante que es inicialmente raro, incrementa aminoacídipresentar diferente tolerancia a los cambiossu frecuencia y se extiende a la población (especie) entera, funcional, cos. En aquellas proteínas con gran limitación alcanzando finalmente el cambios fijación (Kimura y Ohta, 1971). la mayoría de estado dealteran la función proteica y disLa concepción biológica de como sustitución de genes, minuyen la eficacia de evolución los individuos portadores. o contraposición, en aquellas proteínas Ronald A. limiEn secuencias nucleotídicas, se origina concon menorFisher, que demostró matemáticamente cambios aminoacídicos tación funcional, la proporción de que en un locus con dos alelos, si la función favorece Las de los homócigos, el que alteran laselecciónes menor. uno proteínas con mayor gene alternativo será eliminado, y si la selección favorece limitación funcional tienen una menor tasa de mutación al heterócigo, tanto, las condiciones para un equilibrio neutra y, por lo se danuna menor tasa de sustitución. establegustaría terminar con una fraseelde Theodosius acervo. En este Me y ambos alelos permanecen en sentido, la quien afirmaba: Nada estrictamente adaptaDobzhanskyevolución para Fisher es en biología tiene sentiva y fuerzas luz de la evolución. Actualmente, el destido excepto a laestocásticas, como la deriva genética,más empeñan los análisis evolutivos simple de un papel secundario. utiliza la comparación de secuencias entre especies, para determinar la función POSTURAS una nueva secuencia. Más aún, muchos y biológica de DIVERGENTES Fisher, uno de los fundadores de la genética de o de diferentes son los conceptos de evolución molecularpoblaciones, y los neutralistas, que hoy se utilizan con mareconstrucción filogenética aparentemente sostienen ideas similares sobre el proceso de evolución. laboratorios en yor o menor conocimiento en los diversos Otro pioneroen

todo el mundo. La sistemática y la taxonomía microbiológica son dos de las áreas que se han visto fuertemente influenciadas por la evolución molecular, cuyos estudios han permitido la clasificación de especies, aun sin tener al microorganismo cultivado, y han favorecido la reclasificación de especies con problemas en su taxonomía.

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

57 49

la materia, Sewall Wright, (1931, 1932, 1982) difiere de Fisher en Éste y en otros aspectos. Desde su punto de vista, la deriva genética es tan importante en la evolución como la selección natural. Las implicaciones de cada postura conducen a planteamientos evolucionistas muy diferentes. Para Fisher, la selección natural es el mecanismo fundamental que provoca el cambio en las frecuencias génicas, dirigiendo así el proceso de evolución, mientras entiende a la mutación como un mecanismo que también cambia las frecuencias génicas, pero que no da orientación. La mutación es un proceso estocástico; la selección es un proceso determinístico que conduce necesariamente a la adaptación (Fisher, 1930). Ayala (1977) ha precisado la significación del determinismo de la selección natural: “Primero, la selección natural es un proceso dirigido hacia un fin cuyo resultado es el incremento de la eficiencia reproductiva. La adecuación reproductiva es, entonces, el resultado u objetivo de la selección natural. Segundo, la selección natural [...] produce y mantiene órganos y procesos dirigidos hacia un fin, cuando las funciones o los estados finales realizados por el órgano o el proceso, contribuyen a la adecuación reproductiva del organismo. Sin embargo, el proceso de selección natural no es determinístico en un sentido diferente. No tiende de ninguna manera hacia la producción de tipos específicos de organismos ni hacia organismos que tengan ciertas propiedades específicas.” La discrepancia de Kimura y Ohta con el neodarwinismo radica en la afirmación de que la evolución es un proceso dirigido por la selección natural, que elige entre aptos y no aptos. Ellos trataron de demostrar que, por lo menos en el nivel molecular, es la deriva genética la que conduce la evolución. Se trata de un evento aleatorio que no está determinado por tendencias adaptativas. Ésta es la polémica con los seleccionistas. Por seleccionismo se entiende la defensa de la selección natural como única fuerza evolutiva que dirige la evolución. Esteban J. Parra La mayor parte de quienes sostienen la teoría sintética no son seleccionistas, en tanto que admiten que la INTRODUCCIÓN deriva genética también participa de manera importante pigmentación embargo, los fenotipos más variables en laaevolución. Sin es uno de ésta y otras polémicas en en la especie humana. El color de un problema de evolucionismo se refieren sobre todo ala piel, del cabello y de los frecuencias. ojos está determinado principalmente por la melanina,neutralistas genérico utilizado niveldescribir un Ni los un término niegan que en el para molecular grupo complejo de biopolímeros sintetizados los selecpuede haber selección darwiniana positiva, nipor células especializadas conocidas como melanocitos. La evidencia cionistas que la deriva genética desempeña un papel disponible sugiere que la selección natural es responsable significativo. El problema central radica en la importancia de cada una de estas fuerzas. parala variación observada en la pigmentación, pero los factores evolutivos específicos todavía no han sido esta La evidencia presentada por los seguidores de dilucidados. consistente con la hipótesis de que procesos no teoría es Recientemente, ha habido la evolución avances en aleatorios están involucrados en importantes de las pronuestro entendimiento del sistema pigmentario, guiados teínas; sin embargo, también hay pruebas directas que principalmente por estudios en modelos animales, de la corroboran la participación de la selección natural y también por proteica. La selección natural aparece como en variación estudios de los desórdenes de la pigmentación el los humanos. En contraste, solamente estamos las proproceso no aleatorio que dirige la evolución de empezando a de manera bases a lo que de la en la evolución teínas,entender lassimilar genéticasocurre variación normal de la pigmentación morfológicas, funcionales y del desade las característicasen nuestra especie. En este artículo, revisaré rrollo de los organismos. las principales hipótesis evolu-

REFERENCIAS
Alvarez-Valin (2002) Neutral Theory, en Encyclopedia of Evolution. Pp 815-821. Oxford University Press. Ayala, F.J., (1977), “Protein Evolution in Different Species: Is it a Random Process?, en Molecular Evolution and Polymorphism, publicado por M. Kimura, Mishima Japón, pp. 93-102. (1997), La teoría de la evolución. De Darwin a los últimos avances de la genética, Bolsistemas, Madrid Collingridge, D. y M. Earthy, (1990), Science Under StressCrisis in Neo-Darwinism, Hist. Phil. Life Sci., 12:3-26 Coyne, J.A. y B. Charlesworth, (1996), “Mechanisms of punctuated evolution”, Science, 274:1748-1749 (1997), “Response (to Eldredge and Gould, 1997)”, Science, 276: 113-122 Delsol, M., (1991), L’Evolution biologique en vingt propostions, Vrin, París Dobzhansky, Th., (1937), Genetics and the Origin of Species, Columbia Biological Series Eldredge, N., (1982), “La macroevolution”, La recherché, 13 (133):616-626 (1989) Macroevolutionary Dynamics: Species, Niches and Adaptive Peaks. McGraw Hill, New York. Japanese edition: McGraw Hill Publishing Co., Japan, Ltd. (1995), Reinventing Darwin: The Great Debate at the High Table of Evolutionary Theory, John Wiley (1998), “Life in the Balance”, Natural History, June 1998:48-55 Fisher, R.A., (1930), The Genetical Theory of Natural Selection, Oxford University Press Gould, S.J., (1985), “La naturaleza del cambio episódico”, en El pulgar del panda, Biblioteca de la Divulgación Científica, Ed. Orbis, España (1995), “Can we complete Darwin’s Revolution?” en Dinosaur in a Haystack, Harmony Books, New York, pp.125-144 (2002) The Structure of Evolutionary Theory. Belknap, Harvard, USA Hoffman, A. (1989). Arguments on evolution, a paleontologists perspective. Oxford University. New York. US. Kimura, M., (1968), “Evolutionary rate at the molecular level”, Nature, Londres, 217:624-626 (1979), “The neutral theory of molecular evolution”, Scientific American, 241 (5):94-104 (1987), The neutral theory of molecular evolution, Cambridge, Cambridge University Press Kimura, M. y Ohta, T., (1971), Theoretical Aspects of tivas que se Genetics, Princeton, Princeton University Press Population han propuesto para explicar la distribución de King, J.L. y T.H. Jukes, el estado actual de nuestro conola pigmentación y (1969), “Non Darwinian evolution”, Science, 164:788-798 cimiento sobre los genes involucrados en la variación de Williams, G.C., (1992), Adaptation and Natural Selection, Princeton, Princeton University Press pigmentación en la piel, el pelo y los ojos en poblaciones Williamson, P.G., (1981), “Morphological stasis and humanas. Finalmente, dedicaré la última parte de esta redevelopmental constraint: real problems for Neodarwinism”, Nature, 297:214-215 visión a las implicaciones derivadas de la historia evolu(1985), “Punctuated equilibrium, morphological stasis tiva y la distribución geográfica de laof speciation: and the paleontological documentation pigmentación de la a en relación a la salud pública. piel reply to Fryer, Greenwood and Peake’s critique of the Turkana Basin mollusk sequence”, Biol. J. Linn. Soc., 26:307-324 Wright, S., A LA “Evolution in UN REPASO(1931), BIOLOGÍA Mendelian populations”, Genetics, 16:97-159 DE(1932), “The roles of mutation, inbreeding, crossbreeding LA PIGMENTACIÓN La and selection in evolution”, Proceedings of the Sixth piel, camelanina es el principal pigmento de nuestra International Congress of Genetics, 1:356-366 bello y ojos, aun cuando otros cromóforos, tales como la (1982), “Character change, speciation and the higher hemoglobina, juegan también un papel de menor importaxa”, Evolution, 36:427-443

Evolución de la pigmentación en la especie humana

L

tancia en dicha pigmentación. La melanina no es un compuesto único. Más bien es una mezcla de biopolímeros sintetizados en células especializadas llamadas melanocitos, las cuales están localizadas en la capa basal de la epidermis, en el bulbo capilar y en el iris. Dentro de los melanocitos, la producción de melanina se lleva a cabo en pequeñas partículas denominadas melanosomas. En la piel, los melanosomas son transferidos desde los melanocitos a otras células (queratinocitos), y

Doctor Esteban J. Parra Profesor Asociado Departamento de Antropología Universidad de Toronto Canadá esteban.parra@ utoronto.ca Traductor: doctor Juan Lauro Aguirre

46 58

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO
impredecibles del comportamiento el las entidades del yoría de los marcadores genéticos. En de año 2002, Relethnivel inmediato inferior. Sin ciento del total los puntuaford [2] estimó que el 88 por embargo, lo quede la varialistas la pigmentación de la es mostrar que los diferentes ción enhan hecho hasta ahora piel puede ser explicado por mecanismos evolutivos (selección, entre recombinación, las diferencias de la pigmentación deriva,los principales etcétera) actúan de manera diferenciada en los distintos grupos geográficos. Este valor contrasta con el que se ha niveles. Por ejemplo, aceptan -con los neutralistas- que en descrito en numerosos estudios genéticos autosómicos, el cuales indican que para un marcador genético promelos nivel molecular hay determinada preponderancia de la deriva genética y un papel mínimo para principales grudio en los humanos, la variación entre losla selección natural, igual que en la evolución cladogenética. pos geográficos típicamente explica sólo entre 10 y 15 por Para Gould, la jerarquía ciento de la diversidad total [3].depende de la individualización, pues cada nivel debe estarla piel muestra una Claramente, la pigmentación de basado en entidades suficientemente estables para adquirir características distribución atípica, especialmente considerando el orievolutivas de los El equilibrio puntuado defiende que gen recientepropias. humanos anatómicamente moderlas especies son individualidades muestra y, por lo tanto, nos (ca 200,000 años). La Figura 2 legítimasla distribución capaces de desplegar propiedades irreductibles, emerglobal de la pigmentación de la piel, basada en el mapa del gentes, italiano ha podido mostrar la existencia tiende geógrafo pero no Renato Biasutti. El color de la pielde tales apropiedades. ser más oscuro en las áreas ecuatoriales y tropicales Más recientemente (1995), Gould señaló Melanesia) (áfrica Subsahariana, Asia del Sur, Australia y que el puntualismo áreas alejadas del ecuador. que en las se relaciona con la reforma “posmoderna”, que resalta los temas del pluralismo, la causalidad de niveles El factor subyacente que explica esta importante remúltiples, las pigmentación cutánea y la individualidad lación entre lavirtudes de la complejidad, lalatitud parece y la intensidad de radiación ultravioleta que atribuye es serel juego, a diferencia del modernismo, (UVR), la cual a la teoría sintética y que, disminuye progresivamente al por mayor en el ecuador yde acuerdo con él, se caracterizaauuna idea universal de reducción a principios con clarimentar la latitud. Los datos disponibles indican de niveles inferiores y por su énfasis pigmentación cutánea y la dad que la distribución de laen lo simple, abstracto enuniversal. especie humana ha sido grandemente influenciada por los El de UVR. Discutiré contra de en planteamiento es niveles punto medular en este hechoestemás detalle en la que, tal sección, conocidos actualmente, los procesos la próxima como sonque está dedicada a la evolución de microevolutivos son compatibles con los pigmentación cutánea en los humanos. modelos de macroevolución -puntualismo y gradualismo-. Del conocimiento de la microevolución, no se puede inferir cuál de esos dos Figura 1. Diferencias de población en patrones de tamaño patrones macroevolutivos prevalece, piel. Reproducida de y distribución de melanosomas en la ni obtener respuestasBarsh, muchos otros temasla variación en el color de la para 2003. ¿Qué controla macroevolutivos distintivos, piel humana? PLoS Biology 1:19-22, con permiso de PLoS tales como la evolución morfológica, patrones de extinBiology.

fología cuando no hay evidencia de la a las capas sulos queratinocitos eventualmente migran existencia de un estado de la epidermis. dos estados queratinocitos, Eviperiores intermedio entreDentro de los de un carácter. los dentemente, la ausencia de tal estado intermedio puede melanosomas se encuentran agregados en torno al núcleo, yinterpretarse como que nunca ha los efectos dañinos dea proporcionan protección contra existido. Ésta se debe una interpretación saltacionista, o simplemente a que no los rayos ultravioleta. se En el cabello, los melanocitos también transfieren meha encontrado evidencia de que haya existido. Eldredge (1989) ha queratinocitos, que a su vez migran y se difelanosomas aaclarado que los modelos de transformación morfológica de tipo tallo del cabello. En contraste con la rencian para formar elsaltacional comparten la característica y considerar que los cambios de gran escala ocurren piel deel cabello, en el iris los melanosomas se encuentran como eventos de de los melanocitos, y el tipo masivas, únicamente dentro un solo paso. Las extincionesde melaseñala, no pueden y explicadas por los agentes normales nina y la densidadser distribución de los melanosomas en los principales determinantes causal que los ojos. son tanto que “rompen el continuo del color de requiere el sentido uniformitarista de Darwin”.la densidad de melaAunque existen diferencias en Otro función del idea de reconstrucción jerárquica nocitos enaspecto es lalugar en el cuerpo, la variación en de la teoría de la selección natural. ser el principal facel número de melanocitos no parece Es un tema central, en tanto que Gould sostiene la necesidad de teorización tor responsable de las diferencias de pigmentación entre de los fenómenos que estudia la las diferencias en piglas poblaciones humanas. Más bien, paleontología, fenómenos, por definición, macroevolutivos. En este sentido, mentación se deben a dos factores importantes: la canticonsidera indispensable la elaboración de melanocitos, la dad y el tipo de melanina sintetizada en los una teoría de y selección natural, como de proceso más general que trala forma y la distribución un los melanosomas (Figura 1). baja de manera simultánea en objetos biológicos en los La piel con poca pigmentación es rica en las formas diferentes niveles de una (eumelanina café y feomelanimás claras de la melanina jerarquía genealógica: “Puesto que y los melanosomas tienden a ser menos nas amarillo/rojo),muchos de los niveles reconocidos recientemente de intrínsecamente macroevolutivos (selecpigmentados, sonmenor tamaño y empacados en grupos. ción de especies, tiene más melanina, enriquecida con La piel más oscura selección de clados y algunas más de selección más oscuras de la melanina. Adicionalmente, las formas interdémica), y puesto que sus caminos y modos son distintos de la selección de piel oscura son más los melanosomas de los individuosnatural en individuos, la teoría jerárquica grandes y distribuidos en unidades para pigmentados, mástambién asegura un espacio teórico aisla macroevolución y sus bases paleontólogicas” (Gould, ladas [1]. 1995). Como otras concepciones, el puntualismo se ha ido transformando. En sus primeros artículos sobre el equiDISTRIBUCIÓN DE LA PIGMENTACIÓN librio puntuado, HUMANAS EN POBLACIONESGould declaró que el darwinismo estaba muerto y que de la pigmentación de la piel difiere de la La distribución se requería una nueva síntesis. En trabajos más recientes, Gould precisa que más que la teoría maobservada en otras características fenotípicas y en lasintética en general, se trata de lo que él llama “ultradarwinismo”, a cuyos defensores identifica como fundamentalistas contrarios al pluralismo que él, como Darwin, defiende. Coyne y Charlesworth (1996 y 1997) también se refieren a la transformación del equilibrio puntuado, aunque su punto de vista es más crítico: “Para que una teoría científica tenga valor en la exploración del mundo real, debe tener cierta estabilidad como un conjunto de proposiciones abiertas a la comprobación empírica. EI equilibrio puntuado ha sufrido tantas transformaciones, que es difícil distinguir su núcleo de verdad de la “afirmación de que la evolución morfológica a veces ocurre episódicamente”. JERARQUÍAS EN EVOLUCIÓN El equilibrio puntuado sostiene mecanismos de evolución distintos para los diferentes niveles evolutivos (a cada nivel correspondería una unidad de evolución: moléculas, incluidos los genes, organismos, poblaciones y especies), como una necesidad del mundo empírico, no metodológica. De ahí que se precisen jerarquías en evolución. Según Gould, el punto de vista contrario es reduccionista. Igualmente, ha señalado que para hablar de jerarquías en evolución; es decir, de mecanismos distintos para diferentes niveles de evolución, se requiere la emergencia de propiedades

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

59 47

ción En especies y con la pigmentación cutánea, la diversi- capa fotoprotectora de la piel. De particular importancia de contraste factores históricos que regulan la cual muestra una gran correlación con la latitud, la variación es el papel de la melanina en el filtrado de la radiación dad taxonómica. en En color del cabelloprocesos macroevolutivos están cu- ultravioleta proveniente del sol (280-400 nm). el conclusión, los y de los ojos es más restringida Además, la melanina (en particular la eumelanina) geográficamente. La mayoría de las poblaciones humabiertos por fenómenos microevolutivos y son compatibles nas tienen microevolutivas, pero los rojo y el rubio se con teorías pelo e iris oscuros. El pelo estudios al respecto también ejerce un efecto protector sustrayendo radicales encuentran principalmente en poblaciones europeas (la requieren la formulación de hipótesis y modelos autónomos libres reactivos y otros oxidantes. Existen varios factores mayor frecuencia de pelo rojo ocurre evidencia macroevo(que deberían ser contrastados usando en Gran Bretaña e selectivos que podrían guiar la evolución de piel altamente Irlanda, y la sentido epistemológico, es fundamental que lutiva). En el mayor frecuencia del pelo rubio en los países la melanizada en las regiones ecuatoriales y tropicales con nórdicos), aun sea vista pelo rubio es una característica macroevolución cuando el desacoplada de la microevolución; alta incidencia de UVR. también presente en algunas poblaciones australianas y es decir, la macroevolución es un campo autónomo del estumelanesias. dio evolutivo.Similarmente, los colores de iris más claros PROTECCIÓN CONTRA EL CÁNCER (azul, verde, avellana) se encuentran principalmente en Y QUEMADURAS POR EL SOL poblaciones europeas, TEORÍA NEUTRALISTAaunque también están presentes en La melanina actúa como bloqueador natural de los rayos poblaciones del Norte de África, AZAR O DE EVOLUCIÓN MOLECULAR ALAsia Occidental y Asia solares, y es especialmente efectiva para la protección condel de [4]. Una Surlas críticas a la teoría sintética proviene de estudios tra los efectos dañinos de la radiación electromagnética de la evolución en el nivel molecular. La llamada teoría neu- de pequeñas longitudes de onda (~300 nm), que son las HIPÓTESIS evolución sostiene que tralista de laSOBRE LA EVOLUCIÓN la inmensa mayoría del más dañinas para el ADN y las proteínas. Las quemaduras DE LA PIGMENTACIÓN CUTÁNEA cambio molecular es adaptativamente neutro; es decir, que las solares severas pueden causar daños a las glándulas suNumerosas hipótesis se han presentado adaptadas que nuevas variantes no son ni más ni menos para explicar lalas doríparas, lo cual puede generar un trastorno en la termoevolución de la pigmentación selectivamente neutras. Como preexistentes; por lo tanto, son cutánea en poblaciones hu- rregulación, y puede también generar un riesgo adicional manas, tomando en consideración variantes son equivalendesde el punto de vista funcional las la relación observada de infección de las células cutáneas dañadas. Por lo tanto, en los ambientes tropicales en los que entre los niveles de melanina y la latitud. En esta sectes, la selección natural no podría actuar favoreciendo a unas ción discutiré brevemente otra fuerza distinta debería ser sobre otras. En consecuencia,las principales hipótesis. In- se dio la evolución temprana de nuestra especie, la piel formación adicional puede encontrarse el Robbins [5] y la que gobernara el cambio. En concreto, en neutralismo pro- oscura con grandes cantidades de eumelanina que abJabloski la mutación genética y la deriva genética al azar son pone que [6]. De acuerdo con la mayoría de los autores, el factor las fuerzas fundamentales en el proceso de cambio molecular. Figura 2. Mapa del mundo, que muestra la distribución de pigmentación cutánea. El mapa está basado en el trabajo del subyacente que explica la distribución geográfica única (Véase Álvarez-Valin, 2002.) geógrafo italiano R. Biasutti. Los números mayores representan de De acuerdo con esta visión,en selección jugaría un pa- colores de piel más oscuros. Fuente D, O’Neil (Behavioral la pigmentación cutánea la la especie humana papel rece ser la exposición a UVR. La melanina deletéreas una Sciences Department, Palomar College, San Marcos, California, muy importante al eliminar las variantes actúa como (selección negativa), pero la fijación de variantes be-neficiosas mediante selección natural seria un evento muy poco frecuente. Una evidencia en favor de que las sustituciones selectivamente neutras son predominantes en muchos genes, la ofrece la siguiente observación: cuando alineamos y comparamos las secuencias proteicas o de ADN entre genes homólogos provenientes de distintas especies, podemos observar que existen zonas más conservadas (de nulo cambio) y zonas más divergentes. Las zonas conservadas coinciden con los aminoácidos funcionalmente importantes, como lo demuestran varios estudios de mutaciones. Ciertamente, se conoce la secuencia nucleotídica de las versiones mutantes de varios alelos que producen alteraciones genéticas, tanto en el hombre como en otros organismos. Dichas mutaciones se ubican, en su inmensa mayoría, en las regiones del gen que se encuentran evolutivamente conservadas, indicando entonces que tales aminoácidos son funcionalmente importantes, pues las mutaciones que sufren dan lugar a alelos deletéreos. CUESTIONAMIENTOS A LA TEORÍA NEUTRALISTA Existen diversos cuestionamientos a la validez de la teoría neutralista. Por ejemplo, al poner a prueba la hipótesis del reloj molecular, se ha visto que las variaciones en las tasas de evolución molecular son significativamente más grandes de lo que se esperaba con base en la teoría neutral. Es decir, las diferencias entre las tasas de sustitución de aminoácidos en diferentes proteínas son demasiado grandes como para hacer válido un promedio y decir que dicha tasa es una constante.
USA, http://anthro.palomar.edu/vary/vary_1.htm).

44 60

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO
de acción [8]. peso específico en un papel clave en el vitamina D y deLa vitamina D juega micro y en macroevolución. metabolismo de los huesos, y su deficiencia produce raEsta polémica con la Teoría Sintética se basa en la dualidad quitismo en los niños y osteomelacia en los adultos. En del recientes, se han el cual es puesto funciones de hipóañosproceso evolutivo,reconocido otras en duda por lala vitesis de (Figura 3), incluyendo la inmunorregulación y la tamina D los equilibrios puntuados. Como otras polémicas en evolución, tiene su desarrollo, en gran parte, celular. regulación de la diferenciación y la proliferación a partir de una problemática quevitamina D explicalos procesos que La hipótesis de la surge al analizar la distribución caracterizan apigmentación vivos. En como caso, se trata moderna de la los sistemas humana, este resultado de del sentido que se les da natural que favorece la proun balance entre la seleccióntérminos como gradualismo y constancia, y quemaduras solares y la tasas rápidas tección contra las lo que se entiende por destrucción delo lentas en evolución. Esto parece llevar a y la selección folato en regiones con alta exposición a UVR, diferencias en tiempos y modos en evolución, siendo que se lejanas del que favorece la pigmentación clara en regiones trata fundamentalmente de un asunto de orden semántico. ecuador para facilitar la síntesis de vitamina D. A persona de piel oscura diferentes menos 10 Unapartir de interpretaciones requiere alde un registro fósil, paleontólogos modernos llegan auna persona veces mayor exposición a la luz solar que conclusiones un tanto distintas. Algunos cuestionan la interpretación de piel clara para producir la misma cantidad de vitade Darwin y de Simpson del registro fósil, en relación mina D [8]. Esto sugiere que individuos con piel más oscu-a que muestra huecos que son consecuencia, sobre todo, ra estarían en desventaja selectiva para sintetizar vitamina de tendencias en el proceso de fosilización de fallas en D en regiones de baja UVR. Es posible que elymecanismo su estudio. Sostienen que, por el contrario, conocido del selectivo más importante fuera el efecto bien los vados de registro se deben que la evolución morfológica ocurre la vitamina D sobreael crecimiento de los huesos y el defrecuentemente de manera abrupta, precedida y sucedida sarrollo. por largos periodos con poco ohacer notar que investigaSin embargo, es importante ningún cambio. Es decir, se en que las década indican claramente ciones realizadascree la últimabrechas del registro fósil no son artefactos la vitamina D va más allá de la homeostaque el papel de creados, porque no hubo fosilización, sino que son resultado de la forma la que se da están presis del calcio. Los receptores de en vitamina Del origen de las especies. No hay queratinocitos, formas intermedias, sentes en el riñón, los por qué esperarlos osteoblastos, los dado que éstas apenas B, las células beta del páncreas, linfocitos activados T yexistieron. En esta concepción, una nueva especie surge de una población marginal, separada el intestino delgado, la próstata, el colon, y la mayoría de geográficamente de la progenitora. los órganos del cuerpo (incluyendo el cerebro, el corazón, la piel, las gónadas, la próstata y el busto), y la vitamina FÓSILES VIVIENTES D juega un papel importante en la prevención de enferLos llamados fósiles el control cuya historia carece de medades autoinmunes, vivientes, de patógenos invasores ycambio estructural (estasis), porla diferenciación de las la regulación del crecimiento y ejemplo los linajes, representan células [8]. casos típicos, aun cuando son especialmente largos. La teoría del equilibrio puntuado defiende que la evolución ocurre en SELECCIÓN SEXUAL dos etapas: una rápida, en la que surge una nueva especie, cuando sexual podría mayoría de los La idea de que la selección tienen lugar la ser la responcambios morfológicos (especiación), y tiene una larga sable de la variación del color de la pieluna subsecuente, en la que los cambios son virtualmente inexistentes (estahistoria. En el libro El descenso del hombre, Charles Darwin sis). En consecuencia, esta teoría rechaza que la evolución [9] dijo que las diferencias observadas para algunas caracsea gradual. terísticas humanas, incluyendo la pigmentación, podrían La Teoría Sintética mantiene, por ser el resultado de la selección sexual. el contrario, que las etapas sin cambio se deben no a que no que laevolución, De hecho, existe evidencia que indica haya pigmensino a es un criterio importante para la selección defortación que la selección natural está favoreciendo una la ma que los humanos, lo nivel alto de adaptación (selecpareja enha alcanzado un cual condujo a varios autores a ción equilibradora, Dobzhansky, sido Williams, 1992). postular que la selección sexual ha 1937,un factor imporPor de la distribución no sólo de la piel, sino también del tante lo tanto, aunque siguen apareciendo variantes en el nivel el color de los ojos en los humanos [10, 11]. pelo y genético, no hay cambios morfológicos. Los puntualistas no niegan la selección ocurrir lala selección gradual Por supuesto, que pueda natural y evolución sexual ni son gradualistas rechazan que y es posible que ambas los mutuamente excluyentes, pueda haber eventos de no especiación rápida; en ambos casos se mantiene pighayan conformado las distribuciones actuales de la como proceso raro el adverso de cada teoría. mentación humana, ya sea como factores primarios o seEl debate posibilidad ha sido sugerida por ocurren la cundarios. Estaes sobre la frecuencia en la que varios auevolución filética y los eventos rápidos de especiación. En tores, aunque algunos ponen más énfasis en la selección la resolución de esta controversia poco papel secundario natural y asignan a la selección sexual un ha ayudado el trabajo empírico. otros antes se la selección sexual posee [7], mientras queComo creen queseñala, es sobre todo una polémica conceptual, teórica. Los datos empíricos no la un papel más prominente [11]. Para cerrar esta sección, es resuelven, pues, tal que hay han hipótesis para explicar necesario mencionar como se otrasencontrado hasta ahora,

sorbe UVR, sería grandemente ventajosa, mientras que la piel clara, sujeta a quemaduras solares, daño a las glándulas sudoríparas e infecciones, sería desfavorecida por la selección natural. También es bien conocido que la exposición al sol por tiempo prolongado puede generar cáncer en la piel cuando la UVR daña los genes que normalmente inhiben el crecimiento canceroso. Existe evidencia que indica que existen diferencias importantes en el riesgo de cáncer de piel, dependiendo del tipo. La piel oscura es mucho menos susceptible a este tipo de cáncer. PROTECCIÓN CONTRA LA FOTÓLISIS DE LOS NUTRIENTES La luz solar, particularmente la radiación ultravioleta, no solamente es dañina para la piel de los humanos, sino que también puede afectar a algunos nutrientes esenciales, particularmente al folato. El folato es necesario para la síntesis y la reparación del ADN, y la deficiencia de folato puede generar complicaciones durante el embarazo y una multitud de anormalidades fetales, incluyendo los defectos en el tubo neural, tales como la espina bífida y la anencefalia. La deficiencia de folato fue una causa importante de mortalidad perinatal y posnatal en algunas poblaciones antes de la introducción de suplementos preventivos [7]. El folato también juega un papel clave en la espermatogénesis. Central a esta discusión es el hecho de que el folato es extremadamente sensible a la UVR [7]. Esto sugiere que en áreas geográficas con altos niveles de UVR, individuos de piel clara sufrirán más de deficiencia de folato que aquéllos con piel oscura. Debido al papel importante del folato en varios procesos biológicos clave, es probable que el mantenimiento de los niveles óptimos de folato ha estado bajo la influencia de la selección natural. Es importante mencionar que las dos hipótesis descritas anteriormente son compatibles y, ya sea individualmente o combinadamente, pueden explicar la pigmentación oscura rica en eumelanina observada en regiones con alta incidencia de UVR. Sin embargo, esas hipótesis son insuficientes para explicar la distribución geográfica global de la pigmentación cutánea (Figura 2). Para explicar la fuerte correlación entre la pigmentación cutánea con la latitud (o con la UVR), es necesario clarificar los factores evolutivos responsables de la reducción de la pigmentación de la piel en las regiones con poca UVR. En la siguiente sección, sumarizo las dos hipótesis más importantes. LA MELANINA Y LA SÍNTESIS DE VITAMINA D Aun cuando los efectos de la UVR sobre la piel son generalmente dañinos, hay una excepción importante: la radiación UVR es esencial para la síntesis de vitamina D en la piel. Aunque algunas fuentes nutritivas tienen cantidades sustanciales de vitamina D (particularmente el pescado graso y el aceite de pescado, la yema de huevo y las carnes de los órganos) la síntesis cutánea es la principal fuente de

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

61 45

son susceptibles de las dos explicaciones. Un caso interesante es el depósito fosilífero de moluscos del lago Turkana, que primero se consideró una evidencia contundente a favor del puntualismo (Williamson, 1981) y después se presentó como un proceso que tuvo lugar en 50 mil generaciones (Williamson, 1985), un proceso no rápido ni mucho menos (véase, Hoffman, 1989). Por otro lado, la interpretación de Williamson (1981) de que el registro de Turkana puede ser considerado evidencia a favor del equilibrio puntuado, es cuestionable, pues, por ejemplo, se ha mostrado que lo que él consideró especies diferentes -un punto central en la polémica, pues para apoyar la tesis del equilibrio puntuado, Williamson (1981) interpreta el registro como resultado del surgimiento de nuevas especie, iniciado por aislamiento peripátrico y subsecuente estasis- pueden ser sólo variedades resultantes de la adaptación a condiciones cambiantes, tal como se ha observado en las especies vivientes (véase Collingridge y Earthy, 1990). EVOLUCIÓN GRADUAL O PUNTUAL En este sentido, la discusión fundamental es si el registro fósil evidencia en mayor proporción evolución gradual o evolución puntual. Sin embargo, cuando se encuentra un registro continuo con cambios graduales, se trata de demostrar que hubo un proceso de evolución gradual, pero si hay vados, no es fácil saber si así fue el proceso o si hay faltantes. Otro aspecto que critican los puntualistas es la supuesta preeminencia de la selección natural en todos los niveles evolutivos. Eldredge (1995) considera una “extrala distribución de la el extender el de la piel. Por ejemplo, polación innecesaria” pigmentación modelo darwiniano de Wasserman [12] relacionó la pigmentación oscura de la cambio evolutivo de generación en generación a la evolupiel con tiempo geológico. infecciones bacterianas, paración en el la resistencia a las El punto, afirma Eldredge, es sitarias y virales, y Post et alii [13] sugirieron y no deque la selección natural es ante todo un filtro que la un pigmentación de la piel podría generar resistencia al daño agente que moldea los organismos en tiempo. por el frío. Esta crítica, como la anterior, es conceptual. ¿Qué entiende Eldredge por “moldear”? Cuando afirma que la seBASE natural es una y que no puede moldear, lo dice lecciónGENÉTICA DE LA VARIACIÓN NORMAL selección natural eliminara o moldeara pero, como si la DE LA PIGMENTACIÓN A más de los adelantos sea un evolucionista, todos saporpesar seleccionista querecientes en nuestro conocimiento del que la pigmentario, y de la importancia fisiológica bemos sistemaselección natural sólo puede actuar elimiy evolutiva de la pigmentación, nuestro conocimiento de nando organismos, dejándolos vivos y favoreciendo su las bases genéticas de la variación normal de la pigmenreproducción. tación en humanos es muy selección moldea pigmentación Cuando se dice que la incompleto [1]. La o diseña los de las áreas no expuestas de la piel (pigmentación pasar organismos, se da por sentado que lo hace al dejar constitutiva) es bastante eliminar otros; es decir, un individuo unos organismos y estable durante la vida de actúa como y no cambia se haga hincapié en la eliminación, no puefiltro. Aunque mucho debido a factores ambientales [5]. La pigmentación al eliminar es un rasgo vivos a otros y de negarse que,constitutiva a unos, deja poligénico, pero el éstos transmiten sus características exacta de las que número de genes y la naturaleza a la siguiente variantes alélicas sentido, la selección natural de melagene-ración. En esteque determinan el contenidova “molnina permanecen poco dejando vivos a los organismos deando” un carácter, va conocidos. cuyoInvestigaciones en los desórdenes de la pigmentación carácter es más adecuado a cada momento. Es éste humana, que como el albinismo, combinadas con fuerza el sentido talestiene la noción de la selección comoestudios de la pigmentación en modelos animales, han aumentado creadora, pues en tanto puede favorecer la reproducción de considerablemente en vez conocimiento generar novealgunos organismos nuestrode otros, puedesobre el sistema pigmentario y adaptativas que nuevo entendimiento de dades genéticas han generado unsin su acción serían conlas diferentes improbables (Ayala, 1997). siderablemente trayectorias que guían la producción y regulación nunca han utilizado la palabra “salto” o sus deAunquede la melanina.

rivados en la exposición de su teoría, los puntualistas especialmente en los inicios de su planteamiento- tienen Figura 3. Órganos y tejidos capaces de sintetizar la forma activa mucho vitamina D, con corrientes saltacionistas. El pareen común 1,25(OH2)D, que muestran sus múltiples de la cido, es obvio, se debe a que ambos Wagner [18]. papeles fisiológicos. Fuente: Hollis and grupos cuestionan la gradualidad de la evolución. De hecho, la mayor parte de sus lectores afines o de sus críticos (por ejemplo, Delsol, 1991) los han caracterizado como tales, de manera que Dada la herencia poligénica de la concepción punlas más recientes presentaciones de la pigmentación, y la complejidad Gould y Eldredge rechazan es sorprendente tualista dondedel sistema pigmentario, noel calificativo de que haya sido muy complicado identificar que tuvo la versaltacionistas, aún no logra la repercusiónlos genes responsables de la en la que, por ejemplo, Gould la piel, el casión anterior,variación de la pigmentación de(1985) habló bello y el iris. de reivindicar la noción de “monstruo esperanzado” de Sin embargo, la situación ha cambiado drásticamente Goldschmidt o cuando ambos señalaron su acuerdo con el en la última de Huxley (Gould, 1985). saltacionismo década, y varios genes han sido asociados con la variación natural de la pigmentación, incluyendo Eldredge (1982, 1995, 1998) utiliza incluso los térmigenes que regulan la súbita” de las diferentes formas nos “aparición brusca o síntesis y “sin transición”, que en de la melanina (eumelanina vs salto: “Esta noción está cualquier concepción significan feomelanina), tales como los genes MC1R y ASIP, conocida codifican proteínas basada en la observación, genes que desde mucho antes que se expresan dentro de cada especie nueva aparece por los paleontólogos, de quelos melanosomas, tales como SLC24A5, MATP, TYR y OCA2, y otros genes reguladores bruscamente en las secuencias fósiles, para despu é s p e r importantes tales como grandes m a n ecer inalterada por KITLG. periodos (de 5 a 10 millonesEs interesante mencionar que análisis realizados sode años). Después, una especie dada es reemplazada bre el genoma han indicado que muchos genes de la pigpor otra bruscamente, sin transición, por otra” (cursivas men-tación han sido fuertemente influenciados por la senuestras). lección natural. Estos datos preliminares apuntan hacia un marco complejo en donde la selección GRADUALISMO Y SALTACIONISMO positiva ha actuado en diferentes señala, del de los problemas al hablar de Como antes se lugares uno genoma, y para algunos genes solamente en ciertos grupos poblacionales. gradualismo y saltacionismo es, como en otras polémicas Estos resultados ilustran la historia evolutiva compleja en evolución y biología, de carácter semántico. El límite de la entre lo que de la piel y poblaciones humanas, la exacto pigmentación es gradualen lo que es saltacional es cual de definir. empezando a habla de difícilestamos sóloEn general, se entender. salto en mor-

42 62

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

lo que ha ocurrido LA PIGMENTACIÓN IMPLICACIONES DEcon una gran diversidad de familias de proteínas. PARA LA SALUD PÚBLICA En laCualquiera que sea el argumento utilizado para definir sección anterior resumí las principales hipótesis evola evolución de las vías metabólicas, algo patente es que lutivas que han sido presentadas para explicar la distribulas de la pigmentación en través de procesos donde la cación enzimas evolucionan a poblaciones humanas. Aunque pacidad catalítica permanece inalterable, mientras factoexisten todavía algunos debates en relación con losla especificidad por los sustratos se acepta generalmente que res selectivos involucrados, es modificada. Pudiese existir otro punto de partida que apunta al surgimiento de las la fuerte asociación entre la latitud y la pigmentación en vías metabólicas, asociado resultado de la acción de la humanos es principalmentecon la duplicación de genes,la oligomerización que promueve la adaptación de producselección natural y hetero-oligomerización de sus las potos. blaciones humanas a las condiciones del ambiente natural (en particular a la incidencia de UVR), un proceso que DUPLICACIÓN DE GENES probablemente tomó cientos de generaciones. Jensen, al igual que Horowitz, pone de manifiesto la imSin embargo, como consecuencia de las migraciones portancia de la duplicación individuos viven que basta humanas recientes, muchos de genes y asegura ahora en una nueva enzima -producto de una duplicación- para que regiones geográficas con diferentes condiciones ambiena la a las que imperaban cuando la población evolucionó. tales postre pueda instaurarse una nueva vía metabólica. Existe evidencia papel que la pigmentación juega en Debido al importante que sugiere que, paralelamente a la duplicación de genes, pueden existir también estas mila fotoprotección y la síntesis de la vitamina D,duplicaciones de vías metabólicas. implicaciones importantes en la graciones recientes tienenLos casos relacionados con la biosíntesis de leucina y lisina por un lado y de histidina salud pública: individuos de piel clara tienen mayor ries-y triptófano por otro son una muestra de ello (Figura con go de cáncer de piel, particularmente en regiones5). alta incidencia de UVR, e individuos de piel oscura que CONSIDERACIONES viven en regiones de alta latitud tienen mayor riesgo de Independientemente del por la deficiencia o insuficienenfermedades generadasorigen de la vida y la instauración de diversas vías metabólicas a lo largo se discuten en cia del nivel de vitamina D. Estos asuntosde la evolución, existe un punto de la siguiente sección. coincidencia en todas las especies que las hermana químicamente: un origen en común que se mantiene vigente y que, oculto a simple vista, relata poco PIGMENTACIÓN CLARA Y AUMENTO a poco una DE CÁNCER DE PIEL DEL RIESGO historia molecular cuyo fin está ligado al fin de la existencia misma… La mayoría de los efectos dañinos de la luz solar (p.e. eritema y daño al ADN) provienen de la exposición a longitudes de onda UV. Las melaninas son un bloqueador natural de la luz solar, particularmente en el espectro UV, por lo que no es sorprendente que el riesgo de desarrollar cáncer en la piel está fuertemente relacionado con el color de la piel [14]. La incidencia del cáncer en la piel y la mortalidad por el cáncer de piel se correlacionan fuertementeof Horowitz, N. H. (1945). “On the evolution con la latibiochemical syntheses.” Proc Natl Acad Además, tud, y ambas disminuyen lejos del ecuador. Sci U S A en la 31: 153-7. misma latitud, la incidencia del cáncer de piel es mayor en poblacionesA. (1976). “Enzymeen poblaciones de piel Jensen, R. de piel clara que recruitment in evolution of new function.” Annu Rev Microbiol 30: oscura. En ningún otro lugar esto es más evidente que 409-25. en Australia, el país con mayor incidencia de cáncer de piel del mundo. Lazcano-Araujo, Antonio. El origen de la vida: Esto se aplica tanto evolución biológica. no-melanoma evolución química y al cáncer de piel 3a ed. México. Trillas. 2007. (carcinoma de células basales y carcinoma de células escamosas) como al de melanoma maligno. La incidencia de Oparin, I. A. El origen de la vida. Grijalbo. México. estos tres tipos de cáncer en la piel es cerca de 10 veces 1968. mayor en Australia (particularmente en las regiones del Panno, J. THE CELL: Evolution of the First norte, tales como Queensland y el Territorio Norte) que en Organism. Facts On File. Inc. E.U.A. 2005. el norte de Europa. Se ha estimado que uno de cada dos australianos desarrollará alguna forma de cáncer de piel durante su vida (http://www.cancercouncil.com.au/) Sin embargo, el cáncer de piel afecta en forma desproporcionada a los individuos de piel clara, y los aborígenes australianos tienen una incidencia mucho menor de esta enfermedad. Un estudio reciente ha indicado que la pigmentación constitutiva está asociada con el riesgo de

cáncer de piel [15]. Similarmente, los individuos que se queman fácilmente y que no se broncean tienen mayor riesgo de cáncer de piel que los individuos con otros tipos de piel. PIGMENTACIÓN OSCURA E INSUFICIENCIA DE VITAMINA D La síntesis de vitamina D a través de la exposición de la piel a la luz solar es la fuente más abundante de vitamina D para la mayoría de la gente [8]. Dadas las propiedades de la melanina como un filtro natural de la UVR, no es sorpresa que la cantidad de melanina esté inversamente relacionada con la producción de vitamina D en la piel. De acuerdo con Holick et alii [8], una persona con piel oscura requiere al menos 10 veces más exposición a la luz solar que una persona con piel clara para producir la misma cantidad de vitamina D en su piel. Por lo tanto, la síntesis de vitamina D puede obstruirse con cantidades grandes de melanina, particularmente bajo condiciones de exposición limitada a la UVR. Tal es el caso en las regiones de alta latitud, en donde no existe suficiente UVR para sintetizar la vitamina D durante un periodo sustancial del año. Investigaciones recientes indican que existe una incidencia sorprendentemente alta de deficiencia de vitamina D en países de alta latitud, aun entre individuos de piel clara. Sin embargo, la incidencia de insuficiencia de vitamina D es mayor en grupos poblacionales con altos niveles promedio de melanina. La actual epidemia de insuficiencia de vitamina D es de relevancia en la salud pública, no sólo por el bien conocido efecto de la vitamina D en el metabolismo óseo, sino también por su papel importante en la protección contra muchas condiciones crónicas. Aparentemente, niveles adecuados de vitamina D son importantes no sólo para protección contra el raquitismo, la osteomalacia u osteoporosis, sino también para la protección contra varios tipos de cáncer (p.e. cáncer de seno, colon y próstata); enfermedades autoinmunes (p.e. artritis reumatoide, lupus eritematoso sistémico, esclerosis múltiple); enfermedades cardiovasculares e infecciones microbianas (p.e. tuberculosis) [8,16,17] CONCLUSIONES He revisado nuestro entendimiento actual de la evolución de la base genética de la pigmentación de nuestra especie. La pigmentación muestra una notable diversidad en poblaciones humanas, y en este sentido es un rasgo atípico; numerosos estudios genéticos han indicado que la proporción promedio de variación genética debida a las diferencias entre los principales grupos continentales es sólo de 10-15 por ciento del total de la variación genética. En contraste, la pigmentación cutánea muestra grandes diferencias entre las poblaciones continentales. La razón de esta discrepancia puede ser explicada principalmente por la gran influencia de la selección natural, la cual ha conformado la distribución de la pigmentación de acuerdo a un claro gradiente latitudinal. Es erróneo, por lo tanto, suponer que las grandes diferencias observadas en la pig-

REFERENCIAS

CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES

63

mentación cutánea pueden ser extrapoladas a la mayoría de los rasgos humanos. De hecho, rasgos que han sido fuertemente conformados por la selección natural son notoriamente inapropiados para descifrar relaciones entre las poblaciones. Clasificaciones basadas en rasgos sujetos a una fuerte selección natural reflejan los factores ambientales subyacentes. En este caso particular, una clasificación derivada de la pigmentación cutánea principalmente captura las diferencias de exposición a la UVR entre las poblaciones, y muestra muy pobre concordancia con las clasificaciones basadas en marcadores neutrales, los cuales son las herramientas apropiadas que se utilizan para mapear la historia humana. Es por lo tanto desafortunado decir que la pigmentación haya sido un rasgo omnipresente en las clasificaciones “raciales” que explican de modo inadecuado la diversidad observada en la especie humana. El estudio de los genes responsables de la diversidad de la pigmentación humana pone de manifiesto la naturaleza tipo mosaico de la variación genética. Nuestro genoma está compuesto de miríadas de segmentos con diferentes patrones de variación e historias evolutivas. Debido al reciente origen de nuestra especie, la mayoría de los segmentos muestran pequeñas diferencias entre poblaciones humanas, pero algunas regiones genómicas, particularmente aquéllas bajo la influencia de la selección natural, se separan considerablemente del patrón promedio del genoma humano y muestran mayores diferencias entre poblaciones. Esas regiones genómicas probablemente jugaron un papel clave en el proceso de adaptación de las poblaciones humanas a los diferentes ambientes, y también podrían explicar algunas de las diferencias poblacionales que han sido descritas en los riesgos de enfermedad o en el metabolismo de fármacos. Por lo tanto, en la misma forma que es erróneo extrapolar los patrones de variación observados en los rasgos superficiales, tales como la pigmentación al resto del genoma, es incorrecto sugerir, basados en el marco genómico “promedio” que la variación entre poblaciones humanas es irrelevante. En mi opinión, es paradójico que en el Siglo 21 y con el proyecto del genoma humano ya finalizado, tengamos un conocimiento tan incompleto sobre la base genética de la pigmentación de los ojos, el cabello y la piel. Hay muchas razones por las cuales elucidar la base genética y la historia evolutiva de la pigmentación es importante. 1) La pigmentación es un rasgo que debería ser usado como ejemplo de los problemas que se pueden derivar de una interpretación simplista de la variación humana, y para educar al público en general sobre la importancia de estudiar la variación utilizando un enfoque evolutivo en lugar de tipológico. 2) La pigmentación puede ser muy útil para entender la arquitectura genética de rasgos complejos. La pigmentación de las áreas no expuestas de la piel (pigmentación constitutiva) está relativamente poco afectada por las influencias ambientales cuando se compara con otros rasgos complejos, tales como la diabetes

o la presión arterial, y esto proporciona una oportunidad única para estudiar interacciones gen-gen sin el efecto de factores ambientales que confunden la situación. 3) La pigmentación es relevante desde la perspectiva de la salud pública, por su papel crítico en la fotoprotección y la síntesis de la vitamina D. Nuestro entendimiento de los genes involucrados en la variación normal de la pigmentación ha aumentado considerablemente en los últimos cinco años, y estudios recientes han identificado algunos genes candidatos que muestran clara evidencia de selección natural y por lo tanto pueden ser funcionalmente importantes en la pigmentación. A la velocidad actual de los descubrimientos, la próxima década esclarecerá muchos de los vacíos que quedan en nuestro conocimiento de la arquitectura genética y la historia evolutiva de este fascinante rasgo. RECONOCIMIENTOS: EJP posee apoyo para la investigación del Consejo Canadiense para la Investigación de las Ciencias Naturales y la Ingeniería (NSERC), de la Fundación Canadiense para la Innovación (CFI), el Fondo para la Innovación de Ontario (OIT) y el Premio de Investigación Temprana (ERA) del Gobierno de Ontario.

REFERENCIAS
[1] Barsh GS. 2003. PLoS Biol. 1:19-22. [2] Relethford JH. 2002. Am. J. Phys. Anthropol. 118:393-398. [3] Tishkoff SA, Kidd KK. 2004. Nat. Genet. 36 (11 Suppl):S21-S27. [4] Sturm RA, Frudakis TN. 2004. Trends Genet. 20:327-332. [5] Robins AH. 1991. Biological perspectives on human pigmentation. Cambridge University Press: Cambridge, New York. [6] Jablonski NG. 2004. Annu. Rev. Anthropol. 33:585-623. [7] Jablonski NG, Chaplin G. 2000. J. Hum. Evol. 39:57-106 [8] Holick MF. 2003. J. Cell. Biochem. 88:296-307. [9] Darwin C. 1871. The descent of man. Murray: London. [10] Aoki K. 2002. Ann. Hum. Biol. 29:589-608. [11] Diamond J. 1991. The rise and fall of the third chimpanzee. Radius: London. [12] Wassermann HP. 1965. Health. 11:691-694. [13] Post PW, Daniels F, Binford RT. 1975. Hum. Biol. 39:131-143. [14] Rees JL. 2004. Am. J. Hum. Genet. 75:739-51. [15] Dwyer T et al. 2002. Am. J. Epidemiol. 155:614-621. [16] Peterlik M, Cross HS. 2005. Eur. J. Clin Invest. 35:290-304. [17] Giovannucci E. 2005. Cancer Causes Control 16:83-95. [18] Hollis BW, Wagner CL. 2006. Canadian Medical Association Journal 174:1287-1290.

40 64

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO
ma inductivo podía servir en la reconstrucción filogenética del metabolismo, a través de análisis comparativos que sirvieran de evidencia en la explicación del surgimiento de vías metabólicas. Una primera aproximación al respecto se relaciona con ciertos aspectos mencionados anteriormente; la cantidad de recursos disponibles en la Tierra primitiva, si bien fue abundante, no fue ilimitada. Esto hizo que a la postre -tal vez después de cientos de miles o millones de años-, los recursos decrecieran. A partir de esos momentos, la vida sobre la Tierra estuvo supeditada a recursos limitados, como aminoácidos, carbohidratos, nucleótidos, entre otros.

Duplicación de genes: Tautología biológica o evolución molecular hacia la diversificación de funciones?

amoníaco, agua, metano, entre otros. Cabe mencionar que los procesos de polimerización, la ruptura de tales polímeros, la combinación de moléculas orgánicas y la oxidación, fueron esenciales en el diseño de los primeros cuerpos proteinoides (Figura 1).

INICIO DE LA VIDA Se ha propuesto que la vida comenzó a partir de unos cuantos compuestos simples, los cuales, por procesos de oligomerización, fueron implementando un mayor grado de complejidad, hasta conformar “un mundo ancestral de ácidos ribonucleicos” (ARN). Éste, a su vez, sirvió de precedente en la creación de los primeros organismos enzimáticos y autorreplicantes. Mucho se ha discutido sobre este aspecto, y la razón para considerar un mundo de ARN es debido a que las primeras biomoléculas en existir debían presentar dos características principales: la primera de ellas era que pudiesen llevar a cabo reacciones enzimáticas, y la segunda, Geovani López que fueran capaces de auto replicarse. Como bien se sabe, el CONTEXTO HISTÓRICO ADN puede replicarse exitosamente, aunque no puede llevar a Sobre el origen de las harles Darwin, en su libro cabo catálisis alguna. especies (1859), propuso que la variabilidad era Por otra parte, lasde la evolución; sin embargo,excelenla materia prima biomoléculas catalíticas por no decia son las enzimas. órganos a través del tiempo tuviera sestimó que la modificación de ciertos El problema con éstas es que son incapaces de auto replicarse. Hasta 1983, parecía que no iba su génesis sobre elementos primordiales muchas veces repetidos, los cuales a existir molécula alguna que órganos y sistemas. cambiarían continuamente hasta constituir nuevos pudiera presentar esa doble función; sin embargo, Thomas de estructuras que diverEsta primera aproximación sobre la multiplicidad Cech, de la Universidad de Colorado, precedente en la concepción de la de Yale, desgen a través del tiempo, sirvió dey Sidney Altman, de la Universidad duplicación cubrieron algo que denominaron ribozima: una molécula génica. Hacia 1918, Calvin postuló que pueden existir diversos elementos rede ARN con los cuales a su vez dundantes a nivel de cromosomas, capacidad catalítica.podrían mutar y realizar

C

funciones distintas de las que alguna vez presentaron. UN MUNDO DE al insertar parte del cromosoma X en el Los experimentos de Müller (1935), ARN Este gran descubrimiento llevó tenían sus cromosomas cromosoma 2 de moscas Drosophila melanogaster, que a considerar que las primeras células en existir provenían de un elementos croíntegros, mostraron la viabilidad de estos organismos al adquirir mundo de ARN. mosómicos repetidos. El paradigma sintáctico postuló -al igual de ARN ha tenido Lo que es más, Müller sobre un mundo que Calvin- que desde hace tiempo un gran impulso, pero se generaría algo similar podía pasar naturalmente y que ese evento de duplicaciónhan encontrado, algunas veces, discrepancias al tratar de fundamena la postre genes que en la actualidad serían considerados no homólogos, aun cuando provinieran deltar el origen de la vida sobre la base exclusiva de ácidos mismo ancestro. ribonucleicos. En suma, se estima que el origen de la vida surgió hace tres mil 800 millones de años, a partir de unos cuantos elementos que fueron ensamblándose hasta constituir polímeros de diferente naturaleza (i.e. proteínas, lípidos y ácidos nucleicos). Todo esto contribuyó a una especialización de las diversas rutas metabólicas, así como a la complejidad y diversidad de biomoléculas actuales. La abundancia de recursos y la ausencia de competidores eran características inherentes a la Tierra primitiva; el surgimiento de organismos que fueran capaces de utilizar los nutrientes disponibles tuvo que haber sido el siguiente paso en la evolución biológica, y esto sólo podía ser visualizado en virtud de procesos metabólicos que relacionaran los sistemas coloidales y los sistemas enLicenciado zimáticos en formación. Geovani López Estudiante de VÍAS METABÓLICAS doctorado / Instituto Al establecer que los estudios evolutivos se fundamentade Fisiología Celular / UNAM ban en similitudes y diferencias en los diferentes planos glopez@ifc.unam. de organización celular y taxonómica, este mismo esquemx

?

A simple vista, la duplicación de genes pudiera ser considerada como un aumento inútil del material genético, como un lastre energético para el organismo que presenta dicha duplicación. ¿Por qué existen genes por duplicado, cuando podría bastar con uno solo? -una pregunta aparentemente obvia-. El gen duplicado es un elemento que se tiene que replicar y cuya conservación puede ir en detrimento del organismo, pues existe una regla muy simple: a mayor cantidad de bases nitrogenadas, mayor inversión de energía para su mantenimiento; sin embargo, y aunque pareciera una contradicción, se sabe que todos los organismos hasta ahora secuenciados presentan invariablemente duplicaciones de su material genético (Figura 1). ¿A qué responde esta paradoja? ¿Son las duplicaciones génicas una simple redundancia funcional o son el punto de partida hacia la diversificación de genes y proteínas?
Fig. 2. Esquema que representa la interrelación de los primeros compuestos orgánicos en la aparición y evolución de rutas metabólicas a través del tiempo. Los organismos sobreviven debido a su capacidad de transformar ciertos precursores de biomoléculas que intervienen en el metabolismo primario.

De esta manera, los organismos que fueran capaces de adaptarse a esas condiciones de compuestos limitados y que fueran capaces de sintetizar sus propios recursos a partir de componentes más sencillos, presentarían una mayor ventaja selectiva y esto sólo fue posible al instaurar diversas rutas metabólicas (Figura 2). EVOLUCIÓN RETRÓGRADA Lo anterior plantea dos escenarios posibles en la evolución de vías metabólicas, ambos contemplados en el siglo paFigura 1. por Horowitz en sado: el primero de ellos, propuesto Ejemplos de genes1945, hace hincapié en el modelo duplicados en “stepwise” o “evodenominado diferentes especies; se ilustran valores que lución retrógrada”, el cual explica que 11.2 por ciento, las van desde el la evolución de como fue precedida por una primeras moléculas enzimáticas en el caso del patógeno sehumano Haemophilus influenzae, rie de pasos en orden inverso a su producto final; es decir, hasta un 65 por ciento en en un proceso biosintético Arabidopsis thaliana. como resulsecuencial, que da

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

65 41

Figura interna; duplicación completa de genes; eran capaces o 4. Hipótesis de Jensen. Enzimas ancestrales duplicación ORIGEN COMÚN (i.e. aminoácido). La última tado un producto DE LOS SERES VIVIENTES enzima de de utilizar diferentes sustratos para dar lugar a diversos cromosomal tiempo, se especializaron hasta presentar En 1953, la primera en surgir; lade Watson la Crick, de la estras el descubrimiento segunda, y penúltima, la vía fue productos; con el parcial; aneuploidía o duplicación cromosomal y, finalmente, poliploidía o duplicación total del tructura del ADN, sePara tal efecto, los diversos intermeconfirmaron plenamente los postulados catálisis altamente específicas. y así sucesivamente. genoma. evolutivos de un origen rutas para todos los presentes diarios de las diferentes comúnse encontraban seres vivientes Los estudios de Ohno sobre este aspecto en par(Figura 2). La caracterización estructural del ADN abrió en la denominada Tierra primitiva. Esto surge al asumir una ticular fueron preponderantes, según él -basándose ventana en el investigaciones metabolito y estructurales que, cuando las precursor de unfilogenéticas disminuye, en las consideraciones teóricas de Serebrosky (1938). de las especies, lo cual llevó a para sintetizarlo a partir se requiere una nueva enzima contextualizar la evolución en Tras la duplicación de genes, mientras una copia términos moleculares y genéticos. de moléculas disponibles; esta nueva enzima poseerá la continúa realizando su misma función, la otra puede Con esto, se concluyó con dichas moléculas. Sin em- se que los procesos evolutivos no capacidad para interactuar modificarse mediante mutaciones para “asignar” restringen únicamente acción no necesariamente a caractebargo, su mecanismo de a las especies en cuanto estará una función diferente al producto que sintetiza. Esto rísticas fenotípicas se refiere, sino relacionado con la primera enzima. que abarcan los diferentes puede conferir una ventaja selectiva para el organisplanos de organización estructural de los organismos. De tal Esta postura es sumamente interesante y guarda ciermo en cuestión, evidenciando una máxima evolutiva: forma, órganos, tejidos, analiza en un cierto contexto la ta secuencia lógica, si se genes y proteínas se han modificado el surgimiento de una gran diversidad, a partir de esa lo largo del tiempo. Esto ha sido un factor importante para Tierra primitiva, ya que en un pasado remoto los únicos tructuras preexistentes; la frase de Milne Edwards la explicar los disponibles eran biomoléculas ya formadas; cambios macroevolutivos en términos de pasos compuestos naturaleza es prodiga en variedad, pero tacaña en inmicroevolutivos. los primeros organismos utilizaron estas moléculas como novación, podría adquirir una connotación más amplia si se contempla este aspecto de la evolución.

DUPLICACIÓN DE GENES Y EVOLUCIÓN DE NUEVAS FUNCIONES Como se mencionó con anterioridad, se ha establecido que la redundancia génica es un primer paso en la creación de genes con propiedades catalíticas y estructurales diferentes a los establecidos por un primer homólogo. Pues bien, tras una duplicación, pueden presentarse los siguientes escenarios: Figura 2. Todos los seres vivos presentan las mismas cuatro Pseudogenización: ocurre cuando hay pérdida bases nitrogenadas como parte constitutiva de su genoma, lo de función del gen duplicado, ya sea porque acumuló cual muestra una evidencia sólida de una diversificación en la que todos los organismos, como dijera Darwin, se encuentran mutaciones sobre su región codificante o regulatoria o “dentro de la misma red”. Las similitudes y diferencias de porque hay un silenciamiento debido a su localización nucleótidos que puedan presentar dos especies distintas, pueden telomérica. emparentarlas o alejarlas filogenéticamente. Subfuncionalización: ambos genes resultan ser necesarios para llevar a cabo la función original, deDUPLICACIÓN DE GENES, DETERMINANTE bido a que han acumulado mutaciones ya sea sobre su EN LA EVOLUCIÓN MOLECULAR región codificante, regulatoria, ambas, o simplemente En 1965, Zuckerkandl y Pauling propusieron que enzimas resu patrón de expresión es diferente, dependiendo la Figura 5. La duplicación génica puede estar relacionada condel lacionadas respecto a su catálisis o rutas metabólicas podían duplicación de metabólico en elSe observan dos enzimas que contexto vías metabólicas. cual se encuentra el orgaestar emparentadas filogenéticamente y, por consiguiente, catalizan pasos sucesivos en la biosíntesis de un metabolito pudieron haber evolucionado a partir de proteínas ancestra- particular, las cuales, después de duplicarse, realizan la en nismo en cuestión. misma catálisis, pero lapor dosis génica: después cambia; los Duplicación especificidad por el sustrato de que un les. Dicha hipótesis adquirió una gran relevancia, y posteriorprimeros pasos en la biosíntesis de leucina aneuploidía o poliorganismo haya presentado una y lisina sugieren una mente se convirtió en una herramienta imprescindible en los posible duplicación de este tipo. ploidía, la carga metabólica hacia la síntesis de eleanálisis filogenéticos. mentos tiene que repartirse entre las nuevas copias, También en 1965, Horowitz amplía su teoría de la evoconcentraciones pequeñas de genes, tenían cantidades como un efecto amortiguador ante dicho disposición lución retrógrada, y manifiesta que las enzimas pueden evolimitadas de enzimas; para contrarrestar esta aumento de Figura 3. Modelo dede la duplicación genética, por retención genes, o simplemente el excedente de un producto relucionar después Horowitz, de evolución retrógrada, que limitada de enzimas, enzimas “primitivas” debieron de ilustra la formación de vías metabólicas. sulta ser una ventaja. de su especificidad al sustrato y modificación de sus capaciposeer una amplia especificidad en la captación de sustraUn la formación fortuita de metabolitos ofreció dades catalíticas. tos; es decir, tercer aspecto concerniente a los genes, el parte fundamental de su metabolismo heterótrofo. Las diversas posturas sobre la las mismas, lo obvio a cual resulta ser controversial, es el de la NeofuncioAl presentarse un decremento de duplicación de genes y su esas células ancestrales una gran flexibilidad bioquímica importancia en que en vez de generar todos los pasos con nalización, según la cual genes. Estas enzimas fueron un mínimo contenido de un gen duplicado cambia lo sería considerarla evolución molecular encontraron eco en los suficiente como para presentar gran capacidad de trabajos de Ohno (1970) según síntesisla duplicación genética el cual, de compuestos re- altamente inespecíficas y tenían una una nueva función de una ruta metabólica para la completamente químicas similares en diferentes vías es el mecanismo principal en la innovación de genes de funqueridos, los organismos utilizaran los precursoresymás catalizar reacciones diferente a la del gen del cual proviene (Figura (Figura 4). ciones asociadas formar la última reacción requerida en metabólicas3). Sin embargo, tal cambio puede impedir una a sus productos. inmediatos para correcta asociación entre el de que se neofuncionaLas hipótesis de Horowitz ygen Jensen son compledicha síntesis (Figura 3). lizó y su responden que la cantidad de cambios sobre RELEVANCIA DE LA DUPLICACIÓN GÉNICA mentarias, y ancestro, yaa tiempos evolutivos diferentes; La preponderancia de la duplicación génica adquirió relevan- el caso de la primera, hay un análisis filogenéticoejemen su secuencia imposibilita una gran cantidad de entre HIPÓTESIS DEL MOSAISISMO cia de vez que existieron metodologías moleculares plosdichos genes y, por lo tanto, una relación homologías; donde enzimas adyacentes presentan evolutiva. Otrouna los argumentos importantes en la evolución y elque permitieron de caracterización específica de los genes; esto la las vías metabólicas fue propuesto por tales enzimas homólogas conforman las denominadas susurgimiento NUEVAS ESTRUCTURAS TOPOLÓGICAS llevó a en 1976, denominado relación del los tipos de prafamilias, que se encuentran ligadas metabólicamente, Jensen la comprensión sobre la hipótesisentre mosaisismo duPor que la segunda manifiesta un claro derroteros plicación y según tales como: duplicación de al poseer mientrasotra parte, además de los diferentesejemplo de (Patchwork),el ADN, el cual, células ancestrales, genes parcial

66 38

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO
entre otros, ilustran procesos exitosos de divergencia funcional por duplicación de genes (Figura 5).

con las cuales intentamos demostrar que unas etapas deben anteceder a otras, e ir construyendo con esas secuencias parciales una historia coherente. Seguramente existirán lagunas que no podremos llenar, pero hasta que no intentemos construir estas secuencias no las podremos identificar ni podremos encontrar solución a los problemas pendientes.” El descubrimiento de las propiedades catalíticas del RNA ha venido a llenar una de las lagunas de las que habló Bernal, y nos permiten reconocer la existencia del llamado mundo del RNA, que antecedió tanto a las proteínas como al DNA mismo. ¿Qué ocurrió después? Desde su origen mismo, la evolución de la biosfera y la del planeta han ido mano a mano. Hay un diálogo constante entre los organismos y su entorno, como lo muestra la aparición de la fotosíntesis, un fenómeno biológico que eventualmente duplicados. la atmósfera terrestre, enriqueciénFigura 3. Posible destino de los genes transformó(Tomado de Louis, 2007, Nature). dola en oxígeno. La acumulación del oxígeno permitió, a su vez, el surgimiento de nuevas rutas metabólicas, que pueden tomar los genes duplicados (i.e. inactivación, incluyendo la biosíntesis del colesterol. subfunción, especialización, etcétera), puede aumentar la A pesar de su mala fama, el colesterol es un comoligomerización de diversas proteínas sobre motivos parponente esencial de las membranas de células como ticulares y producir nuevas estructuras topológicas, melas de hongos, plantas y animales, y su presencia ha diante la fusión de marcos de lectura abiertos; escenario permitido el desarrollo de un complejo laberinto de que se ha contemplado para uno de los andamiajes más membranas que incluye al núcleo de nuestras células. estudiados en la actualidad: los llamados barriles (βα)8 o De hecho, la coevolución de la atmósfera terrestre y la TIM barrels. Este tipo de enzimas pueden identificar diferentes sustratos y llevar a cabo diversas reacciones con una pequeña cantidad de cambios en los residuos que intervienen en la catálisis. Debido a su capacidad catalítica, los barriles (βα)8 han sido una fuente importante de los estudios evolutivos actuales. Algunos de ellos sugieren que su origen fue a través de eventos de duplicación genética, los cuales determinaron a lo largo del tiempo la diversificación y especificidad de sustrato características de cada enzima. De tal forma, una posibilidad que explica el surgimiento de enzimas con topología (βα)8 se centra en un homodímero formado por dos medios barriles idénticos que, después de adaptaciones funcionales y estructurales, se especializaron hasta constituir los diferentes barriles (βα)8 que se conocen en la actualidad (Figura 4). Lupas et alii (2001) han considerado que ciertos eventos que recaen sobre el ADN pueden producir profundos cambios en las estructuras de las proteínas. Tal es el caso de la permutación cíclica, fenómeno relacionado también con la duplicación de genes, su posterior fusión y la presencia de deleciones parciales. Este proceso de permutación lleva a modificaciones topológicas en las proteínas y puede ser que en un pasado remoto fuera una vía importante en la innovación de nuevas proteínas, a partir de segmentos de ADN que codificaran para unos cuantos aminoácidos. Ejemplos como los de la mioglobina y la hemoglobina, la historia molecular del citocromo C y de las tubulinas,

biosfera ha convencido a muchos científicos de la necesidad de identificar moléculas de origen biológico en los planetas que giran alrededor de otras estrellas. ¿VIDA EXTRATERRESTRE? ¿Existe vida en otras partes del Universo? Los escritos de Darwin no discuten esta cuestión, pero sabemos que el origen de la vida en la Tierra no es resultado ni de un milagro ni de la casualidad, sino de un proceso de evolución. Las moléculas que sirven de precursores en experimentos como los de Miller son extraordinariamente abundantes en cometas y en las nubes de material interestelar de la Vía Láctea, en donde observamos la formación de estrellas, a menudo acompañadas de grupos de planetas. ¿En cuántos de estos cuerpos ha surgido la vida? ¿Existen, como creen algunos astrónomos como Frank Drake, otras civilizaciones en la Galaxia? O bien, como han sugerido Peter D. Ward y Donald Brownlee en su libro Rare Earth, ¿la aparición de formas inteligentes en el Universo es poco probable? Figura 4. Modelo que propone la posible evolución por duplicación génica de dos enzimas (HisA HisF) preguntas. En realidad, no tenemos respuesta ayestas las cuales participan en la biosíntesis de histidina. (Tomado de Lang et al., Es posible que no estemos solos en el Universo, pero pue2000, Science). de haber factores que nos hacen sobreestimar la probabilidad del surgimiento de la vida. Como escribió alguna vez el filósofo francés Blas Pascal: si la nariz de Cleopatra hubiera sido más grande, la historia del mundo hubiera podido ser diferente.

Figura 5. Árbol filogenético que ilustra la divergencia por duplicación génica de la tubulina ancestral hacia la tubulina y . Se observan las relaciones entre genes parálogos (aquéllos que se originan de una duplicación y se encuentran en el mismo organismo) y genes ortólogos (se encuentran en diferentes organismos y provienen de un mismo ancestro). (Tomado de Lodish et al. 2002, en Molecular Cell Biology).

SACCHAROMYCES CEREVISIAE: UN CASO ESPECÍFICO Como se ha mencionado, existen un sinfín de evidencias que proponen que la existencia de genes duplicados es una característica de todas las especies hasta ahora secuenciadas. Después de la secuenciación de la levadura Saccharomyces cerevisiae, se concluyó que existía una gran cantidad de elementos repetidos en su genoma, el cual está compuesto por 12 mil 068 kilobases, y la cantidad de genes que potencialmente codifican para diversas proteínas asciende a casi seis mil. Análisis posteriores llevaron a considerar que la cantidad de genes redundantes en Saccharomyces cerevisiae

66y39.indd 1

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

39 67

CONCLUSIÓN Los productos de los genes duplicados se encuentran en el centro de procesos biológicos de suma importancia en las especies, tales como el metabolismo del carbono, del nitrógeno, la biosíntesis de aminoácidos, o bien, actuando como activadores transcripcionales, definiendo vías de Geovani López señalización, incluso en el surgimiento de patologías. Con todo esto, se puede considerar que uando se habla de evolución, tal y como decía Opamás allá de ser los genes duplicados una tautología rin, se tiene que contemplar irremediablemente el biológica, han sido factores trascendentales en la origen de la vida en términos materialistas; es decir, evolución de los organismos, y han llevado a cabo la formación precedente de compuestos orgánicos que una gran diversidad de funciones, muchas de éstas dieron paso a los primeros organismos vivientes. Desde prácticamente desconocidas en la actualidad. que Virchow produjo su famosa frase Omnis cellula a cellula -toda célula proviene de una célula-, dejó en claro la imposibilidad de la generación espontánea, mas no así la interrogante acerca del origen de la vida. La teoría de la panspermia, formulada por Arrhenius en 1903, apenas trasladó a un contexto exobiológico dichaLang, D., Thoma,bienHenn-Sax, existen evidencias que interrogante; si R., es cierto M., Sterner, R. and Wilmanns, M. (2000). Structural evidence for evolution soportan una barrel scaffold by gene duplication and comof the β/α posible evolución molecular a partir de ponentes hallados289(5484): 1546-1550. fusion. Science en meteoritos denominados condritos carbonáceos, estas consideraciones no profundizan en la Li, W.-H.and Graur, D. (1991). organismos vivos. explicación sobre el origen de los Fundamentals of molecular evolution. Sinauer Associates, Inc. En 1933, Oparin propuso Sunderland Massachusetts. una teoría en la que estableció claves moleculares para el origen de la vida sobre Ohno, S. Evolution que, por poseer todos los organisla tierra; manifestaba by Gene Duplication. Heidelberg, Springer-Verlag. 1970. mos sustancias orgánicas, sin las cuales la vida sería inconcebible, J. S. and Raes, de (2004). Duplication and que Taylor, la formación J. esos componentes tuvo Divergence: The paso hacia New Genes la vida. Ideas. haber sido el primerEvolution of el origen de and Old Todas Annu. Rev. Genet. 38:615–43. esas sustancias partieron de compuestos simples como

Aproximaciones al origen de la vida y la evolución de vías metabólicas C
REFERENCIAS

difícilmente podía atribuirse a innumerables procesos de duplicación. De tal forma, la explicación plausible para esa interrogante era considerar que, paralelamente a duplicaciones independientes de genes, presentaba una duplicación total de su genoma. Wolfe y Shields (1997), al analizar regiones duplicadas sobre esta levadura, encontraron que existe un 16 por ciento de genes duplicados a lo largo de su genoma, los cuales corresponden a esa duplicación total acaecida hace 100 millones de años; la importancia fisiológica y evolutiva de tal duplicación pudo haberle concedido a Saccharomyces cerevisiae la adquisición de un metabolismo facultativo; esto es, la capacidad para sobrevivir en condiciones fermentativas y respiratorias, lo cual indicaría que determinados genes duplicados son regulados dependiendo del contexto metabólico, en este caso en especifico, de la fuente de carbono y de las condiciones respiratorias.

Fig. 1. Experimento de Miller y Urey (1953) en el que se pretendía recrear artificialmente las condiciones de la Tierra primitiva -tal como Oparin había propuesto- y la creación de ciertas moléculas claves en el origen de la vida. Después de pocos días de haber colocado diversos compuestos y en presencia de descargas eléctricas, se sintetizaron moléculas orgánicas como aminoácidos, carbohidratos, lípidos, entre otras. (Modificado de Panno, 2005).

Licenciado Geovani López Estudiante de doctorado / Instituto de Fisiología Celular / UNAM glopez@ifc.unam. mx

17/02/2009 05:27:28 p.m.

36

68

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

La morfología de los primeros humanos de la cuenca de México
José Concepción Jiménez López Gloria Martínez Sosa Rocío Hernández Flores n este trabajo se presentan las características morfológicas de una muestra de esqueletos que pertenecen a los primeros grupos humanos que poblaron la Cuenca de México. Para entender los procesos biológicos que han experimentado estos individuos, es importante interpretarlos como parte del origen y evolución del Homo sapiens sapiens en diferentes partes del mundo. Recordemos que cualquier población humana es parte del proceso evolutivo que se generó en África. Parte de este trabajo consiste en explicar, de manera general, qué eventos biológicos acontecieron en las poblaciones del Nuevo Mundo. No cabe duda que este tema es interesante, y la razón de por qué se han formulado una serie de teorías e hipótesis en relación con la evolución, origen y antigüedad de la población humana en América.

E

Antropólogo Físico Investigador José Concepción Jiménez López josejimenez_ daf@hotmail.com

Un polizón llamado Charles Darwin

POLIZÓN EN ROMA Ajenos a esas proclamas evolutivas, los inspectores del sistema de transporte público nunca se percataron de que, durante varias semanas, Charles Darwin viajó de polizón Antonio Lazcano Araujo por toda Roma. PRINCIPIOS DE LA EVOLUCIÓN HUMANA asta estudio de cualquier grupo humano, se debe tomar La teoría de la evolución nos permite evolutivas, las cuaEn elhace un par de meses, los autobuses urbanos que ginó una serie de transformaciones comprender el circulaban por las calles y avenidas de Roma llevaban origen ocasionaron nuevas modificaciones anatómicas imporen cuenta el proceso evolutivo, debido a que se trata de lesde la resistencia a los antibióticos, el surgimiento en fenómeno natural letreros de colores llamativos, de gripa un sus costados unos que permitió la adaptación, la cual latantes.aviar en Asia, así como el éxito (y los fracasos) Antropólogo de en determina que una especie sea exitosa. La evolución del las terapias con antirretrovirales que se aplican apara exFísico donde se leía: “Antibióticos sí, pero con cautela…” Esto le permitió desarrollar una capacidad las Investigador Es fácil comprender el origen de dicha campaña pu- personas infectas con el virus del SIDA, pero también nos hombre, a diferencia de los demás organismos, presenta plotar nuevos nichos ecológicos, con lo que adquirió los Gloria Martínez blicitaria,principios quepreocupación de médicosprincipio bio- elementos necesarios para sobrevivir fuera dede mi- en dos que refleja la la han caracterizado: el y autori- permite reconstruir la forma en que durante miles África, Sosa dades de salud por la rapidez con la que un número cada da llones de años los microorganismos se fueron diversas islas que Antropólogo Físico lógico y el principio cultural. El primero de ellos se a lugares como Europa y Asia, así como en diversificanInvestigador vez mayor de especies y cepas de microorganismos se ha do hasta dar origen a un número abrumador de especies través de la herencia genética, y el segundo se transmite a se encontraban separadas de la plataforma continental. que se adaptaron a una enorme diversidad de ambientes y vuelto resistente a la acción de los antibióticos. través del aprendizaje. En estos territorios, se produjeron ligeras modificaciones La producción industrial de la penicilina, que comen- terminaron modificando para siempre alse les hamismo. Para comprender de manera más puntual la evolu- anatómicas. Prácticamente a éstas planeta considerado zó hace apenas 70 años,desarrollado diferentes modelos que Estos grandes periodos evolutivos, que son otros. ción humana, se han inauguró una etapa nueva en como regionales, lo que distinguió a unos de el equila lucha contra las enfermedades origen del Homo sapiens; explican de forma detallada el infecciosas, pero no valente biológico a lo que Fernand Braudel llamó “la historia de larga duración”, SAPIENS tardaron de ellos es bacterias resistentes. uno en surgir el llamado multirregional, que plantea que APARICIÓN DEL HOMOal describir el mundo mediEl uso indiscriminado de los antibióticos, que en Méxi- terráneo, comenzaroneuropeo muestra rasgos que posteriorhubo un proceso por el cual nuestra especie es el resul- El Homo erectus hace unos cuatro mil millones de co y tadomuchos otros países se pueden adquirir y con- las mente caracterizaron alla Tierra. en de una transformación filogenética. A partir de años, al aparecer la vida en Homo sapiens de Neandertal; y Doctor Antonio sumir sin supervisión médica, el género Homo evolucionó gra- por otro lado, los Homo erectus africanos reflejan formas poblaciones ancestrales, nos ha permitido atestiguar Lazcano Araujo la rapidez con lahasta la selección natural ha llevado asapiens GRANDES Homo sapiens del tipo Cro-Magnon, que postedualmente, que llegar a convertirse en Homo la LOS típicas del AUSENTES Facultad de Rocío Los microbios son los grandes ausentes de la obra de Daraparición de y posteriormente en el hombre moderno. Ciencias arcaico, patógenos resistentes. riormente dio origen al Homo sapiens sapiens. Los restos Hernández Flores Es decir, los letreros de los autobuses romanos no eran win, que nunca discutió ni su evolución ni el origen de la Universidad Otro de los aspectos importantes es la migración que de este último han sido localizados en África, Europa y Dirección Nacional Autónoma de Sin embargo, su Occidental. De acuerdo a los registros nadase dio, desde el centro de suen pro de la salud públi- vida.en parte de Asia teoría se convirtió en la inspiración más un llamado de atención origen, hasta las diferentes Antropología Física de México ca, regiones del mundo. La dispersión del género Homo básica que llevó a Alexander I. Oparin, sapiens bioquímiInstituto Nacional sino también una declaración del poder explicativo de se arqueológicos, el Homo sapiens un joven apareció hace alar@correo.unam. de Antropología e teoría de evolución. mx co aproximadamente cien mil años, y hace inglés, la inició con la salida del continente africano, lo que ori- soviético, y a John B. S. Haldane, un genetistaunos 60a mil ó Historia

H

36y69.indd 1

CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES

69

70 mil llegó a varios rincones del planeta. Uno de los sitios distantes a donde llegaron los hombres fue Oceanía, durante el Pleistoceno superior. En esa época hubo un aumento de las masas polares, que permitieron el tránsito de estos grupos entre el sudeste de Asia y Australia. Las dos plataformas continentales que emergieron del mar y que fueron conformadas por varias islas, se conocen como Sunda y Sahul, donde se establecieron las posibles rutas de acceso al continente oceánico, hace alrededor de 40 mil años. El último de los continentes en ser poblado fue América. Sabemos que la llegada del hombre a este lugar ha generado una serie de polémicas entre los especialistas, sobre el origen, la antigüedad y las rutas que siguieron estos primeros grupos para ingresar al continente. RUTA DE INGRESO Se ha planteado que fueron tres las posibles rutas que utilizaron estos grupos para ingresar al Nuevo Mundo. En este caso, sólo mencionaremos la que tiene más aceptación, la cual argumenta que la migración fue por el Estrecho de Bering, debido a que durante esa época las condiciones medioambientales formaron en este lugar un puente de tierra que conectó la zona oriental de Siberia con Alaska. Las fechas que se han sustentado son entre los 30 mil y 20 mil años antes del presente, por lo que podemos decir que el Estrecho de Bering fue el punto de partida que tuvieron estos grupos humanos para poblar el continente americano. Para conocer el origen de los primeros hombres americanos, se ha sumado a estas investigaciones el estudio genético de las bases moleculares de los humanos, a través del ADN, con lo cual podemos conocer parte de la información de la historia de la evolución humana en diferentes niveles, que puede ser desde un individuo hasta una población. INFORMACIÓN GENÉTICA ANCESTRAL Los estudios del ADN han llegado a establecer cuatro sitios, dentro de la estructura donde se vincula la información genética ancestral de los nativos americanos. Esto se encuentra en cuatro linajes maternos que son el A- BC- D, los cuales se han rastreado y comparado con otras poblaciones de diferentes partes del mundo, con el fin de conocer si existe una filiación biológica con otros grupos. Con los resultados de estos estudios se ha llegado a establecer que los pueblos del noreste de Asia comparten la información genética con la población americana. Esta información genética apoya los resultados que se han obtenido de los estudios morfológicos que se han llevado a cabo en los esqueletos que pertenecieron a los primeros grupos que llegaron a la Cuenca de México. La Cuenca de México es un lugar dentro del territorio nacional en donde se han localizado más evidencias esqueléticas. De este sitio se tiene una muestra de 20 esqueletos humanos adultos y de ambos sexos. Para sustentar el origen y la antigüedad de estas evidencias humanas, se han aplicado métodos de distintas disciplinas, como la arqueología, genética, lingüística, geología, química y antropología física, entre otras.

ESTUDIO DEL ESQUELETO HUMANO El estudio del esqueleto humano reviste una importancia crucial, debido a que es el único medio para conocer las características anatómicas, genéticas, nutricionales y culturales, puesto que es el único material que se tiene de las poblaciones pretéritas. De esa forma, en este trabajo se presentan de manera general las características morfológicas que caracterizan a los esqueletos de los primeros pobladores de la Cuenca de México. Los rasgos morfológicos que se presentan con mayor frecuencia en restos esqueléticos del período precerámico, son más observables en los individuos del sexo masculino, ya que en el caso de los femeninos muestran características gráciles propias de su sexo. RASGOS MORFOLÓGICOS MASCULINOS Uno de los aspectos que se presentan y que pueden caracterizar a un espécimen americano antiguo, es la forma alargada del cráneo, conocida como dolicoide, ya que esta forma no se encuentra en las poblaciones prehispánicas. Sin embargo, es importante mencionar, que en estos grupos algunos individuos pueden tener el cráneo longitud media (mesocráneo).

Foto 1. Hombre de Texcoco.

En muchos casos, el hueso frontal es grande, con un torus orbitario prominente, lo que hace que se torne más huidizo. A nivel medio de esta zona, se encuentra desarrollada una quilla ósea que se dirige hacia atrás. Los arcos superciliares son muy marcados, con crestas laterales desarrolladas, órbitas de forma cuadrada con bordes redondeados y macizos; las escotaduras supraorbitarias e infraorbitarias son grandes. El maxilar es amplio y robusto, con prognatismo pronunciado. En los parietales, las líneas curvas son muy evidentes. En relación al hueso temporal, la cresta supramastoidea es prominente, la apófisis mastoides es grande y los arcos cigomáticos son muy pronunciados. Estos rasgos de

17/02/2009 05:24:21 p.m.

34 70

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO
resultados de la observación, pero que es homogénea con ellos. Gracias a ella, una serie de datos y de hechos independientes entre sí pueden relacionarse e interpretarse en una explicación unitaria. La teoría prueba su validez en la medida en que puede verificarse; se mide constantemente por el nivel de los hechos; cuando carece de ellos, manifiesta sus límites y su inadaptación. Entonces, es ne-cesario reformularla. Además, la elaboración de una teoría como la de la evolución, que obedece a la exigencia de homogeneidad con los datos de la observación, toma ciertas nociones de la filosofía de la naturaleza. Y, a decir verdad, más que de la teoría de la evolución, conviene hablar de las teorías de la evolución. Esta pluralidad afecta, por una parte, a la diversidad de las explicaFoto 4. Hombre del Metro Balderas. ciones que se han propuesto con respecto al mecanismo de la evolución, y, por otra, a las diversas filosofías a las RASGOS MORFOLÓGICOS FEMENINOS que se refiere. los esqueletos femeninos, son pocos los En lo referente a Existen también lecturas materialistas y reduccionistas, al igual que lecturas espiritualistas. ancaracteres morfológicos que están relacionados con suAquí el juicio tigüedad. compete propiamente a la filosofía y, luego, a la teología.5 Luego de enunciar el meollo epistemológico de la cuestión, enseguida plantea un argumento de antropología filosófica a ser tenido en cuenta en el debate: El Magisterio de la Iglesia está interesado directamente en la cuestión de la evolución, porque influye en la concepción del hombre, acerca del cual la Revelación nos enseña que fue creado a imagen y semejanza de Dios (cf. Gn 1, 28-29). La constitución conciliar Gaudium et spes ha expuesto magníficamente esta doctrina, que es uno de los ejes del pensamiento cristiano. Ha recordado que el hombre es ‘la única criatura en la tierra a la que Dios ha amado por sí misma’ (n. 24). En otras palabras, el hombre no debería subordinarse, como simple medio o mero instrumento, ni a la especie ni a la sociedad; tiene valor por sí mismo. Es una persona. Por su inteligencia y su voluntad, es capaz de entrar en relación de comunión, de solidaridad y de entrega de sí con sus semejantes. Santo Tomás observa que la semejanza del hombre con Dios reside especialmente en su inteligencia especulativa, porque su relación con el objeto de su conocimiento se asemeja a la relación que Dios tiene con su obra (cf. Summa Theol., III, q. 3, a. 5, ad 1). Pero, más aún, el hombre está llamado a entrar en una relación de conocimiento y de amor con Dios mismo, relación que encontrará su plena realización más allá del tiempo, en la eternidad. En el misterio de Cristo resucitado del Peñón revelado toda la profundidad y toda Foto 5. Mujer se nos ha III la grandeza de esta vocación (cf. Gaudium et spes, 22). En virtud de su alma espiritual, toda la persona,forma doliEstos especímenes presentan un cráneo de incluyendo su cuerpo, presenta el torus orbitarioXII había destacado coide; no se posee esa dignidad. Pío desarrollado como este masculinos; al el cuerpo poblaciones más origen en los punto esencial:igual que lashumano tiene surecienen presenta un frontal existe antes que él, pero el alma tes, la materia viva que abombado, con bordes supraorespiritual es creada inmediatamente por Dios (‘animas bitarios cortantes y demás rasgos propios de su sexo. Sin enim a Deo immediate creari catholica fides nos retinere embargo, en algunos casos también se puede observar una iubet’: encíclica Humani generis: AAS 42 [1950], p. 575). quilla ósea en la parte media del cráneo, como en el caso En consecuencia, las teorías de la evolución que, en de los masculinos. función de las filosofías en las que con prognatismo y en El maxilar es un poco robusto, se inspiran, consideran que el espíritu surgetambiénfuerzas de desgaste, menoso las piezas dentarias de las presenta la materia viva que se trata de en simple epifenómeno de esta materia, pronunciado que un los masculinos; sin embargo, en al

Foto 2. Hombre de Tlapacoya I.

Teniendo en cuenta el estado de las investigaciones científicas de esa época y también las exigencias propias de la teología, la encíclica Humani generis consideraba la doctrina del ‘evolucionismo’ como una hipótesis seria, digna de una investigación y de una reflexión profundas, al igual que Aztahuacan. Foto 3. Hombre de Santa Maríala hipótesis opuesta. Pío XII añadía dos condiciones de orden metodológico: que no se adoptara esta opinión como si se fuertes inserciones musculares. En cuanto a robusticidad son causados portratara de una doctrina cierta y de-mostrada, y grandes y pudiera un pronunciado abstracción de la las piezas dentarias, son como si sepresentanhacer totalmente desgaste oclusal, el cual puede causar la Revelación a propósito de en algunos casos llega hasta la desaparición del esmalte; las cuestiones que esa doctrina plantea. Enunciaba igualmente la condición necesaria para raíz, quedando expuesta la dentina, misma que puede presentar una coloración que esa opinión fuera la ausencia del apiñamiento sobre café oscuro. En estos esqueletos, es notoria compatible con la fe cristiana; o roeste aspecto volveré más adelante. tación de piezas dentarias, al igual que de afectaciones patológicas como caries Hoy, casi medio siglo después de la publicación de la encíy abcesos. clica, nuevos conocimientos robusta, con forma de heLa mandíbula de estos especímenes es grande,llevan a pensar que la teoría de la evolución es más que una todo en En efecto, es rradura y con marcadas inserciones musculares, sobre hipótesis.la región gonotable que esta teoría se haya impuesto paulatinamente nial. El tubérculo sinfisial se encuentra poco desarrollado, contrariamente a los al espíritu de los investigadores, a causa de una gonial tubérculos laterales. Las ramas ascendentes son anchas y altas, el ánguloserie de es recto, los cóndilos descubrimientos hechos en diversas disciplinas del saber. son grandes y la sínfisis es alta. Las piezas dentarias se La convergencia, de ningún comportan de la misma forma que las del maxilar. modo buscada o provocada, de los resultados de trabajos realizados independienteEl esqueleto poscraneal en general presenta rasgos de robustez, con evimente unos de otros, constituye presencia de rebordes dencia de fuertes incisiones musculares, ocasionando la de suyo un argumento significativo en favor de esta teoría. óseos, sobre todo en zonas articulares como la cintura pélvica, miembros supe¿Cuál es el alcance de dicha las actividades esta cuestión riores e inferiores. Esto se debe, probablemente, a teoría? Abordarque desarrosignifica entrar en el campo de de esta población de llaban estos individuos. Finalmente, la estatura promediola epistemología. Una teoría es una elaboración metacientífica, diferente de los masculinos se encuentra alrededor de 1.70 metros.

CONOCIMIENTO CONOCIMIENTO
gunos casos queda expuesta la dentina; tampoco hay roson incompatibles con la verdad sobre el hombre. Por otra tación de teorías son incapaces de fundar la dignidad de parte, esas piezas dentarias. La mandíbula es grácil; la sínfisis es corta y poco prola persona. Yminente; el desarrollo de los tubérculos laterales es ligero; Juan Pablo II culmina especificando una arquitectura del por arriba de éstos se forman dos juicio en fositas. conocimiento, pertinente a nuestro pequeñastiempos posEn general, los esqueletos femeninos son mucho más modernos y postseculares: gráciles refiriéndonos al hombre, podríamos decir para Así pues, que los masculinos y la estatura promedio que esta población es de una diferencia de orden ontológinos encontramos ante1.53 metros. En un salto ontológico. Pero, plantear esta disconco, anteconclusión, se puede decir que los esqueletos humanos ontológica, ¿no significa afrontar se puede conotinuidadson evidencias tangibles, con lo quela continuidad cer una serie de características biológicas y culturales. física, que parece ser el hilo conductor de las investigaLos esqueletos de estos esto en el plano de la física ciones sobre la evolución, y individuos estudiados presenytan rasgos morfológicos propiosdel su temporalidad, prinla química? La consideración de método utilizado en cipalmente campos del como la forma, el torus acuerdo los diversos en el cráneo,saber permite poner de orbitario, la puntos de vista, que abrasión dental y la notable rodosquilla ósea, la excesivaparecerían irreconciliables. Las bustez, esta última, particularmente en los cada vez con ciencias de la observación describen y miden del sexo masculino. mayor precisión las múltiples manifestaciones de la vida y las inscriben en la línea del tiempo. El momento del paso a VARIACIÓN ANATÓMICA una observación de este tipo lo espiritual no es objeto de REGIONAL Tomando como referencia la forma del cráneo, se puede que, sin embargo, a nivel experimental, puede descubrir inferir que signos muy valiosos del carácter específico una serie de las poblaciones prehispánicas no descienden de estos primeros grupos, o que en 12 mil 700 años se diedel ser humano. ron algunos cambios en lasaber metafísico, la de de conPero la experiencia del estructura anatómica la estas poblaciones, de su índole reflexiva, la como una variaciencia de sí ylo que se puede considerarde la conciencia ción anatómica de tipo regional. moral, la de la libertad o, incluso, la experiencia estética Otro de los aspectos que llama la atención es la esy religiosa, competen al análisis y la reflexión filosóficas, tatura promedio de estos individuos, en los masculinos mientras que la teología deduce el sentido último según 1.70, y 1.53 del Creador. los designios metros para los femeninos. Estos valores difieren con los de la población prehispánica, en los CON talla es menor. Al 4. EDUCACIÓNque laSENTIDO CRÍTICOrespecto, se puede decir que, probablemente, en Y EDUCACIÓN RESPONSABLEesta época existió una mejor alimentación, a diferencia campos de conocimiento de Una vez reconocidos ambosde los individuos del periodo prehispánico, si entonces buena alimentación órdenes la única realidad,es que una podremos distinguires la detonadora de la estatura o bien, si ésta la humanidad vuelva de conocimiento y de acción, donde tiene una relación con ala carga genética. papel de cuidadora de este mundo en comprender su En cuanto a la dentición, los individuos masculinos son evolución, promoviendo primero su preservación como los que presentan un mayor desgaste, el corazón de ese ecosistema, para luego plantearse en en algunos casos en forma de pertinencia de no generó infección alguna que proceso, labisel, por lo quela libertad y la inteligencia huprovocara la pérdida de alguna responsable, para se puemanas, mediante el uso crítico ypieza o más; lo queenconde el sentido una periodontitís. trar apreciar estrascendente de lo real. En las mujeres sólo de aquel rector europeo con el Volvamos al discursoexiste un desgaste muy marcado sin presentar el tipo de bisel. que iniciamos esta reflexión: Esto puede indicar que ambos comían el mismo tipo de alimentos. “En el creacionismo, la teoría de la evolución encontró El biselado en los hombres posiblemente se deba un adversario que buscaba una disputa sobre un terrenoa que los utilizaron origen de las especies. Pero noinstrucomún; es decir, el para elaborar algunos de sus tenía mentos de que fuesen del mismo valor intelectual. La argumentos trabajo, lo que indicaría que desde estos tiempos ya había permanece: del trabajo en en siete días, o oposición durauna división o bien creación estos grupos de la cuenca de México. bien evolución. O bien uno de los dos contrincantes es deFinalmente, bien asistimos a reedición de la existe rrotado, muerto, oen esta muestralaesquelética no teoría evidencia de alguna enfermedad que dejara huella en el medieval de la doble verdad. Una variante moderada de hueso, con fue expresada recientemente en que probableesta querellaexcepción de procesos artríticos Zurich. Creamente fueron ocasionados por una sobrecarga de trabajo ción y evolución serían enseñadas en las escuelas de ese físico según la propuesta que es donde principalmente cantón,en las articulaciones,de algunos legisladores. Pero se presenta. el postulado fue rechazado por el gobierno cantonal. En la Sin embargo, sí es frecuente la creación se basa de prensa podía leerse: ‘La doctrina de encontrar vestigios en traumatismos en el cráneo y fracturasla teoría de la evofundamentos religiosos, mientras que en costillas, huesos del pie y manos, que pudieron ser provocados por la aclución intenta, sobre una base científica, dar respuestas tividad que desarrollaban, la pregunta por recolección, lo más precisas posibles a como la caza y lael origen y elo bien fueron causados de enfrentamientos. desarrollo del mundo ypor la vida. A causa de tales acerca-

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

71 35

mientos diferentes, creación y evolución pertenecen a materias diferentes en la educación: la teoría de la evolución a la materia Realia’ y la doctrina de la creación a la materia Religión y cultura. Porque soy teólogo, y no a pesar de serlo, también me hubiese unido al rechazo de este postulado. Alberto el Grande, cuya fiesta constituye el marco de nuestro Dies Academicus, estimado Mister Darwin, habría encontrado en usted un espíritu emparentado con el suyo. Baste recordar sus observaciones sobre la naturaleza, las plantas y las aves. Él también se habría indignado y habría rechazado tal alternativa. Si la teoría de la evolución es verdadera, ella obliga a la teología también. Pero, ¿acaso es verdadera? ¿Es ella toda la verdad?”6 Tal vez convenga promover en la universitas posmoderna una síntesis cognitiva que intregre la apertura crítica y al mismo tiempo permita distinguir órdenes del conocimiento sobre una realidad compleja pero unitaria, con rigor de análisis empírico y lógico, pero también con capacidad especulativa para discernir los sentidos de la verdad. En suma, la educación ha de generar habilidad sapiencial en estudiantes y profesores, como personas inteligentes y libres, conscientes de un mundo complejo y maravilloso que hemos de preservar como habitat y como don.

Pie de Página
1 DARWIN Charles. El origen de las especies por medio de la selección natural (Londres: John Murray 1859), tomo I, Introducción. URL: http://www. cervantesvirtual. com/servlet/ SirveObras/1355 96202120264952 22202/p0000001. htm#1 [Fecha de consulta: 5 de febrero de 2009]. 2 Íbid., tomo III, cap. XV. URL: http://www. cervantesvirtual. com/servlet/ SirveObras/1355 96202120264952 22202/p0000016. htm#20 [Fecha de consulta: 5 de febrero de 2009]. 3 VERGAUWEN Guido. Zufällig geworden - nés à l’aventure. Darwin revisited, n. 1. URL: http://www.unifr.ch/ iso/iso020105de. htm#darwin [Fecha de consulta: 4 de febrero de 2009]. 4

PIO XII. Carta Encíclica Humani Generis. Sobre las falsas opiniones contra los fundamentos de la fe católica (12 agosto de 1959). URL: http://www. vatican.va/holy_ father/pius_xii/ encyclicals/ documents/hf_pxii_enc_12081950_ humani-generis_ sp.html [fecha de consulta: 4 de febrero de 2009].

5 JUAN PABLO II. Discurso a la Asamblea Pleanaria de la Academia Pontificia de Ciencias (22 de octubre de 1996). URL: http://www. vatican.va/holy_ father/john_paul_ii/ messages/pont_ messages/1996/ documents/hf_jpii_mes_19961022_ evoluzione_sp.html [Fecha de consulta: 4 de febrero de 2009]. 6 VERGAUEN Guido. Op. Cit., n. 2.

Cuenca de México.

72 32

EVOLUCIÓN LAS ESPECIES EVOLUCIÓN DEDE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

Aplicaciones de la genética de poblaciones en las ciencias genómicas
Doctor Ricardo M. Cerda-Flores Genetista de Poblaciones Investigador Titular del CIBIN-IMSS Maestro de la Facultad de Enfermería / UANL. ricardocerda_ mx@yahoo.com.mx Ricardo M. Cerda-Flores La síntesis evolutiva moderna (también llamada simplemente nueva síntesis, síntesis moderna, síntesis evolutiva, teoría sintética, síntesis neodarwinista o neodarwinismo), en general significa la integración de: 1. La teoría de la evolución de las especies por selección natural de Charles Darwin. 2. La teoría genética de Gregor Mendel como base de la herencia biológica. 3. La mutación genética aleatoria como fuente de variación. 4. La genética de poblaciones matemática.

miten de hecho, sin discreción y sin prudencia, el sistema evolucionista, aunque ni en el mismo campo de las ciencias naturales ha sido probado como indiscutible, y pretenden que hay que extenderlo al origen de todas las cosas, y con temeridad sostienen la hipótesis monista y panteísta de un mundo sujeto a perpetua evolución.4 Y más adelante, en el número 29, el mismo Pío XII llega a recomendar incluso la necesidad del debate con esas ideas “evolucionistas”: Por todas estas razones, el Magisterio de la Iglesia no prohíbe DE POBLACIONES GENÉTICAel que —según el estado actual de las ciencias y Lala teología— poblaciones es la rama dedisputas, entre los genética de en las investigaciones y la genética cuya hombres más describir la de entrambos campos, bioproblemática es competentes variación y distribuciónsea objeto con el objeto doctrina del evolucionismo, en cuanto lógica, de estudio lade dar explicación a fenómenos evolubusca el origen del a una población en una materia viva tivos. Para ello, define cuerpo humano como un grupo de preexistente —pero la fe católica manda defender que las individuos de la misma especie que están aislados reproalmas son creadas inmediatamente por Dios—. Mas todo ductivamente de otros grupos afines. Estas poblaciones ello ha de a cambios evolutivos, las razones de una están sujetashacerse de manera queen los que subyacen y otra opinión —es los que a su vez están influenciados cambios genéticos, decir la defensora y la contraria al evolucionismo— sean examinadas y juzgadas seria, genética, por factores como la selección natural y la derivamoderada y templadamente; y con tal disminuyendo la variabilidad que actúan principalmente que todos se muestren dispuesdetos a poblaciones, o migración Iglesia, a quien Cristo conlas someterse al juicio de la y mutación, que actúan firió el encargo aumentándola. de interpretar auténticamente las Sagradas Escrituras y defender los dogmas de la fe. Lo que parecía estar en juego en esta áspera disputa de mediados del siglo pasado era la confrontación entre una visión crítica de la realidad empírica en pos de las leyes que rigen la relación de las especies biológicas por una parte, y una interpretación filosófica y teológica que defendía el azar y la libertad de la creación y del Creador por otra. ¿Se trataba realmente de una visión opuesta de la realidad contra otra? ¿O acaso en esos mismos debates existía una posibilidad de conceder a cada una su significado propio en la ardua tarea de dar razón de lo real en su complejidad? Un siglo atrás, tanto Darwin como el téologo Hodge apelaban a la verdad de su propia interpretación, y a lo más que llegaron en ese momento fue a conceder que cada uno era un ámbito autónomo del conocimiento. Esa tajante distinción entre el conocimiento crítico y la creencia religiosa como dos mundos separados ha sido el traumatismo de la razón occidental, que sumió a las sociedades modernas en una disociación estéril entre racionalidad y creencia. Tal ruptura, a principios del siglo XXI, parece ser reeditada en una nueva versión que opone ambos enfoques en unaque la pérdida defomenta la discordia. Cabe destacar beligerancia que variabilidad genética en las poblaciones trae consigo dos graves problemas: 1. 2. DETERMINISMO VERSUS FUNDAMENTALISMO Coarta la posibilidad de que el hombre realice mejoEl reduccionismo de la ciencia experimental moderna raramiento genético en especies de interés comercial y/o dica en la pretensión de interpretar lo real según sus coorrecreativo, y 2. denadas espacio-temporales y, en consecuencia, a la mateDisminuye la eficacia biológica (fitness) de las espematización de cambios ambientales. cies ante nuevosla realidad como único criterio de verdad. Sus albores especulativos se remontan al Renacimiento italiano, pero adquirirá carta de ciudadanía congenética Por otra parte, la presencia de variabilidad el triunfo esde la mediciónsólo para sobre las deducciones metafísicas deseable no empírica el mejoramiento genético o la que entraban las especies, ya con el datos de la expeconservación deen contradicción que losrol fundamental deriencia; por ejemplo, en el caso de materia primay para la variabilidad genética es ser la la diversidad correlación de las especies sin variabilidad no hay evolución. los procesos evolutivos:biológicas que hoy nos ocupa. Cierta Laidea mecanicista como principio de explicación del uniinteracción de estos factores con las poblaciones en el

Las figuras importantes en el desarrollo de la síntesis moderna incluyen a Thomas Hunt Morgan, Ronald A. Fisher, Theodosius Dobzhansky, J.B.S. Haldane, Sewall Wright, William Donald Hamilton, Cyril Darlington, Julian Huxley, Ernst Mayr, George Gaylord Simpson, y G. Ledyard Stebbins. Esencialmente, la síntesis moderna introdujo la conexión entre dos descubrimientos importantes: la unidad de la evolución (los genes) con el mecanismo de la evolución (la selección). También representa la unificación de varias ramas de la biología que anteriormente tenían poco en común, especialmente la genética, la citología, la sistemática, la botánica y la paleontología.

32y73.indd 72y33.indd 1 1

CONOCIMIENTO CONOCIMIENTO
verso tiempo, permite la existencia de gran número de espese iba imponiendo en la experimentación científica; cies con variadas estructuras poblacionales de la caupero cuando se transfirió al plano ontológico yy formas de vida. filosófica, generó una ruptura epistemológica que salidad Así, la genética de poblaciones es un elemento esencial de la nuestros días. perdura hasta síntesis evolutiva moderna. En un La especie humana, deel descubrimiento de la ley de sentido más positivo, más de seis mil millones de inla dividuos en la actualidad, se divide en caucásicos, negros evolución puso en entredicho prejuicios “creacionistas” y afirmaban un intervencionismo divino para garantizar que asiáticos. Estos tres grandes grupos, con características la genéticasde la causalidad. Pero no resolvió el problema y libertad claramente distinguibles, se denominan razas, cada una de ellas está formada de la creación. Por ese del azar y la libertad como partepor numerosos subgrupos poblacionales, con ligeras la insuficiencia del planmotivo, podemos decir quediferencias genéticas entre sí, denominados grupos étnicos. teamiento evolucionista radica en extrapolar su hipótesis al orden ontológico de los seres; es decir, que, en SELECCIÓN la MUTACIONES cuanto saber, DEcorrelación filosófica queda entrecortaLa diversidad genética con el estatuto trascendente da, más aún la correlación entre razas y subpoblaciones tiene su de lo real. origen en las mutaciones. El establecimiento de las diferencias genéticas entre las poblaciones se produce Por otra parte, el cristianismo moderno rechazó en su como resultado de la evolución, porque veía en ella una momento la teoríade la selección de mutaciones, en respuesta a condiciones del cosmos, en la lógica de la seculacomprensión atea ambientales regionales, a la perpetuación de mutaciones neutrales específicas y aun de contraria rización del pensamiento occidental ilustrado, mutaciones nocivas, además del grado de reproducción aislada entre a la afirmación de fe que reconoce que el mundo es fruto delos grupos. un deseo amoroso del Dios vivo y que tiene su fuente y Existen diferencias muy marcadas entre grupos potérmino en ese Misterio de donación. No fue capaz en su blacionales en las frecuencias alélicas, tanto del genes momento, el cristianismo occidental de inicios parasiglo causantes de enfermedades, como para marcadores genéXX, sobre todo católico, pero también protestante, de disticos entre teoría de la evolución y presupuestos filosótinguir neutrales selectivos, como lo son ciertos grupos sanguíneos, algunos polimorfismos separar del de DNA. Los ficos. Tal vez porque no se pueden proteicos y todo. primeros que muy sí podemos apreciar, a siglo y me-de Pero lo son hoy significantes para la determinación riesgos de recurrencia de enfermedades genéticas en podio de distancia, es que la teoría de Darwin requiere ser blaciones en un orden filosófico son otro teológico, completada específicas, y los últimos y enimportantes como marcadores de la evolución humana reciente. de manera que pueda irse más allá de la visión fundamentalista de la creación, que no fue sino simple reacción alérgica a un planteamiento que cimbró las bases ideológicas del orden establecido. En tiempos más recientes, la teoría del intelligent design, en boga sobre todo en ciertos círculos fundamentalistas estadunidenses, pretende servir a la idea de creación, rebatiendo la idea de evolución como ley fatal de la rivalidad, sin distinguir de nueva cuenta que lo verdaderamente esencial de la fe cristiana no es la afirmación de un intervencionismo divino en la creación, sino el reconocimiento de la finalidad libre y gratuita con la que Dios ha deseado planificar su obra por la participación de su ser y la encarnación de su Verbo. 3. POR UNA COMPLEMENTARIEDAD DE LAS CIENCIAS Y LAS HUMANIDADES La modernidad tardía, a cien años de la teoría de la evolución y de la crisis modernista en el mundo católico, se encuentra en posibilidades de superar la vieja oposición, para dar paso a un debate crítico en ambos sentidos, de manera que la ciencia empírica dé sus aportaciones pertinentes sobre los mecanismos de evolución de las especies, al mismo tiempo que la filosofía y la teología, junto con las demás ciencias sociales, debaten críticamente la problemática del sentido, la alteridad, la libertad y la apertura a la trascendencia, propias de la creación. En este sentido, el Papa Juan Pablo II, en su Discurso a la Academia Pontificia de Ciencias en 1996, afirmaba:

EVOLUCIÓN LAS ESPECIES EVOLUCIÓN DEDE LAS ESPECIES

33 73

INDIVIDUALIDAD GENÉTICA Cada individuo es genéticamente único. Esta individualidad radica en las variaciones que se presentan dentro de su secuencia nucleotídica de manera silenciosa; es decir, sin provocar enfermedad. Sin embargo, cada individuo mantiene las características genéticas de la raza y subpoblación (grupo étnico) al cual pertenece. Las mutaciones nocivas que producen cambios fenotípicos son fácilmente detectables. Pero un gran número de mutaciones son selectivamente neutras, no causan daño y no se manifiestan fenotípicamente. En estas últimas, la variación se localiza en regiones extragénicas o no codificantes o en regiones heterocromáticas de los cromosomas. En el transcurso de la evolución, el flujo constante de nuevas variaciones nucleotídicas ha asegurado un alto grado de diversidad e individualidad genética. Ésta puede manifestarse como cambios en el patrón de tinción de los cromosomas (heteromorfismos cromosomales), variaciones proteicas (Ejemplo: grupos sanguíneos), o cambios nucleotídicos en diversas regiones del genoma (SNPs). Estos cambios se observan en color gris: T T A A T T C C G G C C G G T T A A C C A A G G

T T

A A

T T

C C

G G

T T

G G

T T

A A

C C

A A

G G

La identificación de individuos se ha realizado tipificando diferentes marcadores genéticos no moleculares (antígenos de los grupos sanguíneos, los del complejo mayor de histocompatibilidad, isoenzimas y proteínas séricas) y moleculares (VNTRs, RFLPs, RAPDs, SNPs, CNVs) los cuales tienen un alto grado de discriminación e identificación.

17/02/2009 05:23:56 p.m. 17/02/2009 05:28:09 p.m.

74 30

EVOLUCIÓN LAS ESPECIES EVOLUCIÓN DEDE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

La identificación de individuos se ha realizado tipificando diferentes marcadores genéticos no moleculares (antígenos de los grupos sanguíneos, los del complejo mayor de histocompatibilidad, isoenzimas y proteínas séricas) y moleculares (VNTRs, RFLPs, RAPDs, SNPs, CNVs) los cuales tienen un alto grado de discriminación e identificación.

Frecuencias alélicas (%) para el marcador D1S80 en mestizos.
Alelo N 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 34 35 36 37 38 41 Heterocigocidad Nuevo León 103 0.97 3.88 0.48 23.30 3.40 0.98 2.43 1.46 1.94 20.39 7.77 2.43 0.00 7.28 5.34 7.28 7.77 0.97 0.97 0.00 0.48 0.00 0.00 0.48 0.878 Jalisco 63 0.00 1.16 0.39 30.21 0.39 1.55 2.33 1.55 0.39 29.07 6.98 1.16 0.78 5.04 2.33 5.81 9.30 0.39 0.00 0.39 0.39 0.39 0.00 0.00 0.806 México 230 0.00 2.20 0.40 32.20 0.40 0.90 1.30 1.50 0.20 20.90 9.60 1.70 1.50 5.90 5.00 8.00 6.30 0.70 0.70 0.20 0.20 0.00 0.20 0.00 0.827

Un gran número de proteínas diversas son utilizadas como marcadores genéticos, cuya utilidad depende de la variabilidad heredable del DNA que las codifica. Actualmente, la tipificación del DNA se utiliza como una herramienta poderosa para la identificación de individuos con mayor poder predictivo que el de las pruebas serológicas. Gran cantidad de genes se caracterizan por tener un número relativamente común de alelos, que permiten clasificar a los miembros de una población originada naturalmente dentro de fenotipos finamente distinguibles. Un polimorfismo genético se define cuando un gen tiene múltiples alelos y al menos dos de ellos tienen frecuencias mayores al uno por ciento entre la población y cuando la frecuencia de heterocigotos en la población es de al menos dos por ciento. No obstante, debido a que muchos locipolimórficos se caracterizan por tener un alto número de alelos diferentes, la proporción de heterocigotos es mucho mayor. A los alelos con frecuencias menores de uno por ciento se les llama variantes raras. (http://uwadmnweb.uwyo.edu/zoology/mcdonald/molmark/index.html#Fdemo).

Creación y evolución: azar y necesidad
Carlos Mendoza-Álvarez Nuevo León Jalisco México

Frecuencias alélicas (%) para el marcador HLA-DQA1 en mestizos.
Allele N 1.1 1.2 1.3 2 3 dades, de otras especies. […] Estoy completamente convencido de que las especies no son inmutables y de que las que pertenecen a lo que se llama el mismo género son descendientes directas de alguna otra especie, generalmente extinguida, de la misma manera que las variedades reconocidas de una especie son las descendientes de ésta. Además, estoy convencido de que la selección natural ha sido el medio más importante, pero no el único, de modificación.1 El famoso científico y viajero no desconocía la posibilidad de que su teoría de la evolución de las especies fuese compatible con la afirmación teológica de un Dios creador, como lo atestigua al final de su obra No veo ninguna razón válida para que las opiniones expuestas en este libro ofendan los sentimientos religiosos de nadie. Es suficiente, como demostración de lo pasajeras que son estas impresiones, recordar que el mayor descubrimiento que jamás ha hecho el hombre, o sea la ley de la atracción de la gravedad, fue también atacado por Leibnitz ‘como subversiva de la religión natural y, por consiguiente, de la revelada’. Un famoso autor y teólogo me ha escrito que ‘gradualmente ha ido viendo que es una concepción igualmente noble de la Divinidad creer que Ella ha creado

PARA IR MÁS ALLÁ DE LOS 63 PREJUICIOS 103 230 ciento cincuenta años de la publicación de la obra de 8.74 15.87 8.50 10.19 3.97 8.50 Charles Darwin: El origen de las especies por medio de 4.85 3.18 2.00 la selección natural, se realizan en todo el mundo con13.59 10.32 5.40 memoraciones científicas, intelectuales y culturales, con 24.27 26.98 31.70 frecuencia marcadas por la ideología de grupo, sea para 4 38.35 39.68 43.9 afirmar la superación de la “edad oscura” de la humaniHeterocigocidad 0.759 al fin por la ciencia empírica de sus ataduras 0.737 0.691 dad, liberada religiosas; sea, por el contrario, para defender “los derechos de Dios” ante los ataques de una racionalidad atea y Probabilidad de un simple manipuladora. locus: D1S80 heterocigoto 16/18 = 2(0.0388)(0.2330) = 0.0180808 Darwin mismo escribió el objetivo de su investigación HLA-DQA1 heterocigoto 1.1/1.2 = 2(0.0874)(0.1019) = 0.01781212 en los siguientes términos: Probabilidad para un perfil de DNA multilocus: Al considerar el origen de las especies se concibe per(0.0180808) (0.01781212) = 0.000322 fectamente que un naturalista, reflexionando sobre las Doctor Carlos Mendoza-Álvarez En otras palabras, tres deafinidadesmil individuos en Nuevo León tendrán el sus relacada diez mutuas de los seres orgánicos, sobre mismo perfil paraUniversidad estos dos marcadores genéticos, que están en equilibrio de Hardy-Weinberg ciones embriológicas, su distribución geográfica, sucesión y en equilibrio de fase gamética. Las frecuencias génicas fueron obtenidas de CerdaIberoamericana geológica y otros hechos semejantes, puede poder a Flores y Cols., México para D1S80 y HLA-DQA1. Si utilizáramos 13 STRs, el llegar de la Ciudad de 2002a discriminación sería de 1 en 2,830,000,000,000,000 de individuos, y la probabilidad de carlos.mendoza conclusión de que las especies no han sido independienteexclusión, en @uia.mx caso de paternidad, de 1 en 8,900,000 (Cerda-Flores y Cols., 2002b). mente creadas, sino que han descendido, como las varie-

A

30y75.indd 74y31.indd 1 1

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN LAS ESPECIES EVOLUCIÓN DEDE LAS ESPECIES

31 75

MARCADORES de formas primitivas capaces de transun corto número GENÉTICOS Los polimorfismos se en otras formas necesarias, como formarse por sí mismas utilizan como marcadores genéticos que permiten distinguir el acto nuevo de creación gen creer que ha necesitado un patrón de herencia de un paraen estudios familiares. Tienen aplicación práctica leyes’.2 llenar los huecos producidos por la acción de susen: a)Sin embargo, y mapeo de genesaquella publicación Localización la discusión que en cromosomas individuales hizo posible a mediados del siglo XIX, está memorablemediante estudios de análisis de ligamiento. b) El diagnóstico concluido en nuestros días. Como lo aún lejos de haber presintomático y prenatal, así como en la detección poco un rector de una universidad eurorecordaba hace de portadores (heterocigotos) de enfermedades genéticas. pea, al conmemorar el debate abierto por Darwin -y hay c) La evaluación del riesgo en personas hablaba a que precisar que se trataba de un teólogo que con predisposición a desórdenes, como preguntas siguen pencientíficos y humanistas- muchasenfermedades coronarias, cáncer dientes: y diabetes, entre otras. d)Todo comenzó probablemente, Mistercasos de con Estudios de paternidad, forenses y Darwin, inmigración. en la Abadía de Westminster, Sir Isaac Newton. su vecino e) Establecer la llamado a su ley de la gravitación, ‘el Usted mismo había compatibilidad donador-receptor para realizar transplantes de tejidos y órganos. más grande descubrimiento que jamás hombre alguno ha f) La Newton presentaba una interpretación mecanihecho’. identificación de gemelos idénticos. g)Recientemente, el uso de bloques haplotípicos que cista de la naturaleza: su modelo era determinista y él lo serán como una explicación medicina genómica Un entendía de gran utilidad en lacompleta del mundo. [New England Journal of Medicine (http://content.nejm.org/ eco semejante se encuentra en la autobiografía que usted misc/genmed.shtml). veces encontré buscar más inforescribió, en la cual variasAquí se puede esta frase: ‘Everymación sobre medicina genómica, laws’. No solamente thing in nature is the result of fixed en forma gratuita, por los editores Alan E. Guttmacher y Francis S. Collins]. los teólogos se sintieron incomodados, dado que veían en

poblaciones mestizas (contribución de poblaciones caucásicas, indígenas y africanas) sino también las indígenas. Los estudios de genómica de poblaciones requieren, para el desarrollo de la medicina genómica, de dos aspectos: primeramente, del conocimiento de la estructura haplotípica de la población humana a estudiar, y, posteriormente, de estudios de asociación que identifiquen los factores de riesgo genético para determinada enfermedad, con fines de diagnóstico y tratamiento. TAREA COMPLEJA Y COSTOSA La secuencia del genoma humano, si bien permite conocer la secuencia de los genes humanos y su ubicación dentro del genoma humano, también ha hecho evidente la gran variabilidad que existe en la secuencia entre individuos. Esfuerzos adicionales hicieron posible conocer que existen entre seis y diez millones de posiciones en el genoma humano en que puede haber variaciones de un solo nucleótido (SNPs). Algunas de estas variaciones confieren susceptibilidad o resistencia a enfermedades comunes; otras sirven como marcadores dentro de la secuencia del genoma humano. La identificación de estas variaciones en cada individuo resulta de gran importancia para el desarrollo de la fase aplicativa de la medicina genómica; sin tear en México el debate entre científicos y humanistas, deembargo, que contribuyamos todos a una más acabada manera la tecnología disponible hasta el momento hace de esta una la compleja realidad del cosmos y de su percepción de tarea extraordinariamente compleja y altamente costosa. sentido trascendente, donde el ser humano tiene un papel Recientemente, se ha identificado que y su preservairreemplazable para el cuidado del planetala recombinación del material sistema (durante la producción de gametos) ción como un genético de mecanismos, pero también de no ocurre al azar, sino que ocurre en sitios específicos, sentidos y significados que nos orientan a una realización lo que da integral. lugar a bloques conservados de material genético que se heredan de generación en generación. Esto significa 1. que en lugar de tenerINTERPRETACIONES? SNPs de un ¿UN CONFLICTO DE que conocer todos los segmento del conflicto entre ciencia moderna y fe reBuena parte de DNA; por ejemplo, alguno con 100 SNPs, el conocimiento el siglo ocho SNPs en ese bloque serviría ligiosa nació en de seis u XVI, cuando Galileo sostuvo el para conocer junto con los SNPs que se heredan en de heliocentrismo, el resto de la tesis de la inmutabilidad cada bloque o haplotipo. los principios filosóficos y la falsedad de los enunciados

esa expresión la expulsión del Dios vivo de aquella naturalezaEs sabido que la respuesta del ser humano ante cualdeterminada, sino también la libertad del espíritu quier quedaba maltrecha. La pernicioso, viene condiciohumanoestímulo, sea positivo o teología no veía entonces nada por dos elementos fundamentales. De una parte, inotra solución sino la de salir de escena y retirarse; por una fluye la información contenida en los otra, hacia otra, los parte, hacia el comienzo absoluto; por genes. De lael más llamados factores ambientales. La precio: ambos, junto allá del cielo. Pero se pagó muy alto elsuma dela soberanía con los procesos de carácter infeccioso, historia fue cesobre la interpretación del mundo y de la desencadenará la presencia o no de la enfermedad. demás ciencias. ¿Cuál dida con demasiada ligereza a las Los factores ambientales responden a un sinfín de formulas. Los fe que de vida, podría ser entonces el significado de una estilos no tiene la exposición con el mundo y con nada que ver a sustancias tóxicas la historia? La teología, (), la nutrición (nutrigenomics) o la higiene, son algupara el cielo; las demás ciencias, para la tierra. A la larga, nos de ellos. conducirnos por buen camino.3 esto no podríaIdentificar en un individuo los genes que predisponen a enfermedades coronarias, diabetesencontrar En un segundo grado de reflexión, podemos o a algunas formas de fundamentados, donde se plantean a eledebates más cáncer, puede ayudar a prevenirlas oloslimitar su impacto, modificando este evolución de las mentos críticos de la teoría de la tipo de factores. especies, teológicos. Su hipótesis astronómica fue celebrada sisus aportes para la comprensión de las leyes de la sele- glos después como triunfo de la razón sobre el prejuicio, GRADO DE así como sus DE LAS callejones cción natural, PROTECCIÓNlímites y VACUNAS sin salida, aunque sus otras tesis no fueron criticadas por los heredeEsa por ejemplo la cuestión ser útil cualitativo entre como misma información va a del salto para determinar el ros de esta civilización empiricista naciente. grado de y otra, que aun la ciencia contemporánea son En efecto, una parte de los diálogos de Galileo con una especie protección de vacunas o qué poblacionesno hamás o menos susceptibles ante este mismo tenor, desde el cardenal Barberini, por ejemplo, tenía que ver con la logrado descifrar del todo. En determinadas infecciones. el Por ejemplo, la tanto filosófico como teológico, algunas distinción entre las observaciones astronómicas y la repunto de vista vacuna que se emplea para la tuberculosis es sumamente planteado los países europeos. No ocurre hipótesis se han efectiva en en las últimas décadas para futación de la verdad de la Biblia que, a juicio de Galieo, se lo mismo, junto con la pertinencia de la necesidad procomprender,sin embargo, para amplias capas de la población implicaban mutuamente. africana. Curiosamente, esa misma vacuna margen para Sin embargo, contra la opinión generalizada aun en pia de ciertos principios de la evolución, el es eficaz de prevenir la y alteridad que azar, libertadlepra en Malawi. supone la naturaleza como nuestros días, la tesis evolucionista de Darwin no fue reLa genética que a un principio “ordenador” y, más una realidad referida se ha desarrollado hasta ahora se dife- futada en sí misma por el magisterio de la Iglesia como rencia de la genómica, en que la primera estudia un gen se piensa, sino que fue vista como parte de una nueva aún, “amoroso”, que da consistencia y finalidad al cosmos. Enque causa una proponemos (como la hemofilia), mientras racionalidad que era necesario discernir para buscar la este artículo enfermedad al lector algunos elemenque la que realice su con varios genes manera que tos para segunda trabaja propio juicio, de que operan en verdad. Así lo muestran las declaraciones del Papa Pío XII forma simultánea pueda entenderse, en enfermedades complejas, que son las en la Encíclica “Humani Generis”, de 1950, quien a pesar primer lugar, el papel imprescinmás comunes, de la evolución para la explicación de dible de la teoríacomo hipertensión, diabetes, asma, osteo- del tono antimodernista, no deja de entreabrir una puerta porosis, etcétera. ciertos fenómenos, así como el lugar irrenunciable de al análisis crítico de la cuestión, tanto en su dimensión El conocimiento de la genética/genómica buscan la filosofía y la teología como disciplinas que de pobla- científica, como filosófica y teológica: ciones permitirá en su horizonte de trascendencia, alDando una mirada al mundo moderno, que se halla comprender lo real ampliar específicamente el abanico de la prevención y el diseño de vacunas mucho más espeteridad y donación. Este argumento pensamos que puede fuera del redil de Cristo, fácilmente se descubren las princíficas, de cuadamente la urgente necesidad de planexplicar ade-acuerdo con los rasgos genéticos no sólo de las cipales direcciones que siguen los doctos. Algunos ad

17/02/2009 05:23:44 p.m. 17/02/2009 05:28:22 p.m.

76 28

EVOLUCIÓN LAS ESPECIES EVOLUCIÓN DEDE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO

3. LA privado para el equipamiento de tecnología de Desde este modelo divino podemos intuir que la vida es moverse a sí mismo blico y CONTRADICCIÓN Ejemplo 2. Los bloques haplotípicos se definen hasASUMIDA EN LA CONTRARIEDAD en un conjunto de relaciones hacia como un donación. de dona lo que se tiene punta en todos los laboratorios de Centros de Salud. la plena conjunto Se marcadores contita el momento y se recibe lo que no se tiene en un proceso incesante que enriquecelosque pre- Siguiendo el hilo conductor de nuestra reflexión, Cristo nuos (SNP1-SNP2-... -SNPn) para los cuales todos y pares cisamente es el proceso vital. Los puntos fundamentales son las relaciones, que asume la contradicción y la vuelve contrariedad de relamuestran desequilibrio de ligamiento (D) > 0.8. fundan la oposición contraria, no para encerrarse en la propia mediante o en ción de máximo amor, y así de máxima vida, contrariedad Supongamos que tenemos 10 SNPs y posesión el la propia privación, análisis deabrirse en total donación. Así, la vida es relación en la que se opone relativamente al hombre como a un susino para desequilibrio de ligamiento encontramos que jeto JM, Zhang G, Zhang K, le L, Shriver en totalidad, la fecunda de donación amorosa. Ésta es la vida en sí, y cuando Dios la participa a Akey al que le dona lo que Jinhace falta MD. Interrogatingvida. existe un bloque (B) en una agrupación (clúster) de 150 kb La vida trinitaria de for signatures of nature selection. su creación; en especialel cromosoma 4: B (1-4) con 69la da de este > 0.8. Este cuando la participa al hombre, kb y con D talante. Dios a high-density SNP map oposición contraria de pura donación en Genome Res, 12:1805-1814, 2002. inscribe esta donación dentro deen libertad humana. Y precisamente cuando el pasa ahora a través de la contradicción de la muerte para análisis está la función de los intervalos de distancia de Blazej RG, Paegel BM, Mathies RA. Polymorphism vencer a esta muerte y hombre no quiere másdistribuciónesta los SNPs en el genoma cierra en sí de un la proceder a de donación, entonces se específico mismo, ratio sequencing:mismaapproach forvolverla pura donación en a new single nucleotide el Espíritu. discovery and genotyping. Genome Res, 13:287se opone a los demás en contradicción. Esto es el pecado, y, lo que es lo mismo, polymorphismLa convierte en donación de puro amor. Se sucromosoma. 293, 2003. pera la contradicción de la muerte en la oposición relativa la muerte. BLOQUE 1 de contrariedad, Discovering genotypes underlying human Botstein D, Risch N.que es relación de amor. Habíamos dicho phenotypes: past successes contradicción genera la cultura de cómo la oposición de for mendelian disease, future 2. LA HISTORIA DE LA SALVACIÓN approaches for complex disease. Nat Genet, 33:228-237, 2003. Dentro de estas coordenadas, se SNP1 SNP2 SNP3 SNP4 SNP5 escribe la Historia SNP8 Salvación como una la muerte; en Cristo, esta oposición lo llevó a la máxima SNP6 SNP7 de la SNP9 SNP10 muerte, por decirlo Rieder MJ, Smith JD, Kruglyak en historia de la libertad. Y como el hombre eligió la oposición de contradicción, el Carlson CS, Eberle MA,así, y la Redención consistió L, volver Nickerson DA. Additional SNPs and linkage-disequilibrium esta máxima muerte en máxima vida; volver studies in pecado y la muerte, y a pesar de ello Dios no le retiró el que desde dentro siga analyses are necessary for whole-genome association la contradicI n t e r su imagen, la e d i detla humanidad viene a ser una historia que se humans.través del Espíritu en pura relación de amor, como d historia s a n c i a ción a Nature Genet, 33:518-521, 2003. siendo v a l o donación total. Éste es el sentido último de la resurrecrealiza dentro de dos términos: contradicción-contrariedad; muerte-vida; odio- Cavalli-Sforza LL, Feldman MW. The application of molecular genetic approaches to the study of human evolution. Nature ción. amor; egoísmo-donación.SNP1 Genet, 33:266-275, 2003. Si, como decíamos, la vida es la capacidad de ser y de 1.00 SNP2 5.59 Cerda-Flores RM, Villalobos-Torres MC, Barrera-Saldaña HA, actuar, ahora podemos concluir que la vida es la capacidad 3. LA ENCARNACIÓN PASCUAL Cortes-Prieto LM, Barajas LO, Rivas F, Carracedo A, Zhong Y, de ser y Chakraborty R. Genetic una oposición contradictoEn este ámbito, la Encarnación pascual viene a realizar el rompimiento de la Barton SA,de actuar a través de admixture in three Mexican 1.00 1.00 SNP3 22.21 5.59 ria; esto es, la muerte; la oposición contraria como contradicción en una construcción amorosa de contrariedad de relación. Esto es, Mestizo populations based on D1S80 and HLA-DQA1 loci. Am Jrelación de donación 2002a. la muerte viene a ser 1.00 vencida por1.00 la resurrección. Cristo SNP4 la contradicción Hum Biol 14:257-263,amorosa absoluta en la que se recibe la asume 1.00 21.48 7.19 21.48 vida participada de la Santísima Trinidad. La vida del hombre que significa su pecado y su muerte, y esta contradicción la lleva Cerda-Flores RM, Budowle B, Jin L, Barton SA, Deka R, es así la Resurrección. hasta sufrirla en sí mismo con el sufrimiento 0.54 muerte. Pero esta muerte, por Chakraborty R. Maximum likelihood estimates of admixture in de la 0.54 0.19 0.45 SNP5 Northeastern México using 13 short tandem repeat loci. Am J 1.21 0.20 0.97 el amor del Espíritu Santo se torna en fuente 1.21 de vida, en resurrección. La muerte Hum Biol 14:429-439, 2002b. se coloca como la mayor prueba de amor, la mayor prueba de donación. Y así, Daly MJ, Rioux JD, Schaffner SF, Hudson TJ, Lander ES. Cristo, de la nada culpable; esto es, de la contradicción absoluta del hombre, High-resolution haplotype structure in the human genome. Nat recrea al nuevo hombre en lahaplotipo de justicia y santidad.de SNPs la profun- Genet, 29:229-232, 2001. Cada relación equivale a la “firma” Ésta es con que didad ilógica de la historia que sólo la Omnipotencia de Dios-Amor pudo hacer Escoffier L, Slatkin M. Maximum likelihood estimation of se puede reconocer a cada bloque genómico. Esta obserlógica, como la expresión humana de gran interés científico y es Cristo, ya Verbo molecular haplotype frequencies in a diploid population. Mol vación resulta máxima de la Verdad: esto práctico, el que Biol Evol, 12:921-927, 1995. de Dios encarnado. el conocimiento de dichos bloques reduciría la necesidad

REFERENCIAS

de analizar a cada una de las variaciones en el genoma humano, a menos del 10 por ciento de ellas, ofreciendo la posibilidad de llevar a cabo proyectos de investigación genómica en forma más precisa, rápida y a menor costo. Sin embargo, este nuevo conocimiento enfrenta el gran reto de identificar las características de dichos bloques que, al parecer, tienden a variar entre cada población. SEGUNDA FASE DEL PROYECTO DEL GENOMA HUMANO La gran importancia que reviste el conocimiento de los bloques de recombinación en diferentes poblaciones mundiales ha servido como base para el desarrollo de la fase II del proyecto del Genoma Humano (Haplotype Map of Human Genome:, por lo que México no puede quedar atrás de los avances de la nueva ciencia y tecnología. Para finalizar, es claro que la investigación en el área de las ciencias genómicas pone de manifiesto la necesidad de: 1. Formar en México equipos de trabajo con científicos expertos en la genómica comparada, genómica funcional, bioinformática, biología computacional, salud pública, genética de poblaciones, farmacogenómica y terapia génica. 2. Proporcionar el apoyo económico de los sectores pú-

Gibson G, Mackay TF. Enabling population and quantitive genomics. Genet Res Camb, 80:1-6, 2002. Goldstein DB, Weale ME. Population genomics: Linkage disequilibrium holds the key. Curr Biol, 11:R576-R579, 2001. Greely HT. Informed consent and other ethical issues in human population genetics. Annu Rev Genet, 35:785-800, 2001. Jorde LB, Watkins WS, Bamshad MJ. Population genomics: a bridge from evolutionary history to genetic medicine. Hum Mol Genet, 10:2199-2207, 2001. Kwok P-Y. Methods for genotyping single nucleotide polymorphisms. Annu Rev Genomics Hum Genet, 2:235-258, 2001. Marth GT. A general approach to single-nucleotide CONCLUSIÓN polymorphism discovery. Nature Genet, 23:452-456, 1999.

En la reflexión que hacíamos sobre algunos elementos de la T, Qin ZS, Xu X, Liu J. Bayesian inicio de la vida humana, NiuBiogenética que describen elhaplotype inference for multiple linked single-nucleotide polymorphisms. Am J Hum hacíamos una primera conclusión: encontrábamos que Genet, 70:157-169, 2002. la vida aparecía como “un movimiento orgánico compleSchlotterer de Hitchhiking mapping-functional genomics from mentario C. relaciones y finalidad”. Cuando avanzábamos the population genetics perspective. Trends in Genetics, 19:32desde el 38, 2003. aspecto filosófico, confirmábamos lo anterior, y Weiss KM, Buchanan AV. Evolution by phenotype: a implica una oposición vital, que para ser tal debe biomedical perspective. Perspect Biol Med 46:159-182, 2003.ser no

decíamos que la vida es “moverse a sí mismo”, y que esto de contradicción sino de contrariedad; esto es, de integración. Teológicamente avanzábamos a la luz de la resurrección de Lázaro y veíamos que la vida no puede ser más que una oposición de contrariedad; esto es, de integración,

28y77.indd 76y29.indd 1 1

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN LAS ESPECIES EVOLUCIÓN DEDE LAS ESPECIES

29 77

pero que pasa a través de la contradicción de la muerte, en la historia de la salvación. Para concluir, pudiéramos decir que la vida es amor. Sólo el amor rompe la contradicción de la muerte y su absurdo de destrucción total lo vuelve fuente inagotable de vida. Lo ilógico se torna en plena y única racionalidad. Es la lógica histórica del Amor que irrumpió en el mundo en el Misterio de la Encarnación pascual. Así entendemos el aforismo de Tertuliano: Credo quia ineptum (creo porque es inepto); a quien replicaríamos: Sed historicum( pero histórico, así aconteció). Así, la vida, que es donación de amor, fluye victoriosa iluminando la oscuridad de la muerte, apoyada en la plena confianza en Aquél que la hizo triunfar en la resurrección de Jesucristo. El máximo movimiento vital es el movimiento de la Encarnación que se va desarrollando hasta llegar a través de la pasión y muerte de Cristo a la plenitud de vida en la resurrección, en la Ascensión y la vida gloriosa del Señor Jesús. La conclusión plena es que la vida es la máxima donación de Dios al hombre, que a partir de la nada de la muerte, realiza la nueva creación de la plenitud de la vida en el triunfo glorioso del Cristo total.

Los arrecifes coralinos: evolución biológica, no creación divina
Juan Jacobo Schmitter-Soto n gigantesco mero se desplaza con elegancia por el arrecife. De pronto, sefebrero de 2009. Ciudad del Vaticano, detiene junto a un cabezo de coral, y un grupo de peces góbidos salen como dardos, se meten en su cavidad branquial y en su boca misma, y se comen los parásitos del mero. En unos momentos, el pez Aristóteles, Metafísica, vol 10, X, 3;b. De Anima II,1-2 y los grande reanuda su paseo, más sano que antes, Sto. Tomás de Aquino, Summa Contra Gentiles, 4,11; gobios regresan a aa.1-2 . Summa Theologica I q.18 esconderse entre los resquicios R. Guardini, Der Gegensatz, 1925 que antes. del coral, más satisfechos C. Nink, Sein, Einheit, Gegensatz, en Scholastik 17 (1942) 504-522¿Cómo pudo evolucionar semejante asociación? M. Honecker. Logik 1927 (índice) primer paso, el mero se Si el gobio hubiese dado el J. Fröbes, Tractatus Logicae Formalis, Roma 1940, 70 y ss. 156 loss. y habría comido; si el mero hubiera tenido la iniJ. Dopp, Lecons de Logique formelle 3 vols, Lovaina 1950. ciativa, los gobios habrían preferido ocultarse.
M. Grabmann, Die Idee des Lebens in der Theologie der hl. Thomas, 1922. H. Driesch-R Woltereck, Das Lebens Problem in der Lichte LA GALLINA O EL HUEVO der modernen Forschung. 1931 Este tipo de planteamientos de “¿qué fue de C. Burdo y otros, La vie et l,’evolution, en “Archives primero: Philosophie”6, o la gallina?” están entre los sofismas fael huevo (1928) Fase. Links, Biogenética, México 2000.

U REFERENCIAS

voritos de los creacionistas (gente como los testi-

Biólogo Juan Jacobo Schmitter-Soto DoctorInvestigador del Área de Conservación de la Biodiversidad Colegio de la Frontera Sur Unidad Chetumal juan.schmittersoto@ fulbrightmail.org

17/02/2009 05:23:29 p.m. 17/02/2009 05:28:34 p.m.

78 26

EVOLUCIÓN LAS ESPECIES EVOLUCIÓN DEDE LAS ESPECIES

CONOCIMIENTO CONOCIMIENTO
fuerte como norma, y de allí se generan todas las opiniones maltusianas y de súper razas, en las cuales alguien se afirma tratando de matar a los demás, de una manera salvaje en estadios primitivos, y de una manera sofisticada en la actualidad. Ésta es la cultura de la contradicción o, lo que es lo mismo, la cultura de la muerte o la anticultura propiamente tal. En esta posición no hay propiamente organicidad; la vida como organicidad desaparece; no hay término de oposición al cual oponerse, pues se ha destruido. Y el problema es que como el término de oposición es absolutamente indispensable para la vida, al no existir más éste, la vida se marchita y cabalmente se llega a la cultura de la muerte. No hay el término contra el cual afirmarse, y como éste pertenece también internamente a la propia organicidad, la misma vida individual perece. Nuevamente, incluso desde la misma Lógica, nos enfrentamos a la cultura de la muerte.

4. SERES DISTINTOS de Jehová o los “antropólogos gnósticos”), que a estas gos Ahora bien, alguien alturas dedecir distinto en cuanto tenga lo que otro no tiene se puede la historia siguen poniendo en duda la realidad y no tenga lo que otro la evolución biológica. de la vida que implica negación y de tiene. Hay un aspecto que a través de esta negación se produzca la vida. seres negación implica una La diversidad misma de los Esta vivos ha sido tamafirmación que exige la organicidad, la convergencia misma en lagrupos relibién utilizada como argumento por estos unidad de diversos seres, la vida. giosos. Señalan la plétora de peces arrecifales, su belleza Esta convergencia sus distintos, que en último término constituye la vida en y de increíbles adaptaciones al medio (como el mutuasu totalidad, ha sido pensada o negada de diversas maneras a travésdebe esta lismo del mero y los gobios), y preguntan: “¿Se de la historia del pensamiento. Una manera dela casualidad ciega, a que la en todas sus biodiversidad a hacerlo ha sido el Panteísmo naturaleza formas; otra, la Participación. Ha habido millones un pensamiento que sido una ‘haya tenido suerte también de veces’ [sic], o ha estructura muchas corrientes contemporáneas y ha sido la negación básica de la organici‘cuestión de diseño’”? dad externa, al menos al llegar al hombre en la llamada cultura o anticultura de la muerte. LA EVOLUCIÓN, ¿UN JUEGO DE AZAR? La primera tergiversación está en la idea de que la evolu5. NEGACIÓN DE LA DISTINCIÓN: PANTEÍSMOmateria prima de la evolución, ción actúe por puro azar. La En el Panteísmo realmente no existe organicidad distinta, pues las las muta-se la variación genética ciertamente es aleatoria: barreras suprimen y el uno es el todo ysontodo es uno. Por lo tanto, el Panteísmo no exciones no el intencionales, y la recombinación genética plica la vida, pues en él acompaña a la reproducción sexual es comparablesino que no hay verdaderamente coincidencia de distintos, a un todo amorfo y, por tanto,las cartasVerdaderamente en la Panteísmo natural barajar sin vida. disponibles. Pero el selección no existe una auténtica oposición entre su fuerza y posesión, materia prima de manera no ejerce privación sobre esta pues todo es todo. fortuita; la eliminación de las mutaciones dañinas no es cuestión de simple suerte, sino que se debe a la desvenI. VIDA COMO OPOSICIÓN dichas mutaciones le acarrean al mutante. taja que En concepciones ajenas del Panteísmo, en herencia de una mutación benefiDel mismo modo, la cambio, existe la oposición, pero atendamos a la clase deno es casual, sino consecuenciavida es oposición; la ciosa oposición que se piensa: La clara de la ventaja oposición, según la (mayor puede reproductivo, de contrariedad u oposición de Lógica, éxito ser oposición mayor capacidad de sobrecontradicción. Si es vivencia) que dicho cambio genético pueda conferir vida. Si de contrariedad, nos encontramos en el ámbito de la a los es de contradicción,descendientes.muerte. La oposición de contrariedad une los nos lleva a la contrarios con una partículapalabrería mañosa se esconde en el implicar que Otra copulativa: esto y esto; la oposición de contradicción excluye a uno si algo opuestos para suerte, entonces sólo puedeuno de los de los no ocurre por afirmar al otro. Al excluir deberse opuestos, no se da más organicidad, y así no se puede hablar de la azarosa no a diseño. Decir que la selección natural no es vida. Abundando más en lo anterior, decir que es intencionada.oposición entre es lo mismo que podemos decir que hay Por ejemplo, dos contenidos cuando la posición de uno excluye (peces planos que se conel camuflaje de los lenguados en cierta manera la del otro. Según sea la índole funden con la arena) no evolucionó para protegerlos de laLa de esta exclusión, resultan diversas clases de oposición. oposición de contradicción es irreductible; se da entre el ser y el no ser, no tolera término medio. La oposición de contrariedad u oposición contraria hace que dos contenidos se excluyan en un campo particular del ser, y por tanto acepta que haya un término medio en el campo universal del ser. La oposición contraria puede ser privativa o bien relativa, según se opongan los dos contenidos por privación–posesión, o bien por mera relación. 1. OPOSICIÓN DE CONTRADICCIÓN EN EL CONCEPTO DE LA VIDA Hay una mentalidad que en la modernidad se basa fuertemente en la oposición de contradicción. Y es la mentalidad evolucionística aplicada al hombre directa y plenamente. En efecto, en la mentalidad evolucionística, la supervivencia de las especies se da por la lucha a muerte, que es una oposición de contradicción, y así por la supervivencia del más fuerte. Se trata de una concepción mecanicista que concibe la vida como simple movimiento contradictorio, de colisión cuántica. Posiblemente muchos pasos de la evolución de los seres inferiores al hombre se puedan explicar en algunos sectores por esta lucha por la vida, la famosa “struggle for life”. Pero no puede ser aplicada en su totalidad, pues si bien es cierto que existe una graduación en la existencia actual de las especies en el mundo vivo infrahumano, persiste hoy la gradualidad de las mismas; no han desaparecido las inferiores. Y en su conjunto forman la esfera infrahumana orgánica. Sin embargo, el problema aparece fuertemente cuando esta explicación de la vida por la oposición contradictoria se aplica a la misma vida en su esfera humana. Entonces se llega a la opinión de la prevalencia y supervivencia del más

depredación, aunque a veces sea más cómodo y breve decirlo así. En realidad, la protección ante los depredadores es consecuencia, no causa, de la aparición del camuflaje. ABRACADABRA: DE LA NADA APARECE UN OJO La selección natural, sobrevivencia del más apto, parece un fenómeno dramático; empero, no hace falta imaginar sangre derramada. La selección es consecuencia inevitable de que los organismos sean diferentes en su éxito reproductivo, así se trate de una diferencia muy pequeña. Las diferencias (ventajas) pequeñas, al acumularse de generación en generación, llevan a adaptaciones todavía más pasmosas que el camuflaje del lenguado. 2. OPOSICIÓN DE CONTRARIEDAD Tomemos, como un ejemplo clásico, el ojo de los EN EL CONCEPTO creacionistas dicen que es un órgano vertebrados. Los DE LA VIDA La auténtica oposición, que es la que puede garantizar la perfecto, y que no pudo evolucionar por modificavida, es la oposición de contrariedad, que, como decíamos ciones pequeñas y graduales. “¿Para qué sirve medio anteriormente, se expresa mediante una partícula copuojo?”, preguntan con sorna; la complejidad de un órlativa, “esto y esto”. Enparece palabras, la vida es complegano tan maravilloso otras irreductible. mentariedad orgánica,ojo no es vive en cuanto se opone Para empezar, el alguien perfecto, ni siquiera el a ojo humano. El punto ciego queque presenta donde otro ser vivo porque no tiene lo se este otro ser vivo posee, pero quiere participar de su riqueza. Y a la vez, el nace el nervio óptico es un defecto evidente, el cual otro ser vivo vive evitado si el ingeniero imaginario hupodría haberse en cuanto que, permaneciendo distinto, participa de la riqueza del primero. El ideal es que esta biera puesto los axones de las células de la retina hacia participación sea no hacia dentro (un “diseño” restar para fuera del ojo y sin mengua ajena; esto es, sin bastante nada lo que cada uno de los seres vivos posean de por torpe). sí. Aquí nos encontraremos que tener “mediopor mera rePero lo importante es con la oposición ojo” sí es lación. que no tener ojos. Un área de piel fotosensible, mejor La conclusión es útil para que la vida día movimiento que ya de por sí filosófica esdistinguir eles ely la noche, de oposición contraria y no contradictoria entre necesidad mejora si adquiere cierta curvatura que concentre la y luz. Este ojo primitivo existe en las planarias, gusanos satisfactor. platelmintos. Si esa concavidad crece, se puede lograr IV. REFLEXIÓN TEOLÓGICA la óptica de una cámara lúcida; esta situación se preSisenta en algunos anélidos. ahora nos preguntamos: ¿qué hay más allá de la Filosofía para entender la vida?, la ya ha formado una esfera con el Si la concavidad que respuesta la encontramos en capítulo 11 del Evangelio de San Juan, en la narración de la un agujero se ve recubierta de piel transparente, se resurrección depequeña Cristo le y cualquier incremento adquiere otra Lázaro: ventaja, dice al muerto: “Lázaro:

26y79.indd 78y27.indd 1 1

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN LAS ESPECIES EVOLUCIÓN DEDE LAS ESPECIES

27 79

“Lázaro, ¡ven fuera!” Y el paso de la muerte a la vida se da visiblemente por el movimiento: Lázaro, inmóvil y cubierto de vendas, empieza a moverse, camina; camina fuera. Una vez más aparece el movimiento que observamos en la Biogenética y en la Filosofía para entender la vida: Lázaro sale de la muerte a la vida. Se trata, es verdad, de un movimiento, pero de un movimiento muy especial en el cual el “terminus a quo” es la muerte. ¿Qué hay de vital dentro de este movimiento?

Se trata de un movimiento de oposición plena entre la muerte y la vida, un movimiento que hemos definido “de contradicción”. Pero, ¿será la contradicción la fuente de la vida, cuando filosóficamente la hemos definido más bien como muerte? en la concentración de proteínas en esa piel aumentará el índice de refracción del lente. Este ojo miope es mejor que una cámara lúcida, y cualquier incremento ulterior en la agudeza visual será una ventaja importante. En resumen: el ojo es un órgano complejo, pero generable por selección natural que actúe sobre mutaciones pequeñas. JALISCO NUNCA PIERDE Cuando los órganos “perfectos” no le sirven, el creacionista voltea completamente su argumento y pregunta con sarcasmo: “Si la selección natural siempre mejora, ¿por qué no son perfectas las adaptaciones?” La falacia ahora radica en pensar que la evolución necesariamente optimiza las adaptaciones. Las planarias llevan millones de años sobreviviendo con sus ojos “imperfectos”; hecho,su oposición ideal para que haya vida y no la De para la tipo de vida resultan suficientes sería hay ninguna “fuerza vital” que las obligue a “perfeccionarse”. oposición de contrariedad donde la privación no existiese. Otro esta oposición ideal que generase una mera ¿Es posibleerror del argumento es olvidar que el ambiente cambia, oposición que, cuando los organismos logran relación dede manera sin privación alguna? La respuesta adaptarse a un ambiente determinado, puede ser y se podrá venir si se asume la oposición de contradicción que el ambiente oposición de mera contrariedad. La reflexión convierte enya no sea exactamente el mismo: es la metáfora de la Reina Roja, en cuyo país de fantasía Alicia tenía que siguiente desea esbozar algunas pistas para lograr esta correr mucho para poder mantenerse en el mismo lugar. asunción. Puede ocurrir que lo que ayer (en términos evolutivos) era Partiremos de la oposición ideal meramente relacional enun rasgo adaptativo, hoy noes la sino unprimigenia de la la Santísima Trinidad, que sea fuente vestigio inútil. vida, para luego converger en la asunción de la oposición deCOMO SANTO causada por la historia del hombre en la contradicción TOMÁS: VER PARA CREER Nuestro creacionista, después de revisar acción del dice Encarnación pascual, que se convierte por lasi su BibliaEsalgo sobre Lewis Carroll, nos mira incrédulo y nos espeta: píritu en mera oposición de contrariedad en plena mutua “¿Quién donación. estuvo allí para ver la evolución del ojo? ¿Quién presenció un establecimiento gradual de la simbiosis en1. tre el mero y sus SANTÍSIMA TRINIDAD realidad, la evoLA VIDA EN LA gobios limpiadores?” En lución a corto plazo no sólo es observable, sino hasta Exactamente el ideal de oposición por mera relación es el

medible, en términos de cambios en lo frecuencias que se realiza en la fuente de la vida de todolas creado, que es la Santísima Trinigenéticas entre las generaciones (desde luego, esto es dad. La Santísima Trinidad, según nos lo ha revelado el mismo Dios, se constifactible sólo si las relativa y una son muy breves). Un tuye por una oposición generaciones coincidencia absoluta. Esto es lo que quiere ejemplo cotidiano es en tres personas distintas. En Dios, decir que Dios sea uno la adaptación de las bacterias a los la oposición entre antibióticos, o de es la oposición de relación, sin que la las divinas personaslas plagas a los plaguicidas: la resisten-privación signifique cia aumenta porque los individuos que cualquier son los mengua y sin que la posesión signifiquesobreviven resta a la otra persona. La que tienen los genes adecuados, y la frecuencia de de contrariedad relativa. oposición entre las divinas personas es una oposición estos genes aumenta rápidamente en la relaciona dado que la Esto es, lo que una persona tiene se población,con lo que losotra persona posee, dehijos sustituyen lalos padres permanece en una posesión infinita. tal manera que a privación en cuestión de horas o días. Sin aparente el camino evolutivo que llevó las tres personas en concreto: Y estaembargo, contradicción se aclara viendo al ojo huEl mano o a tiene la filiación; mero y los gobios trasciende filiación. El Hijo no Padre no la simbiosis del sin embargo, es Padre por la con mucho una sin humana, incluso la la Paternidad. El tiene la paternidad;vida embargo, es Hijo por vida de toda la Espíritu no tiene la humanidad, de modo que se trata de un por la Inspiración inspiración activa; sin embargo, es Espíritufenómeno no ob- activa del Padre y servable vida infinita de las tres divinas personas se realiza del Hijo. La directamente. Lo que vemos hoy evolucionó en por una donación el pasado, y como todavía no se Padre el sueño de H. al absoluta y total de dicha vida, del cumpleal Hijo, del HijoG. Padre, del Padre y Wells, al la máquina del tiempo, no nos queda sino inferir del Hijo de Espíritu y del Espíritu al Padre y al Hijo; por eso son un solo Dios. Lael pasado a de las tres presente. distinción partir del divinas personas es sólo por oposición de contrariedad relativa y por su oposición de contrariedad relativa son la vida en sí; esto es, un EL ORIGEN vez que tres personas distintas. solo Dios, a la DE LAS ESPECIES El creacionista revisa su arsenal y ahora lanza: “¡Nadie ha visto una especie a medio formar en la naturaleza! ¡Las quimeras, sirenas y centauros no existen!” Claro que no puede haber cruzas de perros con gatos, peces con mujeres o caballos con hombres, pero es falso que no existan “especies a medio formar”. La línea entre lo que son poblaciones diferentes de una misma especie y lo que son especies plenamente distintas es tan tenue, que a menudo la decisión taxonómica es arbitraria. Los llamados “hamlets”, peces arrecifales del género Hypoplectrus, llegaron a ser considerados miembros de una sola especie, H. unicolor, por su enorme semejanza genética. Sin embargo, hoy se acepta que cada hamlet es una especie válida, no sólo con su propia coloración, sino con su propio sistema de reconocimiento sexual, el cual mantiene su identidad como especie. El caso contrario: entre los peces dulceacuícolas hay especies consideradas válidas, habitantes de lagunas aisladas, que se han extinguido al entrar en contacto con otras especies, de distribución amplia. Esa extinción de la especie antes aislada se debe al fenómeno conocido como introgresión genética. Es como si el acervo genético de la especie endémica se “disolviera” en el de la de distribución amplia, cuando se dan las circunstancias que les permiten cruzarse. Se infiere que la especie endémica (aislada) se originó a partir de la otra y pudo diferenciarse gracias al aislamiento geográfico, pero su diferenciación genética no llegó a ser tan grande que pudiera impedir la reproducción sexual entre ella y la que le dio origen. En otras palabras, quien observe a estos peces verá, sin metáfora alguna, “una especie a medio formar”. ¿SÓLO UNA TEORÍA? ¿Es la evolución “sólo” una teoría? Lo es, pero eso no significa que no sea real. La evolución es un hecho científico, tanto como la gravedad de Newton o la relatividad de Einstein, las cuales también son teorías; es decir, explicaciones de fenómenos observados. A la luz de evidencias tan independientes entre sí, como las anatómicas,

17/02/2009 05:23:15 p.m. 17/02/2009 05:28:45 p.m.

80

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

bioquímicas, paleontológicas y embriológicas, la única teoría (explicación) científica de la diversidad biológica es la evolución. Por supuesto, el creacionista dirá que Dios tuvo razones inescrutables para crear órganos imperfectos e incluso vestigios inútiles, como nuestro apéndice vermiforme; causas desconocidas para diseñar la biodiversidad de manera que pudieran reconstruirse árboles genealógicos de las especies; motivos inimaginables para hacernos 99 por ciento iguales, genéticamente, al chimpancé y al gorila; fundamentos incognoscibles para sembrar fósiles de seres intermedios entre el hombre y los antropoides, etcétera. No obstante, hay un principio epistemológico (es decir, de búsqueda de la verdad) que el creacionismo viola de entrada: “entre todas las explicaciones posibles de un hecho, hay que escoger la más simple”. ¿Por qué pensar en un dios que crea una por una a todas las especies del planeta, si existe una explicación terrenal para el origen de las especies? Como decía Carl Sagan: “¿para qué inventar a un dios increado, hacedor del universo, cuando es más sencillo pensar que el increado (o autocreado) es el universo mismo?” Nadie vio al primer mero, satisfecho por una buena comida, en el momento de permitir a los primeros gobios valientes, hambrientos de parásitos, entrar en su boca libremente. Pero, ¿no es más sencillo pensar que eso es lo que sucedió, y no que Alguien lo diseñó desde el cielo para deleite de los biólogos marinos? El científico no asegura que sus teorías sean dogmas o que puedan explicarlo todo (y ésta es la gran diferencia entre ciencia y religión). La ciencia puede a menudo estar hecha de errores (errores que es preciso cometer para acercarse paulatinamente a la verdad), pero una teoría no se refuta gratuitamente. Incluso la existencia de casos inexplicables no basta para derrumbar una teoría. Para ello es necesario no sólo acumular incongruencias de la teoría, sino proponer una de mayor poder explicativo. FENÓMENOS EVOLUTIVOS En el caso de la evolución, la teoría ha ganado muchísimo en poder explicativo desde los tiempos de Darwin. Por ejemplo, en los años 30 se consideraba que la selección natural era la única fuerza evolutiva de peso; hoy se sabe que fenómenos evolutivos, tales como la pérdida de los ojos en los peces cavernícolas se explican mejor por cambios genéticos aleatorios (si los ojos no sirven en la oscuridad, una mutación que los reduzca no tendrá efecto selectivo alguno). Suponer que el arrecife coralino es un escenario montado por una inteligencia sobrehumana es gratuito: el creacionismo es un intento dogmático de robar al ser humano y a la vida en la tierra la gloria de sus orígenes naturales. En cambio, pensar en la compleja historia evolutiva detrás de cada uno de los organismos del arrecife y sus interacciones provoca un genuino sentimiento de maravilla. No hace falta inventar algo sobrenatural: lo na-tural es más maravilloso.

80y25.indd 1

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

25 81

6. REPRODUCCIÓN Las células así formadas se dividen y se reproducen por la “mitosis” en proporciones geométricas; cada una con sus 46 cromosomas; excepto la reproducción de las células de las gonadas, las que se reproducen por otro proceso llamado “meiosis”, según el cual la cadena de cromosomas que formaba una hélice de 46 se parte en dos por la mitad. Una mitad va al óvulo y otra al espermatozoo. Cuando el óvulo es fecundado por el espermatozoo, éste se reproduce ya con los 46 cromosomas normales por mitosis; forma así el blastocito, el embrión y el feto.

II. BASE FILOSÓFICA 1. ANTIGUA DEFINICIÓN DE LA VIDA Según la definición clásica, la vida es moverse a sí mismo. Esto es, la vida, nos decían los antiguos, es el ser o actuar de la sustancia, que, según su naturaleza o su operación natural, se relaciona con el movimiento o con alguna operación. Se trata de un ser constituido en sus partes esenciales que ahora se lanza a la vida; esto es, a su movimiento interno. Pero, ¿qué es este movimiento? Se nos responde: es aquello que es en capacidad y potencia en cuanto tal. Por tanto, la vida sería la capacidad primordial de ser y de actuar. 2. MOVIMIENTO ORGÁNICO Precisando más este movimiento orgánico o finalísimo, se puede comprender mejor contraponiéndolo a cierta concepción de la vida que se coloca dentro de un parámetro mecanicista, concibiendo el movimiento vital como una colisión cuántica. El movimiento orgánico que constituye la vida no es un choque de cantidades de la “res extensa” cartesiana, sino una expansión finalística que trasciende la cantidad, aunque no prescinda de ella, y que precisamente gracias a esta finalidad, el movimiento vital es un movimiento que se encuentra en el campo de las relaciones y apunta a una finalidad definida que hace que la vida orgánica sea unidad y que la desintegración vital constituya la muerte.

3. ORGANICIDAD Ser actuando, y actuando siendo. Pero en todo movimiento hay dos términos: uno, del que se procede, y otro, al cual se tiende; y aquél al cual se tiende es su Escapando a Darwin y a la extinción finalidad, lo que especifica y define todo el movimiento. ¿Hacia dónde, pues, tiende la vida? Pienso que la respuesta es que la vida tiende hacia la unidad. La organicidad es lo que especifica la vida; hay una unidad que organiza al ser CONCLUSIÓN DEL MUESTREO BIOGENÉTICO viviente desde dentro y hay una unidad que lo organiza desde fuera; esto es, con De acuerdo a lo anterior, podemos sacar las siguientes relación a otros seres. conclusiones: Pero para que haya organicidad, debe haber distinción de partes, distinción • La vida aparece como un movimiento de órganos, tanto interna como externa; si no, no puede haber unidad. La unidad • Como un movimiento orgánico interna, la organicidad del ser vivo lo constituye presente en la vida; generar • Como un movimiento orgánico complementario que prola delfín de rio chino (Lipotes vexillifer), ocupa el difícil lugar esta organicidad propia organicidad es generar la propia vida. Sin embargo, cede siempre a base de intrincadas relaciones Maestro Adrián nodel agota enen mayor peligro de mira a la organicidad externa, mira hacia la se cetáceo lo interno, sino que extinción en el mundo. • Y tiene siempre una finalidad. Munguía Vega Adrián Munguía Vega La especie no fue científicamente descrita sino da la unidad con los demás seres vivos. La unicidad interna hasta individualidad; sin Estudiante de Ricardo Vázquez Juárez Doctorado 1958, y no unicidad interna no descripción está íntimamente transformada embargo, estahubo disponible unaes vital si no completa de Se perfila así la vida como “Un movimiento orgánico Laboratorio de su morfología externa, sino hastacon otros población tiene 1987. Su seres vivos. por la unicidad externa, la relación complementario de relaciones y finalidad”. Genética de la arwin propuso un nuevo paradigma, totalmente radi- la distribución más restringida de manera la individualidad, que ésta no se La organicidad externa afecta en tal cualquier mamífero Conservación marino, pues habita un área de alrededor de dos mil 700 cal en su tiempo, acerca de cómo funciona el mundo puede cerrar en sí misma para ser vida individual, sino que su riqueza la obtiene Universidad de Arizona, Tucson kilómetros cuadrados demás y se ricas y someras del armonía, la convergennatural en términos de sus mecanismos y patrones cuando se abre hacia los en las aguasrealiza la unidad, la alto airdrian@email. históricos. También formuló las preguntas más impor- ciaGolfo de California, México. decir que la vida es la convergencia de distintos. de distintos. Podríamos así arizona.edu tantes que aún hoy definen nuestro entendimiento de la Así, la organicidad externa se vuelve en cierta manera organicidad interna sin SELECCIÓN NATURAL Y EXTINCIÓN evolución. La influencia en el mundo occidental de su libro dañar la distinción de los seres vivos. El origen de las especies ha sido comparada con el de la Darwin, junto con Alfred Russel Wallace, propuso la idea de que, dado que los recursos son limitados, aquellos inBiblia. En este año en que celebramos a Darwin en el mun- dividuos que están mejor adaptados a su ambiente tienen do entero, nos dimos a la tarea de visitar algunas de sus una mayor sobrevivencia y mayor probabilidad de tener contribuciones más importantes, acompañados de una descendencia. especie marina única en todos los aspectos, para ejempli- En la década de 1930, R. Fisher, S. Wright y J.B.S. Haldane ficar el impacto de las ideas de Darwin a 200 años de su desarrollaron la Síntesis Moderna, y extendieron los procesos selectivos a genes individuales. Además, fue Darwin nacimiento. Doctor Ricardo Vázquez Juárez La marsopa del Golfo de California Phocoena sinus, quien reconoció la presencia e importancia de la extinInvestigador Titular también conocida como “vaquita” es uno de los cetáceos ción de las especies en la historia natural. Centro de En algunos aspectos, la vaquita pareciera ser anti-darmás pequeños (con una longitud máxima de 150 centímeInvestigaciones Biológicas tros). La única población que se ha conocido de la especie winiana (aunque más por necesidad que por convicción): del Noroeste, S.C. • Tal y como Darwin reconoció en un principio, los se estimó en 576 individuos en 1999, y en 150 en 2007. La Paz, BCS La razón de su declive ha sido su muerte incidental en re- procesos de selección natural actúan sobre la variación rvazquez04 des de pesca, y tras la reciente (2007) extinción del Baiji o (morfológica, de comportamiento, genética, etcétera). Sin @cibnor.mx

La vaquita (Phocoena sinus), marsopa endémica del Golfo de California

D

17/02/2009 05:23:05 17/02/2009 05:28:57 p.m.p.m.

82

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

embargo, la vaquita carece casi completamente de variación genética, pues se ha demostrado que todos los individuos tienen una única variante (alelo) en la región control del ADN mitocondrial y en el gen nuclear DQB. Este último forma parte del complejo principal de histocompatibilidad (MHC por sus siglas en ingles) y, encargado de la respuesta inmune contra patógenos, es extremadamente polimórfico en cualquier otra especie, debido a que la selección natural mantiene un número elevado de alelos y una alta heterocigocidad. • Además, se ha observado que, a diferencia de los demás tetrápodos, todas las vaquitas poseen seis dedos en ambas aletas pectorales (polidactilia), además de otras malformaciones vertebrales típicas de síndromes causada por alelos recesivos en genes encargados del desarrollo embrionario (ejemplo de la familia HOX), que normalmente la selección natural mantiene en baja frecuencia, pero que en este caso se ha convertido en una característica de la especie. POBLACIÓN REDUCIDA Simulaciones demográficas del proceso de coalescencia han demostrado que la fijación de estos alelos en la especie es resultado de la deriva genética, debido a un tamaño poblacional (Ne) reducido (quizá unos pocos miles de individuos) durante cientos de miles de años. A diferencia de lo que algunos pudieran suponer, la escasa variación genética no es resultado de la disminución reciente de la población relacionada con las actividades humanas, pues tan sólo han pasado alrededor de seis generaciones de vaquita desde que las redes de pesca comenzaron a utilizarse en

su hábitat a mediados del siglo pasado. En resumen, pareciera que la vaquita ha evolucionado más influenciada por el azar que por la selección natural, escapando en el camino de alguna manera de la extinción por falta de variación y de los problemas de la depresión por endogamia. La teoría neutral de la evolución molecular propuesta por M. Kimura en la década de 1980 demostró que cuando una población aislada como la de la vaquita es lo suficientemente pequeña, la selección natural es verdaderamente inefectiva, y se ve sobrepasada por la deriva genética. En general, la neutralidad de una variante genética se puede asumir cuando el coeficiente de selección (ya sea la desventaja selectiva de un alelo detrimental o la ventaja de un alelo adaptativo) es menor que 1/2Ne. Así, la fijación de genes bajo selección ocurre principalmente para aquéllos con coeficientes de selección pequeños relativos al tamaño efectivo de la población, y la teoría también predice que aquellos genes sujetos a coeficientes mayores deberían estar gobernados aún por la selección. Un grupo de investigadores mexicanos, incluyendo los autores, probaron esta hipótesis. Lo que encontraron fue que, efectivamente, el gen con el coeficiente de selección mayor dentro del MHC encargado de responder ante bacterias y otros parásitos extracelulares (DRB) presenta variación funcional en la vaquita. El coeficiente de selección del DRB es aproximadamente el doble, comparado con el DQB (1 por ciento). Además, los únicos dos alelos encontrados no son típicos, sino que al ser expresados tienen la capacidad (descrita previamente in-vitro en moléculas MHC humanas) de formar súper-dimeros que potencializan la respuesta inmune, de manera que con sólo dos alelos, el MHC de la vaquita sería capaz de reconocer una diversidad de patógenos, una forma de “economía en tiempos de crisis”. OTRAS ESPECIES ENDÉMICAS Cabe mencionar que el patrón observado (DQB monomórfico, DRB polimórfico) lo comparten otras especies de mamíferos endémicos de islas con historias demográficas y de aislamiento similares, tal como el zorro (Urocyon littoralis) endémico de las islas Santa Rosa y San Nicolás frente a California. Así, Darwin, al final, se ve reivindicado, pues al parecer sólo aquellos caracteres que no son cruciales se pueden dar el lujo, tan sólo en poblaciones pequeñas de distribución restringida, de escapar de la selección natural. En ese sentido, el hecho de que todos los indivi-duos presenten polidactilia sugiere que su efecto deletéreo es casi nulo, y asimismo, los alelos deletéreos de mayor efecto, causantes de la depresión endogámica observada en otras especies, habrían sido purgados por la selección durante largo tiempo. Podríamos decir entonces que la vaquita es una especie adaptada a niveles de endogamia pocas veces vistos antes, y que la especie tiene justo la variación genética necesaria para sobrevivir acorde a que históricamente ha sido una especie de distribución restringida y escasa abundancia.

82y23.indd 1

CONOCIMIENTO CONOCIMIENTO
ÁRBOLES Especialmente, al tratar de la base redentora. GENEALÓGICOS, CLASIFICACIÓN científica, Y DISTRIBUCIÓN GEOGRÁIFCA soy consciente de no aportar nada nuevo, si no es el enEl primero de los sintetizo toda esta base, que nos para foque bajo el cualárboles genealógicos, hoy comunes abre describir las relaciones filogenéticas entre especies, apala puerta para, desde la misma, intentar ahora elaborar la reció publicado por Darwin en El origen de una analogía base filosófica, misma que permitirá fincar las especies, y, de hecho, fue la única ilustración en dicho o, más idea de aproximación teológica para comprender;libro. La bien de que las especies algo sobre el partir de la ancestro dicho, para balbucearevolucionan amisterio deun vida hucomún mana. transformó la clasificación taxonómica de los seres vivos para siempre. Asimismo, Darwin fue pionero en reconocer que la distribución geográfica de especies relacionadas era el resultado de climas cambiantes en el pasado, migraciones y adaptación. El “factor tiempo” en la ciencia moderna se lo debemos a él. En los últimos 1.8 millones de años, durante alguno de los 15-20 periodos glaciales del Pleistoceno, las temperaturas ecuatoriales disminuyeron considerablemente, permitiendo que algunas especies templadas ampliaran su distribución. Éste fue el caso de la marsopa espinosa (Phocoena spinipinnis), la especie más cercana de la vaquita, que se distribuye en las costas americanas del hemisferio sur y que en una glaciación habría migrado hacia el norte, cruzando el ecuador, y fundando una nueva población que, al término del periodo glacial, quedaría aislada en el Golfo de California, la cual habría evolucionado in-situ I. BASE CIENTÍFICA para dar origen aenunciar algunos rudimentos científicos Séame permitido la vaquita que hoy conocemos. Hoy día existen herramientas que nos permiten cosobre el origen de la vida humana. Lo hago sólo en cuanto rroborar la transmutación de especies que Darwin propume sirven como datos elementales desde los cuales deseo so hace 150 años. Por ejemplo, mediante la donación de hacer partir mi reflexión sobre la vida comosecuenciación de los amor. genes DQB y DRB de la vaquita, fue posible identificar qué alelos idénticos en secuencia se encuentran en poblaciones actuales de la marsopa espinosa frente a las INICIO DE LA VIDA HUMANA costas humana La vida de Chile. se inicia en una célula que está formada por Este tipo de celular,transespecíficos indican que ambas membrana alelos citoplasma, membrana nuclear y especies comparten un ancestro común, y que la selecnúcleo. ción natural ha mantenido sin cambios la secuencia de diEn el citoplasma hay una serie de estructuras con los alelos desde la divergencia de ambas donde se versas funciones, como los ribosomas, especies. sintetizan las proteínas, consideradas el producto primario de la acEL HOMBRE NO tividad genética. ESCAPA DE LA EVOLUCIÓN… ¿ESCAPARÁ LA VAQUITA DEL HOMBRE? La membrana nuclear separa al citoplasma del núcleo, Cuando Darwin propuso en los cromosomas, en los que dentro del cual se encuentranEl origen de las especies que éstas eran el resultado de los genes, que a su vez se enestán colocados el ADN y la evolución, también mencionó (cautelosamente) en el ADN. cuentran ubicados que su teoría traería luz sobre el origen delDesde los cromosomasEsto cambió súbitamente la perhombre y su historia. brota la vida humana mediante cepción filosófica y teológica del origen del hombre. la energía del ADN con sus genes. ¿Cómo sucede?: En ese sentido, Darwin fue alguien extraordinario, pues sus ideas lo trascendieron como ser humano, y le dieron un nuevo lugar a la especie humana dentro del mundo natural. Es curioso que aún en la actualidad, algunos olviden o quieran ignorar que el hombre es parte de la evolución y que las actividades humanas son un proceso de selección que, en no raras ocasiones, lleva a especies con una larga e intrincada historia evolutiva a la extinción, literalmente en un parpadeo. Lo que sí diferencia al hombre en la evolución son las decisiones colectivas que hace de manera consciente, tal como la decisión reciente del gobierno mexicano y organizaciones no-gubernamentales de, desde el inicio de

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

83 23

2009, eliminar en su totalidad VIDA HUMANA ELEMENTOS INICIALES DE LA las redes de pesca del hábitat de la vaquita, tomando también en cuenta que la pesca 1. ACTORES ahí es el cinco actores, a saber: familias. Tenemos sustento de cientos de los cromosomas –23 pares, 46 en total-; el ADN Esto representa el último intento ubican los cromosomas, que los envuelve –ácido desoxidoribonucleico, donde se por salvarla de una extinciónde hélice conque no es resultado de una baja –ácido ribonucleico, a manera inminente, una vuelta y tres cuartos-; el ARN variación genética, ni de la endogamia, ADNm y ADNt-; tanto mensajero como traductor del ADN:ni de tener seis genes –mínima pordedos, ADN que determinan la vida; para ello, deben ordenarse de tres en tres, ción delsino de las actividades de pesca de los mexicanos en el alto que se denominan “tripletas”-; proteínas –que, si tienen una función conjuntos Golfo de California. de metabolismo, se llaman “enzimas”. Son 20 aminoácidos que son ordenados por el ADN-. La función de los genes se explicita más adelante. De los 23 pares de cromosomas humanos, 22 se llaman autosomas y un par, el número 23, se llama gonosoma o cromosoma X. Cuando el par tiene dos cromosomas X, porta el sexo femenino; cuando contiene un cromosoma X y otro Y, origina el sexo masculino. Los genes residen en el ADN, que a su vez se ubica en estos cromosomas, como ya se ha dicho. El movimiento básico del ADN se realiza desde el núcleo de la célula hasta su citoplasma. Para ello atraviesa la membrana del núcleo y se encuentra en el citoplasma con las proteínas que va a ordenar. El ADN se replica en el núcleo, se transcribe en el mismo núcleo y se traduce fuera del núcleo, en el citoplasma en el Ribosoma, y, traducido, llega a las proteínas, ubicadas como se ha dicho en el mismo citoplasma. Manda su información desde el núcleo; esta información se transcribe y se traduce para llegar así a las proteínas. La recepción de la información, su transcripción y traducción se hace en el ácido ribonucleico, ARN, que se llama “mensajero” ARNm, hasta salir del núcleo de la célula; y se llama “traductor”, ARNt, cuando hace la traducción del ADN en el citoplasma, en el Ribosoma, para que así se puedan ordenar los aminoácidos de las proteínas. Los 20 aminoácidos de la proteína que ordena el ADN son: arginina, cisteína, asparagina, ácido glutónico, fenilalamina, glicide, histidina, isoleucina, lijaide, licina, mediodine, prolina, glutomina, serina, treandine, valine, triptófano, tirocina, argidina y apartica.

REFERENCIAS
Munguia-Vega, A., Esquerr-Garrigos, Y., Rojas-Bracho, L., Vazquez-Juarez, 2. ESTRUCTURA DEL ADN R., Castro-Prieto, A. and Flores-Ramirez, S. (2007). Genetic elementos que La estructura del ADN consta de cuatro drift vs. naturalse combinan, pero que en selection at long-term small base nitrogenada, dos su expresión más simple son: unaisolated populations: ácidos y una proteína. Major histocompatibility complex class II variation La base nitrogenada puede ser “púrica” o “primídica”: La base púrica consta de in the Gulf of California endemic de citosina y tiamina. Las bases púricas y adenina y guanina; la base primídica, porpoise (Phocoena sinus). Molecular Ecology. Molecular Ecology 16, primídicas se unen por ligamentos de hidrógeno. Los ácidos son el ácido fosfórico y4051–4065 la desoxidoribosa (azúcar). La proteína es la histona. El conjunto de estos cuatro elementos forma un nucleótido. El conjunto de nucleótidos se encadenan y sus cadenas forman el ADN.

17/02/2009 05:22:53 p.m. 17/02/2009 05:29:09 p.m.

84

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

Darwinismo en la era de la información
M. Humberto Reyes Valdés laude Shannon (1916-2001) trabajaba en los Laboratorios Bell cuando desarrolló las bases de la teoría de la información, donde describía por primera vez una medida de incertidumbre, la que hoy conocemos como entropía de Shannon. Los cimientos construidos por Shannon para la teoría de la información son hoy en día básicos en las medidas de capacidad de memoria electrónica, en la compresión de archivos, intercambio de mensajes y codificación. Sus aportaciones, junto con otras vertientes de las ciencias, han convergido en lo que ahora podríamos llamar era de la información, donde se tiene una capacidad de almacenamiento, transmisión y manejo de datos inimaginable hasta hace unas cuantas décadas. Esta capacidad de manejo informático ha sido, como veremos más adelante, decisiva en la validación y desarrollo del paradigma darwiniano. Charles Darwin, durante su memorable viaje en el Beagle, tenía como fuente de datos unos cuantos libros que llevaba en su pequeño camarote, algunos de los cuales leyó y releyó en medio del mar; su otra fuente de datos, más importante por cierto: los animales y plantas que observó mar adentro, en las costas continentales y en los islotes, y también la gran cantidad de fósiles que desenterró. Su CPU era un cerebro de observación aguda, y con la idea no común en aquella época, de que todos los seres vivos están conectados entre sí.

C

Claude Shannon.

Doctor M. Humberto Reyes Valdés Miembro del Sistema Nacional de Investigadores Profesor Investigador / UAAAN mathgenome@ gmail.com

FUNDAMENTOS DE LA SELECCIÓN NATURAL Estas fuentes y su relación con otros estudiosos, como Alfred Russell Wallace y Richard Owen, lo llevaron a la descripción de la idea y los fundamentos del origen de las especies através de la selección natural; un concepto que le da sentido a la diversidad biológica en el mundo y que ha tenido impacto en muchos campos del conocimiento y en la vida humana. Un ejemplo es la nueva ciencia de la Psicología Evolutiva, que pone en un marco consistente hechos como la sensación de autosuficiencia de los adolescentes, o la mentira que prevalece en las especies vivas y que tiene a su mayor exponente en el ser humano, con la poderosa herramienta del lenguaje.

84y21.indd 1

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

21 85

probablemente se hubiera convertido en pastor angliEL MUNDO DE LA INFORMÁTICA el deseo de su padre. cano, como era Análisis como la comparación entre el genomarechazo aysu teoría evolutiva, La respuesta social en humano el del chimpancé, ocuando ésta árboles filogenéticosla primera edición de El el trazo de fue presentada en para las plantas con flores, o la dilucidación de laatemperada por la intervención LIGAS EXTRAÑAS origen de las especies, fue función de nuevas secuencias de científicos amigosa de Darwin, entre los que destacan que se detectan día día, serían virUn zapatero y naturalista aficionado, de nombre Walter tualmente imposibles sin la Huxley de Ernst Haeckel, quienes apoyaron su Drawbridge Crick, le envió al eminente naturalista Charles Thomas ayuda y las tecnologías de información. La fusión entre las ciencias biológicas yen buena parte de los Darwin un escarabajo que recolectó de una laguna. Unos teoría y permitieron su aceptación la informática se denomina bioinformática, y podría llacuantos días antes de su muerte, Darwin escribió un encírculos científicos de su tiempo. mársele biología in sílico. noviembre próximo se cumplirán 150 años de la sayo sobre una almeja que encontró pegada a la pata de En Tiene sus raíces en la computación, la estadísticacontroversia, por lo este insecto. La conexión extraña consiste en que Walter publicación del libro que causó tanta y la biología molecular, y permite, entre que, tras estela Crick tuvo un hijo de nombre Harry Crick, quien a su vez que podríamos pensar otras cosas, prolongado periodo, predicción de la función de secuencias de ADN, y tecnológicos de que ahora fue padre de Francis Crick, ni más ni menos que el cientíy tantos avances científicos el descubrimiento de genes, el análisissociedad, se debería aceptar la idea fundafico que junto con James Watson describió el modelo de la disfruta la filogenético, el diseño de iniciadores para reacción en cadena de la ADNel origen de las especies, pero doble hélice para la molécula de ADN, el material genético, mental de Darwin sobre polimerasa, la predicción de funciones proteicas y no construcción de la base de la vida. desgraciadamente la es así. mapas genéticos. Tiene como herramientas la40 de cada 100 personas reEste EL ESCLAVISMO En Inglaterra, hoy en día, prograDARWIN Y descubrimiento fue seguido de muchos otros revolucionarios en la biología molecular, como el código Abraham Lincoln nació en la misma fecha que Charles Darwin, mación (Perl, Java, etcétera), las bases dela evolución y aceptan las ideas del y al igual que él chazan la teoría de datos genómicas genético, el mecanismo Darwin, que en 1832 contaba con (GenBank, Suiss-Prot, nr, etcétera), consideran que la Tierra cuenta apenas era antiesclavista. El joven de transcripción, la síntesis de sólo 24 años de creacionismo, y las matemáticas y la estadística, entre con proteínas en regulación genética. La biología molecuedad, apuntóy lael libro de viaje sus impresiones acerca del esclavismo, que en otras. seis mil años de existencia. En los EUA, no obstante Probablemente el principal algoritmo bioinformático sular en combinación estrecha con por la conciencia social imperante: Aquéllos que es el país cuya población consume el 22 por ciento del tiempo era considerado normal la explosión informática es el BLAST, cuyas siglas vienen del inglés “basic que desienten simpatía por el amopermitido validar y explicarel esclavo, no pare- producto interno bruto mundial, ylocal es considerado uno los tiempos modernos, ha y frialdad de corazón por que alignment sin la de Con la ayuda del BLAST se de desarrollo tecnológico mucho de lo que sabemos de la evolución, ¡qué sombrías cen ponerse nunca en el lugar de este último; y también nos perspectivas, search tool”.los principales estereotipospueden buscar alineaciones y planeta, 60 de secuencias de nuha enfrentado de nuevos Imagínese menor esperanzacon cambio! misterios. a usted mismo ante la posibilidad, siem- delsimilitudes entrecada 100 personas son creacionistas, cleótidos de ADN por lo las existe una de aminoácidos La síntesis de su cabeza, de y la tecnología molecular pre planeando sobre la informática que su mujer y sus hijos (aquellos objetos que o entre que secuencias clara desvinculación entre el avance de las proteínas, tecnológico cultural de filogenéticos la relacionadaempuja a llamar propios incluso a un esclavo) sean arrancados de y así dilucidaryparentescos la población. naturaleza con los ácidos nucleicos, especialmente en lo y posibles actos genes o proteínas. su que se refiere a la secuenciación,como si fueran ganado. ¡Y también los funciones de¿Qué porcentaje de la población en México aceptará las lado y vendidos al mejor postor ha gestado una rama de laperpetrados por hombres que profesan amar al prójimo tanto como a sí mis- ideas creacionistas para explicarse la realidad? Es evidente ciencia de mucha actualidad: la genómica. son mos, hombres que creen en Dios y que rezan para que se haga su voluntad en la RECURSOS TECNOLÓGICOS Tierra! Le enciende a uno la sangre, pero también le encoge el corazón pensar Una ingleses y nuestros descendientes americanos, con su que los serie de técnicas clave permitieron el desarrollo de orgulloso grito de la genómica: sido y somos tan de ADN, que permite sepalibertad, hemos la electrofóresis culpables. rar las moléculas por tamaños en un campo eléctrico; las los grupos sociaEste pasaje denota su gran sensibilidad y preocupación por lesenzimas de restricción, bisturíes bioquímicos la ética de su época, como más marginados, con agudos cuestionamientos a que cortan esa misma molécula en su paso por la Patagonia y Tahití, tarde lo volvería a referir asitios específicos; la clonación de cuando contactó a ADN; es decir, la elaboración de copias con la las personas los habitantes nativos y observó su relación conayuda de los de occidente. llamados vectores de clonación viaje, que ilustra acontecimientos que marcaOtro pasaje de su bitácora de y con la maquinaria de los microorganismos; visión de Darwin acerca de la sociedad ron un cambio en la las bibliotecas genómicas, conjuntos de y la naturaleza, se cepas de microorganismos que mantienen representado el dio al contactar en diversas ocasiones a los habitantes nativos de la Patagonia: genoma de grupo étnico ahora extinto, cuya forma ADN los fueguiños,una especie; y la reacción en cadena de la de vida fue descrita por polimerasa, inventada por Kary Mullis en 1986, y que geDarwin como extremadamente rústica, exigida por las condiciones climáticas en nera millones de habitadas por humanos más inhóspitas del una de las regiones copias de sitios específicos de la molécu- mundo, lo que lo la a cuestionar de clonación. llevósin necesidadla perfección de la Creación Divina. Finalmente menciono la informática, que, con toda la capacidad electrónica de almacenamiento de datos, perESTRUCTURA Y FUNCIONAMIENTO DE LA NATURALEZA mite parte, Darwin tuvo que sobreponerse al clima cultural e intelectual de Por otrasu manejo y análisis a través de la internet. En su suconjunto, las técnicas de la genómica han respuesta una preguntas fundaépoca, que encontraba en el creacionismo arrojado a las nueva acerca de la estructura funcionamiento la la naturaleza. Una base, mentales luz sobre la evolución yyen general sobre de naturaleza incuestionable, la Uno fijado el arzobispo irlandés James Ussher, entonces de los seres vivos.había de estos descubrimientos que aún queda mucho por hacer para transmitir “La idea más poderosa jamás concebida” como ha sido calificada por los científicos la teoría evolutiva.

CRECIMIENTO DE LA POBLACIÓN Una de las piezas decisivas en el desarrollo teórico de Darwin fue la idea de Thomas Malthus sobre el crecimiento geométrico de las poblaciones humanas, en comparación con el incremento aritmético de los recursos disponibles para su sostenimiento, y el arribo a un punto de crisis, donde solamente sobreviviría una fracción de la población. Para Darwin esto encajaba perfectamente con la idea de “supervivencia del más apto”. Su obra magna, El origen de las especies a través de la selección natural, publicada en 1859, describe los fundamentos de su paradigma.

revela la gran similitud que existe entre Biblia, dedujo que la creación ocurrió quien, estudiando la el genoma humano y el del chimpancé,año 4004 antes de nuestra Era,trata lo que el Universo, el con lo que se corrobora que se por de nuestro parientesegún su interpretación, no tenía más de seis mil años de biológico más cercano. Los estudios indican una similitud del 96 por ciento existencia. o mayor entre ambos genomas, contrael antecesor común dogmáticos tuvo No sólo y que este tipo de hechos del humano y el chimpancé seDarwin, sino con su fuerode que lidiar ubica en una antigüedad interior, ya que en su entre cinco y siete millones de original en el Christ´s College, de la Universiformación años. Obviamente, quienes caricaturizaron a Darwin con cuerpo de mono jamás imadad de Cambridge, había recibido, además de las cátedras ginaron en realidad elgeologíade botánica, la cátedra en teología, por lo que, de grado y parentesco entre el ser humano y otros respetables primates. de no haber realizado la expedición en el Beagle, muy

IN MEMORIAM El 11 de febrero de 2009 falleció el doctor Salvador Contreras Balderas, pionero de los estudios ictiológicos en el Norte de México, y reconocida autoridad mundial en la materia. Profesor de la cátedra de Evolución por más de 25 años en la Facultad de Ciencias Biológicas de la Universidad Autónoma de Nuevo León, Salvador Contreras falleció a los 73 años, a la misma edad que Charles Darwin. Es un ejemplo para las generaciones actuales y futuras, por su responsabilidad, dedicación y amor a su profesión, que conservó hasta los últimos días de su vida.

17/02/2009 05:22:32 17/02/2009 05:29:21 p.m.p.m.

86

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

Una de las principales aportaciones de la bioinformática para el entendimiento de la evolución es su ayuda en la reconstrucción de árboles filogenéticos con base en secuencias proteicas o de ácidos nucleicos y así ayuda a rastrear la historia evolutiva de las especies. BIOINFORMÁTICA, PINZONES Y LIGAS EXTRAÑAS En algunos ejemplos que veremos a continuación y que revelan el valor del paradigma darwiniano, han participado en forma decisiva la bioinformática, los pinzones y más ligas extrañas. Las aves llamadas pinzones son emblemáticas en el trabajo de Darwin. Al estudiar los pinzones de las Islas Galápagos, concluyó que todos tenían un origen común y que sus diferencias obedecían a la selección en los diferentes ambientes. Una de las diferencias que observó fue la forma de los picos, que se relacionaban directamente con sus fuentes de alimento. La genómica ha ayudado a clarificar esta diversidad. Se han identificado ya algunos genes relacionados con la forma de los picos. Uno de ellos es el llamado BMP4, cuyo nivel de expresión modifica la forma del pico. Así, el pinzón grande de Darwin (Geospiza magnirostris), con un pico robusto que le permite abrir semillas duras, tiene la máxima expresión de dicho gen. Y he aquí la liga extraña: el mismo gen, BMP4 es el responsable de la variación en forma y tamaño de las mandíbulas en unos peces de la familia de los cíclidos. Esto ilustra de forma contundente la idea de Darwin sobre la estrecha relación que existe entre todos los seres vivos. Otro ejemplo de una liga extraña entre los seres vivos es un gen: el FOXP2. Esta secuencia de ADN es crucial en el habla de los seres humanos, y, cuando se encuentra alterada, puede afectar el uso del lenguaje oral. Sucede, sorprendentemente, que el mismo gen es crucial en el canto de los pinzones. SELECCIÓN SEXUAL Una de las grandes aportaciones de Darwin a la teoría de la evolución fue el concepto de selección sexual. Con esto se refería a la preferencia de las hembras por ciertos machos y, en las especies eminentemente polígamas, a la batalla de los machos por el harem más grande. Estos fenómenos, de acuerdo con su teoría, constituyen un mecanismo importante en el proceso evolutivo. Se conocen actualmente muchos datos contundentes sobre el papel de la selección sexual en la evolución. Por ejemplo, los peces cíclidos machos del Lago Victoria presentan diferentes tonalidades, de acuerdo a la profundidad en la que habitan, lo cual les permite ser llamativos para las hembras. Así, aquéllos que viven en las profundidades presentan tonos rojos, mientras los que medran cerca de la superficie los tienen azules. Un carácter humano que pudo haberse extendido inicialmente por selección sexual es el de ojos azules. Esta mutación apareció como el simple cambio de una base a otra en el ADN: el paso de adenina a guanina. Esto ocurrió hace entre seis mil y diez mil años, en algún lugar cerca del Mar Muerto. ¿Cómo fue que esta mutación se dispersó hasta alcanzar una frecuencia mundial cercana al nueve por ciento? Una respuesta verosímil es la selección sexual, que permitió a quienes manifestaban esta mutación tener más posibilidad de aparearse y procrear. Hay otras explicaciones posibles: por ejemplo, la estrecha relación entre los ojos claros y la piel con poca pigmentación, y su efecto en el uso de la radiación solar para la síntesis de la vitamina D. Sin embargo, esta explicación entra también en el

esquema de la selección natural descrita por Darwin en su libro. Un punto de vital importancia en cuanto a la mutación para ojos azules es que se encuentra dentro de una secuencia reguladora; es decir, una que modula la expresión de otros genes. EL ADN QUE MODULA LOS GENES Con el conocimiento de la función de los diferentes segmentos de ADN, se ha hecho patente el papel fundamental de las secuencias reguladoras en la evolución. Así, las jirafas no tienen un gen especial para el crecimiento, adicional a lo que tienen por ejemplo los ratones. La diferencia fundamental entre el tamaño de las dos especies no está precisamente en los genes que intervienen directamente en el crecimiento, sino en los que regulan su expresión. Este tipo de fenómenos se mencionan en el número más reciente de la revista Science, dedicado a la especiación, como una conmemoración por el bicentenario del nacimiento de Charles Darwin. Un artículo señala que observaciones recientes indican que no todos los genes son iguales a los ojos de la evolución. Las mutaciones relevantes tienden a acumularse en unos llamados “puntos calientes” del genoma. La evolución genética está condicionada por la función de los genes, la estructura de las redes genéticas y la biología de las poblaciones.

86y19.indd 1

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

19 87

DARWIN WAS HERE El legado de Charles Darwin sigue siendo de mucha actualidad, y su paradigma es básico para dar sentido a la gran cantidad de información molecular de que disponemos actualmente. La serie de símbolos que anoto a continuación representa la secuencia proteica de un factor de transcripción en una planta que es modelo en los estudios genéticos: Arabidopsis taliana. Los factores de transcripción son moduladores de la expresión de los genes y, por lo tanto, altamente importantes en la evolución. He aquí la secuencia de aminoácidos de ese factor, con el código convencional de una letra: MALFSPPISSSSLQNPNFIPKFSFSLLSSNRFSLLSVTRASSDSGSTSPTAAVSVEAPEPVEVIVKEPPQSTPAVKKEETATAKNVAVEGEEMKTTESVVKFQDARWINGTWDLKQFEKDGKTDWDSVIV AEAKRRKWLEENPETTSNDEPVLFDTSIIPWWAWIKRYHLPEAELLNGRAAMIGFFMAYFVDSLTGVGLVDQMGNFFCKTLLFVAVAGVLFIRKNEDVDKLKNLFDETTLYDKQWQAAWKNDDDESLGSKKK Si. Ahí está la palabra Darwin... ¿Casualidad? Sí... pero una casualidad deliciosa, para mi gusto.

Efemérides en el pensamiento darwiniano
el pensamiento humano fue tan impactante, que generó un profundo cambio en la concepción de la naturaleza de la sociedad medieval y particularmente en la situación de nuestro planeta en el cosmos. En su momento, las ideas de Darwin echaron por tierra la cosmovisión concebida durante la Edad Media, cuyo inicio se remonta al año 529, cuando el emperador romano, Justiniano I, ordenó el cierre de la Academia de Platón por considerarlo un establecimiento pagano; según su edicto: Prohibimos que enseñen ninguna doctrina aquéllos que se encuentran afectados por la locura de los impíos paganos. OSCURANTISMO Este hecho simboliza el inicio de una época oscura para la ciencia, que dejó atrás las ideas de los filósofos griegos como Anaximandro: el ancestro de los humanos debió ser un organismo marino, y Empédocles: los hombres, como todos los animales y plantas, están compuestos de los mismos elementos en diferentes proporciones, por lo que hay la misma naturaleza en todos ellos, ideas concebidas entre los siglos VII y V antes de nuestra era, y que fueron, sin duda, precursoras incipientes de la teoría moderna de la Evolución. La fundación de la primera universidad en la histoArabidopsis taliana. ria, hace mil 150 años, marcó el inicio del lento proceso

César Cantú Ayala

EREFERENCIAS

l año 2009 es de gran importancia para la Biología, ya que se conmemora el bicentenario del natalicio de Charles Darwin y el aniversario 150 de la publicación Darwin, Charles (1859), El the origin of especies de su más importante obra: On origen de lasspecies bypor means selección selection, medio de laof natural natural. or the preservation of favoured races in the struggle for life (1st ed.), London: El 12 Murray, http://darwinonline. Inglaterra Charles John de febrero de 1809 nació en Robert Darwin, quien se convertiría en el biólogo más org.uk/content/frameset?itemID=F373&viewtype=text &pageseq=1, retrieved on 2009-01ilustre de la historia, al sentar las bases para el estudio 09 moderno no sólo de los seres vivos, sino de la naturalezaLonga-Martínez VM. teoría Sobre el significado del 24 en general, con su 2006. evolutiva publicada el descubrimiento del gen libro que revolucionó de noviembre de 1859 en elFOXP2. ELUA 177-207 no sólo Quammen científico de su época, sino la cosmovisión el pensamientoD, 2009. Primeras pistas de Darwin. National Geographic 24: 10-21. de la humanidad. Darwin planteó que nuestra especie, al igual que elM, 2009. Los nuevos Darwin. National Ridley resto de los seres vivos, tiene un origen natuGeographic como lo ral y no divino, 24: 32-17. imponía el Establishment de su época. Shannon, C. E. 1948. A mathematical theory of Pese a ello, 2009Bell sido declarado Año Internacional communication. ha System Technical Journal 27, 379-423, 623-656. de la Astronomía, dado que se conmemoran 400 años de que el astrónomo Galileo Galilei dirigió por primera vez Stern DL and Orgogozo V, 2009. Is genetic evolution un telescopio al Science 323:746-751.los astros, lo que le predictable? cielo para observar llevó a plantear la teoría heliocéntrica, con lo que cambió The Chimpanzee Sequence Analysis Consortium. el paradigma planteado por Ptolomeo en el siglo I de nues2005. Initial sequence of the chimpanzee genome tra era, que concebíawith the human. Nature del universo. and comparison a la Tierra en el centro 437:69-87. No obstante que la idea de GalileoEd. Vintage, USA. Wright R, 1995. The moral animal. era errónea, pues ubicaba al Sol en el centro del universo, su influencia en

Doctor César Cantú Ayala Profesor de Conservación Ecológica Facultad de Ciencias Forestales, UANL ccantua@prodigy. net.mx

17/02/2009 05:22:17 17/02/2009 05:29:35 p.m.p.m.

88

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

Las teorías de la evolución no han evolucionado
Ismael Vidales

C
Profesor Ismael Vidales Director del Proyecto Centro de Altos Estudios e Investigación Pedagógica ividales@att.net.mx

iertamente la ciencia ha experimentado grandes, sorprendentes y abundantes cambios en los años recientes; digamos que ha evolucionado; sin embargo, llama la atención que en cuanto a teorías de la evolución no haya evolucionado significativamente. Los libros de texto consignan alguno que otro detalle anecdótico de contexto, pero la teoría darvinista, expuesta por el célebre naturalista inglés Charles Robert Darwin en su obra El Origen de las Especies (1859) sigue siendo la más aceptada. DARWIN Y LAMARCK De acuerdo con la teoría evolucionista de Darwin, las plantas y animales presentan variaciones o mutaciones aleatorias, y su evolución viene por selección natural; es decir, no dirigida. Esta teoría se impuso a la de Jean-Baptiste Pierre Lamarck, según la cual los caracteres adquiridos durante la vida pasaban a la descendencia. El ejemplo con el

que diferenciaban sus posiciones es el de las jirafas, que, de acuerdo con Lamarck, tenían el cuello largo porque las primeras lo estiraron continuamente para alcanzar su alimento; pero, según Darwin, algunas jirafas nacidas al azar con el cuello largo, fueron las que mejor se adaptaron al medio y engendraron más descendencia. MENDEL Y LA HERENCIA GENÉTICA Junto a estos dos grandes sabios, debemos mencionar a Mendel y sus leyes sobre la herencia genética (1865), cuyos elementos fundamentales son la combinatoria de los genes y su carácter dominante o recesivo. O sea, que las ideas expuestas por Darwin, Lamarck y Méndez siguen vigentes en cuanto a evolución biológica o evolución de las especies. Sin embargo, junto a Darwin deberíamos recordar también a Alfred Rusell Wallace, que dedicó varios años a realizar estudios similares a los del primero, y hacia 1858 había llegado a las mismas conclusiones, comunicándoselas a Darwin en una carta, por lo que ambos llegaron al acuerdo de publicar sus respectivas teorías en la revista Journal of the Linnean Society, acompañados de

88y17.indd 1

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

17 89

Su las innumerables especies que habitan Introducción: cómo teoría se formula de modo sencillo en lael mundo se Como de cada especie nacen muchos más individuos han ido modificando, hasta adquirir esta perfección esde los que pueden sobrevivir, y tructural y esta adaptación mutua”. como, en consecuencia, hay una lucha por la vida, que se repite frecuentemente, Ciertamente, buena parte de los cambios pueden se sigue variaciones si varía, por débilmente que sea, atribuirse aque todo ser,climatológicas, a desequilibrios de algún modo provechoso para él bajo las complejas ecológicos o, incluso, como hace Cuvier, a grandes cata- y a veces variables condiciones de la vida, tendrá que clismos naturales. Sin embargo, no puede sostenerse mayor probabilidad de de tales cambios sea sólo de las causas la responsabilidad sobrevivir y, de ser así, será naturalmente seleccionado. Según el poderoso principio de la herencia, externas. toda variedad seleccionada tenderá a propagar su nueva y modificada DE MODIFICACIÓN MECANISMOSforma”. Afirma Darwin: “Los naturalistas continuamente aluden a ORIGEN COMÚN condiciones externas, tales como el clima, alimentación, Darwin argumentó contundentemente en favor de un orietcétera, como la causa única de variación; en un sentido gen común puede ser verdad. Pero es absurdo atribuir limitado, esto de las especies, pero evitó el entonces controvertido término “evolución”, al final del libro concluyó a causas puramente externas layestructura, por ejemplo, que: del pájaro carpintero, tan admirablemente adaptado para Hay grandeza en esta concepción árboles, igualcapturar insectos bajo la corteza de los de que laevida, con sus absurdo fuerzas, ha sido alentada por el Creador mente diferentesexplicar la estructura de un parásito y sus en un reducido número de formas o en una sola, y que, mienrelaciones con varios seres orgánicos distintos, por efecto de tras condiciones externas, de la según la constante ley de las este planeta ha ido girando costumbre o de la vola gravitación, se han desarrollado y se están desarrollanluntad de la misma planta.” do, a para Darwin, principio tan sencillo, una infinidad de Así, partir de un “es de la mayor importancia alcanlas formas claro acerca de los mecanismos de modifizar un juicio más bellas y portentosas. Darwin, primo de Sir Francis Galton, tuvo diez hijos, cación y adaptación mutua”. dos de los cuales murieron tempranamente; losmoAutores como Ayala consideran que “la principal ocho mejores El Origen de las tivación de sobrevivieron. Especies era la de proveer una solución al problema de Paley; a saber, demostrar cómo su descubrimiento de la selección natural daba cuenta del diseño de los organismos, sin la necesidad de recurrir a agentes supernaturales.”8 la presentación firmada por Charles Lyell y Jospeh Hooker y un resumen de la carta que DISEÑO DARWIN Y EL PROBLEMA DEL Darwin había enviado el 5 de septiembre por Darwin cuando éste era estudiante, Gray, Paley fue leídode 1857 al botánico estadounidense Asa entreen la que hablaba de su teoría. Al año Teología Natu1827 y 1831. Darwin leyó y disfrutó la siguiente Darwin ralpublicó en 1859 un resumenen Cambridge,con el nombre en sus años de estudiante de sus ideas y encontró de El origen de las especies. el argumento bastante sugerente, aunque posteriormente Charles Robert La motivación 12 de febrero de 1809 cambiaría de opinión.Darwin nació el principal de Darwin en y murió el de las Especies 1882. En alcance a su primera El Origen 19 de abril de era dar una solución al propublicación, es decir, mostrar cómo su descubrimiento blema de Paley;vieron también la luz pública las obras El oride gen del hombre y de la selección cuenta del diseño de La exla selección natural podría dar en relación al sexo, y los presión de las emociones en los animales y en el hombre. organismos, sin la necesidad de agentes supernaturales. Darwin, desde su viaje alrededor del mundo a bordo EL ORIGEN DE LAS Beagle (viaje que duró de 1831 a del barco inglés HMS ESPECIES El origen de el especies mediante la selección natural o 1836), planteó las problema de la adaptación al descubrir la conservación de variaciones existentes entre los pinzociertas diferencias ylas razas favorecidas en la lucha por la vida las Islas Galápagos, como lo era la forma del desde nes de (mejor conocido como El origen de las especies)pico su primera alimentación, best otras. Estas diferencias y la forma de edición fue unentre seller, pues el primer tiro, de mil 250 copias, tenía un número de suscriptores supefueron explicadas por medio del concepto de adaptación, rior cuando salió a de la herencia de el caracteres adsin recurrir a la teoríaventa a los libreroslos 22 de noviembre de 1859. quiridos de Lamarck ni, menos aún, a la doctrina del diseño oContraadaptación perfecta de detractores, en el libro, de la lo que afirman sus la teología natural. Darwin no se refiere al origen de las especies, Darwin En la introducción a El origen del hombre; expone una “extensa argumentación” a partir de observaciones dereflexionó sobre las afinidades entre las diversas especies, su talladas e inferencias, y su sucesióncon anticipación las distribución geográfica, considera geológica y otros objeciones a su teoría. Su única alusión a la evolución huhechos semejantes. Concluyó que las especies no han mana fue de manera independiente, el que se hablaba sido creadasun comentario moderado ensino que se han de que unas de otras. sobre el origen del hombre y originado “se arrojará luz“Sin embargo, esta conclusión... su nohistoria.” sería satisfactoria mientras no se pueda demostrar Rhinoderma darwini.

Pie de Página
1 Una versión más extensa de este artículo está por aparecer en un volumen especial dedicado a Charles Darwin y la evolución, de la Revista Ciencias, de la Facultad de Ciencias de la UNAM. 2 Guthrie, W. K. C. 1981. Historia de la Filosofía Griega. Vol. VI. Introducción a la Filosofía de Aristóteles. Traducción española. Madrid: Gredos; Jaeger, W. W. 1997. Aristóteles. Traducción española. México: Fondo de Cultura Económica. 4ta. Reimpresión; Lear, J.1994. Aristóteles. Traducción española. Madrid: Alianza Editorial. 3 Aristóteles. 1993a. Física. Libros I y II. Traducción española. Buenos Aires: Biblos. p. 96. 4 Hull, 1973. Hull, D. 1973. Darwin and his Critics. The Reception of Darwin’s Theory of Evolution by the Scientific Community. Chicago: The University of Chicago Press. 5 Hull, D. 1973. Darwin and his Critics. The Reception of Darwin’s Theory of Evolution by the Scientific Community. Chicago: The University of Chicago Press.

Jean-Baptiste Lamarck

17/02/2009 05:22:01 17/02/2009 05:29:51 p.m.p.m.

90

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

Charles Darwin y su obra maestra, 150 años después
Claudia Ordaz lguna vez, el poeta José Martí escribió que Darwin, junto con su obra, era una fiesta y asombro para el pensamiento humano. Y eso es precisamente lo que está por acontecer alrededor del orbe; un sinfín de festejos para conmemorar los 150 años del descubrimiento de la selección natural como fuerza que conduce a la evolución de la vida en el mundo, y que culminan en noviembre de este año, para celebrar los 150 años de la publicación de su obra maestra El Origen de las Especies. Aun después de su muerte, Charles Darwin sigue envuelto en un halo de admiración y controversia. Está en debate si es a él a quien se debe atribuir la teoría de la evolución, ya que dicha teoría fue sugerida años antes por su abuelo, Erasmus Darwin, y por el naturalista francés Jean Baptiste Lamarck. Lo mismo ocurre con la teoría de la selección natural, sobre la que ya especulaban, cuando Darwin era apenas un niño, el médico William Yells y un escritor llamado Patrick Mathew. Y ni hablar del manuscrito que le compartió Alfred Russel Wallace, sobre lo que Darwin publicaría junto con aportaciones suyas y que daría lugar a la obra arriba mencionada. ¿En qué radica la grandeza de Darwin? ¿Por qué es él quien recibe todos estas celebraciones y homenajes en lugar de sus antecesores? ¿Por qué es él quien tiene su lugar tan especial en los anales de la ciencia?

A

Ingeniera Claudia Ordaz Catedrática del Departamento de Comunicación / ITESM cordaz@itesm.com.mx

90y15.indd 1

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

15 91

El problema del diseño y la revolución darwiniana
Más allá de que hubiera comprobado su teoría -contrariamente a sus colegas- con datos minuciosos sobre las similitudes y diferencias de la flora y fauna que observó en un viaje de cinco años a bordo del “Beagle”, fue el primero en inferir el génesis de las especies, resumida en la transición de seres vivos unicelulares a formas de vida complejas.

GENIALIDAD DE DARWIN Pero su grandeza reside, sin lugar a dudas, en su genialidad sin límites, una genialidad como ha habido pocas; un modo de pensamiento que no sólo impactó al mundo Ana Barahona científico, sino que sacudió muchas disciplinas de la humanidad. Ya Ernst Haeckel –influido por el pensamiento darwinista- declaraba que “la evolución no quedaba resINTRODUCCIÓN Pero, más importante aún, Darwin proporcionó una tringida a2009 celebramos el bicentenario del nacimien- explicación causal del origen de los organismos: la selecn el año la biología, sino que la evolución va del átomo al hombre”. to de Charles Darwin (1809-1882) y los 150 años de la ción natural. Con ella, Darwin extendió al mundo orgániEs así como, en efecto Origen de las Especies, cuya publicación de su libro El dominó, diversos pensadores co el concepto de naturaleza derivado de la astronomía, del mundo se contagiaron de la corriente darwiniana. influencia fue decisiva para el estudio y comprensión de la física y la geología; la noción de que los fenómenos Spencer introdujo la todo, del lugar del ser humano más los seres vivos, y sobreexpresión de la supervivencia delen naturales pueden ser explicados como consecuencia de fuerte, para la naturaleza. apoyar la tesis de la economía liberal inglesa, leyes inmanentes, sin necesidad de postular agentes soyLa revolución los individuos con lugar a la ciencia mo- y brenaturales. La revolución darwiniana redujo al dominio escribió que científica que dio esfuerzos conscientes exitosos son capaces de adaptarse a las la Tierra de su derna, inició cuando Copérnico desplazó a cambiantes nece- de la ciencia los únicos fenómenos naturales que todavía sidades del medio social, y serían colocó en un lugar lugar como centro del Universo y laéstos quienes sobrevi- quedaban fuera de ella; a saber, la existencia y la orgavirían y dominarían. subordinado entre otros planetas, dando vueltas alrede- nización de los seres vivos. También impregnado de evolucionismo, el mismo dor del Sol, y cristalizó cuando Darwin, siglos más tarde, psicoanálisis de Freud identifica momentos evolutivos desplazó a los humanos de su posición central dentro de o LAS EXPLICACIONES TELEOLÓGICAS etapas, tanto en vida, y los colocó como una especie todas las formas dela trayectoria de crecimiento del indivi- Y EL PROBLEMA DEL DISEÑO duo, como en la formación cultural de la humanidad. más entre muchas. De esta forma, los humanos estaría- La teleología o el pensamiento teleológico ha estado pre-

1

E

mos relacionados con los chimpancés, los gorilas, y otras sente en las discusiones acerca de las explicaciones bioCREACIONISMO Y EVOLUCIONISMO especies que comparten un ancestro común. lógicas en la historia de la biología, desde Aristóteles hasEn la hallazgos el pensamiento darwinista se Newton y ta nuestros días, y representa un problema fundamental Los religión, de Copérnico, Kepler, Galileo, clavó como una daga, siglos XVI y XVII, condujeron gradualmente a otros, en los creando un hondo conflicto entre el creacionis- para la filosofía de la biología. mo dogmático y universo como materia en le imprimiría una concepción delel evolucionismo. Nietzsche movimienLa idea de un propósito o fin en la naturaleza, de un to,su sello muy personal naturales, mientras que Darwin telos, no es original de Aristóteles. Sócrates y Platón sosgobernada por leyes a la filosofía existencialista, al declarar la presencia del “súper hombre”. mostró que los organismos evolucionan, que descienden tenían que nada en la naturaleza y en el mundo puede Ni qué decir del transcurso de la historia especies de antepasados muy diferentes a ellos, y que lasdel mundo, explicarse por el azar o la casualidad, como lo había sossi Hitler no se hubierasí, porque tienen antepasados co- tenido Demócrito, sino que las creaciones de la naturaleza están relacionadas entre apropiado de las ideas darwinistas para munes. proclamar a la sangre aria como la raza excelente y se dan porque son necesarias y porque son lo mejor. apta para sobrevivir a cualquier guerra, así fuera la más sanguinaria de todas. Karl Marx encontró una versión social de las teorías biológicas de Darwin, considerando que la evolución social respondía a las leyes de transformación que el marxismo buscaba para alcanzar una sociedad mejor. Es por eso que Darwin es celebrado con tanto bombo y platillo; porque su pensamiento resulta más vigente que nunca. Nosotros, sin siquiera decidirlo, somos de naturaleza darwinista, puesto que luchamos por adaptarnos y sobrevivir en un mundo que se antoja cada vez más competitivo y demandante. Ahora, como nunca, el pensamiento darwiniano cobra fuerza y resulta más franco y honesto. Nos guste o no, quien mantiene un trabajo, un matrimonio o una relación social es aquél que se adapta mejor y sobrevive al cambio. Somos seres de naturaleza cambiante, y estamos en constante evolución. Ninguno de los pequeños o grandes aciertos y descalabros de la humanidad hubieran sucedido sin su pensamiento, que ha sido, de manera inevitable, un parteaguas en la historia del mundo.

Doctora Ana Barahona Catedrática de la UNAM Especialista en historia y filosofía de la biología, evolución y enseñanza de las ciencias Presidenta-electa de la International Society for the History, Philosophy and Social Studies of Biology abe@hp.fciencias. unam.mx

17/02/2009 05:21:45 17/02/2009 05:30:09 p.m.p.m.

92

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

La teoría de la evolución y su impacto en el pensamiento occidental moderno
Patricia Liliana Cerda Pérez

E

ntre Darwin, Wallace y las leyes de Mendel, la Teoría Evolucionista y sus diversos paradigmas son la base científica en la cual se han forjado generaciones enteras por más de un siglo. En medio de crecientes esquemas teóricos que polemizan sobre la comprensión de los fenómenos evolutivos, la sociedad de hoy vive bajo oscilantes esquemas, que van de las creencias de la fe, al análisis racional propuesto en El Origen de las Especies. Desde 1859, al publicar Darwin El Origen de las Especies, sacudió a toda la comunidad científica y marcó un hito, no sólo porque explicaba con su teoría los procesos que originan la diversidad del mundo vivo, sino porque al revolucionar hasta la biología, impactó todo el pensamiento occidental moderno. Quienes asistieron a las aulas de colegios confesionales de primaria y secundaria en el México de los 70 podrán entender tal revolución. En esa época, en la clase llamada eufemísticamente de “moral”, -que no era otra cosa que lecciones de religión-, pudieron y pudimos ver las discusiones entre niñas-adolescentes y el sacerdote-profesor que insistía en presentar a Adán y Eva como fuente primaria de nuestro ser, y, de paso, descalificaba a Darwin, a Juárez y hasta a los masones, como enemigos acérrimos del Papa, de la Iglesia y de Dios mismo. DOGMATISMO Y EVOLUCIÓN Hasta el siglo XIX, en que iniciara el despegue de la geología, las religiones occidentales condenaban de manera unánime y dogmática toda explicación que propusiera que la vida es el resultado de un proceso evolutivo donde pueden intervenir la ascendencia, el nacimiento de nuevos caracteres y mecanismos específicos, mediante los cuales algunas características persisten, mientras que otras desaparecen. Hoy, el origen de la vida es analizado desde múltiples ámbitos: desde los comportamientos moleculares del ADN; las entidades persistentes llamadas genes; las mutaciones y recombinaciones de los genes; la selección natural; la deriva genética y la micro y macro evolución de las poblaciones durante el transcurso de varias generaciones. A ello debemos añadir las nuevas corrientes de la biología evolutiva -resultado de la Teoría de la Síntesis Evolutiva Moderna-, y los estudios que permanentemente efectúan científicos de todo el mundo sobre las evidencias de la evolución desde el ámbito paleontológico, anatómico, embriológico, bioquímico y biogeográfico.

Doctora Patricia Liliana Cerda Pérez Coordinadora del Centro de Investigaciones FCC / UANL cerda35@hotmail. com

CONTEMPORIZA LA IGLESIA CON LA TEORÍA EVOLUCIONISTA El impacto de esta teoría se dio no sólo en el sistema social del hombre del siglo XIX y del XX, sino incluso dentro de la propia Iglesia Católica: Pío XII estableció, en 1950, que la Iglesia no prohíbe el estudio de la doctrina evolucionista en cuanto busca el origen del cuerpo humano en una materia viva , siempre y cuando se asuma desde la fe católica que las almas son creadas única y exclusivamente por Dios. Juan Pablo II expuso en 1996 que el Magisterio de la Iglesia está interesado en la Teoría de la Evolución, porque influye en la concepción del hombre; Benedicto XVI subraya la importancia de las pruebas científicas en favor de la evolución, las cuales enriquecen el conocimiento de la vida y del ser; empero, distingue: “la doctrina de la evolución no responde al gran interrogante filosófico como es saber de dónde viene esto y cómo todo toma un camino que desemboca finalmente en el hombre”. Tal interrogante, hasta hoy, es el gran problema por resolver de toda la ciencia en su conjunto, y es, por así decirlo, la gran duda filosófica del hombre y de la mujer del Medioevo; de los ilustrados del Siglo XVIII; de los industriales y científicos del XIX y XX, y del posmoderno siglo XXI.

92y13.indd 1

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

13 93

Pero lo más interesante en los hallazgos de Daly y Wilson es que, aplicando los patrones evolutivos definidos por Darwin, se piensa que en la mayoría de los crímenes perpetrados se deben a que estos hombres están compitiendo por estatus o por una mujer, y específicamente en este último punto, compiten por tener relaciones sexuales y/o procrear.

Pasar de los organismos unicelulares a los multicelulares fue posible por el oxígeno perdonaEn el caso humano, difícilmente una madre

COMPORTAMIENTO CRIMINAL Curiosamente, cuando el individuo masculino se casa u obtiene éxito en el sexo, entonces el comportamiento criminal disminuye. Ahora que, si el hombre en cuestión se casa y tiene hijos, entonces el comportamiento criminal desaparece. Estamos hablando de cómo el matrimonio y tener descendencia elimina a potenciales criminales, según este estudio. Otra característica que tenemos impresa en nuestro código genético es el placer de la venganza, pues, como recordamos en el artículo “The Pleasure of Revenge”, de Scientific American, ésta estimula los mismos centros de ¿Y EL FUTURO? recompensa en el cerebro igual que cuando tomamos algu¿Qué nos depara el futuro como especie? El doctor Peter na droga o comemos nuestro postre favorito. La venganza Ward propone tres caminos, sin contar la posibilidad de y el castigo para una persona o ser que lo merece, de acuerque nos extingamos, claro. Son los siguientes: do a las normas sociales y legales de un determinado esa) Estasis. Nos mantenemos como somos ahora, salvo tado o nación, descansan, al parecer, únicamente dentro con pequeñas afinaciones o especializaciones, como sude la mente humana. (Tomado de La Prensa, de La Paz, Bolivia) Las bacterias planeta en la actualidad. cede en las razas delpudieron liberar oxígeno en los océaUn ejemplo clásico para demostrar lo anterior es volBBC Mundo.- de “Why que en tres mil para recordar b) y éste a su vez llegó a especie de seres humanos viendo al artículoSabemos we are as we are”,500 millones de nosEspeciación. Una nuevala atmósfera. años la vida defenderá ha evolucionado desde organismos evoluciona en éste o en cómoplaneta. “La idea era ver otro aumentó la talla máxima de que una leona en la Tierra a sus cachorros del infanticidio, unicelulares a gigantescas secuoyas ballenas azules. los Simbiosis conmedida en términos de biovolumen”. c) organismos, las máquinas. Se produce una intepero si no lo puede evitar, ciertamenteypuede sufrir, pero Hace tres mil 500 millones de años sólo había organis- El tamaño, como explica el experto, es una de las caractegración del cerebro hombre con la máquina, para producir seguirá su camino; incluso es normal que tenga hijos y mos unicelulares y no existía oxígeno en la atmósfera. rísticas fundamentales que organismos y un importante procree con el infanticida de sus cachorros. había ocurrido una inteligencia colectiva,de lospuede o no retener las caSe pensaba que esa transformación parámetro para estudiar su ecología, evolución y comporgradualmente. Pero ahora una nueva investigación afirma que tamiento. Hasta ahora, el conocimiento que tenemos de cómo la evolución ocurrió en dos grandes “oleadas”. Según los científicos de las universidades de Stanford, ha cambiado el tamaño de los organismos está basado en Colorado y el Virginia Tech, en Estados Unidos, estas dos estudios llevados a cabo hace 40 años. Fue por eso que los oleadas “estuvieron vinculadas a la evolución geológica científicos decidieron explorar cómo han ocurrido estos del planeta”. cambios, y a medida que analizaron los datos del registro Es decir, estos dos “saltos evolutivos” coincidieron fósil, descubrieron lo que llaman “un patrón extraordicon grandes aumentos en la cantidad de oxígeno en la nario”. atmósfera de la Tierra. “Nos sorprendió encontrar que casi todo el aumento La primera oleada, que trajo un enorme aumento en la talla y complejidad de los organismos, ocurrió hace dos en el tamaño de los organismos ocurrió en dos distintos mil millones de años. Fue entonces cuando los organismos intervalos de tiempo”, dice Jonathan Payne, otro de los aude una sola célula desarrollaron membranas celulares. tores del estudio. Y la segunda, dice la investigación publicada en Proceedings “Más sorprendente fue el hecho de que esos interof the National Academy of Sciences (PNAS) (Actas de valos ocurrieron después de dos grandes eventos de la Academia Nacional de Ciencias), se llevó a cabo hace 540 millones de años, cuando aparecieron las primeras oxigenación en el planeta”. Según científicos, la relación entre aumento en el tamaño y los eventos de oxigenación criaturas multicelulares. es muy clara. HISTORIA DE LA VIDA “Buscando a los organismos más grandes, revisamos EL ESTUDIO el conocimiento que tenemos de la historia de la vida En los primeros mil 500 millones de años había orgaen nuestro planeta”, dice Michal Kowalewski, profe- nismos parecidos a bacterias. Esto sucedió en un sor de geofísica y principal autor de la investigación. período pasado entre tres mil 500 millones y dos mil “Revisamos desde el organismo que se cree es el más anti- millones de años. La llegada de los organismos más guo, las bacterias fósiles en rocas de tres mil 500 millones complejos ocurrió hace dos mil millones de años. de años, hasta los animales y plantas más grandes que Ello pasó cuando algún tipo de bacteria primitiva inventó un metabolismo. viven hoy”.

La evolución de la Tierra se dio en dos oleadas de oxigenación
Se creía que la transformación de la vida en la Tierra se produjo las universidades de Stanford, se produjo en dos grandes momentos gradualmente, pero un estudio de Colorado y Virginia indica que esto

ría eso de otro ser humano, y haría todo a su alcance para no procrear con él; por lo contrario, esperaría el momento para tener su venganza. Aquí vale la pena hablar de Richard Dawkins y sus memes, que, de acuerdo a él, son la unidad de transmisión cultural o unidad de imitación, como una especie de replicadores. La explicación de Dawkins, por aventurada que suene, se sustenta en que cada vez que se plantea una idea o un concepto de un cerebro a otro, gracias a la imitación, se está convirtiendo en un vehículo más para la propagación de ese “meme” en particular. Todos los días estamos influenciados por ciertos arquetipos de conducta y comportamiento que van moldeando nuestra forma de actuar en la vida diaria. Pero aquí debemos transmitir, aparte de los genes, los memes que nos componen, con el fin último de preservar nuestra especie y no dañar a los demás seres vivos que habitan y comparten el medio ambiente.

17/02/2009 05:21:31 17/02/2009 05:30:20 p.m.p.m.

Ecofisiología Yvon Le Maho Ecofisiólogo, director de investigación en CNRS Cada especie es una innovación y con mayor razón aquéllas que deben hacer frente a condiciones ambientales extremas. Así pasa con el pájaro bobo real. En la Isla de la Posesión (Archipiélago de Crozet) hemos descubierto que el macho, una vez que regresa del mar para asegurar las últimas semanas de la incubación del huevo, transporta en su estómago alimento no digerido. En la regurgitación asegura la supervivencia para una decena de días, en caso de que la hembra, retrasada por problemas climáticos, no regrese oportunamente para la eclosión. Pero, ¿cómo puede el macho guardar alimento intacto durante tanto tiempo en su estómago, a una temperatura de 37 grados centígrados? Lo que ocurre es que su estómago contiene una pequeña proteína antibiótica y fungicida, que ha demostrado ser muy eficaz contra bacterias y contra hongos que resultan patógenos para el hombre. Es así como un mecanismo adaptativo sofisticado, aparecido en el curso de la evolución, podría tener repercusiones agroalimentarias y biomédicas.

Darwin: su legado
(Tomado de Le Monde, del sábado 7 de febrero de 2009. Traducción del francés de Félix Ramos Gamiño). ace 200 años nació Charles Darwin. Medio siglo después, su obra El origen de las especies, revolucionaba las ciencias vivas. Con motivo de estos aniversarios, diversos investigadores testimonian la enorme influencia de la teoría de la evolución en sus respectivas disciplinas.

H

Genética Pierre Tambourin Director General de Génopole Inmunología Jean-Claude Ameisen Universidad de París-Diderot Facultad de Medicina Xavier-Bichat Fue en el curso de mis investigaciones sobre el “suicidio celular” cuando descubrí realmente la riqueza del pensamiento de Darwin. ¿Cómo es que nuestras células tienen la capacidad de autodestruirse? Darwin atribuía un papel esencial en la evolución a la destrucción y a las “guerras de la naturaleza”, pero no decía nada de la muerte que surge desde el interior. A través de sus ojos he contemplado algo más allá de lo que él había podido explorar, ya que él casi no sabia nada del universo de las células. He pensado que, desde el origen, la capacidad de autodestruirse había podido ser una de las consecuencias ineludibles del poder de autoorganización que caracteriza a la vida. He descubierto que la “muerte programada” existía en los organismos unicelulares desde un origen muy remoto; y he propuesto la idea de que no existen “genes de muerte”, sino que una implicación ancestral entre los mecanismos que determinan la vida y la muerte, en el corazón de cada célula, ha jugado un papel esencial en la evolución y en la complejidad de la vida. ¿Qué hay de común entre un peligroso pececillo llamado fugu, el ácido desoxirribonucleico (ADN) y Darwin? Éste planteaba en su obra una pregunta central: ¿Qué sistema de información, presente en cada una de nuestras células, permite comprender la evolución de las especies y la transmisión hereditaria de estos caracteres evolutivos de una generación a otra? Siglo y medio más tarde se conoce el papel fundamental del ADN, y le debemos a Jean Weissenbach (Génopole d’Evry, medalla del CNRS 2008) el haber estudiado el genoma del fugu para aprender más sobre el hombre. El genoma de esta especie es dos veces más pequeño que el nuestro. Al compararlos, Jean Weissenbach y su equipo han podido precisar que el genoma del hombre comprende treinta mil genes menos de los que preveían los científicos en virtud de su talla, lo que demuestra que entre las evoluciones del genotipo y las del fenotipo pueden presentarse serias discordancias… cuyo origen sigue siendo un misterio.

94y11.indd 1

CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES

1 1

Continuando el análisis de cómo percibimos la vida, y según escribe Corey S. Powell en la publicación Discover Magazine, en su artículo de “The long shadow of Darwin”, existen tres descubrimientos que han creado una revolución en sus campos científicos particulares y cambiaron Biología la forma en paradigmas en Molecular que el ser humano percibe la Pensemos en la imagen, de National Geographic o DiscoLos métodos depredador. por la biología evolutiva Jean-Jacques de ella. very Channel, de undesarrolladosPueden ser las leonas en en vida y lo que espera Kupiec la continuación de lascautelosas, sin hacer ruido, para teorías darwinianas constituyen una Escuela Normal Superior África, que se agrupan gran la manada la gacelas y escogen a que busca del rodear aaportación ade lingüística histórica, su víctima trazar FREUD, EINSTEIN, DARWIN la evolución de las lenguas. El mismo Darwin atraparla, Es aspecto que menciona Powell, es La Interpredía, para separarla de la manada, arrinconarla, había notado El primerparadójico que en la actualidad pueda uno realizar un curioso paralelismo entre Aquí podríamos pregunde los Sueños, de Sigmund estar confrontado directamatarla y empezar a devorarla. la formación de las especies tación estudios de biología sin Freud en 1899, que abrió y la de culpa a las leonas cuando arremeten en contra puertas para la original de Darwin. Por mi parte, tar: ¿quién las lenguas. El principio de la descendencia con nuevasmente con la obrainterpretación psicológica de los yo la de la mente humana; el segundo es ha constituido de modificaciones se ilustra por palabras que, desde el latín rincones he leído al fin de mis estudios, y estola Teoría Essu presa para comerla? vulgar hasta el francés antiguo, por ejemplo, presentan pecial para mí una conmoción intelectual. Yo estaba que de la Relatividad, de Albert Einstein, en 1905, intereuna filiación, sin que se hayan conservado idénticas. sado en la diferenciación Newton y transformar la logró aumentar lo descrito por de las células. Elaborando un Igualmente, la influencia de factores sociales sobre el concepción del espacio–tiempo, y, por último, El Origen de nuevo modelo, he constatado que también él se refería léxico o la pronunciación presenta una similitud con la las Especies, de Charles Darwin, en 1859, que, aunque no es al azar sometido a impulsos selectivos: las células funselección natural de los caracteres biológicos a causa del totalmente aceptada como las anteriores, sigue aportando su cionan de manera aleatoria y son seleccionadas por medio ambiente. Los préstamos lexicológicos entre idiomas nuevos datos para diferentes ramas del conocimiento del microambiente. son igualmente comparables con los intercambios de ma- hombre y de su entorno. que la noción de especie depende Darwin escribió terial genético entre las especies, ya sean plantas o bactedel clasificador: este el primero en proponer una Empero, Darwin no fueaspecto es asimismo revolucionarias. Estas analogías han conducido a la utilización de mé- teoría rio, porque Gary Stix, en su objetividad de la especie, evolutiva. si uno aborda la artículo “Darwin´s Litodos de la biología evolutiva para reconstituir la historia ving Legacy”, comenta que Anaximandro,Esto constituye un esto vale también para el hombre. filósofo griego de las lenguas mediante un árbol o una red filogenética, que vivió entre los años 610 y que se ha sostiene que a punto ciego de la biología, 546 a.C., visto obligada igual que se hace para las especies vivientes. abandonar una forma de determinismo, la del la todas las especies, incluido el hombre, descienden de “programa genético”. Esta noción se resiste a diversas vida en el mar o de los peces y que, sufriendola idea, considerada antihumanista, de que el a ser lo que es transformaciones y modificaciones, llegóorganismo es el reahora. sultado aleatorio de un proceso sin finalidad. La desesperación de Darwin para sacar sus ideas a nuestros genes, al igual que reaccionamos con impulsos primitivos impresos en nuestro código genético. Lingüística UNMahé Ben Hamed EJEMPLO Filogenetista, CNRS, visual simple Lyon-II Tomemos un ejemplo Universidad dedel mundo animal. la luz fue beneficiosa, ya que él fue el primero en publicar su libro para reclamar la idea como suya. Neurobiología Catherine Vidal Neurobióloga, llama la de investigación en el InstiEl punto que nosdirectora atención es complicado, al tuto Pasteur igual que la pregunta es difícil de responder, pues pensemos: ¿quién puede explicar mejor la situación anterior?Calamares, babosas, Dios? ¿O es la evolución peces: ¿Es el designio de cucarachas, langostas y de todos estos animales tienen en común el poseer la Darwin? Desde luego, la respuesta es indiferente para neugacela,ronas movida por el instinto hasta de un milímetro de que, gigantes, en ocasiones de conservación, sólo diámetro. Por lo tanto resulta más fácil colocar electrata de correr más velozmente que su depredador para trodos en estas neuronas que en las de ratas, buspoder ver el sol un día más, pastar para alimentarse y ratones y su herencia genética en el planeta antes de cesar car dejarprimates, cuyo grosor no pasa de algunas centenas de de existir. milímetro. Gracias a ellos se ha hecho un descubrimiento extraordinario: los mecanismos que uno A la vez, entrando en el campo teológico, creoelementales de los de transmisión de influjos nerviosos el “libre albe- a mejores regalos que Dios nos dio fue son comunes todas las especies de animales, ya sea las tengan drío”: la capacidad de escoger caminos entre que bifurca- un ciones sistemanos presentan en nuestro andarestén dotadas, que se nervioso rudimentario o que como seres como es el caso del hombre, de un cerebro muy o humanos. Ahora bien, ¿realmente escogemos el caminocomsomos plejo compuesto por millones encuentra en nuestro llevados por el código que se de neuronas. ADN para En esta forma, unael curso de o y? discernir entre en situación x la evolución, se ha puesto en marcha un mecanismo de selección muy poderoso, que ha privilegiado las células neuronales, EL HOMBRE, EN LUCHA CONSTANTE cuyas propiedades han sido ambas posiciones ofrePara mi particular punto de vista, explotadas por numerosas especies. ¡Con su capacidad única de comunicación, cen explicaciones fehacientes, pero para este caso vamos las ruta de base un éxito Explicando a tomar laneuronas soncientífica.evolutivo! más a fondo, creo que el hombre se encuentra atrapado entre bestias y dioses; es decir, entre su lucha constante que tiene, de suprimir sus instintos animales y su anhelo de ser la imagen y semejanza que su Dios quiere que sea.

CRONOLOGÍA
1809: Nacimiento, el 12 de febrero, en Shrewsbury, Inglaterra, de Charles Darwin. Lamarck presenta su teoría transformista. 1831: El 27 de diciembre, Darwin se embarca, como naturista, en el Beagle, para un viaje alrededor del mundo que durará cinco años. 1835: El Beagle hace escala en las Galápagos, donde Darwin observa variaciones en la forma de los picos de los pinzones, que inspirarán su teoría. 1837: Primer bosquejo de Darwin de un árbol evolutivo que figura en sus Apuntes de la transmutación de las especies. 1858: Presentación, el 1 de julio, en Londres, de artículos elaborados conjuntamente con Wallace sobre la “Perpetuación de variedades y especies por los medios naturales de la selección”.

17/02/2009 05:21:21 17/02/2009 05:30:36 p.m.p.m.

96

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

La mente humana
Lo que es es
Todo es cierto y todo es falso. Esta es la naturaleza y limitación del pensamiento y la percepción humanos. La única forma de darle sentido a la “realidad” es dar un salto de fe, aceptar ciertos axiomas y, en base a estos axiomas, intentar construir conocimiento. ¿Qué es el conocimiento? El conocimiento es capacidad de predecir. ¿Cómo se que “se” esto? Bueno, sin entrar en un largo discurso auto-referente lo suficientemente complejo como para enorgullecer a Jean Paul Sartre, un argumento excesivamente simplificado de esta equivalencia es como sigue: ¿Hay alguna vez en la que sepa algo sin embargo este conocimiento no tenga implicaciones de predicción? Sospecho, al reflexionar, que habrá de llegarse a la conclusión de que si el conocimiento no tiene valor de predicción, no hay uso que darle al conocimiento ni habilidad para clasificarle. Aún verbalizar el conocimiento, o cuantificarle de forma alguna, implica predicción. Porque cualquier cantidad y cualidad tiene propiedades y con las propiedades viene la predicción. Así que, con un tentativo “gesto de mano”, todo conocimiento implica predicción; aún la gnosis más allá de los sentidos tiene expresión y la expresión tiene propiedades. ¿Toda predicción implica conocimiento? Si puede Ud. predecir algo, en un sentido muy normal, se considera que lo sabe. Siendo que tanto el conocimiento implica predicción como la predicción implica conocimiento se puede decir que son equivalentes; por supuesto esto asume que acepta Ud. varios axiomas, entre ellos la lógica. Aceptar axiomas—artículos de fe sin prueba—es misticismo.

por Keith Raniere

Todo lo que experimentamos es incierto sin embargo de algún modo construimos la suficiente certeza para movernos en el mundo. Por ejemplo, yo creo que puedo levantarme de mi escritorio y viajar al piso de abajo de mi casa. ¿Cómo sé esto? Recuerdo haber hecho recorridos similares; de hecho creo que existe un piso de abajo de mi casa (aunque desde mi ubicación actual no tengo evidencia sensorial de su existencia) y creo que recuerdo haber hecho dichos recorridos anteriormente. ¿Tengo absoluta certeza de que existe un piso de abajo de mi casa? No. ¿He alguna vez soñado algo que pensaba era verdad y no lo era? Sí, tal vez estoy soñando y de hecho vivo en una tienda de campaña en Arizona. ¿Es infalible mi memoria? No, con miles de millones de señales sensoriales entrando a mi cerebro, sólo tengo un pequeño porcentaje de ellas dentro de mi procesamiento consciente; incluso aquellas que puedo recordar son por necesidad distorsionadas por mi aparato físico, y yo añado a esta distorsión inherente dobleces de mi propia creación. ¿Sé incluso con certeza que el pasado existe? No, tan sólo lo recuerdo. Puedo obtener verificación de otras personas, pero la verificación no asegura la veracidad—¡ciertamente hay incertidumbre aquí!—y ningún par de personas recuerda la misma cosa exactamente de la misma forma. Así es que, estoy sentado aquí sólo, formándome una hipótesis a partir de mi memoria inexacta de que existe un piso de abajo de mi casa y con la esperanza de que mi experiencia defectuosa me sirva lo suficientemente bien para de hecho ser capaz de salirme de esta silla. Para añadir más incertidumbre, recuerdo por lo menos una vez en que intenté salirme de una silla sin darme cuenta de que mi pié o pierna se había “dormido”; estaba extremadamente sorprendido cuando mi cuerpo no llevó a cabo mi hipótesis de movimiento. Tal vez yo solo vivo en una casa de un piso; de pronto estoy menos seguro. Por supuesto que nuestros recuerdos sí parecen tener veracidad así que los usamos. Nuestra lógica funciona bien en muchas circunstancias—no todas—así que la usamos. Y, aunque no estamos realmente seguros de que las demás personas existen, con frecuencia dedicamos una buena porción de nuestras vidas a buscar tener intimidad con estas “cosas” que percibimos son otras personas como nosotros. Caminan como nosotros, hablan como nosotros; pero ¿son realmente como nosotros por dentro? Tal vez no podemos estar absolutamente seguros.

96y9.indd 1

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

9 97

Poniendo los pensamientos En esta esquina, como la promovió el pensamiento SU DEFENSA, CON EVIDENCIAS anteriores en el contexto se asoma describiendo el comportamiento instintivo. Pero de la en la sexta edición del Origen, Darwin, respetuo- ciertamente tenemos a la Teoría de la Evolución con la ciencia ciencia, todas nuestras teorías pueden ser vistas popular, es, nuevamente, en el análisis detallado y descripAsí que, como entrenadora. En especiales, como Ud. por demanda so como verdaderas en base a ciertos el poder que iba de los rivales y sobre todo con todo supuestos (incluso tivo de algunos instintos esta otra, traída a se puede apreeste enunciado se lanza al campo de batalla para deespecializada, han llegado a modificarse por selección ganando su teoría,es cierto sólo basado en ciertos supues- ciar mejor cómo tenemos al Diseño Inteligente con el mistitos). con su mayor fortaleza: las evidencias. cismo fenderseSi nuestros supuesto parecen no corresponder con natural. como fundamento. Si la escuela del entrenamiento la realidad, entonces nuestras conclusiones (asumiendo científico gana, el misticismo—el requerimiento para un Y es precisamente aquí, desde mi muy personal Darwin es el naturalista generoso y hábil que nos que aceptamos la sobre todo, inconsistentes. Podemos punto de vista, donde Darwin y el origen alcanzan el escreador sobrenatural—será desterrado de nuestra edupermite sopesarlas y,lógica) serán aceptar obviamente las examinar la mayoría de los conjuntos lecturas de Darcación. Si el fundamento narrativo; la obtiene de suyas; las malas interpretaciones de las de axiomas y refor- plendor descriptivo e inclusodel misticismoanidaciónla vicmarlos en un conjunto africana; el mimetismo preciso. untoria, será pájaro (el en nuestros esclavitudescolares y la pequeño insertado cuclillo), la sistemas de hormiwin; el origen de la jirafade axiomas más fino, másde los De esta forma tomamos axiomas que de la ballena, rebase otras hormigas, y la construcción de más pequeinsectos (con citas de Wallace); las barbasconducen a resulta- gas porde la ciencia será destruida: si incluso lalas celdas dos inconsistentes y objeciones de Mivart –como la conlos panales por la abeja, son tres estupendas desspuestas ya dadas a los los reformamos en teorías más de en ña noción de este misticismo es aceptada, por naturaleza sistentes; este es el prensil la monos Pero en todos cripcionesla integridad de toda ciencia. socava conductuales que merecen una lectura atenta. Malm en 1867-; la colaproceso de losciencia. americanos: los casos, la las glándulas mamarias en hipótesis basadas Me atrevería a señalar que ninguna de las actuales filla aparición de existencia y la realidad sonlos mamíferos y en la experiencia, percepción y pensamiento; en del ¡Espere! ¿Qué no acabamos toda su sofisticación el ornitorrinco; los estudios sobre la estrellas de mar,el mo- maciones de la conducta animal, conde establecer que toda mento. Esto significa que todo serie de hecho tenemos técnica posmoderna, alcanzan a opacar estas son en esenciencia está basada en axiomas, los cuales tres joyas respetado Agassiz; una estupenda lo quede descripciones es la posible evolución de la capacidad de trepar en la cia misticismo? etología animal. El poder supuesto sobrenuestra existencia de momento a momento; nuestra ex- fundacionales de la¿Qué no es cuestionar todo narrativo y periencia algunos de los memorias a las que parecemos Darwin sólo se entiende por su poder de observación. plantas, soninstantánea, y las ejemplos contundentes que de teoría—incluyendo la de la Evolución—parte de la ciencia? tener acceso través en el sentido del del imaginario Parece haber una confusión en este el colector de esDarwin opone aa Mivart, de un párrafo finalpaso capítulo. Perplejo ante la naturaleza, Darwin, conflicto. carabajos, el cazador, el criador de palomas, es el más Al del tiempo: sin memoriaa las creencias del Mivart, nos referirse directamente no hay sentido de tiempo. dice: “admitirlas es, a mi parecer, entrar en las regiones exacto y minucioso de sus relatores. Sí, lo que es es; verdaderamente parecemos pasar a Estúpido es como estúpido para ver los lienAsí como se recomendaban catalejos hace del milagro y abandonar las de la ciencia”. travésel capítulo octavo, Darwin ha reservado la amplia fí- zos de los pintores de la escuela del río Hudson o de BarbiPara del tiempo con un “algo externo”—la realidad sica—justo afuera de nuestra prisión de la percepción, zon, para leer este maravilloso capítulo, un lienzo descripexplicación que requería una de la objeciones marcadas en aunque anterior, a saber, si los instintos pueden modiPara ayudar a clarificar este conflicto, necesitamos el capitulo sólo experimentamos un momento a la vez; muy tivo del comportamiento animal en la naturaleza, bien seexextrañamente, el tiempo es la vez instantáneo y cumula- puede evocar la presencia de unala estupidez? aminar la estupidez. ¿Qué es lupa, de un microscopio; ficarse también por seleccióna natural. Advierte Darwin tivo; ha intentado, con su teoría, explicar el origen pero no, son la mano y el ojo de Darwin los que nos dan que noevoluciona. A veces usar las experiencias y conceptos más y desde la vida; asimismo, no intentará ocuparse del origen esta visión; generoso conocimiento, lienzo de letrascomunes nos puede ayudar a cripción de maravillas.obtener una perspectiva filosófica que de las habilidades mentales –a las que sin duda Darwin es bastante profunda. Con respecto a la estupidez, sos¿Es suficiente la física? pecho que una definición común es ‘respuesta ineficiente o inefectiva’. Cuando nos imaginamos haciendo algo estúpido (yo Actualmente somos testigos de un concurso entre dos me imagino la vez que jalé tan fuerte una puerta cerrada oponentes disparejos: el ganador se queda con nuestras de débil madera, que se abrió tan abruptamente que no mentes. Lo disparejo sería cómico si el resultado de la pude detener su fuerte impacto contra mi cabeza) nuestro competencia no fuera tan crítico. Mientras un oponente objetivo deseado no coincide con la física del universo; es un luchador que piensa que está luchando, el otro oponuestra ignorancia humana local nos deja ciegos. La esnente se considera un bailarín. ¡Qué colisión más desastupidez falla en la tarea de asociar completamente cautrosa! sas con efectos; la asociación de causas con efectos es la disciplina que conocemos como la física. En un sentido muy amplio, es posible ver a la inteligencia como la física; algunos se refieren a la comprensión máxima de la física como la mente de Dios. Si uno no cree en Dios, nuestra estupidez o inteligencia es evaluada en base a qué tan bien nos va en el universo físico. Si uno cree que Dios sí existe, la mente de Dios es su dirección activa o inactiva del universo, también una especie de física. En ambos casos, hay una razón para todo—una “física” si gusta—aún si nosotros, como humanos, no podamos comprenderla. Inteligencia es física.

17/02/2009 05:21:04 17/02/2009 05:30:52 p.m.p.m.

98

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

El polvo se asienta
Parece que este conflicto es entre dos diferentes conjuntos axiomáticos, ambos utilizando algunos principios científicos, ambos con el misticismo como fundamento, ambos rechazando ciertos aspectos de la ciencia establecida. Desafortunadamente, ambos lados tienen algunos proponentes con objetivos alternativos. El “verdadero” proponente de la Teoría de la Evolución no tendría problema en cuestionar observaciones, datos o teorías. La Teoría de la Evolución es más que sólo una teoría; es más bien un reflejo directo de la conciencia humana del tiempo. Los resultados del cuestionamiento relativo a la evolución sólo nos ayudan a profundizar lo que entendemos de nuestras propias mentes y de la física del universo: su inteligencia. Si no podemos explicar algo, eso no significa que esta inteligencia no existe; significa que no la entendemos, se base o no en Dios. El “verdadero” proponente del Diseño Inteligente buscaría profundizar el cuestionamiento de la ciencia, sin requerir la importación de un principio divino para a fin de cuentas terminar dicho cuestionamiento. Desafortunadamente, no todo proponente viene a la mesa con una intención pura. Algunos expertos en Diseño Inteligente buscan instituir un principio místico específico por encima del proceso científico. Algunos proponentes de la Teoría de la Evolución exigen que el contenido actual de dicha teoría sea generalmente aceptado sin cuestionamientos; a veces desean propagar una agenda ateísta trascendente de la ciencia. Las teorías científicas y los datos siempre se basan en axiomas y deben ser cuestionados, pero la naturaleza axiomática del pensamiento humano no debe ser corrompida con agendas cerradas.

Por qué y cómo
Jamás entenderemos por completo un universo desprovisto de presencia humana. A través de nuestra existencia nuestra mente, percepción y conciencia se vuelven parte de la realidad: su descripción completa debe ser contenida dentro de cualquier modelo de física cerrado.

98y7.indd 1

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

7 99

La evolución es Si hay gradual en las especies, es “convertir las oSELECCIÓN SEXUAL el proceso de la mente humana. No modificaciónun Dios, la evolución es meramente una herramienta para ayudarnos podemos invalidarlo, ni podemos extraerloprincipios de nuestro bras de Dios la majestad de Dios más plenamente. Si yo atestiguar en pura burla y engaño; casi preferiría Dios nos creó, puede que A continuación, Darwin explica otro de los proceso de su teoría: la selección sexual, “esta forma de jamás sepamos porqué ya que la ciencia no intenta contestar dicha pregunta. poderosos científico; sólo podemos refinarlo, atemperando y creer, junto con los antiguos e ignorantes cosmogonistas, reformando nuestras bases axiomáticas de pensamiento. que las nos quedamos con han vivido nunca, sino que han Pero conchas fósiles no nuestra existencia; y un sorprendente sendero de arteselección depende, no de una lucha por la existencia, sino factos demostrando para imitar las conchas que viven sido creadas de piedra que algún fantástico proceso ha ocurrido. Atestiguamos de la lucha de los individuos de un sexo, generalmente los La doctrina de la Selección Natural depende no es las orillas del mar”. machos- por la posesión del otro sexo. El resultadodel axio- en nuestra evolución de todo lo que nos precede: si Dios creó al hombre del polvo, la ciencia estudia, con asombro, las migajas dejadas tentadoramente a su paso. Después de cinco capítulos ampliamente descriptivos, la ma de cómo se define lo natural. sino el dejar poca o a muerte del competidor perdedor, Cuando uno sustrae la humanidad del universo participativo, el menos riguSi no plagados de evidencias y citas de autores resninguna descendencia. La selección sexual es resultado es lo deductivos,hay Dios, el hecho de que existimos y que de algún modo somos derivaque la la natural”. dos de / enunciado fundamentales y casi externo” me rosa que mayoría de la gente define como naturaleza: aquello petados, el con fuerzas de la teoría está “algoconstruido; deja sólo una palabra, desprovisto de interferencia humana. el acostumbrado impoluta de formalidad estructural, en los hechos plena definición, para refeDe regreso a la selección natural, Esto presupone que esta seguridad está íntimamente basada más allá de ladesdicha sustracción es inunda posible. nos llena de rirme a la totalidad de mis insondables circunstancias: detalle de los ejemplosde hechoel texto y Si nos vemos a critos. Darwin nos los demuestra ciertamente, no tanDios. nosotros mismos menos arrogantemente—no flores y que cualquieevidencias; entre otros, lobos, aranes, insectos,como amos sólo al agrupar las principales objeciones Traducción del inglés por Farouk Rojas del observadas por Darwin en un fundacional trabajo abejas universo o aislados en su centro—descubrimos que ra y él mismo le pondría a su teoría, sino además por la de somos en Todo para decirnos cómo esta visión por él de contundente explicación que va dando a cada de estas etología. verdad naturales. La perspectiva expandida Acerca de Executive Success Programs, Inc. la física para incluir a la humanidad conduce a de otra propuesta da pie a la comprensión de hechos que un signifi- cuatro objeciones, para él las principales. En realidad la cado serían inexplicables. manera más profundo de la Selección Natural. Con esta pers- explicación detallada para cada una se encuentra, al programas de Executive Success Programs, Inc.MR (ESP) ofrece mepectiva más fundamental para entender lapodría haber nos, en los próximosenfocados en crear consistencia en todas las áreas entrenamiento cuatro capítulos. Un punto ecológica, holográfica, ¿cómo selección Selección comprensión de los procesos las ideas sobre Eny ayudar acaso, Darwinlas habilidades prácticas, emocionales e el primer desarrollar se pregunta: “¿Por qué, si las natural es laAntinatural? Así, la Evolución yde extinción, intelectuales que la gente necesita para alcanzar su máximo potencial. Selección Natural se vuelven tautologías: siempre verdad. especies, como las aves actuales, han descendido de otras punta con patente principalmente de las especies poco representadas o Todos los programas de ESP utilizan una tecnología especies, trámite llamada Cuestionamiento Racional MR, una ciencia basada en en no encontramos innumerables formas de tranla creencia que entre haber confusión, hay las creencias y patrones sición? ¿Por qué, en lugar demás consistentes seanespecies de conducta de un individuo, más exitoso será en todo lo que haga. El bien definidas en la naturaleza?MR permite a las personas volver a examinar cendientes de una especie, tanto más serán capaces de Cuestionamiento Racional Darwin nos recuerda que En mi mente, la práctica religiosa o de la naturaocupar puestos adicionales en la economíaespiritual ofrece las variaciones seleccionadas naturalmente para la base de limitaciones e incorporar percepciones que pueden ser la sobreun aumentar en número”. autoimpuestas. leza ypropósito de existencia: a la religión le conciernen axio- vivencia de los más aptos, para la adaptación a condiciomas de “porqué”, la ciencia cuadro axiomas para examinar nes y competencias, van acompañadas irremediablemente Darwin nos explica, en un utiliza brillantemente cons“cómo”. Son compañeros sin conflicto de la condición hu- de extinción deinformes: info@nxivm.com truido, y combinando los principios de selección natural y Mayores las formas menos adaptadas. Las formas mana. de transición resultado de esta selección y adaptación no extinción, un gran árbol con ramas que se extienden por las vemos, ya que los registros geológicos, lo conservado todas partes; cómo los descendientes modificados de las pues, es significativamente menor e imperfecto de lo que especies prosperan mejor en la medida que sean más difegeneralmente se asume. Dice Darwin: “la corteza terrestre rentes a sus progenitores. La comprensión de este cuadro es un inmenso museo”, pero “imperfecto y lento”. es fundamental para entender gran parte del proceso de la evolución, y regresará a él en otros capítulos. Nos previene Darwin de que la construcción de este árbol debe ser leída e interpretada con cuidado; hay ramificaciones en todos sentidos, obviamente no representadas en un espacio bidimensional, y, además, el sentido de arriba y abajo “no es sinónimo de inferioridad o superioridad en la cualidad de los seres vivos”. A continuación, la expresión de Goethe “la naturaleza, para gastar en un lado, está obligada a economizar en otro”, sirve para adentrarnos en la explicación sobre la compensación y economía de crecimiento. Aquí, Darwin nos ofrece explicaciones detalladas de uno de los grupos más estudiados por él: los crustáceos del grupo de los cirrípedos. escasas. Otro principio básico del capítulo lo es la divergencia¿Fuerza esto la no-existencia se diferencian los desde caracteres: “cuanto más de Dios? REAPARICIÓN DE CARACTERES La presencia súbita del color azul en distintas palomas: la presencia de tallos gruesos o raíces en distintos nabos; la presencia de rayas entre los asnos, cebras y/o caballos, son algunos de los brillantes ejemplos de este capítulo; deducciones elaboradas, entre otras, en el caballo belga, a partir de dibujos realizados por uno de los hijos de Darwin, o la cruza que el propio Darwin realizó entre una yegua y un caballo. Nos dice el autor: “la mejor hipótesis para explicar la reaparición de caracteres antiquísimos es que en los jóvenes de sucesivas generaciones existe una tendencia a presentar el carácter perdido desde hace mucho tiempo”. No admitirla, como prueba de la descendencia común con

17/02/2009 05:20:47 17/02/2009 05:31:06 p.m.p.m.

100

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

HERBOLARIA
Treinta por ciento de los fármacos utilizados en medicina proceden del reino vegetal
Alfredo Piñeyro López erbolaria: forma anticuada de referirse a la botánica orientada a la terapéutica médica. Según el Diccionario de la Lengua de la Real Academia Española, Vigésima Segunda Edición, debiera preferirse el vocablo herbología. En la antigüedad, el reino vegetal fue la mayor fuente de medicamentos y de venenos utilizados por los médicos, quienes por acierto-error, durante milenios separaron las plantas alimenticias de aquéllas que no lo eran. Los alimentos de sabor dulce se dejan separar de manera relativamente fácil de los compuestos amargos, los que habitualmente contienen alcaloides y glucósidos. Las plantas que los contienen resultaban para el brujo

(Nota de la Redacción: En nuestra edición anterior, se publicó incompleto el artículo del doctor Alfredo Piñeyro López. En esta edición se repite –ya con el agregado- el artículo de referencia).

H

primitivo difíciles de comprender, ya que su ingestión o exposición a ellas, podía dar lugar a cambios notorios del comportamiento humano, tanto en su conducta como en su estado físico. CAMBIOS DE COMPORTAMIENTO Esos cambios en el comportamiento del ser humano tardaron miles de años en ser comprendidos, desde interpretarlos como debidos a la presencia de un principio bueno o malo, a la acción potente de la magia, a la homeopatía, etcétera, etcétera… Finalmente fue la teoría de los receptores, planteada a finales del siglo XIX por Paul Erhlich (1896), lo que ha permitido desarrollar el conocimiento del mecanismo y si

Doctor en Medicina Alfredo Piñeyro López Ex-rector UANL Profesor emérito de Farmacología y Toxicología / UANL pineyro@ipharma. com.mx

100y5.indd 1

CONOCIMIENTO CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES EVOLUCIÓN DE LAS ESPECIES

5101

con eltio exacto tiempo las de los medicamentos, no eran a paso del de acción especies cambiaban; primero nivel molecular, tanto a nivel membrana sus formas, yininmutables; variaban; eran dinámicas en como a nivel lo tracelular y luego a nivel nanomolecular. al entorno de resuelve recurriendo a sus orígenes, Sin embargo, todas granja, a los acumuladas en su infancia, al huerto, a la las creenciasagricultores; cria- el transcurso de los milenios no han desaparecido; han dores de plantas y animales, que, si algo saben de suyo, es persistido, y constituyen especies pensamiento mágico, precisamente eso: que las nuestro domésticas bajo su nuestra vía de pensamiento paralelo a nuestro pensacuidado van variando constantemente, y que no obstante nomientocuál es el origen de las razas domésticas y sus saber científico, y al mismo tiempo motor de él. Podría decirse, sin se en el exceso, que todo el que variaciones, sí se sabe –ycaerdemuestra ampliamente- pensamiento humano procede de un puede contacto entre a esa variación de los progenitores primer ser transmitidaesos alimentos y venenos primigenios, que nos llevaron a dela descendencia. sarrollarnos tal como hoy somos, como seres humanos. EL PERRO Y LA PALOMA MEDICAMENTOS DEL REINO VEGETAL Aparecen en este capítulo dos especies importantes en la En la Darwin: el perro y del auge de la descripciones obra de actualidad, después la paloma. Las síntesis química, de todavía alrededor del 30 por ciento de los hechas a lo las distintas cruzas entre razas de paloma, fármacos utilizados en medicina proceden del reino junto con las largo de muchos años por el propio Darwin,vegetal, con una tendencia referencias históricas, progresivamente se aísinteresantes notoria a crecer, ya que muestran al lector lo lan nuevos medicamentos de este origen. que será este atento y disciplinado observador-relator: un Sin embargo, debemos preguntarnos si esto es lo que apasionado de las especies vivientes, que traza una ruta se la comprobación de sus teorías, respuesta referenhacia entiende como herbolaria, y la utilizando, es tajante: de ninguna manera; esto que rayan en la esto es sólo cias eruditas, descripciones no es herbolaria,composición la fuente un origen pensamiento basado en abundantes literaria y del rigor dede nuestro abastecimiento de materia prima, a Clásicos romanos, enciclopedias chinas, refeevidencias: veces interconectado con la síntesis artificial de nuevos fármacos. rencias a Plinio, África vista por lo ojos del gran Livingstone, Herbolaria bárbaros uso directo de las plantas como salvajes y sería el y su relación con los animales, medicamentos, antigüedad, etcétera; todos reunidos en horticultores de la lo que es frecuentemente posible, pero se unrequiere de severos controles,mosaicose conozca la natudeslumbrante y bien descrito donde que nos muestra la raleza química detienediversos compuestos que la planta importancia que los la selección de especies por el produzca; donde artificial. hombre, la selección se determinen las concentraciones de ellos; donde se establezcan las características de estabilidad, como son humedad, temperatura y luz permitida; FUNCIÓN DE LAS VARIACIONES donde en estudios capítulo dos, Darwin pueda estableA continuación, en elclínicos controlados senos vuelve a cer, en función de poniéndonos justo en seguridad del dejar perplejos, ahorala dosis, la actividad y el lugar que medicamento; estemos para verlas o no, para herbolario nos corresponde, en fin, tratar ese medicamento selecciocomo no; es en otro que deba ser incorporado en más narlas o cualquier realidad la naturaleza el escenario el arsenal terapéutico. importante donde se llevan a cabo las variaciones; es ahí para no perdernos en creer actos únicos de creación para mismo donde ellas toman su principal función: servir a la FACTORES QUE INFLUYEN cada especie o individuo, a lo que irremediablemente llesobrevivencia y evolución de las especies. Naturalmente habrá quienes generen objeciones ameNuestra intervención, si se da, es apenas una mera estos garíamos si no aceptamos que hay variaciones individuaprocedimientos, por considerarlos la lucha por innecesa- les entre las especies. táfora expresada en la crianza; lo real esexcesivos o la exisrios. Sin embargo, la cantidad y calidad de mínimas tencia, donde las variaciones ventajosas, por un fármaco depende de las características de es éste el de la natura- LA LUCHA POR LA EXISTENCIA que sean, determinan al ganador; la cosecha, verdadero leza del suelo, de sobrevivencia, planta, demostrará valor del cambio, lala genética de la como lode la humedad En el capítulo tres, Darwin advierte, con su proverbial senrecibida, de la a continuación. luz y temperatura expuesta, de la forma de tido de la crítica, que lo anteriormente descrito no es una recoger la cosecha, de la forma deexplicaciones(exposición regla absoluta; así, indica que la simple existencia de variaEn el capítulo tres encontramos almacenarla muy ima bacterias, hongos, virus). bilidad no explica cómo aparecen las especies en la naportantes. La primera es la comprobación de que las espeSólo así se puede llevar el sólo en de estos en cies varían en estado natural, no tan control la granja omedi- turaleza; es necesario considerar el fenómeno fundamenla camentos, tal modo que varios de losaprincipiosy no en tal de la lucha por la existencia. De acuerdo a esta lucha, huerta, de en la industria destinada este fin de la una hierbería, localizada endescritos en el húmeda de un las más ligeras variaciones, si son provechosas para los variación y sus consecuencias, la penumbra capítulo anmercado, revueltos con otras yerbas en la controles terior, se aplican a la variación individual y sin naturalezade individuos de una especie, tenderán a conservar a estos alguna clase individuos y sobre todo serán transmitidas, heredadas, a y cómo incluso esta variación puede servir para reconocer Finalmente, se debe remarcar que, por las razones su descendencia. y ordenar, clasificar a las especies. expuestas, la fabricación de el Archipiélago Malayo, Aquí está, pues, la selección natural; la conservaLas mariposas de Wallace en medicamentos realmente herbolarios en Brasil, las hormigas, son algunos los con- ción de variaciones útiles para la sobrevivencia de los los crustáceos es notoriamente más cara que la de de los vencionales, ya que de embargo, en esta requiere mayor que serán los más aptos. La selección natural, nos dice ejemplos que se citan. Sin manera implícita amplia divercomplejidad. Darwin, “siempre es una fuerza dispuesta a la acción y sidad de variaciones es importante ser un observador cuidadoso para decidir cuáles son las variedades y cuáles las especies, o al menos recurrir a los consensos y todo ello será siempre enormemente superior a los esfuerzos del hombre; así de superiores serán las obras de la naturaleza

17/02/2009 05:20:35 17/02/2009 05:31:18 p.m.p.m.

En la Pinacoteca de Nuevo León

102

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

‘“José Luis Cuevas en bronce”, homenaje al artista en su aniversario 75

L

a Pinacoteca de Nuevo León celebrará el 75 aniversario de vida del artista José Luis Cuevas, con la presentación de una exposición-homenaje denominada “José Luis Cuevas en bronce”. La inauguración se llevará a cabo el 26 de febrero, día en que el artista festeja su cumpleaños. Por primera vez en Monterrey se ofrecerá una exposición exclusiva de esculturas de Cuevas; se contará con 25 esculturas realizadas en bronce de pequeño y mediano formato, que abarcan de 1991 a 2008. Se incluyen seis obras inéditas del artista y una escultura de gran formato, piezas que forman parte de la colección del Museo José Luis Cuevas. La curaduría para este evento corrió a cargo de José Luis Cuevas y la señora Beatriz del Carmen Bazán de Cuevas, mientras que la museografía es de Manuel Alegría. Para la inauguración se contará con la presencia de importantes personalidades del ámbito cultural de la Ciudad de México. El artísta estará acompañado de su esposa, Beatriz del Carmen Bazán de Cuevas, quien es también la directora del Museo José Luis Cuevas. El evento, que encabezará el gobernador de Nuevo León, licenciado José Natividad González Parás, se llevará a cabo a las 20:00 horas en el patio de las esculturas de la Pinacoteca, institución que dirige la señora Elvira Lozano de Todd, y que se ubica en Colegio Civil Centro Cultural Universitario, en Juárez y Washington. La entrada es libre.

102y3.indd 1

CONOCIMIENTO

EVOLUCIÓN DE LAS ESPECIES

103

Evolución de las Especies

Evolución y creación
¿Será un dilema?
José Luis Cuevas

EDITORIAL

E

El artista nació en México el 26 de febrero de 1934. Es dibujante, grabador, escultor y escritor. Personaje clave en el arte mexicano de la segunda mitad del siglo XX, dibujante desde los cinco años, alumno irregular de La Esmeralda, expuso por primera vez a los catorce años, época en la que estudió grabado con Dolores Cueto. Desde los años 40, su obra se dio a conocer en los círculos de arte internacional. En 1954 expuso en Washington, D.C. Desde entonces, comenzó a desarrollar su personaje público que lo ha llevado a convertirse en una figura polémica del mundo cultural. Miembro de la Generación de la Ruptura en la plástica mexicana, al lado de Manuel Felguérez, Lilia Carrillo y Vicente Rojo, entre otros, Cuevas se opuso a los movimientos nacionalistas. En 1958 publicó una carta dirigida a Femando Benítez en el suplemento México en la Cultura del periódico Novedades que más tarde se conocería como una especie de manifiesto titulado La Cortina de Nopal, en la que criticó la situación cultural del México de la época. Ha recibido diversos reconocimientos entre los que destacan, Primer Premio de Dibujo de la Quinta Bienal de Sao Paulo por la serie Funerales de un Dictador, en 1959; Primer Premio so- el tema, pero también la Trienal n este volumen se vierten opiniones científicas Internacional de Grabado en agregamos la opinión de una esde Nueva Delhi India, en 1968; Premio Nacional bre un tema que se ha contaminado a lode Ciencias y tructura eclesiástica muy importante, como es la Iglesia largo de la Artes en 1981; Premio Nacional historia reciente, y desde la publicación de El origen Católica, con su representante brillante y mexicano, el de Arte otorgado por el Gobierno de la Ciudad de México, de las especies, de Charles Darwin, por una aparenteen 1982. cardenal Javier Lozano Barragán, presidente del ConEn 1992 se creó el Museo José Luis Cuevas al discusión entre la religión y la ciencia y con una concep- sejo Pontificio para la Pastoral de la Salud, del Vaticano, que el artista donó su colección privada de ción antitésica del concepto evolución vs descripción, y con un destacado jesuita, el doctor Carlos Mendoza arte y en donde presentó en 1994 la muestra Renovación Álvarez. que en el Génesis se hace de la acción creativa de un de piel. En 1997 presenta una exposición Museo de la Moneda histórico, dejamos en la Dios que en los llamados siete días creó este planeta. en elAprovechando este viaje de Madrid y recibe el Premio de la Medallística La conmemoración del nacimiento de Darwin, Francisco Prieto, entregadoesta la Reina el bellísimo recuerdo Tomás que contraportada de por revista desde Cambridge, Inglaterra, hizo temblarSofía. En 1991 recibe lade un darwinista excepcional, el biólogo Salal mundo presencial Orden de Caballero con su visión de la evolución como elemento de las Artes y las Letras. En 2001 recibe la partió al cosmos del fundamen- vador Contreras Balderas, quien Orden Andrés Bello, otorgada por la República tal para la perfección de las especies, con Bolivariana de infinito el día 11 de febrero de 2009. su máxima Venezuela. obra: el ser humano, merece reconocimiento mundial, 2008 se realizó en el Palacio de En junio de Bellas Artes basado en la comprensión y la exaltación de la figura una exposición-homenaje a José Luis Cuevas, científica de ese gran personaje, y no debe ser contami- como un reconocimiento a su destacada labor artística. La exposición fue nada por una visión metafísica que, aunque muy res- por el presidente de la República, inaugurada petable, se basa en la fe y en la interpretación de la Bilicenciado Felipe Calderón Hinojosa. blia, bellísimo documento lleno de parábolas, ejemplos 1596 a 1650 y comparaciones, que no tiene por qué utilizar el método científico convencional, porque, quizás, para ese libro trascendental, los días y las horas son diferentes ¿Por qué tantos problemas, si que los que marca la clásica estructura de los calenla creación se justicia con la darios y la de los horarios en que vivimos. evolución? Como homenaje a Charles Darwin, en este número de la revista Ciencia, Conocimiento, Tecnología, invitamos a científicos nacionales y extranjeros, expertos en

Pienso, luego existo

DESCARTES

17/02/2009 05:20:21 17/02/2009 05:31:31 p.m.p.m.

104

EVOLUCIÓN DE LAS ESPECIES

CONOCIMIENTO

A personajes nuestros en ciencias de la vida
Doctor César Martín Cantú Ayala
Estudioso de la evolución, especialmente en el área que permite el entendimiento de los procesos naturales con miras a la conservación ecológica; los cambios graduales de los organismos vivos y los ecosistemas, y la percepción humana de la realidad, César Martín Cantú Ayala estudia las relaciones insectos-plantas y la selección de ecosistemas prioritarios para establecer áreas naturales protegidas. Es licenciado en Biología por la Facultad de Ciencias Biológicas de la Universidad Autónoma de Nuevo León, y tiene un Doctorado en Zoología por la Facultad de Ciencias Formales y Naturales de la Universidad de Viena, en Austria. Hizo una estancia sabática en Evaluación de Omisiones Geográficas de Conservación, en la Universidad de Idaho, en los Estados Unidos. Actualmente es profesor investigador en la Facultad de Ciencias Forestales de la UANL y miembro del Sistema Nacional de Investigadores.

Juan Roberto Zavala zavat_2004@yahoo.com.mx

Doctora María de Lourdes Lozano Vilano
Destacada investigadora en la relación evolutiva de los peces ciprinodóntidos, en cuanto a su desaparición y a la asociación con las actividades antropogénicas, María de Lourdes Lozano Vilano tiene también un importante trabajo sobre la Sistemática, Evolución y Zoogeografía del complejo alvarezi de los peces del género Cyprinodon, en el sur de Nuevo León. Actualmente es profesora investigadora y responsable del Laboratorio de Ictiología y de la Colección Ictiológica de la Facultad de Ciencias Biológicas de la UANL. Es bióloga y tiene una Maestría en Ciencias, con especialidad en Ecología Acuática y Pesca, ambos grados académicos por la UANL. Su Doctorado en Ciencias Biológicas es de la misma institución. Ha recibido numerosos premios y distinciones, de los que mencionamos: es miembro del SNI Nivel I, y en 1993 The Southwestern Association of Naturalis le otorgó el “Reconocimiento Misksch Sutton”.

Doctor Ricardo M. Cerda Flores
Estudioso de la evolución humana en grupos de mestizos e indígenas mexicanos, buscando la asociación de enfermedades, como la diabetes, obesidad y cáncer con genes candidatos y algunos factores ambientales como estilos de vida y sociodemográficos, Ricardo M. Cerda Flores realiza lo anterior utilizando modelos estadísticos y matemáticos. Asimismo, es estudioso de la genética forense en pruebas de paternidad. Es biólogo y tiene una Maestría en Genética, ambos grados académicos de la UANL. Su Doctorado en Ciencias, con especialidad en Genética, es de la misma institución. Hizo estudios posdoctorales en el Texas Medical Center, de la Universidad de Texas en Houston. Es autor de más de 70 artículos publicados en revistas indexadas, nacionales y extranjeras. Actualmente es investigador del CIBIN-IMSS; profesor de la Facultad de Enfermería de la UANL y, desde 1984, miembro del SNI.

Doctor Manuel Humberto Reyes Valdés
Investigador en el área de genética, con enfoque molecular para estudiar la estructura de las poblaciones silvestres de plantas mexicanas, y así conocer su diversidad y facilitar su conservación, Manuel Humberto Reyes Valdés trabaja con un enfoque de teoría de la información para conocer la complejidad en la expresión genética de los organismos, con el fin de medir el grado de especialización de sus diferentes tejidos. Es biólogo egresado de la Universidad Autónoma de Nuevo León, y tiene una Maestría en Genética de Plantas por la Universidad Autónoma Agraria Antonio Narro. Su Doctorado en Ciencias, con especialización en Genética, es de la Texas A & M University, en College Station, Texas. Actualmente es miembro del Sistema Nacional de Investigadores y profesor investigador en la UAAAN. Es autor de numerosos artículos científicos y de divulgación.

Doctora María Elena García Ramírez
Con importantes trabajos en la relación evolutiva del grupo de peces fundúlidos en México, investigando su origen y su posición taxonómica, con el fin de revisar si se encuentran bien ubicados jerárquicamente, María Elena García Ramírez ha descrito también una nueva especie de fundúlido para el manantial Baño de Ignacio, del sur de Nuevo León. Asimismo, es autora del importante artículo publicado en Bélgica “Estado actual del género Fundulus (Teleostei: Fundulidae) en México”. Es bióloga, e hizo una Maestría en Ecología Acuática, en la Universidad Autónoma de Nuevo León. Tiene un Doctorado en Ciencias, con especialidad en Ecología, de la misma institución. Actualmente es profesora investigadora en la Facultad de Ciencias Biológicas de la UANL. Es autora de diversos artículos científicos y de capítulos en libros.

Doctora Amada Torres Salazar
Dedicada a la investigación en el campo de la evolución humana, utilizando diferentes marcadores genéticos moleculares, Amada Torres Salazar busca conocer los procesos de migración que tienen impacto en la salud y la enfermedad, como la diabetes mellitus tipo II, obesidad y cáncer. Asimismo, realiza la búsqueda de proteínas con interés biotecnológico producidas en Bacillus thuringiensis, en concordancia con las herramientas de la genómica funcional y la bioinformática. Es química bacterióloga y parasitóloga, egresada de la Escuela Nacional de Ciencias Biológicas del IPN, habiendo realizado su disertación en Transferencia Horizontal en Microorganismos. Efectuó estudios de maestría en el Laboratorio de Variación Biológica y Evolución ENCB-IPN. Es profesora invitada de la FCQ-UANL y del ICB-UACJ, así como técnica en Investigación, del Instituto Mexicano del Seguro Social.

104y1.indd 1

CONTENIDO

EVOLUCIÓN DE LAS ESPECIES

Editorial
3
Evolución y creación ¿Será un dilema?

Evolución de las Especies
4
El origen de las especies: el libro de las maravillas Doctor Porfirio Carrillo Castilla-Alcocer Breve historia de la evolución del hombre Maestro Rodrigo Soto El problema del diseño y la revolución darwiniana Doctora Ana Barahona Efemérides en el pensamiento darwiniano Doctor César Cantú Ayala Vida: donación de amor Cardenal Javier Lozano Barragán Creación y evolución: azar y necesidad Doctor Carlos Mendoza Álvarez Un polizón llamado Darwin Doctor Antonio Lazcano Araujo Aproximaciones al origen de la vida y la evolución de las vías metabólicas Licenciado Geovani López La teoría sintética de la evolución y sus críticos Doctora Rosaura Ruiz Gutiérrez La teoría neutralista de la evolución molecular Maestro David Eduardo González Femat Evolución molecular Doctora Amada Torres Salazar Evolución de la pigmentación en la especie humana Doctor Esteban J. Parra Duplicación de genes: ¿Tautología biológica o evolución molecular hacia la diversificación de funciones? Licenciado Geovani López

Consejo Editorial
Presidente del Consejo de Ciencia y Tecnología de Nuevo León Ingeniero Juan Antonio González Aréchiga N. L. Gob. Licenciado Omar Cervantes Rodríguez Director del Programa Ciudad Internacional del Conocimiento Ingeniero Jaime Parada Ávila CAINTRA Ingeniero Xavier Lozano Martínez ITESM M. C. Silvia Patricia Mora Castro UANL Doctor Mario César Salinas Carmona Doctora Diana Reséndez Pérez Doctor Alan Castillo Rodríguez Ingeniero Jorge Mercado Salas

10 15 19 22 30 36 39

En su participación página 4, el doctor Porfirio Carrillo analiza concienzudamente el contenido de la obra de Darwin, El origen de las especies; el maestro Rodrigo Soto, página 10, se remonta a los orígenes del género humano, y lo acompaña en su proceso evolutivo hasta los tiempos actuales; la doctora Ana Barahona escribe, página 15, sobre la revolución científica que empezó con Copérnico y que dio un paso gigantesco con Darwin.

43 50 53 57 64

Directorio
Director General Doctor Luis Eugenio Todd Subdirector Licenciado Juan Roberto Zavala Director Editorial Félix Ramos Gamiño Educación Profesor Ismael Vidales Delgado Ciencias Básicas y del Ambiente Doctor Juan Lauro Aguirre Desarrollo Urbano y Social Ingeniero Gabriel Todd Ciencias Médicas Doctor David Gómez Almaguer Ciencias Políticas y / o de Administración Pública Contador Público José Cárdenas Cavazos Ciencias de la Comunicación Doctora Patricia Liliana Cerda Pérez

El doctor César Cantú Ayala destaca, página 19, fechas importantes en la vida de Darwin y su obra; el cardenal Javier Lozano Barragán, página 22, considera que el debate entre creacionismo y evolucionismo está fuera de lugar, ya que, vistos en la correcta perspectiva, no se excluyen; el doctor Carlos Mendoza Álvarez recuerda, página 30, que, al final de su obra, el mismo Darwin reconoce la posibilidad de que su teoría de la evolución de las especies fuese compatible con la afirmación teológica de un Dios creador.

17/02/2009 03:32:59 17/02/2009 05:31:45 p.m.p.m.

La ciencia en Nuevo León está de luto
Doctor Luis Eugenio Todd Director Coordinación de Ciencia y Tecnología del Estado de Nuevo León onocí a Salvador Contreras Balderas cuando dirigía el Instituto de Investigaciones Científicas de la Universidad de Nuevo León, organismo que, fundado por el doctor Eduardo Aguirre Pequeño, recogía la creatividad de la minúscula investigación científica que por esa época se hacía en la casa de estudios. A diferencia de la que actualmente se realiza, mucha de ella se sintetizaba en abstracciones nostálgicas e históricas. La llama de la creatividad, que va innata en la concepción de la universidad, tenía algunos representantes que la conservaban viva, a pesar de que la institución estaba dedicada fundamentalmente a hacer conciencia crítica y política de la sociedad. En esa circunstancia, Salvador Contreras -y así la conservó hasta sus últimos años-, recogía la pasión de investigar en el maravilloso mundo de la biología, y en particular como un pionero de la investigación ambiental y piscícola, campo en donde a lo largo de los años recibió numerosos reconocimientos nacionales e internacionales, documentados también por la gran cantidad de amigos, instituciones y revistas especializadas que acogieron los más de 100 artículos científicos y muchos de divulgación que publicó a lo largo de su rica y fructífera vida. La energía vital de este prohombre de la investigación en Nuevo León y en México no se extinguió con la jubilación, derecho que adquirió y que fue acompañado del nombramiento de “Maestro Emérito” de la ahora Universidad Autónoma de Nuevo León. Decimos esto porque Salvador nunca se retiró al reposo corporal, sino que continuó con la misma vehemencia y fervor en la trinchera de la investigación ambiental, y su última contribución fue la preocupación prospectiva por la problemática del agua en Nuevo León y las cuencas nacionales. Salvador: donde quiera que estés, y si el cielo es la suma de tus deseos, estoy seguro que estarás rodeado de bellísimos peces que te agradecerán siempre tu preocupación por ellos, y que en el mar de la eternidad verás a tus hijos y la bella familia que te tocó forjar. La ciencia está de luto… y yo también.

C

portada.indd 1

You're Reading a Free Preview

Download
scribd
/*********** DO NOT ALTER ANYTHING BELOW THIS LINE ! ************/ var s_code=s.t();if(s_code)document.write(s_code)//-->