INFORMATIKA

za drugi razred gimnazija
Ud!benik na bosanskom jeziku

septembar 2008. godine

Realizovali: Jikkyo Shuppan.Co.Ltd, u saradnji sa
Japanskom agencijom za me"unarodnu saradnju (JICA),
a po ugledu na japanski ud!benik „Informatika B”

6$'5ä$U V O D .......................................................................................................................................................................16
U V O D N O PO G L AV L J E : N Aâä,927,,1)250$&,-6.2'58â792 ............................................................17 
3RQDãDQMHXLQIRUPDFLMVNRPGUXãWYX ...............................................................................................................17

1) Odgovornost primaoca informacije .............................................................................................................................. 17

2. MoUDOLRGJRYRUQRVWXLQIRUPDFLMVNRPGUXãWYX ...............................................................................................19
PO G L AV LJ E 1. RJ EâAVA NJE PR O B L E M A I K O M PJU T E R .............................................................................20
DIO 1. äIVOT I INFORMACIJSKE TEHNOLOGIJE ...........................................................................................................20

2.

2) Razvoj mobilnog telefona ............................................................................................................................................ 20
3) Razvoj TV-a ............................................................................................................................................................. 21

Karakteristike kompjutera ............................................................................................................................21

1)
2)
3)

5D]OLNHL]PHÿXNRPSMXWHUDLþRYMHND ........................................................................................................................ 21
Nedostaci ................................................................................................................................................................. 24
7HKQRORJLMDNRMDVHSULEOLåDYDþRYMHNX ...................................................................................................................... 25

DIO 2. R-(â$9$1-(352%/(0$, .25,â7(1-(KOMPJUTERA .......................................................................................28
2)

3URFHGXUDUMHãDYDQMDSUREOHPD.................................................................................................................................. 29

2. 5MHãDYDQMHSUREOHPDNRULãWHQMHP .................................................................................................................30
PO G L AV LJ E 2. PR E DSTAV L J A NJ E I N F O R M A C IJ A I K O M PJU T E R .............................................................34
DIO 1. KAKO PREDSTAVITI INFORMACIJE U KOMPJUTERU ........................................................................................34
1. Analogno i digitalno ....................................................................................................................................34
2)

Digitalizacija ............................................................................................................................................................ 35

1)
2)

âWDMHELW" ................................................................................................................................................................. 38
.ROLþLQDLQIRUPDFLMD ................................................................................................................................................. 39

2. %LWLNROLþLQDSRGDWDND .................................................................................................................................38
DIO 2. DIGITALNO PREDSTAVLJANJE NUMERIýKIH VRIJEDNOSTI I ZNAKOVA .............................................................40
1. Binarni broj i dekadni broj ...........................................................................................................................40

1) 9H]DL]PHÿXELQDUQRJLGHNDGQRJEURMD .................................................................................................................... 40
2. 2GQRVL]PHÿXELQDUQRJLKHNVDGHNDdnog broja.......................................................................................................... 41

2. 3UHGVWDYOMDQMHQXPHULþNLKYULMHGQRVWL]QDNRYD ...........................................................................................42

1) Predstavljanje cijelog broja ....................................................................................................................................... 42
3) ,]UDþXQDYDQMHNRULãWHQMHPNRPSOHPHQWDEURMD .......................................................................................................... 44
4) Predstavljanje realnih brojeva ...................................................................................................................................... 45
5) Predstavljanje znakovnog podatka............................................................................................................................. 46

DIO 3. DIGITALNI PRIKAZ ZVUKA I SLIKE ................................................................................................................48
2)

Interval uzimanja uzoraka ......................................................................................................................................... 49

1)

PriND]JUDILþNRJSRGDWNDLSRNUHWQHVOLNH .................................................................................................................. 52

2. Predstavljanje slike ......................................................................................................................................50
3. 3ULND]JUDILþNLKSRGDWDNDLSRNUHWQHVOLNH ....................................................................................................52
DIO 4. KOMPJUTERSKI SISTEM .................................................................................................................................54
1. /RJLþNDRSHUDFLMD ........................................................................................................................................54
2)

I operacija (AND), ILI operacija (OR) i negacija (NOT/NE) .................................................................................... 55

1)
2)
3)

/RJLþNRNROR .......................................................................................................................................................... 57
Konfiguracija kompjuterskog sistema........................................................................................................................ 58
Operacije ................................................................................................................................................................. 58

2. /RJLþNRNRORLIXQNFLMHNRPSMXWHUD ...............................................................................................................57

PO G L AV LJ E 3. O B R A D A ,1)250$&,-$.25,âT E NJ E M K O M PJU T E R A ..................................................62
DIO 1. ALGORITAM ...............................................................................................................................................62
1. âWDMHDOJRULWDP" .........................................................................................................................................62
2. Osnovna struktura algoritma .......................................................................................................................65
1) Algoritam.................................................................................................................................................................... 65
2) Primjeri jednostavnih algoritama............................................................................................................................... 66

3. 3UHWUDåLYDQMHLVRUWLUDQMH .............................................................................................................................71
2)

Sortiranje metodom razmjene ................................................................................................................................... 74

ODLOMAK 2. SAVJETI ZA OBRADU INFORMACIJA ....................................................................................................77
1. 1DSRPHQH]DREUDGXLQIRUPDFLMDNRULãWHQMHPNRPSMXWHUD ............................................................................77
1)

Primjer savjeta za predstavljanje informacija ............................................................................................................. 77

2. 6DYMHWL]DSURFHVNRULãWHQMDSURJUDPD]DUDGVDUDGQLPWDEHODPD ...................................................................79

1)Primjer savjeta za metod predstavljanja informacija ...................................................................................................... 79
2) Primjeri savjeta za proceduru obrade ......................................................................................................................... 80
3) 6DYMHW]DSREROMãDQMHRSHUDWLvne efikasnosti .............................................................................................................. 80
4) Savjet za kreiranje grafikona ..................................................................................................................................... 81

!"

PO G L AV LJ E 4. M O D E L I R A NJ E I SI M U L A C IJ A ...............................................................................................86
DIO 1. K$.25,-(â,7,352%/(0 .............................................................................................................................86
1. Modeliranje/Kreiranje koncepta ..................................................................................................................86
3)

Svrha modeliranja .................................................................................................................................................... 87
4) Klasifikacija modela ...................................................................................................................................... 87
5) Modeliranje.............................................................................................................................................................. 87

2. Si mulacija ...................................................................................................................................................90
2)
3)
4)

Simulacija ................................................................................................................................................................ 90
Pregled i provjera ispravnosti modela ........................................................................................................................ 92
Upotreba .................................................................................................................................................................. 92

DIO 2. METOD MODELIRANJA ................................................................................................................................95
1. Fenomen koji se privremeno mijenja ............................................................................................................95
2. )HQRPHQYMHURYDWQRüH ............................................................................................................................... 102
DIO 3. KOMPJUTERSKA SIMULACIJA ....................................................................................................................... 107
1. Fenomen koji se mijenja vremenski ............................................................................................................ 107
2)
3)

Kada je brzina promjene proporcionalna kumulativnoj dozi?.................................................................................. 108
Kada je brzina promjene proporcionalna razlici ciljne vrijednosti i kumulativne doze?.............................................. 109

2. )HQRPHQYMHURYDWQRüH ............................................................................................................................... 111
3. 

... 111 ................  8SRWUHEDVOXþDMQRJEURMDXSURJUDPX]DUDGVDUDGQLPWDEHODPD ............................................................

...................... 126 ...... 124 Klasifikacija prema vrsti medija ...................................................... 112 Si mulacija poretka ..........................-$ ....................................... 120 1...............................................................  6LPXODFLMDPRGHODYMHURYDWQRüH .......................................................................................................................1)250$&.................................................................. UPO T R E B A I K R E I R A NJ E B A Z E PO D ATA K A .................................................................................................. 122 Klasifikacija u zavisnosti od oblika informacije ............................................................ 2) 2) 3) 4) Funkcije baze podataka...................................................... BAZA PODATAKA I PRETR$ä............................................................................................................................................................................................................................................................... 3UHWUDåLYDQMHLQIRUPDFLMD ............................................................................................................................................... 120 DIO1....................9$1-(............................. 125 Historija baze podataka............................................... 115 PO G L AV LJ E 5. 121 Vrste baza podataka .................... âWDMHED]DSRGDWDND" .................. 125 3.......................................................... 120 2...................................................................................................................

....................................  3UHWUDåLYDQMHLQIRUPDFLMDLSURJUDP]DSUHWUDåLYDQMH.................................................. 127 4) 6LVWHPSUHWUDåLYDQMDSRPRüXNOMXþQHULMHþL .. 130 Dizajn relacione baze podataka ................................................................................................................................................................................ 130 Struktura relacione baze podataka .................................. 126 3) 3UHWUDåLYDQMHLQIRUPDFLMDSRPRüXNOMXþQHULMHþL ............................................................................................................................................................... 1) 2) Funkcionisanje programa baze podataka .................................................................................................................................................................... 130 2........................................ 128 5) 0HWRGDSUHWUDåLYDQMD ....................................................................................................................................... KREIRANJE BAZE PODATAKA .................................... 130 1....................... âWDMHUHODFLRQDED]DSRGDWDND"................. 136 ...................... 133 Kreiranje relacione baze podataka ......................................... 129 DIO 2....................................................................................................................................................... 3.....................................................

.. 145 1......................... INFORMACIJSKE TEHNOLOGIJE KOJE POD5ä$9$-8 '58â792 ..................................................................... 147 3) 4) Razmatranje sigurnosti .............. 156 Upotrebljivost .................................................................................................................................................................. 143 PO G L AV LJ E 6..................................................................UHLUDQMHL]YMHãWDMD ............ 142 6) ............................................. 140 5) Ekranski formulari za unos podataka ...........................................................................................  2GUHÿLYDQMHRVQRYQHWDEHOH .............................................................................................................. 157 2) 3) ....................................................................................................................................................................................... 153 1................................................................................................................................................................... 139 4) Kreiranje upita...................................................................................................................................8 .... INFORMACIJSKE TEHNOLOGIJE PRILAG2Ĉ(1(................................................................................................. 158 Koncept upotrebljivosti ........................................................................................................................................................................................................ 2) 0MHUHVLJXUQRVWLSURWLYQHSUHGYLÿHQLKVLWXDFLMD............ 150 Primjer mjerenja / kontrole ..........................................61............................................................................................................................................. 149 DIO 2............................................................................................................................. 145 DIO 1................................................................................................................................................................................................................... 146 IP adresa i ime domena .................................................................RULVQLþNRRNUXåHQMH.............................. 159 #" ................................................................................................................. 142 7) 3UHWUDåLYDQMHSRGRGUHÿHQLPXYMHWRP...................................................................................................................................................................................................... Sigurnost ................................................25....... I N F O R M A C IJS K E T E H N O L O G IJ E I '58â792 ..... 0MHUHQMHNRQWURODSRPRüX ........................... Informacijska komunikacija .................................. 147 WWW ............................... 136 2) Unos podataka.................................................................... 153 2......................................................................................... 138 3) Povezivanje tabela ....................................... 145 2) 3) 4) Komunikacija i protokol ............................................................................................................................................ 151 2.....

................................................................................. 180 Druge jedinice .......................................................................................................................................... 3URPMHQDGUXãWYDåLYRWD ............................................................. 172 Autorsko pravo / net-etiketa pitanja i odgovori ................................................................................................................................................................................................................. 165 PO G L AV LJ E 7......................... 161 3UREOHPLXLQIRUPDFLMVNRPGUXãWYX ................ 161 1................................................................................................................................................................................................................................. 176 Zakon o autorskim pravima ............................................................................... 167 Funkcije programa za rad sa radni m tabelama ........... ............................................................................................................................................................................. 176 Imovinska prava literarnog djela.................................................................................................................... 168 3URJUDPLUDQMHSRPRüXSURJUDPVNRJMH]LND .................. 179 Jedinice koje se koriste za informaciju ........ 167 Sortiranje i ekstrakcija ................................................................................................................................. 195 /RJLþNHIXQNFLMH .........................................]UDþXQDYDQMH«««8QRVIRUPXOH]DL]UDþXQDYDQMHXNXSQRJ]ELUD......................................................................................................................... 195 " Funkcije programa za rad sa radnim tabelama ....................1)250$7............................................................................................... L ISTA G L AV N I H M A K R O N A R E DB I ...............................................................-6..................................................................................2'58â792 ....................................................................... 162 5D]OLþLWL efekti informatizacije ..............................................................................................................DIO 3................................... 174 Autorsko pravo pitanja & odgovori .................................................................................................................................................................................................................................. 162 1) 3) /LþQLSRGDFLLSULYDWQRVW .......................................................... K O M PJU T E RS K A PISM E N OST ....................................................................................................................................................... 174 Net-etiketa Web-stranice Pitanja&Odgovori .. U7-(&$-...........................................................ý....+ TEHNOLOGIJA NA INFOR0$&................................................................................................................................................................................................ 197 )XQNFLMH]DWUDåHQMHLUHIHUHQFLUDQMH ................................. 177 =DNRQRQHRYODãWHQRPSULVWXSX ............................................................................................................................................................................... 177 Kazna ...................................................................... 181 2EUD]ORåHQMHYDåQLKSRMPRYD ............................................................................................................................ 167 ..... 175 9DåHüL  ]DNRQL ..... 193 Lista funkcija ................................................................................................................................................ 196 6WDWLVWLþNHIXQNFLMH ......... 198 $" ....................................................................................................................................................................... 182 PO G L AV LJ E 8............ 198 0DWHPDWLþNDIXQNcija ..................................................................................................................

vodenih str ujanj a i razdvojene topografije Cumulus oblak Vodopad Simulacij a IHQRPHQDGLQDPLþNH globalne visine Tsunami presje k Pre ko Tihog okeana Utjecaj vode na tlo Z emljotres nastao na REDODPDýLOHD Tsunami je stigao do obale Sanri ke za 22 sata i izazvao pre ko 1000 åUWDYD Simulacij a GLQDPLþNRJ kuglastog fenomena 3ULEOLåDYDQMH binarnih zvijezda 3RþLQMXVHURWLUDWL Spojene su Simulacij a vibracije neboder a prouzro kovane zemljotresom %" .Uvodno poglavlje " Svijet simulacija Simulacij a r aspodjele pritiska nove JHQHUDFLMHVXSHUVRQLþQLK aviona Simulacij a dLQDPLþNRJSURWRNDzraka.

Uvodno poglavlje " Svijet simulacije ãLULVHRGmakrosvijeta. RNROLQHLGUXãWYD do univerzalnog svijeta i mikrosvijeta. 6LPXODFLMDNXüH âHWQMDYUWRP Najprije. dizajniramo NXüX Simulacija prikaza prostorija Molekularna simulacija %LRORãNL film Dizajn i simulacija boje RGMHüHLPDWHULMDOD Carbon C60 i atom litijuma Simulacija oblaka pijeska nastalog od automobilskih guma 6LPXODFLMDRSWHUHüHnosti pod WHåLQRPVQLMHJD Simulacija boje / kombinacija materijala &" .

Kamera 2PRJXüHQRMHVQLPDQMH fotografija. 2PRJXüHQDGLUHNWQDJRYRUQD komunikacija. p."0HGLMMHULMHþNRMDLPDUD]OLþLWD]QDþHQMD XNOMXþXMXüi informacijsku opremu i metode.n. MarkoniMHYEHåLþQLVWURM 2PRJXüHQDNRmunikacija koja koristi elektrotalase.e Oko 1450. 2PRJXüHQRMHãWDPSDQMH YHOLNHNROLþLQHLQIRUPDFLMD 1890. 5RVHWWD3ORþD Gutenbergova PDãLQD]D ãWDPSDQMH 2YRMHELRSRþHWDNDQDOL]H tajnih egipatskih simbola. '" Elektronska kalkulacija RPRJXüHQDSRPRüXUHOHMVNRJ tipa kompjutera.n. ENIAC Prvi kompjuter na svijetu napravljen od katodnih cijevi. st./0 Pascalov kalkulator Kalkulator kao oruÿHNRMH RPRJXüDYDVDELUDQMHLWG (OHNWULþQLNDONXODWRU MARK I 1DSUDYOMHQMHSUYLHOHNWULþQL kalkulator ABC na svijetu.Uvodno poglavlje " H istorija medija Razmjena poruka i pohranjivanje informacija se odvija putem medija. p.e Papirus U starom Egiptu koristio se papirus od koga je kasnije nastao papir. 196 g. 2PRJXüHQMHSULMHQRV informacija Drevna vremena Dimni signali 2PRJXüHQSULMHQRV informacija. Razvoj medija 30.-. Morzeov telegraf Belov telefon 2PRJXüHQSUijenos LQIRUPDFLMDSRPRüXVWUXMH. UHOHMDRWSRUQLNDLSUHNLGDþD . ()*+.

Pojavio se ARPANET koji je bio prethodnik Interneta. Pojavio se prvi PC Aldea. Digitalno emitiranje Japan 1MHPDþND Japan 2PRJXüHQRHPLWLUanje zvuka i slike.Uvodno poglavlje " Magnetna traka Edisonov gramofon Snimanje na magnetnu traku SAD Japan TV emitiranje 23" Videorekorder 2PRJXüHQRVQLPDQMHYHOLNHNROLþLQH ]YXþQLKLYLGHR]DSLVD 2PRJXüHQRVQLPDQMH]YXND Radio emitiranje Mediji sa direktnim pristupom Magnetni disk Internet 2PRJXüHQRVQLPDQMHLVOXãDQMHQD proizvoljnoj lokaciji. EDSAC Prvi kompjuteU³YRQ Neumann´ arhitekture koji je mogao pohranjivati program. 0RJXüQRVWLVWRYUHPHQH komunikacije i emitiranja. 1" PC u Japanu 2PRJXüHQRREUDÿLYDQMH UD]OLþLWLKLQIRUPDFLMDQD PC-u. Mikrokompjuter PC Prvi 4-bitni mikroþLSQD svijetu. .

Sekundarne boje Elementi boje od kojih je svaka dobijena QDVWDOD PLMHãDQMHP GYLMH SULPDUQH ERMH NRMH VXVPMHãWHQHGLMDJRQDOQRMHGQDRGGUXJH. . 4" Tople i hladne boje 7RSOHERMHVDGUåHFUYHQNDVWHWRQRYHWDNRGDRQDMNR " RVMHüD HQHUJLMX 2YH ERMH VH L]GYDMDMX QD LK JOHGD VWUDQLFL+ODGQHERMHVDGUåHSODYNDVWHWRQRYHWDNRGD RQDM NR LK JOHGD RVMHüD VWDELOQRVW 3RJRGQH VX L ]D pozadinu stranice.Uvodno poglavlje " Informacije prenesene bojom Tri svojstva boja Boje se mogu klasificirati na osnovu tri svojstva: tona boje.UXJIRUPLUDQQDQDþLQGDVHSRVWDYOMDMX nij anse boje u k rug tako da varij acij a QLMDQVHERMHWHþHJODWNR7RVH]RYHÄNUXJ ERMH³. bistrine i hromatizacije. Osnovne boje od kojih se PLMHãDQMHP GRELMDMX GUXJH boje 2VQRYQL HOHPHQWL NRML þLQH GUXJe boje " PLMHãDMXüLVHXRGUHÿHQRPUD]PMHUu. Tople 56789/" 6OLþQHERMH Ovo se odnosi na susjedne boje u krugu nijansi boja2YHERMHL]UDåDYDMX sklad i stapanje. Komplementarni parovi boja Boje koje u krugu stoje jedna naspram druge. Efekt koji boje stvaraju: jedna ERMD VH L]GYDMD NRULVWHüL GUXJX NDR pozadinu. x Nijanse boja 2YR VH RGQRVL QD ³QLMDQVH´ NDR ãWR VX crvHQD åXWD ]HOHQD SODYD L OMXELþDVWD .

1DUDQGåDVWD radost. Intenzitet SUHGVWDYOMDVWHSHQMDVQRüHERMH Svijetla boj a postaje svjetlij a na tamnoj podlozi Visoko K o n 3RUHÿHQMHLQWHQ]LWHWD t Intenzitet ERMH PRåH biti nizak ili visok. 6PLUHQRVW PLU RSXãWDQMH priroda. vitalnost. napetost. smrt. aktivnost. zlokobnost. 1HPLU VDPRüD SRWLVNLYDQMH nervoza. äXWD :" . veselje.Uvodno poglavlje " K ontrast i intenzitet boj e 3RUHÿHQMHNRQWUDVWD Kontrast predstavlja stepen koliko je boja svijetla ili tamna. tajnovitost. Zelena 9HVHORVWåLYDKQost. C rvena Strast. /MXELþDVWD aktivnost. Stabilnost. Plava +ODGQRüD LQWHOLJHQFLMD VUHüD mir. poniznost. intenzitet boje predmeta PRåHL]JOHGDWLMDþL nego ãWRXVWYDULMHVWH r a s t Nisko Nisko Intenzitet Visoko Slike prenesene bojama %RMHSRVMHGXMXQHãWRãWR NRGOMXGLL]D]LYDHPRFLMHVOLNHNRMHVX]DMHGQLþNHVNRURXFLMHORPVYLMHWX 6 GUXJH VWUDQH LVWD ERMD PRåH ELWL VKYDüHQD QD SRWSXQR GUXJL QDþLQ ]DYLVQR RG ]HPOMH UDVH LOL kulture. pravednost. Zdravlje. ERåDQVWYHQRVW. zavisno od susjedne boje. neokaljanost. gracioznost. C rna Kazna. Bijela QDGXEXGXüQRVW. 6PHÿD Plemenitost. Siva ýLVWRWa. Kada je intenzitet ERMH X SR]DGLQL QLåL RG boje predmeta. strogost. zadovoljstvo.

Uvodno poglavlje " Sunce Znak za toalet U Japanu ." . Crveno Zabrana 1H]DJDÿXMWH Plavo Uputstvo 7LãLQD äXWR Oprez Oprez ± Klizava SRYUãLQD Zeleno Sigurnost .]OD]]DQXåGX !.Crveno 8-DSDQXPXãNDUFL± SODYRDåHQH.äXWR 8(YURSLRELþQRQHPDUD]OLNHXERML =QDþHQMHERMDSULND]DQRFUWHåLPDLVLPEROLPD JIS (Japanski industrijski standardi) definira boje koje se koriste na znakovima.crveno U Evropi .

zelene i plave.]UDåDYDQMHERMH Slika u bRMLQDHNUDQXVHL]UDåDYDNRULãWenjePLPLMHãDQMHP tri osnovne boje: crvene.DGD MH LQWHQ]LWHW VYDNH ERMH SRGHãHQ GD EXGH  vrijednosti od 0 do 255. [î  777.Uvodno poglavlje " O B R A D A SL I K A . ERMDPRåHELWLL]UDåHQR äXWD Crvena Bijela Grimizno-OMXELþDVWD Plava Zelena Crna R AST E RS K A I V E K T O RSK A G R A F I K A Rasterska grafika je WHKQLND NRMD VH L]UDåDYD NRULãWHQMHP NYDGUDWQLK WDþNLFD =ERJ WRJD NDGD MH SRYHüDWH SRYHüDYDMX VH L WDþNLFH SRND]XMXüL FLN-FDN LYLþQX OLQLMX JXEL VH RãWULQD SULND]D.DRãWRMHGROjHSULND]DQRNDGDMHLQWHQ]LWHWVYDNHERMHSRGHãHQGDEXGHQDGYLMHYULMHGQRVWL  LOL  îî  ERMD PRåH ELWL L]UDåHQR .

2YD WHKQLND QH PRåH RVLJXUDWL fini prelaz nijansi boja. 2YD WHKQLND PRåH L]UDziti fine nijanse i gradaciju. Bitmap grafika" 3:1 Zoom 24:1 Zoom 9HNWRUVND JUDILND MH WHKQLND NRMD VH L]UDåDYD PDWHPDWLþNL NDR NROHNFLMD WDþDND OLQLMD NULYLK L poligona. Kvalitet vektorske slike se ]DGUåDYDþDNLNDGDMHSRYHüDWHLOLVPDQMLWH Vektorska grafika 3:1 Zoom !!" 24:1 Zoom .

Uvodno poglavlje " Digitalizacija sli ka Originalna slika (analogna slika) Visina âLULQD Originalna slika je UDãþODQMHQD u3 primarne boje svjetla. Crvena Zelena " Uzorkovanje Kvantizacija Digitalna slika !#" Plava .

datum kada ste QHãWR NRSLUDOL itd.RSLUDW üX WHNVW VD QHNH Web-stranice i predati ga SUHWYDUDMXüL VH GD sam ga sam napisao. 3RãWR PL se ova SMHVPD PQRJR VYLÿD SXVWLW üX VYLPD GD MH VOXãDMX . kompozitora i L]YRÿDþD 2YLP VH NUãL SUDYR XPQRåDYDQMDDXWRrska prava i pravo javnog emitiranja.UãHQMHDXWRUVNRJSUDYD Kopiranje softvera Softver je literarno djelo i za QMHJRYR NRULãWenje morate imati licencu.RSLUDQMHL]YMHãWDMD Kopiranje sa Web-stranice Dokument koji je napraYLRYDãSULMDWHOMLPDDXWRUVNRSUDYR. Kopiranje softvera bez RGREUHQMD GRYRGL GR NUãHQMD autorskih prava. 1HRYODãWHQ SUijenos elektronske SRãWH ODåQRSUHGVWDYOMDQMH. Javno emitiranje muzike na Web-stranici 1H PRåHWH MDYQR HPLWirati muziku bez odobrenja tekstopisca. Rok predavanje je istekao za rada Ja sam mislio da je rok sutra. Kada kopirate tekst ili sliku sa Web-VWUDQLFH ]D YDãX ]DGDüX itd. 1HRYODãWHQSULVWXS Vau.neophodno je navesti autora i URL Web-stranice.. Nastavnik mi je poslao takav mail. kopirat üXGDWRWHNXEH]RGREUHQMDLSUHGDWLMH .RSLUDQMHL SUHGDYDQMHEH]QMHJRYRJQMHQRJRGREUHQMDGRYRGLGRNUãHQMDDXWRUVNRJ SUDYD 1DUDYQR QLMH SRåHOMQR NRSLUDWL JD þDN L DNR GRELMHWH njegovo/njeno odobrenje.UãHQMHDXWRUVNRJSUDYD .UãHQMHDXWRUVNRJSUDYD . . Pretvaranje da ste sami napisali tekst neke druge osobe GRYRGLGRNUãHQMDDXWRUVNRJDSUDYD =ERJ WRJD ãWR mogu GD SURþLWDP GDWRWHNX koju moj prijatelj planira da preda.UãHQMHDXWRUVNRJSUDYD .Uvodno poglavlje " AUTORSKA PRAVA I MORAL . ovaj softver je dobar! Kopirat üX JD ]D svoj kompjuter.

QIRUPLVDQMH WUHüH VWUDQH o ID-u korisnika ili lozinki drugog korisnika bez odobrenja. Aktivnosti u svrhu promjene postavki Ko je stavio sve ikone XNDQWX]DVPHüH" . Nisam joj rekao. Probat üX GD OL MH OR]LQND QMHJRY URÿHQGDQ 2K XVSLR sam se ulogovati.]PMHQDVDGUåDMDVLVWHPVNHGDWRWHNH 1HVPLMHWHPLMHQMDWLSRVWDYNHVLVWHPVNHGDWRWHNHQDXUHÿDMXNDRãWRMH 3&NRMLVHRELþQRNRULVWLEH]RGREUHQMDYODVQLNDkompjuterDþDNLNDGD se postavke mogu promijeniti. !$" 1HRYODãWHQSULVWXS Dobijanje lozinke Upravljanje lozinkom korisnika GLUHNWQR MH SRYH]DQR VD ]DãWLWRP YODVQLãWYD L SULYDWQRVWL NRULVQLND Zbog toga se njima mora savjesno XSUDYOMDWL . Zbog toga.UãHQMH DXWRUVNRJ L WUJRYDþNRJ prava Javno emitiranje ani miranih Napravit üX QRYRJRGLãQMX þHVWLWNXVIRWRJUDILMRPNRMXVDP likova na Web-stranici /LNRYL REOLFL VOLNH L åLYRWLQMH NDR ãWR VX OLNRYL L] FUWDQLK ILOPRYD  ]DãWLüHQi su zakonom. ja sam je poslao. itd. Kada dajete svoje OLþQH SRGDWNH PRUDWH SD]LWL GD OL je Web-stranica pouzdana ili ne. . Da budem iskren.DGD NRULVWLWH IRWRJUDILMX YDãHJ prijatelja bez njegovog/njenog odobrenja i distribuirate je velikom broju ljudi. je zabranjeno jer je usko povezano s QHRYODãWHQLPSULVWXSRPLND]QHQRMH djelo.DGD åHOLWH GD bilo koji od njih bude dostupan javnosti na Web-stranicama.' L OR]LQNX druge osobe bez odobrenja te RVREHWRVHVPDWUDQHRYODãWHQLP pristupom. 6DGDüHPHVYLXSR]QDWL. PRUDWH WUDåLWL odobrenje. to dovodi do NUãHQMD SRUWUHWVNRJ SUDYD Uvijek je neophodno dobiti RGREUHQMD þDN L NDGD VH UDGL R vDãHPSULMDWHOMX Mogu dobiti poklon samo ako odgovorim na ovaj upitQLN %Dã super! =ORXSRWUHEDOLþQLKSRGDWDND =ORXSRWUHEDOLþQLKSRGDWDND 2WNULYDQMH OLþQLK SRGDWDND odgovaranjem na upitnik PostavljanjH OLþQLK SRGDWDND na Web Kada odgovarate na Web-upitnik. EtLþNL QLje dozvoljeno slati mailRYH SUHWYDUDMXüL VH GD VWH neko drugi. Svima üu pokazati ovaj znak. Neki ljudi mogu biti i zlonamjerni. .UãHQMHSRUWUHWVNRJSUDYD Distribucija fotografija . Kada ste se logovali NRULVWHüL NRULVQLþNL . /MXGL ãLURP VYLMHWD PRJu pregledati informacije na Webstranici. . ali bit üH2. . podaci SR NRMLPD VH SRMHGLQDF PRåH identificirati ne bi trebali biti dostupni. LWG YDãL OLþQL SRGDFL PRJX ELWL zloupotrebljeni. slikao nedavno.

Uvodno poglavlje " Biometrija (biometrijska identifikacija) Biometrijska identifikacija MH WHKQRORJLMD NRMRP VH RVWYDUXMH YHULILNDFLMD LGHQWLWHWD NRULVWHüL IL]LþNH NDUDNWHULVWLNH NDR LQIRUPDFLMH ]D GRQRãHQMH RGOXNH 2VREH VH LGHQWLILNXMX QD RVQRYX YMHURGRVWRMQRVWLSURþLWDQLKSRGDWDNDMHGLQVWYHQLKNDUDNWHULVWLNDWLMHOD2YRMHDXWHQWLþan metod kod kojeg VHODåLUDQMHULMHWNRGRJRGLXSRUHÿHQMXVDNRGQLPEURMHPLOR]LQNRP Tehnologija vjerodostojnosti Otisak M etod vjerodostojnosti Uzorak otiska prsta Iris GXåLFDRND.

9LVRND WDþQRVW prepoznavanja. . Visoka WDþQRVW prepoznavanja. boja. pozicija i oblik oka. !%" Oprema je srednje velika. TeãNRVHIDOVLIFLUD. 8WYUÿLYDQMH vjerodostojnosti bez kontakta. Manje otpora. 8WYUÿLYDQMH vjerodostojnosti bez kontakta. usta itd. 8WYUÿLYDQMH vjerodostojnosti bez NRQWDNWD 0RJXüH L u pokretu. 0RåH VH XNUDVWL LOL IDOVLILcirati. 0UHåQMDþDRND Uzorak krvnih kapilara PUHåQMDþHRND Zvuk Uzorak glasa Nacrt 2EOLN YHOLþLQD UXNH otisak dlana Pritisak pri pisanju. Efekt starenMD L JUDILþNLK VPHWQMLXUHÿDMD 3VLKRORãNL RWSRU NRULVQLND Skupo / veliko. 8WYUÿLYDQMH vjerodostojnosti je visoko i bez kontakta. Skupo / veliko. Manje otpora. 6NXSRYHOLNR0RåHVHRãWHWLWL zdravlje oka. nosa. brzina Rukopis DNA Bazna sekvenca DNA Prednosti Nedostaci 9LVRND WDþQRVW prepoznavanja. Lice Oblik crta lica. Visoka WDþQRVW prepoznavanja. Stopa prepoznavanja je niska. PsihRORãNL RWSRU korisnika.UXåQL GLR RNR RþQH MDEXþLFH 3RORåDMYHQD 8]RUDN SRORåDMD YHQD itd. 3RWUHEDQGXåLYUHPHQVNLSHULRG je ]DXWYUÿLYDQMHYMHURGRVWRMQRVWL .OLQLþND historija GXåLFH RND MH poznata. 9LVRNDWDþQRVW 3VLKRORãNL RWSRU NRUisnika. 1H PRåH VH SUHSR]QDWL DNR QHPDWH DXWHQWLþDQ SULPMHUDN rukopisa. =DYLVL RG ãPLQNH SODVWLþQH RSHUDFLMH RGMHüH IL]LþNRJ VWDQMD SRORåDMD VYMHWOD starenja. Jeftino / malo. 7DþQRVW prepoznavanja veoma visoka. Ne PRåH VH SUHSR]QDWL NDGD MH RWLVDNSUVWDXORãHPVWDQMX . 7HãNRVHIDOVLILFLUD.

Verifikacija Otkrivanje SRORåDMDOLFD Otkrivanje Registr.Uvodno poglavlje " 8WYUÿLYDQMH YMHURGRVWRMQRVWL VH Lzvodi SRUHÿHQMHP SR]LFLMH L VPMHUD EUD]GD krDMQMHWDþNHWDþNHJUDQDQMDLWGotiska prsta s registrovanim podacima.UDMQMDWDþND 'XåLFD RNDLPUHåQMDþD VHUD]OLNXMH NRG svake osobe. Oblik talasa zvuka" Spektar zvuka Spektar zvuka govornika A Frekvencija (kHz) Poloåaj vena Oblik talasa zvuka Spektar zvuka Spektar zvuka govornika B !&" Vrijeme n(sec) Vrijeme n(sec) . Verifikacija se izvodi SRUHÿHQMHP WLK FUWD OLFD VD registrovanim podacima. Verifikacija se L]YRGL SRUHÿHQMHP ovog uzorka sa registrovanim podacima. i otkrivaju crte lica. Verifikacija se L]YRGL SRUHÿHQMHP ovog uzorka sa registrovanim podacima. podaci WDþDNDFUWDOLFD Frekvencija (kHz) Snimite prst i dlan Prst infracrvenim zracima WH GHWHNWXMHWH SRORåDM vena. Iris 0UHåQMDþD -DEXþLFD SnLPDQMHSRORåDMDYHQD NRULãWHQMHP svjetla Vene Kamera Izvor svjetla infracrvenih zraka infrared rays Vjerodostojnost snimka glasa Lice Analizira sliku lica sa CCD kamere itd. spektar zvuka postaje uzorak koji se razlikuje. Kada se zvuk analizira mjerenjem vremena i frekvencije za RGJRYDUDMXüX horizontalnu i vertikalnu osu uzorka glasa. Verifikacija se izvodi VQLPDQMHPRYLKX]RUDNDLSRUHÿenjem sa 'XåLFDRND " Dio koji nije skriven kapkom itd. Vjerodostojnost otiska prsta 7DþNDJUDQDQMD .

QWHUQHW L PRELOQD WHOHIRQLMD YHRPD VH EU]R razvijaju. InIRUPDWLþNR-NRPXQLNDFLMVNDRSUHPDNRULVWLVHX PQRJLPREODVWLPD QDãHJGUXãWYD QSU HOHNWULþQLXUHÿDMLXGRPDüLQVWYXNRMHNRULVWLPRXVYDNRGQHYQRPåLYRWX.Uvodno poglavlje " Uvod PodruþMD LQIRUPDWLþNH NRPXQLNDFLMH NDR ãWR VX .

Zbog toga je potrebno uSR]QDWL VH VD RYLP SUREOHPLPD L QDXþLWL ãWD VX WR KXPDQ-friendly WHKQRORJLMH WHKQRORJLMHNRMHSRPDåXOMXGLPDXVYDNRGQHYQRPUDGX. GLJLWDOQD WHKQRORJLMD L QDþLQL SUHGVWDYOMDQMD VOLND L ]YXND 3RWRP üH VH L]XþDYDWL L nDþLQ QD NRML kompjuter REUDÿXMH LQIRUPDFLMH WH PHWRGe modeliranja i kompjuterske simulacije. karakteristike NRPSMXWHUD UMHãDYDQMH SUREOHPD NRULãWenjem kompjutera. 8 ³. metode za opisivanje informacija. osnove baze podataka kao i njihovo kreiranje. S druge strane.QIRUPDWLFL %´ L]XþDYDt üH VH WHKQRORJLMD ]DVQRYDQD QD NRQFHSWX LQIRUPDFLMD L PRJXüQRVWLPD ]D UMHãDYDQMH SUREOHPD .]XþDYDt üH VH SUHGVWDYOMDQMH LQIRrmacija. postoje problemi izazvani zloupotrebom Interneta i digitalne tehnologije.

 U daljem tekstu usvojit üHWH VWDYRYH R åLYRWX X LQIRUPDFLMVNRP GUXãWYX LPDMXüL QD XPX YDåQRVWLQIRUPDFLMVNRJPRUDOD 1DGDPR VH GD üHWH VWHüL ]QDQMD R RVQRYDPD LQIRUPDFLMD SRVWDWL þODQRYL LQIRUPDFLMVNRJ GUXãWYDVDGREULPPDQLULPDLGDüHWHSRPRüLXVWYDUDQMXVLJXUQRJLERJDWRJGUXãWYD !'" .

E-uþHQMH XþHQMHSRPRüX mobilnog telefona i PC-a ) !1" " . U isto vrijeme. informacije dostupne putem Web-VWUDQLFD PRJX VDGUåDWL SRJUHãQH LOL SULVWUDVQHLQIRUPDFLMHSDþDNãWHWQHLRSDVQH=ERJWRJDSULPDRFLLQIRUPDFLMD moraju provjeriti da li je informacija WDþQDLVDPL. " " " """""""""""" Slika 1. LOLX]QHþLMXVWUXþQXSRPRü.Uvodno poglavlje " Uvodno poglavlje: 1Dã åLYRW L LQIRUPDFLMVNR GUXãWYR Razvoj infoUPDFLMVNH L NRPXQLNDFLMVNH WHKQRORJLMH SRWSXQR MH L]PLMHQLR QDã åLYRW 1DJOL UD]YRM WHKQRORJLMHGRYHRMHGRPRPHQWDXUD]YRMXGUXãWYDNDGDQDþLQLOMXGVNHLQWHUDNFLMHVDPDãLQDPD]D REUDGXLQIRUPDFLMD]DKWLMHYDMXQDãXQDURþLWXSDåQMX U ovom poglavlju razmiVOLPRRWRPH³âWDMH WRQDãWD. 2PRJXüHQa je komunikacija putem e-mailD NDR L SUHWUDåLYDQMH LQIRUPDFLMD L XþHQMH SXWHP Web-VWUDQLFD=ERJUD]YRMDLQIRUPDFLMVNHLNRPXQLNDFLMVNHWHKQRORJLMHQDãåLYRWMHSRVWDRODJRGQLML LVDGDPRåHPRGRüLGRNRULVQLKLQIRUPDFLMDSUHWUDåXMXüL:HE-stranice. WUHEDGDREUDWLPRSDåQMXXLQIRUPDFLMVNRPGUXãWYX"´ 3RQDãDQMHX LQIRUPDFLMVNRPGUXãWYX 1) Odgovornost primaoca informacije Internet i mobilni telefoni postali su komunikacioni mediji dostupni velikom broju ljudi. procijeniti vjerodostojnost informacije do NRMHVXGRãOLQD:HE-stranici. kao pojedinci.

DNRVXPHGLMLNRMLSUHQRVHLQIRUPDFLMXUD]OLþLWLNDRQSUQRYLQHL79. elekt ronska oglasna tabla VH  PRåH koristiti za prijHQRV L SULPDQMH LQIRUPDFLMD ]DRGQHRGUHÿHQRJ EURMD NRULVQLND D Web-stranica se XJODYQRP PRåH NRULVWLWL ]D SUijHQRV LQIRUPDFLMD SUHPD QHRGUHÿHQRP EURMX NRULVQLND Neophodno MH UD]XPMHWL NDUDNWHULVWLNH .DGD VH LQIRUPDFLMD SUHQRVL NRULVWHüL . 3UHWUDåLYDQMHNQMLJDNRMLPDMHSHULRG]DãWLWHDXWRUVNLKprava istekao (elektronska biblioteka) !4" . E-mail se moåH NRULVWLWL ]D NRPXQLNDFLMX V RGUHÿHQLP SRMHGLQFLPD mailing lista VH PRåH koristiti za prijenos i primanje informacija za/od grupe ljudi. NDRSRãLOMDRFL.QWHUQHWD L LVNRULVWLWL LQIRUPDFLMVNX RSUHPX NDR ãWR VX SHUVRQDOQL kompjuter (PC) i mobilni telefon. i metode opisivanja informacija su. Mi. WDNRÿHr. Slika 2. mailing liste. Web-stranice i elektronske oglasne table. S druge strane.Uvodno poglavlje " 2) 2GJRYRUQRVWSRãLOMDRFDLQIRUPDFLMH 3ULNXSOMDQMHLQIRUPDFLMDMHPRJXüHREDYLWLSRPRüXYLãHUD]OLþLWLKPHGLMDNDRãWRVXQRYLQH UDGLR79LNQMLJH3UHNR.QWHUQHWDPRåHPRSUHQRVLWLLOLSrimati informacije putem e-maila. PRUDPRREUDWLWLSDåQMXQDSUijHQRVWDþQLKLQIRUPDFLMD]DãWLWXSULYDWQRVWLL autorskih prava. UD]OLþLWH .QWHUQHW QHRSKRGQRMHRGDEUDWLRGJRYDUDMXüLPHWRG]DSUijenos informacije i imati shemu nDþLQDL]UDåDYDQMD zavisno od karakteristika tog medija komunikacije.

anonimni e-mail je SULKYDüHQSXWHPÄVDYMHWD]D SUREOHPH³ upravo zbog toga. .QWHUQHWRP VH LQIRUPDFLMH PRJX EH]EULåQR i anonimno prenositi. NRML åLYLPR X LQIRUPDFLMVNRP GUXãWYX bismo trebali koristiti QRYH PHGLMH NDR ãWR VX IQWHUQHW L PRELOQL WHOHIRQL =ERJ WRJD MH YDåQR SUDYLOQR UD]XPMHWL LQIRUPDFLMVNX WHKQRORJLMX L SRãWRYDWL]DNRQHLVLVWHPHLQIRUPDFLMVNRJGUXãWYDLSUHSR]QDWLYDåQRVWLQIRUPDFLMVNRJPRUDOD 2G QDV VH QDURþLWR ]DKWLMHYD GD ]QDPR GD RGJRYRUQRVW ]D SULPOMHQH informacije stoji na primaocu i da imamo moralnu odgovornost za informacije koje prenosimo.QWHUQHWDMHDQRQLPQRVW3UHGQRVWDQRQLPQRVWLMHãWRPRåHWHUHüLELOR ãWDMHUQLVWHXGLUHNWQRPNRQWDNWXVDGUXJLPD1SU. Razlog zbog koga je Internet postao popularan nije samo zbog razvoja informacijskih tehnologija QHJRL]ERJPRJXüQRVWLDQRQLPHNRPXQLNDFLMH .Uvodno poglavlje " 0RUDOLRGJRYRUQRVWXLQIRUPDFLMVNRPGUXãWYX -HGQDRGNDUDNWHULVWLND. ali ipak mnogi problemi koji su SRYH]DQL V NUãHQMHP OMXGVNLK SUDYD L QDUXãDYDQMHP SULYDWQRVWL NDR ãWR VX L]UD]L NRML NOHYHWDMX GUXJXRVREXLOLL]UD]LNRMLSRGVWLþXUD]OLNHLQIRUPDFLMHNRMHVXãWHWQH]DGMHFXLXþHQLNHWHFXUHQMH OLþQLK SRGDWDND GRJDÿDMX VH NDR SRVOMHGLFD anonimnosti 3RG RNULOMHP DQRQLPQRVWL MRã XYLMHN VH GRJDÿDMXNULPLQDOQDGMHODSRþLQMHQDXF\EHUVSDFHuNDRãWRMH³ODåQRSUHGVWDYOMDQMH´ Mi.

0LVOLWHRRNUXåHQMXJGMHSULPDODFåLYL RELþDMLLNXOWXUD]HPOMHLHWQLþNDSULSDGQRVW.1HQDUXãDYDWLSULYDWQRVW. te SUHNUãDMLXYH]LVDQHRYODãWHQLPNRULãWHQMHPkompjuterskih PUHåD 1DþLQLSUDYLODSRQDãDQMDNRULãWenja Interneta . .1HRGDYDWLOLþQHSRGDWNHGUXJLKOMXdi.1HQDUXãDYDWLSUDYDLQWHOHNWXDOQRJYODVQLãWYDLDXWRUVNDSUDYD . . 8 NULPLQDOQD GMHOD SRþLQMHQD X YLUWXHOQRP VYLMHWX XEUDMDMX VH NUãHQMH ]DNRQD QHRYODãWenog pristupa kompjuteruSUHNUãDMQHRYODãWHQRJNRULãWHQMDkompjuterskih ili elektromagnetnih zapisa.1HYULMHÿDWLQHGLVNULPLQLUDWLOMXGHLOLSUHQRVLWLODåLLNOHYHWH .

analizirajte vjerodostojnost informacije. !:" .Kada primite informaciju. .

R jeãavanje problema i kompjuter Dio 1. 1. mobilni telefon i digitalna kamera.Poglavlje 15MHãDYDQMHSUREOHPDLkompjuter Poglavlje 1. Slika 1. Postoje razliþite vrste informacijske opreme kao ãto su: kompjuter. 2YD LQIRUPDFLMVND RSUHPD MH PDQMD L ODNãD SUHQRVLYRVW MH SREROMãDQD D QDþLQ Qjenog rada QDVWRML VH SURPLMHQLWL V DQDORJQRJ WLSD QD GLJLWDOQL WLS NRML REUDÿXMH LQIRUPDFLMH WDNR ãWR LK digitalizuje. äLYRWLLQIRUPDFLMVNHWHKQRORJLMH Trenutno se informatizacija promovira X UD]OLþLWLP SRGUXþMLPD GUXãWYD X] SRGUãNX GLJLWDOQLK tehnologija. Razvoj informacijske opreme 1) Oprema koju koristimo za dobijanje informacija . prenosi ili prevodi ovakve informacije zove se informacijska oprema.RULVWLPR VH UD]OLþLWLP LQIRUPDFLMDPD NDR ãWR VX EURMþDQH YULMHGQRVWL ]QDNRYL ]YXNRYL L VOLNHL]åLYRWDOprema koja obraÿuje. Razvoj digitalnih tehnologija ima veliki utjecaj na ljudVNL åLYRW L UD]YRM GUXãWYD X cjelini. Informacijska oprema koja promovira VPDQMLYDQMHYHOLþLQHLGLJLWDOL]DFLMX .

5XþQLkompjuter (PDA: Personal Digital Assistant ) 2) Razvoj mobilnog telefona 0RELOQLWHOHIRQMHLQIRUPDFLMVNDRSUHPDNRMXNRULVWHPQRJL0HÿXWLPDQDORJQLWLSPRELOQRJ WHOHIRQD QLMH ELR SRJRGDQ ]D OLþQH UD]JRYRUH LOL UD]JRYRUH RG YHOLNH YDåQRVWL MHU VX SRVWRMDOH VPHWQMH QHSRåHOMQL ãXPRYL.

a neki od njih imaju i funkciju TV telefona kako biste mogli razmjenjivati videozapise. Npr. 1DRYDMQDþLQVHPRELOQLWHOHIRQUD]YLMDRRGÄPRELOQRJWHOHIRQD]DUD]JRYRU³GRÄPRELOQRJ WHOHIRQDNRMLVHNRULVWL³LUD]YLRVHGRDODWDNRMLVHPRåHNRULVWLWLDNRVWHXSRNUHWX PRELOQLDODW.. Neki mobilni telefoni mogu se koristiti kao digitalne kamere (fotoaparati). LOL VH VDGUåDM WHOHIRQVNRJ UD]JRYRUD JXELR 2YL SUREOHPL VX ULMHãHQL SUHODVNRP QDGLJLWDOQLWLSDUD]OLþLWLSRGDFLNDRãWRVX]QDNRYL L VOLNHVDGDVH PRJXUD]PMHQMLYDWL  uz dodatak zvuka. usluga dostupnosti InteUQHWD NRULãWHQMHP PRELOnog telefonD RPRJXüLOD MH NRULãWHQMH e-maila i Web-stranica.

 6RYRPSURPMHQRPSURPLMHQLRVHLVWLOåLYRWD 20 .

Poglavlje 15MHãDYDQMHSUREOHPDLkompjuter äHOLP GD SUHWUDåLP mapu ovog dijela koriãWHQMHP Interneta. " 3RQDãDQMH Budite svjesni potrebe iskljXþHQMDPRELOQRJWHOHIRQDXSRMHGLQim situacijama zbog njegovog utjeFDMDQDHOHNWURQVNXRSUHPX PHGLFLQVNXRSUHPXXUHÿDMHXDYLRQX.

 3) Razvoj TV-a TV je promijenjen sa analognog na digitalni tip i sa digitalnim emitirDQMHP RPRJXüHQL VX slika i zvuN YLVRNRJ NYDOLWHWD L PRJXüQRVW XVOXJH YHOLNRJ EURMD NDQDOD 0RJXüH MH LQWHJULVDWL UD]OLþLWHSRGDWNHNDRãWRVXYLGHR]YXN L]QDNRYLWDNRÿHr MH PRJXüH prikazati direktne sportske prijHQRVH XþHVWYRYDQMH X NYL]X NRULVWHüL funkciju dvosmjerne komunikacije L QDUXþLWL SURL]YRG NRML VH SRMDYOMXMH QD SURJUDPX X WRP WUHQXWNX 7DNRÿHr se promovira razvoj WHKQRORJLMH NRMD PLMHQMD SR]LFLMX LOL VPMHU LQIRUPDFLMH NRMX YL åHOLWH vidjeti ili preniMHWL 1D RYDM QDþLQ QDã åLYRW SRVWDMH VYH ODJRGQLML evolucijom od jednosWDYQRJ ³JOHGDQMD´ 79-a do dvosmjernog ³NRULãWenja TV-D´ LQWHUDNFLMH.

 2. Karakteristike kompjutera 1) 5D]OLNHL]PHÿXNRPSMXWHUDLþRYMHND Da li je þovjek osloboÿen svih poslova ako posjeduje kompjuter? Razmislimo o karakteristikama kompjutera i njegovoj YH]LVDþRYMHNRP 9MHåED 3UHEURMWHNROLNRSXWDVHSRMDYLRRGUHÿHQL]QDN 1DSUDYLWH JUXSH RG SR  XþHQLND L XSRUHGLWH RSHUDFLMX SUHEURMDYDQMD  RGUHÿHQLK ]QDNova koji se pojavljuju u tekstu L]PHÿXkompjutera LþRYMHND Procedu ra .VSLãLWHWHkst na VWUDQLFX$IRUPDWD RNR]QDNRYD.

2VRED ]DGXåHQD ]D ãWDPSDQL PDWHULMDO QH SLãH QLãWD QD SDSLUX L EURML RGUHÿHQH ]QDNRYH X WHNVWX 2VRED]DGXåHQD]DRSHUDFLMXQDkompjuterXEURMLRGUHÿHQ]QDNNRULVWHüLIXQNFLMXSUHWUDåL/zamijeni REUDGHULMHþL. 8SRUHGLWHEURMHYHEU]LQXEURMDQMDLWDþQRVW =DPLMHQLWHXORJHWDNRGDVYDNRPRåHXUDGLWLRSHUDFLMXQDkompjuteru LELWLXXOR]LLVSLWLYDþD 21 .XSURJUDPX]DREUDGXWHNVWDLRGãWDPSDMWH NRSLMH=DWHNVWPRåHSRVOXåLWLOLWHUDUQLWHNVWVD:HE-stranice. 3RGLMHOLWH XORJH  XþHQLN RSHUDFLMD QD NRPSMXWHUX  XþHQLND RSHUDFLMD NRULãWHQMD ãWDPSDQRJ materijala i XþHQLNLVSLWLYDQMH Upitnikom odredite samo jedan proizvoljan znak.

1024 = (210)B = 1KB 1024 KB = 1MB 1024 MB = 1GB 1024 GB = 1TB 6YDNDMHGLQLFDVHþLWD.Poglavlje 15MHãDYDQMHSUREOHPDLkompjuter Funkcija zamjene Kada se znak u potpunosti zamijeni s nekim drugim znakRPNRULãWenjem funkcije zamijeniti na kompjuteru. koliko se znakova zamijeni vidi se poslijH ]DYUãHQH RSHUDFLMH (koliko postoji tih RGUHÿHQLK znakova). Nominalna oznaka za velike jedinice Osnovna jedinica kapaciteta podataka je B (byte). NLOR.

0 PHJD.

* JLJD.

L7 WHUUD.

Nominalna oznaka za male jedinice Nominalna oznaka male jedinice se mijenja za svakih 10 -3 D MHGLQLFH VHNXQGH VH RGUHÿXMX QD sljHGHüLQDþLQ 1s (second) =1000ms PV —V —V QV 1ns=1000ps 6YDNDMHGLQLFDVHþLWDP PLOOL. Mjerna jedinica prijenosa podataka mijenja se svakih 1000 puta (=103). i 1000 puta se zove k (kilo).

— PLFUR.

Q QDQR.

LS SLFR.

 1. Neki personalni kompjuteri urade jedan SURUDþXQ]DPLOLRQLWLGLRVHNXQGH ȝV. K arakteristike kompjutera [1] Velika brzina Brzina obrade podataka kompjutera je veoma velika.

$EU]LQDREUDGHSRGDWDNDJRGLQX]DJRGLQRPSRVWDMH VYHYHüD 22 .

ako dobije SRJUHãQDXSXWVWYDGRELMHVHSRJUHãDQUH]XOWDW7R]QDþLGDQLMHPRJXüHGRELWLWDþDQUH]XOWDWDNRMH GDWSRJUHãDQQDORJþDNLDNRkompjuter XUDGLWDþQXNDONXOaciju. mRåHWH NUHLUDWL GRNXPHQWH X :RUGX SUHWUDåLYDWL :HE-stranice i QDSUDYLWL PDSX NRULVWHüL SURJUDP ]D UDG sa radnim tabeODPD . gdje sam ostavila pozajmljenju knjigu? " SjeüDP VH L QRYLQD L]SURãOHJRGLQH " [3] Identitet rezultata Kompjuter GRELMH LVWL UH]XOWDW VYDNL SXW NDGD VH SRQDYOMD LVWL SURFHV 0HÿXWLP. Oh.Poglavlje 15MHãDYDQMHSUREOHPDLkompjuter 9Hü]DYUãLR" =DYUãHQR >@ýXYDQMHSRGDWDND Kompjuter PRåH PHPRULVDWL YHOLNX NROLþLQu podataka.RULãWenje personalnog kompjutera (PC-D. PRJXüH MH PHPRULVDWL RNR VHGDP VWRWLQD milijardi jedno-ELWQLK]QDNRYDNDRãWRVXDOIDQXPHULþNL]QDFLQDMHGQRP&'-ROM-u. a PRåH ih memorisati na vanjskoj PHPRULML X] YHü XJUDÿHQ XUHÿDM ]D PHPRULMX 1SU. Odgovor je ij 2K VDGMHÄ" Uvijek ij " >@2Süa svestranost Kompjuter PRåH L]YRGLWL UD]OLþLWH UDGQMH NRULVWHüL UD]OLþLWH SURJUDPH 6 MHGQLP SHUVRQDOQLP kompjuterom (PC-om). npr.

]DUD]OLþLWHDSOLNDFLMHQDRYDMQDþLQ]RYHVHRSüa svestranost. 23 .

" " 24 . kompjuter je PRåGDQHüHSUHSR]QDWLQDSUDYLQDþLQ >@0RüL]UDåDYDQMD S obzirom na to da kompjuter QH PRåH PLVOLWL QL RVMHüDWL NDR OMXGL RQGD VH RQ QH PRåH VDPRVWDOQRL]UDåDYDWL Pjevajmo veselo ! " [3] K reativnost Kompjuter QHPRåHVDPRVWDOQRVWYDUDWL Ovo je novi pronalazak! Ovo je OHWHüD lopta. Ljudi imaju sposobnost procjene informacija ako je informacija koja im dolazi iz oka ili uha MDVQD 0HÿXWLP NDGD kompjuter primijeni istu stvar. ako karakteristika ne odgovara uzorku informacije. " Ne mogu je napraviti bez uputstva.Poglavlje 15MHãDYDQMHSUREOHPDLkompjuter 2) Nedostaci kompjutera [1] Prepoznavanje uzoraka 7HKQRORJLMDNRMDSURYMHUDYDQRYHREOLNHJUDILþNLKLDXGLRSRGDWDNDVpodacima memorisanim u kompjuterXNRMLVHSUHSR]QDMXSRPRüXQMLKRYLKRVRELQD]RYHVHprepoznavanje uzora ka. SUHVXÿXMH SRUHÿHQMH NDUDNWHULVWLND informacijskih uzoraka. Zbog toga.

âWD MH RQGD VD VLWXDFLMRP NDGD NXSLWH kompjuter? UopüHQR ãWR VH YLãH SRYHüDYD VQDJD funkcionalnosti kompjutera LFLMHQDVHSRYHüDYDDNDGDMHFLMena manja i funkcionalnost je manja.L]YRÿHQMHQRYRJ]DNOMXþNDNRULVWHüLSULNXSOMHQHLQIRUPDFLMH. Trenutno se promovira LVWUDåLYDQMH X NRPH kompjuter preuzima informacijski proces koji provodi þRYMHN. karakteristike glasa stavlja u praktiþnu upotrebu 8WYUÿLYDQMH YMHURGRVWRMQRVWL LGHQWLWHWD RYLK IL]LþNLK NDUDNWHULVWLND zove se biometrija. morate znati da nije sve XYLMHNWDþQR 3) 7HKQRORJLMDNRMDVHSULEOLåDYDþRYMHNX Nedavno je predstavljen mali kompjuter koji nema poWHãNRüDXSUHSR]QDYDQMXX]RUDND zbog SREROMãDQMD EU]LQH REUDGH SRGDWDND PHPRULMVNRJ NDSDFLWHWD kompjuterD L SREROMãDQMD VLVWHPD ]DNOMXþLvanja. a isto tako je aktivan i prRFHVSURYRÿHQMDVYDNRJNRPSMXWHUD QDXVNODÿHQQDþLQ 4) 'YLMHWDþNHJOHGLãWD ýHVWRVHQDÿHPRXVLWXDFLMLORãHDNRXUDGLPORãHDNRQHXUDGLP1SUOLMHN]DJODYREROMX je veoma HILNDVDQPHÿXWLPQHJDWLYQRXWMHþHQDåHOXGDF 1D RYDM QDþLQ MH XNOMXþHQ YLãH RG MHGQRJ HOHPHQWD L RGQRV QLMH NRPSDWLELODQ NDR VLWXDFLja NDGD SRNXãDYDWH QHãWR SREROMãDWL L QHãWR GUXJR PRUD ELWL åUWYRYDQR To se zove balansiranje/ trade-off.PRåHUD]JRYDUDWLVþRYMHNRPQDHQJOHVNRPLOLMDSDQVNRPLWG ƒ . Ovim se tehnologija koja digitalizuje otisak prsta. Kako bi se realizovala intelektualna znanja þRYMHNDSRWUHEQHVXVOMHGHüHIXQNFLMH ƒ Prirodna obrada jezik . ƒ 0DãLQVNRXþHQMHSULODJRÿDYDQMHQRYRMRNROLQLRWNULYDQMHLOLSUHGYLÿDQMHX]RUNDRSHUDFLMH.Poglavlje 15MHãDYDQMHSUREOHPDLkompjuter >@6SRVREQRVWUDVXÿLYDQMD Kompjuter MH SRJRGDQ ]D SULNXSOMDQMH LOL DQDOL]LUDQMH YHOLNH NROLþLQH SRGDWDND DOL LSDN QH PRåHGRQLMHWLNRQDþQXRGOXNXQDRVQRYXWLKSRGDWDND )XQNFLMD]DPMHQHSULREUDGLULMHþLNRMDVHNRULVWLQSUL]YRUQRVHNRULVWLOD]D]DPMHQXMHGQRJ QL]D]QDNRYDVGUXJLPQL]RP]QDNRYD0HÿXWLPNDGD]DPLMHQLWHVYDNLDrugar" s "Prijatelj".]UDåDYDQMH]QDQMD.þXYDQMHLQIRUPDFLMDGRELMHQLKSULMHRSHUDFLMHLOLWRNRPRSHUDFLMH. iris oka. Razvojem YMHãWDþNH inteligencije ]D SURPRYLVDQMH RSüHJ SURFHVD SXãWD VH YLãH RG MHGQRJ kompjuterD GD EXGH GMHOLPLþQR RGJRYRUDQ ]D VORåHQH LQIRUPDFLMVNH SURFHVH NRMH SURYRGH OMXGL. ƒ $XWRPDWVNRUDVXÿLYDQMH. 8 RYRP VOXþDMX QLMH PRJXüH ]DGRYROMLWL REMH WDþNH JOHGLãWD IXQNFLMX L FLMHQX. desit üHVHSURPMHQDLNRGSUHRVWDOHWULULMHþLLDNRWRQLVWHQDPMHUDYDOL2YRSRND]XMHGDkompjuter PRåH L]YUãLWL]DPMHQXDOLLSDNQHPRåHSURFLMHQLWLGDOLMHWDDNFLMDELODQDPMHUD 3RJUHãQRSUHSR]QDYDQMHPRåHELWLXNOMXþHQRXUH]XOWDWREUDGHkompjutera.

 D SRWUHEQR MH XVSRVWDYLWLUDYQRWHåXPHÿXQMLPD0RUDWHPLVOLWLQDSURJUDPLSURFLMHQLWLKRüHWHOLåUWYRYDWLMHGQX od stavki ili obje pomalo5D]PRWULPRSULPMHUHRYHGYLMHWDþNHJOHGLãWD 25 .

ROLþLQD SRGDWDND RGJRYDUD YHOLþLQL GDWRWHND 1D VOLFL LVSRG NROLþLQD SRGDWDND VH UD]OLNXMH RNR  SXWD L]PHÿX dvije fotografije. Neuredno je.. " Dobro se þXYD QH mogu provaliti. " >@.. mala degradacija. MRåHWH li provesti proces kako biVWHVPDQMLOLNROLþLQXSRGDWDNDLWG 26 . i.DRSRVOMHGLFDWRJDSRWUHEQD MH PHPRrija velikog NDSDFLWHWDGDELVHLQIRUPDFLMHVDþXYDOH0HÿXWLPNDSDFLWHWPHPRULMH LPDRJUDQLþHQMHDFLMHQD MH YHüDãWRMHNDSDFLWHWYHüL .' korisnika i ponegdje OR]LQNX SD VH RQGD NRULVQLFL åDOH 3URFLMHQLWH GD OL MH SRWUHEDQ YLVRN VWHSHQ sigurnosti ili jednostavan operativni sistem. EDã ]JRGQR Mogu odmah koristiti kompjuter.ROLþLQDSRGDWDNDLVDGUåDMLQIRUPDFLMD Ako se slika ili audio]DSLVSUHWYRULXGLJLWDOQXLQIRUPDFLMXNROLþLQDSRGDWDNDMHPQRJRYHüD XSRUHÿHQMXVDNROLþLQRP]QDNRYQLKSRGDWDND. 0HÿXWLPERMD]HPOMHLWG.. ali informacija da se ptica nalazi na zemlji je prenesena. /DNRMHXüL8NUDVWüXGDWRWHNH i prepraviti Web-stranicu..Poglavlje 15MHãDYDQMHSUREOHPDLkompjuter [1] Odnos sigurnosti i operativnosti KompjuterVNL VLVWHP L PUHåD LPDMX GYLMH WDþNH JOHGLãWD VLJXUQRVW L RSHUDWLYQRVW 'D EL VH L]JUDGLR VLJXUDQ L SRX]GDQ VLVWHP QD SULVWXSX PUHåL SULSUHPDMX VH PMHUH VLJXUQRVWL NDR ãWR VX XQRãHQMHOR]LQNH]DSULVWXSSRVWDYOMDQMHKDUGYerskog ili softverskog firewalla NDNRELVHVSULMHþLOR QHRYODãüHQRXSDGDQMHVSROMDLFXUHQMHLQIRUPDFLMDL]QXWUD0HÿXWLPDNRVHL]JUDGLVLVWHPXNRPH MH QDJODãHQD VDPR VLJXUQRVW SURFHGXUD ]D NRULãtHQMH PUHåH SRVWDMH QDSRUQD MHU PRUDWH XQLMHWL . L RQGD QDSUDYLWH VLVWHP LPDMXüL X YLGX UDYQRWHåX ove dvije karakteristike. Mnogo pitanja. Nema provjere. ako postoji. MHSRWSXQRGUXJDþLMDRGRQHQDRULJLQDOQRMIRWRJUDILMLWDNRGDVHVDGUåDM LQIRUPDFLMDNDRãWRMHVKYDWDQMHJRGLãQMHJGREDVIRWRJUDILMHPRåHVKYDWLWLQDUD]OLþLWQDþLQ Procijenite da li je potrebno 100%-no preslikavanje slike ili audiozapisa da bi se informacija prenijela L RQGD NDGD QD VDGUåDM LQIRUPDFLMH NRMX åHOLWH SUHQLMHWL QH XWMHþH..

6OXþDj koji je bolje prepustiti kompjuterXDQHþRYMHNX. 2. 3. 5D]JRYDUDMWHNDNYLVOXþDMHYLSRVWRMHXVOMHGHüLPSULPMHULPD . 3URQDÿLWHSULPMHUGYLMHWDþNHJOHGLãWDXVYDNRGQHYQRPåLYRWXSULNRULãWenju kompjutera.Poglavlje 15MHãDYDQMHSUREOHPDLkompjuter Velika 765 KB " . . 6DþXYDMWHVOLNXVDåLPDMXüLMHNRULVWHüLSURJUDP]DREUDGXVOLNDLSURYMHULWHNDNRNYDOLWHWVOLNH VODELXSRUHÿHQMXVDRULJLQDOQRP 27 .ROLþLQD podataka " Mala 8 KB " Mislim da je ova slika dovoljno jasna da VH YLGL ãWD MH QD QMRM MHU MD üX VDPR GL]DMQLUDWLSULMHORPþDVRSLVD " .VNRULVWLW üX Rvu sliku za IRWRJUDYXUXþDVRSLVDWDNRGD PL MH SRWUHEQD ãWR SUHFL]QLMD fotografija.6OXþDMNRMLMHEROMHSUHSXVWLWLþRYMHNXDQHkompjuteru. " 9MHåED]DNUDMGLMHOD 1.

1. äLYLPR SURQDOD]HüL RGUHÿHQH RGJRYRUH ]D VYDNLSUREOHPþDNLDNRQLVPRWRJDVYMHVQL1DRYDMQDþLQL]QDODåHQMHUMHãHQMa za neke probleme. 5MHãDYDQMHSUREOHPDLNRULãtenje kompjutera 8 VYDNRGQHYQRP åLYRWX VXVUHüHPR VH  VD VLWXDFLMDPD NDGD PRUDPR ULMHãLWL UD]OLþLWH SUREOHPH 3RVWRMH UD]OLþLWH PHWRGH L PMHUH ]D UMHãDYDQMH SUREOHPD 8 RYRP SRJODYOMX REMDVQLt üHPR GD MH upotreba kompjutera jedna od efektnijih mjera.DNRULMHãLWLSUREOHP" 1) 5MHãDYDQMHSUREOHPD 6XRþDYDPR VH V UD]OLþLWLP SUREOHPLPD X åLYRWX. . te QMLKRYRL]YUãDYDQMHLSUDüHQMH zove se UMHãDYDQMHSUREOHPD *GMHPRJXRWLüL s ovim novcem? " âWD üHPR pripremiti za festival kulture? " äHOLP MHVWL jeftinu i ukusnu hranu! " 28 .Poglavlje 15MHãDYDQMHSUREOHPDLkompjuter Dio 2.

Poglavlje 15MHãDYDQMHSUREOHPDLkompjuter 2) 3URFHGXUDUMHãDYDQMDSUREOHPD =D PHWRG UMHãDYDQMD SUREOHPD SRWUHEQH VX UD]OLþLWH YMHãWLQH ]DYLVQR RG NDUDNWHULVWLND prREOHPDDOLVHXSURFHGXULXRSüeno provodi .

REMDãQMHQMHSUREOHPD .

VDNXSOMDQMHLQIRUPDFLMD .

 SULSUHPD  DQDOL]D LQIRUPDFLMD .

 SUHJOHG  SURFMHQD UMHãHQMD L .

RUDN REMDãQMHQMHSUREOHPD. LPSOHPHQWDFLMD L QRYL SUHJOHGUMHãHQMD .

5D]MDVQLWHSUREOHPNRMLUMHãDYDWH .RUDN SURYMHUDSURFMHQDUMHãHQMD. .6YUKDUMHãDYDQMDSUREOHPD .A naliza ograniþHQMD K orak 2.A naliza sastava problema .RUDN XUHÿLYDQMHDQDOL]Dinformacija) Sredite sakupljene informacije u koraku  NRULVWHüL WDEHOH L GLMDJUDPH A nalizirajte sakupljene informacije L]UDþXQDYDMXüL XNXSDQ L SURVMHþDQ rezultat. (sakupljanje informacija) Povratna informacija Sakupite informacije potrebne za UMHãDYDQMH SUREOHPD REMDãQMHQLP X koraku 1. proporciju i napravite grafikone .

1DSUDYLWH UMHãHQMH ]DVQRYDQR QD dobijenim informacijama/ analiziranim u koraku 3. i procijenite ih. K ada niste zadovoljni procjenom vratite se na kora k od 1 do 3. 29 .RUDN  LPSOHPHQWDFLMD UMHãHQMD provjera) i PrimiMHQLWH UMHãHQMH GR NRMHJ VWH GRãOL X NRUDNX  L ULMHãLWH SUREOHP 3URFijenite primiMHQMHQL VDGUåDM L LVNRULVWLWH JD ]D sljHGHüHUMHãDYDQMHSUREOHPD. .

Rok za kupovinu 'D VH PRåH NRULVWLWL za 10.Cijena .Rezolucija . 5MHãDYDQMHSUREOHPDNRULãWenjem kompjutera 8 VYDNRGQHYQRP åLYRWX veoma þHVWR NRULVWLPR LQIRUPDFLMVNX RSUHPX. Procedu ra 1.7HNXüLWURãNRYL . oktobar natpise na oglasnoj tabli . K oncept 3UDWLWH SURFHGXUX REMDãQMHQMD SUREOHPD SULNXSOMDQMD LQIRUPDFLMD SULSUHPH  DQalize LQIRUPDFLMD SUHJOHGD  SURFMHQH UMHãHQMD L SURYRÿHQMD L SRQRYQRJ SUHJOHGD UMHãHQMD L WR X fazama.XSRYLQD ãWDPSDþDZahtjev za kupovinu .Poglavlje 15MHãDYDQMHSUREOHPDLkompjuter 2. Kada kupujemo opremu. SRVWDYOMDPRQHNROLNRVWDQGDUGDNDRãWRVXSHUIRUPDQVHFLMHQDLXSRWUHEOMLYRVWNDNRELsmo napravili SUDYLL]ERU5D]PLVOLPRRSURFHVXRGOXþLYDQMDNDGDNXSXMHPRãWDPSDþ 9MHåED 2GOXþLYDQMHRNXSRYLQLPRGHODãWDPSDþD 6DYMHW XþHQLND MH GRQLR RGOXNX GD NXSL ãWDPSDþ ]D ãWDPSDQMH VQLPOMHnih fotografija digitalnim fotoDSDUDWRP3RNXãDMWHRGDEUDWLmodel. 5D]MDãQMDYDQMHSUREOHPD Kako biste razjasnili problem. raspravljajte o uvjetima koji moraju biti zadovoljeni da bi se NXSLRãWDPSDþ .

postaje jasno koja informacija je neophodna.Mora imati 2 USB veze Procedura 2. katalogom ili SURL]YRÿDþHP 30 . 6DYMHWXþHQLNDSRNXãDYDVDNXSLWLNDWDORJHL]SURGDYQLFD kompjuterske opreme ili s Interneta kako biste þXOLGHWDOMHRGNRULVQLNDNRMLYHüLPDMXLVNXVWYDVDSUHGORåHQLPPRGHOLPDãWDPSDþD 0RJXüH MH VDNXSLWL EURMþDQH SRGatke koji se lako porede sa Web-stranicom.VNRULVWLWHLQIRUPDFLMHGRNRMLKVWHGRãOLSURFMHQMXMXüLREMHNWLYQRVWLWG na dobrovoljnoj osnovi. 3RãWR VX uvjetL ]D UMHãDYDQMH SUREOHPD REMDãQMHQL. 210 KM ili manje WUHEDMXELWLãWRPDQML . Prikupljanje informacija K oncept .

3UHJOHGSURFMHQDUMHãHQMD 3RPQRåLWHXNXSQXRFMHQX]DVYDNXWDþNXVDSURFHQWRPERGRYDQMDLNRULVWLWHMHNDRNRQDþQX WDþNXSURFMHQH]DWDMSURL]YRG. þLMDMHXSRUHÿHQDSURFMHQDQD QDMYLãHPQLYRX. þDNLDNRVDGUåLPLãOMHQMDNRMDQLVXREMHNWLYQD Procedu ra 3. mjesto i 3. Zbog toga je neophodno pripremiti i analizirati sakupljene informacije 1. saberite bodove procjene dvoje ljudi.]UDþXQDMWHYULMHGQRVWVYDNHNDUDNWHULVWLNH]DVYDNLSURL]YRGLGRELt üHWHXNXSDQ]ELU2YHRSHUDFLMHPRJXVHLVSUREDWLVUD]OLþLWLPYULMHGQRVWLPDDNRNRULVWLWHSURJUDP za rad sa radnim tabelama. S druge strane. i uporedite tri modela. %RGRYDQMH]DNDUDNWHULVWLNHMHSULRULWHWQLIDNWRUSURL]YRGDNRMLVHXSRUHÿXMX 1DSUDYLWH SRSLV NDUDNWHULVWLND ]D SRUHÿHQMH ãWDPSDþD NRULVWHüL SURJUDP ]D UDG VD UDGQLP tabelama s funkcijom kalkulacije i napravite analizu na osnovu te tablice. 2. informacijD NRMD VDGUåL QH VDPR SR]LWLYQH HOHPHQWH QHJR L QHJDWLYQH HOHPHQWH NRML VH ponekad prenesu. Tabela procjene Karakteristike procjene Rezolucija Model A Model B Model C Ukupno Cijena Upotrebljivost 3RWURãQL materijal Procedu ra 4. na Internetu. mjesto.Poglavlje 15MHãDYDQMHSUREOHPDLkompjuter G lediãte Imajte u vidu da taþke koje odgovaraju proizvoÿaþu mogu biti naroþito naglaãene ili je utisak pod utjecajem slike.DRSRVOMHGLFDWRJDPRåHVHGRJRGLWLGDSRWUHEQH informacije ostanu zakopane u neSRWUHEQLP LQIRUPDFLMDPD LRGQRVPHÿX LQIRUPDFLMDPD PRåHELWL nejasan. mjesto. Na kraju.ROLþLQDVDNXSOMHQLKLQIRUPDFLMDMHYHOLND. K oncept 9DåQo je sakupiti informacije s Web-VWUDQLFH VD NRMH VX GRVWXSQD REMHNWLYQD SRUHÿHQMD PHÿXWLP RJODVQX WDEOX QD NRMRM VX PLãOMHQMD PQRJLK NRULVQLND PRåHWH VPDWUDWL XRSüeno objektivnom.DRXWLVDNVWYDUQRJNRULãWenja od strane korisnika. fotografije ili ilustracije. 3ULSUHPDSURL]YRGD]DSRUHÿHQMH 6X]LWHEURMSURL]YRGD]DSURFMHQXQDRVQRYXVDNXSOMHQLKGRNXPHQDWDNDRãWRMH prikazano u Tabeli 1. 2 boda i 1 bod za 1. Popis karakteristika Karakteristike procjene Rezolucija Cijena Upotrebljivost 3RWURãQL materijal Napomena Da li je RGãWDPSDQD slika dovoljno kvalitetna Odgovara li planiranom SURUDþXQX 0RåHOLJDVYDNRNRULVWLWL . kupci i ljudi koji planiraju kupovinu istog proizvoda ponekad LPDMXYH]XSUHNRRJODVQHWDEOH3URFMHQHVHRELþQRSUH]HQWXMXL]UD]OLþLWLKXJORYDJOHGLãWDNDRãWR MHFLMHQDVWYDUQHNXSRYLQHLSRUHÿHQMHVDGUXJLPPRGHORP. Kao dodatak ovim RSHUDFLMDPDLVSLãLWHRGOXNXRRFMHQMLYDQMXSURFMHQHXWDEHOX Tabela 1.ROLNLVXWHNXüLWURãNRYL Tabela 2. Bit üH RPRJXüHQ SULODJRGOMLY RGJRYRU DNR VH SRYHüDMX NDUDNWHULVWLNH procjene. Analizirajte 3 modela po svakoj karakteristici i dodijelite 3 boda. 2. odvojeno. odvojeno. Napravite grupe od po dvije osobe koje procjenjuju svaki model i dvije osobe koje ocjenjuju karakteristike procjene. Procjenu izvode dvije osobe. Prip rema / analiza informacija . 2YLP UH]XOWDWRP 6DYMHW XþHQLND RGOXþXMH GD NXSL PRGHO & þLMD MH XSRUHÿHQD SURFMHQD QD QDMYLãHPQLYRX7DþNDQDNRMXWUHEDREUDWLWLSDåQMXMHVWHGDmodel C. QLMHQDQDMYLãHPQLYRXNDGDVHMHGQRVWDYQRVDEHUHSRMHGLQDþQDSURFMHQD 31 .

Poglavlje 15MHãDYDQMHSUREOHPDLkompjuter K oncept 9DåQRVW SURFMHQDSRMHGLQDþQHNDUDNWHULVWLNH LVYDNRJSURL]YRGD.VWRWDNRMH  PRJXüH SURPLMHQLWL YULMHGQRVW YUHGQRYDQMD EH] PLMHQMDQMD SURFMHQH WDNR ãWR üHPR RGYRMLWL RYH stavke. PRåHELWLSURmjenjiva. Isto taNR PRJXüH MH SURPLMHQLWL SURFHQt bodovanja rasporeda procjene proizvoda unaprijed LPDMXüL X YLGX SULRULWHW QSU UH]ROXFLMD MH SRVWDYOMHQD QD  ERGRYD D FLMHQD QD  ERGRYD PHÿXWLPQHULMHWNRGRÿHGRNRPSOLNDFLMHSULSURFMHQL Prema WRPHPRJXüHMHL]EMHüLNRPSOLNDFLMXRGYDMDQMHPSURFMHQHLYUHGQRYDQMD. da biste RGOXþLOLNRML PRGHO odabrati. 32 .

PSOHPHQWDFLMDLSUHJOHGUMHãHQMD RjeãHQMHSUREOHPDMHSULYUHPHQR]DYUãHQRSURYRÿHQMHPSODQDLSURFMHQRPUH]XOWDWD3ODQGD VH NXSL ãWDPSDþ NRML MH RYGMH REUDÿHQ SURFMHQD üH ELWL SURYHGHQD kroz stvarnu kupovinu i NRULãWHQMH.Poglavlje 15MHãDYDQMHSUREOHPDLkompjuter Procedura 5 .

Rasp rava Neki problemi mogu biti manje uspjeãno rijeãeni ako su provedeni onako kako su planirani zavisno od samog problema.PDMWH X YLGX GD QLMH PRJXüH ODNR ]DPLMHQLWL ãWDPSDþ V GUXJLP ãWDPSDþHP ili kupiti QRYL PRGHO $NR VKYDWLWH GD VWH SRJULMHãLOL SRVOLMH NXSRYLQH QHRSKRGQR MH QDSUDYLWL SODQ ãWR MH PRJXüHEUåH 0RGHONRMLMHSRJRGQLML]DWXVYUKXPRåGDVHSURGDMHLSRQLåRMFLMHQLSULMHQHJRãWRQDUXþHQL ãWDPSDþGRÿHXYDãHUXNH$OLDNRSRþQHWHUD]PLãOMDWLRWRPHQLMHGDQPRGHOQHPRåHWHNXSLWLGD vam traje zauvijek. . 2YDMSXWãWDPSDþPRGHOD&MHNXSOMHQLNRULãWHQRGVWUDQH6DYMHWDXþHQLND . K oncept Isto tako je potreban koncept donoãenja odluke poslije nekih ispitivanja da bi se problem rijeãio. U ovom sluþaju vaåno je traåiti uzrok i poþeti ga koristiti za rjeãavanje sljedeüeg problema.

7URãNRYLSRWUHEQL ]DNRULãWenje.DGDNRULVWLWHYULMHGQRVWXMHGQRMüHOLML]DNDONXODFLMXXSURJUDPX]DUDGVDUDGQLPWDEHODPD SRVWRMH PHWRGH L]UDåDYDQMD SR]LFLMH  üHOLMH SRPRüX UHODWLYQH SR]LFLMH YLÿHQH L] üHOLMH JGMH MH L]QHVHQUH]XOWDWNDONXODFLMH UHODWLYQDUHIHUHQFD. (2) Specifikacija za povezivanje kompjuterDLRSUHPHNDRãWRMHãWDPSDþ A psolutna referenca i relativna referenca .

stavite $ prije prikazivanja kolone i broja reda da budu nepromjenjivi (ili kolone i reda ili jednog od to dvoje).LPHWRGL]UDåDYDQMDWDNRGDVHQHSURPMHQMLYDüHOLMD  SULND]XMHVWDOQREH]RE]LUD QDüHOLMXXNRMRM MHSULND]DQUH]XOWDWNDONXODFLMH Dpsolutna referenca). A1 relativna referenca $A$1 apsolutna referenca A$1 or $A1 apsolutna referenca samo zDNRORQXLOLUHG PMHãRYLWDUHIHUHQFD. Za apsolutnu referencu.

'RGDMWHMHGDQPRGHOPRGHOLPD$%&LDQDOL]LUDMWHWDþNHSURFMHQHþHWLULPRGHODLSURYMHULWHNRML model je odabran. Zamijenite modele A. 9MHåED]DNUDMGLMHOD 1DSUDYLWHUDGQLOLVW9MHåEHNRULVWHüLSURJUDP]DUDGVDUDGQLPWDEHODPD Provjerite kako se procjena odabranog modela mijenja kada se vrijednost vrednovanja mijenja. % L & VD VWYDUQLP SURL]YRGLPD L DQDOL]LUDMWH WDþNH L YUHGQRYDQMH GRGDMXüL dvije nove karakteristike procjene i provjerite koji model je odabran. 33 .

Poglavlje 2. Predstavljanje informacija i kompjuter

Poglavlje 2.
kompjuter
Dio 1.

Predstavljanje

informacija

i

Kako predstaviti informacije u kompjuteru

Svakodnevno koristimo digitalnu opremu kaR ãWR MH GLJLWDOQL IRWRDSDUDW L &'-plejer. U ovom
poglavlju nauþLt üHPR RUD]OLFLL]PHÿXDQDORJQRJ i digitalnog i osobinama digitalizacije. 8þLt üHPR
RMHGLQLFLLQIRUPDFLMHLNROLþLQLLQIRUPDFLMD

1.

Analogno i digitalno
1) 5D]OLNDL]PHÿXDQDORJQRJLGLJLWDOQRJ

=D NROLþLQH LQIRUPDFLMD NRMH NRULVWLPR X VYDNRGQHYQRP åLYRWX SRVWRML ÄDQDORJQR³ NRMe se
koristi za stalnu koliþLQXNDRãWRMHWHåLQDGXåLQDWH ugao, LÄGLJLWDOQR³NRMHNRULVWLPR]DGMHOLPLþQX
NROLþLQXNDRãWRMHEURM]DNRMLMHVWDOQDNROLþLQDUD]JUDQLþHQDXRGUHÿHQLPLQWHUYDOLPDNDRãWRMHVDW
LPMHUDþEU]LQHSULND]DQEURMHPLYHOLþLQRm.
2SUHPDNDRãWRMHVDWLOLPMHUDþNUYQRJSULWLVNDNRULVWHREMHYUVWHSULND]DDQDORJQLLGLJLWDOQL
SULND]1SUVDWVGLJLWDOQLPSULND]RPSRND]XMHWDþQRYULMHPHGRNQDDQDORJQRP VDWXQH
PRåHPRYLGMHWLWDþQRYULMHPHMHUVHGUXJDND]DOMNDXYLMHNNUHüH6GUXJHVWUDQHDNRåHOLPRYLGMHWL
NROLNR PLQXWD RVWDMH GR GRODVND YR]D SRWUHEQR MH L]UDþXQDWL ³YULMHPH GRODVND YR]D ± trenutno
YULMHPH]DVDWVGLJLWDOQLPSULND]RPPHÿXWLPVDVDWRPNRMLLPDDQDORJQLSULND]PRåHWHYL]XHOQR
procijeniti koliko jHYUHPHQDSURãORDNROLNRRVWDOR 6OLND


Imam samo oko 7
minuta da stignem
na voz u 8:30.

"

Sad je 8:23:15,
,PDPMRã«XK«

"

Slika 2. Analogni prikaz i digitalni prikaz

ƔDigitalno
Ovo je rijeþkoja je nastala od rijeþi digit ãto znaþi cifra.

34

Poglavlje 2. Predstavljanje informacija i kompjuter

2) Digitalizacija
1.

Pretvaranje sli kovnog pri kaza u digitalni
Zamislimo slikovni podatak koji ima 9 polja, 3 kolone x 3 vrste (Slika 3). Kada se obojeni dio
i bijeli dio ovog slikovnog podatka zamijeni sa "1" i "0" i prikaåe u horizontalnoj liniji, on postaje
"011101010". Sa ovom operacijom PRåHWHYLGMHWLGDMHVOikovni podatak digitalizovan.
Digitalizovan

Horizontalno
postavljen

Slika 3. Pretvaranje slikovnog prikaza u digitalni
Zatim, kakva vrsta slikovnog prikaza ima vrijednost "101010101"? Sa ovom informacijom
PRJXüHMHODNRUHNRQVWUXLVDWLVOLNRYQLSULND]

Kada je poredan 3x3

Koja je to vrsta
JUDILþNRJ
oblika?

Slika 4. Rekonstrukcija slikovnog prikaza
,VWRWDNR NDGD VH SDQHO SRGLMHOL QD YLãH YUVWD L NRORQD PRJXüH MH L VORåHQLML VOLNRYQL SULND] 
digitalizovati i precizno predstaviti. 

3UHGVWDYOMDQMHEURMDSRPRüXGYDEURMDL]RYHVHSUHGVWDYOMDQMHEURMDXELQDUQRPEURMþDQRP
VLVWHPXDEURMSUHGVWDYOMHQNRULVWHüLELQDUQLEURMþDQLVLVWHP]RYHVHELQDUQLEURM
9MHåED
Vrijednost "1000101010001000101010001"pretvori u panel od 5 vrsta x 5 kolona.
2.

3UHWYDUDQMH]YXNDXEURMþDQL]DSLV
Razmislimo kako se digitalno snima zvuk. Zvuk je talas. Zvuk bubnjeva oscilira kroz zrak i ta
RVFLODFLMDGRSLUHGRQDãLKXãLMX2YDM]YXþQLWDODVVHSUHWYDUDXYLVRNL L QLVNL QDSRQ LVQLPDVH QD
CD itd...(1) âWRMH]YXNYLãLYLãDMHLDPSOLWXGDLL]OD]QLQDSRQSRVWDMHYHüL

Slika 5.

ZYXNLHOHNWULþQLVLJQDO

%XEDQM  ĺ  9LEUDFLMDNUR]zrak ĺ0LNURIRQĺ(OHNWULþQL signal

6QLPDQMH HOHNWULþQLP VLJQDORP MH GLUHNWQD SURPMHQD QDSRQD SURPMHQD PDJQHtnog polja je
analogno snimanje)(2)DVQLPDQMHSUHWYDUDQMHPXEURMþDQXYULMHGQRVWi "1" je digitalno snimanje. (3)

35

Poglavlje 2. Predstavljanje informacija i kompjuter

Npr., provjerite napon oblika talasa DQDORJQLVLJQDO

NRMLMHDQDORJQLHOHNWULþQLVLJQDO JRUQML
dio Slike 6). Horizontalna osa prikazuje vrijeme, a vertikalna osa prikazuje vrijednost napona. Ako
je vrijednost napona YHüD SRVWDYOMD VH QD ³´, a DNR MH PDQMD RG RGUHÿHQRJ VWDQGDUGD na ³´.
'LJLWDOQL QDSRQ MH PRJXüH SUHWYRULWL X REOLN WDODVD GLJLWDOQL VLJQDO

Analogni signal i digitalni signal . Analogni signal Digitalni signal Slika 6. NDR "011100100" (donji dio Slike 6).

2SUHPDNRMDSUHWYDUDRVFLODFLMX ]YXþQLWDODV.

.XHOHNWULþQLVLJQDOMHmikrofon.

MD-RYLLPRELOQLWHOHIRQLMHVYHYHüD Prednosti digitalizacije: >@0RJXüHMHXNORQLWLãXPNRMLVHVDGUåLXDQDORJQRPVLJQDOX RPHWDMXüLãXP. 3) Osobine digitalizacije 8SRWUHEDGLJLWDOQHRSUHPHNDRãWRVXPX]LþNL&'-ovi.2YRMHPDJQHWQLPHKDQL]DPNRMLSULYODþLåHOMH]R (3) Snimanje na kasetu je analogno snimanje. a muzika sa CD-a i MD-a (mini disk) je digitalno snimanje.

]YRUQLREOLNWDODVDQDSRQDNRGGLJLWDOQRJVLJQDODMHEURMþDQDYULMHGQRVWLWDNRGDMH PRJXüHLVSUDYOMDQMHãXPD GRQMLGLR6OLNH. ..

jer je oblik izvornog signala nepoznat NDGDSRNXãDWHXNORQLWLãXP JRUQMLGLR6OLNH.RGDQDORJQRJVLJQDODWDODVQLREOLNQDSRQDSRVWDMH L]REOLþHQ DNRãXPSRVWRMLLQLMHPRJXüHprovesti obnavljanje..

vrijednost koja se ispravlja je nepoznata. tako da se PRåHLVSUDYLWL Slika 7. vrijednost koja se ispravlja je "0" ili "1". Analogni signal Izvorni oblik talasa 2EOLNWDODVDVDãXPRP Ako je signal iskrivljen. Obnavljanje digitalnog signala 36 . Digitalni signal Ako je signal iskrivljen.

Poglavlje 2. Osobine digitalizacije .'HNRPSUHVLMDVLJQDODMHODND ULMHWNRGRÿHGRJUHãNH. PRJXVHREUDGLWLNDREURMþDQDYULMHGQRVWELQDUQRJEURMDLOL  QDLVWLQDþLQ Slika 8. Predstavljanje informacija i kompjuter >@0RJXüQRVWVPDQMHQMDNROLþLQHSRGDWDND 0RJXüH MH VPDQMLWL NROLþLQX SRGDWDND SR RGUHÿHQLP SUDYLOLPD NDR ãWR MH SUHGVWDYOMDQMH $$$$$$NDR$1DRYDMQDþLQNRPXQLNDFLMDLQIRUPDFLMHMHODNãDSXWHPVDåLPDQMD 1) >@=YXNLVOLNRYQLSULND]LWGPRJXVHREUDGLWLQDLVWLQDþLQ Zvuk i slikovni prikaz itd. 'LJLWDOL]DFLMDUD]OLþLWLKLQIRUPDFLMD (1) Ovo je procHVNRMLPVHVPDQMXMHNDSDFLWHWSRGDWDNDDVDGUåDMLQIRUPDFLMHRVWDMHQHL]Pijenjen.

.. .0RJXüHMHVDåLPDWLSRGDWNHLODNRSUHQLMHWLLQIRUPDFLMX. 37 .0RJXüHMHREUDGLWL]QDN]YXNLVOLNXQDLVWLQDþLQ.

"-&'.Poglavlje 2. Predstavljanje informacija i kompjuter 2. Ne" igru s 32 karte od 2 do 9 pripremljenih karata za igru. %LWLNROLþLQDSRGDWDND 1) âWDMHELW" =DPLVOLWHVOMHGHüH"Da.VSLWLYDþPRåHRGJRYRULWLVDPR'DLOL1HQDSLWDQMHLVSLWDQLND 4'DOLMHERMDNDUWHFUQD"«'D Q2 "Da li je znak pik?" «'D 4'DOLMHEURMQHSDUDQ"«1H Q4 "Da li je brRMLOLPDQMH"«1H .VSLWLYDþ Da « 1 Ispitanik Da li je boja crna? Da li je pik? Da « 1 Da li je broj neparan? !"#$%#&'#()*&#+#%$%#. Druga osoba postaje iVSLWDQLNLRQRQDSRJDÿDNDUWXNRMXMHRGDEUDRLVSLWLYDþRYHLJUH . Ne" igra Kada se ova pitanja ponavljaju. Slika 9 " Da. dobije se odgovor. -HGQD RVRED SRVWDMH LVSLWLYDþ L RQ/ona odabere jednu kartu i pogleda je. Ɣ%LW ELW.

7R]QDþLMHGQDFLIUD ELQDUQDFLIUD.

ELQDUQRJEURMD 38 Ne « 0 Ne « 0 .

Poglavlje 2. Predstavljanje informacija i kompjuter

2)

.ROLþLQDLQIRUPDFLMD

U "Da, 1HLJULPRåHWHYLGMHWLGDOLMHNDUWDFUQDLOLFUYHQDRGJRYDUDMXüLQDSLWDQMH4'D
OL MH ERMD FUQD" L PRJXüH MH VX]LWL RGJRYRUH QD SRORYLQX 0RJXüH MH VX]LWL RGJRYRUH QD 
îîî  VD  SLWDQMD 7R ]QDþL GD MH PRJXüH VX]LWL RGJRYRUH QD  L] kombinacija 
îîî X]RUDND
Za odgovore ovih alternativnih pitanja, ako su "Da" i "Ne" postavljeni na "1" ili "0" i
SULND]DQL UHGRP RGJRYRU ]D MHGQR SLWDQMD PRåH VH SULND]DWL NDR  DRGJRYRUL QD þHWLUL SLWDQMD
mogu se prikazati kao"1100" i oni poVWDMXEURMþDQDYULMHGQRVWbinarnog broja. Informacija za jedan
odgovor zove se NROLþLQDLQIRUPDFLMH RGELWD.ROLþLQDLQIRUPDFLMDSLWDQMDMHELWDLNROLþLQD
LQIRUPDFLMDVHSRYHüDYDDNRVHSRYHüDYDLEURMRGJRYRUD
.DRãWRMHJRUHSUHGVWDYOMHQR, ELQDUQLEURMNRMLVH]DSLVXMHSRPRüXGYDEURMDLPRåH
predstavljati sljHGHüDVWDQMD
Za 1 bit, 21=2=2 uzorka
Za 2 bita, 22 î X]RUND
Za 3 bita, 23 îî X]RUDND
Za 4 bita, 24 îîî X]RUDND
Za 5 bita, 25 îîîî X]RUND
Za 6 bita, 26 îîîîî X]RUND
Za 7 bita, 27 îîîîîî X]RUDND
Za 8 bita, 28 îîîîîîî X]RUDND 

1L]RGELWD]RYHVHEDMW E\WH

EDMW E\WH

Ne" igru? 39 .ROLNDNROLþLQDL]UDåHQDXELWLPDMHSRWUHEQD ]DL]ERUSLNRYHãHVWLFHRGNDUWHRGGR  NDUDWD za "Da.ROLNDNROLþLQDL]UDåHQDXELWLPDMHSRWUHEQD za predstavljanje 26 znakova engleskog alfabeta? . 9MHåED]DNUDMGLMHOD .ROLNRNRPELQDFLMDVHPRåHQDSUDYLWLSRPRüXSDQHODRG NRORQH[YUVWH".ROLNRELWDMHNROLþLQD informacije? .PRåHSUHGVWDYOMDWLX]RUDNDVWDQMD %LWLNROLþLQDLQIRUPDFLMD ELWPRåHSUHGVWDYOMDWLGYDVWDQMDLNROLþLQDLQIRUPDFLMHMHELW n ELWDPRåHSUHGVWDYOMDWLn VWDQMDLNROLþLQDLQIRUPDFLMHMHn bita.DGD MHNROLþLQD LQIRUPDFLMD YHOLND PRJXüH MHSUHGVWDYOMDWL PQRJRVWDQMD PHÿXWLP YMHURYDWQRüD realizovanja tog stanja postaje 1/(broj stanja koja se mogu realizovati). .

Poglavlje 2. 2 Pretvaranje (1011)2 u dekadni broj (1011)2 î3î2î1î0 îîîî =8 +0 +2 +1 =(11)10 . Digitalno predstavljanje numeriþkih vrijednosti i znakova U ovom poglavlju nauþLt üHPR kako kompjuter predstavljD LQIRUPDFLMH NRULVWHüL PHWRGH SUHGVWDYOMDQMDQXPHULþNLKYULMHGQRVWLL]QDNRYD 1. 9MHåED 3URYMHULWHYH]XL]PHÿXELQDUQRJLGHNDGQRJEURMD 3RNDåLPRGDMHEURMELQDUQLEURM O dgovor .DNR ELVPR GRãOL od dekadnog broja GR ELQDUQRJ EURMD SRGLMHOLWH GHNDGQL EURM VD  L GRüL üHWH GR RVWDWND 3RVWXSDN QDVWDYLWH VYH GRN UH]XOWDW GLMHOMHQMD EURMHP GYD QH SRVWDQH  'HNDGQL broj 11 i binarni broj 1011 predstavljeni su kao (11)10 i (1011)2. Binarni broj i dekadni broj 1) 9H]DL]PHÿXELQDUQRJLGHNDGQRJEURMD 1XPHULþND YULMHGQRVW NRMX NRULVWLPR X VYDNRGQHYQRP åLYRWX MHVWH GHNDGQL EURM NRML VH predstavlja SRPRüX FLIDUD RG  GR  6 GUXJH VWUDQH QXPHULþND YULMHGQRVW NRMX NRULVWL kompjuter predstavljena je binarnim brojevima koji koristi samo cifre 0 i 1. Predstavljanje informacija i kompjuter Dio 2. 1 Pretvaranje (11)10 u binarni broj Ostatak Donja cifra Gornja cifra dobijamo (1011)2.

ali 00 nije definisano. 40 .RGGHNDGQLKEURMHYDþLWDVHKLOMDGXMHGDQDHVWPHÿXWLPNRGELQDUQLKEURMHYDþLWDVHMHGDQ nula jedan jedan" s lijeva na desno.. ƔEURMQD 20=1 100=1 Svaki broj na 0 postaje 1.

Binarni broj 0001 1101 Heksadekadni broj 1D î1'î0 îî . Veza izmeÿu dekadnog broja.Poglavlje 2. 2GQRVL]PHÿXELQDUQRJLKHNVDGHNDGQRJEURMD Binarni broj je manje razumljiv kada se broj cifara SRYHüD=DWRSRVWRMLPHWRGRJUDQLþDYDQMD EURMDRGQLåHFLIUH]DELWDLSUHGVWDYOMDVHMHGQLP]QDNRP]DVPDQMLYDQMHEURMDFLIDUD2YDPHWRGD se zove heksadekadni broj i predstavlja se sa ukupno 16 znakova. Ovom metodom. brojevima od 0 do 9 i slovima od A do F. Predstavljanje informacija i kompjuter 2. heksadekadnog broja i binarnog broja je pokazana u tabeli 1. dekadni broj "29" je predstavljen sa "0001 1101" kao binarni broj i "1D" kao heksadekadni broj.

10 Tabela 1 9H]DL]PHÿXGHNDGQRJELQDUQRJLKHNVDGHNDGQRJEURMD Dekadni Binarni broj broj 0 0000 1 0001 2 0010 3 0011 4 0100 5 0101 6 0110 7 0111 8 1000 9 1001 10 1010 11 1011 12 1100 13 1101 14 1110 15 1111 Heksadekadni broj 0 1 2 3 4 5 6 7 8 9 A B C D E F Cifre binarnog broja. dekadnog broja. heksadekadnog broja 9MHåED Pretvorite sljHGHüHGHNDGQHLELQDUQHEURMHYHXELQDUQHRGQRVQRGHNDGQHEURMHYH (1) (18)10 (2) (25)10 (3) (00101010)2 (4) (10011001)2 Pretvorite sljHGHüH KHNVDGHNDGQH EURMHYH L ELQDUQH EURMHYH X ELQDUQH RGQRVQR KHNVDGHNDGQH brojeve. (1) (4F)16 (2) (7C)16 (3) (01101110)2 (4) (10000110)2 41 .

3UHGVWDYOMDQMHQXPHULþNLKYULMHGQRVWL]QDNRYD 1) Predstavljanje cijelog broja U kompjuteru VH QXPHULþNH YULMHGQRVWL PRJX SUHGVWDYOMDWL kao cijeli i realni brojevi.. Npr.Poglavlje 2. 3-ELWQL SR]LWLYQL FLMHOL EURM PRåH SUHGVWDYOMDWL QXPHULþNH YULMHGQRVWL RG . Predstavljanje informacija i kompjuter 2.

2 do (111)2.). a u ostatku smMHãWDPRQXPHULþNXYULMHGQRVW. Dekadni EURMQXPHULþNHYULMHGQRVWLRG do 7 su prikazane Tabela 2(a).DGDVHSULND]XMXQHJDWLYQLFLMHOL EURMHYLNDåHVHGD VXSULND]DQLXQRWDFLMLSRWSXQRJNRPSOHPHQWD R]QDþHQEURM. Predstavljanje cijelog broja (a) Bez koda 8QXWUDãQMLSULND] Vrijednost cijelog broja 000 0 001 1 010 2 011 3 100 4 101 5 110 6 111 7 (b) S kodom 8QXWUDãQMLSULND] 100 101 110 111 000 001 010 011 Vrijednost cijelog broja -4 -3 -2 -1 0 1 2 3 &LMHOL EURMHYL PRJX ELWL R]QDþHQL LOL QHR]QDþHQL WM PRJX LPDWL SUHG]QDN  LOL . Tabela 2. 3ULPMHULFLMHOLKEURMHYDXNOMXþXMXüLL negativne brojeve su prikazani u Tabeli 2(b). Za UHJLVWURYDQMHR]QDþHQRJFLMHORJEURMDXkompjuteru kRULVWLVHSUYLELWSRVPDWUDMXüLVlijeva na desno.

Prikaz cijelog broja 2) Predstavljanje u notaciji potpunog komplementa 5D]PLVOLPRREURMDþXNRPHVHEURMþDQDYULMHGQRVWSRYHüDYD ]DMHGDQNDGDVHRNUHüHXVPMHUX ND]DOMNHQDVDWXDDNRVHRNUHüHVXSURWQRRGND]DOMNHQDVDWXEURMþDQDYULMHGQRst smanjuje za jedan. Na primjer. "001" je 1 i "111" je -NDRãWRMHSULND]DQRQD6OLFL E.DGDXNOMXþXMHPRQHJDWLYQHYULMHGQRVWLEURMDþVHRNUHüHXVPMHUXVXSURWQRPND]DOMFLQD VDWX]DNRULVWHüLNDRSRþHWQXYULMHGQRVWEURMþDQDYULMHdnost smanjena je za 1 i dobija se broj ³´NRMLVHWUHWLUDNDRQHJDWLYQDYULMHGQRVW7RMHVWMHDMH-1. kada se -2 prikazuje kao cijeli broj potpunog komplementa. Za binarni broj. Za dekadni broj na Slici 2(a). "00" je minimalna vrijednost a "99" je maksimalna YULMHGQRVW. Znak broja (kodni dio) %URMþDQDYULMHGQRVW Slika 1. taj broj moåe biti izraþunat kao 100-2=98 i 98 je negativna vrijednost broja -2. (Slika 2).

QDLVWLQDþLQLSULND] NRMLXNOMXþXMHQHJDWLYQXYULMHGQRVWMHSULND]DQX7DEHOL E.

 $NRåHOLPRSUHGVWDYLWL binarni broj u notaciji potpunog komplementa. komplement broja (010)2 VH PRåH L]UDþXQDWL kao (1000)2-(010)2=(110)2. UDþXQDQMHVH L]YUãDYD QD LVWL QDþLQ NDR L ]D GHNDGQL EURM. i (110)2 pokazuje negativnu vrijednost -(010)2. 42 . Npr.

RPSOHPHQWELQDUQRJEURMDPRåHWHL]UDþXQDWLQDVOjHGHüLQDþLQ [1] Zamijenite 0 i 1 svake cifre (010)2 je zamijenjen u (101)2 [2] Dodajte 1 (101)2 i (001)2 dobit üHWH . Koncept prikaza komplementa . Predstavljanje informacija i kompjuter (a) Dekadni broj (b) Binarni broj Slika 2.Poglavlje 2.

DNRGRüLGRNRPSOHPHQWDELQDUQRJEURMD" Zamijeni 1 i 0 svake cifre i dodaj 1.2 Rezultat . predstavi sljHGHüLEURMGHNDGQLPEURMHP (1) Pozitivni cijeli broj 0 011 (2) Negativni cijeli broj 1 110 43 . 9MHåED Provjerite predstavljanje cijeloga broja kompjuterom Kada je cijeli broj predstavljen sa 4 bita.

Poglavlje 2. Predstavljanje informacija i kompjuter O dgovor (.

 3RãWR MH SR]LWLYDQ EURM NRGQL GLR MH  L SRND]XMH SR]LWLYDQ EURM 'R QXPHULþNH YULMHGQRVWL VH
dolazi kako je prikazano dole, 
î2î1î0=2+1=3
i prava vrijednost je 3. 

3RãWRMHQHJDWLYDQEURMNRGQLGLRMHLSRND]XMHQHJDWLYDQEURM
(1000)2-(110)2=(010)2 
î2î1î0=2
1DNRQãWRVPRL]UDþXQDOL, stvarna vrijednost je -2.
(1) Predstavljanje cijelog broja u kompjuteru je 16 bita, 32 bita itd.

3) ,]UDþXQDYDQMHNRULãWenjem komplementa broja
Za ljude je lako razumljivo prikazivanje nHJDWLYQRJ EURMD NRULVWHüL NRG NDR ãWR MH -2",
PHÿXWLP NUXJ operacija postaje komplikovan u samom kompjuteru. Pogledajmo primjer kada se
operacija oduzimanje pretvara u VDELUDQMHNRULãWenjem komplementa broja.

9MHåED ,]UDþXQDYDQMHNRULãtenjem komplementa broja
,]UDþXQDMPR-2 koristeüLNRPSOHPHQWEURMDLL]UDþXQDMPo (111)2-(010)2.
O dgovor
1 ,]UDþXQDYDQMHGHNDGQRJDEURMD
-2 je 10-2=8 kada je prikazano komplementom broja.
Onda, broju 7 dodamo komplement 8, rezultat se prikazuje kao:
(7+8)-10=5
2 I]UDþXQDYDQMHELQDUQRJEURMD
-(010)2 je (1000)2-(010)2=(110)2 kada je prikazano komplementom broja.
Onda, dodamo (111)2 i komplement broja (110)2 rezultat se prikazuje kao:
((111)2+(110)2)-(1000)2=(1101)2-(1000)2=(101)2
9MHåED 
3URQDÿLWHYULMHGQRVWLNada je cijeli broj prikazan sa 4 bita.
(1)
(2)
0

0

110

110 

,]UDþXQDMWHVOjHGHüHGHNDGQHEURMHYHNRULVWHüLNRPSOHPHQWEURMD
(1) 15-6 (2) 72-24 
,]UDþXQDMWHVOjHGHüHELQDUQHEURMHYHNRULVWHüLNRPSOHPHQWEURMD
(1) (011)2-(001)2 (2) (111)2-(101)2

44

Poglavlje 2. Predstavljanje informacija i kompjuter

4) Predstavljanje realnih brojeva
Realni broj prikazan na kompjuteru u pokretnom za rezu sastoji se iz tri dijela: kodnog dijela
(dio za znak broja), eksponenta i v rijednosti mantise. Za 32-bitno predstavljanje broja (4 bytea),
za kodni dio je rezervisan 1 bit, eksponent 8 bita, i vrijednost mantise 23 bita. Realni broj se
SUHGVWDYOMD  GHFLPDOQRP WDþNRP SRVWDYOMHQRP QD SRþHWNX GLMHOD UH]HUYLVDQRJ za vrijednost
mantise (Slika 3).
Kodni dio

Eksponent

Vrijednost mantise

Slika 3. Predstavljanje realnih brojeva
Ovdje je prikazan koncept decimalnog broja u pokretnom zarezu. Npr., EURM  PRåH
ELWL SULND]DQ NDR î3, gdje je "0.123456" vrijednost mantise,"10" je baza, a"3"
predstavlja vrijednost eksponenta. (Slika 4).
Predstavljanje realnog broja u pokretnom zarezu; Ako je broj cifara vrijednosti mantise veliki,
sve cifre ne mogu biti prikazane (Slika 5). Sa 32-bitnim realnim brojem, pouzdan broj cifara (broj
vDåQLKFLIDUD

456 i 0.123456x103 ima istu vrijednost vrijednost mantise baza eksponent Slika 4.MHRNRGRFLIUL RGSRþHWNDGHNDGQRJEURMDLYLãHFLIUL ne mRåHELWLSULND]DQR 123. %URM]QDþDMQLKFLIDUD . Slika 5. Prikaz pokretnog zareza (interni prikaz kompjutera) 2YDMGLRQLMHWDþQR prikazan.

DR ãWR MH SULND]DQR. (2) Ustvari. to je binarni broj. . . pomjeranje decimalnog dijela realnoga broja zove se predstavljanje u pokretnom zarezu.

3UHGVWDYOMDQMHUHDOQLK EURMHYDXUHJLVWUXRGüHOLMH -bitnom) je predstavljanje jednostruke WDþQRVWL D X UHJLVWUX RG  üHOLMH -ELWQRP.

45 . GYRVWUXNH WDþQRVWL 8 RYRP VOXþDMX UHJLVWURYDQMH broja u pokretnom zare]X VH YUãL X GYD UHJLVWUD 6DGUåDM SUYRJ UHJLVWUD RGJRYDUD MHGQRVWUXNRM WDþQRVWLDXGUXJRPUHJLVWUXVHQDOD]LSURGXåHQDPDQWLVD 9MHåED 3ULNDåLWH  X SRNUHWQRP ]DUH]X UHDOQRJ EURMD NRML LPD LVWL IRUPDW NDR ãWR MH prikazano na Slici 4.

DOIDQXPHULþNL ]QDFL L VLPEROL VH SUHGVWDYOMDMX ELQDUQRP ULMHþL GXåLQHELWD E\WH. Predstavljanje informacija i kompjuter 5) Predstavljanje znakovnog podatka U dDQDãQMLP kompjuterima.Poglavlje 2.

'DNOHMHGQLPEDMWRP E\WH.

EUC za japanski jezik i 8QLFRGH NRML RGJRYDUD ]QDNRYQLP VLVWHPLPD ãLURP VYLMHWD . sa znakovnim kodom prikazanim u TDEHOLVYDNL]QDNVHSUHGVWDYOMDQDVOMHGHüLQDþLQ Broj "0" kao znak: (0011 0000)2 (30)16 Slovo "A": (0100 0001)2 (41)16 Slovo "a": (0110 0001)2 (61)16 K odovi za zapisivanje zna kova Osim brojeva.QWHUFKDQJH. JIS kod.. 'DQDVVH]DNRGLUDQMH]QDNRYDQDMþHãüHNRULVWLNRGSR]QDWSRVYRMRMNUDWLFL ASC I I þLWDMDVNL LQDþH NUDWLFD RG $PHULFDQ 6WDQGDUG &RGH IRU .QIRUPDWLRQ .PRåHPRSUHGVWDYLWL 8=256 tipova znakova. Zna kovnih kodova LPD UD]OLþLWLK 3RVWRML shift JIS kod.RG QDV VH NRULVWL VWDQGDUG 8QLFRGH varijanta UTF-NRMDMHQDMSRJRGQLMD]DNRGLUDQMHSUHWHåQRODWLQLþQRJWHNVWD Npr. sva slova abecede (i velika i mala). interpunNFLMVNL ]QDNRYL SD þDN L ]QDN ]D razmak te znak za prelazak u novi red PRJXVH]DSLVDWLX]SRPRüL7RMH]DSUDYRLobavezno jer kompjuter pamti podatke samo u obliku 0 i 1.

VSUYD MH WR ELR VWDQGDUG SAD-DDOLMHNDVQLMHXWYUÿHQLNDRPHÿXQDURGQLVWandard pod nazivom ISO-7. odnosno 1 bytHVWLPGDMHNUDMQMLOLMHYLELWVORERGDQ8ELWRYDPRJXüH je pohraniti 27 UD]OLþLWLK]QDNRYDãWRMHVDVYLPGRYROMQRGDVHSRKUDQHVYL]QDNRYLVWDVWDWXUH Kodove pojedinih znakova nalazimo u tabeli: bitovi b3 b2b1b0 Bitovi b6b5b4 000 001 010 011 100 101 110 111 0000 0001 0010 0011 0100 0101 0110 0111 1000 1001 1010 1011 1100 1101 1110 1111 NUL SOH STX ETX EOT ENQ ACK BEL BS HT LF VT FF CR SO SI DLE DC1 DC2 DC3 DC4 NAK SYN ETB CAN EM SUB ESC FS GS RS US SP ! " # $ % & ` ( ) * + . . / 0 1 2 3 4 5 6 7 8 9 : . < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ – ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~ DEL 46 . . Broj ]QDþLGDVH]D kodiranje koristi 7 bitova.

UTF-8 zapisom i sa HTML oktalnim i decimalnim zapisom. 9MHåED 3UHGVWDYLWHVYRMHLPHKHNVDGHNDGQLPEURMHPNRULVWHüL]QDNRYQLNRGL]WDEHOH 9MHåED]DNUDMGLMHOD 1 3URQDÿLWHEURMNRMLPRåHELWLSUHGVWDYOMen 4-ELWQLPR]QDþHQLPFLMHOLPEURMHP 2 3URQDÿLWH YULMHGQRVWL þLMH MH SUHGVWDYOMDQMH FLMHORJD EURMD -bitni cijeli broj predstavljen dekadnim brojem. 47 . Predstavljanje informacija i kompjuter Kodove VPMHãWDPRSRãemi: bitovi kolone tabele bitovi reda tabele b7 b6 b5 b4 b3 b2 b1 b0 bitovi ASCII znaka (2) U ASCII kodu (American Standard Code for Information Interchange) DOIDQXPHULþNL ]QDFL L simboli se predstavljaju binarnom rijeþi duåine 7 bita. (1) (2) 8 WDEHOL VX GDWD VORYD V RGJRYDUDMXüLP 8&6-2 kodom.Poglavlje 2. Dakle moåemo predstaviti 27=128 tipova znakova (3) 2 bajta mogu predstavljati 216 (65536) tipova znakova.

Poglavlje 2. Predstavljanje informacija i kompjuter Dio 3. kYDQWL]DFLMRP SUYD WDþND X]RUND SRVWDMH  D SXWHP kodiranja postaje 010 binarni broj. dijelu VPR QDXþLOL GD VH ELQDUQL EURM SULND]DQ SRPRüX  L  NRULVWL X kompjuteru za RSLVLYDQMH EURMþDQH YULMHGQRVWL L ]QDND U ovom dijelu nauþit üemo da se zvuk i slika mogu predstaviti binarnim brojem na isti naþin. analogni oblik talasa je kontinuirani kvantitet i za vrijeme i za amplitudu oblika talasa. Interval koji se posmatra zove se period uzor ka2EOLNWDODVDSRGVMHüDQDRULJLQDOQLDQDORJQLREOLNWDODVDNDGDMHSHULRGX]RUNDNUDüL (3) K vantizacija Isto tako oJUDQLþHQMHDPSOLWXGH oblika talasDXRGUHÿHQLPLQWHUYDOLPDLGROD]DN GRQXPHULþNH vrijednosti najbliåH YULMHGQRVWL WDþNL X]RUND se zove kvantizacija. Analogni podaci 45"-6%1"7%&"# Uzimanje uzoraka Kodiranje Digitalni podaci Slika 1. Digitalni prikaz zvuka i slike U 2. Za kvantizaciju. (2) Uzimanje uzora ka 2JUDQLþDYDQMH REOLND WDODVD ]D RGUHÿHQR YULMHPH L njegovo prekidanje zove se uzimanje uzora ka. Digitalizacija zvuka (1) A nalogni podaci Zvuk je analogni oblik talasa.. Npr. kvantizacijom i kodiranjem kako je prikazano na Slici 1. Amplituda Amplituda Vrijeme 7DþNDX]RUND Vrijeme 48 . oblik talasa SRGVMHüDQDRULJLQDOQLDQDORJQLREOLNWDODVDNDGDMH LQWHUYDONRML VHRGUHÿXMHNUDWDN1D6OLFL je REOLN WDODVD RJUDQLþHQ QD  QLYRD RG  GR  PHÿXWLP DNR VH RJUDQLþL QD  QLYRD RG  GR  NROLþLQD SRGDWDND NRML VH REUDÿXMX VH SRYHüDYD D JUHãNH VH VPDQMXMX 5D]OLND L]PHÿX RULJLQDOQH analogne vrijednosti pri kvantizaciji zove se NYDQWL]DFLMVNDJUHãND (4) K odiranje 0LMHQMDQMH QXPHULþNH YULMHGQRVWL GR NRMH VPR GRãOL X]LPDQMHP X]RUDND L NYDQWL]DFLMRP binarnim brojem zove se kodi ranje. Kada horizontalna i vertikalna osa predstavljaju vrijeme i amplitudu oblika talasa. DWDþND NRMD VH L]GYRML ]RYH VH WDþND Xzor ka. 1. Predstavljanje zvuka 1) Od analognog do digitalnog =YXN PRåH ELWL SULND]DQ SRPRüX ELQDUQRJ EURMD 3URYMHULPR NDNR VH DQDORJQL SRGDFL pretvaraju u digitalne podatke uzimanjem uzoraka. i Slici 2.

Suprotno. Predstavljanje informacija i kompjuter Amplituda Amplituda Vrijeme Vrijeme Slika 2.Poglavlje 2. pretvaranje digitalnih podataka u analogne podatke zove DA pretvaranje (Digitalna/Analogno Pretvaranje). (2) Ovo je vrijednosWRJUDQLþHQDRGUHÿHQLPLQWHUYDOLPD . Proces prebacivanja analognih podataka u digitalne podatke (primjer kvantizacije 3 bita) (1) Zove se AD pretvaranje (Analogna/Digitalna pretvaranje).

a na 16 nivoa 4-bitna kvantizacija. Npr. ako je frekvencija 50Hz. oblik talasa prikazan na VOLFL  D.. 2) Interval uzimanja uzoraka Amplituda Amplitude Vrh Amplituda Razmislimo na koliko nivoa treba izdijeliti interval uzimanja uzoraka u sljedeüHP SULPMHUX Frekvencija je broj oscilacija za 1 sekundu. $NR MH REOLN WDODVD RJUDQLþHQ QD  QLYRD WR MH -bitna kvantizacija.

Zbog toga. SRMDYOMXMH VH  SXWD X VHNXQGL 0HÿXWLP NDGD MH WDODV RG +] GLJLWDOL]RYDQ L DNR MH frekvencija uzorka koja pokazuje broj uzetiKX]RUDND]D MHGQXVHNXQGX+]VDPRVHQDMYLãLGLR WDODVDPRåHX]HWLNDRX]RUDN 6lika 3(b)). neophodno je uzeti uzorak 100 puta (uzeta frekvencija 100+]. bar dva puta. da bismo uzeli uzorak dna.

Efekt intervala uzimanja uzoraka 9MHåED . 5D]PLVOLWH]DãWRMHWRWDNR >6DYMHW@=QDPRGDMHJRUQMDJUDQLFDIUHNYHQFLMHNRMXþRYMHNPRåHþXWL>N+]@ 49 .DGDGLJLWDOL]XMHWH]YXNVYHãWRPRUDWHXUDGLWLMHVWHX]HWLX]RUDNRG>N+]@LOLYLãHSRVekundi.LOLYLãH]DMHGQXVHNXQGX 6lika 3(c)). Vrijeme Frekvencija (a) Talas Frekvencija uzorka (b) Uzimanje uzorka od 50Hz Frekvencija uzorka (c) Uzimanje uzorka od 100Hz Slika 3.

RGGDQDãQMLKkompjutera slike u boji su prikazane kombinacijom nijansi tri osnovne boje. G (green-zelena) i B (blue-SODYD.Poglavlje 2. Predstavljanje slike 1. R (red-crvena). Predstavljanje informacija i kompjuter 2. Slika u boji .

Kada je svaka od R. prikaz 2 8î8î8 îî256 = 16777216 boja je omRJXüHQ (Slika 4). B predstavljena sa 8 bita. 0LMHãDQMH WLK ERMD SRYHüDYD VYMHWORVW L ERMD VH SULEOLåDYDELMHORM2YRVH]RYHGRGDWQRPLMHãDQMHERMD. True color (24-ELWQD ERMD. Ovo MH GRYROMDQ EURM ERMD NRML þRYMHN PRåH SUHSR]QDWL. G.

Iznad je prikazan dio oblaka crvenih elemenata kada je svaka RGB kvantizovana na 256 nivoa. Informacija o slici Lijeva slika je slika rastavljena na nijanse tri primarne boje. L SRJRGQD MH ]D SULND] IRWRJUDILMH LOL GUXJH VOLNH þLML MH EURM ERMD YHOLN D ERMH VX VORåHQH6OLNDSULND]XMHGLMDJUDPUDVWDYOMHQQDQLMDQVHWULRVQRYQH boje. M (magHQWD. 8 bita x3 Slika u boji Slika 4. C (cyanogen). Tri osnovne boje slike u boji 6 GUXJH VWUDQH NRG ãWDPSDþD X ERML ERMH VX SULND]DQH NRPELQRYDQMHP nijansi boja tri osnovne boje . Slika 5.

L< \HOORZåXWD.

.%RMDSRVWDMHWDPQLMDPLMHãDMXüLRYH boje i SULEOLåDYDse crnoj. To se zove PLMHãDQMHERMDoduzimanjem osobina tri osnovne boje.

3UDNWLþQRQH]DYLVQDFUQD .

WLQWDVHNRULVWL 50 .

%#. koji je sastavni dio boje slike. Digitalizacija 1D LVWL QDþLQ NDR L ]YXk. Broj kvantizacije. . 85"9"#(*&"# 2+:#-%&"-. crne i ELMHOH . Slika 6. -DVQRüDVOLNH]DYLVLRGEURMD piksela. Uzimanje uzorka slike (razlika slike zavisi od rezolucije) Za kvantizaciju slike QDMEOLåD YULMHGQRVW FLMHORJ EURMD QLMDQVL GRELMH VH MHGLQLFRP SLNVHOD ]D svaku od tri osnovne boje. Jedan piksel je prikazan s dvije nijanse sive (1 bit) i 8 nijansi sive (3 bita). pikseli âWR YLãH SLNVHOD EROMD  je slika. Slika i pikseli Rezolucija 480x480 Rezolucija 32x32 Rezolucija 16x16 Rezolucija 8x8 Slika 7. Slika se digitalizuje tako ãWR VH SRYUãLQD VOLNH SRGLMHOL OLQLMDPD X PUHåX NYDGUDWLüD-piksela (pixel) da bi se uzeo uzorak pozicije i kvantizacija nijansi tri osnovne boje. i prikazuje se rezolucijom (Slika 6).%5'# 85"9"#(*&"# 2#-%&"-. Metoda digitalizacije fotografija i slika je u osnovi ista kao i digitalizacija zvuka. Predstavljanje informacija i kompjuter 2. slika se predstavlja u binarnom zapisu sa "0" i "1".ROLþLQD SRGDWDNDRG  QLMDQVL VLYH SRVWDMH WURVWUXNR YHüD RGRQH RG  QLMDQVH VLYH L VOLND postaje realnija.%5'# 85"9"#(*&"# =#-%&"-. Kvalitet slike zavisi od rezolucije (Slika 7).'#.'#.%5'# Slika 8.%#. To je ton slike.%5'# 85"9"#(*&"# <#-%&"-.Poglavlje 2. pokazuje kolika je MDþLQDVYLMHWORJLtamnog. Kvantizacija slike ( razlika slike zavisi od tona) -HGQRERMQDVOLND VHSULND]XMHVMHQþHQMHPSLNVHOD LVOLNDSRVWDMHNYDOLWHWQLMDDNR MH VMHQþHQMH visokog nivoa.

51 .1DMPDQMDWDþNDNRMDNRQILJXULãHVOLNX]RYHVHSLNVHO (2) Broj podjela po horizontali i veUWLNDOLL]UDåDYDUH]ROXFLMXLMDVQRMHGDüHNYDOLWHWVOLNHELWLEROML ãWRMHUH]ROXFLMDYHüD 5H]ROXFLMDãWDPSDþDLOLVNHQHUDMHEURMSLNVHODSRLQþX-dpi (dot per inch) (oko 2. (3) Ovo je slika prikazana nijansiranjem crne i bijele.5 cm).

. Prikaz JUDILþNLKSRGDWDNDLSRNUHWQHVOLNH 1) 3ULND]JUDILþNRJSRGDWNDLSRNUHWQHVOLNH 0HWRGD NRMD REUDÿXMH VOLNX QLMDQVLUDQMHP SLNVHOD RSLVDQD X SUHWKRGQRP GLMHOX ]RYH VH rasterska grafi ka.DGD SULND]XMHWH JUDILþNL SRGDWDN NROLþLQD SRGDWDNDVHVPDQMXMHDNRNRRUGLQDWHVQLPDWHNDRQXPHULþNXYULMHGQRVWLQIRUPDFLMH Kod pokretnih slika SRNUHWLVXL]UDåHQLVXNFHVLYQRPVPMHQRPSRMHGLQDþQLKVOLNDXQL]Xgdje VYDNDSRMHGLQDþQDVOLNDSUHGVWDYOMDGMHOLüSRNUHWD1SUPRJXüH MHSULND]DWL QHSRNUHWQXVOLNXNDR SRNUHWQX VOLNX SULND]XMXüL QHSRNUHWQH VOLNH QHSUHNLGQR NDR LVSUHNLGDQX DQLPDFLMX -HGDQ GLR SRNUHWQHVOLNH]RYHVHIUDPHVOLþLFD%URMIUHMPRYDVOLþLFD u jednoj sekundi zove se brzina slike. 1SU NDGD FUWDWH NUXJ QHRSKRGQH LQIRUPDFLMH VX NRRUGLQDWD FHQWUD NUXJD SUHþQLN NUXJD ERMD XQXWUDãQMRVWL NUXJD ERMD L GHEOMLQD NUXåQH OLQLMH . S druge strane. metoda predstavljanja slike koja koristi osnovne grDILþNH HOHPHQWHNDRãWRVXSUDYDFUWDLVNULYOMHQDFUWDNUXJLþHWYRURXJDRLNRMDMHRSLVXMHVSHFLILNDFLMRP koordinata zove se vektorska grafika. i R]QDþDYDVHNDRfps. Slika na TV-u i videu je oko 30 fps. Predstavljanje informacija i kompjuter 3.Poglavlje 2.

. 5DVWHUVNL WLS 3URJUDP NRML SUHGVWDYOMD VOLNX SRUDYQDYDQMHP SLNVHOD NRULVWHüL LQIRUPDFLMX piksela.

ROLþLQDSRGDWDNDLVOLND Jednobojna slika (2 nijanse sive) 1x640x480=307200 bita = 38400 bytes Jednobojna slika (8 nijansi sive) 3x640x480=921600 bita = 115200 bytes Slika u boji (8x3)x640x480 = 7372800 bita = 921600 bytes =DWLPL]UDþXQDMWHNROLþLQXSRGDWDNDVOLNHLSRNUHWQHVOLNH 9MHåED . 9HNWRUVNL WLS 3URJUDP ]D FUWDQMH JUDILþNRJ REOLNa. Postoji program za crtanje koji uglavnom NRULVWLOLQLMHNRMHSUHGVWDYOMDMXVOLNXNRULVWHüLLQIRUPDFLMXNRRUGLQDWD 2.ROLþLQDSRGDWDNDMHGQRERMQLKVOLNDLVOLNDXERMLQLMDQVH sive i 8 nijansi sive prikazani su u Tabeli 1. .ROLþLQDSRGDWDNDLVDåLPDQMH .]UDþXQDMWHNROLþLQXSRGDWDNDVOLNHLSRNUHWQHVOLNH .ROLND MH >%@ NROLþLQD SRGDWDND -ELWQH VOLNH X ERML þLMD MH UH]ROXFLMD î WDþDND" $NR napravite pokretnu sliku koja prikazuje ovu sliku kao nepokretQX  VOLþLFD SR MHGQRP PLQXWX pri brzini slike od 30 ISVNROLNDMHNROLþLQDSRGDWDND>0%@" R G B 8x3 bita 320 taþDND 240 bita 1 sekunda 30 slika 52 . SUHWSRVWDYOMDMXüLGDMHSULND]EURMDSLNVHODî 7DEHOD.

Predstavljanje informacija i kompjuter O dgovor 3RãWRMHVOLNDXERMLVYDNLSLNVHOLPD ELWD >%@.Poglavlje 2.

ROLþLQDSRGDWDNDSRNUHWQHVOLNHMHYUORYHOLNDWDNRGDVHNRULVWLWHKQRORJLMDVDåLPDQMDda bi VH VPDQMLOD YHOLþLQD SRGDWDND SUDWHüL RGUHÿHQD SUDYLOD 2EQDYOMDQMH VDåHWLK podataka zove se ekstenzija (dekomp resija.NROLþLQX podataka WDNRGDMHNROLþLQDSRGDWDND îî >%@ . ekspanzija. rekonst rukcija.ROLþLQD SRGDWDND  VOLþLFH QHSRNUHWQH VOLNH MH  >%@ NROLþLQD SRGDWDND  RNYLUD MH î  >%@ 3RãWR  VHNXQGD þLQH MHGDQ PLQXW NROLþLQD SRGDWDND je î >%@ 8VOXþDMX>0%@ 2 >%@ >%@NROLþLQDSRGDWDNDMHRNR>0%@ .

3RGDFLVHPRåGDQHüHYUDWLWLXRULJLQDOQL ]DSLVãWRüH]DYLVLWLRGPHWRGHVDåLPDQMDPHÿXWLPSRGDFLVHPRJXSURãLULWLQDQLYRNRMLQLMHWROLNR ORãXRGQRVXQDRULJLQDOQHSRGDWNH (1) 6DåLPDQMH NRMLP VH VDåHWL SRGDFL PRJX REQRYLWL X SRWSXQRVWL NDR RULJLQDOQL SRGDFL ]RYH VH VDåLPDQMH EH] JXELWDND D VDåLPDQMH NRMLP VH SRGDFL QH PRJX X SRWSXQRVWL REnoviti zove se VDåLPDQMHVJXELcima. .

 =D VDåLPDQMH VOLNH X ERML -3(* -RLQW 3KRWRJUDSKLF ([SHUWV *URXS.

csv. Formati datoteka i njihovi nastavci 3RVWRMH IRUPDWL GDWRWHND SULVXWQL X DSOLNDWLYQLP SURJUDPLPD L UD]OLþLWL IRUPDWL NRMH PRJX REUDÿLYDWLPQRJLSURJUDPL FormaWGDWRWHNHVHXRSüeno identifikuje nizom znakova koji su dodati na kraju imena datoteke. broj kvantizacije je 16 bita. htm etc. wmv*. mid. gif*. jpg*. Format datoteke Prisutna aplikacija Nastavak imena datoteke doc. i stereo (2 NDQDOD. xls. jtd. wma*. Tekst txt. png* etc. Zvuk wav. Amplituda 9MHåED]DNUDMGLMHOD 1. mpg* etc. NRULVWL VH PHÿXQDURGQD standardna metoda kodiranja nepokretne slike u boji. provedimo kodiranje. Slika bmp. mp3* etc. Kvalitet zvuka CD-a ima frekvenciju uzorka 44100 [Hz]. pdf etc. Film avi. 0HÿXWLPYHUWLNDOQDRVDELWUHEDODLPDWLYULMHGQRVWXNRUDFLPD Vrijeme 2. Poslije izvedene 4-bit-ne kvantizacije ]D WDþNH X]RUND ]YXND $ GR .

]UDþXQDMPR NROLND MH >.%@ NROLþLQD podataka za 1 sekundu kada se provede digitalno snimanje sa ovim kvalitetom zvuka. . 53 .

osnovama funkcionisanja kompjutera i operacijama koje se izvode u kompjuteru. /RJLþNDRSHUDFLMD 1) âWDMHORJLþNDRSHUDFLMD" 1HND L]UDþXQDYDQMD REUDÿHQD kompjuterom zovu se ORJLþNH RSHUDFLMH 2VQRYQH ORJLþNH operacije su: I operacija (A N D). I L I operacija (O R) i negacija (N O T/N E.Poglavlje 2. 1. Predstavljanje informacija i kompjuter Dio 4. Kompjuterski sistem 8RYRPGLMHOXXþLPRRORJLþNLPRSHUDFLMDPDXkompjuteru.

Za Da. Pitanje 3'DOLVLVUHGQMRãNRODF" Odgovor je X. Za Da.MHRGJRYRUQDSLWDQMH'DOLVLVUHGQMRãNRODF"D<MHRGJRYRUQD'DOLVLGMHþDN"6SLVDN PRJXüLK RGJRYRUD MH GDW X WDEHOL 2YD WDEHOD VH ]RYH tabela istinitosti (tabela 1). 2EMDVQLPR ORJLþNH RSHUDFLMH SRPRüX VOMHGHüHJ SULPMHUD 3LWDMWH JUXSX RG þHWLUL RVQRYFD L þHWLUL VUHGQMRãNROFD GYD pitanja: 'DOLVLVUHGQMRãNRODF"L'DOLVLGMHþDN" 'MHþDN 'MHYRMþLFD 6UHGQMRãNRODF 'MHþDN 'MHYRMþLFD Osnovci . Vrijednosti I operacije (AND). Y=0 54 . ILI operacije (OR) i negacije (NOT/NE) je prikazan dolje. X=0 3'DOLVLGMHþDN" Odgovor je Y. Y=1 Za Ne. X=1 Za Ne.

ILI operacija (OR) i negacija (NOT/NE) 1. Tabela istinitosti (a) I operacija (AND) X Y Z 0 0 0 0 1 0 1 0 0 1 1 1 Z postaje 1 samo kada su obje vrijednosti X i Y MHGQDNHDXRVWDOLPVOXþDMHYLPD 2. Z=1 onosno Z=0 6UHGQMRãNRODF: 'MHþDN 6UHGQMRãNRODF: 'MHYRMþLFD Osnovac: 'MHþDN 55 Osnovac: 'MHYRMþLFD . I L I operacija (O R) 5H]XOWDWRGJRYRUDQDSLWDQMH'DOLVLVUHGQMRãNRODFili GMHþak?" dodijelite promjenljivoj Z. Za Da i Ne. Predstavljanje informacija i kompjuter 2) I operacija (AND). Z=1 odnosno Z=0 6UHGQMRãNRODF 'MHþDN 6UHGQMRãNRODF 'MHYRMþLFD Osnovac: 'MHþDN Osnovac: 'MHYRMþLFD Tabela 1. A N D operacija 5H]XOWDWRGJRYRUDQDSLWDQMH'DOLVLVUHGQMRãNRODF i GMHþDN"GRGLMHOLWHSURPMHQOMLYRM= Za Da i Ne.Poglavlje 2.

Negacija RezuOWDWRGJRYRUDQDSLWDQMH'DOLVLVUHGQMRãNRODF"GRGLMHOLWHSURPMHQOMLYRM= Za Da i Ne. na str. Z=1 odnosno Z=0 Osnovac: 'MHþDN Osnovac: 'MHYRMþLFD 6UHGQMRãNRODF: 'MHþDN 6UHGQMRãNRODF: 'MHYRMþica (c) Negacija (NOT) X Z 0 1 1 0 Z postaje 1 ako je X jednako 0 i obrnuto. 9MHåED .RSHUDFLMD]DGYDJUDILþND prikaza na slikama 3. i 4.Poglavlje 2.RMDYUVWDJUDILþNRJSRGDWNDVHGRELMDNDGDVHNRULVWH$1'RSHUDFLMDL. Predstavljanje informacija i kompjuter (b) ILI operacija (OR) X Y Z 0 0 0 0 1 1 1 0 1 1 1 1 Z postaje 1 kada su obje vrijednosti X i Y (ili jedna od njih) jednake DXRVWDOLPVOXþDMHYLPD 3. 25? 56 .

RSHUDFLMHRSHUDFLMHORJLþNRJ]ELUDLQHJDFLMH Sabiranje jedne cifre binarnog broja Zbir? /RJLþND PUHåD NRMD YUãL VDELUDQMH MHGQRFLIUHQLK ELQDUQLK EURMHYD ]RYH VH SROXVDELUDþ 6DELUDMPR ELQDUQH FLIUH . 3ULPMHUSROXVDELUDþD ]D. OR/ILI procedura i NOT/NE procedura. Ove procedure SURYRGH$1'. L < L SUL WRPH PRåHPR GRELWL GYRFLIUHQ UH]XOWDW FV JGMH MH V FLIUD QD MHGLQLþQRPPMHVWXUH]XOWDWDDFMHPRJXüLSUijenos. Tabela 2. Tabela istinitosti za sabiranje Vrijednosti koje se Prva cifra sabiraju Prijenos Slika 1. Tabela 2. /RJLþNRNRORLIXQNFLMHkompjutera 1) /RJLþNRNROR 3URFHGXUD NRMD SURYRGL ORJLþNH RSHUDFLMH X kompjuteru zove se logiþko kolo.Poglavlje 2. Predstavljanje informacija i kompjuter 2. L< . Osnove ovog ORJLþNRJ NROa su: AND/I procedura.

57 .

Postoji operativna memori ja RAM (Random acces memory) u kojoj se L]YUãDYDMXVYLSURJUDPLLREUDGDSRGDWDNDVanjska memorija (hard disk.]ERURSUHPHNRMDþLQL kompjuterski sistem zove se konfiguracija.Poglavlje 2. Predstavljanje informacija i kompjuter 2) Konfiguracija kompjuterskog sistema . CD. Kompjuter komunicira sa GUXJLP XUHÿDMLPD WDNR ãWR VH SUHNR XOD]QLK XUHÿDMD podaci mogu unositi u kompjuter a preko L]OD]QLK XUHÿDMD se mogu izdDYDWL UH]XOWDWL REUDGH 8UHÿDM X NRPH VH þXYDMX SURJUDPL L SRGDFL zove se memorija. floppy disk.

VOXåL]D pohranu programa i podataka koji se po potrebi mogu prenijeti u operativnu memoriju u cilju QMLKRYRJ L]YUãHQMD C PU (central p rocessing unit/ centralna jedinica za obradu.

 MH XUHÿDM X kompjuterX X NRPH VH L]YUãDYDMX LQVWUXNFLMH SURJUDPD L L]YRGH UD]OLþLWH RSHUDFLMH nad podacima. Kompjuter se sastoji od centralne jedinice i SHULIHUQLKXUHÿDMD koji se jednim imenom nazivaju hardver. Program je niz instrukcija koje kompjuter L]YUãDYD SUL UMHãDYDQMX RGUHÿHQRJ ]DGDWND 6LVWHPVNHLDSOLNDWLYQH NRULVQLþNH.

SURJUDPHMHGQRPULMHþMX]RYHPRsoftver. podaci Podaci Tok instrukcija Tok programa. 3) Operacije kompjutera U operativnoj memoriji se nalazi program koji se neposredno izvrãDYD L SRGDFL NRML VH QHSRVUHGQR NRULVWH SUL L]YUãDYDQMX SURJUDPD 3UL L]YUãHQMX SURJUDPD X RSHUDWLYQRM PHPRULML podaci se unose iz vanjske PHPRULMH L SURVOMHÿXMX X regista r CPU-a. (2) UlazQL XUHÿDML WDVWDWXUD PLã LWG VX MHGLQLFH ]D XQRV SRGDWDND 0RQLWRU L ãWDPSDþ VX L]OD]QL ureÿDML)ORSS\GLVNHWDKDUGGLVN. su vanjske memorije.]OD]QLXUHÿDML Program $ULWPHWLþND instrukcija $ULWPHWLþNR-ORJLþND      jedinica Vanjska memorija Prijenos instrukcija Podaci Podaci Operativna memorija Ulaz podataka Izlaz podataka Program. Prijenos instrukcija Instrukcije ulaza 8OD]QLXUHÿDML Instrukcije izlaza 8SUDYOMDþNDMHGLQLFD . Predstavimo proces rada CPU-DQDSULPMHUX³VDELUDQMH´ 58 . Podaci i instrukcije se UD]PMHQMXMXL]PHÿX operativne memorije i registra velikom brzinom (Slika 3). podataka Slika 2. CD-ROM jedinica itd. DVD jedinica. Osnovna konfiguracija kompjutera (1) Pet funkcija: XOD]þXYDQMHL]OD]RSHUDFLMDNRQWUROD]RYXVHSHWJODYQLKIXQNFLMDkompjutera.

QVWUXNFLMH L SRGDFL VX VPMHãWHQL X RSHUDWLYQX PHPRULMX =QDþHQMH VYDNH instrukcije je prikazano ispod. ýLWDQMH 3RGDFLVHþLWDMXL]RSHUDWLYQHPHPRULMH Sabiranje: .Poglavlje 2.QVWUXNFLMD þLWDQMH QD DGUHVL  MH SURþLWDQD L REUDÿHQD 3RGDWDN  QD DGUHVL  MH SURþLWDQ L SULYUHPHQRVPMHãWHQXUHJLVWDU $. Operacijski sklop potreban za operaciju þLWDQMH Registar instrukcija Address þLWDQMH þLWDQMH 3URJUDPVNLEURMDþ þXYDQMH <Aritm-ORJLþND jedinica> + sabiranje Registar potreban za operaciju Instrukcija sabiranje Podatak Registar Registar Slika 3. .]YUãDYDVHVDELUDQMH Snimanje: 3RGDFLVHþXYDMXXRSHUDWLYQRMPHPRULML =DYUãHWDN 3URFHVMH]DYUãHQ . Predstavljanje informacija i kompjuter <Operativna memorija> <8SUDYOMDþNDMHGLQLFD> Instrukcija je privremeno VPMHãWHQD. Osnovna operacija CPU .]YUãHQD LQVWUXNFLMD MH VPMHãWHQD X RSHUDWLYQX memoriju.

&38-D3URJUDPVNLEURMDþMHSRVWDYOMHQQDDGUHVX <Operativna memorija> ýLWDQMHLQVWUXNFLMH Adresa ýLWDQMHLQVWUXNFLMH Slanje na adresu 10 3URJUDPVNLEURMDþ ýLWDQMH ýLWDQMH ýLWDnje Instrukcija Sabiranje Spremanje Kraj .]YUãDYDQMH instrukcije Podatak Registar Register 59 .

Poglavlje 2. Predstavljanje informacija i kompjuter .

QVWUXNFLMDþLWDQMH QDDGUHVL  MHSURþLWDQD L REUDÿHQD3RGDWDNQDDGUHVL MHSURþLWDQ L SULYUHPHQRVPMHãWHQXUHJLVWDU%3URJUDPVNLEURMDþMHSRVWDYOMHQQDDGUHVX < Operativna memorija > ýLWDQMHLQVWUXNFLMH " ýLWDQMHLQVWUXNFLMH " ýLWDQMH 3URJUDPVNLEURMDþ " Adresa ýLWDQMH " ýLWDQMH Slanje na adresu 11 " Sabiranje 6PMHãWDQMH " " " Instrukcija " Kraj " Podatak Registar ..

 .]YUãavanje instrukcije Sabiranje Instrukcija Spremanje =DYUãHWDN ýLWDQMH Podatak Registar .QVWUXNFLMD VDELUDQMH QD DGUHVL  MH SURþLWDQD L REUDÿHQD 6DUGåDM UHJLVWUD $ ³ L VDGUåDM registra B "5" se sabiraju i rezultat operacije je  L SULYUHPHQR MH VPMHãWHQ X UHJLVWDU & 3URJUDPVNLEURMDþMHSRVWDYOMHQQDDGUHVX < Glavna memorijska oprema > ýLWDQMHLQVWUXNFLMH " Adresa ýLWDQMH ýLWDQMHLQVWUXNFLMH " " + sabiranje 3URJUDPVNLEURMDþ ýLWDQMH .

QVWUXNFLMD VSUHPL QD DGUHVL  MH SURþLWDQD LREUDÿHQD 6DGUåDM UHJLVWUD &  MH VPMHãWHQ QD DGUHVL  JODYQRJ PHPRULMVNRJ XUHÿDMD 3RGDWDN QD RYoj adresi je rezultat operacije. Programski EURMDþMHSRVWDYOMHQQDDGUHVX 60 ..

Predstavljanje informacija i kompjuter < Glavna memorijska oprema> ýLWDQMHLQVWUXNFLMH " Adresa þLWDQMH ýLWDQMHLQVWUXNFLMH " ýXYDQMH þLWDQMH Slanje na adresu12 " Sabiranje Instrukcija ýXYDQMH 3URJUDPVNLEURMDþ Kraj .]YUåDYDQMH <9=./" Podatak Registar .Poglavlje 2.0->?<.

QVWUXNFLMDNUDMQDDGUHVLMHSURþLWDQDLVHULMDSURFHVD SURJUDPD..

MH]DYUãHQD 9MHåED]DNUDMGLMHOD 1. provjerite izlazne rezultate za C i S za svaki VOXþDM 61 . Kada je signal "1" ili "0" unesen u X i Y na slici 1.

. 2EUDGDLQIRUPDFLMDNRULãtenjem kompjuterDL]YRGLVHQDVOMHGHüLQDþLQ [1] Problem se analizira i oblikuje. >@5D]PDWUDVHPHWRGDUMHãDYDQMDSUREOHPD [3] Razmatra se konkretna metoda obrade. Npr. Algoritam 8 RYRP SRJODYOMX XþLt üHPR R PHWRGDPD REUDGH LQIRUPDFLMD NRULãWenjem kompjutera. Definicija algoritma Algoritam je kRQDþDQ QL]NRUDNDNRML MDVQR LRGUHÿHQRYRGHNDUMHãHQMXQHNRJSUREOHPD XNROLNR UMHãHQMH SRVWRML. âWDMHDOJRULWDP" -HGQRRGRELOMHåMDVDYUHPHQRJVYLMHWDMHVWHXþHVWDOD i raznovrsna primjena kompjutera. o SUHWUDåLYDnju i procesu obrade sortiranja podataka. [4] Procedura (program) itd. nDXþQR-WHKQLþND SULPMHQD SRVORYQD SULPMHQD SULPMHQD X XSUDYOMDQMX kompjuterskim komunikacijama i drugo. 1. flowchart). se kreira na oVQRYXUMHãHQMD >@3URFHGXUDVHL]YUãDYDLGROD]LVHGRUMHãHQMDSUREOHPD Metod obrade u koraku [2] i [3] zove se algoritam D JUDILþNL ]DSLV DOJRULWPD ]RYHPR algoritamska shema ili dijagram toka (eng.Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 3RJODYOMH  2EUDGD LQIRUPDFLMD NRULãtenjem kompjutera Dio 1..

RGQRVQRGDMXRGJRYRUGDSUREOHPQHPDUMHãHQMD DNRUMHãHQMHQHSRVWRML.

Tekstualni opis algoritma 3URFHGXUD VDGUåL VOMHGHüH NRUDNH RWYRULWH JODVDþNX NXWLMX L]EURMite glasove za svakog kDQGLGDWDLXSRUHGLWHEURMJODVRYDGRNRMLKVWHGRãOL 'HWDOMQLMHREMDãQMHQLNRUDFL . 3ULPMHU6DVWDYLWHSURFHGXUXL]ERUDSUHGVWDYQLNDRGMHOMHQMD]D6DYMHWXþHQLND NoYR SROXJRGLãWH MH WHN SRþHOR L PRUDWH L]DEUDWL SUHGVWDYQLND RGMHOMHQMD ]D 6DYMHW XþHQLND 2GOXþHQRMHGDVYDNLXþHQLNRGMHOMHQMDQDSLãHLPHMHGQRJLOLGYDNDQGLGDWD. Razmislite o proceduri JODVDQMD]DL]ERUSUHGVWDYQLNDRGMHOMHQMD]D6DYMHWXþHQLNDLSUHGVWDYLWHMHGLMDJUDPRPWRND Procedu ra 1.DGDMHEURMXþHQLNDX RGMHOMHQMX QHSDUDQ QHPRJXüH MH GD GYD XþHQLND LPDMX LVWL EURM JODVova.

³2WYRULWHJODVDþNXNXWLMX´2WYRULWHJODVDþNXNXWLMXJGMHVXJODVDþNLOLVWLüL .

.³.]EURMLWHJODVRYH´Izbrojite glasove dobijene za svakog kandidata.

2SLVSRPRüXGLMDJUDPDWRND DOJRULWDPVNHsheme) 3URFHGXUD VH RSLVXMH GLMDJUDPRP WRND NDR ãWR MH SULND]DQR QD SOLFL  *UDILþNL VLmboli algoritamskih koraka prikazani su u Tabeli 1. 62 .³8SRUHGLte bURMJODVRYD´8SRUHGLWHEURMJODVRYDGRNRMLKVWHGRãOLLL]DEHULWHNDQGLGDWDNRMLMH GRELRQDMYLãHJODVRYD Procedu ra 2.

Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 3RþHWDN .]YDGLWHJODVDþNHOLVWLüH NE Da li je registrovan A DA Dodajte 1 glas za A Da li je dobijeni broj JODVRYDYHüLRG% Dodajte 1 glas za B NE DA 2GDEHULWH$NDRþODQD6DYMHWDXþHQLND 2GDEHULWH%NDRþODQD6DYMHWDXþHQLND Kraj Slika 1. 63 .

Pod strukturom algoritama podrazumijevamo redoslijed pojedinih vrsta DOJRULWDPVNLKNRUDNDXDOJRULWPX9UVWDDOJRULWDPVNRJNRUDNDMHNDUDNWHUDNFLMHNRMDVHL]YUãDYDX algoritamskom koraku. Da bi se osigurao pregledan zapis tRND DOJRULWPD X NRPH üH VH MDVQR XRþDYDWLYUVWHDOJRULWDPVNLKNRUDNDLVWUXNWXUDDOJRULWPDNRULVWLt üHVHJUDILþNL]DSLVL Zadata k 1. 1DSLãLWH DOJRULWDPVNX VKemu tako da primjeru 1. WHNVW PRåH ELWL QHMDVQR IRUPXOLVDQ L QHSUHJOHGDQ VD JOHGLãWD XYLGD X YUVWX DOJRULWDPVNLK koraka i strukturu algoritma. dodate proces koji dozvoljava postojanje QHYDåHüLKOLVWLüD 64 .Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera *UDILþNLVLPERO =QDþHQMH Upravljanje L]YUãDYDQMHP " Obrada podataka " Ispitivanje uvjeta " 8QRãHQMHSRGDWDND " Izdavanje podataka 7DEHOD*UDILþNLVLPEROLDOJRULWDPVNLKNRUDND Napomena Tekstualni zapis algoritma (procedura 1) koji smo naveli ima izvjesne nedostatke. Prije svega.

SUL MHGQRP L]YUãDYDQMX DOJRULWPD. svaka naredba L]YUãDYD WDþQR jedanput naziva se linijska struktura. Na Slici 2. 1.RPELQRYDQMHPRYLKHOHPHQWDUQLKDOJRULWDPVNLKVWUXNWXUDREUD]XMXVHVORåHQLDOJRULWPL Predstavimo primjerima tri osnovne strukture algoritma. L inijska stru ktura Struktura kod koje se. Osnovna struktura algoritma 1) Algoritam 3ULPMHUSRND]XMHSURFHGXUXL]ERUDþODQD6DYMHWDXþHQLNDNRULVWHüLVLPEROHGLMDJUDPDWRND kao ãWR VX REUDGD L SURFMHQD 8RSüeno. Razgranata stru ktura Ovo je struktura u kojoj se redoslijed obrade mijenja u zavisnosti od uvjeta.Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 2. razgranaWDVWUXNWXUDLFLNOLþQDVWUXNWXUDNDRãWRMHSULND]DQRQDVOLNDPDRGGR . QDUHGED  L QDUHGED  VX L]YUãHQH ]DGDWLP redosliMHGRPLL]YUãLOHVXVHWDþQRMHGDQSXW Naredba 1 Naredba 1 je izvrãena Naredba 2 1DUHGEDMHL]YUãHQD Slika 1. Linijska struktura 2. naredba  VH L]YUãDYD DNR MH uvjet WDþDQ 'D. algoritmom se mogu predstaviti tri osnovne strukture: linijska struktura. Na Slici 1.

 D QDUHGED  VH L]YUãDYD DNR MH uvjet QHWDþDQ 1H.

 3RVOLMH L]YUãDYDQMDQDUHGEHLOLQDUHGEHQDVWDYOMDVHVDL]YUãDYDQMHPVOjHGHüHJQL]DQDUHGEL Uvjet Ne Ako je uvjet ispunjen L]YUãDYDVHQDUHGED a ako uvjet nije ispunjen L]YUãDYDVHQDUHGED Da " " Naredba 1 Naredba 2 Slika 2. Razgranata struktura 65 .

Ne Uvjet i=1. Ovakav dio DOJRULWPDNRMLVH PRåHYLãHSXWDSRQDYOMDWLREUD]XMHFLNOLþQXVWUXNWXUX8 zavisnosti od izlaznog kriterijDFLNOXVLVHGLMHOHQDEURMDþNHFLNOXVHLFLNOXVHVDXvjetima. 2) Primjeri jednostavnih algoritama Pokazat üHPR SULPMHUH MHGQRVWDYQLK DOJRULWDPD WUL RVQRYQH VWUXNWXUH: linijske strukture.RULãWHQMH EURMDþNLKFLNOXVDSUHWSRVWDYOMDGD PL]QDPRNROLNRSXWDåHOLPRGD se ponovi dio tijela FLNOXVD0HÿXWLPQHNDGDQLMHMDVQRNROLNRüHSXWDGDVHL]YUãLFLNOXV2YXPRJXüQRVWSUXåDuvjetni ciklus. Identifikator lokacije u SURJUDPX ]RYH VH SURPMHQOMLYD 9ULMHGQRVW NRMX GRELMD SURPMHQOMLYD ]RYH VH WHNXüD YULMHGQRVW -HGQD RG RVQRYQLK QDUHGEL REUDGH SRGDWDND MH QDUHGED GRGMHOH 1DUHGED GRGMHOH VH R]QDþDYa znakom jedanakosti (=). . Promjenljivoj x se dodaje broj 1 (desna strana) i taj zbir se dodjeljuje promjenljivoj x (lijeva strana). Podatak je objekW REUDGH D SURJUDP GHILQLãH QDþLQ REUDGH podataka. nDUHGEDSRYHüDYDQMDYULMHGQRVWLSURPMHQOMLYH[]DMHGDQR]QDþDYDVH sa x = x+1. UD]JUDQDWHVWUXNWXUHLFLNOLþQHVWUXNWXUH Primjer 2. &LNOLþQDVWUXNWXUD (Petlja) U svDNRGQHYQRPåLYRWXþHVWRVHSRMDYHLGRJDÿDMLSRQDYOMDMX1LMHWHãNRSUHWSRVWDYLWLGDELL u algoritmima bilo pogodno da se izvjestan broj algoritamskih koraka ponavlja. . 66 . Svi podaci sa kojima program radi moraju se nalaziti u operativnoj memoriji. L inijska stru ktura 1DSLãLWHDOJRULWDPVNXshHPXLWHNVWXDOQRRSLãLWHDOJRULWDP]DXQRVEURMHYDXSURPMHQOMLYX a. Npr.Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 3. %URMDþNLFLNOXV je ciklus u kome je broj ponavljanja kriterij za izlazak iz njega. Mjesto u operativnoj memoriji u kome se nalazi jedan podatak zovemo lokacija..n naredba Da Tijelo ciklusa " " " Tijelo ciklusa Ne Uvjet Da %URMDþNLFLNOXV)RU        8YMHWQi ciklus While Uvjetni ciklus Repeat 3URJUDPL X VHEL VDGUåH podatke. 5 u promjenljivu b LL]UDþXQDWL]ELUa+b dodijelite promjenljivoj c.

(2) Saberite vrijednosti promjenljive a i promjenljive b. . i dodijelite je promjenljivoj c.Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera Procedu ra 1. Tekstualni opis algoritma (1) Unesite vrijednosti promjenljive a i promjenljive b.

Jednostavno opisana procedura (1) Unesite a. b (2) c = a+b . Promjenljiva i podaci 2.3ULNDåLWHYULMHGQRVWSURPMHQOMLYHFQDHNUDQX Obrada 1 Slika 4.

3ULNDåLWHF 3RþHWDN a. NumHULþND YULMHGQRVW  X üHOLML %.b c=a+b c Kraj Za primjer programa na SOLFLNRULãWHQ MHSURJUDPVNL MH]LNNRML MHVH QDOD]LXSURJUDPX]D rad sa radnim tabelama.

 MH GRGijeljena promjenljivoj a. QXPHULþNDYULMHGQRVWXüHOLML %.

MHGRGijeljena promjenljivoj b3URPMHQOMLYD³F´VDGUåLUH]XOWDW L]UDþXQDWRJ]ELUDDELWDQXPHULþNDYULMHGQRVWMHGRGiMHOMHQMDüHOLML %.

 67 .

Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera Cells (1. 3ULPMHUSURJUDPDLUH]XOWDWDL]YUãHQMD (1) ZQDNMHGQDNRVWL³ ³JRYRULGDMHUH]XOWDWVGHVQHVWUDQHGRGijeljen promjenljivoj s lijeve strane Zadata k 2. 1DSLãLWHDOJRULWDPVNX shemu i tHNVWXDOQRRSLãLWHDOJRULWDP L]UDþXQDYDQMDUD]OLNH LSURL]YRGDGYLMH YULMHGQRVWLNRULVWHüLSURPMHQOMLYHXSULPMHUX Primjer 3. Tekstualni opis algoritma : (1) Vrijednost broja bodova je unesena u promjenljivu tokuten. Cells(1. Razgranata stru ktura 1HND MH XOD]QL SRGDWDN EURM ERGRYD RVYRMHQLK QD ãNROVNRP WDNPLþHQMX L] LQIRUPDWLNH 1DSLãLWH DOJRULWDPVku shHPX L WHNVWXDOQR RSLãLWH DOJRULWDP GRGMHOMXMXüLSURPMHQOMLYRM*YULMHGQRVWNDGDMHRVYRMHQLEURMERGRYDLOL YLãH LGRGMHOMXMXüLSURPMHQOMLYRM* YULMHGQRVWNDGD MHUH]XOWDW PDQMLRG bodova. Slika 5.Value predstavlja YULMHGQRVWüHOLMH%. .2) predstavlja üHOLMX%. Procedu ra 1.2).

(5) Promjenljivoj G se dodjeljuje vrijednost 0. Jednostavno opisana procedura (1) Vrijednost za promjenljivu tokuten se unosi (2) Ako je tokuten t 50 (3) G = 1 (4) Ako nije (5) G = 0 (6) G je prikazan 68 . (3) Promjenljivoj G se dodjeljuje vrijednost 1. (6) Prikazuje se vrijednost promjenljive G. (4) Ako je vrijednost promjenljive tokuten manji od 50 bodova.$NRMHYULMHGQRVWSURPMHQOMLYHWRNXWHQERGRYDLOLYLãH.

30d@A" br_bodova  50 3 . 1DSLãLWHDOJRULWDPVNXVKemu dodavanja procesa neprikaziYDQMDYULMHGQRVWLL]DYUãLWHRSHUDFLMX kada se -1 unese za primjer 3. Napiãite algoritamsku shemu i WHNVWXDOQR RSLãLWH DOJRULWDP L]UDþXQDYDQMD IXQNFLMH GDWH formulama 2 .Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 3RþHWDN tokuten tokuten t50 Ne Da G=1 G=0 " G Kraj Slika 6. 69 . br_bodova t 50 1 G= 2. 3ULPMHUSURJUDPDLUH]XOWDWDL]YUãHQMD =DGDFL]DVDPRVWDODQUDGXþHQLND 1. br_bodova  30 """"""""" .

3ULPMHUSURJUDPDLUMHãHQMD =DGDFL]DVDPRVWDODQUDGXþHQLND 1. Napisati algoritamsku shHPX]DãWDPSDQMHYULMHGQRVWLSURPMHQOMLYH[GRGMHOMXMXüLMRMYULMHGQRVWL od 1 do n. 70 . Vrijednosti promjenljive x potrebno je i RGãWDPSDWL 3RþHWDN X = 1. &LNOLþQDVWUXNWXUD (Petlja) Napisati algoritamsku shemu kojom se promjenljivoj x dodjeljuju vrijednosti od 1 do 10.10 X Kraj Slika 7. Napisati algoritamsku shHPXNRMRPVHSURPMHQOMLYRM[GRGMHOMXMXYULMHGQRVWL« Vrijednosti promjenOMLYH[SRWUHEQRMHLRGãWDPSDWL 2.Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera Primjer 4.

onGDMHQL]JUXSDHOHPHQDWD7R]QDþLGDVHJUXSDLVWRJWLSD podataka zove niz. 3UHWUDåLYDQMHLVRUWLUDQMH ýHVWRVPRXVLWXDFLMLGDXVYDNRGQHYQRPåLYRWXSUHWUDåXMHPRLVRUWLUDPRpodatke. npr. Najjednostavniji algoritam pretraåivanja je serijsko pret raåivanje traåenja podataka od poþetka tabele jedan po jedan. . kada WUDåLPR ULMHþ X bosansko-HQJOHVNRP ULMHþQLNX SRGDFL VX VRUWLUDQL SR Dbecednom redu).. Ovdje XþLPRPHWRGXSUHWUDåLYDQMa i metodu sortiranja podataka. (1) Ako je promjenljiva jedan elemenat.Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 3. 1) 6HULMVNRSUHWUDåLYDQMHLELQDUQRSUHWUDåLYDQMH 1. 6HULMVNRSUHWUDåLYDQMH 1DODåHQMH RGUHÿHQLK SRGDWDND L] SRGDWDND VPMHãWHQLK X niz (ar ray) ili tabelu zove se SUHWUDåLYDQMH.

 =D VHULMVNR SUHWUDåLYDQMH SRGDFL QH PRUDMX XYLMHN ELWL SRUHGDQL RG PDQMHJ SUHPD YHüHP L REUQXWR'DNOHQL]QHPRUDELWLXUDVWXüHPLOLRSDGDMXüHPSRUHWNX Primjer 5. 7UDåLWHSRGDWDNRGSRþHWNDWMRGSUYRJHOHPHQWD niza a (1) redom. A lgRULWDPVHULMVNRJSUHWUDåLYDQMD 3URQDÿLPRVHULMVNLPSUHWUDåLYDQMHPEURMXQL]XRGFLMHOLKEURMHYD Procedura 1. (1) Uporedite vrijednost elementa a(1) sa YULMHGQRãüX  3RãWR VX YULMHGQRVWL UD]OLþLWH SUHÿLWHQDVOMHGHüLNRUDN (2) Uporedite vrijednost drugog elementa a(2) sa YULMHGQRãüX  3RãWR VX YULMHGQRVWL UD]OLþLWH SUHÿLWHQDVOMHGHüLNRUDN .

 1D SR]LFLML WUHüHJ HOHPHQWD D .

i = 1.DGD VH WUDåHQL SRGDWDN SURQDÿH SULNDåH VH L petlja SURQDODåHQMDMH]DYUãHQD 3RþHWDN " Procedu ra 2.7 O pis algoritma i algoritamska shema (1) Unosimo elemente niza a(i) (2) i dobijamo vrijednosti od 1 do 7. (3) Ako je a(i) = 36. . YULMHGQRVW SRVWDMHMHGQDNDWUDåHQRPSRGDWNX 7UDåHQL SRGDWDN  MH SURQDÿHQ SRVOLMH  SRUHÿHQMD .

YUDüDPRVHQDSRþHWDNFLNOXVD. (5) Izlazimo iz ciklusa.7 " " a(i) = 36 71 " Ne " " 37" Kraj Ä3URQDÿHQ³ . (6) Ako nije. " a(i) i = 1.³3URQDÿHQ´MHSULND]DQRLRSHUDFLMDMH]DYUãHQD.

Dakle (1+.Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 2. %LQDUQRSUHWUDåLYDQMH Kada postoji mnogo podataka koML VH WUDåH VHULMVNR SUHWUDåLYDQMH QLMH HILNDVQR .DR posljedica toga koristi se ELQDUQRSUHWUDåLYDQMH XNRPHVHSULPMHQMXMHPHWRGDWUDåHQMDRGUHÿHQRJ SRGDWNDGLMHOHüLLQWHUYDOQDSROD =D ELQDUQR SUHWUDåLYDQMH podaci se moraju poredati od manjeg prema YHüHP LOL REUQXWR WM PRUDMXVHVRUWLUDWLXUDVWXüLLOLRSDGDMXüLQL] Primjer 6. 1. $OJRULWDPELQDUQRJSUHWUDåLYDQMD 3URQDÿLWHEURMXQL]X RGFLMHOLKEURMHYDLVWLKNDRXSULPMHUXELQDUQLPSUHWUDåLYDQMHP Procedura 1. Na taj naþin dobijate poziciju i vrijednost srednjeg þlana. .]UDþXQDMWHVUHGQML þODQLVPDQMLWHLQWHUYDOSUHWUDåLYDQMD (1)Saberite indeks prvog i posljednjeg þlana niza i podjelite sa brojem 2.

· SRGDWDNYULMHGQRVWHOHPHQWDD .

MH VUHGQMLþODQ (2) "QLMHWUDåHQDYULMHGQRVW3RãWRMHPDQMLRGEURMDSRVWRMLQDOLMHYRMSRORYLQL 2. 6DGDMHYULMHGQRVWD .

JRUQMDJUDQLFDLVXåHQMHLQWHUYDOSUHWUDåLYDQMD .

3RãWRWUDåHQLSRGDWDNSRVWRMLXOLMHYRMSRORYLQLSRQRYLt üHPRSRVWXSDN6DEHUite indeks prvog i WUHüHJþODQDQL]DLSRGMHOLWHVDEURMHP'DNOH +.

· SRGDWDN³YULMHGQRVWHOHPHQWDD .

 MHVUHGQMLþODQ .

Sada je vrijednost a(2) GRQMDJUDQLFDLVXåHQMHLQWHUYDOSUHWUDåLYDQMD .QLMHWUDåHQDYULMHGQRVW3RãWRMHYHüLRGEURMDSRVWRMLQDGHVQRMSRORYLQL 3.

3RãWRWUDåHQLSRGDWDNSRVWRMLQDGHVQRMSRORYLQLSRQRYLt üHPRSRVWXSDN6DEHULWHLQGHNVWUHüHJL WUHüHJ þODQD QL]D L SRGMHOLWH VD EURMHP  Dakle (3+.

·   L SRGDWDN  YULMHGQRVW HOHPHQWD   a .

MHGQDNMHWUDåHQRPSRGDWNX 7UDåHQLSRGDWDNMHSURQDÿHQSRVOLMHWULSRUHÿHQMD 72 .

a promjenljivoj j vrijednost 7 (2) Ponavljajte niz sljHGHüLKRSHUDFLMDVYHGRNMHi jednako ili manje od j (3) m = (i+M.7 " " a(i) i = 1.Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera Procedu ra 2.QGHNVVUHGQMHYULMHGQRVWL (1) Promjenljivoj i se dodjeljuje vrijednost 1.QGHNVGRQMHJUDQLFH M«. j = 7 idj Da m = (i+j) / 2 Da a(m) = 36 Ne Ne " a(m) ! 36 Da i=m+1 j=m-1 Ä3URQDÿHQ³ Kraj L«. 3RþHWDN " i = 1.QGHNVJRUQMHJUDQLFH P«. A lgoritam i dijagram toka.

· .

$NRMHD P.

WUDåHQDYULMHGQRVWMHSURQDÿHQD "Postojanje" je prikazano i opeUDFLMDMH]DYUãHQD .

$NRQLMHD P.

LVSLWXMHVHWDþQRVWVOjHGHüHJXvjeta: da li je a(m) !36 ako jeste promjenljivoj j dodjeljujemo vrijednost m-1 tj. j = m-1 (6) U suprotnom promjenljivoj i dodjeljujemo vrijednost m+1 tj. i = m+1 .

9UDüDPRVH na korak (2) .

.  þODQRYD LPDt üHWH VOjHGHüX VLWXDFLMX (1+8)y 'DNOHLQGHNVVUHGQMHJþODQDELt üH broj 4. npr. 73 . $NR LQGHNV VUHGQMHJ þODQD QL]D QLMH FLMHOL EURM RGVLMHFLWH GHFLPDOQL GLR EURMD L GRELMDWH FLMHOL EURM $NR LPDWH QL] VD SDUQLP EURMHP þODQRYD.

kada ih je mnogo.ar ray (niz) 1L]MHVWUXNWXUDSRGDWDNDNRMDPRåHGDVDGUåLYLãHRGMHGQHSURPMHQOMLYHLVWRJWLSD8RSüeno RYD PHWRGD VH NRULVWL ]D REUDGX YHOLNH NROLþLQH SRGDWDND LOL LãþLWDYDQMD YLãH RG MHGQRJ SRGDWND X serijama. a (2. nazovu istim imenom. Ideja je da se sve promjenljive. Npr. a PHÿXVREQRGDVHUD]OLNXMXSRPMHVWXXQL]XNRMHVHRGUHÿXMHLQGHNVRP Kod jednodimenzionalnog niza podaci se predstavljaju kao a (1).Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 6WUXNWXUDSRGDWDNDNRMDVHNRULVWL]DSUHWUDåLYDQMHLVRUWLUDQMH. a.

1). b . Dvodimenzionalni niz od 3 vrste i 2 kolone predstavlja se kao b (1. « a (n). gdje a R]QDþDYD LPH QL]D Q R]QDþDYD EURM HOHPHQDWD QL]D L    « QR]QDþDYDMX YULMHGQRVWL LQGHNVD niza. 2). b (1.

Primjer 7. (1) Za algoritam sortiranja. metoda unosa i brzog sortiranja. postoje i metoda izbora. 16. Na osnovu vrijednosti indeksa niza PRJXüHMHSURQDüLHOHPHQDWXQL]X2YDRVRELQDQL]DþLQL SURFHVSUHWUDåLYDQMDLVRUWLUDQMDHILNDVQLP 'YRGLPHQ]LRQDOQLQL]RGYUVWHîNRORQH 2) Sortiranje metodom razmjene 1DMþHãüHNRULãWHQDPHWRGDVRUWLUDQMDQL]RYDMH metoda razmjene. 3RVWDYLQDMYHüLSRGDWDN]DSRVOHGQMLþODQQL]D (1) a (1)>a (2) -> izmijenjeno (2) a (2)>a (3) -> izmijenjeno (3) a (3)>a (4) -> izmijenjeno . Metodom razmjene sortirajte ove podatke u UDVWXüLSRUHGDN Procedu ra 1 1.«b (3. 2). osim metode razmjene. U metodi razmjene porede VH VXVMHGQL HOHPHQWL QL]D L DNR VX QHSUDYLOQR XUHÿHQL UD]PMHQMXMX PMHVWD 3RVOLMH SRUHÿHQMD VYLK SDURYDVXVMHGQLKHOHPHQDWDQDMYHüLüHVHQDüLQDNUDMXQL]D3RVWXSDNVHSRQDYOMDGDELVHQDVYRMH PMHVWRGRYHRQDMYHüLHOHPHQWXpreostalom nesortiranom dijelu niza. A lgoritam metode razmjene Neka je dat niz od 4 cijela broja "24. 18". 17.

1DMYHüDYULMHGQRVWMHSRVWDYOMHQDXD .

74 .

DR ãWR MH SULND]DQR QD VOLFL GD ELVPR ]DPMHQLOL VRN RG QDUDQGåH $. 7UDåLWHWUHüLQDMYHüLSRGDWDN (1) a (1)<a (2) -> nema izmjene (2) a (2) je nepromjenjivo Sortiranje je zavrãHQR Razmjena podataka 5D]PLVOLPRRSURFHGXULUD]PMHQHSRGDWDNDQDRVQRYXSULPMHUDþDãDVRNDRGQDUDQGåHLVRND od jabuke. 7UDåLWHGUXJLSRUHGXQDMYHüLSRGDWDN (1) a (1)>a (2) -> izmijenjeno (2) a (2)<a (3) -> nema izmjene (3) a (3) je nepromjenjivo 3. 6OLND  SULND]XMH SURFHGXUX UD]PMHQH VRNRYD .Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 2.

 VD VRNRP RG MDEXNH %.

 SRWUHEQD MH WUHüD þDãD &.

Razmjena podataka 5D]PMHQDSRGDWDNDVPMHãWHQLKXSURPMHQOMLYHVHL]YRGLVOLþQRPSURFHGXURP2YDSURFHGXUD je predstavljena simbolima na sljHGHüLQDþLQ c=a a=b b=c Procedu ra 2. Slika 8. O pis algoritma i algoritamska shema Napisati algoritam za primjer 7. (1) i dobija vrijednosti od 3 do 1 (2) j dobija vrijednosti od 1 do i . 3URFHGXUD razmjene je u koracima (2) u (4).

$NRMHD M.

YHüHRGD M+1) a (j) se zamjenjuje s a (j+1) wk = a (j) a (j) = a (j+1) a (j+1) = wk .

3RQDYOMDQMHMVHRYGMH]DYUãDYD .

75 .3RQDYOMDQMHLVHRYGMH]DYUãDYD Zadaci za rad 6DVWDYLWLDOJRULWDP]DVRUWLUDQMHXRSDGDMXüLSRUHGDNQL]Dx koji ima n elemenata.

1 Nema zamjene Zamjena j=1. Napravite algoritamsku shemu na osnovu ovog primjera.Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 9MHåED]DNUDMGLMHOD 1. 76 . 4" VRUWLUDMX X UDVWXüL Soredak. Za cijele brojeve od 1 i 100. 3RþHWDN 3RþHWQLSRGDFL! Nema zamjene j=1.4 Nema zamjene Zamjena a(j) Nema zamjena Zamjena Zamjena i=3. Tabela prikazuje kako se podaci "2.       X SULPMHUX  3ULNDåLWH WUDåHQH SRGDWNH NRML VH PRJX GRELWL SRPRüX  SRUHÿHQMD 3. 1.4 a(j) Kraj Dijagram toka primjera procedura 2. 2EUD]ORåLWH DOJRULWDPELQDUQRJSUHWUDåLYDQMDNDGDMHWUDåHQLSRGDWDNNRULVWHüLSRdatke "11. 3.i Nema zamjene Ne Zamjena a(j) Sortiranje je ]DYUãHQR ! a(j+1) Da wk =a(j) a(j) = a(j+1) a(j+1) = wk j = 1. 5. sastaviti algoritamsku shemu sljHGHüLKSURFHVD (1) Sumu od 1 do 100 (2) Sumu neparnih brojeva (3) Sumu brojeva koji nisu djeljivi sa 7 2.

1. 1D RYDM QDþLQ XSUDYOMDQMH SURL]YRGRP SRPRüX NRGD RODNãDYDSUHWUDåLYDQMHLþLWDþEDU-NRGDãWHGLWrud unosa u kompjuter. Svaki proizvod ima svoj kod proizvoda koji se zove bar-NRG3UHYODþHQMHPSURL]YRGDSUHNRþLWDþDEDU-koda kasirki se na ekranu pojavljuje naziv artikla i njegova cijena. Kakva je bila usluga osoblja prodavnice? 'REUD0DQMHGREUD1RUPDOQD%ODJRORãD/RãD Ŷ3ULPMHUUH]XOWDWDRGJRYRUDNRMLQLMHGLJLWDOL]RYDQ Upitnik 0ROLP 9DV GD ]DRNUXåLWH MHGDQ RG SRQXÿHQLK odgovora Q1.Normalna %ODJRORãD  /RãD Ŷ3ULPMHUGLJLWDOL]RYDQRJUH]XOWDWDRGJRYRUD 2. Kakva je bila usluga osoblja prodavnice? 1. Bar-kod 77 . Npr. Savjeti za obradu informacija 1DXþLOL VPR R PHWRGDPD REUDGH LQIRUPDFLMD NRULãWenjem kompjutera itd.Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera Odlomak 2. Savjeti za kodi ranje Podsjetimo se situacije kada kupujemo proizvod u prodavnici. 6DYMHWLSULNRULãWHQMXGLJLWDOL]DFLMH Analizirajmo situaciju popunjavanja upitnika. Slika 1..Dobra 2. 1DSRPHQH]DREUDGXLQIRUPDFLMDNRULãtenjem kompjutera 1) Primjer savjeta za predstavljanje informacija 1. Ljudi se trude na razne QDþLQH kako bi obradilLLQIRUPDFLMHNRULVWHüLkompjuter.Manje dobra 3. popunjavamo upitnik koji ima pet PRJXüLKRGJRYRUD Upitnik 0ROLP 9DV GD ]DRNUXåLWH MHGDQ RG SRQXÿHQLK odgovora Q1.

programa za rad sa radnim tabelama i prograPD]DQRYRJRGLãQMHþHVWLWNHLWGWDNRGDMHPRJXüH smanjiti posao unosa adresa.Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 3RãWDQVNLNRGMHMHGDQRGUHSUH]HQWDWLYQLKSULPMHUDNRGLUDQMD3RãWDQVNLNRGMH NRULVWDQ ]D VRUWLUDQMH SRãWDQVNLK DUWLNDOD D X]WR DGUHVD VH DXWRPDWVNL SULNDåH DNRXQHVHWHSRãWDQVNLNRG u program za obradu teksta worda. .

326 3RLQW2I6DOHV.

se.. . provode na osnovu unesenih podataka. WDNRÿHr.VLVWHP8SUDYOMDQMHVWDQMHPNROLþLQHSURL]YRGDLprocesa kretanja prodaje itd.

kod zaposlenih.1DLVWLQDþLQVHNRULVWLVUHGQMRãNROVNLNRG. potrajaWüH DNRMHNROLþLQDSRGDWDND NRMD VH REUDÿXMH YHOLND =D SULPMHU L] SUYRJ GLMHOD NDGD MH SRGDWDN NRML VH WUDåL ELR  GR UMHãHQMDVHGRãORSRVOLMHWULSRUHÿHQMDLVHULMVNRJLELQDUQRJSUHWUDåLYDQMD0HÿXWLPNDGDMHSRGDWDN NRMLVHWUDåLGRUMHãHQMDVHGROD]LSRPRüXSRUHÿHQMDELQDUQLPSUHWUDåLYDQMHPDSRUHÿHQMD ]D VHULMVNR SUHWUDåLYDQMH 3RWUHEQR MH QDüL UMHãHQMH NDNR EL VH VPDQMLR EURM SRUHÿHQMD ]D ELQDUQR SUHWUDåLYDQMH 2. Savjeti za procedu ru 5D]PRWULPR VOXþDM FUWDQMD JUDILþNRJ REOLND E. 2) Primjer savjeta za proces obrade 1. Savjet za algoritam 6HULMVNRSUHWUDåLYDQMHNRMHVPRQDXþLOLXGLMHOXMH PHWRGSUHWUDåLYDQMD podataka od prvog jedan po jedan. Ponavljanje istog procesa je lako za kompjuterPHÿXWLP. studenata itd.

 NRPELQiUDMXüL 5 dijelova prikazanih na slici  D.

 $NR QDFUWDWH JUDILþNL REOLN L VDþXYDWH JD SRG LPHQRP DXWR PRJXüH MH SRYHüDQL JUDILþNL oblik (c.

PRåHRODNãDWLSURFHVLSREROMãDWLHILNDVQRVW (a) Dijelovi E. memorisanje rezultata procesa i procesa obrade itd.LVDþXYDWLJDSRGLVWLPLPHQRPDXWR .DRãWRMHRSLVDQRNDGDprovodite isti proces.

*UDILþNL oblik "auto" F.

5HJLVWURYDQMHJUDILþNRJREOLND .8YHüDQMH JUDILþNRJREOLND Slika 2.

3URQDÿLWHEURMNRULVWHüLPHWRGXELQDUQRJLVHULMVNRJSUHWUDåLYDQMD 78 . 17. 19. 13. 5. 29. 31. Zadata k 1HNDMHGDWQL]SURVWLKEURMHYDPDQMLKRGXUDVWXüHP poretku 2. 7. 6D XUHÿLYDQMHP L IRUPDWLUDQMHP WHNVWD L SURJUDPRP NRML SRGUåDYD JUDILNX DNR VX QDFUWDQL JUDILþNL REOLFL JUXSLVDQL NDR MHGDQ JUDILþNL REOLN PRJXüH MH ODNR SURYHVWL XYHüDQMHVPDQMHQMH rotaciju itd. 11. 3. 23.

Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 2. 1 sat (1:00:00). Vrijeme je prikazano u zapisu 24 sata. Npr. 3RUXNDXSR]RUHQMD]DJUHãNXSULXQRVX 3 6DYMHW]DRODNãDYDQMHSUHJOHGQRVWL 2ODNãDYDQMHSUHJOHGQRVWL MH PRJXüHRGYDMDQMHP GLMHODVWUDnice za unos podataka i rezultata. Savjeti za proces NRULãtenja programa za rad sa radnim tabelama 1DYHGLPRSULPMHUHVDYMHWD]DHILNDVQLMHL]YRÿHQMH SURFHVDNRULVWHüLSURJUDP]DUDGVDUDGQLP tabelama 1)Primjer savjeta za metod predstavljanja informacija 1. prva vrijednost VHWXPDþLNDRMDQuar 2007. Slika 3. odnosno vrijednosti 1/24. JDGUXJDNDRVDWDPLQXWDLVHNXQGL1DRYDMQDþLQODNRMH L]YUãLWLL]UDþXQDYDQMHGDWXPDLYUHPHQD (1) Datum (godina. 6DYMHW]DVPDQMLYDQMHJUHãDND 'D EL VH VPDQMLOH JUHãNH SUL XQRVX SRWUHEQR MH SRVWDYLWL RGUHÿHQD RJUDQLþHQMD QSU. 6DYMHWL]DRODNãDYDQMHSURFHVD Ako u program za rad sa radnim tabelama unesete "2007/1/1" ili "2:17:16".. NRULãtHQMHPERMH]DFUWHLRNYLUHüHOLMHLGUXJR . fRUPDWLUDMWH üHOLMH ]D XQRV RGUHÿHQH YUVWH SRGDWDND LWG Ako QDSUDYLWH JUHãNX SUL XQRVX RGUHÿHQH IRUPXOH IXQNFLMH LOL SRGDWND GRELt üHWH poruku upozorenja. 2. mjesec i dan) je sekvencijalni broj (serijska vrijednost) zasnovan na standardnoj vrijednosti datuma.

 5DGQD WDEHOD VDVWRML VH L] UHGRYD R]QDþHQLK EURMHYLPD L NRORQD NRMH VX R]QDþHQH VORYLPD Presjek jedne kRORQHLMHGQRJUHGDþLQLHOHPHQWWDEHOHNRMLVHQD]LYDüHOLMD. Primjer savjeta za metodu prikaza informacija 79 . 4 6DYMHW]DODNãXXSRWUHEX 2GYDMDQMHSUR]RUD]DXQRVSRGDWDNDLSULND]UH]XOWDWDNRULVWHüLSUR]RUIXQNFLMH RGYDMDQMD je LVWRWDNRMHGDQRGVDYMHWD]DODNãXXSRWUHEX Slika 4.

Ponekad je proces obrade podataka bolje uraditi VDPR QD MHGQRP OLVWX VKHHW.Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 2) Primjeri savjeta za proceduru obrade 1.

" Promjenom vrijednosti VDGUåDMD üHOLMH % PLMHQMDMX se i" YULMHGQRVWL VDGUåDMD üHOLMD'L'. QHJR QD YLãH njih. Ukoliko sa istiP SRGDFLPD åHOLPR XUDGLWL QHNH QRYH SURUDþXQH.DGD NRSLUDWH IRUPXOX L]UDþXQDYDQMD QHRSKRGQR MH REUDWLWL SDåQMX QD SR]LFLMHüHOLMD 80 . 3) 6DYMHW]DSREROMãDQMHRSHUDWLYQHHILNDVQRVWL .DGD XQHVHWH SRGDWNH X üHOLMH NRSLUDMWH IRUPXOX L]UDþXQDYDQMD NDNR ELVWH SREROMãDOL RSHUDWLYQX HILNDVQRVW . potrebno je samo izmijeniti formule i dobit üHPRQRYHUH]XOWDWH 2. 8NROLNR RGUHÿHQH SRGDWNH X WDEHOL SRYH]XMHWH IRUPXODPD IRUPXOX ]DGDMWH NRULVWHüL DGUHVH üHOLMDD QHVDGUåDMHüHOLMD(IHNW MHVOMHGHüL L]PMHQRP ELORNRJSRGDWNDXüHOLMDPD QDGNRMLPD MH napravljena formula izmijenit üHVHLNUDMQMLUH]XOWDWIRUPXOHL]UDþXQDYDQMD .]UDþXQDWD MH VXPD RSVHJD üHOLMD RG % GR % L DULWPHWLþND" sredina" NRULãWHQMHPüHOLMH'. Npr.. nHND VX SRGDFL NRML VH REUDÿXMX L IRUPXOH NRMH üHPR NRULVWLWL ]D QMLKRYX REUDGX QD jednom listu.

rang-lista za prve. koristite grafikone. Posmatranjem grafikona jednostavnije analizirate dobijene rezultate. Tabela 1. Uslovi WDNPLþHQMD  Razred / broj odjeljenja äLUL Nagrade Rezultati Grafikon 3RRGMHOMHQMDSUYRJGUXJRJLWUHüHJUD]UHGD (ukupno 15 odjeljenja) þODQRYDåLULMD 1. 3. Broj 0 2 4 6 10 18 20 22 . napravite rang-OLVWX L JUDILNRQ NRULVWHüL program za rad sa radnim tabelama. 7DNPLþHQMHKRURYD Na osnovu zadatih uvjeta L UH]XOWDWD WDNPLþHQMD horova.ROLþLQD 10000 11600 13456 15609 21560 38030 44114 51173 Grafikon vrijednosti 60000 50000 40000 Broj 30000 . mjesto. 2. druge i WUHüHUD]UHGHXNXSDQSRUHGDNLUD]UHG-SREMHGQLNWDNPLþHQMD 1DSUDYLWH JUDILNRQ VD UH]XOWDWLPD ERGRYDQMD VYLK  þODQRYD åLULMD 81 . mjesto Ukupan rezultat svakog odjeljenja. mjesto.Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 4) Savjet za kreiranje grafikona Da biste vizuelno predstavili informacije.ROLþLQD 20000 10000 0 1 2 3 4 5 6 7 8 Primjer 1.

RULãtenje komande Data/Sort sorti ranja podataka (1) Unesite broj bodoYD]DVYDNRRGMHOMHQMHRGVYDNRJþODQDåLULMDSRMHGLQDþQR . Rezultati bodovanja Za poredak razmotrite dvije metode: PHWRGXNRULãWHQMDNRPDQGHVRUWLUDQMD'DWD6RUWSURJUDPD]D UDGVDUDGQLPWDEHODPDLPHWRGNRULãWHQMDIXQNFLMH5DQN Procedu ra 1. .Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera Slika 5.

8NRORQL*  L]UDþXQDMWHXNXSDQEURMERGRYD]DVYDNRRGMHOMHQMHLRGYRMLWHUD]UHGHERMDPD .

drugi LWUHüLUD]UHG " " Unesite Selektovano i sortirano za svaki razred poredak razreda . 'D ELVWH GRãOL GR SRUHWND UD]UHGD VRUWLUDMWH SRGDWNH X RSDGDMXüL UHGRVOijed posebno za prvi.

'DELVWHGRãOLGRUDQJOLVWHVRUWLUDMWHFLMHOXWDEHOXXRSDGDMXüHPUHGRVOijedu. 82 .

.Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera Sortirano u RSDGDMXüLSRUHGDN 2SüLSRUHGDN Napomena . Procedu ra 2. R A N K funkcija 2YRPIXQNFLMRPRGUHÿXMHVHSRUHGDN3RUHGDN]DUD]UHGHVHRGUHÿXMHXH koloni.RULãWHQMH5$1.83IXQNFLMH 1. Format R A N K funkcije 5$1.DGDNRULVWLWHNRPDQGXVRUWLUDQMDSRGDWDNDYRGLWHUDþXQDRPDUNLUDQMXSRGDWDNDQDGNRMLPDYUãLWH sortiranje. a opüi poredak u I koloni na osnovu ukupnog broja bodova smjeãtenih u G koloni. QXPEHUUHIRUGHU.IXQNFLMHL9/22.

  5$1. EURMRSVHJüHOLMDUHGRVOijed) Number.DGUHVDüHOLMHNRMRMVHRGUHÿXMHUDQJ 2SVHJüHOLMD.DNRMHRSDGDMXüLUHGRVOijHGUDVWXüLUHGRVOijed ûHOLMD +.opseg u kome se provjerava poredak Redoslijed.

Ä 5$1. ***.

³     ûHOLMD ..

***.Ä 5$1.

³          83 .

NRORQD. Za opüL poredak i pobjednika razreda SULND]XMHVH LPHRGMHOMHQMDRGJRYDUDMXüHJSRUHWNDX0NRORQL1SU ]DRGUHÿLYanje pobjednika svih odjeljenja "1" se WUDåLL]NRORQHRSüHJSRUHWND .Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 2 V L O O K UP funkcija 2YR MH IXQNFLMD NRMD NDR UH]XOWDW GDMH SRGDWDN NRML LVSXQMDYD RGUHÿHQH Xvjete.

DVDGUåDM NRORQHRGMHOMHQMD -NRORQD.

VHSULND]XMHNDRUH]XOWDWXüHOLML 0.

 Format VLOOKUP funkcije VLOOKUP(lookup_value.DNRMHijWUDåHVHSRGDFLNRMLRGJRYDUDMXWUDåHQRMYULMHGQRVWLijDNRVHWUDåHQDYULMHGQRVWQHSURQDÿH WUDåLVHQDMYHüDYULMHGQRVWNRMDMHPDQMDRGWUDåHQH ûHOLMD 0.YULMHGQRVWNRMDVHWUDåLXOLMHYRMNRORQLXRNYLUXRSVHJDüHOLMD Table_array.search_type) Lookup_value.RSVHJüHOLMDXNRPHVHWUDåLYULMHGQRVW Col_index_num.EURMNRORQHL]NRMHVHGRELMDWUDåHQDYULMHGQRVW Search_type.table_array.col_index_num.

83 +-.Ä 9/22.

³                  ûHOLMD 0.

-.Ä 9/22.83 .

Pravljenje grafi kona 2GUHGLWHRSVHJSRGDWDNDNRMHåHOLWHGDSULNDåHWHJUDILNRQRP Rezultat glasanja Ukupan rezultat 120 100 þODQ 80 þODQ 60 þODQ 40 þODQ þODQ 20 0 1-1 1-2 1-3 1-4 1-5 2-1 2-2 2-3 2-4 2-5 3-1 3-2 3-3 3-4 3-5 Odjeljenje 84 .³ 3.

U datoj tabeli su SRGDFLVYDNH]RQHVUHGQMRãNROVNHãWDIHWQHWUNH6DEHULWHSULNXSOMHQHSRGDWNH SR]RQDPD]DVYDNXãNROXLQDSUDYLWHWDEHOXLJUDILNRQNDNRELVWHYLGMHOLSRUHGDNSULNDåLWHLPHQD ãNRODSREMHGQLNDGUXJLKLWUHüLKPMHVWD .PHVUHGQMHãNROe Zona 1 Zona 2 Zona 3 Zona 4 Zona 5 Zona 6 6UHGQMDãNROD$ 6UHGQMDãNRODO% 6UHGQMDãNROD& 6UHGQMDãNROD' 6UHGQMDãNROD( 6UHGQMDãNROD) 0:27:51 0:27:16 0:27:26 0:28:32 0:27:23 0:28:33 0:21:49 0:21:35 0:22:12 0:21:14 0:21:03 0:21:10 0:13:04 0:13:37 0:12:55 0:12:46 0:12:48 0:13:07 0:26:28 0:25:13 0:25:44 0:24:08 0:24:44 0:25:48 0:13:07 0:13:22 0:12:56 0:13:24 0:12:57 0:13:32 0:30:22 0:29:24 0:28:46 0:29:57 0:29:03 0:32:07 85 .Poglavlje 32EUDGDLQIRUPDFLMDNRULãWHQMHPkompjutera 9MHåED 1.

Modeliranje/Kreiranje koncepta 1) âWDMHPRGHOLUDQMH" Dok smo odrastali.Poglavlje 4.DNRULMHãLWLSUREOHP 8RYRPSRJODYOMXXþLt üHPRRPHWRGDPDPRGHOLUDQMDLVLPXODFLMDPDNUR]SULPMHUH L]GUXãWYDLQDãH RNROLQHNRMH  PRåHPRNRULVWLWL]DUMHãDYDQMHDNWXHOQLKSUREOHPD. . igrali smo se LJUDþNDPD OXWNDPDDXWLüLPD LGU. Modeliranje i simulacija Poglavlje 4. Modeliranje i simulacija Dio 1. 1.

Dobro auto je auto sa manje YD]GXãQRJ otpora Otpor zraka raste sa kvadratom brzine Modelirajte auto sa PDQMH YD]GXãQRJ otpora i razradite dizajn ! Problem Modeliranje Smanjite visinu SRNXãDMWH ponovno i ..-./0a 5MHãHQMH Razvojem kompjuterD PRGHOLUDQMH MH SRVWDOD YDåQD QDXþQD PHWRGD UMHãDYDQMD PQRJLK SUREOHPD X GUXãWYX NDR ãWR VX ÄUD]YRM QRYRJ YR]LOD³ ÄSRNUHWDQMH SUREQRJ YR]LOD³ YUHPHQVND SURJQR]D SUHGYLÿDQMH HNRQRPVNRJ UD]YRMD SRPRüX QRYLK VWUDWHJLMD SUHGYLÿDQMD ãWHWH SURX]URNRYDQH ]HPOMRWUHVRP L SODQLUDQMH VSUHþDYDQMD NDWDVWURID Da bismo shvatili problem i SURQDãOLUMHãHQMHSRWUHEQRMHGDNRULVWLPRPHWRGPRGHOLUDQMD .JUDþNHVXQDSUDYOMHQH na osnovu osobina i oblika iz UHDOQRJVYLMHWD1DRYDMQDþLQ "predmet napravljen na osnovu" realnih predmeta zove se model(1) ili maketa. a postupak pravljenja modela zove se modeli ranje.RULãWHQMH>)*+.

2) Procedura modeliranja Procedura modeliranja realizuje se kroz 3 koraka: >@8SUYRPNRUDNXREUD]ORåLWHVYUKXPRGHOLUDQMD. 2EUD]ORåLWH]DãWDSUDYLWHPRGHONDNYHRVRELQHåHOLWHGDLPDLNDNYDVXSUHGYLÿDQMa. Jedinica p rodaje WUHQXWQDMHGLQLFDSURGDMHNROLþLQDSURPMHQH # 3ULPMHUPMHUQRJPRGHOD       3ULPMHUPRGHODIRUPXOH         3ULPMHUJUDILþNRJ !modela! ! Razumijevanje i po]QDYDQMH SUDYLOD L QDþHOD PHÿX HOHPHQWLPD Postoji: dijagram toka programa. RUJDQL]DFLMVNLJUDILNRQNRPSDQLMHLPUHåQLGLMDJUDPSXWDLåHOMH]QLFHLWG 86 .(1) >@8WUHüHPNRUDNXSUHGVWDYLWHPRGHOSRPRüXPDWHPDWLþNRJL]UD]D Postoje: mjerni model koji predstavlja realan predmet u smanjenom obliku. [2] U drugom koraku odredite strukturu modela 3URQDÿLWH RVQRYQH HOHPHQWH NRML SUHGVWDYOMDMX RVRELQH PRGHOD L REUD]ORåLWH YH]X L]PHÿX elemenata. model PDWHPDWLþNRJ L]UD]D NRML PDWHPDWLþNL SUHGVWDYOMD VWDWXV SUHGPHWD L JUDILþNL PRGHO (2) koji je struktura pretvorena u dijagram koji prikazuje komponente cilja i njihovu samu povezanost itd. 0RGHO MH SUH]HQWDFLMD VLVWHPD QDMþHãüH X LGHDOL]RYDQRP REOLNX 6OLND X YDãRM JODYL MH MHGQD vrsta modela.

4) Klasifikacija modela 8]DYLVQRVWLRGQDþLQDSUHGVWDYOMDQMDREMHNWDSRVWRMHLUD]OLþLWHYUVWHPRGHOa (Slika 1). Klasifikacija modela (3) Primjer izgradnje vodovoda Zadatak.RQDþDQPRGHO Klasifikacija po osobinama predmeta 'LQDPLþNLPRGHO 6WDWLþNLPRGHO 0RGHO YMHURYDWQRüH model Slika 1. Izbor st ruktu re 3UHWSRVWDYLPR GD MH EURM XþHVQLND QD ãNROVNRM SULUHGEL  OMXGL NDR L VYDNH JRGLQH PoVWDYLPRWURãNRYHL]UDGHQDMHQD]DOXWNXLSURYHGLWHPRGHOLUDQMHQDVOjHGHüLQDþLQ dobit po 1 lutki = cijena ± WURãNRYLL]UDGH 87 . koji XNOMXþXMHIHQRPHQQHSUDYLOQRVWLLNRQDþDQPRGHO NRMLQHXNOMXþXMHfenomen nepravilnosti. A naliza p roblema =D PRGHOLUDQMH MH YDåQRGDREUD]ORåLPR VYUKXSUDYOMHQMD PRGHOD0RJXüHVYUKH EL ELOHQH pravite mrtve zalihe". Mjerni model Klasifikacija prema QDþLQXSUHGVWDYOMDQMD Model formule GrafLþNLPRGel . Kod GLQDPLþNRJ PRGHOD rezultati se mijenjaju u zavisnosti od toka vremena. "bez velikih gubitaka". Kako biste kategorizovali modele prema osobinama predmeta dDPRGHOLUDWHVOMHGHüHIHQRPHQH: (1) Red na elektronskoj kasi u supermarketu? (2) Promjena temperature vode u vruüoj kupki? (3) Upravljanje zalihama kako biste SRYHüDOLSURGDMX? 5) Modeliranje 1DSUDYLPRPRGHONRULVWHüLSURFHGXUXPRGHOLUDQMD 9MHåED 3URGDMDSDSLUQHOXWNHQDãNROVNRMSULUHGEL Planiramo da napravimo "papirnu OXWNX L GD MH SURGDMHPR QD ãNROVNRM SULUHGEL Analizirajmo u NRPRGQRVXüHELWLFLMHQDLNROLþLQDNRMDüHVHQDSUDYLWL Procedu ra 1. U RYRP VOXþDMX  provedimo modeliranje sa VYUKRPSRYHüDYDQMDSURILWDNROLNRMHJRGPRJXüH Procedu ra 2.Poglavlje 4. Modeliranje i simulacija 3) Svrha modeliranja 3RPRüXPRGHOLUDQMDYUãHVHDQDOL]HNDUDNWHULVWLNDSRQDãDQMDVXEMHNWDNUR]SURmjene uvjeta u kojima se subjekW QDOD]L GD EL VH NUHLUDOL VORåHQL VLVWHPL L LPSOHPHQWLUDOL X VWUDWHJLMX NRPSDQLMH ekonomsku politiku i drugo. a kod VWDWLþNRJ modela(3) WRN YUHPHQD VH QH UD]PDWUD 'LQDPLþNL PRGHO VH GLMHOL QD model YMHURYDWQRüH. itd.

Modeliranje i simulacija Cijena Dobit po 1 jedinici 7URãNRYLL]UDGH .Poglavlje 4.

%UXWRGRELW GRELWSROXWNLîNROLþLQDNRMDüHVHSURGDWL Dobit po 1 jedinici Ukupna dobit .ROLþLQDNRMDüHVHSURGDWL .

ROLþLQDNRMDüHVHSURGDWL\# Dobit po 1 jedinici " 7URãNRYLL]UDGH 100 jena/jedinici Ukupna dobit p 6OLND2Süa struktura modela âWD SUHGVWDYOMD" strelica na" slici ?" Kada postoji bilo kakva veza L]PHÿX GYD HOHPHQWD elementi su povezani i kada åHOLWH SUHGVWDYLWL ]DYLVQRVW uzroka i rezultata. kupaca .ROLþLQDNRMDüHVHSURGDWL (4) Proporcija broja kupaca zavisi od cijene lutke Proporcija Cijena Model je konfigurisan s 4 elementa: "cijena x". "kROLþLQD NRMD üH VH Srodati y". postavite strelicu. "proporcija r". EUXWRGRELWS2Süa struktura modela (Slika 2).ROLþLQDNRMDüHVHSURGDWL EURMXþHVQLNDîSURSRUFLMDEURMDNXSDFD %URMXþHVQLND # Proporcija br. 2<.. Cijena x Proporcija r %URMXþHVQLND 1000 ljudi # ./97" 2YDNR MH R]QDþHQR NDGD "proporcija" zavisi od ³FLMHQH Proporcija 88 .

(1) Ako je cijena x jednaka 100 jena (100 jena oko 1. polovina XþHVQLND üH NXSLWL OXWNX U .25 km). .Poglavlje 4. Modeliranje i simulacija Proporcija Procedu ra 3.UHLUDQMHPDWHPDWLþNRJPRGHOD Napravimo YH]X L]PHÿX FLMHQH L SURSRUFLMH SRPRüX PDWHPDWLþNRJ izraza.

 D DNR MH FLMHQD x jednaka 600 jena. niko QHüH NXSLWL OXWNX U .

6 "#$%&'!($%&)! .001x + 0. 6DGD SRVPDWUDMPR YH]X L]PHÿX SURSRUFLMH L FLMHQH NDRãWRMHSULND]DQRQDVOLFL9H]DMHL]UDåHQDQDVOMHGHüLQDþLQ r = -0.

 .ROLþLQD NRMD üH VH SURGDWL y SUHGVWDYOMHQD MH EURMHP XþHVQLND L Slika 3. C ijena i proporcija proporcijom r na sljHGHüLQDþLQ\ U Proporcija .

6"# # A)'B.6"# ?)*&# *>".DGD MH XNOMXþHQRPQRJRHOHPHQDWDmodel postaje sloåen i velik.6) p=y(x-100) Vrijednosti za x.001x+0.'9"6"# NRMLüHVH %1("7%6%# " E*B'$%)"-&'# E*B'$# A)'B.-%@# %-.001x+0.F$"7%&"# # A)*G-*1"# . napravljeni model varira za svaku osobu i rezultati VLPXODFLMHVXUD]OLþLWL Zbog WRJD MH YDåQR ]QDWL GD PRGHO QLMH XYLMHN WDþDQ 3RWUHEQR MH prostudirati pretpostavke za dovoljan broj modela i provjeriti da li su NRULãWHQLSRGDFLWDþQL ?)*&#*>". bruto dobit p VHL]UDþXQDYDPQRåHQMHPNROLþLQHNRMDüHVHSURGDWLy i RYRPYULMHGQRãüXLSUHGVWDYOMHQDMHNDRS \ [-100). 3RãWR VH PRGHOLUDQMH L]YRGL SRG SUHWSRVWDYNRP ]DVQRYDQRP QD znanju i iskustvu.'6# 865")-*# SRQDãDQMH# # # A*BFB")"-& '# >@. >@=DLVWLSUHGPHWPRåHWHQDSUDYLWHYLãHUD]OLþLWLKPRGHOD. 3RãWR MH GRELW SR  OXWNL SUHGVWDYOMHQD FLMHQRP x L WURãNRYLPD L]UDGH (x-100).-%@# %-.6 y=1000r p=y(x-100) Vrijednosti za x. (4) Interval vrijednosti za x bi trebao biti 100 d x d 600 tako da cijena ne bude PDQMDRGWURãNRYD 0DWHPDWLþNRSUHGVWDYOjanje od (1) do (4) r=-0.'9"6"# 8%. 100 d x d 600 "#$%&'!($%&)! 3RYHüDQD ()1%-"# # # # 86*>"# )".'6# 3RYHüDQD ()1%-"# # # 6) 0MHUHSUHGRVWURåQRVWLSULOLNRPPRGHOLUDQMD 89 # 86*>"# )". pa modeliranje i simulacija postaju teãki.ROLNRWDþQREismo VHWUHEDOLSULODJRÿDYDWLVWYDUQRMVLWXDFLML" =D PRGHOLUDQMH QLMH QHRSKRGQR XNOMXþLWL VYH HOHPHQWH VWYDUQRVWL  (OHPHQWL VH XNLGDMX ]DYLVQR RG WRJD ]D ãWD NRULVWLPR PRGHO . 100 d x d 600 8NUDüHP]DSLVX y=1000(-0.'9"6"# # # # # ?)C*&# D-.

Simulacija 1) âWDMHVLPXODFLMD" =DEXGXüLSODQUMHãDYDQMDHNRQRPVNLKSUREOHPD ]HPOMe ili regije.]YHGLWHHNVSHULPHQWNRULVWHüLPRGHO.3URVWXGLUDMWHNUHüHOLVHPRGHOQHUHDOQR. prilagodite strukturu modela i pa rameta ra (2).Poglavlje 4. .Posmatrajte model SRGUD]OLþLWLPuvjetima i sakupite podatke. eksperiment je izveden i napravljena je studija. dizajna HOHNWUDQH DHURGURPD QDSUDYOMHQ MH PDWHPDWLþki model ili mjerni model. .Uporedite rezultat eksperimenta i stvarne podatke.3URQDÿLWHQDMEROMHUMHãHQMH]DUD]OLþLWHSODQRYH. . . (1) Procedu ra simulacije: >@. problema okoline. [2] Pregled provjere da li je proces pravilan.6DNXSLWHSRWUHEQHSRGDWNH]DSURJQR]XLRGOXþLYDQMH. Ovo se zove simulacija. . [3] Upotreba modela . Modeliranje i simulacija 2.Ako postoji problem. .

6LPXODFLMDMHWHKQLNDNRQVWUXLVDQMDLL]YRÿHQMDPRGHODUHDOQRJVLVWHPDXQDPMHULGDVHDQDOL]LUD SRQDãDQMH WRJ VLVWHPD EH] RPHWDQMD L] QMHJRYRJ RNUXåHQMD 3URWLYSRåDUQD REXND MH SULPMHU simulacije koja koristi stvarne predmete. .

Zaradit üHWHDNRMHFLMHQDLOL MHQD. 300. 400. Procedu ra 1.DGDQDSUDYLWHJUDILNRQQDRVQRYXUH]XOWDWDPRåHWHYLGMHWLNDNRVHGRELWPLMHQMDX]DYLVQRVWLRG cijene (Slika 4). dodjeljujte vrijednosti promjenljivoj x redom 100.]UDþXQDMPRGRELW]DFLMHQXRGMHQD (3) (3) Dobit je 62. 2. 3.]UDþXQDMWHGRELW]DUD]OLþLWHFLMHQH 3RãWRMHFLMHQD x iz intervala od 100 d x d 600. 200. 500 i 600 jena.2YRMHNRQVWDQWQDYULMHGQRVWNRMDVHNRULVWL]DPDWHPDWLþNLPRGHO 2) Simulacija Izvedite simulaciju: 9MHåEa 2. PrRQDÿLWHFLMHQXNRMDGRQRVLQDMYHüXGRELW Kada je cijena 100 jena ili 600 jena. . Napravite grafikon za dobijene rezultate .500 jena i to je maksimalna dobit. Simulacija prodaje papirnih lutaka 6LPXOLUDMWH GRELW RG SURGDMH SDSLUQLK OXWDND NRMH üH VH SURGDWL NRULVWHüL PRGHO QDSUDYOMHQ X primjeru 1. nema dobiti. 90 . 1.

Poglavlje 4. Pregled i provjera isp ravnosti modela 9H]DL]PHÿXFLMHQHLSURSRUFLMHSULPRGHOLUDQMXMHYDåDQGLRNRMLRGUHÿXMHVWUXNWXUXRYHYH]H Prostudirajmo da li je rezultat eksperimenta L]UDþXQDYDQMH. Modeliranje i simulacija Proporcija Model napravljen u primjeru 1.6) p=y(x-100) 100 d x d 600 Slika 4.001x+0. Cijena i profit "#$%&'!($%&)! Procedu ra 2. y=1000(-0.

%URMXþHVQLNDüH]DYLVLWL od vremena.%& -! Ako napravimo manji broj lutaka QHNL OMXGL PRåGD QHüH PRüL NXSLWL OXWNX D DNo QDSUDYLPR SUHYLãH OXWDND PRåHmo ]DYUãLWL sa deficitom.6) =-x+600 Napravimo mnogo lutaka da nam se ne bi rasprodale. 3URJQR]DLRGOXþLYDQMH 2GOXþLWH NROLNR OXWDND üHWH QDSUDYLWL L NROLNR üH NRãWDWL MHGQD OXWND $NR MH EURM XþHVQLND 1.VWYDUDQLGDOLMHSDUDPHWDUGREDU /RJLþQR MH GD QHPD dobiti kada je cijena 100 jena. 3RWUHEQDMHVLPXODFLMDXVOXþDMXNLãHC# # Ako je cijena 600 jena.DGD MH EURM XþHVQLND  NROLNR lutaka treba napraviti da ne bismo imali neprodatih lutaka? Papirne lutke Molim! ! Papi rnate lutke "#$%! *'+. tako da je potrebno napraviti 250 lutaka. jer je to cijena izrade. y=1000(-0.001x+0.-. GRELW üH ELWL PDNVLPDOQD DNR MH FLMHQD MHGQH OXWNH  MHQD 8RYRP VOXþDMX  OMXGL üH kupiti lutku (1). nema dobiti MHU QLNR QHüH kupiti lutku. SUHWSRVWDYOMDMXüL GD üH EURM XþHVQLNDELWL .(2) Matematiþko izraåavanje modela sa Slike 4. Procedu ra 3. =-350+600 =250 91 &'(()! (*+.! Rasp roda to .

Uporedite i prostudirajte rezultat simulacije sa VWYDUQLP SRGDFLPD $NR QLVX WDþQL X UHDOQRM VLWXDFLML LVSUDYLWH PRGHO =D SUHGYLÿDQMH EXGXüH RULMHQWDFLMH UD]YRMD NDR ãWR MH UHJLRQDOQL HNRQRPVNL SODQ SURYMHULWH GD OL VX YDåQL HOHPHQWL XNOMXþHQL X PRGHO L GD OL VX QDSUDYOMHQHGREUHUHODFLMHL]PHÿXHOHPHQDWD Teorija Eksperiment " KompjuterVND VLPXODFLMD MH WUHüD QDXþQD PHWRGD SRVOLMH WHRULMH L eksperimenta. Modeliranje i simulacija (2) =DVLPXODFLMXMHYDåQRSURYHVWLSURJQR]XLGRQLMHWLGREUXRGOXNX.]YHGLWH VLPXODFLMX NDGD MH EURM XþHVQLND  LOL  X SULPMHUX  L RGUHGLWH NROLþLQX L FLMHQX OXWNH NRMD üH VH QDSUDYLWLXVYDNRPSRMHGLQDþQRPVOXþaju. 3RQDYOMDMWHLKPQRJRSXWDLWUDåLWHXNRPVOXþDMXVHPRåHGRüLGRQDMEROMLKUH]XOWDWD 9MHåED . Kompjuterska simulacija 1DXþQH metode 3) Pregled i provjera ispravnosti modela =D VLPXODFLMX MH YDåQR SURYMHULWL GD OL MH PRGHO WDþDQ (1). " .Poglavlje 4.

Simulator leta 92 . NDRãWRMHVLPXODWRUOHWHQMDNRML se koristi za obuku pilota. LOLREXNXOMXGL]DUDGXYHOLNLPSRVWURMHQMLPDNDRãWRMHHOHNWUDQD Slika 5.3RVWRMHHNVSHULPHQWLNRML PRJXELWLãWHWQLDNRVHNRULVWLVWYDUQLSUHGPHWHNVSHULPHQWXNRPHVH PRåHL]JXELWLOMXGVNLåLYRWLOLVORåHQHNVSHULPHQWNRMLMHWHãNRSURYHVWLVDVWYDUQLPSUHGPHWRPNDR ãWRMHGUXãWYHQLIHQRPHQLWG Kompjuter se kRULVWL]DVLPXODFLMHXNRMLPDXþHVWYXMX OMXGL. simulacija koristi kompjuter kao neophodno sredstvo za UMHãDYDQMHSUREOHPDXUD]OLþLWLPSRGUXþMLPDGUXãWYHQLKDNWLYQRVWL Prednosti upotrebe kompjutera . 8 VOXþDMX GD PRGHO QLMH WDþDQ SURYMHULWH WDþQRVW strukture modela i parametre. 4) Upotreba kompjutera Dugo vremena simulacija kao eksperiment je koristila stvarne predmete i modele.3RãWRVHPRGHOSUDYLSUHPDRULJLQDOXPDQMLVXWURãNRYLQHJRNRGSUDYOMHQMDVWYDUQLKSUHGPHWDLOL pravljenja modela u mnogim sluþDMHYLPD . Sa SREROMãDQMHP kompjuterske tehnologije.0RJXüHMHL]YUãLWLSRQDYOMDQMHHNVSHULPHQWDYHOLNRPEU]LQRP .

Poglavlje 4. Meÿutim. Slika 7. Modeliranje i simulacija Kada izvodite simulaciju pomRüXkompjuterDSRWUHEQRMHQDSUDYLWLQRYLPDWHPDWLþNLL]UD] Dostupni programski paketi za ove svrhe su: 1. neophodno je znanje iz programiranja i potrebno je mnogo truda za debug (uklanjanje greãa ka) (1) iz programa itd. Program za rad sa radnim tabelama 8QHVLWH PRGHO PDWHPDWLþNRJ L]UD]D SDUDPHWDU LWG X üHOLMH L QDSUDYLWH VLPXODFLMX 0RJXüH MH JUDILþNL SULND]DWL UH]XOWDW VLPXODFLMH JUDILNRQRP WDNR GD VH VLPXODFLMD PRåH ODNR QDSUDYLWL L DNR nemate znanje iz programiranja. U sloåenim modelima je moguüe boljim algoritmom poveüati uspjeãnost obrade podataka. C ili Pascal. Slika 6. Programski jezi k 1DSUDYLWH SURJUDP NRULVWHüL PDWHPDWLþNH L]UD]H X QHNRP RG SURJUDPVNLK MH]LND NDR ãWR VX BASIC. 6LPXODFLMDSRPRüXSURJUDPVNRJMH]LND . Simulacija programa za rad sa radnim tabelama 2.

  8NODQMDQMHJUHãDNDL]SURJUDPD 93 .

6LPXODFLMDSRPRüXDODWD]DPRGHOLUDQMH 9MHåED]DNUDMSUYRJGLMHOD ƒ 8PHWQLWH SUDYLOQX ULMHþ X ) u sljHGHüLP UHþHQLFDPD Kao model postoje ( (1) ) koje se mijenjaju u protoku vremena i ( (2) ) za koji nije potrebno razmatrati vrijeme. Za PRGHOLUDQMH REUD]ORåLWH (3) . Razvili su se neki alati za modeliranje koML RGJRYDUDMXGLQDPLFL IHQRPHQDNRML LPDVORåHQX VWUXNWXUXNDRãWRVXGUXãWYHQLIHQRPHQL Slika 8.Poglavlje 4. A lat za modeli ranje 3RVWRML NRULVQLþNL SURJUDP ]D L]YRÿHQMH VLPXODFLMD L SRVWRML DODW ]D PRGHOLUDQMH $ODW ]a VLPXODFLMX RGUHÿHQLK IHQRPHQD PRåH QDSUDYLWL PRGHO L L]YUãLWL VLPXODFLMX QD RVQRYX NRQNUHWQH slike. Modeliranje i simulacija 3.

 SUYR L RGOXþLWH .

) i na kraju predstavite to PDWHPDWLþNLP L]UD]RP LWG Za ( (5) .

 SURYMHULWH GD OL MH WDþQR PLMHQMDMXüL PRGHO L prilagodite strukturu ili parametre ako postoji problem. ƒ 3RWUDåLWH PRGHOH NRML SRVWRML RNR YDV L REMDVQLWH NRMD YUVWD VLPXODFLMH VH SULPMHQMXMH X praksi. 94 .

Poglavlje 4. Fenomen koji se privremeno mijenja 3URPMHQH NROLþLQH NDR ãWR VX WHåLQD FLMHQD L Sopulacija povezujemo s "vremenom" kao WUHQXWQDWHåLQD WLMHOD MH  NJ NRULãWenje telefonskih usluga za prethodni mjesec je bilo 20. NDR ãWR MH SRUDVW SRSXODFLMH L LQGXVWULMVNDSURL]YRGQMDWHSULURGQLIHQRPHQLNDRãWRMHYULMHPHPRJXüHMHSUHGYLGMHWLLOLSODQLUDWL EXGXüQRVW 8 RYRP GLMHOX XþLt üHPR R PHWRGDPD PRGHOLUDQMD ]D GLQDPLþNH PRGHOH NRML VH SULYUHPHQRPLMHQMDMXLRPRGHOLPDYMHURYDWQRüHNRMLVHPLMHQMDMX]ERJHOHPHQDWDQHSUDYLOQRVWL 1. Modeliranje i simulacija Dio 2. 1. Metod modeliranja $NR PRåHPR SURYMHULWL NUHWDQMH GUXãWYHQRJ IHQRPHQD. K ada je brzina p romjene stalna? 6OXþDMHYLNDGDMHEU]LQDSURPMHQHNRQVWDQWQDSXWQDXGDOMHQRVWYR]LODNRMHLGHLVWRPEU]LQRP LNROLþLQDQRYFDXEDQFLNRMLãWHGLWHGRELMDWHVWDODQPMHVHþQLL]QRV L]QRVNDPDWH.000 MHQD SRSXODFLMD üH SRUDVWL ]D  PLOLRQD OMXGL VOMHGHüH JRGLQH´ LWG 1DRYDM QDþLQ PRGHO NRML MH REXKYDüHQLSUHGVWDYOMHQSRPRüXYH]HL]PHÿXNROLþLQHLYUHPHQD]RYHVHGLQDPLþNLPRGHO.

2JUDQLþLWH YULMHPH X RGUHÿHQRP NRQVWDntnom vremenskom intervalu (Slika 1) i dodajte SRYHüDQXNROLþLQX NROLþLQXSURPMHQH. A nalizi ranje problema Svrha modeliranja jeste obuhvatiti zapreminu vode u rezervoaru za vodu privremenom promjenom. Procedu ra 1. UsredVUHGLWH VH QD WR GD X ]DYLVQRVWL RG ÄEU]LQH SURWRND³ YRGH ]DYLVL SULYUHPHQD promjena "zapremine vode". 9MHåED Promjena zap remine vode u rezervoaru za vodu 1DSUDYLPRPRGHOPDWHPDWLþNRJL]UD]DNRMLSRND]XMHSURPMHQX]DSUHPLQHYRGHNDGDVHUH]HUYRDU za vodu puni brzinom protoka 6 l u 1 minuti.

9%# >')%*B#=# H)'.9%#>')%*B#L#&'B%-%7"#5)'.'# J.9%# >')%*B#3# H)'.'-. 3UDYOMHQMHPRGHODPDWHPDWLþNRJL]UD]D Vremenski period 3RGHVLWHYULMHPHNDGDSRþQHWHVLSDWLYRGXNDRSRþHWQXWDþNXLNRULVWLWHRYRNDRVWDQGDUG 'XåLQDYUHPHQVNRJLQWHUYDODPRåHELWLSURL]YROMQDXMHGLQLFLYUHPHQD (1) (minuta se koristi na slici 1). Fenomen zavisan od vremena Procedu ra 2.'-.'-.NROLþLQLQDSUYRMWDþNLVYDNRJYUHPHQVNRJSHULRGD WUHQXWQD kumulativna doza) i dobit üHWH NROLþLQX SRVOLMH YUHPHQVNRJ SHULRGD NRMD SUHOD]L NXPXODWLYQX dozu poslije promjene).'-"#JI#. 95 .'-.'-.'-.9%# >')%*B#+# H)%&'.%-F6"K# Slika 1.9%# >')%*B#I# 3RþHWQDWDþND# " H)'. 1. Kumulativna doza poslije promjene = trenutna kumulativna doza + koliþina promjene H)'.9%# >')%*B#2# H)'.%-F6"K# H)'.

Modeliranje i simulacija 2. . brzina protoka koja pokazuje "brzinu promjene (2)" postaje 6 ( lPLQXWL.ROLþLQDSURPMHQH Kada je jedinica vremena "1 minuta".Poglavlje 4.

3RãWRMHEU]LQDSURWRNDVWDOQDSRYHüDQMH]DSUHPLQDYRGH NROLþLQDSURPMHQH.

 VHL]UDþXQDYDQDVOMHGHüLQDþLQ 3RYHüDQD]DSUHPLQDYRGH EU]LQDSURWRNDîYUHPHQVNLLQWHUYDO 3. K umulativna doza Postavite zapreminu vode na odUHÿHQXWDþNXL]DSUHPLQXYRGHSRVOLMH YUHPHQVNRJLQWHUYDOD kao "trenutna zapremina vode (trenutna kumulativna doza)" odnosno "zapremina vode poslije promjene (kumulativna doza poslije promjene (Slika 2.

1 miQXWDVDWGDQVHGPLFDPMHVHFJRGLQDLWG« . 3URPMHQD]DSUHPLQHYRGHXRGUHÿHQRPYUHPHQX (1) Jedinica vremena je 1 sekunda.&'-'" Slika 2. $NR NRULVWLWH L]UD] SRYHüDQD ]DSUHPLQD vode".&'-'" M)'-F6-"#B*1"# 5*B'" 3RþHWQD 6"þND" H)'.9%#%-6')5"$# H)%&'. model PDWHPDWLþNRJL]UD]DMHSUHGVWDYOMHQQDVOLMHGHüLQDþLQ =DSUHPLQDYRGHSRVOLMHSURPMHQH WUHQXWQD]DSUHPLQDYRGHEU]LQDSURWRNDî  YUHPHQVNL interval 3RYHüDQDGR]DYRGH#J:$K" !*1"#5*B'#J$K" !*1"# 5*B'# >*.%-F6"K" M)'-F6-*" A*.%-F6"K" # JI#.'#J.$%&'# >)*.'-.$%&'# >)*.

Primjer kumulativne doze i brzine pro4F..DNR EL VH SUHGVWDYLR GLQDPLþNL PRGHO NDR GLMDJUDP NRULVWH se sljHGHüL VLPEROL ]D NXPXODWLYQXGR]XEU]LQXSURPMHQHGUXJDþLMLHOHPHQWL  NXPXODWLYQHGR]HLEU]LQHSURPMHQH "protok predmeta i informacija". Tabela 1.ROLþLQDYRGH# ?)1%-"#>)*."# ?)1%-"# N97'$')"7%&.9"#()1%-"# A*>F$"7%&"# *RGLãQMLSRUDVWSRSXODFLMH# " .ROLþLQDNRMDVHWUHEDVPDQMLWLLOLSRYHüDWL]DMHGLQLFXYUHPHQD Kumulativna doza poslije promjene u vremenskom intervalu koristi se za trenutnu kumulativnu dozu u sljHGHüHPYUHPHQVNRPLQWHUYDlu. 0RJXüHMHREXKYDWLWLSULYUHPHQXSURPMHQX SRQDYOMDMXüLRYRQHSUHVWDQRRGSRþHWQHWDþNH 3ULPMHUNRMLSRND]XMHYH]HL]PHÿXNXPXODWLYQHGR]HLEU]LQHSURPMHQHSULND]DQMHXWDEHOL.&'-'# 86*>"#F-*.F$"6%5-"# mjene B*1"# # " . 96 .

F$"6%5-"#B*1"# # ?)1%-"#>)*."# (OHPHQWGUXNþLMLRGNXPXODWLYQHGR]H %#()1%-'#>)*.&'-'# # A)*6*9# >)'BPHWD L LQIRUPDFLMD PHÿX '$'. Modeliranje i simulacija 4F. tako da je SURFHGXUDNUHLUDQMDJUDILþNRJPRGHODSRND]DQDLVSRG (1) Predstavite zapreminu vode simbolom (pravougaonika) kumulativne doze.&'-'# # " 86*>"#F-*."# !*1"#5*B'# Model dijagrama primjera 1. U primjeru 1.'-6%. a brzina protoka brzina promjene. zapremina vode je kumulativna doza.Poglavlje 4. .

3UHGVWDYLWHEU]LQXSURWRNDNRULVWHüLVLPERO HOLSVH.

9MHåED Kompanija A proizvela je 50.EU]LQHSURPMHQHLSRYHåLWHJDVDVLPERORP zapremine vode. 2. WHOHYL]RUD X RYRP PMHVHFX 3UHWSRVWDYLWH GD üH VH RYD NROLþLQD SURL]YRGQMH QDVWDYLWL L QDSUDYLWH PRGHO PDWHPDWLþNRJ L]UD]D NRML SUHGVWDYOMD SURPMHQX NROLþLQH proizvodnje. K ada je brzina p romjene p roporcionalna kumulativnoj dozi? 2URþLWH . MHQD JODYQLFD.

JODYQLFDîNDPDWQDVWRSDDNDGDJODYQLFXVPDWUDPRNXPXODWLYQRPGR]RPEU]LQD SURPMHQH´MHSURSRUFLRQDOQD³NXPXODWLYQRMGR]L Za fenomen kod kojeg MH EU]LQD SURPMHQH SURSRUFLRQDOQD NXPXODWLYQRM GR]L XNOMXþXMH VH SRUDVW SRSXODFLMH HNRQRPVNL UDVW VODER UD]YLMHQH ]HPOMH SRYHüDQMH PRELOQLK WHOefona u difuzijskom periodu itd. U 10-oj godini dodaje se kamata od MHQDLXNOMXþXMXüLNDPDWXLPDt üHWH. U prvoj godini dobit od kamate je 500 jena i XNOMXþXMXüLJODYQLFX (2) imate 10. X EDQNX VD  JRGLãQMH NDPDWH (1). Kamata sljHGHüHJRGLQHMHMHQD jer VHNDPDWQDVWRSDRGREUDþXQDYDQDL]QRVRGMena.MHQD1DRYDMQDþLQNDPDWQLPVLVWHPRPEU]LQD SURPMHQH´MH.500 jena. .

 2YRP VH PHWRGRP L]UDþXQDYDMX NDPDWH GRGDMXüL NDPDWH QD JODYQLFX SD VH QRYD JODYQLFD koristi za sljHGHüLYUHPHQVNLSHULRG .

8NOMXþHQHNDPDWH JODYQLFDNDPDWH 9MHåED 3RYHüDQMHEURMDãWHWQLKLQVHNDWD âWHWQLLQVHNWL VNDNDYFL.

(OHPHQWLRGOXþLYDQMD 1HND MH EURM ãWHWQLK LQVHNDWD NXPXODWLYQD GR]D L QHND MH SRYHüDQD EU]LQD EU]LQD SURPMHQH 3UHWSRVWDYLWH L UD]PRWULWH NDNR MH SUHGVWDYOMHQD SRYHüDQD EU]LQDNRMDRGUHÿXMHEURMãWHWQLKLQVHNDWD" 2.3RYHüDQDEU]LQDMHSURSRUFLRQDOQDEURMXãWHWQLKLQVHNDWD 97 . Pretpostavite i razmotrite promjenu broja ãtetnih insekata. A naliza p roblema 1. Pretpostavite GDSRVWRMLLGHDOQDRNROLQDLGRYROMQRKUDQH]DSRYHüDQMHEURMDãWHWQLKLQVHNDWD .%URMãWHWQLKLQVHNDWDRGUHÿXMHVHSRYHüDQRPEU]LQRP (3) .VDNXSOMDMXVHXSROMRSULYUHGQRMUHJLML%URMãWHWQLKLQVHNDWDSRYHüDYDVH]D SRMHGLQLFLYUHPHQD1DSUDYLPRPRGHOPDWHPDWLþNRJL]UD]DNRMLSUHGVWDYOMDRYDMIHQRPHQ Procedu ra 1.

Poglavlje 4. Modeliranje i simulacija Iz modela dijagrama(4) PRåHWH YLGMHWL GD VH SRYHüDQD EU]LQD EU]R PLMHQMD SUHPD SURPMHQL EURMD ãWHWQLK LQVHNDWD 0HÿXWLP NDNR VH SRYHüDQD EU]LQD XYLMHN PLMHQMD QLMH PRJXüH L]UDþXQDWL VWYDUQLEURMãWHWQLKLQVHNDWD 3RYHüDQD ()1%-"# %URM %-.'9"6"# ãWHWQLK 86*>"# )".6"# .

.3RYHüDQDEU]LQD SURSRUFLRQDOQDNRQVWDQWDîEURMãWHWQLKLQVHNDWD.

 3UHGVWDYLWH EURM ãWHWQLK LQVHNDWD VLPERORP NXPXODWLYQH GR]H L SRYHüDQMH EU]LQH NRMD VH RGUHÿXMHVLPERORPEU]LQHSURPMHQH 3RãWR MH SRYHüDQD EU]LQD SURSRUFLRQDOQD EURMX ãWHWQLK LQVHNDWD SUHGVWDYLWH VWRSX UDVWD NDR NUXJ L SUHGVWDYLWH YH]H NRMH SRND]XMX SURWRN SUHGPHWD L] RYRJ NUXJD L EURM ãWHWQLK NXNDFD GR SRYHüDQHEU]Lne.zadajte mali vremenski period. . Primijenite isti koncept kao kada je brzina promjene konstantna: .PDMXüL X YLGX GD MH SRYHüDQD EU]LQD VWDOQD PRJXüH MH L]UDþXQDWL NXPXODWLYQX GR]X SRVOLMH SURPMHQH PHÿXWLP SRMDYOMXMH VH JUHãND X L]UDþXQDYDQMX EURMD ãWHWQLK LQVHNDWD NDR ãWR MH SULND]DQR QD VOLFL  =ERJWRJD VPDQMLWH JUHãNX SRVWDYOMDMXüL GXåLQX YUHPHQVNRJ SHULRGD NRji je dovoljno PDQML RG  YUHPHQVND MHGLQLFD.SUHWSRVWDYLWH GD MH EU]LQD SURPMHQH VWDOQD X PDORP YUHPHQVNRP SHULRGX L L]UDþXQDMWH NROLþLQX SURPMHQHEURMDãWHWQLKLQVHNDWD .

(tabela 2. 0HÿXWLP ãWR MH PDQML YUHPHQVNL SHULRG YHüL MH EURM SURUDþXQD YDåQR MH X]HWL vremenski period pravilno prema neophodnoj preciznosti. M"('$"# 2C# 3URPMHQD EURMD ãWHWQLK LQVHNDWD X UD]OLþLWLP YUHPHQVNLP SHULRGLPD SRþHWQD WDþNDLQVHNDWD.).

.UHLUDQMHPRGHODPDWHPDWLþNRJL]UD]D 98 # .#>')%*B*.#>')%*B*.'-.9%.'-.C#%-6')5"$# 865")-%#()*&# # # %URMãWHWQLKLQVHNDWD EURMK# %URMVWYDUQLKãWHWQLKLQVHNDWD# # # # %URM VWYDUQLK ãWHWQLK LQVHNDWD NDGD VH L]UDþXQDYD V 5)'.'# 3URPMHQDEURMDãWHWQLKLQVHNDWD# JB"-K# H)'.#*B#OC+# %URM VWYDUQLK ãWHWLK LQVHNDWD NDGD VH L]UDþXQDYD V 5)'.C#%-6')5"$#H)'.'-. 3URPMHQDEURMDãWHWQLKLQVHNDWDX]DYLVQRVWLRGGXåLQHYUHPHQVNRJSHULRGD Procedu ra 2.9%. H)%&'.9*G#>')%*B"#OC+K# # H)%&'.'# JB"-K# # Slika 3.#*B#I# *UHãND MH YHüD QHJR NRG 5)'.

Poglavlje 4.'# JB"-K# # ãWHWQLK Trenutan broj + Stopa rasta poslije = ãWHWQLKLQVHNDWD %URM ãWHWQLK LQVHNDWD J()*&K# %URMãWHWQLKLQVHNDWD EURM. %URMãWHWQLKLQVHNDWD .XPXODWLYQDGR]DSRVOLMHSURPMHQHPRåHVHL]UDþXQDWLQDVOLMHGHüLQDþLQ: %URM ãWHWQLK LQVHNDWD SRVOLMH SURPMHQH  WUHQXWQL EURM ãWHWQLK LQVHNDWD  SRYHüDQD EU]LQD î vremenski period. 2. Model matematiþkog izraza 3ULPLMHQLWHL]UD]SRYHüDQMDEU]LQHQDL]UD]NRMLSUHGVWDYOMDNXPXODWLYQXGR]XSRVOLMHSURPMHQH %URM insekata promjene H)%&'. 3RYHüDQMHEU]LQH 3RYHüDQMHEU]LQHVHRGUHÿXMH SURSRUFLMRPEURMDãWHWQLKLQVHNDWD (2) 3RYHüDQMHEU]LQH VWRSDUDVWDîWUHQXWQLEURMãWHWQLKLQVHNDWD 3. Modeliranje i simulacija 1.

# 3RYHüDQDEU]LQD EURMPB"-K# î Trenutan broj î ãWHWQLKLQVHNDWD vremenski period 3RYHüDQMH ()1%-'J()*&PB"-K#JIK# %URMãWHWQLKLQVHNDWD EURM.

# 3RYHüDQMHEU]LQH EURMGDQ.

/*/"D879E" Slika 4. %URMãWHWQLKLQVHNDWDLSURPMHQDSRYHüDQMDEU]LQH YUHPHQVNLLQWHUYDO .# C0<.

9MHåED Navedite prednosti i nedostatke uzimanja manjeg vremenskog perioda kada brzina promjene nije stalna. (2) Stopa rasta se tretira kao proporcionalna konstanta. (1) Jedinica vremena je 1 dan. NDRãWRMHSULND]DQRXSULPMHUX 3.DGDMHEU]LQDSURPMHQHSURSRUFLRQDOQDUD]OLFLL]PHÿXFLOMQHYULMHdnosti i kumulativne doze? Ako MHEU]LQDSURPMHQHSURSRUFLRQDOQDUD]OLFLL]PHÿXFLOMQHYULMHGQRVWLLNXPXODWLYQHGR]HYUãLVH SULODJRÿDYDQMH ]DOLKD (1) X VHNWRUX SURGDMH SULODJRÿDYD VH WHPSHUDWXUD NXüQLK HOHNWULþQLK XUHÿDMD NDRãWRVXNOLPDLWG (1) PriODJRÿDYDQMHNROLþLQD]DOLKDSUHPDPLMHQMDQMXSURGDMH 9MHåED 3URPMHQD]DSUHPLQHYRGHXYRGRNRWOLüX Voda koja se puni u YRGRNRWOLüX je SULODJRÿHQD WDNR GD VH RGUåDYD VWDOQD ]DSUHPLQD YRGH FLOMQD zapremina vode). 99 . Modelirajmo ovu promjenu zapremine vode. .

Poglavlje 4. Modeliranje i simulacija Procedu ra 1.UHLUDQMHJUDILþNRJPRGHOD . Neka je "zapremina YRGH X YRGRNRWOLüX NXPXODWLYQD GR]D D EU]LQD SURPMHQH ³EU]LQX GRWRND vode iz vodovoda. A naliza p roblema 9RGRNRWOLüRWYDUDþHSYRGRYRGDNDGDMHUD]OLND]DSUHPLQHYRGHYHOLND L]DWYDUDþHSNDGDMH PDOD NDNR EL SULODJRGLR NROLþLQX YRGH NRMD VH WUHED QDSXQLWL 7R ]QDþL GD WUHEDPR YRGLWL UDþXQD RUD]OLFL]DSUHPLQHYRGH´L]PHÿXFLOMQH]DSUHPLQHYRGHL]DSUHPLQHYRGHXYRGRNRWOLüX Slika 5). 1 .

. 2]QDþLWH ]DSUHPLQX YRGH VLPERORP kumulativne GR]HLSRYHåLWHVEU]LQRPGRWRNDL ]DSUHPLQRP YRGH´R]QDþHQRJVLPERORP EU]LQH promjene.

(3) "brziQD GRWRND YRGH SULODJRÿHQD MH proporcionalno "razlici zapremine vode" i povucite linije od "razlike zapremine vode" i "proporcionalne konstante" odvojeno od "brzine dotoka". 3RãWR VH ³UD]OLND ]DSUHPLQH YRGH RGUHÿXMH "zapreminom vode" i "ciljanom zapreminom YRGH SRYXFLWH OLQLMH L] VYDNH WDþNH ND UD]OLFL zapremine vode". /%&'5# 5*B*Q# 5*B"# # /%$&-"#B*1"# 5*B'# R"1$%9"#B*1'#5*B'# !*1"#5*B'# A$*5"9# Slika 5. 9H]DL]PHÿXEU]LQHGRWRNDL]DSUHPLQHYRGH 5D]OLND]DSUHPLQHYRGHSUHGVWDYOMHQDMHQDVOMHGHüLQDþLQ Razlika zapremine vode = ciljna zapremina vode ± trenutna zapremina vode %U]LQDGRWRNDPRåHELWLSUHGVWDYOMHQDNRULVWHüLSURSRUFLRQDOQXNRQVWDQWXQDVOMHGHüLQDþLQ: %U]LQDGRWRND SURSRUFLRQDOQDNRQVWDQWDîUD]OLND]DSUHPLQHYRGH 2.UHLUDQMHPRGHODPDWHPDWLþNRJL]UD]D 0RGHOPDWHPDWLþNRJL]UD]DSUHGVWDYLt üHPRQDVOMHGHüLQDþLQ Zapremina vode poslije promjene = trenutna zapremina vode + proporcLRQDOQDNRQVWDQWDî FLOMQD zapremina vode ± WUHQXWQD]DSUHPLQDYRGH.6"-6"# Procedura 2. 8UHÿHQMHYH]HHOHPHQDWDLVWYDUDQMDPRGHODPDWHPDWLþNRJL]UD]D 1. 3ULODJRÿDYDQMH zapremine vode u YRGRNRWOLüX !*1"# 5*B'" 86*>"# F-*. ."# R"1$%9"# B*1'#5*B'# /%$&-"# B*1"# 5*B'# A)*>*)7%*-"$"#9*-.

îYUHPHQVNLSHULRG 9MHåED Predstavite proces grijanja vode napunjene kade podeãDYDMXüL WHPSHUDWXUX L VWDELOL]LUDMXüL MH NRULVWHüLJULMDOLFXLRSUHPX]DSULODJRÿDYDQMHWHPSHUDWXUHNRMD DXWRPDWVNLNRQWUROLãHL]YRUWRSORWH PRGHORP PDWHPDWLþNRJ L]UD]D 2SUHPD ]D SULODJRÿDYDQMH WHPSHUDWXUH NRQWUROLãH EU]LQX JULMDQMD VWRSXJULMDQMD.

>')"6F)"# 5*B'# 100 .SURSRUFLRQDOQXUD]OLFLL]PHÿXWHPSHUDWXUHYRGHLSRGHãHQHWHPSHUDWXUH ?)1%-"#G)%&"-&"# M'.

Feedback control (regulacija povratnom vezom) =DVWYDUDQMHGLQDPLþNog modela.Poglavlje 4. 2. te promiMHQLWHX]URþQXYH]XVOLNHLPDWHPDWLþNRJL]UD]D 0RGHOPDWHPDWLþNRJL]UD]DIHQRPHQDNRMLVHSULYUHPHQRPLMHQMD 0RGHO PDWHPDWLþNRJL]UD]D IHQRPHQDNRML VHSULYUHPHQRPLMHQMDSUHGVWDYOMHQ MHQDVOMHGHüL QDþLQ 1. Modeliranje i simulacija U primjeru 3. 101 . Kumulativna doza poslije promjene = trenutnDNXPXODWLYQDGR]DEU]LQDSURPMHQHîYUHPHQVNL period. odredite koji element fenomena bi trebao biti postavljen kao "kumulatLYQD GR]D =DWLP DQDOL]LUDMWH RVRELQH FLOMD SRVWDYLWH X]URþQX YH]X L SULNDåLWH NDko je "brzina promjene" koja utjeþH QD NXPXODWLYQX GR]X SULND]DQD QD GLMDJUDPX 6DNXSLWH L analizirajte podatke. Izrazi koji predstavljaju "brzinu promjene". 6LVWHPVNRURVYLKSULURGQLKLGUXãWYHQLKIHQRPHQDMHRYRJWLSD Slika 6. pozicija plovka SRND]XMH WUHQXWQX ]DSUHPLQX YRGH D þHS YRGRYRGD VH DXWRPDWVNLSULODJRÿDYDSR]LFLML1DRYDMQDþLQVistem NRMLRGOXþXMHRVOjHGHüHP VWDWXVXXRGQRVX na trenutni zove se feedback control (regulacija povratnom vezom) i to je osnova automatskog kontrolnog sistema (Slika 6).

000 bacanja) 2EMDãQMHQMHUMHãDYDQMDSUREOHPDNRULãtenjem Monte Carlo metode: . *UDILNRQYMHURYDWQRüHWDþQRJEURMDQDNRFNLFL SULPMHURG. problem . 0HWRGDUMHãDYDQMDSUREOHPDSULPMHQMXMXüLVOXþDMDQEURM]Dovaj model zove se Monte Carlo metoda. )HQRPHQYMHURYDWQRüH $NREDFLWHNRFNXQHPRJXüH MHSUHGYLGMHWLNRML EURMüHWHGRELWL%URMNOLMHQWDNRMLGROD]L QD elektronsku blagajnu supermarketa je. NePRJXüQRVW SUHGYLÿDQMD ]DKWiMHYD PRGHOLUDQMH SUREOHPD ]DNRQLPD YMHURYDWQRüH 2YR MH PRGHO YMHURYDWQRüH.ROLND MH YMHURYDWQRüD GD üH OHSWLU VOHWMHWL QD UXåX X URNX RG  PLQXWD"  3UREOHPPRåHELWLULMHãHQSRPRüX0RQWH&DUORPHWRGH Monte Carlo metoda MH VSHFLILþna MHU NRULVWL VOXþDMQH EURMHYH .DGD EDFLWH NRFNLFX KLOMDGX SXWD LOL GHVHWLQH KLOMDGD SXWD L GRÿHWH GR UHODWLYQH XþHVWDORVWL brojeva od 1 do 6 koje dobijate..Poglavlje 4. 2YD UHODWLYQD XþHVWDORVW SRND]XMH YMHURYDWQRüXVYDNRJEURMDQDNRFNLFLNRMLGRELMHWH 9MHURYDWQRüD (relativna XþHVWDORVW) 7DþDN"#-"#9*79%7%# Slika 7. QHPRJXüH WDþQR predvidjeti. WDNRÿHr. YMHURYDWQRüD GRELMDQMD VYDNRJ EURMD SRVWDMH  Slika 7). Modeliranje i simulacija 2. Npr.

6NXSEURMþDQLKYULMHGQRVWLNRMHLPDMXLVWXYMHURYDWQRüX]DVYDNLEURMNRMLGRELMHWH .

2YRVH]RYHSUREOHPVOXþDMQRJNUHtanja. . (3) RAND funkcija programa za rad sa radnim tabelama. (4) RHODWLYQDXþHVWDORVW EURMGRJDÿDQMDXNXSDQEURM.

A naliza p roblema .]YHGLWHHNVSHULPHQW RJOHG.]UDþXQDYDQMHEURMDʌ .5HODWLYQDXþHVWDORVWGRELMHQDRGPQRJRSRGDWDNDMHYMHURYDWQRüXGRJDÿDMDNRMLüHVHGRJRGLWL 9MHåED . Procedu ra 1.]UDþXQDMPRYULMHGQRVWLEURMDʌNRULVWHüL0RQWH&DUORPHWRGu.

NRULVWHüLVOXþDMDQEURMXNUXJXUHOHYDQWQRP]DL]UDþXQDYDQMHʌL QDSUDYLWHNRUHNFLMXUHODWLYQHXþHVWDORVWLGRNRMHVWHGRãOLL]RYRJLSRGUXþMDNUXJD 3RVPDWUDMPR NYDGUDW X NRML MH XSLVDQD ó NUXJD L SRVWDYLWH WDþNH X XQXWUDãQMRVW NYDGUDWD NRULVWHüL VOXþDMDQ EURM 2YH WDþNH VH ]RYX VOXþDMQH WDþNH 6DGD VX VOXþDMQH WDþNH SRVWDYOMHQH X NYDGUDW VYRMVWYRP VOXþDMQRJ EURMD 5D]PRWULWH YMHURYDWQRüX SRVWDYOMDQD VOXþDMQLK WDþDND X NUXJ V GYD JOHGLãWD YMHURYDWQRüX GR NRMH VH PRåH GRüL HPSLULMVNL VWYDUDQMHP PQRJR VOXþDMQLK EURMHYD UHODWLYQD XþHVWDORVW.

6OLND. L YMHURYDWQRüX GR NRMH VH PRåH GRüL SRPRüX RGQRVD SRGUXþMD NYDGUDWD L kvadranta. Procedu ra 2. 'RELMDQMHYULMHGQRVWLEURMDʌ (1) Nacrtajte kvadrat stranice 1 u prvom kvadrantu (Slika 8).]UDþXQDYDQMHʌ0RQWH&DUORPHWRGRP 102 .

Modeliranje i simulacija .Poglavlje 4.

uy). . 2GUHGLWH GYD VOXþDMQD EURMD X x i uy NRMD VX MHGQDND LOL PDQMD RG  1D WDM QDþLQ GRELMDPR VOXþDMQXWDþNX3VDNRRUGLQDWDPD Xx.

3RGUXþMHNYDGUDQWD# 3RGUXþMHNYDGUDW"# . 3RVWDYLPR 1 VOXþDMQLK WDþDND X NYDGUDW %URM VOXþDMQLK WDþDND NRMH VX SRVWDYOMHQH X NYDGUDQW  R]QDþLPR VD Q 5HODWLYQX XþHVWDORVW Q1 JGMH VX VOXþDMQH WDþNH SRVWDYOMHQH X NYDGUDQW SRVWDMX JRWRYRMHGQDNHYMHURYDWQRüHGRNRMHVHPRåHGRüLL]RGQRVDSRGUXþMDNYDGUDWDLNYDGUDQWDNDGDMH N dovoljno veliko.

(6) Ovdje zamislite kvadrant. .9ULMHGQRVWEURMDʌMHʌ| Q1LPRJXüHMHL]UDþXQDWLSULEOLåQXYULMHGQRVWEURMDʌDNRVXEURjevi n i N poznati.

2GQRVSRGUXþMD SRGUXþMHNUXJDSRGUXþMHNYDGUDWD .

 (NVSHULPHQWDOQD YMHURYDWQRüD Q1 LPD JUHãNX KDGD VH EURM HNVSHULPHQDWD RJOHGD.

 SRYHüa. WDþQRVWüHVHSRYHüDWL 9MHåED Objasnite metodu GRELMDQMD]DSUHPLQHVIHUHSROXSUHþQLNDSRPRüX0RQWH&DUORPHWRGH Procedura upotrebe Monte Carlo metode za fenomen vjerovatnoüe prikazana je na sljedeüi naþin: >@3URYMHULWHSRMDYXYMHURYDWQRüH (1) Posmatrajte pojavu i registrujte svaku uþestalost za pojavu koja üe se dogoditi. .

=DELOMHåLWHXþHVWDORVW LRGUHGLWHGRYMHURYDWQRüHVYHSRMDYHNRMDüHVHGRJRGLWL UHODWLYQD XþHVWDORVW.

 [2] Odredite VOXþDMDQEURMLQDSUDYLWHIHQRPHQSUHPDYMHURYDWQRüLGRNRMHVWHGRãOL (1) Napravite tabelu i grafikon kumulativne (NXPXODWLYQDYMHURYDWQRüD.

YMHURYDWQRüH .

2GUHGLWHVOXþDMDQEURML]LQWHUYDOD .

SRPRüXkompjutera.DR SRVOMHGLFD WRJD PRUDWH L]DEUDWL SUDYL RG PQRJR VLPXOLUDQLK rezultata. Ɣ0RQWH&DUORPHWRGD 0RJXüH MH ULMHãLWL PDWHPDWLþNH L IL]LþNH SUREOHPH NRML VH QH PRJX ULMHãLWL X WHRUHWVNRP VPLVOX (analitLþNL. Primijenite ga u tabeli. kreirajte JUDILNRQNXPXODWLYQHYMHURYDWQRüHLL]UDþXQDMWHYULMHGQRVWNRMDSUDWLVYDNXYMHURYDWQRüX 0RJXüH MH QDSUDYLWL VLWXDFLMX VOLþQX IHQRPHQX YMHURYDWQRüH NRMD VH GRJDÿD 0RQWH &DUOR PHWRGRP D GRELMHQL SRGDFL VH PRJX NRULVWLWL ]D UMHãDYDQMH SUREOHPD 0HÿXWLP GRELMHQL SRGDFL LPDMX YDULMDFLMX L QLVX WDþQL .

DNR EL VH UD]MDVQLOR VYRMVWYR YMHURYDWQRüH NRFNLFH NRMX VWH QDSUDYLOL EDFLWH NRFNLFX YLãH pXWDLL]UDþXQDMWHYMHURYDWQRüXEURMDQDNRFNLFLNRMLGRELMHWH 103 . 9MHåED Model kockice Napravite NRFNLFX L L]UDþXQDMWH YMHURYDWQRüX EURMD QD NRFNLFL 'RELMHQH UH]XOWDWH XSRUHGLWH VD UH]XOWDWLPDNRMHMHGRELRYDãSULMDWHOM Procedu ra 1. A naliza p roblema . NDNRELVHRGUHGLODYHOLþLQDLNRQILJXUDFLMD DWRPDSHüL]DGL]DMQLUDQMHSUYDSUDNWLþQD upotreba Monte Carlo metode. 5HþHQR MH GD MH VLPXODFLMD QHSUDYLOQRJ NUHWDQMD PDWHULMDOD NRML NRQILJXULãX HOHPHQt DWRPDXSHüL.

SvakLXþHQLNEDFDkockicu 50 puta i biljeåi (uþestalost). 3URYMHULWHEURMGRNRMHJVWHGRãOL 1.6"$-*#-">)"5$&'-'#9*79%7'# M"('$"#3# 7DþNH -"# 9*79%7%# 8þHVWDORVW J>F6"K# 9MHURYDWQRüD# 9MHURYDWQRüD # TaþNHQD kockici S9F>-*# Slika 10. 9MHURYDWQRüD#. koliko puta se pojavio broj na kockici.GHDOQDYMHURYDWQRüD EURMDQDNRFNLFLMH]DVYDNLEURM8SRUHGLWHMHVJUDILNRQRPYMHURYDWQRüH kockice koju ste napravili i provjerite odstupanje. tj. Formirajte JUXSHRGSRXþHQLNDLQDSUDYLWHNRFNLFXWDNRGDL]JOHGDNDRãWRMHSULND]DQDQDVOLFL 9. *UDILNRQ YMHURYDWQRüH napravljene kockice Rasp rava . Napravite tabelu i JUDILNRQGRELMHQHYMHURYDWQRüH (Tabela 3. Napravite kockicu i bacite je. Modeliranje i simulacija Procedu ra 2. 'RÿLWHGRUH]XOWDWDSRPRüXYMHURYDWQRüH Podijelite broj pojavljivanja broja na kockici sa ukupnim brojem bacanja. Slika 9.Poglavlje 4. Slika 10).". U ovom primMHUXYMHURYDWQRüD]DLMHYLVRND a za 1 je niska.*. Izgled presjeka kockice 2. 9MHåED Simulirajte k retanje kockice koju ste napravili 'RÿLWHGRNXPXODWLYQHYMHURYDWQRüHYMHURYDWQRüHXSULPMHUXLQDSUDYLWHVLWXDFLMXNRMDSRkazuje WHQGHQFLMXVOLþQXVLWXDFLMLNDGDEDFDWHNRFNLFXNRMXVWHQDSUDYLOL 104 . Uporedite ove podatke sa podacima druge grupe.

XPXODWLYQD YMHURYDWQRüD EURMD  MH  GRGDMXüL SUHWKRGQH NXPXODWLYQH RG  GR  . Modeliranje i simulacija Tabela 4 9MHURYDWQRüD i kumulativna YMHURYDWQRüD 7DþNHQD kockici 9MHURYDWQRüD Kumulativna YMHURYDWQRüD " S9F>-*# Procedu ra A naliza p roblema 1. Kumulativna YMHURYDWQRüD 7DþNHQDNRFNLFL 6OLND*UDILNRQNXPXODWLYQHYMHURYDWQRüH 2.DGDGRÿHWHGRNXPXODWLYQHYMHURYDWQRüHEURMHYa od 1 do 6 kako je opisano. posljednja vrijednost kumulDWLYQHYMHURYDWQRüHSRVWDMH 6lika 4). .]UDþXQDMWHNXPXODWLYQXYMHURYDWQRüX .XPXODWLYQD YMHURYDWQRüD EURMD  MH  YMHURYDWQRüH NDR ãWR MH SULND]DQR X WDEHOL  Kumulativna vMHURYDWQRüD EURMD  MH  GRGDMXüL SUHWKRGQX NXPXODWLYQX RG  GR  .Poglavlje 4. 3RVWDYOMDQMHVOXþDMQLKEURMHYD Odaberite broj L] LQWHUYDOD > .

Slika 12. QD RVQRYX NXPXODWLYQH YMHURYDWQRüH Napravite tabelu i grafikon (Tabela 5.

6"5$&"-&'#>*>%. NRULVWHüL RYR NDR LQWHUYDO VOXþDMQRJ EURMD .QWHUYDO VOXþDMQRJ EURMD SRVWDYOMHQRJ]DVYDNLEURMRGJRYDUDYMHURYDWQRüLVYDNRJEURMDNRMLGRELMHWH M"('$"#+# A*.XPXODWLYQDYMHURYDWQRüD# 6OXþDMDQEURM# 7DþNHQDNRFNLFL# Slika 12. 3RVWDYOMDQMHVOXþDMQRJEURMDLJUDILNRQNXPXODWLYQHYMHURYDWQRüH 105 .F$"6%5-"# YMHURYDWQRüD# .QWHUYDOVOXþDMQRJEURMD# # " 4F."#VOXþDMQLK#()*&'5"# 7DþNHQDNRFNLFL# D-6')5"OVOXþDMQLKEURMHYD # .

OdabHULWHVOXþDMDQEURMLQDRVQRYXQMHJDGRELt üHWHEURMQDNRFNLFL Uzmite VOXþDMDQEURM L]LQWHUYDOD>. Modeliranje i simulacija 3.Poglavlje 4.

. Prodaja digitalnoga fotoaparata po danu se provjerava za poslednjih 100 dana u prodavnici i UH]XOWDW MH L]UDåHQ WDEHORP 1DSLãLPR SURFHGXUX SURPMHQH SURGDMH X URNX RG  GDQD SRPRüX 0RQWH&DUORPHWRGHGRELMDQMHPYMHURYDWQRüHLNXPXODWLYQHYMHURYDWQRüH A)*B"&"#J()*&# &'B%-%7"PB"-K# 8þHVWDORVW JB"-K# " LOLYLãH# S9F>-*# " 106 . tako da se dobije broj 5 kao odgovaUDMXüLEURMQDNRFNLFL 6OLND)..794. vremenom EU]LQDRWLFDQMDYUXüHYRGHELVHWUHEDOD VPDQMLWLSURSRUFLRQDOQRNROLþLQLYUXüHYRGHXNDGL 2. aNRMHVOXþDMDQEURMRQSULSDGDLQWHUYDOXVOXþDMQLKEURMHva od 0. 9MHåED]DNUDMGLMHOD 1. Npr.DGD VH L]YDGL þHS VD GQD NDGH LVFXUL YUXüD YRGD =D SURPMHQX NROLþLQH YUXüH YRGH X NDGL QDSUDYLWHPRGHOPDWHPDWLþNRJL]UD]D0HÿXWim.635 do 0.LSRJOHGDMWHNRPLQWHUYDOXVOXþDMQLKEURMHYDRGJRYDUD iz tabele i grafikona.

Analiza i provjera rezultata simulacije 0RåHWHYLGMHWLQDJUDILNRQXGDVHSRYHüDQMH ubrzava pri brzini dotoka. [3] Analiza i provjera rezultata simulacije.DGDMHEU]LQDXþHVWDORVWLVWDOQD 86*>"# F-*.Poglavlje 4. 0RGHOLUDQMHLNUHLUDQMHPRGHODPDWHPDWLþNRJL]UD]D 0RGHOPDWHPDWLþNRJL]UD]DPRåHVHGRELWL modeliranjem. [2] Kreiranje radne stranice i grafikona."# !*1"# 5*B'# 9MHåED Promjena zap remine vode u rezervoaru za vodu . Fenomen koji se mijenja vremenski 3URFHGXUDVLPXODFLMHNRULãWenjem programa za rad sa radnim tabelama: [1] Modeliranje i stvaranje modHODPDWHPDWLþNRJL]UD]D. 1) . SimuliraW üHPR UD]QH PRGHOH NRULãWenjem programa za rad sa radnim tabelama. Zapremina vode poslije promjenH WUHQXWQD]DSUHPLQDYRGHEU]LQDGRWRNDîYUHPHQVNLSHULRG 2. Kreiranje radne stranice i grafikona 'RGLMHOLWH EURMþDQX YULMHGQRVW VYDNRM üHOLML NDR ãWR MH SUHGVWDYOMHQR QD VOLFL  L QDSUDYLWH UDGQX stranicu.]YHGLWH VLPXODFLMX SRVWDYOMDMXüL SRþHWQX zapreminu vode na 2 l. Modeliranje i simulacija Dio 3. Napravite grafikon na osnovu dobijenih rezultata. 3. Kompjuterska simulacija $NR PRGHO PDWHPDWLþNRJ L]UD]D PRåH ELWL L]UDÿHQ PRGHOLUDQMHP PRJXüH MH L]YHVWL L simulaciju. vremenski period na 1 minut i YULMHPH]DYUãHWNDQDPLQXWDXSULPMHUXGLR Procedu ra 1. 1. Analizirajmo rezultat i prednosti upotrebe kompjutera. GrafikonWDþNDVWLGLMDJUDP Opseg grafikona: ûHOLMH od A7 do B12 3RþHWQDNROLþLQDYRGH ûHOLMD %.

Ä %³ 3RþHWQR vrijeme vrijemevrijem e 6OMHGHüHYULMHPH ûHOLMD $.

³ $%³ .ROLþLQD YRGH  PLQXW NDVQLMH  NROLþ YRGH  VWRSD XQRVD  vremenski interval (1 minuta) ûHOLMD %.

Ä %% %³ Slika 1. Promjena zapremine vode u rezervoaru za vodu 107 .

0RGHOLUDQMHLSUDYOMHQMHPRGHODPDWHPDWLþNRJL]UD]D 3RãWR MH PRGHO LVWL NDR X SULPMHUX  SRYHüDQMH ãWHWQLK LQVHNDWD.]YHGLWHVLPXODFLMXGDELVWHSURYMHULOLNROLNRULELFDüHELWL]DJRGLQXGDQD DNRMHVWRSDSRYHüDQMDVWRSDVPDQMHQMDDVWYDUQDVWRSDSRYHüDQMD3UHWSRstavlja se da je vremenski period 1 mjesec. okolina za UD]PQRåDYDQMHYHOLþLQHDNYDULMD uz idealne uvjete. Procedura 1. Modeliranje i simulacija 2) Kada je brzina promjene proporcionalna kumulativnoj dozi? 9MHåED 5D]PQRåDYDnje akva rijskih ribica U akvariju je 10 ribica.Poglavlje 4.

K reiranje radne stranice i grafikona 1DSUDYLWHUDGQXVWDQLFXNDRãWRMHSUHGVWDYOMHQRQDVOLFLLJUDILNRQQDRVQRYXGRELMHQLKUH]XOWDWD *UDILNRQ dijagram WDþNDVWL Opseg üHOLMD $GR%.6"# 2. X GLMHOX  PRåH VH GRüL GR PRGHODPDWHPDWLþNRJL]UD]DQDVOMHGHüLQDþLQ %URM ULELFD SRVOLMH SURPMHQH  WUHQXWQL EURM ULELFD  VWRSD SRYHüDQMD î WUHQXWQL EURM ULELFD î vremenski interval 0HÿXWLPVWYDUQDVWRSDSRYHüDQMDMHSURPLMHQMHQDXVWRSXSRYHüDQMD 3RYHüDQD ()1%-"# ?)*&#)%(%7"# 86*>"# )".

3RþHWQLEURMULELFD ûHOLMD %.

 3RþHWQRYULMHPH SljHGHüHYULMHPH ûHOLMD $.

Ä $%³ Broj ribica 1 mjesec kasnije = broj ribica za 0 mjesec + stopa rasta * broj ribica za 0 mjesec* vremenski interval (1 mjesec) ûHOLMD %.

3RYHüDQMHEURMDULELFD 108 .Ä %% % %³ Slika 2.

9MHåba Uporedite rezultat primjera 2. Procedura 1. 3) Kada je brzina promjene proporcionalna razlici ciljne vrijednosti i kumulativne doze? 9MHåED 3URPMHQD]DSUHPLQHYRGHXYRGRNRWOLüX IzvHGLWH VLPXODFLMX SRVWDYOMDMXüL SRþHWQX ]DSUHPLQX YRGH QD  l. i rezultat simulacije s vremenskim periodom postavljenim na 0.]JUDILNRQDVHPRåHYLGMHWLGDVHEURMULELFDYUHPHQRPEU]RSRYHüDYD$NRVHVWYDUQDVWRSD SRYHüDQMDSURPLMHQLPRåHWHYLGMHWLGDMHSRYHüDQMHPDORDNRMHYULMHGQRVWPDODX]WREURMULELFD se smanjuje ako vrijednost postane negativna. =DSUHPLQD YRGHSRVOLMHSURPMHQH WUHQXWQD]DSUHPLQD YRGHSURSRUFLRQDOQDNRQVWDQWDî FLOMQD zapremina vode ± WUHQXWQD]DSUHPLQDYRGH. proporcionalnu konstantu na 0. Modeliranjem u dijelu 2. Analiza i provjera rezultata simulacije . Modeliranje i kreiranje modela matematiþkog izraza.5. moåe se doüi do modela matematiþkog izraza. Modeliranje i simulacija 3.7.Poglavlje 4. ciljnu zapreminu vode na 10 lYUHPHQVNLSHULRGQDPLQXWDLYULMHPH]DYUãHWNDQDPLQXWD]D primjer 3 u dijelu 2.

6"-6"# R"1$%9"# B*1'#5*B'# /%$&-"# B*1"# 5*B'# 109 .îYUHPHQVNLSHULRG !*1"# 5*B'# 86*>"# F-*."# A)*>*)7%*-"$-"# 9*-.

K reiranje radne stranice i grafikona 'RGLMHOLWH EURMþDQX YULMHGQRVW VYDNRM üHOLML NDR ãWR MH SUHGVWDYOMHQR QD VOLFL  L QDSUDYLWH radnu stranicu. 3RþHWQDYULMHGQRVWüHOLMH %. Modeliranje i simulacija 2.Poglavlje 4. Napravite grafikon na osnovu dobijenih rezultata.

³ %´ 3RþHWQRYULMHPH SljHGHüHYULMHPH ûHOLMD $.

Ä $%³ &RS\3DVWHXüHOLMH $GR$.

ûHOLMD %.

Ä %7 +B$2 * (B$4 . Analiza i pregled rezultata simulacije 1D JUDILNRQX PRåHWH YLGMHWL GD VH ]DSUHPLQD YRGH YUHPHQRP PLMHQMD L GRVWLåH FLOMQX zapreminu vode. 110 . proporcionalna konstanta promijeni. 9MHåED Provjerite kako se proporcionalna konstanta mijenja kada se u primjeru 3.B7) %³ &RS\3DVWHXüHOLMH (B9 do B17) Slika 3. 3URPMHQD]DSUHPLQHYRGHXYRGRNRWOLüX 3.

Poglavlje 4. )HQRPHQYMHURYDWQRüH 1) 8SRWUHEDVOXþDMQRJEURMDXSURJUDPX]DUDGVDUDGQLPWDEHODPD 'DELVPRSURYMHULOLRSHUDFLMXPRGHODYMHURYDWQRüH]DkompjuterVNXVLPXODFLMXVOXþDMDQ broj VH NRULVWL NDR ãWR MH RSLVDQR X GLMHOX  2VQRYQL RG VOXþDMQLK EURMHYD MH QHSURPMHQMLYL VOXþDMni broj7HãNRMHQDSUDYLWLLGHDOQXNRFNLFX1RYþLüQLMHQDSUDYOMHQWDNRGDSLVPRLJODYDL]JOHGDMXLVWR =ERJWRJDL]YHGLPRVLPXODFLMXNRULVWHüLVOXþDMDQbroj u programu za rad sa radnim tabelama . Modeliranje i simulacija 2.

6"5-%9" Procedu ra 1. V jeåba 4. Modeliranje 2GUHGLWH VOXþDMDQ EURM L] LQWHUYDOD > . 6OXþDMDQ EURM ]D NRML VH YULMHGQRVW L] LQWHUYDOD >) VOXþDMQR SRMDYOMXMH X LVWRM VWRSL ]RYH VH VWDQGDUGQLQHSURPMHQMLYLVOXþDMni broj. 2GUHGLPR PMHVWD]DXþHQLNH NRULVWHüLVOXþDMDQEURM T". Pravljenje grafi kona mjesta za sjedenje Brojevi stolica su dodijeljeni za stolice kao ãto je prikazano na slici.

1) ûHOLMD %. L GRGLMHOLWH VOXþDMDQ EURM VMHGLãWD XþHQLNX NRULVWHüL UDVWXüLSRUHGDN 2. K reirajte radnu stranicu i rezultat simulacije 8QHVLWH YULMHGQRVW X VYDNX üHOLMX NDR ãWR MH SULND]DQR QD VOLFL  2GUHGLWH VOXþDMDQ EURM SRPRüX5$1'IXQNFLMHLL]UDþXQDMWHSRUHGDNSRPRüX5$1.IXQNFLMH %URMVMHGLãWD 2GUHGLPRVOXþDMDQEURML]LQWHUYDOD[ 0.

Ä 5$1' .

³ &RS\3DVWHXüHOLMH %GR%.

2GUHÿLYDQMHSRUHWND ûHOLMD &.

%%%.Ä 5$1.

³ &RS\3DVWHXüHOLMH &GR&.

Simulacija sjedenja 111 . Slika 4.

Modeliranje i simulacija 3. Analiza i pregled rezultata simulacije 3URYMHULWHUD]OLNHUH]XOWDWDQRYLPL]UDþXQDYDQMHP .Poglavlje 4.

2YRPIXQNFLMRPELUDPRVOXþDMDQEURML]LQWHUYDOD>.

Broj podataka 2GUHGLPR VOXþDMDQ EURM L] LQWHUYDOD [ 0. postavite uvjet manji od 0.1) ûHOLMD %. 1). 2. Modeliranje 3RãWRMHYMHURYDWQRüDGDüHQRYþLüSDVWLQDÄJODYX³ 1/2. 2) 6LPXODFLMDPRGHODYMHURYDWQRüe 9MHåED %DFDQMHQRYþLüD . K reirajte radne stranice i rezultat simulacije 8QHVLWHYULMHGQRVWXVYDNXüHOLMXNDRãWRMHSULND]DQRQDSlici 5.ROLND MH YMHURYDWQRüD GD üH QRYþLü NDGDJDEDFLWHSDVWLQD³JODYX´" Procedu ra 1.]YHGLWH VLPXODFLMX IHQRPHQD QRYþLüD . Broj podataka bi trebao da bude 10.5 da üe biti ³glava´i odredite sluþajan broj iz intervala [0.

Ä 5$1' .

a 0 za pismo ûHOLMD &.³ &RS\3DVWHXüHOLMH %GR%1) 1 je za glavu.

) %<.Ä .

³ Copy/3DVWHXüHOLMH &GR&11) 9MHURYDWQRüDGDüHSDVWLÄJODYD³ ûHOLMD &.

Ä 680 &&.

 Slika 5.]UDþXQDYDQMHEURMDʌ 6LPXOLUDMPRYULMHGQRVWEURMDʌ Procedu ra 1. .000 EURMHYD. Analiza i pregled rezultata simulacije 3URYMHULWH UD]OLNH UH]XOWDWD QRYLP L]UDþXQDYDQMHP. dijeluPRåe se GRüLGRUH]XOWDWDQDVOMHGHüLQDþLQ: ʌ| 4n/N 3RãWRMH1VOXþDMQDWDþNDXNYDGUDWXRGUHGLWH1 . U ovom primjeru broj podataka je 10. 0RGHOLUDQMH«««$NRMHSROXSUHþQLNNUXga postavljen na 1 za 4. Zadata k . PHÿXWLPYDULMDFLMDYMHURYDWQRüHVHVPDQMXMHL]DWYDUDQDDNRSRYHüDWHEroj podataka. primjer u 2.]YHGLWHVLPXODFLMXSRVWDYOMDMXüLEURMSRGDWDNDXSULPMHUXQD Primjer 6. 6LPXODFLMDEDFDQMDQRYþLüD 3.

VOXþDMQHEURMHYH.<L]LQWHUYDOD > .

 .DNR MH Q EURM VOXþDMQLK EURMHYD X SUYRP NYDGUDQWXRQGD MH to EURM VOXþDMQLK EURMHYD NRML ispunjavaju uvjet X2+Y2 d 1. 112 .

000. 6OXþDMDQEURM.]UDþXQDYDQMHEURMDʌ0RQWH&DUORPHWRGRP 2. K reiranje radne st ranice i rezultat simulaci je 8QHVLWH YULMHGQRVW X VYDNX üHOLMX NDR ãWR MH SULND]DQR QD Slici 7. . Broj stvarnih podataka je 1.Poglavlje 4. a samo 10 podataka je prikazano. Ako postoji krug izbrojmo vrijednosti ûHOLMD ). Modeliranje i simulacija Slika 6. =RAND() Procjenjuje se da li postoji krug.

 Ä  &2817.) &&³< ³.

(³ 6OXþDMDQEURM< =RAND() %URMVOXþDMQLKEURMHYD Od 100 do 1000 Vrijednost kruga X2+Y2 ûHOLMD &.

]UDþXQDYDQMHʌ# ?)*&" Slika 8. .]UDþXQDYDQMHVLPXODFLMRPYULMHGQRVWLEURMDʌ 3. 113 .Ä $ $% %³ Slika 7. ʌ" . 5D]OLNDYULMHGQRVWLEURMDʌSUHPDEURMXVOXþDMQLKEURMHYD (1) Ovom se funkcijom provjerava broj elemenata koji odgovaraju uvjetLPD SUHWUDåLYDQMD XNOMXþHQLKXRGUHÿHQLLQWHUYDO (2) Vrijednost brojDʌMH« Zadata k Napravite grafikon simulacije sa brojem podataka od 100 do 1.000 u primjeru 6. Analiza i pregled rezultata simulacije 3URYMHULWHYULMHGQRVWNRMDVHSULEOLåDYDʌ DNRVHSRYHüDEURj podataka.

Modeliranje 1DSUDYLWHNRFNLFXNUHLUDQMHP VOXþDMQRJ EURMD L] LQWHUYDOD>. Modeliranje i simulacija 9MHåED Pravljenje elekt ronske kockice 1DSUDYLPRHOHNWURQVNXNRFNLFXLL]UDþXQDMPRYMHURYDWQRüXSRMDYOMLYDQMDEURMDWDþDNDQDNRFNLFL Procedu ra 1.Poglavlje 4.

pokazuje samo 10 podataka. K reiranje radne stranice i rezultat simulacije 8QHVLWH YULMHGQRVWL X VYDNX üHOLMX NDR ãWR MH SULND]DQR QD Slici 9. Broj stvarnih podataka je PHÿXWLP6lika 9. Broj podataka Napravite taþke na kocki ûHOLMD &. 2.SRPQRåLWHJDVD EURMHP L dodajte broj 1.

17 % .³ .

]UDþXQDMWHXþHVWDORVW]DWDþNHQDNRFNL ûHOLMD)Ä &2817.´ .) &&(.

³ .]UDþXQDWDYMHURYDWQRüD ûHOLMD *.

Ä ))³ 8NXSQDYMHURYDWQRüD ûHOLMD *.

Ä 680 **.

.³ Slika 9. Pravljenje elektronske kockice 3. Analiza i pregled rezultata simulacije 3URYMHULWH SULEOLåDYD OL VH YMHURYDWQRüD EURMD WDþDND NRFNLce broju  DNR SRYHüDWH EURM podataka.

ako bude pismo. pomjerite se za 1 u smjeru Y-ose.ROLNDMHYMHURYDWQRüD GDüHWHVWLüLGRWDþNH . . 2YRP IXQNFLMRP VH GROD]L GR QDMYHüHJ FLMHORJ EURMD NRML QH SUHOD]L RGUHÿHQX EURMþDQX vrijednost. Zadata k %DFLWHQRYþLüDNRSDGQHJODYDSRPMHULWHVH]DXVPMHUX.-ose.

SRVOLMH 10 bacanja? 114 .

'/!0'&'1#" :%6>&8'" 2-34/! 5#3'6#! " Primjer 8.#$%1%!8-9'36'" Drugi kupac je ispred. PRUDPVDþHNDWL.-&8" *ĀLFD/! 0'&'1#" 2-34/! 5#3'6#! " 2. K ada nema ljudi na elekt ronskoj kasi (nema poretka) 9ULMHPH NDGD NXSDF GRÿH MH SRþHWQR vrijeme usluge. Poredak na automatu za prodaju karata u zabavnom parku U zabavnom parku je automat za prodaju karata za zabavni park.#$%1%!8-9'36'" Kasa je otvorena.#$%1%!8-9'36'" *ĀLFD/!0'&'1#" <=!3%6>&8#" K asa " 28$#.#$%1%!8-9'36'" *ĀLFD/!0'&'1#" <=!3%6>&8#" K asa :%. 2-34/!5#3'6#" 7. Prethodni kupac je na elekt ronskoj kasi (postoji queuing/poredak) $NRVOMHGHüLNXSDFGRÿHSULMHQHJRãWRMHSUHWKRGQLNXSDFXVOXåHQNXSDF koji dolazi kasnije PRUD GD þHND GRN VH QH ]DYUãL XVOXåLYDQMH NXSFD NRML MH X UHGX SULMH QMHJDQMH 8 RYRP VOXþDMX YULMHPH NRMH SURWHNQH RG PRPHQWD XVOXåLYDQMD NXSFD LVSUHG QMHJDQMH MH SRþHWQR YULMHPH XVOXåLYDQMDNXSFDNRMLGRÿHNDVQLMH 7. 1. Na mjestu gdje se redovi formiraju. neophodno je XVNODGLWL YH]X L]PHÿX EURMD XUHÿDMD L YUHPHQD þHNDQMD NXSFD Razmislimo o tome na primjeru supermarketa s jednom elektronskom kasom. Periodi dolaska kupaca su LVSLVDQLNDRNXPXODWLYQDYMHURYDWQRüDXWDEHOLL LQWHUYDO MHGRGLMHOMHQ. 7R ]QDþL SUHWKRGQL NXSDF MH RWLãDR V HOHNWURQVNHNDVHSULMHQHJRãWRVOMHGHüLNXSDFGRÿH 7.Poglavlje 4. Modeliranje i simulacija 3.koja YUVWDSRUHWNDMHPRJXüD]DNXSDFDDNRLVSUHGDXWRPDWDQHPDNXSDFD 115 . Simulacija poretka 5HG NXSDFD NRMH WUHED XVOXåLWL QD XUHÿDMX ]D SURGDMX NDUDWD L HOHNWURQVNRM EODJDMQL X supermarketu zove se queuing/poreda k.]YHGLWHVLPXODciju. 2-34/!5#3'6#" 7.

Periodi dolaska kupca mogu se odrediti dodjeljiYDQMHP VOXþDMQLK EURMHYD NRML RGJRYDUDMX NXPXODWLYQRMYMHURYDWQRüL9ULMHPHXVOXJHMHRJUDQLþHQRQDVHNXQGL M"('$"#I" 3HULRGGRODVNDNXSFD SURãODVLWXDFLMD.Poglavlje 4. Modeliranje "Periodi dolazaka kupaca" i "vrijeme usluge" su dva glavna elementa za modeliranje poretka. Modeliranje i simulacija Procedu ra 1.

6# A')%*B#B*$".9"# J.'9F-B"K# 8þHVWDORVW# 4F.F$"6%5-"# YMHURYDWQRüD# 9MHURYDWQRüD# LOLYLãHPDQMHRG# # # # # LOLYLãHPDQMHRG# # # # # LOLYLãHPDQMHRG# # # # # LOLYLãHPDQMH#*B#=O# # # # # LOLYLãHPDQMHRG# # # # # LOLYLãHPDQMHRG# # # # # LOLYLãH# # # # # # # # # S9F>-*# " (1) Postavite vrijeme dolaska prvog kupca (kupac 1." 8)'B-&"# 5)%&'B-*.

(2) Provjerite da li je automat otvoren pri dolasku kupca i ako jeste. postavite status automata na ³RWYRUHQR´DDNRQLMHRWYRUHQRSRVWDYLWHQD³VDþHNDMWH´ (3) PRþHWQR YULMHPH XVOXJH MH YULMHPH GRODVND DNR MH DXWRPDW RWYRUHQR L YULMHPH NDGD MH ]DYUãHQDXVOXJD]DNXSFDNRMLVWRMLSULMHQMHJDQMHDNRMHDXWRPDW³VDþHNDMWH´ .QD=DGROD]DNNXSDFDRGGRL]UDþXQDMWH iz kog intervala je umetnuta vrijHGQRVW VOXþDMQRJ EURMD L RGUHGLWH YULMHPH LQWHUYDOD GROD]DND NRML odgovaraju tom intervalu.

. 9ULMHPH NDGD MH XVOXJD ]DYUãHQD MH YULMHGQRVW ]D NRMX VH GRGDMH YULMHPH XVOXJH QD SRþHWQR vrijeme usluge.

H)%&'. na VOMHGHüRM VWUDQLFL SRND]XMH NUHLUDQX UDGQX VWUDQLFX L UH]XOWDW VLPXODFLMH 3HULRGL GRODVND NXSFD X tabeli 1 su uneseni u gornjem dijelu radne stranice. K reiranje radne st ranice i rezultat simulaci je KDR ãWR MH SULND]DQR QD VOLFL  XQHVLWH YULMHGQRVWL X VYDNX üHOLMX ]D NXSFD  Slika 11.9"" T'. 2.9"# ûHOLMD ). 9ULMHPH þHNDQMD MH YULMHPH GRELMHQR NDGD YULMHPH GRODVND RGX]PHPR RG SRþHWQRJ YUHPHQD usluge."# 9F>"7"# ($"G"&-%" -"# 3RþHWQR YULMHPH XVOXJH  YULMHPH B*$".'# B*$".

$FG'# ûHOLMD# JUI3K# VLWI3XYI3V" HULMHPHþHNDQMD# ûHOLMD .. '" 9ULMHPH ]DYUãHWND F.

116 Prvi kupac . )Q!I3V" Slika 10.

Modeliranje i simulacija 6OXþDMDQ EURM MH XQHVHQ X üelije (B14 to B17) na slici 11. i na osnovu te vrijednosti srednja YULMHGQRVWüHOLMD &WR&.Poglavlje 4.

83IXQNFLMX]DüHOLMH &GR&.VHRGUHÿXMHNRULVWHüL/22.

83 %))&&.  /22.

üHOLMH &.

SUHWUDåXMHYULMHGQRVW .

.

üHOLMH %.

L]RSVHJD (F3).

 .

.

 L X üHOLMDPD &&.

 XQXWDU RGJRYDUDMXüHJ LQWHUYDOD .

.

 SRGDFL NRML RGJRYDUDMX YULMHGQRVWLüHOLMH %.

VXSULND]DQL .

.

0HÿXWLPNDGDQHPDRGJRYDUDMXüLKSRGDWDNDXüHOLMDPD )).

 QDMYHüD YULMHGQRVW PDQMD RGWUDåHQH YULMHGQRVWL MH SULND]DQD 8 RYRP VOXþDMX YULMHGQRVW üHOLMH %.

 MH  üHOLMD ).

 þLMD MH YULMHGQRVW  MH QDMYHüD YULMHGQRVW PDQMD RG YULMHGQRVWL NRMD VH WUDåL D YULMHGQRVW  üHOLMH &.

 NRMD RGJRYDUD WRM YULMHGQRVWL SULND]DQD MH X üHOLML &.

"6"# ûHOLMD# JWI=K# VLDWJ_I=LV*>'-V\!I=\UI3KV" . A)*7%&'-&'-*# .$%&'#B*$".#"F6*.6"6F."6"# ûHOLMD (.# "F6*.]UDþXQDYDQMHYUHPHQDGRODVND# ûHOLMD#J!I=K#VL!I3X/I=V" H)'.*.]UDþXQDWR QD LVWL QDþLQ NDR 1"#9F>7"#I# ûHOLMD#JUI=K#VLWI=XYI=V" .'-.9%# >')%*B# >)%&'# B*$".9"# 9F>7"#2#>*.9"#9F>7"#I# ûHOLMD#J?I=K#VLRNT!JKV" 86"6F.

  . 3HULRGLGRODVNDNXSFDLVWDQMHDXWRPDWD EXGXüDSURJQR]D.) '!LUI3\# V*65*)'-*V\VSULþHNDMWHVKV" .]UDþXQDY"-&'#>')%*B"#B*$".9"#9F>7"#I#%$%#9F>7"#2# ûHOLMD#J/I=K#VLZ[[4SAJ?I=\W]<\/]3^/]<KV# Slika 11.

$FG'K# VH ãLUL QD G'.6F>7'.'# þHNDQMD *(*&'-*# H)%&'. 3. Analiza i pregled rezultata simulacije 7HãNRMHYLGMHWLSURPMHQXSRUHWNDYUHPHQRPQDRVQRYXSOLNH7R]QDþLPRåHWHSURYMHULWL SRVWRMDQMHSRUHWNDL]DXWRPDWDLGXåLQXYUHPHQDþHNDQMDL]YUHPHQDþHNDQMDPHÿXWLPPRåHWH vidjeti koliko je ljudi u redu.-F# VWUDQXRG]DYUãHWNDXVOXJH# MH !*$"1"9# 9F>7"#2# 9ULMHPHþHNDQMD 9F>7"#2# Slika 12.C# !*$"1"9# 3RþHWDNXVOXJH# !*$"1"9# 9F>7"# I# P# F.$FG'# H)%&'. PRåHWH YLGMHWL GD VH SRUHGDN PLMHQMD YUHPHQRP 9RGRUDYQD RVD SUHGVWDYOMD YULMHPH D YHUWikalna RVD  SUHGVWDYOMD NXSFD 1DSUDYLWH GLMDJUDP SRþHWND XVOXJH YUHPHQD XVOXJH L ]DYUãHWND XVOXJH 4"B"# &'# >')%*B# B*$".$FG"# 1"# >)'6@*B-*G# 9F>7"# -%&'# ]DYUãHQD# 6"9*# B"# -*5%# 9F>"7# .#.'# F.'#F. =ERJ WRJD DNR SUHWYRULWH SURPMHQX SRUHWND X JUDILNRQ NDR ãWR MH SULND]DQR na Slici 12.$FG'# F.$FG"#&'#>*þHOD# =DYUãHWDNXVOXJH]DNXSFD#I# 3RþHODXVOXJD]DNXSFD#2# # =DYUãHWDN F.#@*)%1*-6"$-%. 3RORåDMJUDILNRQDUHGDQMD 117 =DYUãHWDNXVOXJH]DNXSFD# . A')%*B# *B# B*$".6F>"7# J5)%&'.9"# &'B-*G# 9F>7"# B*# ]DYUãHWND XVOXJH SUHGVWDYOMHQR MH (%&'$%.*)"# þHNDWL# GRN VH QH ]DYUãL XVOXJD ]D >)'6@*B-*G# 9F>7"# %# (%&'$%# .9"# 9)"6"9\# "# (Slika 12).

Poglavlje 4. Modeliranje i simulacija $NR SRVPDWUDWH JUDILNRQ L SURYMHULWH EURM RERMHQLK VWXEDFD PRåHWH YLGMHWL GXåLQX SRUHWND (SOLNDD.

U rezultatu na slici 13.'#J. QDMGXåLUHGMHRGRVREHLVHNXQGLQDMGXåHYULMHPHþHNDQMDMH sekundi za kXSFDLSURVMHþQRYULMHPHþHNDQMDMHVHNXQGL J"K#8%.$NRSRVWDYLWHEURMNXSDFDNRMLþHNDMXLYULMHPHPRåHWHQDSUDYLWLJUDILNRQ vremenske promjene u redanju (Slika 13 b).F$"7%&"#>*)'69"" H)%&'.'9F-B"K" 4F>"7" E.

'#J. Grafikon poretka .'9F-B"K" Slika 13.'XåLQDUHGD" 'XåLQDUHGDQMD OMXGLK" H)%&'.

640 ilLYLãHLPDQMHRG kupac dolazi u periodima srednje vrijednosti 25 sekundi. 8SRUHGLWH YULMHGQRVW VOXþDMQRJ EURMD L UHG EURMþDQH YULMHGQRVWL NXPXODWLYQH YMHURYDWQRüH L usredsredite se na liniju vrijednosWL NXPXODWLYQH YULMHGQRVWL þLMD MH EURMþDQD YULMHGQRVW YHüD RG QDMEOLåHYULMHGQRVWLVOXþDMQRJEURMDWHXSRWUijebite srednju vrijednost te linije kao perioda dolaska. 1SUNDGDVOXþDMDQEURM postoji u intervalu od 0. .

Postavite 10 miliona ljudi za populaciju korisnika. 2YR MH IXQNFLMD ]D SUHWUDåLYDQMH RGUHÿHQH YULMHGQRVWL LQWHUYDOD L SULND] YULMHGQRVWL üHOLMH X RGJRYDUDMXüHPLQWHUYDOX 9MHåED . 2.]YHGLWHVLPXODFLMXGDSURYMHULWHNDNRVHPLMHQMDYULMHPHþHNDQMDNDda je vrijeme usluge 20 sekundi ili 25 sekundi. VWRSX SRYHüDQMD  KLOMDGH OMXGLJRGLãQMH YUHPHQVNL LQWHUYDO QD  JRGLQX L ]DYUãHWDN QD  godina. 0RGHOPDWHPDWLþNRJL]UD]DMHSUHGVWDYOMHQQDVOMHGHüLQDþLQ Populacija korisnika poslije promjene = trenutna populacija korisnika + stopa poveüanja îtrenutna populacija korisnika îvremenski period. Postavite stopu promjene temperature na 0.3 i simulirajte SURPMHQXWHPSHUDWXUH]DPLQXWDSRPRüXYUHPHQVNRJLQWHUYDODRGPLQXWH 118 . Klima XUHÿDM NRML KODGL L JULMH LQVWDOLUDQ MH X SURSRUFLML V UD]OLNRP L]PHÿX WUHQXWQH VREQH temperature i postavljene temperature. Izvedimo simulaciju za korisnike Interneta. 9MHåED]DNUDM 1.

&'-'# 6'. 2GOXþHQRMHda VHQDSODWLSRMHQDRGXþHQLND2GUHGLWHVOXþDMDQEURML]LQWHUYDOD .2.>')"6F)'" A*. Modeliranje i simulacija Dijagram modela je prika]DQQDGHVQRMVOLFL3RþHWQDWHPSHUDWXUDMHƒ&DSRVWDYOMHQDWHPSHUDWXUH MHƒ& ?)1%-"#>)*.&'-'" 86*>"# >)*.>')"6F)"" R"1$%9"# 6'.>')"6F)'" M'.>')"6F)'" 3. Kada je koeficijent grijanja za model temperature vode u kadi u prethodnom zadatku 0.6"5$&"-&'# 6'.Poglavlje 4. kada je trenutna temperatura YRGHƒ& a postavljena temperatura MH ƒ& SRVWDYLWH NRHILFLMent grijanja tako da temperatura vode dostigne postavljenu temperature za otprilike 20 minuta i izvedite simulaciju s vremenskim intervalom postavljenim na 1 minutu'RÿLWHGRPLQLPDOQRJNRHILFLMHQWDJULMDQMD]DWHPSHUDWXUHYRGHRGƒ& LOLYLãH]DPLQXWD 4. L]YHGLWHVLPXODFLMXNRULVWHüLDODWPRGHOLUDQMD 5. Za model temperature vode u kadi u zadatku dijela 2.

Izvedite simulaciju za promjenu prodaje unutar 10 dana. 119 .000 jena treba donijeti ]DLOLYLãHLL]YHGLWHVLPXODFLMXNDNRELste SURYMHULOLNROLNRQRYþLüDRG jena treba pripremiti.L RGOXþLWHGDQRYþLüRG jena treba donijeti ]DPDQMHRGDUDþXQRG. Prodaja digitalnog fotoaparata je provjeravanD ]D SURãOLK  GDQD X SURGDYnici i rezultat je prikazan u desnoj tabeli. 6.

8SUDYOMDQMHSRVWRMHüLPLQIRUPDFLMDPD """"""""""""""""""""""""""""""""""""""""""""""""""" " 1 3ROMHMHQDMPDQMDORJLþNDMHGLQLFDSRGDWND6NXSSROMDNRMLVHRGQRVLQDLVWLSRMDPQD]LYDVHVORJDVNXSVORJRYDþLQL datoteku.RGXÿHQLND Klub ejzbol tenis PC fudbal tenis PC Suprotnost se pojavljuje jer se svaka datoteka posebno RGUåDYD. podataka Upotreba i k reiranje baze Dio1.RGXÿHQLND Klub .Poglavlje 5. Ovakva organizacija dovodi i do dupliranja podataka i rasta obima podataka. 120 . 'DWRWHND6DYMHWDXþHQLND Zdravstveni kartoni Datoteka svih ãNROH                   XþHQLND              XþHQLNDãNROH . %D]DSRGDWDNDLSUHWUDåLYDQMHLQIRUPDFLMD Informacije GDQDV GRELMDMX VYH YHüL ]QDþDM pa se javlja problem njihovog organizovanja. Organizacija podataka u datoteke1 QD]LYD VH NRQYHQFLRQDOQLP QDþLQRP RUJDQL]DFLMH SRGDWDND D RUJDQL]DFLMD podataka u vidu integrisanih podataka naziva se baza podataka.RGXÿHQ#6' Klub bejzbol tenis PC 2KNOXEMHUD]OLþLW þDN L ]D LVWL NRG XþHQLND . âWDMHED]DSRGDWDND" 1) Osobine baza podataka Baza podataka se deILQLãH NDR VNXS FHQWUDOL]RYDQLK podataka tako da se obrada podataka i QMLKRYRSUHWUDåLYDQMH PRåHXVSMHãQRSULPMHQMLYDWL 2UJDQL]DFLMD SRGDWDND X GDWRWHNH GRYRGL GR WRJD GD UD]OLþLWH GDWRWHNH VDGUåH LVWH SRGDWNH þLPH VH RWHåDYD QMLKRYR RGUåDYDQMH L QHSRWrebno zauzimanje memorijskog kapaciteta. Slika 1. Upotreba i kreiranje baze podataka Poglavlje 5. Pod organizacijom podataka podrazumijeva se njihovo predstavljanje i povezivanje. U ovom poglavlju objasnit üHPR pRMDP ED]H SRGDWDND VYUKX NRULãWHQMD ED]H SRGDWDND L SUHWUDåLYDQMD LQIRUPDFLMD NDNR ELVPR SURQDãOLSRWUHEQHSRGDWNH 1.

65'-%#9")6*-%# 8þHQLFLãNROH Slika 2. VYDNLNRULVQLþNLSURJUDPREXKYDWDSRGDWNHXRGJRYDUDMXüRMVWUXNWXULi formatu. # ?'@'!4-8'+'6'! . 2) 4$F( I:3a# # ?'&1(*$# . baza podataka. NRULãWenje podataka nije uvjetovano SR]QDYDQMHPXQXWUDãQMHRUJDQL]DFLMHED]HSRGDWDND SRVWRMHüHDSOLNDFLMHQHPRUDMXVHSRQRYRSURJUDPLUDWLSULXYRÿHQMXQRYRJVRIWYHUDLKDUGYHUD ODNãHVH]DGRYROMDYDSRWUHED]DEXGXüLPSURãLUHQMHPbaze podataka novim podacima.RGXþHQLND# # 4$F(# Upravljanje informacijama pomoüX baze podataka # Funkcije baze podataka 3ULVWXS L NRULãWHQMH SRGDWDND L] ED]H SRGDWDND RPRJXüHQR MH SURJUDPLPD NRML VH QD]LYDMX sistem za upravljanje bazom podataka (DB MS-Data Base M anagement Systems). Kod baza podataka nema dupliranja podataka i novi podaci se jednostavno mogu dodavati. smanjuje se dupliranje podataka. Moguüe je poveüati poslovanje ili poboljãati kvalitet i pouzdanost informacija. tj. SRSUDYLOXNRULVWLYHOLNLEURMNRULVQLND)RUPLUDQMHP]DMHGQLþNHED]HSRVWLåXVHVOjHGHüLFLOMHYL 1. Bazu podataka.RGXþHQLND `B)"5. tako da se baze podataka koriste u gotovo svim organizacijama. ]DMHGQLþNLQDþLQSULVWXSDSRGDFLPD]DVYHNRULVQLNHRPRJXüDYDRODNãDQXNRQWUROXL]DPMHQX 121 .Poglavlje 5. # 6DYMHWXþHQLNDãNROH# # # *UHãDNDQHma jer su SRGDFL VPMHãWHQL X bazu podataka. Upotreba i kreiranje baze podataka Ovi nedostaci se prevazilaze organizacijom podataka u vidu integrisanih podataka.

H ijera rhijska stu r ktura H ijera rhijski tip zasniva se na strukturi u kRMRM VX SRGDFL XUHÿHQL YH]RP URGLWHOM-dijete. mreåna baza podataka zasniva se na mreåi podataka povezanih tako da ne postoji ni korijenski ni podreÿeni segmenti8RVQRYLMHRYRKLMHUDUKLMVNDVWUXNWXUDPHÿXWLPQHVDPRGDURGLWHOMLPDYLãHRGMHGQRJ GMHWHWD QHJR L GLMHWH LPD YLãH RG MHGQRJ URGLWHOMD VLãHVWUXNH NODVH YH]H URGitelj-dijete (set) mogu biti predstavljene PUHåQLP WLSRP. U uvjetLPD NDGD VX YH]H L]PHÿX SRGDWDND MHGQRVWDYQH L PDOREURMQHPUHåQDLKLMHUDUKLMVNDVWUXNWXUD]DGRYROMDYDMXSRWUHEHNRULVQLND 8 PUHåQRM VWUXNWXUL Slika 4. M iss. 5RGLWHOM PRåH GD LPD YLãH RG MHGQRJ GMHWHWD DOL GLMHWH LPD VDPR MHGQRJ URGLWHOMD 2YD VWUXNWXUD podataka ima oblik stabla. C hiho ku 2â Toshima 2â H arusawa M2â Toshima 2â H arusawa 2â " M iss . razred 2. Sastoji se od korijenskRJ VHJPHQWD L QMHPX SRGUHÿHQLK VHJPHQDWD 1DGUHÿHQL VHJPHQWL PRJX LPDWL YLãH SRGUHÿHQLK VHJPHQDWD D SRGUHÿHQL VHJPHQWL PRJX LPDWL VDPRMHGDQQDGUHÿHQL Npr. B M r. Vrste baza podataka 1) Klasifikacija prema strukturi 'HILQLVDQLRGQRVL]PHÿXSRGDWDNDXED]LRGUHÿXMHJOREDOQXORJLþNXVWUXNWXUX2GQRVLL]PHÿX SRGDWDNDPRJXVHSUHGVWDYLWLRGUHÿHQLPVWUXNWXUDPDSRGDWDND3RVWRMHþHWLULORJLþNHVWUXNWXUHED]D SRGDWDNDKLMHUDUKLMVNDPUHåQDUHODFLRQDLREMHNWQD 1. D M iss.Poglavlje 5. O P Slika 3. razred 1. E M r. M reåna st ru ktura Za razliku od hijerarhijske baze podataka i hijerarhijske strukture podataka. Upotreba i kreiranje baze podataka 2. razred dodati u hijerarhijskoj strukturi. " A M r.. *UXSLãLPR þODQRYH ýODQVYDNRJ razreda EHM]ERO NOXED X RVQRYQRM ãNROL ]D VYDNL UD]UHG $NR åHOLPR GD SUHGVWDYLPR GD VX þODQRYL % L O RERMLFDEDFDþLWDNYXYH]XQHPRåHPR 3. predstaYLPR SR]LFLMH XþHQLND u klubu (Slika 3). C M iss. Hijerarhijski tip 2.

 &KLKRNX RVQRYQH ãNROH &KLKRNX RVQRYQD ãNROD L QMHQ ELYãL XþHQLN.

 7RVKLPD RVQRYQH ãNROH VHW EDFDþD EDFDþ L þODQ þLMD SR]LFLMD MH EDFDþ.

122 . VHW KYDWDþD LWG mogu biti predstavljeni.

'@. a u jednoj koloni postoji samo jedna vrsta podataka.'@. Svaka tabela je ekvivalentna i nezavisna. koGRPþODQDSDOLFDPDDPRJXüHMHLEURMHPXGDUDFD Klasifikacijska tabela RVQRYQHãNROH" 7DEHODþODQRYD" . 015 O HS002 016 P HS003 Slika 5.Poglavlje 5./! A! " ?! " " 5. .%8 ! G/!.>3'K'! 2ã! " " I-3H#1'! ! 2ã" " J'.RG ELYãH RVQRYQH ãNROH 001 A HS001 002 B HS001 003 C HS002 . Za hijerarhijski i mUHåQL WLS VDPL podaci (Slika 3) i veza L]PHÿX VYDNRJ SRGDWND Slika 4) predstavljene su linijama. U ovoj strukturi ne postoje grupe koje se ponavljaju i VYDND üHOLMD WDEHOH SUHGVWDYOMD MHGDQ SRGDWDN . Npr./! "! " " 5#33/! B! " 5#33/! 5. Kod relacione ED]HSRGDWDNDSRGDFLVHVPMHãWDMXXWDEHOHL povezuju se relacijama..RGþODQD .'@. Upotreba i kreiranje baze podataka ! ýlan svakog razreda ! F/!.. Relacijski tip 123 .. lijeva tabela na SOLFL  MH WDEHOD þODQRYD NRQILJXULVDQD NRGRP þODQD LPHQRP þODQD L NRGRP ELYãH RVQRYQH ãNROH D GHVQD WDEHOD MH NODVLILNDFLMVND WDEHOD RVQRYQH ãNROH NRQILJXULVDQD NRGRP ELYãH RVQRYQH ãNROH L LPHQRP RVQRYQH ãNROH 3RUHGWRJDWDEHOD þODQRYD NRQILJXULVDQD VD NRGRP þODQD SR]LFLMRP UD]UHGRP L RGMHOMHQMHP NRGRP L] VWDUH RVQRYQH ãNROH WDEHOa rezultata konfigurisana je NRGRP XWDNPLFH GDWXPRP SURWLYQLþNRP ãNRORP WDbela rezultata konfigurisana kodom igre. 0UHåQLWLS 3.RORQH LPDMX VYRM QD]LY UHGRYL VH UD]OLNXMX PHÿX sobom..-! " " " %DFDÿ! ! ! 0HQDGæHU! " " " Slika 4. .%8! "H#H-6>! 2ã" "H#H-6>! 2ã! I-3H#1'! ! 2ã" J'.>3'K'! 2ã! " " 5#33/! 5.. Relaciona baza podataka Predstavljanje podataka dvodimenzionalnim tabelama predstavlja relacijsku st ruktu ru.PHþODQD ./! 5#33/! D! E" ! ! C! " " +YDWDÿ! 6HWEDFDÿD" 6HWKYDWDÿD" " ! L#$%.RG ELYãH RVQRYQH Ime ãNROH  osnovne ãNROH HS001 Tomokita HS002 Toshima HS003 Harusawa ...%8 </!.

Relacioni pristup zasnovan je na relacionoj matematici. Prikupljene primarne informacije zovu se þinjeniþna baza podataka. istraåivanjem terena ili prikupljanjem eksperimentalnih podataka itd. odnosno kolone. 5HODFLMDMHMHGQR]QDþQRLGHQWLILNRYDQDNOMXþHPUHODFLMH6YDNDUHODFLMDPRUDLPDWLNOMXþ Selekcija Join Projekcija Red (record) L]YXþHQ Kolona (record) je L]YXþHQa je Jedna tabela je napravljena RGYLãHWDEHOD Slika 6. Prikaz relacijske operacije 2) Klasifikacija u zavisnosti od oblika informacije Prima rna informacija je informacija koja se direktno prikupi pregledom terena. Baza podataka ýLQMHQLþQDEDza podataka Referentna baza podataka %URMþDQHLQIRUPDFLMH VWDWLVWLþNLSRGDFLLWG) 6YRMVWYHQLSRGDFL GRNXPHQWFLMHOLWHNVWUDþXQDLWG. a prikupljene sekundarne informacije zovu se referentna baza podataka. Upotreba i kreiranje baze podataka Relaciona baza podataka sastoji se od relacija. knjige.Poglavlje 5. Sekundarna informacija je informacija dobijena ureÿivanjem ili obradom (1) primarnih informacija kao ãto su novine. Skup vrijednosti jednog podatka. zove se domen. Relaciona algebra je potrebna za precizan opis operacija koje se izvode nad podacima X UHODFLRQRM ED]L SRGDWDND 9HüLQD UH]XOWDWD UHODFLRQH PDWHPDWLNH PRåH VH QHSRVUHGQR SULPijeniti na relacione baze podataka. podaci i Web-stranice na Internetu.

itd. eksperimentalno posmatranje itd. Ɣ'HILQLFLMDVHNXQGDUQLKLQIRUPDFLMDXELEOLRWHNDUVWYX U ELEOLRWHNDUVWYX VH NRULVWH VHNXQGDUQH LQIRUPDFLMH 3ULPMHU NDWDORJ UREH ERWDQLþND VOLNRYQLFD VWDWLVWLþNDNQMLJDNDWDORJNQMLåDUHPDJazin itd. Prikaz informacija (dizajn crtanja.) Vizuelne informacije (prirodno posmatranje.) Audio informacije (audio.) Slika 7. muzika itd.) Svojstvene informacije (dokument. mapa itd. Klasifikacija baze podataka (1) Kod sekundarnih informacija moraju biti ukljuþene informacije u kojima moåete vidjeti koje vrste primarnih informacija su koriãtene. 124 . bibliografija .

2. Trenutno se ova baza podataka najviãe koristi. Slika 8. telefonski imenik. Ovi rMHþQLFLVH]RYXLdatabase package. i sve ãto ima veliku koliþinu podataka pretvara se u bazu podataka i objavljuje kao elektronski rjeþnik. Sveobuhvatna upotreba baze podataka u -DSDQXSRþHODMHUH]HUYDFLMDPDPMHVWDQD-DSDQVNRMQDFLRQDOQRMåHOMH]QLFLNRMHMHSRþHORãH]GHVHWLK JRGLQDSURãORJYLMHNDL$70EDQNRPDWD Sistem rezervisanjDVMHGLãWD Ranijih godina. To se kasnije nazvalo bazom podataka. Primjer programa baze podataka database package 4) Historija baze podataka 3HGHVHWLK JRGLQD SURãORJ YLMHND DPHULþNH VQDJH VDNXSLOH VX L NRULVWLOH LQIRUPDFLMH R VWDnju svojih potreba. 1. Rijeþnici kao ãto je japanski rjeþnik i japansko-engleski rjeþnik. O ffline baza podataka 2YR MH ED]D SRGDWDND NRMD VH QDOD]L QD QHNRP RG PHGLMD NDR ãWR VX CD-ROM i DVD.Poglavlje 5.DGD EL VH ]DKWMHY ]D UH]HUYLVDQMHVMHGLãWDSULKYDWLRQDEODJDMQLRVREOMHEODJDMQHELQD]YDORED]QXVWDQLFX (kancelarija za UH]HUYDFLMH. O nline baza podataka 2YR MH ED]D SRGDWDND NRMX PRåHWH SUHWUDåLYDWL NDGD åHOLWH L X VWYDUQRP YUHPHQX MHU MH NRULVQLþNLWHUPLQDOLVHUYHUED]HSRGDWDND povezan komunikacijskom linijom. dijelimo ih na online bazu podataka i offline bazu podataka. Upotreba i kreiranje baze podataka 3) Klasifikacija prema vrsti medija 8]DYLVQRVWLRGYUVWHPHGLMDQDNRMRMMHVPMHãWHQDED]DSRGDWDND. enciklopedije. rezervaciMD NDUDWD ]D YR] ELOD MH UXþQR SURYRÿHQD . slikovnice.

i to samo pristupom bazi podataka. Pored toga. godine.RULãWenje RYH PHWRGH ]DKWMHYDOR MH PQRJR YUHPHQD ]D UH]HUYLVDQMH VMHGLãWD WDNR GD MH ELOR WHãNR SRYHüDWL RJUDQLþHQXEU]LQXUDGDLWG Da bi se RODNãDR QDþLQ UH]HUYDFLMH razvijen je jedinstven sistem za upravljanje kartama. 125 .. 5RÿHQMHSUYLVYMHWVNLVLVWHPUH]HUYDFLMDVMHGLãWDXYR]X6RYLP WUHQXWQRMHRPRJXüHQDUH]HUYDFLMD V LQVWDOLUDQH RSUHPH QD WHUPLQDOX QD VWDQLFL X SURGDYQLFDPD SXWQLþNLK NDUDWD PC-ju . JGMH VH QDOD]LR SODQ VMHGLãWD X YR]RYLPD L RVRED ]DGXåHQD ]D XSUDYOMDQMH SODQRP L]YXNOD EL PDSX VMHGHQMD X YR]X ]D WUDåHQL GDWXP WH SURYMHULOD EURM VMHGLãWD NRML WUHED L]GDWL L obavijestila osoblje blagajne od kojeg je on/ona primio zahtjev. osoblje na blagajni bi zapisalo informaFLMX R EURMX VMHGLãWD X YR]X QD NDUWL L QD NUDMX EL NDUWD PRJOD ELWL SURGDWD =D RYDNDY QDþLQ UH]HUYDFLMD ELOR MH SRWUHEQR PQRJR YUHPHQD L WUXGD =ERJ RYDNYRJ QDþLQD UDGD SRQHNDGELGRãORGRJUHãNH]ERJORãHWHOHIRQVNHYH]HLOLYR]NRMLPMHNOLMHQWåHOLR putovati nekad ne bi imao prazno mjesto dok je drugi klijent bio u redu na blagajni ]DUH]HUYLUDQRVMHGLãWH. mobilnim telefonom itd. 3RþHYãL RG XVOXJH L]GDYDQMD UH]HUYLVDQLK NDUDWD ãH]GHVHWLK JRGLQD SURãORJD YLMHND UD]YLMHQ MH  *UHHQ &RXQWHU QDPLMHQMHQ ]D SURGDMX UH]HUYLUDQLK NDUDWD L SXãWHQ X XSRWUHEX 965.

Upotreba i kreiranje baze podataka 3. 3UHWUDåLYDQMHLQIRUPDFLMD 1) 3UHWUDåLYDQMHLQIRUPDFLMDLSURJUDP]DSUHWUDåLYDQMH 3UHWUDåLYDQMHSRWUHEQLKLQIRUPDFLMHXED]LSRGDWDND]RYHVHSUHWUDåLYDQMHLQIRUPDFLMD(I R).QWHUQHWX SRVWRML XVOXJD SUHWUDåLYDQMD NRMX RPRJXüDYD SUHWUDåLYDþ SURJUDP]DSUHWUDåLYDQMH.Poglavlje 5. Online baza podataka i elektronski rMHþQLNLPDMXUD]OLþLWHVLVWHPHSUHWUDåLYDQMD Na Web-stranici koju koristimo QD .

.DGD MH WHPD LQIRUPDFLMH XUHÿHQD WDNR GD SUHWUDåLYDQMH PRåH ELWL REDYOMHQRRG ãLURNRJ SRMPa ka manjem pojmu to je kategorija. U PQRJRVOXþDMHYDNUHDWRU:HE-stranice direktno napravi popis podataka. 2. XSRWUHEDSURFHGXUH]DSUHWUDåLYDQMHMHMHGDQRGQDþLQDSUHWUDåLYDQMDLQIRUPDFLMD Ako ]D SUHWUDåLYDQMH LQIRUPDFLMD NRULVWLPR XUHÿDM ]D SUHWUDåLYDQMH XNOMXþHQH VX VOjHGHüH metode: 1. Direktorijska v rsta (regist racijski tip) S direktorijskom YUVWRP XUHÿDMD ]D SUHWUDåLYDQMD LQIRUPDFLMH VX UXþQR XUHÿHQH QD RVQRYX VDåHWLK informacija.DWHJRULMVNR SUHWUDåLYDQMH MH PHWRGD SUHWUDåLYDQMD FLOMQLK LQIRUPDFLMDSUDWHüLNDWHJRULMX 2. 3UHWUDåLYDQMHSRPRüXNOMXþQHULMHþL 5LMHþ NRMD QDP JRYRUL R SRMPX SUHWUDåLYDQMD ]D SUHWUDåLYDQMH LQIRUPDFLMD ]RYH VH NOMXþQD ULMHþ. Ako Web-stranicu na Internetu smatrate bazom podataka. Kao rezultat. 2) 9UVWHSURJUDPD]DSUHWUDåLYDQMH 1. SRX]GDQRVW VDGUåDMD je velika i ima manje nepotrebnih informacija. 3UHWUDåLYDQMH SRPRüX NOMXþQH ULMHþL MH PHWRGDSUHWUDåLYDQMD FLOMQLK LQIRUPDFLMD XQRVRP NOMXþQH ULMHþL Pravilo %LORNRPRåHSULPLWLLQIRUPDFLMHV. 3UHWUDåLYDQMHSRNDWHJRULMDPD .QWHUQHWD9MHURGRVWRMQRVWRFMHQMXMHRQDMNRMLSULPDLQIRUPDFLMH 7UHEDYRGLWLUDþXQDRDXWRUVNLPSUDvima nad tim informacijama. 5RERWVNLWLS WLSSUHWUDåLYDQMDFMHORNXSQRJWHNVWD. .

6URERWVNRP YUVWRPSURJUDPDSUHWUDåLYDQMDSURJUDPNRMLVH]RYH :HE-robot periodLþQRSDWUROLUD Web-VHUYHURP .

DR UH]XOWDW NROLþLQD LQIRUPDFLMDMHYHOLNDLXNOMXþHQRMHPQRJRQHSRWUHEQLKLQIRUPDFLMD (1) Ovo je kompjuter QDNRPHMHVPMHãWHQD:HE-stranica na Internetu. Zadata k Uporedite svojstva direktorijVNH YUVWH SUHWUDåLYDQMD SURJUDPD SUHWUDåLYDQMD L URERWVNRJ WLSD SUHWUDåLYDQMD 126 . NDNR EL VDNXSLR LQIRUPDFLMH L DXWRPDWVNL LK VUHGLR .

3UHWUDåLYDQMH:HE-stranice .OLNQLWHQDQDVORY LQIRUPDFLMHROLQNX. 8QRVNOMXþQHULMHþL 8QHVLWHPX]HMX7RNLMXXSROMHXQRVDNOMXþQHULMHþL$NRSULWLVQHWHWDVWHU]DSUHWUDåLYDQMH LQIRUPDFLMHNRMHVHWLþX7RNLMDLPX]HMDSRþLQMXVHSUHWUDåLYDWL 3. Upotreba i kreiranje baze podataka 3) 3UHWUDåLYDQMHLQIRUPDFLMDSRPRüXNOMXþQHULMHþL 9MHåED 3UHWUDåLWHPX]HMX7RNLMXSRPRüXNOMXþQHULMHþL äHOLWH SURYMHULWL LQIRUmacije koje se odnose na muzej u Tokiju. 3UHWUDåLPR LQIRUPDFLMH NRMH VH RGQRVHQD³PX]HM´X7RNLMXNRULVWHüLSURJUDPSUHWUDåLYDQMD Procedu ra 1.Poglavlje 5. Ako SULWLVQHWHWDVWHU(QWHUSULND]DQDMHVWUDQLFDSURJUDPD]DSUHWUDåLYDQMH 2. 3ULND]SURJUDPD]DSUHWUDåLYDQMH 3RNUHQLWH SUHWUDåLYDþ L XQHVLWH U R L SURJUDPD ]D SUHWUDåLYDQMH X SROMH ]D unos adrese.

]DNRMLPLVOLWHGDVDGUåLFLOMQHLQIRUPDFLMHL]QDÿHQLK informaciMD L SULNDåLWH RGJRYDUDMXüX :HE-stranicu. Suzite izbor LQIRUPDFLMD SUHWUDåLYDQMHP Web-stranica jedne zDGUXJRPLSURQDÿLWHFLOMQX:HE-stranicu. Zadata k 8QHVLWHLPHSRGUXþMDXNRPHåLYLWHL³PX]HM´XSROMH]DXQRVNOMXþQHULMHþLLREDYLWHSUHWUDåLYDQMH 127 .

Poglavlje 5.DGD VX]LWH UH]XOWDW SUHWUDåLYDQMD SUHWUDåLYDQMH VH REDYOMD SRG uvjetom GD VX REMH NOMXþQH ULMHþLÄ$L%XNOMXþHQH2YDPHWRGDSUHWUDåLYDQMD]RYHVH.SUHWUDåLYDQMH 3UHWUDåLYDQMHVHREDYOMDSRGXvjetom GDMHEDUMHGQDRGNOMXþQLKULMHþL$LOL%XNOMXþHQD 2YD PHWRGD SUHWUDåLYDQMD ]RYH se ././. SUHWUDåLYDQMH 6 RE]LURP GD VH SUHWUDåLYDQMH REDYOMD SRG ãLULPXvjetLPDQHJRNRG. 1(SUHWUDåLYDQMH . Upotreba i kreiranje baze podataka 4) 6LVWHPSUHWUDåLYDQMDSRPRüXNOMXþQHULMHþL 3UHWUDåLYDQMH SRPRüX MHGQH NOMXþQH ULMHþL ]RYH VH jednostavni uvjet. 1($.L1(]RYHVH kombinovani uvjet.SUHWUDåLYDQMH . uvjet NRMLSRYH]XMHMHGQXLOLYLãHNOMXþQLKULMHþLULMHþLPD. . S druge strane.SUHWUDåLYDQMDEURMQDÿHQLKUH]XOWDWDVHSRYHüDYD 3. 2../.SUHWUDåLYDQMH. .DGDVX]LWHUH]XOWDWSUHWUDåLYDQMDSUHWUDåLYDQMHVHREDYOMDSRG uvjetom GDNOMXþQDULMHþ$" QLMHXNOMXþHQD2YDPHWRGDSUHWUDåLYDQMD]RYHVH1(SUHWUDåLYDQMH3UHWUDåLYDQMHVHþHVWRREDYOMD kombiniraQMHP L SUHWUDåLYDQMD SRG XvjetRP GD MH NOMXþQD ULMHþ % XNOMXþHQD DOL $  QLMH XNOMXþHQD (KH-9%)! B NE A 3RãWR1(VDPRQHJLUD$WDþQo predsWDYOMDQMHMH%. 1.

1(SUHWUDåLYDQMD 128 .RQFHSWXDOQLGLMDJUDP./.WMQHãWRãWRMH%DQLMH$ Slika 9. ..

Upotreba i kreiranje baze podataka 5) 0HWRGDSUHWUDåLYDQMD . .Poglavlje 5.DGD VH FLOMQH LQIRUPDFLMH QH PRJX SUHWUDåLWL NOMXþQRP ULMHþMX SURJUDPD ]D SUHWUDåLYDQMH GREURMHSURPLMHQLWLPHWRGXSUHWUDåLYDQMD M"('$"#I Situacija Primjer upotrebe SUHWUDåLYDQMDNOMXþQRPULMHþMX" Odgovor %URMSUHWUDåHQLKUH]XOWDWD JIK# Promijenite program SUHWUDåLYDQMDVGLUHNWRULMVNHYUVWHQDURERWVNX je mali vrstu.

3URPLMHQLWHNOMXþQXULMHþQDXRSüHQLSRMDP .

/. ]D.SURPLMHQLWHX./.2EDYLWHSUHWUDåLYDQMHVGRGDYDQMHP.

 .

 2EULãLWH XYMHW NDR ãWR MH ]DYUãQL GDWXP DåXULUDQMD L REDYLWH # SUHWUDåLYDQMH # BrRMSUHWUDåHQLKUH]XOWDWD .

 3URPLMHQLWH SURFHGXUX SUHWUDåLYDQMD V URERWVNH YUVWH QD je veliki direktorijsku vrstu. .

3URPLMHQLWHNOMXþQXULMHþQDXRSüHQLSRMDP .

2EDYLWHSUHWUDåLYDQMHVGRGDYDQMHP.L1( .

2GJRYRULWHãWD]QDþHVOjHGHüLSRMPRYLYDåQL]DREMDãQMDYDQMHED]HSRGDWDND . 'RGDMWH XYMHW NDR ãWR MH ]DYUãQL GDWXP GRpunjavanja podataka i REDYLWHSUHWUDåLYDQMH " 9MHåED]DNUDMSRJODYOMD 1.

(2) ElektronVNLULMHþQLFLNRMLVXXREOLNX&'-ROM-a i DVD-a.1DPLMHQMHQLSURJUDPL]DUHOL]DFLMXUD]OLþLWLKIXQNFLMDED]HSRGDWDND. . 2. UpotrijHELPRSURJUDP]DSUHWUDåLYDQMHSRGVOjHGHüLPXvjetima.

2GDEHULWH]DQLPOMLYXWHPXLRGOXþLWHVH]DMHGQXNOMXþQXULMHþ .

 2EDYLWH SUHWUDåLYDQMH SURFHGXURP GLUHNWRULMVNH YUVWH L SURFHGXURP UREotskog tipa i uporedite EURMSUHWUDåHQLKUH]XOWDWD .

DNRELVWHVX]LOLLOLSRYHüDOLEURMSUHWUDåHQLKUH]XOWDWDRGUHGLWHMRãMHGQXNOMXþQXULMHþ ..

 2EDYLWH . 2EMDVQLWHUD]OLNXL]PHÿXVOjHGHüLKSRMPRYD . SUHWUDåLYDQMH L 1( SUHWUDåLYDQMH V GYLMH NOMXþQH ULMHþL SURFHGXURP direktoULMVNHYUVWHLSURFHGXURPURERWVNRJWLSDLXSRUHGLWHEURMQDÿHQLKUH]XOWDWD 3./. SUHWUDåLYDQMH .

. (2) Primarne informacije i sekundarne informacije.+LMHUDUKLMVNDED]DSRGDWDNDPUHåQDED]DSRGDWDNDUHODFLRQDED]DSRGDWDND.

(5) DirektorijVNDYUVWDSURJUDPD]DSUHWUDåLYDQMHLURERWVNLWLSSURFHGXUD]DSUHWUDåLYDQMH.ýLQMHQLþQDED]DSRGDWDNDLUHIHUHQWQDED]DSRGDWDND. 129 . (4) Offline baza podataka i online baza podataka.

RPSRQHQWDED]HSRGDWDNDNRMRPVHNRULVWLPRNDGDåHOLPRQDüLQHNLSRGDWDN LOL JUXSX SRGDWDND L] MHGQH LOL YLãe tabela na osnovi nekog uvjeta ili parametra (vrijednost koju XQRVLPRVYDNLSXWSULMHSRNUHWDQMDL]YMHãWDMD. QUERY ili UPITI ± . âWDMHUHODFLRQDED]DSRGDWDND" 1) Funkcionisanje programa baze podataka U relacionoj bazi podataka. 1. Upotreba i kreiranje baze podataka Dio 2. Kreiranje baze podataka 'DQDV VX SUHWHåQR u upotrebi relacione baze podataka koje se mogu koristiti na PC-u bez RJUDQLþHQMD 8RYRPSRJODYOMXQDXþLt üHPRRRSüim metodama kreiranja relacione baze podataka. koja se trenutno najviãe koristi. elementi baze podataka su: TABELE ± (Tables) su glavna komponenta baze pRGDWDNDMHUVHXQMLPDQDOD]HVYLSRGDFLVDGUåDQL XED]LSRGDWDND=DEROMXRUJDQL]DFLMXSRGDWDNDSRåHOMQRMHLPDWLYLãHWDEela. moåete lako obraÿivati ili mijenjati podatke povezujuüi dvodimenzionalne tabele.Poglavlje 5. Ako koristite program za kreiranje baza podataka.

ali i mijenjati ih. 2%5$6&. )RUPV.Te podatke moåemo samo gledati.

]YMHãWDMMHQDþLQSULND]LYDQMDSRGDWDNDSULODJRÿHQSULQWDQRPREOLNX STRANICE ZA INTERNET ± 2QHVXVSRMIRUPDLL]YMHãWDMDLVOXåH]DSULND]LYDQMHLXQRVSRGDWDND na Internetu ili intranetu. Red u tabeli se zove slog (record). Potrebno je da neko polje GHILQLãHWHNDRSROMHSULPDUQRJNOMXþD3ROMHSULPDUQRJNOMXþD PRUDELWLXQLNDWQRLQLMHGR]YROMHQR da ima duplirane vrijednosti.SULND]XMXSRGDWNHVDGUåDQHXWDEHODPDLXSLWLPDLRPRJXüDYDMXGDGRGDWHQRYH SRGDWNHLDåXULUDWH LOLREULãHWHSRVWRMHüHSRGDWNH 5(3257. Slika 1. 130 . RQGD]DWDNYRSROMHNDåHPRGDMH]DYLVQR od onog drugog polja.LOL.± .=9-(â7$-. Kombiniranjem ovih komponenata i njihovo povezivanje i sinhroniziranMHþLQLED]XSRGDWDND âWRVXNRPSRQHQWHEROMHSRVWDYOMHQHXPHÿXVREQHRGQRVHWRMHED]DSRGDWDNDHILNDVQLMDLEUåD 2) Struktura relacione baze podataka Podaci su predstavljeni u obliku dvodimenzionalne tabele . Polje od koga zavise sva druga polja naziva se NOMXþQR SROMH. Kolona u tabeli se zove polje (fild). i on pokazuje podatke za 1 subjekt. MACROI ± Macro koristimo kada åHOLPRDXWRPDWL]LUDWLQHNXUDGQMX MODULI ± Modul je kolekcija Visual Basic deklaracija i procedura koje su spremljene zajedno kao cjelina. Struktura relacione baze podataka $NRPRåHPRGDRGUHGLPRYULMHGQRVWMHGQRJSROMDQDRVQRYXYULMHGQRVWLQHNRJGUXJRJSROMa.

 Selekcija / projekcija / veza 131 .View/Pregledna tabela Ovo je tabela koja odre&uje strukturu kada se podaci koriste. Svaki rezultat je prikazan u virtuelnoj tabeli. 4)  Kako obraditi podatke Za osnovne metode obrade za kreiranje pregledne tabele iz master/glavne tabele. Upotreba i kreiranje baze podataka 3) Vrste tabela Postoje dvije vrste tabela: . postoje tri vrste: selekcija kako bi se uzeo samo slog koji ispunjava uvjet. palice. projekcija kako bi se uzelo samo neophodno polje. pozicija) Kreirajte novu tabelu na osnovu zajedni"kih osobina iz vi#e od jedne tabele ("lanski kod. broj udaraca) Virtuelna tabela 3 Virtuelna tabela 2 Uzmite red iz tabele pod uvjetom selekcije i kreirajte drugu tabelu (pozicija = baca") Selekcija Virtuelna tabela 4 Slika 2. i veza kako bi kombinovali dvije ili vi%e tabela za kreiranje nove tabele. master/glavna tabela nije ponovo napisana. Podaci se uvoze iz master/glavne tabele ukoliko je potrebno. (1) U ovome trenutku. ime "lana. Osnovna tabela 1                 Osnovna    tabela   2             Projekcija Veza Uzmite odre!eno polje iz tabele i kreirajte drugu tabelu ("lanski kod. Ista vrijednost ne mo!e biti odre&ena za primarni klju".Poglavlje 5. ime "lana.  .Master/glavna tabela Ovo je tabela koja odre&uje osnovnu strukturu podataka u koju se smije%taju podaci.

 Dizajn relacione baze podataka Kako biste kreirali bazu podataka. pozicija. krug Kod druge !kole: t001 Druga !kola: me unarodna  Rezultat na!e !kole: 5  Rezultat druge !kole: 2 !lanski kod Ime "lana Kenta ASAKURA Sho INOUE Ryo KANO Pozicija Razred Odjelj.  132 . rezultat druge %kole. kodni broj za identifikaciju protivni"ke %kole. razred. a koli"ina podataka se pove#ava. #kola Baca" Chihoku Hvata" Atsumi Desno Toshima Visina Te$ina Palice Broj udaraca Za knjigu rezultata nije neophodno imati zasjenjeni dio.'lanski kod.   . 'etvrta i peta normalizacija je ostavljena za profesionalce. 1) Analiza podataka Ovdje provjeravamo proceduru gdje menad!er bejzbol kluba ure&uje knjigu rezultata koriste#i program za kreiranje baze podataka. te!ina. odjeljenje.Poglavlje 5.Kod utakmice. jer je va no polje koje ovaj sistem koristi.A!uriranje (dodavanje. potrebno je. kodni broj za identifikaciju utakmice.Nema dupliranih podataka.Datum.   . brisanje) se lako izvodi. ime utakmice. Prednosti normalizacije podataka su:  .Palice. smanjenje broja nelogi"nih podataka. Knjiga informacija o rezultatima bejzbol utakmice srednje !kole Kod utakmice s001      Datum: 28. broj udaraca.  .Ne pojavljuje se suprotnost podataka. atributa (kolona) i me&usobne zavisnosti atributa u cilju izbjegavanja nepotrebnog ponavljanja podataka.   . me utim. baza podataka se ne mo!e kontrolisati.      Ime utakmice: Proljetna serija 1. Biv#a osn.   . visina. Podaci jedne utakmice i polja svakog podatka koja su ru"no izra"unata prikazana su na sljede#i na"in: [1] Podaci vezani za utakmicu   . izrada strukture pogodne za odr!avanje.Ime "lana. Upotreba i kreiranje baze podataka 2. kodni broj za identifikaciju "lana. Cilj normalizacije je minimiziranje ponavljanja podataka. biv%a osnovna %kola. Slika 3.   . potrebno je struktuisati podatke po"ev%i od faze dizajna. Sada!nja knjiga rezultata 2) Normalizacija Normalizacija se svodi na izu"avanje relacija izme&u tabela. Ako ne odlu"ite koji elementi se unose u koju tabelu unaprijed.g. Normalizacija se sastoji od 5 koraka od kojih #emo mi u"iti najva!nija 3 koraka. mart 2007. protivni"ka %kola.  . rezultat na%e %kole. [2] Podaci vezani za svakog "lana 'lanovi koji su u"estvovali na utakmici.Kod protivni"ke %kole. podaci o rezultatima utakmice svakog "lana.

(Na slici 4. Datum Odre"eni dio                     Ponovljeni dio     Rezult Rezultat Kod Biv!a druge !kole Druga !kola Ime utakmice at na!e !kole druge !kole lanski kod Ime lana Pozicija Kenta ASAKURA Baca Sho INOUE Hvata Atsum i Ryo KANO Desno Toshima Razred Odjel osnovna !kola Visina Te ina Palice Broj udaraca Chihoku Slika 4. kodom utakmice. Tako #emo dobiti dvije tabele. Prvi normalni oblik (1) Npr. Odre"eni dio Polja (kod utakmice do rezultata druge %kole) odre&enog dijela su podaci koji se pojavljuje samo jednom i odre&uju se samo po utakmici.) Na ovaj na"in je mogu#e identifikovati podatke ponovljenog dijela pomo#u dva koda: kod utakmice i "lanski kod. Ponovljeni dio Polja ("lanski kod do broja udaraca) ponovljenog dijela su podaci koji se ponovo pojavljuju i pokazuju rezultat svakog "lana u svakoj utakmici. postoje podaci za vi%e od jednog "lana po jednoj utakmici u ponovljenom dijelu. 133 . tako da zavise od koda utakmice i "lanskog koda. Slika 5. primarni kju" je dodijeljen i postavljen u odre&eni dio (1) i ponovljeni dio. "lanski kod #e se tretirati kao primarni klju". tako da zavise od koda utakmice. Ovako sre&eni podaci nalaze se u takozvanoj prvoj normalnoj formi. mogu#e je identifikovati cijelu tabelu sa primarnim klju"em. Odre"eni dio Kod utakmice Ponovljeni dio Kod utakmice Datum Kod druge %kole #lanski kod Ime "lana Druga %kola Pozicija Ime utakmice Razred Class Rezultat na%e %kole Biv%a osnovna %kola Rezultat druge %kole Visina Te!ina Palice Broj udaraca Polje podvu"enog dijela pokazuje primarni klju". Kod utakm. Prvi korak normalizacije Prvi korak normalizacije ima zadatak da napravi selekciju i odvoji ono %to se ponavlja (Slika 4).Poglavlje 5. Upotreba i kreiranje baze podataka 1. Tabela koja nije normalizovana Tabela je ure&ena sljede#im dijelovima. postoji polje"pobjeda ili poraz". tako da ga elimini%ete. me&utim. tako da "kod utakmice + "lanski kod" postaju primarni klju"evi. U ovoj fazi podaci nisu normalizovani. U prvoj normalizaciji. Odredite primarni klju" tako da se podaci u polju ne dupliraju. me&utim. "Kod utakmice + "lanski kod" postaju primarni klju"evi. do njega se mo!e do#i iz "rezultat na%e %kole" i "rezultat druge %kole".

Poglavlje 5. Drugi korak normalizacije Druga normalizacija ima zadatak da identifikuje potpune zavisnosti od klju"nog podatka tako da se tabele mogu povezati. To zna"i da je potrebno izolovati one podatke u relaciji koji naizgled zavise samo od primarnog klju"a. zavisi od "kod protivni"ke %kole" koji je polje koje nije primarni klju". a u stvari. podaci mogu biti uneseni odjedanput. ove podatke smjestit #emo u Tabelu A. tabela podijeljena na odre&eni dio i ponovljeni dio. Tabela B (zavisi samo od !lanskog koda) Po%to polja (ime "lana do te!ina) ponovljenog dijela zavise od "lanskog koda smjestit #emo ih u Tabelu B. Tabela A Kod utakmice Tabela B !lanski kod Tabela C Kod utakmice Datum Ime lana Kod druge !kole Pozicija !lanski kod Palice Druga !kola Razred Ime utakmice Odjel Rezultat na!e !kole Biv!a osnovna !kola Rezultat druge !kole Visina Te ina Broj udaraca Slika 6. Po%to ova polja ne mogu biti odre&ena ako oba koda nisu odre&ena. Upotreba i kreiranje baze podataka 2. Ovako sre&eni podaci nalaze se u takozvanoj drugoj normalnoj formi. Tre"i normalni oblik Normalizacija Prva normalizacija:odre&uje primarni klju". oformit #emo tabelu D tre#om normalizacijom kako je prikazano na slici 7. Na ovaj na"in za polja (ime "lana do te!ine) ponovljenog dijela. Druga normalizacija: polja koja zavise od primarnog klju"a smje%taju se u drugu tabelu. Tabela ponovo napisana tre$om normalizacijom zove se tre#i normalni oblik. zavise i od drugog podatka u relaciji. Tabela A Kod utakmice Tabela B !lanski kod Tabela C Kod utakmice Tabela D Kod druge #kole Datum Ime lana Kod druge !kole Pozicija !lanski kod Palice Ime utakmice Razred Rezultat na!e !kole Odjel Rezultat druge !kole Biv!a osnovna !kola Visina Te ina Broj udaraca Druga !kola Slika 7. 134 . Drugi normalni oblik 3. smje%taju se u novu tabelu. Tabela A (zavisi samo od koda utakmice) Po%to polja (datum do rezultat druge %kole) odre&enog dijela zavise od koda utakmice. Tabela C (zavisi od koda utakmice + !lanski kod) Polja (palice i broj udaraca) koja su ostala poslije odvajanja tabele B od ponovljenog dijela mogu biti povezana samo ako je odre&en kod utakmice ili "lanski kod. Tre$i korak normalizacije Tre#i korak normalizacije ima zadatak da odstrani sve prenosne zavisnosti. oni upotpunosti zavise od primarnih klju"eva. Zadatak Dodajte “kod biv%e osnovne %kole” u tablu na slici 3 i normalizujte je. Ovako sre&eni podaci nalaze se u takozvanoj tre$oj normalnoj formi. Tre#a normalizacija: polja koje zavisi od polja koje nije primarni klju". Po%to podatak "protivni"ka %kola" u tabeli A na slici 6.

"Tabela "lanstva" kako je prikazano u tabeli. Procedura kreiranja baze podataka 1) Odre&ivanje osnovne tabele Prvo kreirajte bazu podataka pod imenom "bejzbol klub". Kreiranje relacione baze podataka Kreiranje baze podataka i obrada podataka za relacionu bazu podataka izvodi se na sljede#i na"in: (1) Ure"ivanje polja (2) Odre"ivanje osnovne tabele (3) Uno%enje po!etnih podataka K oji su podaci istog datum a za jedno ime? (4) Povezivanje tabela (5) Kreiranje upita (7) Kreiranje izvje%taja Odnos prema korisniku (6) Kreiranje formulara za unos podataka Savjet dizajnera Odnos prema korisniku Slika 8. Primjer 1. Odredimo imena polja i odredimo zavisnost polja i primarni klju". 135 . Kreiranje prve tabele "Tabela !lanstva" Defini%imo atribut svakog polja u master/glavnoj tabeli. Upotreba i kreiranje baze podataka 3.Poglavlje 5.

Upotreba i kreiranje baze podataka Ime polja Tip klju"a Tip (polje) podataka lanski kod Primarni klju Tekstualni tip Ime lana Tekstualni tip Pozicija Tekstualni tip Razred Tekstualni tip Odjeljenje Tekstualni tip Biv!a !kola Tekstualni tip osnovna Visina Broj ani tip Te ina Broj ani tip Procedura 1. zvukovi itd. Yes/No Sadr!i samo da ili ne vrijednost.000 znakova 1. OLE Object Objekti drugih programa kao %to su dokumenti Worda. Zadatak Kreirajte master/glavne tabele. Sa"uvajte je pod imenom " tabela "lanstva".4. 136 Veli"ina Do 255 znakova Do 64.000 znakova Isto kao polje iz kojeg se popunjava .Poglavlje 5. mo!e se kombinirati sa brojevima kao %to su telefonski brojevi. Date/Time Koristimo ga za datume ili vrijeme Currency Za ra"unanje sa valutama (ovako izbjegavamo mogu#a zaokru!ivanja pri ra"unanju). Number Numeri"ki podaci kori%teni za matemati"ke operacije. 3. AutoNumber Automatski broja" koji se svaki red pove#a (smanji) za 1 ili stavlja neki proizvoljni broj.2. "tabela utakmice". slike. Excela. Memo Ve#i tekst koji koristimo za opise i sli"no. "tabela rezultata" i "tabela protivni"ke %kole". <Preporuka> Tip podataka Tip Podatka Koristi se za Text Manji tekst. 2. Kreirajte tabelu i unesite ime polja i tip podataka.8 ili 16 bytova ovisno o formatu 8 bytova 8 bytova 4 ili 16 (Replication ID) bytova 1 bit Ograni"eno samo veli"inom hard disca Do 64. Lookup Stvara polje koje se popunjava iz polja neke Wizard druge tablice ili iz liste zadanih vrijednosti. Odredite primarni klju" ["lanski kod]. Hyperlink Adresa nekog fajla na na%em kompjuteru ili Internetu. osim operacija nad valutama-za to imamo poseban tip. po%tanski brojevi itd.

 Zatvorite tabelu. visinu i te!inu. Procedura 1. Unesite kod "lana. ime "lana. Upotreba i kreiranje baze podataka 2) Unos podataka Nakon %to je tabela definirana. odjeljenje. 3. Unos podataka Unesite podatke u “ tabelu "lanstva”. biv%u osnovnu %kolu. poziciju. Zadatak Unesite podatke u "tabelu rezultata". Vje&ba 2.Poglavlje 5. "tabelu utakmice" i "tabelu protivni"ke %kole" kao %to je prikazano na slici: 137 . razred. 2. Otvorite tabelu "tabela "lanstva" i unesite podatke. unesite podatke.

Poglavlje 5. 2. Povucite [kod "lana] "Tabele "lanstva" i pustite dugme mi%a na [kod "lana] "tabele rezultata". Kada dobijete njegov prikaz odaberite tabelu "Tabela "lanstva" i kliknite na Add. Pojavit #e vam se dijalog Edit Relationships. 138 . Otvorite bazu podataka „bejzbol klub“ kako biste napravili relaciju. kliknite na dugme Create da potvrdite kreiranje relacije. "tabela utakmice" i "tabela protivni"ke %kole". Iz menija Tools odaberite komandu Relationships i dobit #ete dijalog Show Table. Vje&ba 3. Upotreba i kreiranje baze podataka 3)  Povezivanje tabela Jedna od va!nijih mogu#nosti u upravljanju tabelama baze podataka je povezivanje i kori%tenje podataka iz vi%e tabela. Kreiranje relacija Napravite relaciju za ["lanski kod] iz tabela " tabela "lanstva” i "tabela rezultata". 3. Zadatak Napravite relaciju za [kod utakmice] i [kod protivni"ke %kole] kao %to je prikazano na slici. isto uradite sa tabelama "tabela rezultata". Procedura 1.

139 . 4. [ime "lana] i [poziciju]. 5. 6. dodavanje novih zapisa tabeli i biranje odre&enih grupa zapisa koji ispunjavaju odre&ene kriterije. Iz „tabele "lanstva“ odaberite polja [kod "lana]. 2. a iz "tabele rezultata" odaberite [palicu] i [broj udaraca]. a!uriranje tabela. U opciji sort polja 'lanski kod odaberite rastu#i poredak (Ascending).Poglavlje 5. Odaberite Queries/Create query in Design view i odaberite tabele "tabela "lanstva" i "tabelu rezultata". uglavnom. 3. Sa"uvajte pod imenom "popis rezultata udaraca za svakog "lana". Vje&ba 4. (2) Ikona zbira je . Za polja Palica i Broj udaraca iz opcije Total odaberite izra"unavanje ukupnog zbira (2). Zatvorite prozor Query 1. Napravite popis rezultata udaraca za svakog !lana Napravimo tabelu "popis rezultata udaraca za svakog "lana" koriste#i tabele "tabela "lanstva" i "tabele rezultata". ostvaruje kroz upite. Upite #ete koristiti za biranje zapisa. Procedura 1. Upotreba i kreiranje baze podataka 4) Kreiranje upita Osnovna osobina baze podataka je mogu#nost jednostavnog i brzog pristupa podacima koji se.

[ime "lana].Poglavlje 5. 140 . Vje&ba 5. [poziciju]. Napravite tabelu prosjeka udaraca svakog !lana Odaberimo upit "popis prosjeka udaraca za svakoga "lana" i tabelu "popisa rezultata udaraca svakog "lana". Procedura 1. Odaberite [kod "lana]. 3. 2. Sa"uvajte ga pod imenom ”popis prosjeka udaraca svakog "lana". Zatvorite prozor "popis rezultata udaraca svakog "lana” 5. Prika!ite izra&eni upit i dodajte "popis rezultata udaraca svakog "lana” prikazanoj tabeli. Upotreba i kreiranje baze podataka Zadatak Napravite tabelu “popis udaraca po svakoj utakmici" kao %to je prikazano na slici. 4. [palica] i [broj udaraca]. Unesite formulu za izra"unavanje prosjeka udaraca [broj udaraca] / [palica] u novom polju.

Upotreba i kreiranje baze podataka 5) Ekranski formulari za unos podataka U cilju za%tite integriteta podataka u bazi. Koriste se za %tampanje ili prikazivanje na ekranu podataka u unaprijed definisanom formatu.Poglavlje 5. Forme sadr!e uputstva i obja%njenja koja se ti"u procesa unosa podataka. Vje&ba 6. 3 Sa"uvajte ga pod imenom "tabela rezultata". 2 Ako odaberete "auto report: format tabele" izvje%taj se automatski prikazuje. Izrada obrasca za unos podataka Napravimo obrazac za unos podataka za "tabelu rezultata". unos se ne vr%i direktno u tabele ve# putem obrasca ili forme koja funkcioni%e kao elektronski formular za unos podataka. Napravimo obrazac za unos tako da ne morate direktno unositi podatke u tabelu. zatim odaberite tabelu „tabela rezultata“ i kliknite na ok. Kreiranje izvje%taja tabele !lanstva Prika!imo "tabelu "lanstva" koriste#i funkciju kreiranja izvje%taja. 141 . Procedura 1 Odaberite podlistak Forms. Izvje%taji se prave na osnovu tabele ili upita. Procedura 1 Odaberite " tabelu "lanstva " na obrascu za izradu izvje%taja. 6) Kreiranje izvje%taja Izvje%taji su krajnji proizvod ve#ine aplikacija baza podataka. 3 Sa"uvajte ga pod imenom ” tabela "lanstva”. 2 Iz prozora New Form odaberite opciju AutoForm: Columnar. ""lansku tabelu" i "tabelu protivni"ke %kole". Zadatak Napravite formulare za unos podataka za "tabelu utakmice". pa kliknite na dugme New. Vje&ba 7.

Vje&ba 8. 142 .3" u "Criteria" prosjeka udaranja “ popisa prosjeka udaranja svakog "lana”. Procedura 1 Unesite ">=0.3 ili vi%e. Pretra&ivanje pod uvjetom Potra!imo "lana "iji je prosjek udaranja 0.Poglavlje 5. 7)  Pretra!ivanje pod odre&enim uvjetom Mogu#e je postaviti uvjet i pretra!ivati dosije koji ispunjava zadati uvjet. Upotreba i kreiranje baze podataka Zadatak Napravite izvje%taje “popisa prosjeka udaraca svake utakmice” i “popisa prosjeka udaraca svakog "lana”. 2 Prebacite ekran na prikaz podataka i provjerite rezultat.

1. 3. Izvr%ite normalizaciju tabele Kod klijenta Ime klijenta Kod proizvoda Ime proizvoda Daisuke YAMAURA Daisuke YAMAURA Daisuke YAMAURA Akiko YANO Magnetno-opti ki disk Mi! USB memorija Akiko YANO 143 Cijena po jedinici Kupljena koli"ina . Napravite „popis godi%njeg rezultata "lana“ koriste#i svako polje „tabele "lanstva“. Napravite „listu popisa prosjeka udaranja“ prikazan opadaju#im redoslijedom prosjeka udaranja koriste#i [kod "lana]. [ime "lana] i [prosjek udaranja] "popisa prosjeka udaranja svakoga "lana". Upotreba i kreiranje baze podataka Zadatak Potra!ite "lanove "iji je prosjek udaranja manji od 0. 2.Poglavlje 5. Vje&be za kraj poglavlja 1.

Poglavlje 6. WAN (Wide Area Network).mre!a koja pokriva ograni"ena (u!a) geografska podru"ja. Sistem linijskog prespajanja i sistem paket prespajanja 144 .mre!a koja pokriva %ira geografska podru"ja. mo!ete dominirati linijom sve dok je sami ne prekinete. Sistem informacijske komunikacije (1) LAN (Local Area Network). tako da komunikacija nije ometana. metoda slanja informacija kao sukcesivnog niza povezanih dijelova informacije tzv. Oda%ilja" Prijemnik Izvor informacije Informacija Poruka Signal Poruka Slika 1. Informacijska komunikacija Preno%enje informacija zove se informacijska komunikacija. a globalna telekomunikaciona mre!a zove se Internet. Informacijske tehnologije i dru#tvo Poglavlje dru%tvo 6. S druge strane. paketa (packet). Informacijske tehnologije koje podr!avaju dru%tvo S razvojem informacijskih tehnologija razvija se i informacijska oprema koja nam poma!e pri rje%avanju razli"itih problema. U informacijskoj komunikaciji poruka se %alje tako %to se pomo#u oda%ilja"a pretvara u signal i tako putuje komunikacijskim linijama dok ne stigne do prijemnika koji je pretvara u prvobitni oblik. gdje su svakom paketu dodijeljeni podaci o primaocu i po%iljaocu zove se packet-switching system. (router) Linijski prenosni sistem Kru!ni prekida" Metoda razmjene paketa Slika 2. Podaci se prenose pravilnom rutom zavisno od uslova komunikacijskih linija. Kada koristite telefonsku liniju. Povezivanje kompjutera komunikacionim linijama zove se telekomunikaciona mre!a. Telekomunikaciona mre!a unutar %kole ili radne organizacije zove se LAN. Da bismo postali odgovorni korisnici informacijske opreme. trebali bismo razumjeti na"in njenog funkcionisanja i njenu ulogu u na%em dru%tvu. Informacijske tehnologije i Dio 1. 1. 1) Metoda komunikacije Metoda komunikacije pomo#u linije kao %to je telefonska zove se line switching system/linijski prijenosni sistem.

a ure&aji zadu!eni za usmjeravanje paketa zovu se ruteri. On se stara da paketi do&u do odredi%ta. sloj Sa!eti koncept 3.) 2. sloj: primjenjeni sloj (HTTP. opti"ko vlakno itd. Informacijska komunikacija razgovorom 4. slanje je po MAIL protokolu a primanje po POP protokolu.) Slika 4. sloj: Internet sloj (IP itd. Slojevi protokola: 1. Po#iljalac 4. Za protokol Interneta se koristi TCP/IP protokol. 2. sloj je inherentni protokol primjenjenog softvera. sloj je TCP protokol i 4.) 1. Protokol Interneta TCP Protokol koji omogu#ava ta"an prijenos podataka od izvori%ta do odredi%ta. Dok kod nekih drugih. Informacijske tehnologije i dru#tvo Proces prijenosa podataka podijeljenih u pakete preko niza mre!a koje "ine Internet vr%i se uz pomo# odgovaraju#ih mre!nih protokola. POP itd. Protokol zadu!en za slanje e-mailova (Outgoing mail server). sloj mo!e biti bakarna linija. 2) Komunikacija i protokol Raznolikost hardverskih i softverskih tehnologija zahtijeva definisanje odre&enih pravila koja omogu#avaju me&usobnu komunikaciju u sistemu. 145 .Poglavlje 6. HTTP (Hyper Text Transport Protocol) pomo#u kojeg se prenosi Web-stranica od servera do korisnika. ETHERNET Uop#eno najrasprostranjeniji standard LAN-a. Pravila i procedure koje omogu#avaju primopredaju podataka izme&u dvije ta"ke sistema naziva se protokol. sloj Predstavljanje konceptom rije"i Primaoc Isti koncept Razumijevanje zna"enja Ista gramatika Promjena u tekst Isti metod 2.) 3. Protokol se sastoji od slojeva. SMTP. sloj: mre#a / Internet sloj (Ethernet itd. POP3 (Post Office Protocol 3) je protokol za primanje elektronske po%te. sloj 1. sloj Slu%anje zvuka Izgovoriti Prijenosni medij Slika 3. sloj je IP protokol. sloj: transportni sloj (TCP itd. Kod nekih poslu!itelja slanje i primanje se odvija po istom (MAIL) protokolu. SMTP (Simple Mail Transfer Protocol) protokol je odgovoran za rad s elektronskom po%tom. 3. pri "emu svaki sloj ima svoju ulogu.

Za pretra!iva". kantei.nesto. Kako je IP adresa broj"ana vrijednost. Informacijske tehnologije i dru#tvo 3) IP adresa i ime domena Opremi koja je priklju"ena na Internet dodjeljuje se jedinstveni broj koji se zove IP adresa. srednje %kole Lokalna javna agencija jp Japan de Njema"ka cn Kina ru Rusija kr Korea it Italija in Indija br Brazil Ime domena i IP adresa www.com Web server Ruter Klijent Internet Ruter DNS server Slika 5. klasifikacije i koda zemlje.234. pokazuje kako je informacija poslata s Web-servera na pretra!iva" kao primjer.  Slika 5. Podaci s Web-stranice se smje%taju na Web-server. Unesite URL: http:// www.Poglavlje 6. kod zemlje) Primjer organizacijske klasifikacije ac Akademska mre!a net co Kompanija gr gov Vladina agencija edu org Nekomercijalna organizacija lg Primjer koda zemlje Mre!na usluga Privatna organizacija Osnovne %kole. Sistem pretra#ivanja informacija pomo"u Interneta 146 .58. Tabela 1. Za IP adresu se koristi 32-bitna broj"ana vrijednost. Organizacijska klasifikacija DNS server 202. Primjer domena (organizacijska klasifikacija. “edu” predstavlja obrazovnu ustanovu 4)  WWW WWW predstavlja multimedijalni dio Interneta koji slu!i za pronala!enje informacija. ljudima je te%ko da je zapamte u ovakvom zapisu. Primjer IP adrese je 192. Ure&aj koji pretvara ime domena u IP adresu zove se DNS server.232. Ime organizacije go. IP adresa Kod zemlje (1) "com" predstavlja komercijalnu kompaniju. jp.100.)ime domena/ime puta.168. a pretra!iva" slu!i za njihovo pretra!ivanje.50. Iz tog razloga obi"no se koristi ime domena koje je zapisano slovima. Ime domena se sastoji od organizacijskog imena. mjesto Web-stranice je ozna"eno URL-om "http://(ime doma#ina.

koristi se program e-maila (mailer). (2) DNS server obavje%tava klijenta o prona&enoj IP adresi. Mail-server Mail-server Ruter G!ica A Internet Ruter G!ica B G!ica C Otvori i pretra$i mail Po#iljalac DNS server Primaoc. (6) Klijent primalac tra!i od mail-servera da po%alje podatke maila ako je dostavljen. Obi"no se koriste protokoli koji se zovu SMTP i POP za slanje i primanje e-maila odnosno za izdvajanje dostavljenih e-mailova s mail-servera. (5) Podaci s Web-stranice se dijele u nekoliko paketa pa se %alju Internetom. i prikazuju se na pretra!iva"u. 147 . a nekad mo!e biti i izostavljeno. (3) DNS-server obavje%tava IP adresu mail-servera o adresi mail-servera po%iljaoca. 5) E-mail Za kreiranje ili preuzimanje e-maila. G!ica. Prikazuje kako se e-mail %alje od klijenta kao po%iljaoca do klijenta primaoca. (5) Kompjuter koji zahtijeva uslugu. Informacijske tehnologije i dru#tvo (1) Klijent uzima ime domena s URL-a i informi%e se o IP adresi Web-servera do DNS servera. (5) Paket se dostavlja na ciljni mail server pomo#u raznih rutera/usmjeriva"a na Internet. E-mail se dostavlja putem mail-servera. (4) Ime puta je odre&eno imenom direktorija i datoteke. (2) Mail-server izdvaja ime domena iz mail adrese i informi%e se o IP adresi s mail-servera te adrese do DNS-servera. Mail (po%tanska) adresa ima sljede#i izgled "korisni"ki ID@ime domena". Sistem dostavljanja e-maila (1) Klijent kao po%iljalac %alje podatke maila na mail-server. (1) Razmjena paketa. Web-server i IP adresa po%iljaoca itd. podacima samog maila i %alje ga kao paket. Slika 6.Poglavlje 6. A Slika 6. (4) Paket je dostavljen na Web-server putem razli"itih rutera/usmjeriva"a na Internetu. i poslate su kao paket. (6) Podaci s Web-stranice se dostavljaju klijentu pomo#u razli"itih rutera/usmjeriva"a redom. (7) Mail-server %alje podatke maila klijentu primaocu. (3) Podaci o imenu Web-stranice koju !elite pretra!ivati. su prilo!ene. (4) Mail-server prila!e adresu i IP adresu po%iljaoca itd.

mo!ete izvesti mjerenje i kontrolu automatski bez radne snage.Poglavlje 6.promovi%e cilj kontrole pomo#u instrukcija dobijenih od kompjutera. [2] Kompjuter . Mozak (kompjuter) Oko (senzor) Uho (senzor) Ruka (operativni dio) Stopalo (operativni dio) Slika 8. [1] Senzor . utvr&ivanje odre&enog stanje zove se mjerenje. Mjerenje / kontrola klima ure$aja 2)  Sistem mjerenja / kontrole Mjerenje / kontrola putem kompjutera provodi se pomo#u tri vrste opreme. Mjerenje / kontrola pomo#u kompjutera  1) $ta je to mjerenje / kontrola? Klima ure&aj u sebi ima ugra&en mali kompjuter koji izdaje uputstva i stalno mjeri temperaturu prostorije kako bi je prilagodio odre&enoj temperaturi.procjenjuje koje informacije su bitne koje je dobio od senzora. Pore$enje mjerenja / kontrola %ovjeka i kompjutera 148 . Temperatura Unutra%nja oprema Kompjuter Ispu%tanje zraka Daljinski upravlja" Spoljna oprema Slika 7. Informacijske tehnologije i dru#tvo 2. [3] Operativni dio . a operacija koja se izvodi da bi se utvrdilo stanje zove se kontrola. Ako koristite kompjuter. Na ovaj na"in.izdvaja potrebne informacije.

Senzor AD konvertor Cilj kontrole Kompjuter Operativni dio DA konvertor Slika 9. %poret na plin automatski se gasi prilikom zemljotresa. 149 . temperature. Mo!emo mjeriti / kontrolisati informacije koje se ne mogu direktno obra&ivati kompjuterom. (1) Kada senzor i operativni dio upravljaju digitalnim kvantitetom. Promjena informacije u drugu informaciju koja ima stalnu vezu s njom zove se konverzija (pretvaranje). Osnovna konfiguracija mjerenja / kontrole pomo"u kompjuter Temperatura Volta$a Senzor za temperaturu Motor Volta$a Rotacijski broj Slika 10. Me&utim. (1) Npr. primjenjuje se koncept pogrije%i-ispravi sistem koji uvijek djeluje kada do&e do kvara. kada do&e do kvara opreme povezane sa kompjuterom. 3) Oh. AD mjerni pretvara" (AD konvertor) pretvara analogne informacije u digitalne informacije koje su u proporcionaloj vezi. Npr. senzor i operativni dio su tako&e konvertori (Slika 10). Zbog toga je potrebno preduzeti sigurnosne mjere. Informacijske tehnologije i dru#tvo Kod klima ure&aja. Razmatranje sigurnosti Tehnologija mjerenja / kontrole se primjenjuje na razli"itim podru"jima kao %to su ku#ni aparati i industrijske ma%ine. ovo je opasno! $poret se automatski isklju"uje ako se mnogo nakrivi. Op#a konfiguracija mjerenja / kontrole pomo#u kompjutera prikazana je na Slici 9. konvertor nije neophodan.. Sobna temperature se stalno prilago&ava pomo#u kontrolisanja operativnog dijela. i to kombinovanjem razli"itih konvertora. razlika izme&u sobne temperature izmjerene senzorom i pode%ene temperature upore&uje se pomo#u kompjutera. mo!e do#i do nesre#e. ili do&e do kvara zbog gre%ke u programiranju. npr. a oprema koja se koristi za konverziju zove se konvertor. Primjer senzora / operativnog dijela Uz AD konvertor i DA konvertor.Poglavlje 6.

Povezivanjem ovih ku#nih aparata u mre!u. ispiranje i cije&enje. Roboti se primjenjuju u poslovima zavarivanja. Slika 12. kod ma%ine za pranje ve%a MCU uklju"uje pranje. Informacijske tehnologije i dru#tvo 4) Primjer mjerenja / kontrole 1. u kosmi"kim istra!ivanjima. za razna istra!ivanja u morima i okeanima. DVD recorder i dr. Ku$ni aparati U ku#ne aparate kao %to su: ma%ina za pranje ve%a.Poglavlje 6. te automatski prilago&ava nivo pranja i ispiranja prema koli"ini vode i statusu mrlja prona&enih pomo#u senzora.. Kompjuter Senzor nivoa vode Motor Senzor za mrlje Slika 11. Prakti"ne potrebe su uvjetovale pronala!enje ma%ine koja #e u odre&enim poslovima zamijeniti "ovjeka. U po"etku su to bili opasni poslovi koji su %tetno djelovali na "ovjeka za vrijeme njihovog obavljanja. mogu#e je UKLJU'ITI klima ure&aj pomo#u telefona. koji se mogu povezati na mre!u kao %to je Internet zovu se informacijski aparati.. u oblasti medicine i savladavanju te%ko prohodnih terena. Ku#ni aparati s funkcijom komunikacije. Robot Rije" robot je "e%kog porijekla nastala od rije"i „robota“ koja ozna"ava posao. ugra&en je mikroprocesor (MCU). Npr. Mjerenje / kontrola automatskog ure$aja za pranje ve!a 2. Robot za zavarivanje 150 .

skra#ivanjem vremena vo!nje i smanjivanjem potro%nje goriva. (2) Strelica koja pokazuje na kompjuter pokazuje mjerenje. (2) Kada se napravi vi%i protokol. strelica koja izlazi iz kompjutera pokazuje kontrolu. Centar saobra#ajne kontrole Kompjuter Proces prikupljanja za analizu Navigacija u vozilu Detektor vozila Mjerenje Saobra%ajni signal Informacijska tabla signal Kontrola Kontrola Prijemnik Mjerenje Kontrola Slika 13. Vje&ba za kraj dijela 1.. Prednost hijerarhije protokola.Poglavlje 6. 151 . Informacijske tehnologije i dru#tvo 3. Kako se informacije %alju na Internet? Odaberite ta"nu re"enicu. Podaci se analiziraju za kontrolisanje signala i saobra#ajni podaci se prikazuju na informacijskoj tabli na putu ili na ekranu navigacijskog sistema automobila. (2) Informacije tre#e strane ne idu kroz rutu izme&u po%iljaoca i primaoca informacije. lako se mo!e zamijeniti..mjere se senzorom koji se zove detektor vozila koji je instaliran na putu i podaci se %alju kompjuteru centra saobra#ajne kontrole. a primalac ih ponovo sastavlja i vra#a u prvobitno stanje. Koja od ponu&enih re"enica je neta"na? (1) Kako se protokol mo!e razviti za svaki sloj. Ovi podaci su povezani s rje%avanjem saobra#ajnih gu!vi. 2. mo!e se lako napraviti. (4) Svaka informacija podijeljena od strane po%iljaoca dolazi do primaoca istom rutom. (1) Informacije se %alju najmanjom razdaljinom izme&u po%iljaoca i primaoca informacije. Sistem kontrole saobra"aja (1) Sistem koji obuhvata sistem kontrole saobra#aja zove se Inteligentni transportni sistem (ITS). (3) Mogu#e je ugraditi protokole proizvodima istog proizvo&a"a. Sistem kontrole saobra$aja Broj i brzina automobila. bukom i saobra#ajnim nesre#ama. saobra#ajne gu!ve itd. (3) Po%iljalac podijeli informacije i po%alje ih. smanjivanjem izduvnih gasova.

Glavni simptomi infekcije . Kako bismo se suprotstavili novom virusu. Me&utim. Inficira pomo#u prilo!ene datoteke ili kopiranjem Web-stranice.Virus koji nije zarazan. onda je potrebno kompjutere u"initi %to jednostavnijim za upotrebu. .OS (operativni sistem) odjednom otka!e. Kao posljedica javlja se potreba za preduzimanjem razli"itih mjera. Informacijske tehnologije prilago&ene korisniku Ako ve# postoji tendencija. neophodno je uvesti datoteku definicije virusa za koju se prikupljaju najnovije informacije i svojstva ili stalno a!uriranje Slika 1. podaci i programi se mogu o%tetiti slu"ajno ili namjerno nedozvoljenim upadom. jer u suprotnom ne doprinose „ oboga#enju“ dru%tva u kome !ivimo. napravite backup podataka (rezervnu kopiju).Velika koli"ina e-mailova je automatski poslana. Program koji pronalazi virus i izoluje zara!enu datoteku. Mjere za%tite .Kompjuter se ne uklju"uje. Glavne vrste virusa . da dru%tvo u kojem !ivimo u"inimo %to lagodnijim za !ivot pojedinca. o%te#uju#i programe i podatke zove se kompjuterski virus (virus).Kada postoji “rupa” u sigurnosti (lo%a ta"ka mjere sigurnosti). Kako bi se pobolj%ala sigurnost. nabavite i instalirajte “zakrpu” (program koji ispravlja problem). .Za datoteku u prilogu e-maila i datoteku preuzetu sa Web-stranice. moramo preduzeti mjere za%tite. prislu%kivanjem. datoteka je izbrisana / o%te#ena. te zaustavlja aktivnosti virusa zove se antivirus program. samo uvo&enje antivirusnog programa nije dovoljno.Virus koji napada kompjuter datotekom. Sigurnost U kompjuteru i telekomunikacionoj mre!i. stalno a!uriranje datoteke definicije virusa. . . 1) Mjere sigurnosti 1.Poglavlje 6. . o%te#uje datoteku. blokiranjem i drugo. ili mu treba vremena da se uklju"i. 152 .Iskoristiti funkciju sigurnosti primijenjenog programa. .  Trojanski konj nije zarazan. Sigurnost Budite pa!ljivi da ne biste postali !rtva ili u"esnik cyber (informati"kog) kriminala. Primjer ekrana zara#enog kompjuterskim virusom (osigurano od strane IPA/ISEC) antivirusnog programa.  Prvi predstavnik je crv. . . . falsifikovanjem. Informacijske tehnologije i dru#tvo Dio 2.U cilju za%tite od destruktivnog djelovanja virusa. ometanjem. provjerite da li su zara!ane prije otvaranja. 1. me&utim o%te#uje datoteke nezavisno.Pojavljuje se izvje%taj o gre%ci na ekranu. Antivirus Program napravljen kako bi namjerno izazvao o%te#enja.Programi se ne mogu koristiti.Korisna je upotreba antivirus programa. %to se ti"e mjera sigurnosti.

me&utim potrebno je prvo poslati tajni klju" ljudima kojima se %alje informacija. kada A po%alje informaciju B. (1) Ovo je originalan tekst koji nije %ifrovan. U ovom sistemu. Npr. Firewall 3.. Postoje dvije metode %ifrovanja: pomo#u “zajedni!kog klju!a” i “javnog klju!a” [1] Sistem zajedni!kog klju!a Ovo je sistem u kome po%iljalac i primalac informacije koriste zajedni"ki tajni klju". Sistem javnog klju%a (2) Kao jednostavan primjer %ifrovanja postoji Cezarova %ifra. Ovim sistemom brzina obrade podataka je velika. Po%iljalac %ifruje informacije koriste#i tajni klju" i primalac ih vra#a u originalne informacije koriste#i isti tajni klju" (dekodiranje). po%iljalac ne mora poslati tajni klju" svakom primaocu. %tetu / curenje podataka zove se firewall.. niz znakova postaje "ひろどせ". Slika 2. tako da postoji rizik presretanja i otkrivanja klju"a tokom tog procesa. Npr.Poglavlje 6. Informacijske tehnologije i dru#tvo 2. podaci su %ifrovani i poslati. a tajni klju" ima samo primalac. Firewall Hardver i softver koji spre"avaju nedozvoljeni upad. a B otvara bravu koriste#i klju" koji ima samo B. sigurni su jer ne mogu biti dekodirani javnim klju"em. (2) Ako je znak klju"a (brave) prikazan na dnu pretra!iva"a. [2] Sistem javnog klju!a Ovo je sistem kori%tenja javnog klju"a (objavljen i javno poznat). Dekodiranje &ifrovanje Kodirana poruka Kodirana poruka Obi"an tekst Obi"an tekst Tajni klju$ primaoca B Javni klju$ primaoca B Po!iljalac A Primalac B Slika 3. a ako se podaci presretnu. 'ifrovanje Tehnologija kojom se spre"ava otkrivanje informacija poslatih Internetom zove se %ifrovanje. Firewall je instaliran izme&u vanjske mre!e kao %to je Internet i mre!e u kompaniji ili %koli i provjerava dolazne i odlazne informacije. 153 . kada se niz znakova "はれです " prebaci unazad za 1 znak u japanskom pismu. A nema klju" nego bravu za %ifrovanje. a B ga dekodira koriste#i svoj tajni klju". A %ifruje i po%alje obi"an tekst koriste#i javni klju" od B. me&utim brzina obrade podataka je manja.

dokaz je da je digitalni potpis proveo po%iljalac.) (1) Po%iljalac objavi javni klju" upravi za certifikate (organizacija koja certificira) unaprijed. Ako je originalni tekst falsificiran. (9) Primalac se poziva u upravu za certifikate da bi se provjerilo da li je elektronski certifikat ispravan. Metoda digitalnog potpisa / elektronskog dokaza ispravnosti (pogledajte sliku 4. Ova tehnologija je jednaka certifikatu vodenog pe"ata za dokazivanje da li je pe"at na dokumentu od autora dokumenta. Digitalni potpis i elektronski dokaz ispravnosti Digitalni potpis je tehnologija koja obezbje&uje da je " napravljena od strane samog po%iljaoca" i "da nije falsifikovana". (2) Uprava za certifikate izdaje elektronski certifikat koji dokazuje da je javni klju" podnosioca (po%iljaoca). Po#iljalac &alje podatke Primalac Primljeni podaci Obi"an tekst Obi"an tekst Digitalni potpis Digitalni potpis Elektronska potvrda Elektronska potvrda Javni klju" po#iljaoca Javni klju" po#iljaoca Kontrola gre#ke Pore!enje Kontrola gre#ke &ifrovanje Tajni klju" po#iljaoca Javni klju" po#iljaoca Provjera ispravnostii Javni klju" po#iljaoca De#ifrovanj e Javni klju" po#iljaoca Elektronska potvrda Javni klju" po#iljaoca Provjera Potvrda autenti"nosti Slika 4. Informacijske tehnologije i dru#tvo 4. (5) $alje se elektronski certifikat sa digitalnim potpisom i javnim klju"em po%iljaoca koji je prilo!en s tekstom. Digitalni potpis i elektronski dokaz ispravnosti 154 Kontrola gre#ke . potreban je elektronski dokaz ispravnosti (dokaz ispravnosti pomo#u elektronskog certifikata).Poglavlje 6. Elektronski dokaz ispravnosti je tehnologija koja dokazuje da li je digitalni potpis po%iljaoca njegov ili ne. Ako se dekodiranje uspje%no zavr%i. onda je po%iljalac pravi). Digitalni potpis je isto %to i stavljanje pe"ata na dokument. (8) Poredi izmije%ane re"enice u koracima (6) i (7) i ako odgovaraju jedna drugoj. (3) Po%iljalac pravi izmije%anu re"enicu (kratak prikaz) iz obi"nog teksta koja se %alje pomo#u programa. pravi se druga izmije%ana re"enica. “ometanje” se ne mo!e u potpunosti sprije"iti samo digitalnim potpisom. Ovo se zove digitalni potpis. (7) Primalac sklapa izmije%anu re"enicu iz obi"nog teksta koriste#i program isti kao kod koraka (3). (6) Primalac provodi dokaz ispravnosti (izdvaja javni klju" po%iljaoca iz elektronskog certifikata i dekodira digitalni potpis kako bi napravio izmije%anu re"enicu. (4) Po%iljalac pi%e svoj potpis (%ifrira izmije%anu re"enicu koriste#i tajni klju"). Kako bi se rije%io ovaj problem. Me&utim.

Poglavlje 6. Sistem protiv otkazivanja Funkcija koja smanjuje %tetu prouzrokovanu pogre%nim operacijama ljudi ili prekid u radu ure&aja zove se sistem protiv otkazivanja. ako poku%ate zatvoriti program bez prethodnog "uvanja dokumenta u word procesoru. tako da je kompjuter uvijek funkcionalan. Odr!avanje uklju"uje i zamjenu dijelova prije eventualnog otkaza u radu. 2. flash memorije. 2) Mjere sigurnosti protiv nepredvi&enih situacija 1. Slika 5. trake. (5) Za %ifrovanje obi"nog teksta koristi se digitalni potpis. elektronski certifikat. Npr. externe diskove) kako bismo sprije"ili ne!eljeni gubitak podataka u slu"aju hardverskog otkaza sistema. mogu#e je napraviti automatski backup datoteke. sistem javnog klju"a itd. Odr&avanje Odr!avanje je povremeno nadgledanje rada kompjutera u cilju spre"avanja kvarova. prikazuje se poruka koja pita !elite li sa"uvati dokument. U slu"aju da kompjuter prestane raditi. kopiranje programa i podataka na CD i flash memoriju zove se backup. Informacijske tehnologije i dru#tvo (3) U suprotnom. (4) Samo oni koji imaju tajni klju" mogu dodati digitalni potpis. Backup Backup je kreiranje sigurnosnih kopija podataka na razli"ite vrste medija (CD. U slu"aju slu"ajnog prekidanja i gubljenja programa i podataka. 3.. te%ko je napraviti obi"an tekst od izmije%ane re"enice. Primjer sistema protiv otkazivanja 155 .

linija i povezivanje s LAN-om. kori%tenjem ove tehnologije. 3. Model klijent-server 2. Promovi%e se i oprema za "ulo dodira (ne%to kao Brajevo pismo ) koja mo!e pretvoriti informaciju kao %to su znakovi i grafika na TV ekran. Digitalno emitiranje Digitalno emitiranje mo!e integrisati cijelu informaciju. glas spikera mogao bi biti pretvoren u znakove i natpise koji se mogu prikazati na TV ekranu. Izvr%avanje %tampanja Server Zahtjev za podacima Server datoteke Server %tampa"a Zahtjev za %tampanje Opslu!ivanje podacima Klijent Slika 6. Model ovakve komunikacije poznat je kao model klijent-server. Informacijske tehnologije i dru#tvo 2. 1) Sistem informisanja i emitiranja 1. (1) Oprema za slanje i primanje podataka bez tel.Poglavlje 6. samo server ili klijent i server. Kompjuter koji tra!i uslugu zove se klijent. 156 . Mobilna upotreba kompjuter Ovo je sistem upotrebe Interneta bez kori%tenja mobilnog telefona itd. Zapo"eta su istra!ivanja u vezi sa stvaranjem TV-a koji #e biti od koristi osobama o%te#enog sluha ili vida. Upotrebljivost Jedan od razloga za%to je kompjuter postao pristupa"an velikom broju ljudi jeste da je kompjuter postao lak za upotrebu. Povezivanje na Internet omogu#eno je pomo#u be!i"nog LAN-a (postavljanja be!i"ne LAN kartice) instaliranog u javnom objektu kao %to je kancelarija ili restoran. Pomo#u tehnologije za prepoznavanje govora. a onaj koji pru!a uslugu zove se server. Model klijent-server U mre!ama se komunicira tako %to jedan kompjuter tra!i uslugu od nekog drugog kompjutera u mre!i. Svaki kompjuter u mre!i mo!e biti samo klijent.

 Ekran osjetljiv na dodir Ovo je oprema kojom se unose podaci direktnim dodirom ekrana kako bi na taj na"in koristili kompjuter bez upotrebe tastature ili mi%a.  Usluga natpisa pomo"u tehnologije prepoznavanja govora Slika 8. Slika 9. Danas je vrijeme u Tokiju lijepo s povremenom pojavom oblaka. U grafi!kom korisni!kom okru&enju (GUI) kori%tenje ikona. 3. ure&aje za prodaju karata i kompjutera za tra!enje knjiga u knji!arama itd.Poglavlje 6. Prezentacija opreme za %ulo dodira 2) Korisni"ko okru!enje 1. a uputstvo ili odgovor kao izlaz iz kompjutera pomo#u glasa zove se izlaz glasa. CUI okru!enje ( CUI Korisni"ko okru!enje u kome korisnik i sistem komuniciraju pomo#u teksta koji korisnik saop#ava kompjuteru zove se Znakovno korisni"ko okru!enje (CUI – Character User Interface). Informacijske tehnologije i dru#tvo Baza podataka glasa spikera #itanje vijesti-sistem prepoznavanja Glas Znak Planina Fud!i se prikazuje na TV-u. % Slika 7. "ini rad jednostavnijim i smanjuje mogu#nost gre%ki korisnika u radu sa kompjuterom. Ulaz/izlaz glasa Uno%enje podataka u kompjuter glasom zove se ulaz glasa. Izlaz glasa je jednoobrazan za bankomate i navigacione sisteme automobila. Ova oprema se koristi za bankomate. Ulaz glasa se po"eo koristiti unosom znakova u program za obradu teksta. 157 . Danas je vrijeme u Tokiju lijepo s povremenom pojavom oblaka. Grafi!ko korisni!ko okru&enje (GUI) Spona izme&u "ovjeka i kompjutera zove se korisni!ko okru&enje. 2. GUI okru!enje Slika 10. osim %to podsje#a korisnika na odre&enu aktivnost.

 Web-pristup Web-pristup pokazuje upotrebljivost Web-stranice. Neograni!ene informacije Mjere za uklanjanje razli"itih uskih grla s kojima se susre#u hendikepirane i starije osobe kada koriste informacijsku tehnologiju kao %to je kompjuter ili Internet zovu se neograni!ene informacije. Koncept op$eg dizajna ciljanog za upotrebu od strane razli"itih ljudi uz hendikepirane i starije osobe bez obzira na godine. Prona&imo stvarni primjer pristupnosti Webu. 158 . zamjenski niz znakova prikazan je kada postavite strelicu mi%a na ekran. Glasovni pretra!iva" mo!e i%"itati zamjenski niz znakova kako bi prenio sadr!aj slike osobi sa slabim vidom. elemente kao %to su slika ili muzika mogu#e je postaviti na Web-stranicu. i savjeta kao %to je izrada Web-stranice gdje se razmatraju veli"ina i boja znakova. ili ga prikazati na ekranu ili papiru u razli"itim veli"inama.Op#i dizajn  Ovo je koncept izrade proizvoda koje mo!e koristiti mnogo ljudi. Na pretra!iva"u. Primjer rje%enja Za sliku sa znakovima postavite svijetlu pozadinu i tamne znakove ili tamnu pozadinu i svijetle znakove kako biste vidjeli kontrast.Poglavlje 6. izlaz poput Brajevog pisma. Dobar primjer Lo% primjer (1) Ovim programom se i%"itavaju znakovi teksta Web-stranice i sadr!aj zamjenskog niza znakova slike. Za neograni"ene informacije potrebno je osigurati pristup (dostupnost) za dobijanje informacija upotrebom Interneta razvijanjem informacijske opreme prilago&ene korisniku. Vje!ba 1. Mogu#e je pretvoriti tekst u glas sintetizatorom glasova. spolnu opredijeljenost ili jezik. tako&er se %iri na podru"ju informacijske tehnologije. .. Neograni!ene informacije i op$i dizajn . 2. Prona&imo primjere pristupnosti Webu. Npr. Informacijske tehnologije i dru#tvo 3) Koncept upotrebljivosti 1.Neograni"eno  Ovo je pobolj%avanje kako bi se uklonio nivo koji blokira osobu.

Poglavlje 6. Grupa A Grupa B Grupa C Grupa D Vje&ba 1.  $ifrirani klju" Klju" za dekodiranje A B Javni klju" po%iljaoca Javni klju" primaoca Tajni klju" po%iljaoca Tajni klju" primaoca C D Tajni klju" primaoca Tajni klju" po%iljaoca Javni klju" primaoca Javni klju" po%iljaoca 159 . (1) Kombinacija va!na za vrstu klju"a koji se koristi za sistem %ifrovanja javnim klju"em. Odaberite ta"ne odgovore iz tabele za obja%njenja i odgovore simbola. (2) Kombinacija va!na za vrstu klju"a koji se koristi za digitalni potpis. Informacijske tehnologije i dru#tvo Vje&ba Pobolj%ajte dostupnost desnog grafikona kao na slici koja je na Web-stranici za ljude koji ne mogu odrediti odre&enu boju.

sa sistemom telekonferencije. Npr. medicinski pregled pacijenta u udaljenoj ljekarskoj ordinaciji ili kod ku#e mo!e se ostvariti online iz gradske bolnice. 1. Ovakav radni prostor smanjuju gubitak vremena i novca za putovanje i isto tako smanjuju psihi"ku napetost. Online shopping(2) je e-poslovanje izme&u potro%a"a i kompanije koja prodaje proizvode i usluge na Web-stranici. a da ne idete u gradsku bolnicu. mo!ete u"estvovati na konferenciji u glavnoj kancelariji iz podru"ne kancelarije. (2) Isto tako se koristi izraz e-poslovanje. Ovakav razvoj jednak je "industrijskoj revoluciji". S udaljenim sistemom medicinske pomo#i. Slika 1. 2) Mijenjanje dru%tva 1. ( Uzorak e -poslovanja Poslovanje izme&u kompanija zove se B to B (biznis za biznis). Inovativna promjena dru%tva ovih informacijskih tehnologija (IT) zove se "IT revolucija". vijeku. Udaljena ljekarska ordinacija 160 .Poglavlje 6. poslovanje izme&u kompanije i potro%a"a zove se B to C (biznis za konsumera/potro%a"a). SOHO je mali poslovni prostor u ku#i koji se koristi kao kancelarija. 3) Promjene u na"inu !ivljenja Telekomunikacijska mre!a je omogu#ila komunikaciju izme&u ljudi na udaljenim mjestima. Uzorak rasprostranjenosti Elektronsko poslovanje (EC) se koristi za obavljanje prodaje proizvoda i usluga pomo#u mre!e (omogu#ava novu vrstu rasprostranjenosti za potro%a"e i kompanije). Promjena dru%tva / !ivota 1) IT revolucija Informatizacija je po"ela naglim razvojem kompjutera i razvijala se eksponencijalno sa razvojem i upotrebljivo%#u mre!a. Sistem obrazovanja na daljinu za online poha&anje predavanja profesora koji je daleko i sistem e-u"enja gdje je u"enje nezavisno od vremena i mjesta tako&er postaje aktivan. Utjecaj informati"kih tehnologija na informacijsko dru%tvo Informatizacija je promijenila na% !ivot i dru%tvo. tako da mo!ete dobiti specijalisti"ki medicinski pregled visokog kvaliteta. Vje&ba: Na %ta korisnik mora da obrati pa!nju prilikom online shoppinga? Napravite raspravu po grupama. a omogu#ava povezanost kompanije pomo#u mre!e. (1) Ponekad se koriste pojmovi: Informacijska i komunikacijska tehnologija (ICT) . poslovanje me&u pojedincima zove se C to C (konzumer za konzumera / potro%a" za potro%a"a). te sada pokriva cijeli svijet.na posao od ku#e s kompjuterom kod ku#e. Razmislimo o efektima informatizacije na na% !ivot i dru%tvo i %ta je sve potrebno za stvaranje kvalitetnog informacijskog dru%tva u 21. 2. Radni uzorak Elektronska migracija.. Informacijske tehnologije i dru#tvo Dio 3.

prihodi. kvalifikacija. porijeklo. nagrade i kazne. itd. kriminalni dosije itd. datum ro&enja. Kreditni podaci kao %to su imovina. spol. nacionalnost Srodstvo. Primjer li%nih podataka koje ne trebate objavljivati (1) Ime. Tabela 1. u li"nim podacima po op#em pravilu nisu otvorena za javnost. ulaganja. Telefonski broj Ime !kole Porodica Spol Ruta putovanja Zanimanje Ime kompanije u kojoj ste zaposleni Broj mobilnog telefona Adresa Broj bankarskog ra"una Ime Broj kreditne kartice Imena "lanova porodice Slika 2. ako su otkriveni bez upozorenja. datum ro&enja. i informacije pomo#u kojih pojedinac mo!e biti identifikovan kombinovane sa drugim informacijama zovu se li!ni podaci (tabela 1). Morate sprije"iti objavljivanje li"nih podataka na Web-stranicama koliko god je to mogu#e. spol. bra"ni status. pla#anja poreza itd. historija bolesti. Primjeri li%nih podataka Sadr!aj Primjer Osnovni podaci Privatni !ivot itd. Ekonomska aktivnost itd. etni"ka pripadnost. vjera. otkrivanjem li"nih podataka. 161 .. adresa. telefonski broj. jer su one dostupne javnosti. Zanimanje / prethodna zaposlenja. rezultati u"enja / procjena itd. privatnost osobe mo!e biti ugro!ena. adresa. porodi"na situacija. dugovanja. spol.Poglavlje 6. Ime. Savjest. datum ro&enja su 4 osnovne informacije. adresa. S druge strane. Informacijske tehnologije i dru#tvo 2. %kola / akademski podaci. Problemi u informacijskom dru%tvu 1) Li"ni podaci i privatnost Informacije kojima se pojedinac mo!e identifikovati kao %to je ime. na"ela. Dru%tveni !ivot itd.

postoje pravo patenta.Poglavlje 6. Uz to postoje va!na prava. Privatno kopiranje za li"nu upotrebu je dozvoljeno. morate ta"no navesti citat i izvor. rezbarenje. autorsko pravo (pravo vlasni%tva) koje je dato ljudima koji su napravili autorsko djelo prvi put.itd. Ako citirate tekst nekog dokumenta ili sl. Me&utim. pravo umno!avanja. jednostavno se postavlja fotografija pjeva"a preuzeta s Web-stranice na va%u Web-stranicu. Glavne odlike autorskog prava kao moralno pravo. pravo dizajna i pravo za%titnog znaka za djela va!na za razvoj industrije kao %to su pronalasci i oni su za%ti#eni kao pravo industrijskog vlasni%tva. Ovim pravom se %titi autor djela kako ga neko drugi ne bi koristio za dobijanje profita. kompozicije) Jezik (roman. Informacijske tehnologije i dru#tvo 2) Za%tita prava intelektualnog vlasni%tva Autorsko pravo je pravo dato autoru kada on/ona napi%e knjigu ili komponuje muziku. pjeva". 162 . pravo prikazivanja je napisano u tabeli 2. pravo obzira i za%tite moralnog karaktera autora. Primjer autorskog djela  Prava autora. rukopis. Npr. i ona su data ljudima koji prenose autorsko djelo javnosti kao %to je npr.) Film Umjetnost (slikanje.) Ples (koreografija.. Razvojem kompjutera i Interneta.. Uz autorsko pravo i prava koja se na njega naslanjaju.itd. Muzika (tekstovi pjesama. Za autorsko djelo pravo se automatski sti"e i nije neophodno provoditi registrovanje. ali za prijenos informacija morate dobiti odobrenje od autora. itd.. prijevod.) Fotografija kompjuterski program Slika 3. a uklju"eno je i moralno pravo. prava koja se naslanjaju na autorsko pravo. pravo upotrebe modela. ovim kr%ite autorska prava fotografa i portretsko pravo osobe na toj fotografiji... vajanje. Ova autorska prava i prava industrijskog vlasni%tva se zajedno zovu prava intelektualnog vlasni%tva. govor. pravo izvo&enja. svako mo!e lako kopirati i obra&ivati digitalne informacije.

Kr%enje moralnog prava vlasni%tva). 163 . Vje&ba Prona&ite situaciju u kojoj je do%lo do kr%enja autorskih prava i ukratko predstavite koja su prava prekr%ena. Kr%enje prava portreta. Ona mi je prijateljica. igranja i predstavljanja djela i Pravo prevo&enja. Informacijske tehnologije i dru#tvo Vrsta prava autora Glavne odlike prava Moralno pravo Pravo odlu"ivanja ho#e li djelo biti javno Pravo odlu"ivanja ho#e li autorovo ime biti prikazano pri objavljivanju djela Pravo nemijenjanja sadr!aja djela Pravo kopiranja djela Autorsko pravo (pravo vlasni%tva) Pravo javnog rada Pravo stavljanja autorovog imena Pravo o"uvanja cjelovitosti Pravo umno!avanja Pravo izvo&enja / predstava / predstavljanje Pravo preno%enja ili omogu#avanje prijenosa putem javnog emitiranja ili komunikacije Pravo odlu"ivanja jezika djela Pravo izlaganja umjetni"kih djela Pravo distribucije filma Pravo dodjeljivanja ili posu&ivanja djela osim filma Pravo javnog preno%enja Pravo recitovanja Pravo izlaganja Pravo distribucije Pravo prijenosa vlasni%tva Pravo prijevoda prilago&avanja SLU'AJ 1 Stavite muziku u pozadini na va%u Web-stranicu koriste#i kupljeni CD. Pravo izvo&enja.Poglavlje 6. Kr%enje prava umno!avanja i prava javnog prijenosa. Ja koristim ovu pjesmu. prava prevo&enja! (prava SLU'AJ 3 Postavili ste fotografiju sa svojom prijateljicom bez njenog znanja. ure&ivanja SLU'AJ 2 Popravili ste fotografiju "ije je objavljivanje dozvoljeno i postavili je na Web-stranicu. Malo izmijenjena.

Dru%tvena informatizacija dovodi do va!nih novih poslovanja i usluga. a samim tim su se znatno promijenile potrebe zapo%ljavanja. S ovom informatizacijom promijenila se industrijska struktura. Zbog ovoga dolazi do problema da se dio industrije prebacio u inostranstvo gdje je radna snaga jeftinija. gre%ke i „padovi“ mre!a znali su prouzrokovati veliki haos i gubitak za dru%tvo. (2) Kompanija osnuje poslovnicu u inostranstvu. 164 . postoji jaz izme&u ljudi koji mogu koristiti kompjuter i ljudi koji ne mogu. stvaraju se uvjeti za kontakt sa informacijama i sadr!aj obrazovanja je oboga#en za obrazovanje kako u %kolama tako i za cjelo!ivotno obrazovanje. U isto vrijeme pojavljuje se i ”tehnolo%ki stres” zajedni"ko ime za dvojni vid psiholo%kog gubitka samokontrole uzrokovanog kontaktom s tehnologijom. Pojava novih oblika kriminala Po%to je informacijska oprema povezana mre!om. pa je industrijski kapacitet doma#e proizvodnje oslabljen. Informacijske tehnologije i dru#tvo 3) Razli"iti efekti informatizacije 1. u"inila je !ivot ugodnijim i modernizovala je rad. oblici kriminala pomo#u kompjutera koji se koriste mre!om kao %to je zloupotreba. neovla%ten pristup. Kako bi se ovakve situacije sprije"ile. Ovo se zove digitalna podjela. Uz to. 2. tako da se stvaraju nove dru%tvene i ekonomske razlike. Slika 4. Promjena rada / industrijska struktura Difuzija informacijske opreme kao %to je kompjuter. ilegalna kupovina. kra&a. tako da je !ivot postao udoban i ispunjen. prodaja i otkrivanje informacija pove#avaju se iz godine u godinu. techno-zavisnost kao rezultat pretjerane zavisnosti.Poglavlje 6. Vijesti o kriminalu koje se koriste mre#om Sistem je postao ogroman i komplikovan. pronevjera. Konferencija ili razmjena informacija Internetom >>skra#eno vrijeme putovanja Osnivanje glavne kancelarije i podru"nih kancelarija %irom svijeta >>aktivno tokom 24 sata (1) Stvara se techno-anksioznost zbog lo%eg prilago&avanja na kompjuter. Me&utim. informacije mo!ete razmjenjivati uvijek i na svakom mjestu.

obra&ena je bez obavje%tenja i objavljena. open source postaje rasprostranjen. ( (3) ) i ( (4) ) . c. ( ) (5) Fotografija koja je ve# objavljena. a informacije sa drugog kraja svijeta su dostupne pojedincu. ekonomija i kultura poja"ano i globalno %ire preko granice a. i. f. uklju"eni su ime. koncept promovisanja razvoja kulture i ekonomije ovom metodom. zdravstveno stanje. pravo razgla%avanja. Ubacite pravu rije" u ( ) sljede#eg teksta koji opisuje ure&ivanje li"nih podataka. Informacijske tehnologije i dru#tvo 3. d. (1) Kancelarija iz koje se provodi posao putem Interneta. U prava industrijskog vlasni%tva uklju"eni su ( (1) ). Autorsko pravo je pravo dato osobi koja stvara autorsko djelo kao %to je ( (6) ). Nova prava: patent modela poslovanja. i rezultira pravom kada se autorsko djelo napravi bez prove&enja ( (10) ) i registrovanja. tako da ga svako mo!e pobolj%ati i ponovo dijeliti. Ovim pravom se %tite novi izumi. e. U informacijskom dru%tvu svako mo!e primiti i prenijeti svaku vrstu informacije. ( )( ) (3) Fotografija na kojoj je tvoj prijatelj postavljena je na Web-stranicu bez obavje%tenja. ( (1) ). 4. i porodi"na situacija i "ak i informacije ( (3) ) same osobe. b. ( (9) ) i kompjuterski program po prvi put. i registrovano je kao pravo primjenom na ( (5) ) i to ako je prihva#eno. a isto tako dovodi do velike ekonomske razlike. Globalizacijom politike. open source. prihod. uklju"ene su informacije koje mogu identifikovati osobu pomo#u njih kombinovane s drugim informacijama.Poglavlje 6. Promjena ekonomskog opticaja Razvojem informacijske tehnologije pojedinac se mo!e povezati s cijelim svijetom pomo#u Interneta. privatnost. manja preduze#a i pojedince bez obzira na postoje#i red i mo# drugih kompanija. ( )( ) (2) Objavljeni autorski rad druge osobe je postavljen na Web-stranicu bez obavje%tenja. pravo prilago&avanja. pronalasci. vijeku. ( (2) ). globalizacija. U prava intelektualnog vlasni%tva uklju"ena su prava industrijskog vlasni%tva. ( ) (4) Li"ni podaci pomo#u kojih se osoba mo!e identifikovati postavljeni su na Web-stranicu bez obavje%tenja. nastavimo u"enje na osnovu onog %to smo u"ili u ovom ud!beniku „Informatika B“. datum ro&enja. U isto vrijeme globalizacija dovodi do ravnomjernosti i homogenizacije vrijednosti. Ubacite pravu rije" ( ) sljede#eg teksta koji opisuje za%titu prava intelektualnog vlasni%tva. ekonomije i kulture dolazi do globalnog %irenja preko granica. pravo umno!avanja. Ako li"ni podatak procuri. ( )( ) a. b. pravo portreta. vijeku. Pojavom Interneta stvorio se novi patent. g. h. c. zanimanje. 3. e. Ovaj patent je prihva#en kao metoda novog poslovanja i ideja sistema realizovana upotrebom sistema informacija. vijeku Predvi&a se da #e se informatizacija promovirati vi%e nego ikad u 21. Koja vrsta prava se kr%e u sljede#im slu"ajevima? Odaberite odgovore od a do i i odgovorite upisivanjem simbola. povlastica. itd. Li"nim podacima se smatraju sve informacije koje identifikuju osobu. digitalna podijeljenost. pravo raspodjele. itd odre&eni vremenski period. pravo cjelovitosti. dizajn. Ovim se stvara prilika za male zemlje. d. mo!e biti upotrijebljen na na"in koji prava osoba ne !eli. Me&utim. jezika itd. ( (2) ). logo. Odaberite primjenjivu rije" za re"enice (1) do (4) od a do e i odgovorite upisivanjem simbola. 165 . Ovo je metoda razvoja otkrivanja izvornog koda u kome se program koristi besplatno. S druge strane. Vje&ba za kraj odlomka 1. (2) Razlika izme&u ljudi koji imaju informacije i ljudi koji nemaju informacije. SOHO. podaci o %kolovanju. iz male kancelarije kod ku#e. 4. 4) (ivimo u 21. 2. ili ( (4) ) mo!e biti prekr%eno ili mo!e do#i do nezgode. nacionalnost. autorska prava. open source Pravo intelektualnog vlasni%tva kao %to je patent promovi%e razvoj kulturnog i ekonomskog prava intelektualnog vlasni%tva. patent modela poslovanja. Kako bi se stvorilo veliko informacijsko dru%tvo u 21. pravo objavljivanja. (3) Da se politika. ( (8) ). (1) Emitirani film snimljen je videom i dao si ga svom prijatelju. ( (7) ). EC. pravo javnog prijenosa. ipak je istaknuto da patent modela poslovanja mo!e kontrolisati takmi"enje s drugim takmi"arima i razvoj se mo!e odgoditi.

2………Automatsko dobijanje zbira Odaberite opseg #elija za koje !elite da dobijete ukupan zbir i pritisnite dugme SUM) . Kompjuterska pismenost Poglavlje 7.Poglavlje 7. * Oblik ikone se razlikuje u zavisnosti od programa koji se koristi. Na taj na"in automatski dobijate ukupan zbir. Kompjuterska pismenost Funkcije programa za rad sa radnim tabelama Izra"unavanje 1………Unos formule za izra"unavanje ukupnog zbira Odaberite #eliju (B9) u koju #ete unijeti "=B5+B6+B7+B8" i pritisnite taster Enter.Oduzimanje * Mno!enje / Dijeljenje ! Stepen * Neki programi koriste "+" umjesto "=". U #eliji (B9) bit #e prikazan zbir vrijednosti iz opsega #elija B5:B8. 166 (auto . Svi podaci koji po"inju znakom"=" program #e uvrstiti u formule ili funkcije. Aritmeti!ke operacije + Sabiranje .

mogu#e je koristiti pet funkcija [suma. Kada sortirate mogu#e je postaviti vi%e od jednog uvjeta za sortiranje. koli"ina podataka. Prikazana je kolona koja ispunjava uvjet i toj koloni postaje plava. Odaberite [SUM] iz menija funkcija [Most Recently Used] i kliknite OK. najve#a vrijednost. Kompjuterska pismenost Sortiranje i ekstrakcija 1………Sortiranje u rastu$i poredak (opadaju$i poredak) Odaberite opseg #elija koje #e biti sortirane i iz menija Data odaberite komandu Sort. Na ekranu se pojavljuje prozor Insert Function. Po%to je prozor [Function Arguments] prikazan na ekranu. Kada kliknete na dugmeta (auto SUM). mo!ete je prona#i u kategoriji matemati"kih funkcija. unesite opseg #elija "B5:D5" za koje se izra"unava suma u [Number 1] i kliknite OK. 2………Prikaz podataka koji ispunjavaju uvjet (ekstrakcija) Odaberite proizvoljnu #eliju unutar opsega #elija i iz menija Data odaberite Filter/AutoFilter. Ukoliko se [SUM] ne nalazi u [Most Recently Used]. najmanja vrijednost]. Odredite po kojoj koloni !elite da sortirate i odaberite rastu#i poredak (od manjeg ka ve#em) ili opadaju#i poredak (od ve#eg ka manjem). u Upotreba funkcija 1………Dobijanje ukupnog zbira (SUM funkcija) Odaberite #eliju (E5) u koju #ete unijeti ukupan zbir i kliknite na dugme (umetanje funkcije). Dobijena suma smje%tena je u #eliju (E5).Poglavlje 7. mogu#e je koristiti dugme rastu#i poredak) ili (sortiraj u (sortiraj u opadaju#i poredak) . prosjek. Ako sortirate samo po jednoj koloni. Kliknite na #elije i odaberite odre&eni uvjet. =SUM(opseg #elija) 167 .

kategorije Statistical odaberite funkciju Rank.Poglavlje 7. opseg #elija. u polje Order 0 (opadaju#i poredak) i kliknite na OK. =RANK (broj"ana vrijednost. U polje Number otkucajte (B25). redoslijed) 168 . Iz menija Insert Function. u polje Ref opseg #elija $B25:$D25 (apsolutne reference). Kompjuterska pismenost 2………Rangiranje (RANK funkcija)  Odaberite #eliju (B26) i kliknite na dugme . Kao rezultat dobili smo da je "lan A tre#i po redu.

za ta"nu vrijednost uvjeta. „1“ako se tra!ena vrijednost ne prona&e. Kompjuterska pismenost 3………Dobijanje slu!ajnog broja (RAND funkcija) Da bi se dobio slu"ajan broj iz intervala od 0 do1. u polje Value_if_true vrijednost 1. Iz menija Insert Function. vrsta pretra!ivanja) „0“ tra!e se podaci koji odgovaraju tra!enoj vrijednosti. Pobjedni"ki razred prikazan je u #eliji M10. =VLOOKUP (vrijednost pretra!ivanja. Iz menija Insert Function. S obzirom na ta"nost uvjeta u #eliji C2 prikazat #e se vrijednost 1. unesite "=RAND()". zatim kliknite na OK. 5………Odlu!ivanje (IF/AKO funkcija) Odaberite #eliju (C2) i kliknite na dugme . U polje Lookup_value unesite 1. u polje Col_index_num broj 2 i u polje Range_lookup vrijednost 0.Poglavlje 7. Za svako novo pozivanje funkcije Rand dobit #ete novi slu"ajan broj. u polje Value_if_false 0 i kliknite na OK. =RAND() 4………Pretra&ivanje (VLOOKUP funkcija) Odaberite #eliju (M10) i kliknite na dugme . =IF (uvjet. Ako je vrijednost izraza ta"na u #eliji C2 bit #e prikazana vrijednost 1. Kolona koja se pretra!uje mora biti sortirana u rastu#em poretku. kategorije Logical odaberite funkciju IF. tra!i se najve#a vrijednost koja je manja od tra!ene. U polje Logical_test unesite uvjet B2<0. jer tra!ite pobjedni"ki razred. a ako nije vrijednost 0. opseg #elija. za neta"nu vrijednost uvjeta) Relacijski operatori = jednako > = ve#e ili jednako > ve#e <> razli"ito < = manje ili jednako < manje 169 . broj kolone. kategorije Lookup & Reference odaberite funkciju VLOOKUP. u polje Table_array opseg #elija.5.

kategorije Statistical odaberite funkciju COUNTIF. namjeni i zahtjevima. Iz menija Insert Function. u polje Criteria "E2" i kliknite na OK. tekst pored Y-ose. Po zadavanju ove komande dobija se dijalo%ki prozor ChartWizard-Step 1 of 4-Chart Type u kojem prvo treba izabrati tip i podtip grafikona. (2) U drugom koraku. Klikom na Next prelazi se na sljede#i korak. tekst ispod X-ose.Poglavlje 7. (3) U tre#em koraku potrebno je ispisati naslov grafikona. prelazi se na sljede#i korak klikom na Next. Kompjuterska pismenost 6………Brojanje koliko $elija ispunjava uvjet (COUNTIF funkcija) Odaberite #eliju (F2) i kliknite na dugme . U polje Range unesite opseg #elija "C2:C101". ako ve# nije odre&ena. 170 . Poslije toga klikom na Finish grafikon je kreiran i prikazan. Kao rezultat dobijate broj #elija "iji sadr!aji zadovoljavaju postavljeni kriterij. =COUNTIF (opseg #elija. tj. uvjet pretra!ivanja) Grafi"ki prikaz podataka 1………Histogram (1) Odaberite opseg #elija (A2:F17) koje !elite da predstavite grafikonom i kliknite na (Chart Wizard). 2………Druge vrste grafikona  Postoje razli"iti tipovi grafikona po izgledu. jednaki su broju 1 (sadr!aj #elije E2). Klikom na Next prelazi se na sljede#i korak. (4) U "etvrtom koraku se odre&uje da li #e se grafikon prikazati na posebnom listu (As new sheet) ili u okviru nekog postoje#eg radnog lista (As object in:). odre&uje se grupa podataka koju trebe nacrtati. Kada ste izabrali !eljeni podtip.

3………Uno%enje i zavr%avanje programa (macro) Unesite program (macro) u prozor. Ako ste odabrali [Module]. Kada se ekran editora prika!e. pritisnite taster Enter. Kompjuterska pismenost Programiranje pomo#u programskog jezika 1………Prikazivanje alata za programiranje Pokrenite program za rad sa radnim tabelama i iz menija Tools odaberite Macro/Visual Basic Editor. Korisno je koristiti liniju sa alatima za Visual Basic. Kada je unos programa zavr%en. 171 . kliknite na dugme za prikaz na alatima i vratite se na radnu stranicu. Ako ste dobro otkucali naredbu i !elite da pre&ete u novi red. 2………Pokretanje editora Kliknite na dugme (VBasic editor) koje se nalazi na liniji alata. kliknite na dugmeta (insert of user form) alata ure&iva"a.Poglavlje 7. dobit #ete ekran za unos programa.

neophodno je promijeniti nivo sigurnosti programa za rad sa radnim tabelama sa "visoko" na "srednje". Kompjuterska pismenost 4………Izvr%avanje programa (izvr%avanje macro-a) Unesite znakove i broj"anu vrijednost u svaku #eliju radne stranice i kliknite na dugme (run macroa).Poglavlje 7. rezultat procesa je prikazan u #eliji (B3). U prozoru Macros odaberite zbir i kliknite na Run. * Kako biste pokrenuli macro. po!eljno je napraviti dugme oblika na desnoj strani. Kada izvr%avate isti proces vi%e puta. 172 .

P3…………Kako mo&emo koristiti citate? O3…………"Citat" je "citiranje pasusa ne"ijeg autorskog djela i upotreba istog u svom autorskom djelu". neophodno je platiti nadoknadu vlasniku autorskog djela. Kompjuterska pismenost Autorsko pravo / net-etiketa pitanja i odgovori Autorsko pravo pitanja & odgovori P1…………Koju proceduru je potrebno ispo%tovati da bih dobio/la autorsko pravo? O1…………Procedura nije neophodna. naslov. 173 . Me&utim.Jasno ozna"avanje citiranog dijela sa znakom navoda " " itd. Klijent ne mo!e tre#oj osobi iznajmiti video. Autorsko pravo se dobija kada stvorite autorsko djelo (nemetodi"ko na"elo).Poglavlje 7.  . prava umno!avanja i pravo javnog emitiranja.  . Nije mogu#e posuditi CD tre#oj osobi ako nije kupljen. Me&utim. itd. tako da posu&ivanjem videa drugim ljudima kr%ite pravo umno!avanja. ako ne pravite kopiju.Citat mo!ete upotrijebiti u sklopu pravnog okvira za citate kao %to je izvje%taj za novine. P8…………Da li mogu da posu"ujem i iznajmljujem video na kome je snimljen TV program? O8…………Snimanje TV programa zna"i kopiranje. kako biste jasno nazna"ili da citirani tekst nije Va%. P4…………Da li mogu da napravim kopiju ako je sadr&aj blago izmijenjen? O4…………Blagim mijenjanjem sadr!aja ste ve# prekr%ili prava cjelovitosti.Trebao bi postojati odnos “gospodar-sluga” sadr!aja gdje je va%e autorsko djelo "gospodar" a autorska djela drugih ljudi "sluga"  . kada kopirate autorsko djelo koriste#i opremu za audio i video snimanje. po%to je ovaj proces nemogu#e kontrolisati. Za citat je neophodno po%tovati sljede#e:  . P6…………Da li mogu da postavim pjesme (s kupljenog muzi!kog CD-a) na svoje Webstranice? O6…………Tim kr%ite prava producenata CD-a. P10……… Da li mogu da posu"ujem i iznajmljujem muzi!ke CD-ove? A10………Pravo posu&ivanja ima izvo&a" i producent na jednu godinu nakon izdavanja.Napi%ite ime autora. P7…………Da li mogu da posu"ujem knjige i !asopise ? O7…………Da. P2…………Da li mogu da kopiram tu"e autorsko djelo bez odobrenja autora ako ga koristim samo za ku$nu upotrebu? O2…………Kopija za privatnu upotrebu (li"nu upotrebu. upotrebu kod ku#e ili upotrebu unutar odgovaraju#eg okru!enja) je dozvoljena. kritike i istra!ivanje. P9…………Da li mogu da posu"ujem iznajmljeni video drugim ljudima prije vra$anja u datom vremenskom roku? A9…………Videoteka se bavi iznajmljivanjem videa namijenjenih za iznajmljivanje. novac nadoknade autoru je uklju"en u cijenu digitalne opreme i medija za snimanje. P5…………Da li mogu da kopiram sadr&aj ako nije napisano "all rights reserved" ? O5…………Ne mo!ete kopirati sadr!aj bez odobrenja bez obzira na nepostojanje oznake " all rights reserved ".

Neki pretra!iva"i ne mogu prikazati okvir ili sliku. me&utim.Poglavlje 7. Kompjuterska pismenost P11………'ta trebam uraditi kada &elim da upotrijebim “poznati lik” kao %to je Mickey Mouse? O11………Za upotrebu koja prelazi granice privatne upotrebe. kompanija ili autor? O13………Autorsko pravo ima autor autorskog djela bez obzira "iji alat ili oprema se koristi. onda mo!ete prekr%iti razli"ita prava kao %to su pravo umno!avanja. kontaktirajte ga. potrebno je usredsrediti se na dizajn koji mo!e vidjeti %to ve#i broj ljudi. P12………Da li mogu da objavim pjesmu koju sam sam pjevao i snimio na karaokama? O12………Potrebna su odobrenja tekstopisca. P14………'ta je "free use mark"? O14………To je oznaka koja pokazuje namjeru autora kada on/ona misli da njegovo/njeno autorsko djelo mo!e biti slobodno kori%teno od strane drugih ljudi. Slu"aj kada autorsko pravo autorskog djela koje je napravio radnik ima kompanija je samo onda kada je "napravljeno autorsko djelo povezano s poslom" inicijativom kompanije”. ako autor stranice zahtijeva odobrenje. kompozitora i izvo&a"a. Ne koristite ih kao da su dio va%e stranice. potrebno je odobrenje vlasnika autorskih prava. Net-etiketa Web-stranice Pitanja&Odgovori P15………Koju vrstu korisnika treba da predvidim kada dizajniram Web-stranicu? O15………Pravite stranicu koja #e biti dostupna ljudima iz cijelog svijeta. P16………Na %ta treba da obratim pa&nju kada postavljam link? O16………Klasifikujte linkove stranica napravljenih od strane drugih autora i to vidno ozna"ite. P17………Na %ta treba da obratim pa&nju prilikom kori%tenja materijala postavljenih na Web-stranici? O17………Da li su to materijali koje ste sami izradili? Ako je to autorsko djelo drugih ljudi. Te%ko je uklju"iti sve. Nije dozvoljeno koristiti snimak ako se prelazi granica privatne upotrebe. tako da morate uzeti u obzir postojanje razli"itih korisnika. pravo objavljivanja. Mogu#e je koristiti autorsko djelo u odre&ene svrhe bez kontaktiranja autora ili pla#anja tro%kova upotrebe. Za link nije potrebno odobrenje unaprijed. me&utim. P13………Ko je autor autorskog djela stvorenog kori%tenjem kompjuterske opreme kompanije. 174 . Neke boje mogu biti manje vidljive ljudima koji ne razlikuju boje. pravo javnog prijenosa i pravo omogu#avanja slanja.

#lan 10. definirana su sljede#a tri prava. (V) arhitektonska djela. Prava autora Autorsko pravo se automatski daje bez obavje%tenja. U me&uvremenu Zakon se mijenjao i dodati su novi "lanovi. Me&utim. Nije dozvoljena bilo koja vrsta iskrivljavanja. (VI) karte. Autor ima pravo da svoje djelo koje jo% nije objavljeno ponudi i u"ini dostupnim javnosti.  175 . To zna"i da je svrha "za%tita prava autora i doprinos razvoju kulture" . drame. kao i figurativna djela nau"ne prirode kao %to su planovi. Djela za%ti#ena autorskim pravom Postoje razli"ita autorska djela koja se %tite. emitiranja. Kompjuterska pismenost Va!e#i zakoni Zakon o autorskim pravima Svrha autorskog prava Zakon o autorskim pravima je donesen 1970. unakazivanja. Autor ima pravo da odredi ho#e li njegovo pravo ime ili pseudonim biti nazna"eno ili ne kao ime autora na originalnom djelu. Autor ima pravo na o"uvanje integriteta svog djela i njegovog naslova. novinarski "lanak koji je samo preno%enje "injenica nije za%ti#en autorskim pravom. "lanke. fonograma. Pravo odre"ivanja oznake autorskog imena: #lan 19. su u svrhu osiguravanja za%tite prava autora. dijagrami i modeli. skulpture i druga umjetni"ka djela. (VIII) fotografska djela. (IV) slike. Pravo o!uvanja integriteta: #lan 20. Prava svira"a muzi"kih instrumenata i producenata su za%ti#ena kao srodna prava. (III) koreografska djela i pantomime. (II) muzi"ka djela. Pravo !ine$i djelo javnim: #lan 18. (VII) kinematografska djela. Svrha ovoga Zakona je da osigura prava autora i prava koja se na ovo oslanjaju. Izmjene zakona su mogu#e u skladu sa primjenom prema ovoj svrsi. ili neka druga vrste izmjena protiv njegove volje. godine. "Djela" uklju"uju sljede#e: (I) novele. ili kada se njegovo djelo nudi ili "ini dostupnim javnosti. gravure. predavanja i druga literarna djela. Imaju#i u vidu pravednu i po%tenu eksploataciju ovih kulturnih proizvoda. #lan 1. Pravo po%tovanja djela kao i izvo&enja.Poglavlje 7. difuzija. (IX) programska djela. Kada je usvojen. doprinosimo razvoju kulture. Skoro sve %to je povezano s kreativnim aktivnostima ljudi je za%ti#eno autorskim pravom. ovaj Zakon je imao 124 "lana. Svrha je obrazlo!ena u 'lanu 1. Kao moralno pravo.

Kompjuterska pismenost Imovinska prava literarnog djela. (Umno!avanje. (Umno!avanje u %kolskim ud!benicima itd. neprofitabilna)  * Ove olak%ice se nastavljaju do 'lana 50.) #lan 28. pravo na objavljivanje. itd.) #lan 24. a 70 godina poslije objavljivanja) svako mo!e slobodno koristiti. #lan 119. #lan 30. moralno pravo izvo&a"a srodnih prava (op. (Trajanje autorskog prava) Kazna Za ljude koji prekr%e autorska prava predvi&ene su stroge kazne kao %to su nov"ane kazne i zatvorske kazne. (Umno!avanje u knji!arama itd.)      (Interaktivni prijenos za osobe s pote%ko#ama sluha) #lan 38. itd. autorsko pravo. stav (i) koja predstavljaju kr%enje autorskih prava. itd. (Pravo umno!avanja) #lan 22. (Umno!avanje u Brajevom pismu itd.Poglavlje 7. #lan 21. Ograni"avanje autorskih prava U odre&enim situacijama mo!e se dodati ograni"enje na autorsko pravo. prava objavljivanja ili srodna prava. Interneta… itd. u %kolama i drugim obrazovnim institucijama) #lan 36. ili nov"anom kaznom koja ne prelazi pet miliona jena (oko 40. (Umno!avanje. (Citati) #lan 33.) #lan 32. (Umno!avanje za li"nu upotrebu) #lan 31.) (II) svaka osoba koja. u ispitnim pitanjima) #lan 37. ako postavite podatke na Web-server itd. (Pravo distribucije) ( Pravo prijenosa vlasni%tva) (Pravo posu&ivanja) #lan 27.000 KM) . (Izvo&enje. (Pravo izvo&enja) (Pravo prezentovanja) #lan 23. Autorsko djelo "iji je period za%tite istekao (u Japanu.a. navede druge da koriste ure&aje za umno!avanje pomenute u 'lanu 30. itd. 50 godina poslije smrti autora za film. itd. (Pravo javnog prijenosa. ili oboje: (I) svaka osoba koja povrijedi moralna prava autora. tako da ih svako mo!e uzeti (omogu#ujete slanje). radija. itd. (Pravo autora izvornog djela pri eksploataciji izvedenog djela) Pravo javnog prijenosa je pravo slanja autorskog djela javnosti pomo#u televizije. 'ak i ako nije poslano. (Pravo prevo&enja.)      (Umno!avanje za pripremu ud!benika pri obimnim %tampanjima) #lan 34. u svrhu stvaranja profita. (Emitiranje. (Pravo izlaganja) #lan 26. paragraf (1). 176 . prekr%ili ste ovo pravo. prilago&avanja. #lan 51. u %kolskim obrazovnim programima) #lan 35. (Pravo recitovanja) #lan 25. Sljede#e osobe #e biti ka!njene zatvorom na period ne du!i od pet godina.

cric. Bernska konvencija va!i za autorska djela koja treba da budu prihva#ena. (6) WIPO ugovor o autorskim pravima (1996) Ovo je novi ugovor o autorskim pravima koji se mo!e zvati internetski ugovor o autorskim pravima. Za me&unarodnu konvenciju relevantnu za prava intelektualnog vlasni%tva.jp/ . autorskog prava). Ovim se autorska djela ljudi u zemljama nemetodi"kog na"ela mogu za%titi u zemljama koje zahtjevaju registrovanje za za%titu autorskih prava ako je prilo!eno "zaokru!eno C " (C. Imajte u vidu da neki "lanovi zakona mogu zastariti i da se mogu promijeniti. itd.".Act Data Provision System (Ministry of Internal Affairs and Communications) http://law. po"etno slovo Copyrighta. (1) Pari%ka konvencija (1883)  Pravno ime je "Me&unarodna konvencija za za%titu industrijskog vlasni%tva 20. producenta.e-gov. (5) TRIPs protokol (1994) Dodatak osniva"kom sporazumu World Trade Organization (WTO)/Svjetska trgova"ka organizacija uklju"uje "Trade-Related Aspects of Intellectual Property Rights"/Trgova"ko-povezane aspekte prava intelektualnog vlasni%tva (TRIPs protokol).or. (2) Bernska konvencija (1886) Pravno ime je "Bernska konvencija za za%titu literarnih i umjetni"kih djela". (1) za%tita autorskih prava za kompjuter.Copyright Research and Information Center http://www. Kompjuterska pismenost Web-stranice nadle&ne za autorska prava  Odgovaraju#i zakon o autorskim pravima se "esto prera&uje. godine. Ovim putem kolektivnog obra&ivanja problema. osnovana je World Intellectual Property Organization (WIPO)/ Svjetska organizacija za intelektualno vlasni%tvo 1970. Sve zemlje svijeta potpisale su ugovore i za%titile autorska djela i same sebe.go. Zakon o autorskom djelu u Bosni i Hercegovini ispunjava ove me&unarodne konvencije. mart 1883. Ovo je osnovni sporazum koji se bavi pravima indrustrijskog vlasni%tva. Uz to. program. za za%titu prava autorskog djela. (3) za%tita izvo&a"a. usvojeno je nemetodi"no na"elo koje ne zahtijeva nikakvu proceduru kao %to je registrovanje ili prilo!ena kopija. . radio-izvje%ta"a. va!e sljede#a prava. film i snimak. Usvojen je sa "WIPO ugovorom o izvo&enju i fonogramima" za za%titu prava izvo&a"a i producenata. a zasniva se na istim pravima. poslovanja i organizovanja Bernske konvencije koja se bavi autorskim pravima i Pari%ke konvencije koja se bavi pravima industrijskog vlasni%tva. prikazivanjem i snimanjem javnosti pomo#u "interaktivne komunikacije" koja koristi Internet. Novi ugovor se bavi preno%enjem autorskih djela. 177 .Poglavlje 7. (2) pravo posu&ivanja prava za kompjuter.jp/ Me"unarodna konvencija nadle&na za pravo intelektualnog vlasni%tva Kvalitetna literarna djela i muzika obi"no prelaze nacionalne granice. program i bazu podataka. (4) WIPO osniva!ki sporazum (1970) Kako bi se promovisala i pobolj%ala za%tita prava intelektualnog vlasni%tva %irom svijeta. Jednaka nacionalna prava treba dati "ak i strancima u svrhu za%tite prava autorskog djela.g. (3) Konvencija o op$im pravima autorskog djela (1952) Ovo je sporazum koji povezuje zemlje nemetodi"kog na"ela i zemlje koje zahtjevaju registraciju kao uvjet za%tite autorskog djela Bernske konvencija. Ovaj sporazum se smatra osnovnim sporazumom za me&unarodno pravo autorskog djela.

otkrivanje generacijskog statusa i utemeljenje mjera za%tite odre&ene su zakonom. od Metropolitan ili Uprave javne sigurnosti #lan 6. u posebnom slu"aju kada to "ini pristupni administrator. Kompjuterska pismenost Zakon o neovla%tenom pristupu kompjuteru Za neovla%ten pristup. Niko ne smije po"initi djelo neovla%tenog pristupa kompjuteru. Niko ne smije otkriti identifikacioni kod druge osobe povezan s pristupom kontrolnim funkcijama.  (2) Osoba koja je prekr%ila propis 'lana 6. Svrha ovoga Zakona je zabraniti djelovanje neovla%tenog pristupa kompjuteru kao i odre&ivanje kaznenih propisa za takve aktivnosti. Definicije #lan 2. te pomo#ne mjere izvr%ene od strane Metropolitan ili Uprave javne sigurnosti za spre"avanje ponavljanja ovakvih djelovanja. ili na zahtjev osobe koja to zna. slu"ajeve neovla%tenog pristupa kompjuteru kao i situaciju istra!ivanja i razvijanja tehnologije povezane s funkcijom kontrole pristupa. zabrana djelovanja. (izostavljeno) ako (izostavljeno) pomo# zahtijeva pristupni administrator odre&enog kompjutera nad kojim je djelovanje neovla%tenog pristupa (izostavljeno). zavisno od njegove upotrebe (ograni"eno na takvu vrstu upotrebe koja se obavlja putem telekomunikacijske linije o kojoj je rije". Metropolitan ili Uprava javne sigurnosti. Osoba koja je prekr%ila propis 'lana 4. osim pristupnom administratoru za tu pristupnu kontrolnu funkciju ili ovla%tenom korisniku tog identifikacionog koda. itd. u daljem tekstu se navodi kao “odre&ena upotreba”). (izostavljeno) Kazneni propisi #lan 8. kazna. Savjetovanje.000 KM) jena:  (1) Osoba koja je prekr%ila propis 'lana 3. (Izdato 1999) Svrha #lan 1. 178 . paragraf 3. ili s odobrenjem tog pristupnog administratora ili ovla%tenog korisnika. #lan 7. kako bi se taj odre&eni kompjuter za%titio od neovla%tenog pristupa. Osoba koja spada pod jednu od sljede#ih stavki bit #e ka!njena izdr!avanjem kazne ne du!e od godinu dana ili nov"anom kaznom ne ve#om od 500. paragraf 1. (izostavljeno) #lan 4. Pristupni administrator (izostavljeno) #e nastojati pravilno da upravlja identifikacionim kodovima (izostavljeno) kako bi za%titio odre&eni kompjuter od djelovanja neovla%tenog pristupa. #e osigurati savjetovanje kada ocijeni da je zahtjev razuman (izostavljeno) kako bi se potrebne hitne mjere mogle pravilno primijeniti u skladu s na"inom rada tog djelovanja neovla%tenog pristupa ili njegovog uzroka. Kako bi se sprije"ila kompjuterska kaznena djela koja se izvode putem telekomunikacijskih linija i odr!avanje reda u telekomunikaciji koji se ostvaruje pristupom kontrolnim funkcijama.000 (oko 6.000 jena. Za%titne mjere pristupnih administratora #lan 5. Ministar vanjske trgovine(izostavljeno) #e objaviti.Poglavlje 7. ukazuju#i da je to identifikacioni kod za odre&enu upotrebu kompjutera. i stoga doprinosi ispravnom razvoju naprednog informacijskog i telekomunikacijskog dru%tva. (izostavljeno) Zabrana djelovanja neovla%tenog pristupa kompjuteru #lan 3. U ovom Zakonu. Nacionalna uprava javne sigurnosti. “pristupni administrator” zna"i osoba koja obavlja operacije na kompjuteru (u daljem tekstu se navodi kao “odre&en kompjuter”) koji je povezan s telekomunikacijskom linijom. barem jednom godi%nje. bit #e ka!njena nov"anom sumom ne ve#om od 300.. #lan 9.

) Simbol Prefiks Veli"ina m mili 10-3 mikro 10-6 µ n nano 10-9 p piko 10-12 f femto 10-15 Primjeri brzina pristupa memorijama Memorije Vrijeme prilaza Hard disk Oko 10 m sekundi Operativna memorija Nekoliko desetina n sekundi Disketa 0. brzinu komunikacije…itd.) Veli"ina za brzinu se mijenja za 103 (kilo je malim slovima) Simbol Prefiks Veli"ina P peta 1015 T tera 1012 G giga 109 M mega 106 k kilo 103 Veli"ina za kapacitet memorije se mijenja za 210 (kilo je velikim slovima) Simbol Prefiks Veli"ina P peta 250 T tera 240 G giga 230 M mega 220 K kilo 210 Primjeri kapaciteta vanjskih memorija Vanjske memorije Kapacitet Hard disk Oko 1 TB Operativna memorija Oko 1 GB Disketa 1.1 sekunde Eksterna memorija Nekoliko µ sekundi Interni ke% Nekoliko stotina p sekundi 179 . itd.Poglavlje 7. Kompjuterska pismenost Jedinice koje se koriste za informaciju Jedinice kojima ozna"avamo velike veli"ine (kapacitet memorije. brzinu izvo&enja operacije.44 MB Interni ke% Nekoliko stotina KB Jedinice kojima ozna"avamo male veli"ine (vrijeme prilaza memoriji.

Kompjuterska pismenost Druge jedinice Jedinice koli"ine informacije b Bit najmanja jedinica informacije B Bajt 1 bajt = 8 bita Jedinica baud brzine bps Bita po sekundi B/s Bajta po sekundi 1 bps= jedan bit prenesen po sekundi 1 B/s= jedan bajt prenesen po sekundi Jedinice brzine obrade podataka Milion instrukcija po MIPS sekundi Broj promjenljivih FLOPS operacija po sekundi Jedinica za izra"unavanje broja instrukcija u sekundi Jedinica u"estalosti "asovnika mikroprocesora Jedinica u"estalosti Hz herc Jedinica brzine obrtaja rpm Obrtaji po minuti Grafi"ke jedinice pixel Element slike bpp Bitova po pikselu ppi Piksela po in"u Jedinica pokreta slike fps Frejmova po sekundi Osnovna jedinica za definisanje slike Koli"ina informacije po 1 pikselu Broj piksela po jednom in"u( 1in"=2.54cm) Brzina pojavljivanja slike po sekundi Jedinica veli"ine karaktera (znaka) point 1 ta"ka = 0.Poglavlje 7.3514mm Jedinica za %tampa" ppm Strana po minuti Broj od%tampanih strana po minuti 180 .

IP adresa (Internet protokol adresa) Internet protokol adresa. NOT operator Metoda pretra!ivanja se obavlja pod uvjetom da klju"na rije" "A" nije uklju"ena. E i F. zgrada). Binarni broj Broj binarnog broj"anog sistema koji ima 2 cifre : 0 i 1. Ova metoda pretra!ivanja zove se NE pretra&ivanje. Ova metoda pretra!ivanja zove se ILI pretra&ivanje POP (Post Office Protokol) Protokol koji se koristi za preuzimanje e-mail poruke sa servera. Kompjuterska pismenost Obrazlo!enje va!nih pojmova Heksadekadni broj Broj heksadekadnog broj"anog sistema koji ima 16 cifara : brojevi od 0 do 9 i slovne oznake A. kancelarija. Jedinstvena adresa kompjutera i komunikacijskih ure&aja spojenih u kompjutersku mre!u.Poglavlje 7. HTTP (HyperText Transfer Protocol) Protokol za prijenos podataka pomo#u WWW. C. SMTP (Simple Mail Transfer Protocol)/Jednostavni protokol za prijenos mailova Protokol koji se koristi za slanje e-mail poruka na Internet. SOHO (Small Office Home Office) Radna jedinica u kojoj obavljate posao pomo#u Interneta i koja je smje%tena u va%oj ku#i. LAN (Local Area Network)/Mre&a lokalnog podru!ja Kompjuterska mre!a koja pokriva ograni"ena geografska podru"ja (kabinet. Koristi TCP/IP protokol. IT (Informacijske tehnologije) Informacijske tehnologije su tehnologije koje proizlaze iz razvoja kompjutera i kompjuterskih mre!a. AND operator Metoda pretra!ivanja se obavlja pod uvjetom da su obje klju"ne rije"i „A" i "B" uklju"ene. 181 . B. DNS server (Domain Name System server)/Server sistema imena domena Ure&aj koji pretvara ime domena u IP adresu zove se DNS server. OR operator Metoda pretra!ivanja se obavlja pod uvjetom da je bar jedna od klju"nih rije"i "A" ili "B" uklju"ena. D. Ova metoda pretra!ivanja zove se I pretra&ivanje CPU (Central Processing Unit)/Centralna procesorska jedinica Ure&aj koji izvr%ava operacije i kontroli%e podatke i programe.

M (magenta) i Y (yellow/!uta). Tri primarne boje To su boje C (cyanogen). du!ina. 'ifriranje. ugao. WWW "ini veliki broj prezentacija institucija i pojedinaca koji se nalaze na raznim lokacijama. Web-dostupnost Lako#a pristupa informacijama pomo#u Web-stranica. Postoje rje"nici kao %to je japanski rje"nik. Analogno Koristi se za stalnu koli"inu podataka kao %to je te!ina. kriptografija Metoda mijenjanja informacije kori%tenjem odre&enog klju"a (klju" %ifre) kako bi se sprije"ilo dekodiranje i upotreba od strane tre#eg lica. Primarna informacija Direktno prikupljene informacije kao %to su dokumenti. Online shopping/Kupovina putem Interneta Na ovaj na"in se kupuju proizvodi u elektronskoj prodavnici postavljenoj na Internetu. za kontrolu URL (Uniform Resource Locator)/Ure"eni lokator resursa Predstavlja niz znakova koji podlije!u odre&enim standardizovanim formatima za izra!avanje lokacije Web-stranica. englesko-japanski rje"nik. Postoji sa!imanje sa gubitkom. za ispis se dodaje (K) crna boja. Open source Preuzimanje programa (izvornog koda) sa Interneta itd. Internet Globalna mre!a na koju su spojene ostale mre!e %irom svijeta. bez naplate tako da ih svako mo!e pobolj%ati ili dalje distribuirati. ipak. Web-stranica Stranica postavljena na Web-server koju pregledamo pomo#u Web-browsera. Ovo je jedan od primjera transakcije izme&u poslovnog preduzetni%tva i potro%a"a. statisti"ki podaci ili istra!ivanje. Kompjuterska pismenost TCP/IP (Transmission Control Protocol/Internet Protocol)/Protokol prijenosa/Internet protokol Standardni protokol kontrole prijenosa podataka pomo#u Interneta. WWW (World Wide Web)/Svjetska internet mre&a Predstavlja multimedijalni dio Interneta koji slu!i za pronala!enje i transfer informacija. nije idealno crna. Compression/Sa&imanje Metoda smanjivanja veli"ine podataka. telefonski imenici i karte. Algoritam Algoritam je kona"an niz pravila pomo#u kojih se defini%e proces obrade podataka. Po%to. gdje se podaci ne mogu ponovo vratiti i sa!imanje bez gubitaka gdje se podaci mogu ponovo vratiti. 182 .Poglavlje 7. enciklopedije. Offline database/Vanmre&na baza podataka Baza podataka sa"uvana na medijima kao %to su CD-ROM i DVD. Mije%anjem ovih boja dobije se tamna boja sli"na crnoj.

Hijerarhijski tip Zasniva se na hijerarhijskim strukturama podataka koje imaju oblik stabla. nijansa Vrijednost koja pokazuje promjene boje slike kada se predstavljaju digitalno. Glavna tabela Tabela koja defini%e strukturu podataka u kojoj su. Gradacija. se predstavlja jedinicom dpi (dots per inch/ta"aka po in"u). Pristup po klju!noj rije!i Metoda pretra!ivanja koja koristi klju"nu rije". Rezolucija Vrijednost koja predstavlja kvalitet slike. podaci smje%teni. Pomo#u ove metode isti klju" se koristi za %ifrovanje i de%ifrovanje sadr!aja. a uvjet za obavljanje pretra!ivanja pomo#u kombinovanja dvije ili vi%e klju"nih rije"i je kombinovani uvjet. itd. u stvari. ure"aj za pohranjivanje (storage) Oprema koja memori%e podatke i program. Kompjuterska pismenost Online database/Baza podataka na Internetu To je baza podataka za koju je korisni"ki terminal i server baze podataka spojen komunikacijskom vezom tako da se podaci mogu pretra!ivati kada je to potrebno u realnom vremenu. Sistem %ifrovanja zajedni!kim klju!em Jedna od metoda %ifrovanja. Ujedno se koristi za br!e pretra!ivanje baze. Ogledna tabela Privremeno kreirana tabela na osnovu glavne tabele. Kona!ni model Model koji ne uklju"uje pojavu nepravilnosti. Memorijska jedinica.Poglavlje 7. Za kombinovani uvjet koristi se: AND/I pretra!ivanje. G (green/zelena) i B (blue/plava). Mije%anje ovih boja pove#ava kontrast i pribli!ava se bijeloj. Pixel Ta"ka ili piksel je najmanja jedinica informacije kojom defini%emo sliku. Rezolucija %tampa"a i skenera…itd. 183 . Klju! / primarni klju! Polje od kojeg zavise ostala polja zove se polje primarnog klju"a. Model vjerovatno$e Model koji uklju"uje pojavu nepravilnosti kao %to su ta"ke kockice. Uvjet obavljanja pretra!ivanja pomo#u jedne klju"ne rije"i je jednostavan uvjet. Pristup po kategoriji Metoda obavljanja pretra!ivanja prate#i kategorije cilja pretra!ivanja po odre&enom redu. Dodavanje pomije%anih boja Ekran predstavlja svaku boju koriste#i tri osnovne boje: R (red/crvena). OR/ILI pretra!ivanje i NOT/NE pretra!ivanje. Podaci se dobijaju iz glavne tabele.

Kompjuterska pismenost Upitnik Dora&eni zahtjev kako bi se uzeli podaci iz baze podataka. meni. me&utim. pravo upotrebe modela. Oba klju"a omogu#avaju %ifrovranje. e-maila. ikonu i kursor kako bi omogu#ilo intuitivnu i laku operaciju mi%em. pravo dizajna i pravo na za%titni znak. Pretra&iva! Sistem koji omogu#ava uslugu pretra!ivanja informacija. Pridru&ivanje Ovim se povezuju dvije ili vi%e tabela kako bi se napravila nova tabela. Kompjuterski virus To je generi"ko ime programa koji izaziva nepravilnosti u radu kompjutera ili upada u datoteku. Sistem %ifrovanja javnim klju!em Jedna od metoda %ifrovanja. Mije%anjem ovih boja dobija se tamna boja pribli!na crnoj. Kombinovanje boja $tampa" predstavlja boje koriste#i tri osnovne boje: C (cyanogen). klju" kori%ten za %ifrovanje ne omogu#ava i de%ifrovanje. Klijent-server sistem Sistem uspje%ne upotrebe kompjutera kombiniraju#i kompjuter klijenta koji zahtijeva uslugu i kompjuter servera koji provodi razne procese zavisno od zahtjeva klijenta. itd. Koriste se dvije vrste klju"a: tajni klju" koji samo vi znate i privatni klju" koji se ka!e drugoj strani. pomo#u programa koji koriste#i kompjutersku mre!u nanose ogromne %tete drugim kompjuterima i podacima. Sajber kriminal Kriminal koji zloupotrebljava informacijsku tehnologiju. To je kriminalno djelo usmjereno ka kompjuterima i elektromagnetnim podacima. Tako&er se zove i virus. Kompjuter se zarazi pomo#u preuzimanja podataka. Sistem %ifrovanja javnim klju"em ima prednost jer klju" za dekodiranje rijetko bude presretnut i otkriven. M (magenta) i Y (yellow). spol i datum ro&enja su "etiri osnovna podatka. Simulacija Metod kojim se provodi eksperiment koriste#i stvarne proizvode i modele kako bi se rije%io problem. Mjera Ovime se mjeri koli"ina u odre&enom stanju. 184 . Ime i prezime.Poglavlje 7. itd. adresa. Pravo industrijskog vlasni%tva To je ime za "etiri prava: patent pravo. Graphical User Interface (GUI)/Grafi!ko korisni!ko okru&enje Okru!enje koje sadr!i prozor. povezivanje tabela. Ispitivanje podataka koji su smje%teni u tabelu. Li!ni podaci Ovo su informacije kojima se mo!ete identifikovati. Projekcija Operacija kojom se uzima red iz tabele koji odgovara upitu.

Kompjuterska pismenost Periferni ure"aji Ulazni ure&aji. Grafi!ki model Model koji opisuje strukturu u dijagramu usredsre&uju#i se na sastavne elemente rezultata i njihovu povezanost kao %to je dijagram toka programa ili organizacijski grafikon kompanije. Skalni model Model umanjenoga stvarnog proizvoda. Informacije bez ograni!enja Omogu#ava hendikepiranim osobama i starijim osobama da koriste informacijsku opremu %to je mogu#e lak%e. Koli!ina informacija Koli"ina informacija koju sadr!i slika ili dokument. izlazna jedinica Slu!e za prikazivanje rezultata obrade na kompjuteru u obliku pogodnom za kori%tenje. rekonstrukcija i %irenje. ekstrakcija. kao %to je model koji se koristi pri eksperimentu zra"nog tunela. Aritmeti!ki model Model koji matemati"ki opisuje status rezultata kao %to je jedna"ina koja predstavlja vezu cijena profit.Poglavlje 7. ali se naj"e%#e koriste 3 NF. 'irenje. 185 . vanjske memorije i ulazno-izlazni ure&aji. U praksi postoje 5. Kontrolni sistem Operacija kojom se odre&uje status do statusa rezultata. izlazni ure&aji. Pristup informacijama Pretra!ivanje potrebnih informacija iz baze podataka. Uop#eno. Operativna memorija U operativnoj memoriji se nalazi izvr%ni program koji se neposredno izvr%ava i podaci koji se neposredno koriste tokom izvr%avanja programa. Tablica istinitosti Tablica koja opisuje rezultat logi"ke operacije. dekompresija Povrat sa!etih podataka. Stati!ki model Model kod kojeg ne morate misliti na protok vremena kao %to je simulacija stope profita. Normalizacija/Filtriranje Normalizacija baza podataka jeste izbjegavanje nepotrebnog vi%estrukog ponavljanja podataka. Tako&er se zove i dekompresija. slika ima ve#u koli"inu informacija od tekstualnih podataka. pravilnim postavljanjem relacija izme&u tabela. Izlazni ure"aj. %to se posti!e kroz 3 normalne forme. Sigurnost Spre"avanje neovla%tenog pristupa kompjuteru i falsificiranju podataka kako bi se obezbijedila sigurnost pri upotrebi kompjutera.

prijevoda. Digitalizacija Konvertovanje (pretvaranje) analognih podataka u digitalne podatke. itd. Autorsko pravo Pravo autora da kontroli%e i sti"e profit pomo#u umno!avanja. pravo industrijskoga vlasni%tva…itd. OR/ILI uvjet. Kompjuterska pismenost Apsolutna referenca. Postoji autorsko pravo. Jednostavno pretra&ivanje Metoda pretra!ivanja ciljnih podataka jedan po jedan. Digitalno Ovime se ograni"ava neprestano mijenjanje koli"ine u odre&enim intervalima njihovo predstavljanje broj"anom vrijedno%#u. Relativna referenca Metoda preciziranja polo!aja #elije pomo#u relativne pozicijske povezanosti s drugim #elijama u programu za rad sa radnim tabelama. izdavanja. a relativna frekvencija se odre&uje: broj doga&aja koji su se pojavili ÷ ukupni broj. Pravo intelektualnog vlasni%tva Pravo monopola u odre&enom utvr&enom vremenskom periodu koje se daje autoru za intelektualne kreativne aktivnosti. vrste. te za%tita identiteta za autorsko djelo. no potrebno je mnogo vremena za pretra!ivanje ako postoji mnogo podataka. Prilikom kopiranja formule u kojoj Selekcija Operacija uzimanja reda koji ispunjava uvjet iz tabele. Ovim pravom se uzima isklju"ivo pravo na posjedovanje zvu"nog zapisa. itd. Apsolutna referenca ima znak & ispred oznake kolone se nalaze one se ne mijenjaju. prikazivanja i emitiranja. Moralno pravo Pravo za%tite li"nog profita koji ima autor za svoje autorsko djelo kroz objavljivanje autorskog djela. Osnovna klasifikacija softvera je na aplikativni i sistemski. prikaz imena na autorskom djelu. njegovog/njenog autorskog djela. prijenose. Jednostavni uvjet Jednostavni uvjet pretra!ivanja koji ne koristi AND/I uvjet. Softver Programske komponente kompjuterskog sistema. Ovo je jednostavna metoda. Srodno pravo Pravo zasnovano na autorskom pravu ovla%teno za izvo&a"e. producente fonograma. Relativna frekvencija Broj doga&aja koji su se pojavili zove se frekvencija. videozapisa i kopije. 186 . itd.Poglavlje 7.

Digitalni potpis Tehnologija koja dokazuje da podatke stvara sam po%iljalac. Electronic Commerce (EC)/Elektronsko poslovanje Transakcija proizvoda i usluga putem mre!e. Elektronska po%ta Sistem razmjene poruka s odre&enom osobom na Internetu. potpis po%iljaoca. te razli"iti oblici za%tite baze podataka. DVD-a. sr . Tako&er se zove e-mail. Database management system (DBMS)/Sistem za obradu baze podataka Programi koji funkcioniraju kao most izme&u korisnika i baze podataka. ne%to drugo morate !rtvovati. Postoji tip po datumu i tip automatskog broja itd. Sastoji se od redova i kolona. Pored samog kreiranja baze. Dinami!ki model Model za koji su bitne promjene rezultata pomo#u pra#enja protoka vremena. To je isto %to i certifikat ili pe"at. uz tip teksta i tip broj"ane vrijednosti. Baza podataka Velika koli"ina sre&enih i prikupljenih podataka koja se lako pretra!uje.Hrvatska. itd. Zbog ovoga se stvara dru%tveni i ekonomski jaz izme&u ljudi. 187 . nadgledanje rada.Poglavlje 7. Tako&er se zove i elektronska trgovina. Ime domena Ime domena odre&uje zemlju porijekla (ba – Bosna i Hercegovina. hr. com – komercijalna). Trade off/Kompromis Veza u kojoj vi%e od jednog elementa ima vezu koja ne mo!e biti konzistentna.Srbija) ili namjenu domene (edu – edukacija. Eletronska provjera ispravnosti Tehnologija kojom tre#a strana dokazuje da je digitalni potpis. Kompjuterska pismenost Digitalna podjela Pod ovime se podrazumijeva podjela za ljude koji !ive u okolini gdje se informacijska oprema mo!e koristiti i za ljude koji ne !ive u takvoj okolini. Digitalno emitiranje Sistem koji emituje digitalni elektri"ni signal. gov – vlada. Tabela To je dvodimenzionalna tabela. Tehno-stres Zajedni"ko ime za dvojni vid psiholo%kog gubitka samokontrole uzrokovanog kontaktom s tehnologijom. Tipovi podataka Tipovi podataka s kojima se radi u bazama podataka. i da sadr!aj nije falsificiran. kao u situaciji kada !elite ne%to pobolj%ati. zadatak DBMS-a je kontrola. Paket baze podataka Elektronski rje"nici u obliku CD-ROM-a.

Metode sortiranja su: metoda razmjene. Patenti metod poslovanja Patent "iji je cilj za%tita poslovanja i ideje. externe diskove) kako bismo sprije"ili ne!eljeni gubitak podataka u slu"aju hardverskog otkaza sistema. Topologija mre&e Fizi"ko i logi"ko ure&enje kompjutera unutar mre!e. Originalni podaci moraju biti sortirani u rastu#em ili opadaju#em poretku. trake.Poglavlje 7. itd. metoda umetanja. Kompjuterska pismenost Sortiranje Sortiranje podataka konfiguriranih rastu#im ili opadaju#im redoslijedom. Mije%anje ovih boja poja"ava kontrast i blizu je bijeloj.Prsten . metoda izbora. Svaki paket sadr!i adresu primaoca i po%iljaoca. Bajt Niz od 8 bita zove se bajt. metoda brzoga sortiranja. Paket Podaci koji se prenose Internetom dijele se u pakete. ulazna jedinica Ulazni ure&aji slu!e za uno%enje podataka u kompjuter.Bus . Tri osnovne boje svjetla To su R (red/crvena). (1 byte = 8 bits) Array/Niz Skup podataka iste vrste. 188 . flash memorije. Sekundarne informacije Ovim informacijama lako pretra!ujemo primarne informacije kao %to su indeks i sadr!aj. Postoje 3 osnovne mre!ne topologije: . Prepoznavanje uzoraka Tehnologija provjeravanja novih grafi"kih i zvu"nih podataka s podacima memorisanim u kompjuteru i prepoznavanje po njihovim osobinama. Backup Backup je kreiranje sigurnosnih kopija podataka na razli"ite vrste medija (CD. Ulazni ure"aji. G (green/zelena) i B (blue/plava).Zvijezda Hardver Oprema koja "ini kompjuter. Biometrija Metoda provjere identiteta koja koristi fizi"ke osobine "ovjeka. Binarno pretra&ivanje Metoda pretra!ivanja ciljnih podataka ponavljanjem podjele intervala na pola.

Kompjuterska pismenost Bit Kra#i oblik za binarnu cifru. osam za eksponent i 23 za apsolutnu vrijednost mantise. koji je osnova automatskog kontrolnog sistema. Feedback control/Regulacija povratnom vezom Ovim sistemom se odlu"uje sada%nji status do sljede#eg statusa. Form/Oblik Elektronski obrazac za unos podataka. Binarna cifra mo!e biti 0 i 1. Predstavljanje u pokretnom zarezu To je sistem ozna"avanja realnih brojeva u registar sa 32 #elije gdje je jedna #elija rezervisana za znak. a izra!ava se fps (frames per second/slika u sekundi). 'ifrovanje Pretvaranje informacija u %ifre zasnovano na odre&enom pravilu. ime. Tako da se bit javlja kao najmanja jedinica za skladi%tenje podataka u memorijskim medijima kompjutera. Negacija Operacija kojom rezultat postaje 0 kada je unos 1. Broj slika u jednoj sekundi zove se brzina slike. Firewall Sistem koji %titi kompjuter i mre!u spojenu na Internet od upada i sprije"ava zloupotrebu internih informacija. Samplovanje Metoda uzimanja zvuka u odre&enim intervalima. 189 . (polje prezime. Vrsta datoteke Postoje vrste datoteka svojstvenih primjeni programa i op#a vrsta kojom se mo!e upravljati pomo#u razli"itih programa. Interval ograni"avanja (vremenski interval) zove se odabrani ciklus ili sampling ciklus.Poglavlje 7. #injeni!na baza podataka To je baza podataka u koju se prikupljaju dokumenti (primarne informacije). a rezultat postaje 1 kada je unos 0. Vrste datoteka se obi"no identifikuju nizom znakova koji se zove ektenzija/produ!etak koji je prilo!en na kraj imena datoteke..) Fail-safe/Protiv otkazivanja Funkcija koja smanjuje %tetu nastalu kada "ovjek primijeni pogre%nu operaciju ili se ure&aj pokvari.. Sve informacije predstavljene su u kompjuteru kao niz bitova. Slo&en uvjet To je uvjet pretra!ivanja koji koristi AND/I uvjet i OR/ILI uvjet. Frame/Okvir To je slika koja defini%e pokretnu sliku. Ta"ka ograni"avanja zove se ta"ka uzorka. Polje Kolona u tabeli koja odre&uje tip podatka. Web-pretra&iva! Program za pretra!ivanje Web-stranica.

krivih ili poligona. Pri upotrebi kompjutera. Complement/Dopuna To je broj koji se mo!e dobiti oduzimanjem datog broja od odre&enog broja. koristi se izraz negativnog broja. Mogu#e je rije%iti problem matemati"ki i uz pomo# fizike. Rje%enje problema Put do rje%enja problema i izvr%avanje rje%enja. Rasterska grafika Definisana slika kao skup ta"aka. Mogu#e je snimiti veliku koli"inu podataka na njega. Program Opisuje procedure obrade podataka izra!enu na na"in koji kompjuter razumije. Protokol To je unaprijed definisana procedura i metod kada se primjenjuje komunikacija putem kompjutera. Vanjska memorijska jedinica. Model Model je kopija stvarnog predmeta. Red/redanje Linearni raspored elemenata (sli"an uslu!ivanju klijenata na blagajni supermarketa). Kompjuterska pismenost Dijagram Opisuje procedure procesa koriste#i odre&ene simbole u fazi dizajna programa i sistema. 190 . Zove se i maketa. Slu!ajan broj To je broj "ija se vrijednost ne mo!e predvidjeti unaprijed. Znakovni kod Kod dodijeljen svakom znaku za upotrebu znakova u kompjuteru. Mobilno ra!unarstvo Mogu#nost slanja i primanja podataka kori%tenjem digitalnih ure&aja kao %to su PC i mobilni telefon. Simboli i stil pisanja odre&uju se od strane JIS-a. Vektorska grafika Vektorska grafika se obra&uje matemati"ki kao kolekcija ta"aka. Monte Carlo metod Metoda rje%avanja problema primjenom slu"ajnog broja. Modeliranje Stvaranje modela na osnovu stvarnog predmeta. linija. vanjska memorija To je vanjska memorijska jedinica kao %to je magnetni disk odvojen od glavne memorijske jedinice.Poglavlje 7. Ovaj problem se ne mo!e rije%iti u teoriji (analiti"ki) jednostavnim metodom. Univerzalni dizajn Dizajniranje proizvoda tako da ga ljudi mogu lako koristiti.

Rezultat #e biti jednak jedinici samo ako su obje vrijednosti 1. Kvantizacijska gre%ka Razlika izme&u originalne analogne vrijednosti pri kvantizaciji zove se kvantizacijska gre%ka. ime. Registar To je podru"je memorije u CPU u kome su podaci i uputstva privremeno sa"uvani. Povezanost To je povezivanje vi%e od jedne tabele. Record/Zapis To je red u tabeli koji predstavlja skup svih polja (atributa). Logi!ki proizvod Operacija mno!enja binarnih brojeva. ta"ki uzorka. adresa) "ini jedan slog ili record baze podataka. Relaciona baza podataka Podaci pretvoreni u dvodimenzionalni tabelarni oblik. Kvantizacija Kvantizacija predstavlja ograni"avanje amplitude oblika talasa u odre&enim intervalima da bi se dobila numeri"ka vrijednost najbli!oj vrijednosti. Logi!ko kolo Procedura koja provodi logi"ke operacije u kompjuteru zove se logi!ko kolo. Antivirusni program Program koji pronalazi virus i izoluje zara!enu datoteku. Logi!ka operacija Operacija koju obavlja kompjuter. te zaustavlja aktivnosti virusa. Rezultat #e biti jednak nuli samo ako su obje vrijednosti 0. skup svih polja za jednog u"enika (prezime. To se zove i hiperlink. 191 . Npr.Poglavlje 7. Link To je funkcija pokretanja odgovaraju#e Web-stranice klikom na odre&eni znak ili sliku na Web-stranici. Logi!ka suma Operacija sabiranja binarnih brojeva. Kompjuterska pismenost Referentna baza podataka Baza podataka u kojoj se prikupljaju sekundarne informacije obra&ene iz primarnih informacija.

Dodjeljivanje vrijednosti #elije promjenljivoj. For broja" = po"etna vrijednost Do krajnja vrijednosti [Korak dodavanja]  Instrukcija Sljede#a vrijednost Promjenljiva x dobijat #e vrijednosti od 1 do 10 (svaki put uve#ane za 1).vrijednost = a Substitucija promjenljive a = )elije(1.2). a=b. )elija(1. zadaju se instrukcije itd. Broja"ki ciklus se opisuje upotrebom For naredbe. y as Int Substitucija #elije )elije(1. izvr%it #e se niz naredbi (c=a.x). Dodjeljivanje podataka #eliji.2). Dodijelite vrijednost #elije (B1) promjenljivoj a. Promjenljive X i Y su deklarisane kao cjelobrojne promjenljive (mogu im se dodjeljivati samo cjelobrojne vrijednosti). Procedura je program koji mo!e imati vi%e ulaznih i izlaznih vrijednosti.Vrijednost = x Next x Zna"enje makronaredbe Zna"enje primjera Makro opisuje program izme&u Sub i End Sub. Vrijednosti 1.Poglavlje 8. Me&utim. Lista glavnih makronaredbi Glavne makronaredbe programa za rad sa radnim tabelama Makro naredbe Primjer Procedura Sub Macro() : : End Sub Deklaracija promjenljive Dim x as Int. 192 .2.2) je #elija "ija je pozicija prvi red i druga kolona.Vrijednost Razgranata struktura If a<b then  c=a  a=b  b=c End If Broja"ki ciklus For x = 1 Do 10  )elije(1.3…10 bit #e smje%tene od #elije (A1) do #elije (J1). kod koje se vrijednost broja"a mijenja od po"etne vrijednosti do krajnje vrijednosti. u suprotnom naredba2. To je nepotpuni oblik If naredbe If izraz then If izraz then  naredba1 naredba1 [Else End If  i naredba2] End If Ako je ta"an izraz “vrijednost a manja od vrijednosti promjenljive b”. izme&u [ ] mo!e biti izostavljeno. #elija(B1). Promjenljiva je deklarisana. b=c) tj. Ovoj #eliji bi#e dodjeljena vrijednost a. Naredbe i funkcije Poglavlje 8. Razgranata struktura se opisuje upotrebom If naredbe koja po"inje sa ako je izraz ta"an tada se izvr%ava naredba1. promjenljive a i b razmjenit #e svoje vrijednosti. tj. Izme&u Sub Macro() i End Sub se vr%i deklaracija promjenljivih.

Poglavlje 8.Vrijednost = x  x = x+1 Loop Uvjetni ciklus se opisuje upotrebom naredbe While.3…10 bit #e smje%tene od #elije (A1) do #elije (J1).2. Naredbe i funkcije Uvjetni ciklus x=1 Do While(x<=10)  )elije(1. 193 .x). Do While izraz Instrukcija Loop Sve dok je vrijednost izraza ta"na instrukcija #e se izvr%avati. Promjenljiva x dobijat #e vrijednosti od 1 do 10 (svaki put uve#ane za 1). Vrijednosti 1.

AVERAGE(cell address:cell address) Dobija se aritmeti"ka sredina (srednja vrijednost) u odre&enom opsegu #elija. 16 i 17. dobija se srednja vrijednost dva srednja "lana opsega.2.">12") Ako su vrijednosti 10. 3. 194 .B1:B3) =SUMIF(A1:A3. SUMIF) Statisti"ke funkcije (AVERAGE. rezultat je 16. =AVERAGE(5. Rezultat je zbir brojeva 3. i 3 su uneseni u #elije (B1) do #elije (B3). Kada su iste vrijednosti unesene. 2. 15 i 20 unesene u #elije (A1) do #elije (A3) i 1.7) =AVERAGE(A1:A3) MEDIAN (cell address:cell address) =MEDIAN(3. 6 i 7.17) =MEDIAN(A1:A4) Dobija se vrijednost srednjeg "lana opsega #elija. Rezultat je zbir numeri"kih vrijednosti opsega #elija od A1 do B3. search condition. 2 i 6.6. =SUMIF(A1:A3. uklju"uju#i nule. Naredbe i funkcije Lista funkcija Funkcije programa za rad sa radnim tabelama * Matemati"ke funkcije (SUM. 16. SUMIF (range. Rezultat je 6.6) =SUM(A1:B3) Zna"enje funkcije Zna"enje primjera Sabira sve numeri"ke vrijednosti u odre&enom opsegu #elija. dobija se ukupan zbir vrijednosti #elija koje ispunjavaju uvjet pretra!ivanja.Poglavlje 8. Kada se 3. MEDIAN) Funkcija Primjer SUM (cell address:cell address) =SUM(3. Kada je total range izostavljen.16.">12". %to je aritmeti"ka sredina brojeva 5. rezultat je zbir brojeva 15 i 20. Ako opseg ima paran broj "lanova.5 %to je srednja vrijednost dva srednja "lana. total Dobija se ukupna vrijednost #elija koje ispunjavaju uvjet range) pretra!ivanja. 17 i 33 unesu u #eliju (A1) do #elije (A4). rezultat funkcije je 5 koji je zbir brojeva 2 i 3. ali ne uklju"uje prazne #elije. Rezultat je 16 %to i jeste srednji "lan tri vrijednosti. Rezultat je aritmeti"ka sredina opsega #elija (A1:A3).

"Ne") Ako je vrijednost #elije A1= 10. dakle ve#e je od 1 i manje od 100. respektivno ta"an. 195 . Ako je vrijednost #elije A1=15. =IF(A1=10. neta"an. rezultat rada ove funkcije je TRUE. krajnja vrijednost #e biti ta"an. Ako su npr.…) =AND(1<A1. Ako je bar jedan od logi"kih izraza ta"an. for true. Ako je vrijednost #elije A1= 76.Poglavlje 8. u suprotnom je FALSE. Samo kada su svi logi"ki izrazi ta"ni.A1<100) OR (conditional expression conditional expression 2. 1. rezultat #e biti True. AND (conditional expression conditional expression 2. Ako je logi"ki izraz ta"an rezultat #e biti neta"no i obrnuto. for Ako je ta"an conditional expression (logi"ki izraz) u false) #eliji u kojoj je ta funkcija bit #e prikazana vrijednost for true. slijedi da je rezultat rada ove funkcije "NETA'NO". %to je manje od 30.…) =OR(A1:A3) NOT (conditional expression) =NOT(A1<30) 1. sadr!aj #elije u kojoj se nalazi funkcija postaje “Da”. ta"an."Da". rezultat #e biti TRUE. vrijednosti izraza u #elijama (A1) do #elije (A3). logi"ki izraz je ta"an. Samo u slu"aju da nijedan izraz nije ta"an rezultat je FALSE. u suprotnom for false. u suprotnom “Ne”. Naredbe i funkcije Logi"ke funkcije Funkcija Zna"enje funkcije Primjer prikaza Zna"enje primjera IF (conditional expression.

ne uzimaju#i u obzir prazne #elije =MIN(A1:A5) Rezultat je najmanja vrijednost sadr!ana u opsegu #elija (A1:A5).ako je 0 opadaju#i redoslijed.0) Ako su 5. ali ne ra"una prazne #elije i #elije sa tekstom. COUNTIF (range. search condition) Broji #elije iz opsega #elija "iji sadr!aji zadovoljavaju postavljeni uvjet. 2. 196 .ref. 1 vrijednosti #elija (A1) do (A5) redom. =COUNTIF(A1:A10. kao i #elije u kojima su upisane nule. MIN (cell address:cell address) Prikazuje najmanju vrijednost sadr!anu u opsegu #elija. 1 rastu#i redoslijed.opseg u kome se provjerava poredak.A1:A5.order) Number. RANK(number. ali uklju"uju#i #elije u kojima je upisana nula.adresa #elije kojoj se odre&uje rang. Opseg #elija. 3. Rezultat funkcije je 4 zato %to je broj 2 "etvrti po redu u opadaju#em nizu zadatih brojeva. =MAX(A1:A5) Rezultat je najve#a vrijednost sadr!ana u opsegu #elija (A1:A5). COUNTA(cell address:cell address) Broji koliko #elija ima u opsegu. =RANK(A2. Dobija se broj numeri"kih podataka iz opsega #elija (A1:A10).Poglavlje 8. 4.20) Dobija se broj podataka "ija je vrijednost jednaka 20 iz opsega #elija (A1:A10). MAX(cell address:cell address) Prikazuje najve#u vrijednost sadr!anu u opsegu #elija. =COUNTA(A1:A10) Dobija se broj svih podataka iz opsega #elija (A1:A10). uklju"uju#i formule i funkcije. Naredbe i funkcije Statisti"ke funkcije Funkcija Primjer prikaza COUNT (cell address:cell address) =COUNT(A1:A10) Zna"enje funkcije Zna"enje primjera Broji koliko ima #elija u opsegu sa upisanim numeri"kim vrijednostima. ne uklju"uju#i prazne #elije. Redoslijed.

col_index_num.H3:J7. Naredbe i funkcije Funkcije za tra!enje i referenciranje Funkcija Primjer prikaza VLOOKUP(lookup_value. number of row.4) Prikazuje se vrijednost sadr!aja #elije (E5) Matemati"ka funkcija Funkcija Primjer RAND() Zna"enje funkcije Zna"enje primjera Dobija se slu"ajan broj izme&u 0. Col_index_num.2.broj kolone iz koje se dobija tra!ena vrijednost.vrijednost koja se tra!i u lijevoj koloni u okviru opsega #elija.ako je „0“ tra!e se podaci koji odgovaraju tra!enoj vrijednosti „1“.broj reda iz kojeg se dobija tra!ena vrijednost.opseg #elija u kome se tra!i vrijednost. tra!i se najve#a vrijednost koja je manja od tra!ene. INDEX (table_array.3.table_array.search_type) Lookup_value.ako je „0“ tra!e se podaci koji odgovaraju tra!enoj vrijednosti „1“. Table_array.Poglavlje 8.vrijednost koja se tra!i u prvom odozgo redu u okviru opsega #elija. 197 . Table_array.877816.000000 i 1.table_array. 0. Vra#a vrijednost sadr!aja #elije presjeka zadatog reda I i number of column) kolone iz odre&enog opsega =INDEX(B4:G6. Search_type. Ako se tra!ena vrijednost ne prona&e. Row_index_num. row_index_num.opseg #elija u kome se tra!i vrijednost. Search_type. Lookup_value. Ako se tra!ena vrijednost ne prona&e. prikazuje se slu"ajan broj kao %to je npr.search_type) Zna"enje funkcije Zna"enje primjera =VLOOKUP(1.0) Primjer iz poglavlja Algoritmi HLOOKUP(lookup_value. tra!i se najve#a vrijednost koja je manja od tra!ene.000000 =RAND() Svaki put prilikom novog izra"unavanja.

Related Interests