You are on page 1of 927

U TOKU JE LEKTURA I KOREKTURA TEKSTA

Osho-Patanali
Izreke o jogi
Deset knjiga predavanja Oshoa o Patanjalijevim Joga sutrama,
odranih od 25-XII-1973. do 10-V-1976. godine
izdate pod nazivom: Yoga, The Alpha and the Omega
Prevod:
Ivan Anti
Ivana Beker
Milivoje Vukovi
Lektura, korektura i napomene:
Ivan Anti

PREDGOVOR
Kao da je posle vie hiljada godina sam Patanjali ponovo doao i progovorio o
svojim uvenim Joga sutrama, ali sada sve to nije prvi put rekao, sve to treba rei tako da
nita ne preostane, tako da i savremenom oveku budu savreno jasne. Takav se utisak stie
dok itamo ove Oshoove komentare.
Patanjalijeve Joga sutre su "Biblija za meditante", apsolutno neophodne svakome
ko namerava da medititra, ko ve medititra i onome ko misli da je ve savladao meditaciju.
Samo ovde moe saznati sutinu i svrhu prave meditacije i duhovnosti.
Joga sutre su najznaajnije delo na svetu koje iznosi ljudsku sutinu i praksu za
njenu aktuelizaciju. Nigde nije tako objektivno i precizno u rei pretoena sutina ljudskog
duha i svrha ljudske egzistencije kao u teorijskim postavkama Sankhye, i nigde nije tako
precizno dato reenje za ostvarenje smisla egzistencije u samom oveku, a ne spolja kao to
sva druga uenja pokuavaju, korak po korak, usavravanjem oveka da on sam bude olienje
ishoda stvarnosti, praktinom primenom postavki Sankhye u jogi, koju je sakupio Patanjali.
Ovo je jedini tekst u kome je sutina duhovnosti izneta kao nauka. Patanjali je sutinu
duhovnosti i religioznosti izrazio na nauan nain. Savremena nauka tek danas otkriva neke
istine o oveku i svesti koje je on opisao tako davno. Zapravo, u tim vremenima, pre oko 5
hiljada godina, duhovnost je i bila samo nauka i praksa: joga. Tek kasnije je degradirana u
religijske kultove, mitove i prakse sa dolaskom Veda na indijski potkontinent. Vede
predstavljaju degradaciju i propast duhovne prakse koja se razvijala pre toga kod
starosedelaca u dolini Inda, a ostala je delimino ouvana i specifino prikazana samo u
tradiciji aina, jogina i budista, kao doktrina probuenja, ili pobede nad nesvesnim
uslovljavanjem. Ta degradacija je zatrla tu istu praksu ovekovog probuenja, i donela
procvat religija i teologija, od hinduizma do judeo-hrianstva i masovne kontrole uma.
Bolje od svih drugih komentatora, Osho je ovde pokazao da o tom iskonskom putu
probuenja moe da svedoi samo onaj koji ga je proao.
Ivan Anti

Osho
JOGA: ALFA I OMEGA
Knjiga prva
Poglavlje 1
UVOENJE NA STAZU JOGE
25. decembar 1973.1
I, l:

atha yognuasanam.
[Neka bi se upravo ovo to] sada [sledi uzelo za] jogistiko uenje.

I, 2:

yogacittavrttinirodhah.
Yoga je u obustavljenosti [zamuujuih partikularnih] obrta u s-vesti
(cittavrtti).
I, 3:

tada dratuh svarupe vasthanam.


[Samo] tada [u toj obustavljenosti partikularnih obrta] onaj koji vidi (dratr)
biva u skladu sa svojom pravom prirodom (svarupa).
I, 4:
svesti].2

vrttisarupyamitaratra.
Inae se [ovek] poistoveuje sa [partikularnim] obrtima (vrtti) [vlastite

Mi ivimo u dubokoj iluziji - iluziji o nadi, budunosti, sutranjici. ovek, ovakav


kakav jeste, ne moe da ivi bez samoobmane. Nie je negde rekao da ovek ne moe iveti
sa istinom; njemu trebaju snovi, trebaju mu obmane, potrebne su mu lai da bi postojao. Nie
je u pravu. ovek kakav je sada ne moe postojati sa istinom. 3 Ovo treba shvatiti vrlo duboko,
jer bez razumevanja toga, ne moe biti ulaska u istraivanje koje se zove joga.
Um treba duboko razumeti - um kome trebaju lai, um kome trebaju iluzije, um koji
ne moe postojati sa realnim, um kome trebaju snovi. Vi ne sanjate samo nou. ak i dok ste
budni, sanjate neprekidno. Moda gledate u mene, moda me sluate, ali struja sna tee unutra
u vama. Neprekidno um stvara snove, slike, fantazije.
Sada naunici kau da ovek moe iveti bez spavanja, ali ne moe iveti bez snova.
Odavno je shvaeno da je spavanje potrebno, ali sada moderno istraivanje kae da spavanje
nije zaista nuno. Spavanje je potrebno samo da biste mogli sanjati. Ako vam nije dozvoljeno
1

Predavanja su drana usmeno, snimljena i naknadno zapisana, stoga treba imati u vidu da ovaj prevod tih
predavanja, iako veran originalu, u nekim delovima nije jeziki ispravan sa duhom pisanog knjievnog jezika.
2
Ovde, i na poetku svakog poglavlja, dajemo najbolji prevod Joga sutri na srpski jezik sa sanskrita od Zorana
Zeca (Patanjali: Izreke o Jogi, Beograd, 1977) Ceo prevod te knjige dat je na kraju ove knjige. Oshov prevod sa
engleskog jezika nalazi se u tekstu njegovih komentara gde se esto ponavlja, tako da su oba prevoda sauvana i
mogu da se dopunjuju radi boljeg razumevanja sutri. Poneki komentari iz prevoda Zorana Zeca obeleeni su u
napomeni kao: Komentar Z.Z.
3
Ako je ovek nesvestan, neprobuen, onda je njegova potreba za iluzijama prirodan odraz njegovog stanja.
2

da sanjate a dozvoljeno da spavate, neete se ujutru oseati sveim, bodrim. Oseaete umor,
kao da uopte niste spavali.
U noi ima perioda - perioda za duboko spavanje i perioda za sanjanje. Postoji ritam upravo kao dan i no, postoji ritam. U poetku padate u dubok san oko 40-45 minuta. Onda
dolazi faza sanjanja, tada sanjate. Posle toga opet spavanje bez snova, pa onda opet sanjanje.
itave noi se to odvija. Ako je vae spavanje ometano za vreme dok spavate duboko bez
snova, ujutru neete oseati da vam je ita nedostajalo. Ali dok sanjate, ako je va san ometen,
onda ete se ujutru oseati sasvim umorni i iscrpljeni.
Sada se ovo moe znati spolja. Ako neko spava, vi moete oceniti da li sanja ili spava.
Ako sanja, njegove oi e se neprestano kretati - kao da gleda neto sa zatvorenim oima.
Kada on duboko spava, oi se nee kretati; one e ostati smirene. Dakle, dok se vae oi
pokreu, ako je vae spavanje tada ometano, ujutru ete oseati umor. Onda kada se vae oi
ne kreu, spavanje moe biti ometano, i ujutru neete oseati da vam ita nedostaje.
Mnogi istraivai su dokazali da se ljudski um hrani za vreme snova, san je nuan, a
san je totalna samoobmana. A to nije samo tokom noi; dok ste budni takoe isti obrazac
sledi; danju to ak moete primetiti. Ponekad e u umu ploviti san, ponekad nee biti snova.
Kada ima snova vi ete initi neto, ali ete biti odsutni. Unutra ete biti okupirani. Na
primer, vi ste ovde. Ako va um prolazi kroz stanje sanjanja, vi ete sluati mene a da me
uopte ne ujete, jer va um e biti okupiran unutra. Ako niste u stanju sanjanja, samo me
onda moete uti.
Danju, nou, um nastavlja da se kree od nesanjanja do sna, onda od sna do
nesanjanja. To je jedan unutranji ritam. Ne samo da mi svesno sanjamo, u ivotu mi takoe
projektujemo nade u budunost.
Dananjica je gotovo uvek pakao. Vi moete produavati to samo zbog nade koju ste
projektovali u budunosti. Vi moete iveti danas zbog sutra. Nadate se da e se neto sutra
dogoditi - neka vrata raja e se sutra otvoriti. Ona se nikada ne otvaraju danas, a kada sutra
doe ono nee doi kao sutra, ono e doi kao danas, ali dotle va um se ponovo pomerio. Vi
se stalno kreete ispred sebe; to je ono ta znai sanjanje. Vi niste jedno sa realnim, onim to
je u blizini, onim to je ovde i sada, vi ste negde drugde - kreete se unapred, skaete napred.
A to sutra, tu budunost, vi ste imenovali na tako mnogo naina. Ljudi to nazivaju
nebom, neki ljudi to zovu moksha (osloboenje), ali to je uvek u budunosti. Neko misli u
terminima bogatstva, ali to bogatstvo e biti u budunosti. Neko misli u terminima raja, a taj
raj e biti posle vae smrti - daleko u budunosti. Vi gubite svoju sadanjost za ono to nije; to
je ono ta sanjanje znai. Vi ne moete biti ovde i sada. To izgleda da je teko, da se bude
upravo u sadanjem trenutku.
Moete biti u prolosti zato to je opet to sanjanje - seanja, pamenje stvari kojih
nema vie, ili moete biti u budunosti, koja je projekcija, koja je opet kreiranje neega iz
prolosti. Budunost nije nita do opet projektovana prolost - mnogo ivopisnija, mnogo
lepa, ali to je profinjena prolost.
Ne moete misliti ni o emu drugom nego o prolosti. Budunost nije nita drugo do
ponovo projektovana prolost, a obe nisu. Sadanjost jeste, ali vi nikada niste u dananjici. To
je ono ta znai sanjanje. Nie je u pravu kada kae da ovek ne moe iveti sa istinom.
Njemu su potrebne lai, on ivi kroz njih. Nie kae da mi stalno govorimo da elimo istinu,
ali je niko ne eli. Nae takozvane istine nisu nita do lai, lepe lai. Niko nije spreman da
vidi golu stvarnost.
Takav um ne moe ui na stazu joge, jer joga oznaava metodologiju za otkrivanje
istine. Joga je metod da se doe do nesanjajueg uma. Joga je nauka da se bude u ovde i sada.
Joga znai da ste sada spremni da se ne kreete u budunost. Joga znai da ste sada spremni
da se ne nadate, da ne iskaete napred iz vaeg bia. Joga znai sresti se s realnou kakva
jeste.
Prema tome ovek moe ui u jogu, ili na stazu joge, samo kada je totalno izigran i
frustriran od svog vlastitog uma kakav on jeste. Ako se jo nadate da moete dobiti neto
kroz svoj um, joga nije za vas. Potrebna je totalna frustracija - otkrie da ovaj um koji
projektuje jeste beskoristan, um koji se nada jeste besmislica, on ne vodi nigde. On
3

jednostavno zatvara vae oi; on vas opija; on nikada ne dozvoljava realnosti da vam bude
otkrivena. On vas titi od realnosti.
Va um je opojno sredstvo, droga. On je protiv onoga to jeste. Stoga dok ne budete
totalno frustrirani sa svojim umom, sa svojim nainom postojanja, nainom na koji ste
postojali do sada, ako ga moete ostaviti bezuslovno, onda moete ui na stazu.
Mnogi su postali zainteresovani, ali vrlo mali broj ulazi jer vae interesovanje moe
biti samo radi vaeg uma. Vi se moda sada nadate, kroz jogu, da moete dobiti neto, ako
motiv postizanja postoji - da moete postati savreni kroz jogu, da moete postii blaeno
stanje savrenog postojanja, da moete postati jedno s brahmanom, da moete postii sat chit
anandu.4 Ovo moe da bude uzrok zato se interesujete za jogu. Ako je to sluaj onda ne
moe biti susreta izmeu vas i staze koja je joga. Onda ste vi sasvim protiv nje, kreete se u
potpuno suprotnoj dimenziji.
Joga znai da sada ne postoji nada, da sada ne postoji budunost, da nema vie elja.
ovek je spreman da zna ta jeste. ovek nije zainteresovan za ono ta moe biti, ta treba da
bude, da bi ita trebao da bude. ovek nije zainteresovan! ovek je zainteresovan samo za
ono to jeste, jer samo realno moe da vas oslobodi, samo realnost moe da postane
osloboenje.
Potrebna je potpuna beznadenost. Buddha5 (Buda) je oajanje nazvao dukha. Ako ste
zaista u patnji, ne nadajte se, jer vaa nada e samo prolongirati jad. Vaa nada je opojno
sredstvo. Moe vam pomoi samo da stignete do smrti i nigde vie. Sve vae nade mogu vas
dovesti samo do smrti. One tamo vode.
Postanite potpuno beznadeni - nema budunosti, nema nade. Teko razumljivo.
Potrebna je odvanost da se hrabro podnese realnost. Meutim, takav trenutak dolazi
svakome, pre ili kasnije. Svakom ljudskom biu doe trenutak kada se osea potpuno
beznadeno. Dogodi mu se apsolutna besmislenost. Kada on postane svestan da je beskorisno
ta god da ini, gde god da ide, to ne vodi nikuda, itav ivot je bez znaaja - iznenada nade
ga ostavljaju, budunost naputa, i po prvi put vi ste usaglaeni sa sadanjim, po prvi put ste
licem u lice sa realnou.
Dok taj trenutak ne doe vi moete nastaviti da radite asane, poloaje; ali to nije
joga. Joga je okretanje unutra. To je totalan zaokret. Kada se ne kreete u budunost, ne
kreete se prema prolosti, onda zapoinjete da se kreete ka sebi - jer vae bivanje je ovde i
sada, ono nije u budunosti. Vi ste prisutni ovde i sada, vi moete ui u ovu realnost. Ali onda
um mora biti ovde.
Ovaj momenat je oznaen prvom Patanjalijevom sutrom. Pre nego to zaponemo
govoriti o prvoj sutri, nekoliko stvari treba razumeti. Prvo, joga nije religija - zapamtite to.
Joga nije hinduistika ili muslimanska. Joga je ista nauka, ba kao matematika, fizika ili
hemija. Fizika nije hrianska, fizika nije budistika. Ako su hriani otkrili zakone fizike,
onda nije zato fizika hrianska. Samo su sluajno hriani otkrili zakone fizike. Ali fizika
ostaje samo nauka. Joga je nauka - samo ju je sluajno otkrio hindus.6 Ona nije hinduistika.
To je ista matematika o unutranjem bivanju. Tako musliman moe biti jogi, ain moe biti
jogi, hrianin moe biti jogi, budista moe biti jogi.
Joga je ista nauka, a Patanjali je najvee ime to se tie sveta joge. Taj ovek je
izuzetan. Niko se ne moe uporediti sa njim. Po prvi put u istoriji oveanstva ovaj ovek je

Sat - bitak, chit - svest, ananda - blaenstvo. To je klasian opis stvarnosti ili budnosti u vedanti po kojoj je
ovekova sutina jedno sa brahmanom - apsolutom.
5
Buddha je ispravan nain pisanja imena osnivaa budizma Gautame Bude. Izgovara se u dva sloga: 'bud' i 'dha'.
6
Ovde je potrebna mala ispravka: joga je mnogo starija od pojave hinduizma. Ona potie iz kulture Mohendo
Daro civilizacije u dolini Inda, koja nema nieg zajednikog sa hinduizmom i vie hiljada godina je starija od
naseljavanja indijskog potkontinenta. Zapravo, kada su arijevci sa iranske visoravni naseljavali indijski
potkontinent, i nosili sa sobom osnove hinduizma, Vede, sukobili su se sa kulturom u dolini inda i porazili je. To
je opisano u epu Mahabharata, tanije u delu tog epa koji je poznat kao Bhagavad Gita. Sutina duhovnosti u
Bhagavad Giti potie od starosedelaca, a to je uenje o sankhyi i yogi. To je uenje ateistika praksa duhovnog
probuenje ovekovog. Arijevci su je samo preuzeli i pomeali sa svojim vedskim uenjima posveenim raznim
bogovima i rtvovanjima. Iz te meavine nastao je hinduizam kakvog danas znamo.
4

doveo religiju do stanja nauke; on je nainio religiju naukom, oevidnim zakonima; nikakva
vera nije potrebna.
Takozvane religije trebaju verovanje. Ne postoje druge razlike izmeu jedne religije i
druge; razlika je samo u verovanju. Musliman ima odreena verovanja, hindu neka druga, a
hrianih neka trea. Razlika je u verovanjima. Joga nema niega to se tie verovanja; joga
ne kae da veruje ni u ta. Joga iskazuje iskustvo. Upravo kao to nauka kazuje
eksperimentom; joga govori iskustvom. Eksperiment i iskustvo su oboje isti, njihova podruja
su razliita. Eksperiment znai neto to vi moete vriti spolja; a iskustvo oznaava neto to
vi moete initi unutra. Iskustvo je jedan unutranji eksperiment.
Nauka kae: ne verujte, sumnjajte onoliko koliko moete. I takoe, nemojte da ne
verujete, jer neverovanje je opet vrsta verovanja. Vi moete verovati u Boga, vi moete
verovati u koncept ne-Boga. Moete rei Bog postoji, sa fanatinim gleditem, moete rei
sasvim suprotno, da Bog ne postoji s istim fanatizmom. Ateisti, teisti, svi su vernici, a vera
nije oblast za nauku. Nauka znai iskusiti neto, ono to jeste; nije potrebna vera. Dakle,
druga stvar koju treba zapamtiti: joga je egzistencijalna isksutvena i eksperimentalna.
Nikakva vera se ne zahteva, nikakva vera nije potrebna - samo odvanost da se iskusi. A to je
ono to nedostaje. Vi moete verovati lako jer u verovanju neete biti preobraeni. Vera je
neto vama dodato, neto povrno. Vae bie se ne menja; vi ne prolazite kroz neku promenu.
Moete biti hindu, moete postati hrianin sledeeg dana. Jednostavno promenite: promenite
Gitu za Bibliju. Moete da je promenite za Kuran, meutim ovek koji je drao Gitu a sada
dri Bibliju, ostaje isti. On je promenio svoja verovanja.
Verovanja su kao odea. Nita bitno se ne preobraava; vi ostajete isti. Analizirajte
hindusa, ispitajte muslimana, unutra su oni isti. On odlazi u hram, musliman mrzi hram.
Musliman ide u damiju, a hindus mrzi damiju, ali iznutra oni su ista ljudska bia.
Vera je laka jer se od vas ne zahteva zapravo da inite nita - samo povrinsko
doterivanje, dekorisanje, neto to moete odloiti na stranu svakog momenta kada hoete.
Joga nije verovanje. Zbog toga je teka, naporna, ponekad izgleda nemogua. To je jedan
egzistencijalni pristup. Vi ete doi do istine, ali ne kroz veru, nego kroz svoje vlastito
iskustvo, kroz vae vlastito ostvarenje. To znai da ete morati potpuno da se promenite. Vaa
gledita, va nain ivota, va um, vaa psiha kakva jeste mora potpuno da se razbije. Neto
novo mora da se stvori. Samo s tim novim vi ete doi u kontakt s realnou.
Dakle, joga je oboje, i smrt i novi ivot. Ovakvi kakvi jeste vi ete morati umreti, a
dok ne umrete novo se ne moe roditi. Novo je skriveno u vama. Vi ste samo seme za to, a
seme mora pasti dole, apsorbovano od zemlje. Seme mora da umre; samo onda novo e se
pojaviti iz vas. Vaa smrt e vam doneti novi ivot. Joga je oboje: smrt i novo roenje. Dok
niste spremni da umrete, ne moete biti preporoeni. Dakle to nije pitanje promene verovanja.
Joga nije filozofija. Ja tvrdim da nije religija, kaem i da nije filozofija. To nije neto
o emu moete razmiljati. To je neto to morate biti; razmiljanje nee biti dovoljno.
Miljenje se odvija u vaoj glavi. Ono ne zadire duboko do korena vaeg bia; ono nije vaa
celokupnost. Ono je samo deo, funkcionalni deo; ono se moe uvebati. I vi moete da
rasuujete logino, moete misliti racionalno, ali vae srce e ostati isto. Vae srce je va
najdublji centar, va glava je samo grana. Moete biti bez glave, ali ne moete biti bez srca.
Vaa glava nije osnovna.
Joga se odnosi na vae celokupno bie, s vaim korenom. To nije filozofiranje. Dakle,
sa Patanjalijem neemo postati mislioci, spekulativci. Sa Patanjalijem pokuaemo da
saznamo najvie zakone bivanja; zakone transformacije bia, zakone kako umreti i kako se
ponovo roditi, zakone novog poretka postojanja. Zbog toga ja jogu nazivam naukom.
Patanjali je izuzetan. On je prosvetljena osoba, kao Buddha, kao Krina, kao Hrist,
kao Mahavira, Muhamed, Zaratustra, ali je razliit na jedan nain. Niko od Buddhe, Krine,
Mahavire, Zaratustre, Muhameda nema nauno gledite. Oni su veliki osnivai religija. Oni su
izmenili ceo obrazac ljudskog uma i njegovu strukturu, ali njihov pristup nije nauan.
Patanjali je kao Ajntajn u svetu Buddha. On je fenomen. On bi lako dobio Nobelovu
nagradu kao Ajntajn, ili Bor, Maks Plank ili Hajzenberg. On ima isto gledite, isti pristup
strogog naunog uma. On nije pesnik; Krina je pesnik. On nije moralista; Mahavira je
5

moralista. On je u osnovi naunik, koji razmilja u terminima zakona. On je doao da izvede


apsolutne zakone ljudskog postojanja, najviu radnu strukturu ljudskog uma i realnosti.
I ako sledite Patanjalija, saznaete da je on tako taan kao matematika formula.
Jednostavno inite ono ta on kae i rezultat e se postii. Rezultat se garantovano postie; to
je upravo kao dva plus dva, oni postaju etiri. To je ba kao kada zagrevate vodu do 100
stepeni celzijusovih i ona isparava. Vera nije potrebna; jednostavno inite to i znate. To je
neto to treba uraditi i znati. Zbog toga ja kaem ne postoji poreenje. Na ovoj planeti nikada
nije postojao ovek kao Patanjali.
Vi moete nai u Buddhinim govorima, poeziju - garantovano da je tamo. Mnogo puta
dok je Buddha izraavao sebe, on je postajao pesnik. Kraljevstvo ekstaze, podruje najvieg
saznavanja, takoe je lepo, iskuenje je tako veliko da se postane poetian, lepota je takva,
blagoslov je takav, blaenstvo je takvo da ovek zapoinje da misli poetskim jezikom.
Meutim, Patanjali se odupreo tome. On je sasvim razliit. Niko nije mogao da se
odupre. Isus, Krina, Buddha, svi su postali pesnici. Sjaj, lepota, kada to bukne u vama,
poeete da pleete, poeete da pevate. U tom stanju vi ste kao ljubavnik koji se zaljubio u
itav univerzum.
Patanjali se odupreo tome. On nje koristio poeziju; nikada nije upotrebio nijedan
pesniki simbol. Nije se bavio poezijom; nije govorio u terminima lepote. On je govorio samo
u matematikim terminima. On je bio egzaktan, i dao vam je maksime (mudre izreke). Ove
izreke su samo naznake ta treba da se uradi. On nije buknuo u ekstazi; nije rekao stvari koje
se ne mogu rei; nije istraivao nemogue. On je samo poloio temelj, a ako sledite temelj
dospeete do vrha koji je iznad. On je strog matematiar - zapamtite to.
Prva sutra:
A sada, disciplina joge
Atha joganushasanam
A sada disciplina joge. Svaku pojedinu re treba shvatiti jer Patanjali nije koristio
nijednu suvinu re.
A sada, disciplina joge.
Prvo pokuajte da razumete re sada. Ovo sada pokazuje stanje uma o kome vam
upravo govorim.
Ako ste se oslobodili iluzija, ako ste bez nade, ako ste potpuno postali svesni
nitavnosti svih elja, ako vidite svoj ivot kao besmislen - bilo ta da ste radili do sada
jednostavno je umrlo, nita nee ostati u budunosti, vi ste u apsolutnoj beznadenosti - to
Kjerkegor zove agonijom. Ako ste u agoniji, patnji, neznajui ta da inite, neznajui gde da
idete, neznajui u koga da gledate, upravo na ivici ludila, samoubistva ili smrti, ceo va
obrazac ivota iznenada je postao nitavan. Ako takav trenutak nastupi, Patanjali kae: "Sada
disciplina joge." Samo tada moete razumeti nauku o jogi, disciplinu joge.
Ako taj trenutak ne doe, moete nastaviti da izuavate jogu, moete postati veliki
uenjak, ali neete biti jogi. Moete napisati rasprave o jogi, moete drati predavanja o njoj,
ali neete biti jogi. Nije doao taj trenutak za vas. Intelektualno moete postati zainteresovani,
kroz va um moete biti povezani s jogom, ali joga nije nita ako nije disciplina. Joga nije
shastra; to nije spis. To je disciplina. To je neto to morate da uinite. To nije neobinost, to
nije filozosko mozganje. Ona je dublja od toga. To je pitanje ivota i smrti.
Ako je doao trenutak kada oseate da su svi pravci ometeni, svi putevi su iezli;
budunost je mrana, a svaka elja je postala gorka, i kroz svaku elju ste upoznali samo
razoarenje; svi pokreti u nade i snove su obustavljeni:
A sada, disciplina joge.
Ovo sada moda nije dolo. Onda ja mogu govoriti o jogi, ali vi neete sluati. Vi
moete sluati samo ako je taj trenutak prisutan u vama.
Jeste li zaista nezadovoljni? Svako e rei: "Da", ali to nezadovoljstvo nije stvarno. Vi
ste nezadovoljni sa ovim, moete biti nezadovoljni sa onim, ali niste totalno nezadovoljni. Vi
se jo nadate. Nezadovoljni ste zbog svojih prolih nadanja, ali za budunost se jo nadate.
6

Vae nezadovoljstvo nije potpuno. Jo uvek prieljkujete neko zadovoljstvo negde, neku
nagradu negde.
Ponekad se oseate beznadeno, ali ta beznadenost nije istinita. Oseate
beznadenost jer odreena nada nije ostvarena, odreena nada je propala. Ali nadanje je jo
uvek prisutno; nadanje nije propalo. Vi ete se jo nadati. Nezadovoljni ste s ovom nadom,
onom nadom, ali niste nezadovoljni sa nadom kao takvom. Ako ste s nadom kao takvom
razoarani, doao je trenutak kada moete ui u jogu. Onda ovaj ulazak nee biti samo
mentalna, spekulativna pojava. Ovaj ulazak e biti ulazak u disciplinu.
ta je disciplina? Disciplina oznaava kreiranje reda u vama. Kakvi jeste, vi ste haos.
Kakvi jeste, vi ste neuredni. Gurijev je imao obiaj da kae - a Gurijev je na mnogo naina
slian Patanjaliju: on je opet pokuao da naini sr religije naukom - Gurijev kae da vi
niste jedan, vi ste gomila, ak i kada kaete: "Ja", ne postoji neko ja. U vama ima mnogo
ja, ali nikada ne postajete svesni ovog nereda jer ko e postati svestan toga? Ne postoji
centar koji moe postati svestan.
"Joga je disciplina" znai joga eli da stvori kristalisani centar u vama. Takvi kakvi
jeste, vi ste gomila, a gomila ima mnogo pojava. Jedna je da ne moete verovati gomili.
Gurijev bi obino rekao da ovek ne moe obeati. Ko e obeati? Vi niste prisutni. Ako
obeate, ko e ispuniti obeanje? Sledeeg jutra onog koji je obeao vie nema.
Ljudi dou kod mene i kau: "Sada u poloiti zavet. Obeavam da u uiniti ovo." Ja
im kaem: "Razmislite dva puta pre nego to obeate neto. Jeste li sigurni da e sledeeg
jutra biti tu onaj ko je obeao?" Vi odluite da ustajete rano ujutru od sutra - u etiri sata. A u
etiri sata neko u vama kae: "Ne sekiraj se. Tako je hladno napolju. Zato se toliko uri? Mi
to moemo uraditi ujutru." I ponovo zaspite.
Kada ustanete vi se kajete. Mislite, "Ovo nije dobro, trebao sam to da uradim."
Odluujete ponovo "Sutra u to uraditi", a isto e se desiti i sutra jer u etiri ujutru onaj koji je
obeao nije vie tu, neko drugi je u krevetu. Vi ste Rotary Club: predsedavajui se stalno
menja. Svaki lan postaje rotirajui predsedavajui. Postoji kruenje. Svakog momenta neko
drugi je glavni.
Gurijev je obino govorio: "Ovo je glavna karakteristika oveka, da on ne moe
obeati." Vi ne moete ispuniti obeanje. Nastavljate da dajete obeanja, a dobro znate da ih
ne moete ispuniti, jer vi niste jedan: vi ste nered, haos. Otuda, Patanjali kae: "A sada
disciplina joge." Ako je va ivot postao apsolutna patnja, ako ste shvatili da ta god uinite
stvara pakao, onda je trenutak doao. Ovaj trenutak moe promeniti vau dimenziju, pravac
vaeg postojanja.
Do sada ste iveli kao haos, gomila. Joga znai, sada ete morati biti harmonija,
moraete da postanete jedan. Nuna je kristalizacija; potrebno je usreditavanje. Dok ne
dostignete centar, sve to inite jeste beskorisno. To je traenje ivota i vremena. Centriranje
je prvo potrebno, a jedino moe biti blaen onaj ko je zadobio sredite. Svako trai to, ali vi
ne moete zahtevati. Vi treba to da zasluite! Svako ezne za blaenim stanjem postojanja, ali
samo centar moe biti blaen. Mnotvo ne moe biti blaeno, gomila nema Sopstvo, nema
atmana koji e biti blaen.
Blaenstvo podrazumeva apsolutnu tiinu, a tiina je mogua samo kada postoji
harmonija - kada su svi neskladni fragmenti postali jedno, kada ne postoji mnotvo, ve
jedno. Kada ste vi sami u kui i niko drugi nije tu, biete blaeni. Upravo sada svako drugi je
u vaoj kui, samo vi niste tamo. Samo gosti su tamo, domain je uvek odsutan. A samo
domain moe biti blaen.
Usreditavanje Patanjali naziva disciplinom - anushasanam. Re disciplina je lepa.
Ona dolazi iz istog korena odakle i re disciple dolazi. Disciplina znai sposobnost da se
ui, kapacitet da se zna. Inae vi ne moete znati, vi ne moete uiti, dok niste dostigli
sposobnost da budete ili postojite.
Jednom je jedan ovek doao kod Buddhe i rekao Mora da je bio drutveni
reformator, revolucionar. Rekao je Budi: "Svet je u patnji. Slaem se s vama". Buddha nikada
nije rekao da je svet u patnji. Buddha kae: "Vi ste patnja", ne svet. "ivot je patnja", ne svet.
"ovek je patnja", ne svet. "Um je patnja", ne svet. Ali taj revolucionar je rekao: "Svet je u
7

patnji. Ja se slaem s vama. Kaite mi sada ta mogu uiniti? Imam duboko saoseanje, i
elim da sluim oveanstvu."
Sluenje mora da je njegov moto. Buddha ga je pogledao i ostao nem. Buddhin
uenik Ananda je rekao: "Taj ovek izgleda da je iskren. Uputite ga. Zato utite?" Onda je
Buddha rekao buntovniku: "Vi elite da sluite svetu, ali gde ste vi? Ja ne vidim nikoga
unutra. Gledam u vas, tamo nema nikoga."
"Vi nemate nikakvo sredite, a dok ne budete usrediteni ta god da inite stvarae
vie smutnje." Svi vai drutveni reformatori, vai revolucionari, vai lideri, oni su veliki
stvaraoci smutnje, trgovci smutnjom. Svet bi bio bolji da nije bilo lidera. Inae oni ne mogu
pomoi. Oni moraju uiniti neto zato to je svet u patnji. A oni nisu usrediteni, tako da ta
god uine stvaraju vie patnje. Samo saoseanje nee pomoi, samo sluenje nee pomoi.
Saoseanje kroz usrediteno postojanje je neto sasvim razliito. Saoseanje kroz mnotvo je
propast. Takva samilost je otrov.
A sada, disciplina Joge.
Disciplina oznaava sposobnost da se postoji, sposobnost da se zna, kapacitet da se
ui. Moramo nauiti ove tri stvari.
Sposobnost da se bude. Svi joga poloaji ne bave se stvarno s telom, bave se
sposobnou da se postoji. Patanjali kae da ako moete sedeti tiho bez kretanja vaeg tela
za nekoliko sati, raste vaa sposobnosti da postojite. Zato se kreete? Ne moete sedeti bez
kretanja ak ni za nekoliko sekundi. Vae telo zapoinje da se kree. Negde oseate svrab,
noge postaju umrtvljene; mnoge stvari zapoinju da se dogaaju. Ovo su samo izgovori za vas
da se pokreete.
Vi niste gospodar. Ne moete rei telu: "Sada za jedan sat se neu pokretati." Telo e
se odmah pobuniti. Odmah e vas prisiliti da se pokrenete, da uradite neto, a ono e dati
razloge: "Morate se pokrenuti jer vas komarac ujeda." Moda neete nai komarca kada
pogledate. Vi niste bie, vi ste strepnja - neprekidna grozniava aktivnost. Patanjalijeve
asane, poloaji, se ne bave ni sa kojom vrstom fiziolokog treninga, ve unutranjim
treningom bia, samo da se bude - bez injenja iega, bez ikakvih pokreta, bez ikakve
aktivnosti, samo da se postoji. Samo to ostajanje u postojanju pomoi e u usreditenju.
Ako moete ostati u jednom poloaju, telo e postati rob; sledie vas. A to vas vie
telo sledi, imaete vee postojanje unutar sebe, jae postojanje unutar vas. I zapamtite, ako se
telo ne pokree, va um ne moe da se kree, jer um i telo nisu dve stvari. Oni su dva pola iste
pojave. Vi niste telo i um, vi ste telo-um. Vaa linost je psiho-somatska - psiho-fizika. Um
je najsuptilniji deo tela. Ili moete rei obrnuto, da je telo najgrublji deo uma.
Tako ta god da se desi u telu deava se i u umu. I obrnuto: to god se desi u umu
deava se i telu. Ako se telo ne pokree i vi moete ostati u jednom poloaju, ako moete rei
telu: "Budi mirno", um e ostati miran. Zaista, um zapoinje kretanje i pokuava da pokrene
telo, jer ako se telo kree onda i um moe da se kree. U nepokretnom telu, um se ne moe
pokretati; njemu je potrebno pokretno telo.
Ako se telo ne kree, um se ne kree, vi ste usrediteni. Ovaj nepokretan poloaj nije
samo fizioloko treniranje. On samo stvara situaciju u kojoj usreditenje moe da se dogodi, u
kojoj moete postati disciplinovani. Kada vi jeste, kada ste postali usrediteni, kada saznate
ta znai postojati, onda moete uiti, jer ete biti ponizni, skromni. Onda se moete predati.
Onda nikakav lani ego nee prianjati uz vas jer kada ste jednom usrediteni vi znate da su svi
egoi lani. Onda se moete pokloniti. Onda se raa disciplina.
Disciplina je veliko postignue. Samo kroz disciplinu moete postati uenik. Samo
bivajui usrediteni vi moete postati ponizni, prijemivi, postati prazni, i guru, uitelj, moe
sebe izliti u vas. U vaoj praznini, ako ste tihi, on moe doi i dopreti do vas. Komunikacija
postaje mogua.
Uenik je onaj ko je usrediten, ponizan, prijemiv, otvoren, spreman, budan, usluan,
poboan. U jogi, uitelj je vrlo, vrlo vaan, apsolutno vaan, jer samo kada ste u neposrednoj
blizini bia koje je usrediteno vae vlastito usreditenje e se desiti.
To je znaenje satsanga. Jeste li uli re satsang? Ona je sasvim pogreno koriena.
Satsang oznaava neposrednu blizinu istine; ona znai blizu istine, znai blizu uitelja koji je
8

postao jedno s istinom - samo biti blizu njega, otvoren, prijemiv i ekati. Ako je to u vama
postalo duboko i jako, duboka prisnost e se dogoditi.
Uitelj nee initi nita. On je jednostavno tu, na raspolaganju. Ako ste vi otvoreni, on
e strujati unutar vas. Ovo strujanje se naziva satsang. S uiteljem vi ne treba da uite nita
drugo. Ako moete nauiti satsang, to je dovoljno - ako samo moete biti pokraj njega bez
pitanja, bez razmiljanja, bez raspravljanja; samo prisutni tu, na raspolaganju, tako da bie
uitelja moe da se izlije u vas. A bie moe da tee. Ono ve tee. Kad god osoba postigne
integritet, njeno bie postaje zraee.
Ono nadolazi. Bilo da ste vi prisutni da primate ili ne, to nije vano. Ono tee kao
reka. Ako ste vi prazni kao posuda, spremni, otvoreni, ono e se uliti u vas.
Uenik oznaava nekoga ko je spreman da prima, ko je postao materica - uitelj moe
da prodre u njega. Ovo je znaenje rei satsang. To u osnovi nije propoved, predavanje;
satsang nije rasprava. Rasprava moe biti prisutna, ali raspravljanje je samo jedan izgovor. Vi
ste ovde, a ja u govoriti o Patanjalijevim sutrama. To je samo jedan izgovor. Ako ste vi
zbilja ovde, onda rasprava, razgovor, postaje samo jedan izgovor za vas da budete ovde. To je
samo jedan izgovor. A ako ste vi zaista ovde, satsang poinje. Ja mogu tei a to strujanje je
snanije od bilo kog govora, svake komunikacije kroz jezik, od svakog intelektualnog susreta
s vama.
Dok je va um angaovan, ako ste uenik, ako ste disciplinovano bie, va um je
uposlen u sluanju mene, vae bie moe biti u satsangu. Onda je vaa glava zauzeta, vae
srce je otvoreno. Onda na dubljem nivou, susret se deava. Taj susret je satsang, a sve drugo
je samo jedno opravdanje, samo da se nau putevi da se bude blizu uitelja.
Bliskost je sve, ali samo uenik moe biti blizak. Bilo ko i svako ne moe biti blizak.
Bliskost znai odano poverenje. Zato nismo bliski? Jer ima straha. Prevelika blizina moe
biti opasna, prevelika otvorenost moe biti opasna, jer vi postajete ranjivi, a onda e biti teko
odbraniti se. Stoga samo radi sigurnosne mere mi drimo svakog na ostojanju, nikada ne
dozvoljavamo da pree dozvoljeno rastojanje.
Svako ima teritoriju oko sebe. Kad god neko ue u vau teritoriju vi postanete
uplaeni. Svako ima prostor za zatitu. Vi sedite sami u svojoj sobi. Stranac ue u sobu. Samo
posmatrajte kako postajete zaista uplaeni. Postoji jedna taka, a ako on pree tu taku, iza te
take vi ete biti preplaeni. Osetie se iznenadno drhtanje. Izvan odreene teritorije on se
moe kretati.
Biti blizak znai da sada nema vae vlastite teritorije. Biti blizak znai biti ranjiv, biti
blizak znai da ta god da se dogodi vi ne razmiljate u terminima sigurnosti.
Uenik moe biti blizak iz dva razloga. Jedan je da je on usrediten, on pokuava da
bude usredsreen. Osoba koja pokuava da bude usreditena postaje neuplaena, ona postaje
neustraiva. Ona ima neto to se ne moe ubiti. Vi nemate nita, otuda strah. Vi ste gomila,
mnotvo. Mnotvo moe biti rasuto svakog momenta. Vi nemate neto kao stena to e biti tu
ta god da se dogodi. Bez stene, bez temelja vi postojite kao kua od karata, obavezna da bude
uvek u strahu. Bilo kakav vetar, ak svaki povetarac, moe da je uniti, tako da morate da
zatitite sebe.
Zbog ove konstantne bezbednosti, vi ne moete voleti, ne moete verovati, vi ne
moete biti prijatelj. Moete imati mnogo prijatelja ali tu ne postoji prijateljstvo, jer
prijateljstvu je potrebna bliskost. Moete imati ene i mueve i takozvane ljubavnike, ali tu
nema ljubavi, jer ljubav trai bliskost, ljubavi treba poverenje. Moete imati gurue, uitelje,
ali nema uenitva, jer vi ne moete dozvoliti sebi da budete totalno odani neijem biu, u
blizini njegovog bia, bliski njegovom biu, tako da on ne moe da vas nadvlada, da vas
preplavi.
Uenik oznaava tragaoca koji nije mnotvo, koji pokuava da bude usrediten i
kristalizovan, barem pokuavajui, inei napor, iskreni napor da postane individua, da osea
svoje bie, da postane svoj vlastiti gospodar. Sva disciplina joge je jedan napor da vas naini
gospodarem vas samih. Takvi kakvi jeste vi ste samo rob mnogih, mnogih bolesti. Mnogi,
mnogi gospodari postoje, a vi ste samo rob - i razvueni ste u mnogim pravcima.
A sada, disciplina joge.
9

Joga je disciplina. To je jedan napor s vae strane da promenite sebe. Mnoge druge
stvari moraju se razumeti. Joga nije terapija. Na zapadu mnogi psiholoke terapije su
rasprostranjene danas, i mnogi zapadni psiholozi misle da je joga takoe terapija. Ona to nije!
Ona je disciplina. A kakva je razlika? Ovo je razlika: terapija je potrebna ako ste bolesni,
terapija je potrebna ako ste oboleli, terapija je potrebna ako ste u patolokom stanju.
Disciplina je potrebna ak i kada ste zdravi. Zaista, kada ste zdravi samo disciplina moe
pomoi onda.
To nije za patoloke sluajeve. Joga je za one koji su potpuno zdravi, ukoliko je
medicinska nauka u pitanju, normalni. Oni nisu izofrenini; oni nisu ludi, oni nisu neurotini.
Oni su normalni ljudi, zdravi ljudi bez odreene patologije. Pri svemu tome oni su svesni da
ta god da se naziva normalnou jeste beskorisno, ma ta da se naziva zdravljem nije od
koristi. Neto vie je potrebno, neto vee je potrebno, neto svetije i celovitije je potrebno.
Terapije su za bolesne ljude. Terapije vam mogu pomoi da doete do joge, ali joga
nije za terapiju. Joga je za vii red zdravlja, razliit od sree - razliitog tipa bitisanja i
celovitosti. Terapija moe, uglavnom, da vas uini prilagoenim. Frojd kae da mi ne
moemo uiniti vie. Mi vas moemo uiniti prilagoenim, normalnim lanom drutva - ali
ako je drutvo samo patoloko, ta onda? A to i jeste! Samo drutvo je bolesno. Terapija vas
moe uiniti normalnim u smislu da ste prilagoeni drutvu, ali samo drutvo je bolesno!
Tako ponekad se deava da se u jednom bolesnom drutvu za zdravu osobu misli da je
bolesna. Mislilo se da je Isus bolestan, i svi napori su uloeni da se on dovede u red. A kada
se nalo da je on beznadean sluaj, onda je razapet na krst. Kada se nalo da se nita ne moe
uiniti, da je taj ovek neizleiv, onda je raspet. Drutvo je samo bolesno jer nije nita drugo
nego vaa zajednica. Ako su svi lanovi bolesni, drutvo je bolesno, a svaki lan mora biti
podeen prema njemu.
Joga nije terapija; joga nije ni na koji nain pokuaj da vas uini prilagoenim
drutvu. Ako elite da definiete jogu u terminima prilagoavanja, onda to nije podeavanje sa
drutvom, ve je to izmirenje sa samom egzistencijom. To je usklaivanje sa boanskim!
Dakle, moe se dogoditi da vama savreni jogi izgleda lud. Moe izgledati da je van
svoje ulnosti, izvan svog uma, jer je on sada u dodiru sa monijim, s viim umom, viim
redom stvari. On je u dodiru sa univerzalnim umom. Uvek se deavalo tako: Buda, Isus,
Krina, oni su uvek izgledali nekako ekscentrini. Oni ne pripadaju nama; izgledaju kao
strana lica.
Zbog toga mi njih nazivamo avatarima, stranim licima. Oni kao da su doli s druge
planete; oni ne pripadaju nama. Oni mogu biti vii, mogu biti ispravni, mogu biti boanski, ali
oni ne pripadaju nama. Oni su doli odnekuda drugde. Oni nisu deo i paket naeg postojanja,
oveanstva. Ostalo je oseanje da su oni strana lica; a oni to nisu. Oni su stvarni insajderi jer
su dotakli najskriveniju sr egzistencije. Ali nama oni tako izgledaju.
A sada, disciplina joge.
Ako je va um shvatio da ta god ste radili do sada je bilo potpuno besmisleno, da je
bilo nona mora u najgorem, a lep san u najboljem sluaju, onda se staza discipline otvorila
pred vama. Kakva je ta staza?
Osnovna definicija je,
Joga je obustava aktivnosti uma Chitta vritti nirodha.
Rekao sam vam da je Patanjali samo matematiar. U jednoj jedinoj reenici, a sada
disciplina joge, on je zavrio sa vama. Ovo je jedina reenica koja je koriena za vas. Sad on
uzima zdravo za gotovo da ste vi zainteresovani za jogu, ne kao nadu, ve kao disciplinu, kao
preobraaj upravo ovde i sada. On nastavlja da objanjava:
Joga je obustava aktivnosti uma.
Ovo je definicija joge, najbolja. Na mnogo naina je opisana joga, ima mnogo
definicija. Neki kau joga je susret uma sa boanskim; otuda, ona je nazvana joga - joga znai
spoj, spajanje zajedno. Neki kau da joga znai odbacivanje ega; ego je prepreka; onog
momenta kada napustite ego vi ste spojeni sa boanskim. Vi ste ve povezani, samo zbog
10

vaeg ega vama izgleda da ste bili rastavljeni. Ima ih mnogo, ali Patanjalijeva je najnaunija.
On kae:
Joga je obustava aktivnosti uma.
Joga je stanje u kome nema uma. Re 'um' pokriva sve - va ego, vae elje, vae
nade, vae filozofije, vae religije, vae spise. 'Um' pokriva sve. ta god vi moete zamisliti
jeste um. Sve to je znano, sve to moe da se zna, sve to je saznajno, jeste unutar uma.
Prestajanje uma oznaava obustavu znanog, prekid saznajnog. To je skok u nepoznato. Kada
nema uma, vi ste u nepoznatom. Joga je skok u nepoznato. Nee biti ispravno rei
nepoznato, pravilnije je, nesaznajno.
ta je um? ta um radi ovde? ta je to? Obino mi mislimo da je um neto
supstancijalno tamo u glavi. Patanjali se ne slae - i niko ko je ikada saznao unutranjost
uma se nee sloiti. Savremeni naunici se takoe ne slau sa tim. Um nije neto
supstancijalno unutar glave. Um je upravo delovanje, samo aktivnost.
Vi hodate i kaete da etate. ta je hodanje? Ako stanete, gde je hodanje? Ako
sednete, gde je hodanje otilo? Hodanje nije nita supstancijalno; to je jedna aktivnost. Tako
dok vi sedite, niko ne moe da pita, "Gde ste metnuli svoje hodanje? Upravo sada ste bili
hodali, dakle gde je hodanje otilo?" Vi ete se smejati. Rei ete: "Hodanje nije neto
supstancijalno, to je samo aktivnost. Ja mogu etati. Mogu opet hodati i mogu se zaustaviti.
To je aktivnost."
Um je takoe aktivnost, ali usred rei um, izgleda kao da je neto supstancijalno tu.
Bolje je nazvati to "umovanje" - upravo kao hodanje. Um znai "umovanje", um znai
razmiljanje. To je jedna aktivnost.
Citiram ponovo Bodhidharmu.
On je otiao u Kinu, i kineski car je doao da ga vidi. Car je rekao: "Moj um je vrlo
uznemiren, smeten. Vi ste veliki mudrac, i ja sam vas oekivao. Kaite mi ta treba da inim
da bih smirio svoj um."
Bodhidharma je rekao: "Ne inite nita. Prvo donesite svoj um meni." Car ga nije
mogao shvatiti pa je rekao: "ta mislite pod tim?" On je rekao: "Doite ujutru u etiri sata
kada niko nije ovde. Doite sami, i setite se da ponesete svoj um sa vama."
Car nije mogao da spava cele noi. Mnogo puta je odbacivao celu zamisao: "Ovaj
ovek izgleda da je lud. ta je on mislio kada je rekao, "Doi sa svojim umom, ne zaboravi
ga?" ovek je bio tako zanosan, tako harizmatian da nije mogao da otkae sastanak.
Privlaio ga je kao magnet, u etiri sata je iskoio iz kreveta i rekao: "ta god da se dogodi,
moram ii. Ovaj ovek moda ima neto, njegove oi govore da ima neto. Izgleda pomalo
luckasto, ali ipak moram otii da vidim ta e se dogoditi."
Tako je stigao kod njega, a Bodhidharma je sedeo sa svojim velikim tapom. Rekao je:
"Dakle doli ste? Gde je va um? Jeste li ga doneli ili ne?"
Car je rekao: "Vi govorite besmislicu. Kada sam ja ovde moj um je ovde, i to nije
neto to ja mogu zaboraviti negde. To je u meni". Stoga je Bodhidharma rekao: "U redu.
Dakle prva stvar je jasna - da je um u vama." Car je rekao: "U redu, um je u meni."
Bodhidharma je rekao: "Sada zatvorite svoje oi i naite gde je on. Ako ga moete nai gde
je, odmah ga pokaite meni. Ja u ga umiriti."
Tako je car zatvorio svoje oi, pokuavao i pokuavao, traio i traio. to je vie
traio, vie je postao svestan da nema uma, um je samo jedna aktivnost. To nije neto tamo
to vi moete pokazati. Onog momenta kada je on shvatio da to nije neto, onda je apsurdnost
njegovog traganja njemu bila jasna. Ako to nije neto, nita se oko toga ne moe uraditi. Ako
je to samo jedna aktivnost, onda ne vrite tu aktivnost; to je sve. Ako je to kao hodanje;
nemojte hodati.
On je otvorio svoje oi. Poklonio se Bodhidharmi i rekao: "Ne postoji um koji bi se
naao." Bodhidharma je rekao: "Onda sam ga ja umirio. I kad god osetite da ste uznemireni,
samo pogledajte unutra, gde je ta neprijatnost." Samo gledanje je ne-um, jer gledanje nije
miljenje. I ako gledate duboko cela vaa energija postaje gledanje, a ista energija postaje
kretanje i miljenje.
Joga je obustava aktivnosti uma.
11

Ovo je Patanjalijeva definicija. Kada ne postoji um, vi ste u jogi; kada je um tu, vi
niste u jogi. Dakle, vi moete raditi sve poloaje, ali ako um nastavi da deluje, ako vi nastavite
sa miljenjem, vi niste u jogi. Joga je stanje nemanja uma. Ako moete biti bez uma bez
izvoenja ikakvih poloaja, vi ste postali savreni jogi. To se dogodilo mnogima bez
izvoenja ikakvih poloaja, asana, a to se nije dogodilo mnogima koji su radili poloaje
(asane) tokom mnogo ivota.
Budui da osnovna stvar koju treba razumeti jeste da, kada aktivnost miljenja nije
prisutna, vi ste tu; kada aktivnost uma nije prisutna, kada misli ieznu, kada su samo kao
oblaci, kada i oni ieznu, vae postojanje, upravo kao nebo, je otkriveno. Ono je uvek tu samo prekriveno oblacima, pokriveno mislima.
Joga je obustava aktivnosti uma.
Na Zapadu sada, postoji veliko zanimanje za Zen - japansku metodu joge. Re zen
dolazi od rei dhyana. Bodhidharma je uveo ovu re u Kinu. U Kini re dhyana postaje
jhan, onda chan, a onda je re prela u Japan i postala zen.
Koren je dhyana. Dhyana znai nemanje uma, tako ceo trening zena u Japanu nije
nita do kako zaustaviti umovanje, kako da ne bude uma, kako da se bude jednostavno bez
miljenja. Pokuajte to! Kada ja kaem pokuajte to, to e izgledati kontradiktorno, jer ne
postoji drugi nain da se to kae. Jer ako vi pokuate, sam pokuaj, napor dolazi od uma.
Moete sedeti u poloaju i pokuati neko apa pevanje, mantru - ili moete samo pokuati da
sedite smireno, da ne mislite. Ali onda ne misliti postaje miljenje. Onda vi nastavljate da
govorite: "Ja ne mislim; nemoj razmiljati; prestani razmiljati." Ali to je sve razmiljanje.
Pokuajte da razumete. Kada Patanjali kae, nemanje uma, obustava uma, on
podrazumeva potpunu obustavu. On vam nee dozvoliti da vrite apu, "Ram-Ram-Ram." On
e rei da to nije obustava; vi koristite um. On e rei: "Jednostavno prestanite!" ali vi ete
pitati: "Kako? Kako jednostavno prekinuti?" Um nastavlja. ak i ako sedite, um nastavlja.
ak i ako ne radite, to nastavlja da se radi.
Patanjali kae samo posmatrajte. Pustite da um ide, pustite da um ini ta god da on
ini. Vi samo posmatrajte. Ne meajte se. Vi samo budite svedok, samo budite jedan
nezainteresovani posmatra, kao da um ne pripada vama, kao da to nije va posao, nije vaa
stvar. Ne budite zainteresovani! Samo posmatrajte i pustite um da tee. To je kretanje usled
prolog impulsa,7 jer ste uvek pomagali to da tee. Aktivnost je preuzela svoj vlastiti impuls,
tako ona tee. Vi samo nemojte saraivati. Posmatrajte i pustite um da se kree.
Tokom mnogo, mnogo ivota, moda milion ivota, vi ste saraivali sa umom, vi ste
ga pomagali, vi ste mu davali svoju energiju. Reka e tei za neko vreme. Ako ne saraujete,
ako samo posmatrate nezainteresovano - Budina re je ravnodunost, upekha: gledajui bez
ikakvog zanimanja, samo posmatrajui, ne inei nita ni na koji nain - um e tei za kratko i
zaustavie se sam od sebe. Kada je impuls izgubljen, kada je energija istekla, um e se
zaustaviti. Kada se um zaustavi, vi ste u jogi; vi ste postigli disciplinu. To je definicija: Joga
je obustava aktivnosti uma. 8
7

Podsvesnih utisaka (vasana) i na njima zasnovanih predispozicija (samskara).


Joga je disciplina meditacije s kojom nadilazimo iluziju o sebi kao posebnom biu. Sutina meditacije je u
smirenju aktivnosti uma koji odrava sve iluzije. Um ne moe sam sebe da smiri, jer on nije razliit od nas, on je
naa aktivnost, kao hodanje. Jedini nain da smirimo um je da prestanemo da ulaemo energiju u umnu
aktivnost, da se odvratimo od toga. Da bismo se odvratili od stalnog ulaganja energije u umnu aktivnost moramo
najpre da prestanemo da verujemo da to moramo da radimo, da nam je zamiljanje i razmiljanje potrebno, da
prestanemo da verujemo u svoje snove. Da se bar za trenutak uverimo u to. Ovakvi kakvi smo prirodno dati,
nemamo iskustvo takve odvraenosti jer smo s umnom aktivnou i svojim snovima, dnevnim i nonim,
identifikovani od najranijeg detinjstva. Potrebno nam je kratko direktno iskustvo potpune odvraenosti od umne
aktivnosti kako bismo se uverili u njega i prepoznali. To kratko iskustvo ne-uma je disciplina meditativnog
smirenja. Smirujui sebe smirujemo um, iskljuujemo mu utika, dovod energije. To je jedini nain. Tada se on
sam smiruje, jer mi smo ga i pokretali. U tom kratkotrajnom iskustvu uviamo da nismo um, da moemo da
postojimo kao isto bie koje nadilazi sve umne predstave, da smo neto mnogo vie od malog uma i njegovih
iluzija da smo izdvojeno, malo bie sa neurotinim sadrajima koje je dotle nosilo. To je iskustvo nae
autentinosti, naeg jedinstva sa apsolutnim biem koje sve omoguava. Takvo iskustvo nas jaa da tu svesnost u
meditaciji proirimo na stalnu prisutnost danju i nou, u svim aktivnostima, a ne samo za vreme meditativnog
zadubljenja. Ostali tekst Joga sutri opisuje detalje prakse proirivanja takve svesti sve do trajne nezavisnosti i
12
8

Onda je svedok utvren u sebi.


Kada se um obustavi, svedok je utvren u sebi.
Kada moete jednostavno posmatrati unutra ne bivajui identifikovani sa umom, bez
rasuivanja, bez ocenjivanja, bez osuivanja, bez odabiranja - vi jednostavno posmatrate i um
tee, vreme dolazi kada se sam od sebe, iz sebe, um zaustavlja.
Kada nema uma, vi ste utvreni u vaem svedoenju. Onda ste postali svedok - samo
videlac - dratra, sakin. Onda niste inilac, onda niste mislilac. Onda ste jednostavno isto
bie, najistije od bia. Onda je svedok utvren u sebi samom.
U svim drugim stanjima postoji identifikacija sa modifikacijama uma.
Izuzev svedoenja, u svim stanjima, vi ste identifikovani s umom. Vi postajete jedno
sa tokom misli, postajete jedno sa oblacima; ponekad sa belim oblakom, ponekad sa tamnim
oblakom, ponekad sa kiom ispunjenim oblakom, ponekad sa praznim oblakom, ma kako
bilo, vi postajete jedno s miljenjem, vi postajete jedno s oblakom, i ne primeujete vau
istotu neba, istotu prostora. Vi postajete naoblaeni, a to naoblaenje se deava jer vi
postajete identifikovani, postajete jedno s tim.
Misao doe. Vi ste gladni, i misao projuri u umu. Misao je samo to, da postoji glad, da
stomak osea glad. Odmah postajete identifikovani; kaete: "Ja sam gladan." Um je bio
potpuno ispunjen milju da je glad prisutna; vi postajete identifikovani i kaete: "Ja sam
gladan." Ovo je identifikacija.
Buda takoe osea glad, Patanjali takoe osea glad, ali on nikada nee rei: "Ja sam
gladan." On e rei: "Telo je gladno"; on e rei: "Moj stomak osea glad"; on e rei;
"Postoji glad. Ja sam svedok. Ja sam doao da svedoim ovoj misli, koja je iznenadno iz
stomaka sevnula u mozgu, da sam gladan." Stomak je gladan; Patanjali e ostati svedok. Vi
postajete identifikovani, vi postajete jedno s miljenjem.
Onda je svedok utvren u sebi samom.
U svim drugim stanjima, postoji identifikacija sa modifikacijama uma.
Ovo je definicija:
Joga je obustava aktivnosti uma.
Kada um prestane, vi ste utvreni u vaem svedoeem Sopstvu. U svim drugim
stanjima, izuzev ovog, vi ste identifikovani. A sve identifikacije obrazuju samsaru; one su
svet. Ako ste identifikovani, vi ste u svetu, u patnji. Ako ste transcendirali identifikacije, vi ste
osloboeni. Vi ste postali siddha, vi ste u nirvani. Vi ste transcendirali ovaj svet patnje i uli
ste u svet blaenstva.
A taj svet je ovde i sada - upravo sada, ba ovog trenutka! Nije potrebno ekati ga ak
nijedan trenutak. Samo postanite svedok uma, i biete uneti u taj svet. Postanite identifikovani
sa umom, i vi ete ga izgubiti. Ovo je osnovna definicija.
Zapamtite sve, jer docnije, u drugim sutrama, ui emo u detalje ta treba da se uradi,
kako treba da se uradi - ali uvek imajte na umu da je ovo temelj.
ovek treba da postigne stanje bez uma: to je cilj.

Poglavlje 2
JOGA, STAZA BEZ ELJA
26. decembar 1973, posle podne.
Prvo pitanje:
Rekli ste prole noi da su potpuno oajanje, frustracija i beznadenost poetne
osnove za jogu. Ovo daje jogi pesimistiki izgled. Da li je to pesimistiko stanje zaista
potrebno da zapone staza joge? Da li optimista takoe moe poi stazom joge?
autentinosti koja se naziva Kaivalya.
13

Nije ni jedno ni drugo. To nije pesimistino, to nije optimistino, jer pesimizam i


optimizam su dva aspekta istog novia. Pesimista oznaava oveka koji je bio optimista u
prolosti; a optimista oznaava onoga ko e biti pesimista u budunosti. Svaki optimizam vodi
do pesimizma, jer svaka nada vodi do beznadenosti.
Ako se jo nadate, onda joga nije za vas. Postoji elja, ima nade; samsara je tu, svet je
tu. Vaa elja je svet, vaa nada je ropstvo, jer nada vam nee dozvoliti da ivite u sadanjosti.
Nastavljae da vas prisiljava ka budunosti; nee vam dozvoliti da budete usrediteni. Ona e
potezati i potiskivati, ali vam nee dozvoliti da ostanete mirni u sadanjem trenutku, u tiini.
To vam nee dozvoliti.
Tako kada kaem totalna beznadenost, ja mislim da je nada oslabila, a i beznadenost
je takoe postala uzaludna. Onda je to totalna beznadenost. Totalna beznadenost znai da ni
sama beznadenost nije prisutna, jer kada oseate beznadenost, suptilna nada je prisutna.
Inae, zato biste oseali beznadenost? Nada postoji, vi jo prianjate uz nju; otuda
beznadenost.
Totalna beznadenost znai da sada nema nade. A kada ne postoji nada ne moe biti
beznadenosti. Vi ste jednostavno odbacili celu pojavu. Obe strane su odbaene, ceo novi je
baen. U ovom stanju uma vi moete ui na stazu joge; nikada pre. Pre toga nije mogue.
Nada je protiv joge.
Joga nije pesimistika. Vi moete biti optimista ili pesimista; joga nije ni jedno ni
drugo. Ako ste pesimista, ne moete ui na stazu joge jer pesimista se vezuje uz svoje nevolje.
On nee dozvoliti svojim nevoljama da ieznu. Optimista se lepi uz svoje nade, a pesimista
se lepi za svoju patnju, za svoju beznadenost. Ta beznadenost mu je postala pratilac. Joga je
za nekoga ko nije ni jedno ni drugo, ko je postao tako potpuno beznadean da je ak
nekorisno da osea beznadenost.
Suprotno moe da se oseti samo ako nastavite da prianjate negde duboko dole uz
pozitivno. Ako prianjate uz nadu moete se oseati beznadeno. Ako prionete uz oekivanje
vi moete oseati frustraciju. Ako jednostavno shvatite da nema mogunosti da oekujete
nita, onda gde je frustracija? Onda je priroda egzistencije da nema mogunosti bilo ta de se
oekuje, ne postoji mogunost za nadu. Kada ovo postane sigurna injenica, kako moete
oseati beznadenost? Onda oboje ieznu.
Patanjali kae, a sada, disciplina joge. To 'sada' e se dogoditi kada niste nijedno.
Pesimistika gledita ili optimistika gledita, oba su bolesna, ali postoje uitelji koji stalno
govore u terminima optimizma - naroito ameriki hrianski misionari. Oni stalno govore u
terminima nade, optimizma, budunosti, raja. U oima Patanjalija to su samo prie za malu
decu, jer vam jednostavno daju novu bolest. Zamenjujete novu bolest za staru. Vi ste nesreni
i traite na neki nain sreu. Stoga ko god vam da uverenje da je to staza koja e vas voditi do
sree, vi ete slediti to. On vam daje nadu. Ali vi oseate tako veliku patnju zbog vaih prolih
nada. On vam opet stvara budui pakao.
Joga oekuje od vas da budete vie odrasli, vie zreli. Joga kae da ne postoji
mogunost da se oekuje ita, ne postoji mogunost ma kakvog ispunjenja u budunosti. Ne
postoji nebo u budunosti i nema Boga koji vas eka sa boinim darovima. Nema nikog da
vas oekuje, stoga ne udite vie za budunou.
A kada postanete svesni da nema niega to e se dogoditi negde u budunosti, vi ete
postati spremni za sve ovde i sada jer nema nikuda da se krene. Onda ne postoji mogunost za
strepnju. Onda vam se deava smirenost. Iznenada ste duboko oputeni. Ne moete ii nikuda,
vi ste kod kue. Kretanje prestaje; uznemirenost iezava. Sada je vreme da se ue u jogu.
Patanjali vam nee dati nikakvu nadu. On potuje vas vie nego to vi potujete sebe.
On misli da ste zreli i da vam igrake nee pomoi. Bolje je biti spreman za ono to se deava.
Inae odmah im ja kaem: "Potpuna beznadenost" va um e rei: "Ovo izgleda
pesimistino", jer va um ivi kroz nadu, jer va um se lepi uz elje, nadanja.
Vi ste tako nesreni upravo sada da ete poiniti samoubistvo ako nema nade. Ako je
stvarno Patanjali u pravu, ta e vam se dogoditi? Ako nema nade, nema budunosti, i vi ste
baeni natrag u vau sadanjost, vi ete poiniti samoubistvo. Nema niega zata bi se onda
14

ivelo. Vi ivite za neto to e se dogoditi negde, nekada. To se nee dogoditi, ali oseanje
da se to moe dogoditi pomae vam da budete ivi.
Zbog toga kaem da kada doete do take gde je samoubistvo postalo najznaajnije
pitanje, gde je ivot izgubio svako svoje znaenje, gde moete ubiti sebe, u tom trenutku joga
postaje mogua, jer neete biti spremni da preobrazite sebe dok vam se ova silna nitavnost
ivota dogaa. Biete spremni da preobrazite sebe samo kada oseate da ne postoji drugi put ili samoubistvo ili sadhana (duhovna praksa, meditacija), ili da poinite samoubistvo ili da
preobrazite svoje bie. Kada preostanu samo ove dve alternative, samo onda se bira joga,
nikada pre. Meutim, joga nije pesimistina. Vi ste optimistini, zato vam joga izgleda kao
pesimistina. To je zbog vas.
Buddha je uzet na Zapadu kao vrhunac pesimizma, jer Buddha kae: "ivot je dukkha,
patnja". Tako su zapadni filozofi tumaili da je Buddha pesimista. ak i osoba poput Alberta
vajcera (A. Schweitzer), osoba od koje moemo oekivati da zna izvesne stvari, ak i on je u
zabuni. On misli da je itav Istok pesimistian. A ovo je velika kritika od njega. itav Istok Buddha, Patanjali, Mahavira, Lao Ce, za njega su svi pesimisti. Oni samo tako izgledaju jer
su uvideli da je va ivot besmislen. Ne kau da je sam ivot besmislica - nego ivot koji vi
znate. A dok va ivot ne postane sasvim besmislen, vi ga ne moete transcendirati. Vi ete se
lepiti uz njega.
I dok ne transcendirate takav ivot, ovaj oblik egzistencije, neete znati ta je
blaenstvo. Ali Buddha, Patanjali, oni nee govoriti mnogo o blaenstvu jer imaju duboko
saoseanje prema vama. Ako zaponu da govore o blaenstvu, vi opet stvarate nadu. Vi ste
neizleivi: vi opet kreirate nadu. Kaete: "U redu! Onda moemo ostaviti ovaj ivot. Ako je
bolji i bogatiji ivot mogu, onda moemo ostaviti elje. Ako je kroz ostavljanje elja mogue
ostvariti najdublju elju dostizanja krajnjeg vrhunca blaenstva, onda moemo napustiti elje.
Ali ih moemo samo napustiti radi vee elje."
Onda gde je vae naputanje? Nita ne ostavljate. Vi jednostavno zamenjujete
drugaiju elju za stare elje. A nova elja e biti mnogo opasnija nego stara jer ste sa starom
ve prevareni. Da biste postali izigrani sa novom, moete proi puno ivota da biste doli do
take gde moete rei 'Bog je beskoristan', gde moete rei 'raj je besmislen', gde moete rei
'sva budunost je bezumnost'.
Nije to pitanje samo svetovnih elja, to je pitanje elje kao takve. eljenje mora
prestati. Samo onda postajete spremni, samo onda skupite hrabrost, samo onda se vrata
otvaraju i vi moete ui u nepoznato. Otuda je Patanjalijeva prva sutra: "A sada, disciplina
joge".
Drugo pitanje:
Reeno je da je joga ateistiki sistem. Da li se vi slaete s tim?
Jo jednom, joga nije ni jedno ni drugo. Ona je jednostavno nauka. Nije ni teistika
niti ateistika. Patanjali je zaista velianstven, udesan ovek. On nikada ne govori o Bogu.
A ak i ako pominje jednom, onda takoe kae da je to samo jedna od metoda da se dostigne
ono najvie, vera u Boga je samo metoda da se dostigne krajnje; Bog kao objekat ne postoji.
Verovanje u Boga jeste samo tehnika, jer kroz verovanje u Boga molitva postaje mogua,
kroz verovanje u Boga predanost postaje mogua. Znaaj je u predanosti i molitvi, ne u Bogu
kao njihovom objektu.
Patanjali je zaista neverovatan! On je rekao Bog - vera u Boga, koncept Boga takoe je jedna od metoda, meu mnogim metodama, da bi se postigla istina. Ivara
pranidhan - verovanje u Boga samo je staza. Ali to nije nuno. Moete odabrati i neto drugo.
Buddha je dospeo do te krajnje realnosti bez verovanja u Boga. On je odabrao drugaiju stazu
gde Bog nije potreban.
Vi ste doli u moju kuu. Proli ste kroz odreenu ulicu. Ta ulica nije bila cilj; ona je
samo bila pomono sredstvo. Mogli ste doi do iste kue kroz neku drugu ulicu; drugi su
stigli do nje kroz druge ulice. U vaoj ulici moda postoji zelena trava, veliko drvee; u
15

drugim ulicama ih nema. Dakle Bog je samo jedna staza. Zapamtite tu razliku. Bog nije cilj.
Bog je samo jedna od staza.
Patanjali nita ne porie; on nita ne namee. On je apsolutno nauan. Hrianima je
teko da zamisle kako je Buddha mogao da dostigne krajnju istinu, jer nikada nije verovao u
Boga. Teko je hindusu da veruje kako je Mahavira postigao osloboenje; on nikada nije
verovao u Boga.
Pre nego to su zapadni mislioci postali upoznati sa istonim religijama, oni su uvek
definisali religiju kao usmerenost ka Bogu. Kada su doli do istonjakog miljenja, i onda su
postali svesni da tamo postoji tradicionalni put prema istini na kome nema Boga, oni su bili
okirani; to je nemogue.
H. G. Wells je pisao o Buddhi da je Buddha najbezboniji ovek, a ipak najpoboniji.
On nikada nije verovao i nikada nije rekao nikome da veruje u Boga, ali je on sam najvii
fenomen deavanja boanskog postojanja. Mahavira je takoe iao stazom gde Bog nije bio
nuan.
Patanjali je potpuno nauan. On kae da mi nismo povezani sa sredstvima; postoji
hiljadu i jedno sredstvo. Cilj je istina. Neki su je postigli kroz Boga, dakle to je u redu verujte u Boga i postignite cilj, jer kada se cilj postigne vi ete odbaciti svoju veru. Dakle,
vera je samo instrument. Ako ne verujete, to je u redu; nemojte verovati, idite stazom
bezvernosti, i dostignite cilj.
On nije ni teista niti ateista. On ne kreira religiju, on vam jednostavno pokazuje sve
staze koje su mogue i sve zakone koji dejstvuju u vaoj transformaciji. Bog je jedna od tih
staza; tu nema prisile. Ako ste niste vernik, nije potrebno da budete i nereligiozni. Patanjali
kae da vi takoe moete dostii iako niste vernik, ne marite za Boga. Ovo su zakoni, to su
eksperimenti; to je meditacija - proite kroz to.
On nije insistirao ni na jednom konceptu. To je bilo vrlo teko. Zbog toga su joga
sutre od Patanjalija izuzetne, jedinstvene. Takva knjiga se nikada nije dogodila ranije i ne
postoji mogunost ponovo da se dogodi, jer sve to moe biti napisano o jogi napisano je; on
nita nije izostavio. Niko ne moe dodati nita tome. Nikada u budunosti nee postojati
mogunost stvaranja drugog dela kao to su Patanjalijeve Joga sutre. On je kompletno
zavrio posao, a on je to mogao da uradi tako kompletno jer nije bio jednostran. Da je bio
jednostran, to ne bi mogao da uradi tako celovito.
Buda je delimian, Mahavira je nepotpun, Muhamed je jednostran, Isus je nepotpun oni imaju odreenu stazu. Njihova nepotpunost moe biti zbog vas - zbog dubokog
razumevanja za vas, dubokog saoseanja za vas. Oni insistiraju na odreenoj stazi; stalno su
insistirali itavog njihovog ivota. Oni su govorili: "Sve drugo je pogreno; ovo je ispravna
staza" samo da bi stvorili veru u vama. Vi ste tako bezverni, tako ste ispunjeni sumnjom, da
ako oni kau da ova staza predvodi, a druge staze takoe vode, vi neete slediti ni jednu. Zato
su insistirali da jednino njihova staza vodi do cilja.
To nije tano. To je pomono sredstvo za vas - jer ako oseate neku nesigurnost u
njima, ako oni kau: "Ovo vodi do cilja, i ono takoe vodi; ovo je istina, i ono je takoe
istina", vi ete postati nesigurni. Vi ste ve nesigurni, potreban vam je neko ko je apsolutno
pouzdan. Samo da bi izgledali pouzdani vama, oni su nainili sebe jednostranim.
Inae ako ste jednostrani, ne moete obuhvatiti itavu osnovu. Patanjali nije
jednostran. On je manje zainteresovan za vas, vie se brine o projektovanju dobre staze. On
nee koristiti neistinu; on nee koristiti pomona sredstva, on se nee nagaati s vama.
Nijedan naunik ne prihvata kompromis.
Buda je bio sposoban za kompromis; on ima saoseanje. On vas ne tretira nauno.
Vrlo duboko ljudsko oseanje ima prema vama; moe ak i lagati da bi vam pomogao. Ako vi
ne moete razumeti istinu, on ini nagodbu s vama. Patanjali nee imati kompromis s vama.
Ma kakva da je istina, on e govoriti o injenici. Nee se spustiti nijedan korak da udovolji
vama; on je apsolutno beskompromisan. Nauka mora biti takva. Nauka ne moe praviti
kompromise; inae ona bi postala samo religija.
On nije ni ateista ni teista. On nije ni hinduista, niti musliman, ni hrianin niti ain, a
takoe ni budista. On je apsolutno nauni istraiva koji samo otkriva kakav sve to jeste 16

otkriva bez ikakvog izmiljanja mitova. On nee koristiti nijednu alegoriju. Isus je stalno
govorio u priama jer vi ste deca i moete razumeti samo prie. On je govorio u alegorijama.
Buddha koristi tako mnogo pria samo da bi vam pomogao da ostvarite letimian uvid.
itao sam o hasidu, jevrejskom uitelju, Bal emu. On je bio rabin u malom selu, a
kad god bi tamo bila neka nevolja, neka bolest, neka nesrea u selu, on bi krenuo u umu.
Otiao bi do odreenog mesta, ispod odreenog drveta, tamo bi obavio neki ritual i onda bi se
molio Bogu. I uvek bi se deavalo da je nesrea naputala selo, bolesti bi iezavale iz sela,
nevolje bi prestajale.
Onda je Bal em umro. Postavljen je njegov naslednik Problem je nastupio ponovo.
Selo je bilo u nevolji. Nastupila je neka nevolja, i seljani su zatraili od naslednika, novog
rabina, da ode u umu i da se moli Bogu. Novi rabin je bio jako uznemiren jer nije znao
mesto, tano odreeno drvo. Bio je neiskusan, ali je ipak otiao - pod neko drvo. Zapalio je
vatru, izveo je ritual, molio se i rekao Bogu: "Vidi, ja ne znam tano mesto na koje je moj
uitelj imao obiaj da dolazi, ali ti zna. Ti si svemoan, sveprisutan, dakle ti zna - stoga
nema potrebe za tano odreenim mestom. Moje selo je u nevolji, prema tome sluaj i uini
neto." Nesrea je prola!
Onda kada je ovaj rabin umro i doao njegov naslednik, opet je nastupio problem. Selo
je bilo u izvesnoj krizi, i seljani su doli. Rabin je bio uznemiren; zaboravio je ak i molitvu.
Tako je otiao u umu, odabrao izvesno mesto. Nije znao ni da zapali ritualnu vatru, ali
nekako je uspeo da zapali vatru i rekao je Bogu: "Sluaj, ja ne znam kako da zapalim ritualnu
vatru, ja ne znam tano mesto, i zaboravio sam molitvu, ali ti si sveznajui, tako da zna ve,
nema potrebe. Zato uini ta treba." Vratio se natrag i selo je prebrodilo krizu.
Onda je on takoe umro, a njegov naslednik Njegovo selo je opet bilo u nevolji,
tako su doli kod njega. Sedeo je u fotelji. Rekao je Bogu: "Ja ne elim da idem nikuda. uj,
ti si svuda. Ja ne znam molitvu, ne znam nikakav ritual. Ali to nije vano; moje znanje nije
glavna stvar. Ti zna sve. Kakva je korist moliti se, kakva je korist vriti ritual, i kakva korist
od posebnog svetog mesta? Ja znam samo priu o mojim prethodnicima. Ispriau ti priu, da
se to dogodilo u Bal emovo vreme, onda u vreme njegovog naslednika, onda njegovog
naslednika; to je pria. Sada uini ta treba, i to je dovoljno." I nevolja je iezla - zato to je
Bog mnogo voleo prie.
Ljudi vole njihove prie i boiji ljudi takoe, kroz prie moete imati odreena
delimina sagledavanja. Meutim, Patanjali nee koristiti nijednu alegoriju. Rekao sam vam
da je on kao Ajntajn plus Buddha - vrlo retka kombinacija. On je imao unutranje svedoenje
Buddhe i mehanizam uma jednog Ajntajna.
On nije ni jedno ni drugo. Teizam je pria; ateizam je antipria. Prie su samo mitovi,
od ljudi stvorene parabole. Nekima se jedna dopada, a nekima druga. Patanjali nije
zainteresovan za prie, nije zainteresovan za mitove. On je zainteresovan za golu istinu. On je
nee ak ni zaodenuti, nee je ak ni doterati, nee je ukraavati. To nije njegov nain.
Zapamtite ovo.
Kretaemo se po vrlo suvoj zemlji, zemlji nalik pustinji. Ali pustinja ima svoju
vlastitu lepotu. Ona nema drvee, ona nema reke, ali ima svo svoje prostranstvo. Nijedna
uma se ne moe uporediti s njom. ume imaju svoje sopstvene lepote, brda svoje vlastite
lepote, reke svoje vlastite divote. Pustinja ima svoju sopstvenu neizmernu beskrajnost.
Kretaemo se kroz pustu zemlju. Hrabrost je nuna. Nee vam dati nijedno drvo da se
odmorite ispod njega, nee vam dati nijednu priu - samo gole injenice. Nee koristiti ak
nijednu suvinu re. Otuda je re sutre. Sutre oznaavaju osnovni minimum, aforizme u
kratkim izrekama. Sutra nije ak ni potpuna reenica. Ona je samo sutina - kao kada aljete
telegram, kreete suvine rei. Onda to postaje sutra jer samo deset ili devet rei mogu biti
stavljene u poruci. Ako biste pisali pismo, ispunili biste deset stranica, a ak ni u deset
stranica poruka nee biti potpuna. Ali u telegramu, u deset rei, ne samo da je kompletna, ona
je vie nego potpuna. Ona pogaa srce; sama sr je u njoj.
17

To su telegrami - Patanjalijeve sutre. On je tvrdica; nije koristio nijednu suvinu re.


Prema tome kako on moe priati prie? Ne moe, i ne oekujte to. Stoga ne pitajte da li je on
teista ili ateista; to su sve prie.
Filozofi su stvorili mnogo pria, i to je igra. Ako elite igru ateizma, budite ateista.
Ako elite igru teizma, budite teista. Ali to su igre, nisu realnost. Realnost je neto drugo.
Realnost se bavi s vama, ne s onim u ta verujete. Realnost ste vi, ne ono ta verujete.
Realnost je iza uma, ne u sadrajima uma, jer teizam je sadraj uma, ateizam je sadraj uma neto u umu. Hinduizam je sadraj uma, i hrianstvo je sadraj uma.
Patanjali je zainteresovan za ono to je izvan, ne za sadraj. On kae: "Odbaci ceo
ovaj um. ta god da sadri, to je beskorisno." Vi moda nosite divne filozofije, Patanjali je
rekao: "Odbacite ih, sve je besmislica." To je teko. Ako neko kae: "Vaa Biblija je triarija,
vaa Gita je besmislica, vai spisi su bezvredni, budalatina, odbacite ih", vi ete biti okirani.
Ali to je ono to e se dogoditi. Patanjali vam nee uiniti nikakav ustupak. On je
beskompromisan. A to je lepota, i to je njegova jedinstvenost.
Tree pitanje:
Vi ste govorili o znaaju uenitva na stazi joge, ali kako jedan ateista moe biti
uenik?
Ni teista ni ateista ne mogu biti uenici. Oni su ve zauzeli gledite, oni su ve
odluili, stoga gde je svrha da budu uenici? Ako ve znate, kako moete biti uenik?
Uenitvo znai spoznaju da ja ne znam. Ateisti, teisti - ne, oni ne mogu biti uenici.
Ako verujete u neto, vi ete propustiti lepotu uenitva. Ako neto ve znate, to
saznanje e vam dati ego. Ono vas nee uiniti poniznim. Zbog toga panditi i uenjaci
proputaju. Ponekad grenici dostiu uenitvo, ali naunici nikada. Oni znaju previe; oni su
tako pametni. Njihova darovitost je njihova bolest; ona postaje samoubistvo. Oni nee sluati
jer nee biti spremni da ue.
Uenitvo jednostavno oznaava jedno stanovite prema uenju - iz trena u tren
ostajati svestan da ne znam. Ovo saznanje da ne znam, ova svesnost Ja sam neznalica,
daje vam otvorenost; onda niste zatvoreni. Onog momenta kada kaete: "znam", vi ste
zatvoreni u krugu; vrata vie nisu otvorena.
Ako ste ve dostigli, zakljuili, ne moete biti uenik. ovek mora da bude u
prijemljivom raspoloenju. ovek mora neprekidno da bude svestan da stvarnost je nepoznata
i ma ta da znam to je beznaajno. ta vi znate? Vi ste moda skupili mnogo informacija, ali
to nije spoznaja. Moda ste pokupili mnogo praine kroz univerzitete; to nije spoznaja. Moda
znate o Buddhi, moda znate o Isusu, ali to nije spoznaja. Dok ne postanete Buddha, nema
spoznaje. Dok niste Isus, nema spoznaje.
Spoznaja dolazi kroz bie, ne kroz pamenje. Moete imati uvebano pamenje;
pamenje je samo mehanizam. Ono vam nee dati bogatije postojanje. Moe vam dati strane
snove, ali vam ne moe dati bogatije postojanje. Ostaete isto pokriveni s mnogo praine.
Znanje, a naroito ego koji dolazi kroz znanje - oseanje ja znam zatvara vas. Jo ne moete
biti uenik. A ako ne moete biti uenik, ne moete ui u disciplinu joge. Stoga doite do
vrata joge neupueni, svesni da ne znate. A ja u vam rei: To je jedino znanje koje e vam
pomoi, znanje da ne znate.
Ovo vas ini poniznim i skromnim. Suptilna poniznost e vam doi. Uskoro e ego
splasnuti. Znajui da ne znate, kako moete biti egoistini? Znanje je najsuptilnija hrana za
ego: vi oseate da ste neto. Vi znate; vi postajete neko.
Ba pre dva dana, inicirao sam devojku sa Zapada u sannyas i dao sam joj ime Joga
sambodhi i pitao sam je: "Da li e ti biti lako da ga izgovara? Ona je rekla: "Da. Lii na
englesku re 'somebody'9." Meutim, sambodhi je sasvim suprotno. Kada postanete niko, onda
se sambodhi deava. Sambodhi znai prosvetljenje. Ako ste vi neko, sambodhi se nikada nee
dogoditi. Ta "nekost"10 je prepreka.
9

Neko, vana linost, vana osoba.


Eng.: Somebodiness.

10

18

Kada oseate da ste niko, kada oseate da ste nita, iznenada ste pristupani mnogim
misterijama da vam se dogode. Vaa vrata su otvorena. Sunce moe da se uzdigne; sunevi
zraci mogu da prodru u vas. Vaa turobnost, vaa tama e ieznuti. Ali vi ste zatvoreni.
Sunce moda kuca na vrata, ali niko ne otvara; ni prozor ak nije otvoren.
Ateisti ili teisti, hindusi ili muslimani, hriani ili budisti, oni ne mogu stupiti na stazu
joge. Oni veruju. Oni su ve dosegli bez pruanja ruke ma gde. Oni su zakljuili bez ikakve
realizacije. Oni imaju rei u umovima - koncepte, teorije, spise. A to je vee breme, oni su
vie mrtvi.
etvrto pitanje:
Vi ste rekli da joga ne trai nikakvu veru. Ali ako je ueniku potrebna vera,
predanost i poverenje u uitelja kao osnovni uslov, onda kako je prva tvrdnja opravdana?
Ne. Nikada nisam rekao da joga ne trai veru. Ja sam rekao da joga ne trai neko
uverenje. Vera je potpuno razliita, poverenje je potpuno razliito. Uverenje je intelektualna
stvar, ali vera je vrlo duboko poverenje. Ona nije intelektualna. Vi volite uitelja, onda imate
poverenje i postoji vera. Meutim, ova vera nije nikakav koncept, ona je u samoj osobi. A to
nije uslov; to nije zahtevano - zapamtite ovu razliku. Ne trai se da vi morate verovati u
uitelja; to nije preduslov. Sve to je reeno je ovo: ako se to dogodi izmeu vas i uitelja,
onda e biti mogu satsang. To je samo situacija, a ne uslov. Nita se ne zahteva.
Samo ljubav... Ako se ljubav dogodi onda brak moe uslediti, ali vi ne moete uiniti
ljubav uslovom, da prvo morate voleti a onda e brak uslediti. Inae onda ete pitati: "Kako
ovek moe voleti?" Ako se to dogodi, dogodi se; ako se to ne dogaa, ne dogaa se. Vi ne
moete uiniti nita. Stoga ne moete prisiliti poverenje.
U davnim vremenima tragaoci bi lutali svuda po svetu. Lutali bi od jednog uitelja do
drugog, samo oekujui pojavu da se dogodi. Vi to ne moete prisiliti. Moete promeniti
mnogo uitelja, upravo u potrazi ne bi li negde neto kljocnulo. Onda se stvar dogodi; to nije
okolnost. Vi ne moete otii kod uitelja i pokuati da mu verujete. Kako moete pokuati da
verujete? Sam pokuaj, sam napor, pokazuje da ne verujete. Kako moete pokuati da volite
nekoga? Moete li? Ako pokuate, cela stvar e postati lana. To se smo dogaa.
Inae dok se to ne dogodi, satsang nee biti mogu. Tada vam uitelj ne moe dati
svoju milost. Nee on odvratiti sebe od davanja; vi niste dostupni. On ne moe uiniti nita.
Vi niste otvoreni.
Sunce moda eka ispred prozora, ali ako je on zatvoren, ta sunce moe uiniti? Zraci
e se reflektovati natrag. Oni e doi, kucati na vrata i vratiti se natrag. Zapamtite, to nije
uslov da vi otvorite vrata da bi sunce izalo na horizontu; to nije uslov! Sunce moda nee biti
tu, moda je no. Samo otvaranjem vrata vi ne moete stvoriti sunce. Vae otvaranje vrata je
samo vae bivanje dostupnim. Ako je sunce tu, ono moe ui.
Tako e se tragaoci kretati, morae da se kreu od jednog uitelja do drugog. Jedina
stvar koju treba zapamtiti je da oni moraju biti otvoreni i da ne treba da sude. Ako doete
blizu uitelja, i ne oseate nikakav rad unutar njega, kretanje - ali ne sudite. Jer vae
prosuivanje e biti pogreno. Vi nikada niste bili u kontaktu. Dok ne volite, vi ne znate,
stoga ne sudite. Jednostavno kaite: "Ovaj uitelj nije za mene; ja nisam za ovog uitelja.
Stvar se nije dogodila." Jednostavno idite dalje.
Ako zaponete da sudite, onda zatvarate sebe za druge uitelje takoe. Moda ete
morati da proete kroz mnoge, mnoge situacije, ali zapamtite ovo: ne sudite. Kad god oseate
da je neto pogreno sa uiteljem, idite dalje. To znai da ne moete imati poverenje. Neto je
krenulo pogreno, ne moete verovati. Ali ne kaite da je uitelj pogrean; ne znate.
Jednostavno se maknite; to je dovoljno. Traite negde drugde.
Ako ponete da prosuujete, osuujete, zakljuujete, onda ete biti zatvoreni. A one
oi koje sude nikada nee moi da veruju. Jednom kada postanete rtva suenja nikada neete
biti sposobni da verujete jer ete nai neto to e vam pomoi da ne verujete, to e vam
pomoi da se zatvorite.
Dakle, nemojte verovati, nemojte suditi, kreite se. Jednog dana, ako nastavite da se
kreete, stvar e se sigurno dogoditi; jednog dana, negde, u nekom momentu, jer ima
19

trenutaka - ne moete uiniti nita s njima kada ste osetljivi, i kada uitelj tee. Vi ste
osetljivi, vi ga susreete. U odreenim takama vremena i prostora, susret se dogaa. Onda
satsang postaje mogu.
Satsang znai intimna blizina sa uiteljem, sa ovekom koji je spoznao. Jer onda on
moe da tee. On ve tee. Sufi kau da je to dovoljno. Samo da se bude u intimnoj blizini
uitelja, to je dovoljno, samo da se sedi pokraj njega, samo da se hoda uz njega, samo da se
sedi u blizini njegove sobe, samo da se bdi u noi sedei iza njegovog zida, samo ga se stalno
seati, to je dovoljno.
Ali to trai godine, godine ekanja. A on nee postupati s vama dobro, zapamtite, on
e vam stvarati svaku vrstu prepreka. Dae vam mnogo prilika da sudite. irie glasine o sebi
tako da moete pomisliti da je on pogrean ovek, da biste pobegli. Pomoi e vam na svaki
nain da pobegnete. Dok ne proete sve prepone... A one su nune, jer jeftino poverenje je
neupotrebljivo. Pravo poverenje, zrelo poverenje, koje se ekalo dugo, postalo je jaka stena...
Samo onda se moe prodreti u najdublje slojeve.
Patanjali ne kae da morate da imate uverenja. Uverenje je intelektualno. Vi verujete
u hinduizam, to nije vae poverenje. Vi ste samo sluajno u hinduistikoj porodici, i tako ste
sluali; od samog detinjstva ste bili proeti. Na vas su ostavile utisak teorije, koncepti,
filozofije, sistemi. Oni su postali deo vae krvi. Oni su samo zapali u vau svest; vi verujete u
njih. Ali to verovanje nije od koristi jer vas nije preobrazilo. To je mrtva stvar, pozajmljena.
Poverenje nikada nije mrtva stvar. Vi ne moete pozajmiti poverenje od vae porodice.
To je lina pojava. Moraete da doete do njega. Hinduizam je tradicionalan, islam je
tradicionalan.
Prva grupa oko Muhameda - bili su pravi muslimani - jer je to bilo poverenje u njega;
oni su doli lino do uitelja. Oni su iveli sa uiteljem u intimnoj blizini; imali su satsang.
Oni su verovali u Muhameda, a Muhamed nije bio ovek kome se lako moglo verovati.
Teko. Da ste vi bili kod Muhameda, vi biste pobegli - on je imao devet ena. Nemogue je
verovati takvom oveku. Drao je ma u svojoj ruci, a na mau je pisalo: "Mir"; re "Islam"
znai mir. Kako moete verovati takvom oveku?
Moete poverovati Mahaviru kada kae: "Nenasilje"; on je nenasilan. Oigledno
moete verovati Mahaviru. Kako moete verovati Muhamedu s maem? A on kae: "Ljubav
je poruka i mir je moto." Ne moete verovati. Ovaj ovek stvara ograde.
On je bio sufi; on je bio uitelj. On je kreirao svakojake tekoe. Dakle, ako va um
jo funkcionie, jo sumnjate, jo ste skeptini, pobei ete. Inae ako ostanete, ekate, ako
imate strpljenje - a beskonano strpljenje e biti potrebno - jednog dana ete upoznati
Muhameda, vi ete postati musliman. Samo znajui njega, vi ete postati musliman.
Prva grupa njegovih uenika je bila sasvim razliita stvar. Prva grupa Buddhinih
uenika je bila sasvim razliita stvar. Sada su budisti mrtvi. Muslimani su mrtvi. Oni su samo
po tradiciji muslimani.
Istina ne moe biti prenesena kao imovina. Vai roditelji vam ne mogu dati istinu. Oni
vam mogu dati imovinu jer imovina pripada svetu. Istina ne pripada svetu; oni vam je ne
mogu dati, oni je ne mogu imati u riznici. Ne mogu je imati u banci tako da vam se ona ne
moe preneti. Vi ete morati da je traite sami. Moraete da patite, da postanete uenik i
moraete da proete kroz strogu disciplinu. To e biti lini dogaaj. Istina je uvek lina. Ona
se deava osobi. Poverenje je razliito od verovanja. Vera vam je data od drugih, a poverenje
vi stiete sami.
Patanjali ne zahteva nikakvu veru, ali bez poverenja nita ne moe da se uini, bez
poverenja nita nije mogue. Ali vi to ne moete prisiliti - zapamtite. Vi ne moete prisiliti
svoje poverenje; to nije u vaim rukama da ga prisilite. Ako prisiljavate, ono e biti lano. A
nepoverenje je bolje od lanog poverenja, jer troite sebe. Bolje je preseliti se negde drugde
gde realno moe da se dogodi.
Nemojte suditi, nastavite da se kreete. Jednog dana, negde, va uitelj vas oekuje. A
uitelj vam se ne moe pokazati: "Idite tamo i taj e biti va uitelj". Moraete da traite,
moraete da patite, jer kroz patnju i traganje ete moi da ga vidite. Vae oi e postati vedre;
suze e ieznuti. Vae oi e postati bistre i vi ete spoznati da taj jeste va uitelj.
20

Pria se da je jedan od sufija, po imenu Junaid, doao kod starog fakira i zapitao ga:
"uo sam da vi znate. Pokaite mi put." Starac mu je rekao: "Ti si uo da ja znam. Ti ne zna.
Pogledaj u mene i oseti." ovek je rekao: "Ne mogu osetiti nita. Samo uradite jednu stvar:
pokaite mi put gde mogu nai svog uitelja." Tada je stari ovek rekao: "Prvo idi u Meku.
Naini hodoae i trai takvog i takvog oveka. On e sedeti ispod drveta. Njegove oi e
biti takve da e bacati svetlost, a ti e oseati odreen miris slian mousu oko njega. Idi i
trai."
I Junaid je putovao i putovao dvadeset godina. Gde god je uo za uitelja, on bi otiao.
Ali niti je bilo drveta, niti mirisa, mousa, niti onih oiju koje je opisao starac. Takva linost
nije postojala. A on je imao gotovu formulu, tako da je odmah sudio: "Ovo nije moj uitelj" i
kretao bi dalje. Posle dvadeset godina doao je do drveta. Uitelj je bio tamo. Mous je lebdeo
u vazduhu, ba kao izmaglica okolo oveka. Oi su bile vatrene, zraile su crvenim svetlom.
Pao je pred nogama tog oveka i rekao: "Uitelju, traio sam vas dvadeset godina."
Uitelj je rekao: "Ja takoe ekam tebe dvadeset godina. Pogledaj ponovo." On je
pogledao. To je bio isti ovek koji mu je pre dvadeset godina pokazao put da nae uitelja.
Junaid je zapoeo da plae: "ta, vi se alite sa mnom? Dvadeset godina sam potroio. Zato
mi niste rekli da ste moj uitelj?"
Starac je rekao: "To ti ne bi pomoglo; to nije bilo od velike koristi - jer dok ti nisi
imao oi da vidi... Ovih dvadeset godina su ti pomogle da me vidi; ja sam isti ovek.
Meutim pre dvadeset godina si mi rekao: "Ja ne oseam nita." Ja sam isti, ali ti si sada
postao sposoban da osea. Ti si se promenio. Ovih dvadeset godina su te dobro izglancale.
Sva praina je otpala; tvoj um je ist. Ovaj miris mousa je i u to vreme takoe bio prisutan,
ali ti nisi bio sposoban da ga omirie. Tvoj nos je bio zatvoren; tvoje oi nisu funkcionisale;
tvoje srce nije stvarno kucalo. Tako, kontakt nije bio mogu."
Vi ne znate nikoga koji bi rekao kada e se poverenje dogoditi. Ja ne kaem veruj
uitelju, jednostavno kaem nai osobu gde se poverenje stvara - ta osoba je va uitelj. Vi
nita ne moete uiniti oko toga. Moraete da lutate. Stvar e se sigurno dogoditi, ali traganje
je nuno jer vas ono priprema. Ne vodi vas traganje do uitelja, traganje vas priprema da ga
moete videti. On moe biti sve vreme pokraj vas.
Peto pitanje:
Prole noi ste govorili o satsangu i vanosti uenikove blizine guruu, da li to
podrazumeva fiziku blizinu? Da li je uenik koji ivi na velikoj fizikoj udaljenosti od gurua
na gubitku?
Da i ne. Da, fizika blizina je nuna u poetku jer takvi kakvi jeste ne moete
razumeti nita odmah. Moete razumeti telo; moete razumeti jezik fizikog. Vi postojite u
fizikom, tako da fizika blizina jeste nuna - u poetku.
A ja kaem 'ne' takoe jer kako rastete, kako poinjete da uite drugaiji jezik koji je
nefiziki, onda fizika blizina nije nuna. Onda moete ii svuda. Onda prostor ne ini
nikakvu razliku. Vi ostajete u kontaktu. Ne samo prostor, nego i vreme takoe ne ini nikakvu
razliku. Uitelj moe biti mrtav, vi ostajete u kontaktu. On je moda odbacio fiziko telo, vi
ostajete u kontaktu. Ako se poverenje dogodi, onda se oboje, i vreme i prostor transcendiraju.
Poverenje je udo. Vi moete biti u blizini Muhameda, Isusa ili Buddhe ba sada ako
postoji poverenje. Ali, to je teko! To je teko jer vi ne znate kako. Vi ne moete verovati
ivoj osobi, kako moete verovati mrtvoj. Ako se dogodi poverenje, onda ste upravo sada
blizu Buddhe. A za osobe koje imaju veru, Buddha je iv. Nijedan uitelj nikada ne umire za
onoga ko moe verovati. On nastavlja da pomae, on je uvek tu. Ali za vas, ak i da je
Buddha tu fiziki, da stoji iza vas ili ispred vas, da upravo sedi pored vas, vi neete biti bliski
s njim. Moe postojati irok prostor izmeu vas. Ljubav, vera, oni unitavaju prostor, vreme,
oboje.
U poetku, poto ne moete razumeti nijedan drugi jezik, moete razumeti samo jezik
fizikog, fizika blizina je nuna - ali samo u poetku. Doi e trenutak kada e vas sam
21

uitelj poslati daleko. On e vas prisiliti da se udaljite jer je to takoe potrebno - moete
poeti da se lepite uz fiziki jezik.
Gurijev je gotovo uvek, celog svog ivota, slao svoje uenike daleko. On je stvarao
tako jadnu situaciju za njih, da su oni morali da odlaze. Nije bilo mogue iveti s njim. Posle
odreene take, on bi im pomogao da odu daleko. Zaista ih je prisiljavao da odu daleko, jer ne
treba da postanete previe zavisni od fizikog. Drugi, vii jezik, mora da se razvije. Morate
zapoeti da oseate bliskost s njim gde god da ste, jer telo mora biti transcendirano. Ne samo
vae, uiteljevo telo takoe mora biti transcendirano.
Ali u poetku je to velika pomo. Kada je seme zasaeno, kada je pruilo koren, onda
ste dovoljno jaki. Onda moete otii daleko, i tada moete da osetite. Ako odete daleko
kontakt se nee izgubiti - onda kontakt nije od velike vanosti. Poverenje e rasti, to dalje
odete. Poverenje e rasti vie, jer kad god ste na zemlji vi ete konstantno oseati uiteljevo
prisustvo. Poverenje e rasti. Sada e vam on pomagati kroz skrivene ruke, nevidljive ruke.
On e delovati na vas kroz vae snove, i vi ete konstantno oseati da vas on sledi kao senka.
Ali to je vrlo razvijen jezik. Nemojte ga probati od samog poetka jer onda moete biti
obmanuti. Stoga u rei, kreite se korak po korak. Kad god se poverenje dogodi, onda
zatvorite svoje oi i sledite naslepo. Zaista, onog trenutka kada se poverenje dogodi morate
zatvoriti svoje oi. Onda, kakva je korist od miljenja, prosuivanja? Poverenje se dogodilo i
verovanje nee sada sluati nita.
Onda sledite i ostanite blizu dok vas sam uitelj ne poalje daleko. A kada vas poalje
daleko onda se ne vezujte. Onda sledite. Sledite njegove instrukcije i otidite daleko, jer on zna
bolje, i ta je korisno, on zna.
Ponekad, ba pored uitelja, moe vam postati teko da rastete - kao to ispod velikog
drveta nova mladica ima potekoe da izraste. Ispod velikog drveta, novo drvo e postati
obogaljeno. ak i drvee se brine da baci svoje seme daleko tako da moe proklijati. Drvee
koristi mnoge trikove da poalje seme daleko; inae ono bi umrlo, ako padne ba ispod
velikog drveta. Tamo je previe senke. Sunce nikako tamo ne dopire, malo sunevih zraka
tamo dosee.
Dakle, uitelj zna bolje. Ako on osea da vi treba da odete daleko, onda se ne opirite.
Onda jednostavno sledite i otidite daleko. Ovo odlaenje daleko e biti dolaenje blie njemu.
Ako moete slediti, ako moete tiho slediti bez ikakvog otpora, ovo odlaenje daleko e biti
dolaenje blizu. Vi ete postii novu bliskost.
esto pitanje:
Kada traite od nas da razumemo neto jasno, kome se vi obraate da razume? Um
treba da se obustavi. Zbog toga nije od koristi uiniti da um razume sve. Ko onda treba da
razume?
Da, um treba da prestane, ali on nije jo prestao. Na umu treba da se radi; jedno
razumevanje treba da se stvori u umu. Kroz ovo razumevanje ovaj um e umreti. To
razumevanje je ba slino otrovu. Vi uzmete otrov i otrov vas ubije. Tako i um razume, ali
samo razumevanje je otrov za um. Zbog toga se um opire tako mnogo. On stalno pokuava da
ne razume. On stvara sumnju, bori se na svaki nain, titi sebe jer razumevanje je otrov za um.
On je eliksir za vas, ali za um je otrov.
Dakle, kada kaem razumite jasno, mislim na va um, ne na vas, jer vama ne treba
nikakvo razumevanje. Vi ve razumete. Vi ste sama mudrost - pranya.
Vama nije potrebna nikakva pomo od mene ili od nekoga drugog. Va um treba da
bude promenjen. A ako se razumevanje dogodi umu, um e umreti, a sa umom razumevanje
e ieznuti. Onda ete biti u vaoj iskonskoj istoti. Onda e vae bie reflektovati istotu
slino ogledalu - nema sadraja, besadrajno. Inae to unutranje bie ne treba razumevanje.
Ono je ve sama sr razumevanja. Njemu ne treba razumevanje - samo oblaci uma zahtevaju
uveravanja.
Dakle, ta je razumevanje zaista? Samo nagovaranje uma da ode. Zapamtite, ja ne
kaem borba, ja kaem nagovaranje. Ako se borite, um nikada nee otii, jer kroz borbu vi
22

pokazujete svoj strah. Ako se borite, vi pokazujete da je um neto od ega se bojite. Samo
uveravajte. Sva ova uenja, sve meditacije su duboko uveravanje uma da doe do take gde
e poiniti samoubistvo, gde on jednostavno otpada, gde um sam po sebi postaje takva
apsurdnost da ga ne moete vie nositi - vi ga jednostavno ispustite. Bolje je rei, um otpada
sam od sebe.
Dakle, kada ja neto objanjavam radi jasnog razumevanja, ja se obraam vaem umu.
Ne postoji drugi nain. Samo vaem umu se moe pristupiti jer ste vi nedostupni. Vi ste tako
skriveni duboko unutra, a samo um je na vratima. Um treba ubediti da napusti vrata i da
ostavi vrata otvorena. Onda ete vi postati dostupni.
Ja se obraam umu - vaem umu, ne vama. Ako se um odbaci, nije potrebno obraati
se - mogu sedeti u tiini i vi ete razumeti; nije potrebno obraati se. Umu su potrebne rei;
umu trebaju misli; umu je potrebno neto mentalno to ga moe nagovoriti. Buddha,
Patanjali ili Krina govorei vama, obraaju se vaem umu.
Doe momenat kada um jednostavno postane svestan cele apsurdnosti. To je ba kao
ovo: ako vas vidim da vuete vae pertle za cipele, i pokuavate da povuete sebe navie
pomou njih, i ako vam kaem: "Kakvu besmislicu inite; to je nemogue." Pomou vaih
pertli za cipele, ne moete podii sebe navie. To je jednostavno nemogue; to se ne moe
dogoditi. Tako vas ja nagovaram da mislite vie o celoj stvari: "To je apsurd. ta to radite?" A
onda se oseate jadno jer to se ne dogaa, tako ja nastavljam da vam govorim, insistirajui,
udarajui ekiem. Jednog dana moete postati svesni: "Da, ovo je apsurd. ta to radim?"
Isto kao podizanje sebe uz pomo pertli za cipele, jeste sav va napor uma. Sve to
radite je apsurd. Ne moe vas odvesti nigde do u pakao, u nevolju. To vas je uvek vodilo u
bedu, ali vi jo niste toga bili svesni. Sva ova komunikacija od mene je samo da uini va um
svesnim da je sav njegov napor apsurdan. Jednom kada doete do oseanja da je itav napor
apsurd, napor iezava. Ne samo da ete morati da ostavite svoje pertle za cipele, ve i da ete
morati da inite ikakav napor, i to e biti apsurdno, vi ete jednostavno uvideti injenicu,
ostaviete i smejaete se. Postali ste prosvetljeni ako ostavite svoje pertle za cipele,
jednostavno ustanete i smejete se. To e se tako dogoditi.
Kroz razumevanje um otpada. Iznenada vi postajete svesni da niko nije bio odgovoran
za vau nevolju, vi ste je stvarali neprekidno; iz trenutka u trenutak vi ste bili tvorac. Vi ste
stvarali bedu, a onda ste traili kako da odete izvan nje, kako da ne budete jadni, kako da
postignete blaenstvo, kako da dostignete samadhi. I dok ste o tome pitali vi ste je stvarali.
ak i ovo pitanje. "Kako dostii samadhi?" je stvaranje patnje jer onda vi kaete: "Ja sam
uinio tako mnogo napora, a samadhi jo nije postignut. Uradio sam sve to je trebalo uraditi,
a samadhi jo nije postignut. Kada u postati prosvetljen?"
Sada vi stvarate novu nevolju kada ste nainili prosvetljenje takoe predmetom elje,
to je apsurdno. Nijedna elja nee doi do ispunjenja. Kada shvatite ovo, elje otpadaju - vi
ste prosvetljeni. Bez elja, vi ste prosvetljeni. Sa eljama vi se kreete u krugu patnje.
Poslednje, sedmo pitanje:
Rekli ste da je joga nauka, metodologija za unutarnje buenje. Ali napor da se bude
blie ne-umu, sadri motivaciju i nadu. ak i podvrgavanje procesu unutranje
transformacije sadri motivaciju. Kako onda ovek moe da se kree na stazi joge sa nadom i
motivacijom? Zar i samo ekanje ne sadri motivaciju?
Da, ne moete da se kreete na stazi joge s motivacijom, sa eljom, sa nadom. Zaista,
tako nema kretanja na stazi joge. Kada doete do shvatanja da su sve elje apsurdne, da su sve
elje patnja, nema ta da se ini, jer svako injenje e biti nova elja. Nema ta da se ini!
Jednostavno ne moete initi nita jer ta god vi inili vodie vas u novu patnju. Onda ne
inite. elje su naputene, um je prestao, i to je joga; uli ste u jogu. To nije kretanje, to je
smirenost. Zbog jezika se javlja problem. Ja sam rekao da ste uli, pa izgleda kao da ste se
kretali. Kada elje prestanu, svo kretanje prestaje. Vi ste u jogi: "a sada disciplina joge".
Sa motivacijom, u ime joge, stvoriete opet druge nevolje. Ja viam svakog dana
takve ljude. Oni dolaze i govore: "Ja sam praktikovao jogu trideset godina, nita se nije
23

dogodilo." Ali ko vam je rekao da e se neto dogoditi? On mora da je oekivao neto da se


dogodi; zbog toga se nita nije dogodilo. Joga kae da ne ekamo na budunost. Vi
meditirate, ali meditirate s motivom da ete kroz meditaciju doi negde do nekog cilja. Vi
proputate svrhu. Meditirajte i uivajte u tome. Ne postoji cilj. Ne postoji budunost, nema
dalje; ne postoji nita ispred. Meditirajte, uivajte u tome - bez ikakve motivacije.
I iznenada, cilj je tu. Iznenada oblaci iezavaju jer su oni stvoreni od vaih elja.
Vaa motivacija je dim koji stvara oblake; oni su iezli. Dakle, igrajte se meditacijom;
uivajte u tome. Ne inite je sredstvom za neto. Ona je kraj svega. Ovo je sva sutina koju
treba razumeti.
Ne stvarajte nove elje. Shvatite pravu prirodu elje, da je patnja. Samo pokuajte da
razumete prirodu elje, i doi ete do saznanja da je ona patnja. ta onda treba uraditi? Nita
ne treba raditi! Postajui svesni da je elja patnja, elja iezava. A sada, disciplina joge. Uli
ste na stazu.
A to zavisi od vae snage. Ako je vaa spoznaja da je elja patnja tako duboka da je
totalna, ne samo da ete ui u jogu, vi ete postati siddha. Vi ste postigli cilj.
To e zavisiti od vae snage. Ako je snaga totalna, onda ste postigli cilj. Ako vaa
snaga nije totalna, vi ste samo uli na stazu.

Poglavlje 3
PET MODIFIKACIJA UMA
27. decembar 1973.
I, 5:

vrttayah pancatayyah klitaklitah.


Obrta ima pet vrsta. [Neki od njih] su ometajui (klita) [po proces
samoprepoznavanja subjekta] neki to nisu (aklita).
I, 6:

pramanaviparyayavikalpanidrasmrtayah.
Istinosna spoznaja, zabluda, afektivno uivljavanje u imaginativnom
(vikalpa), spavanje i seanje [ine tih pet obrta].
Um moe biti ili izvor ropstva ili izvor slobode. Um postaje kapija za ovaj svet, ulaz;
on takoe moe postati i izlaz. Um vas vodi do pakla; um moe da vas odvede i do raja. Dakle
to zavisi od toga kako se um koristi. Ispravna upotreba uma postaje meditacija, neispravna
upotreba uma postaje ludilo.
Um je prisutan kod svakog. Mogunosti tame i svetla prisutne su u njemu. Sam um
nije ni neprijatelj ni prijatelj. Vi ga moete uiniti prijateljem, a moete ga uiniti i
neprijateljem. To zavisi od vas - od vas koji ste skriveni iza uma. Ako moete uiniti um
svojim instrumentom, svojim robom, um postaje prolaz kroz koji moete dostii krajnje,
maksimum. Ako postanete rob i umu dozvolite da bude gospodar, onda e vas ovaj um koji je
postao gospodar voditi do krajnjeg bola i tame.
Sve tehnike, sve metode, svi delovi joge, bave se zaista duboko samo s jednim
problemom: kako koristiti um. Ispravno korien um dolazi do take gde on postaje ne-um
(gde nema uma). Pogreno korien, um dolazi do take gde je on samo haos, mnogi glasovi
suprotstavljeni jedni drugima - kontradiktorni, zbunjujui, umobolni.
Ludak u ludnici i Buddha ispod bodhi drveta - obojica su koristili um; obojica su
prolazili kroz um. Buddha je doao do take gde je um iezao. Pravilno korien on nastavlja
da iezava; i doe momenat kada on vie nije. Ludak je takoe koristio um. Pogreno
korien, um postaje podeljen; nepravilno i krivo korien um postaje mnotvo. I, konano,
ludi um je tu, vi ste sasvim odsutni.
24

Buddhin um je iezao, a Buddha je prisutan u svojoj celosti. Ludakov um je postao


celovit, a on sam je iezao sasvim. Ovo su dva pola. Vi i va um, ako postojite zajedno, onda
ete biti u patnji. Ili ete vi morati da nestanete, ili e um morati da nestane. Ako um nestane,
onda vi postiete istinu; ako vi nestanete, postiete ludilo. A to je borba: ko e nestati? Vi ete
nestati ili um? To je protivrenost, koren svake borbe. 11
Ove Patanjalijeve sutre e vas voditi korak po korak prema ovom razumevanju uma ta je on, koje sve oblike on uzima, koje vrste modifikacija dolaze iz njega, kako ga moete
koristiti i dopreti izvan njega. I zapamtite, vi nemate nita drugo upravo sada - samo um.
Morate ga koristiti.
Ako ga pogreno koristite vi ete nastaviti da padate u sve veu i veu patnju. Vi jeste
u patnji. To je zato to ste tokom mnogo ivota koristili svoj um pogreno. I um je postao
gospodar; vi ste samo rob, senka koja sledi um. Ne moete rei umu: "Stani", ne moete
narediti svom vlastitom umu; va um stalno nareuje vama i vi ga morate slediti. Vae bie je
postalo senka i rob, jedno orue.
Um nije nita drugo ve orue, upravo kao to su vae ruke ili vae noge. Vi naredite
svojim stopalima - svojim nogama, one se kreu. Kada kaete: "Stanite", one se zaustavljaju.
Vi ste gospodar. Ako elim da pokrenem svoju ruku, ja je pokreem. Ako ne elim da je
pomerim, ja je ne pomeram. Ruka ne moe da mi kae: "Sada elim da budem pomerena."
Ruka ne moe rei meni: "Sada u se ja pomeriti ta god ti da ini. Ja te neu sluati." A ako
moja ruka zapone da se kree u inat meni, onda e nastupiti haos u mom telu. To se dogodilo
sa umom.
Vi ne elite misliti, a um nastavlja da misli. Vi elite da spavate. Leite na svom
krevetu, okreui se as na jednu as na drugu stranu elite da se uspavate, a um nastavlja, um
govori: "Ne, ja u razmiljati o neemu." Vi stalno govorite "Stani" a on vas nikada ne slua. I
ne moete uiniti nita. Um je takoe jedno orue, ali ste mu dali previe moi. On je postao
diktator, i borie se jako ako pokuate da ga postavite na njegovo pravo mesto.
Buddha je takoe koristio um, ali je njegov um samo kao vae noge. Ljudi i dalje
dolaze kod mene i pitaju me: "ta se deava s umom prosvetljenog oveka? Da li on
jednostavno iezava? On ne moe da ga koristi?"
On iezava kao gospodar, a ostaje kao rob. On ostaje kao pasivno orue. Kada
Buddha eli da ga koristi, on moe da ga koristi. Kada Buddha govori vama on e morati da
ga koristi, jer ne postoji mogunost govora bez uma. Um treba da se koristi. Ako odete kod
Buddhe i on vas prepozna, da ste bili takoe ranije, on mora da koristi um. Bez uma ne moe
biti prepoznavanja; bez uma ne moe biti pamenja. Meutim zapamtite da on koristi um - a
vi ste korieni od uma, u tome je razlika. Kad god eli da ga koristi, on ga koristi. Kad god
ne eli da ga koristi, on ga ne koristi. On je pasivno orue; on se ne hvata za njega.
Dakle, Buddha ostaje kao ogledalo. Ako doete ispred ogledala, ogledalo vas
reflektuje. Kada se uklonite, odraavanje nestaje; ogledalo je prazno. Vi niste kao ogledalo.
Vidite nekoga, on ode, ali miljenje se nastavlja, refleksija se nastavlja. Vi nastavljate da
mislite o njemu. ak i ako biste eleli da prestanete, um ne bi posluao.
Gospodarenje nad umom je joga. A kada Patanjali kae "obustavljanje uma", ovim se
misli na prestajanje u svojstvu gospodara. Um prestaje da biva gospodar. Onda on nije
aktivan. Onda je on pasivno orue. Vi naredite, on radi; vi ne naredite, on ostaje smiren. On
samo eka. On ne moe da se dokazuje i gura napred sam od sebe. Njegovo nametljivo
dokazivanje se gubi; nasilje se gubi. On nee pokuavati da vas kontrolie.
11

U knjizi Newton Michael: "Putovanje dua" detaljno je opisano stanje due izmeu ivota i kako se due
raaju u novom telu. Do tih informacija autor je doao zahvaljujui hipnotikoj regresiji svojih pacijenata. Tu se
svedoi da dua ulazi u telo pri poroaju ili malo pre toga, ali ne boravi stalno u telu do starosti deteta do 6 ili 7
godina. Dotle esto izlazi dok spava ili na javi. Tek od toga doba dua stalno boravi u telu. Takoe je dokazano
da telo moe da deluje vrlo sloeno i bez uma, kao u somnabulnom stanju (mesearenju) ili u hipnozi. Tako se i
ovde moe razumeti da je duevni bolesnik onaj ovek, ili tanije, ono telo koje je dua napustila iz nekog
razloga, a telo je ostalo energizovano i delatno u izvesnoj meri. Prisustvo due daje svest i razumevanje. Bez nje
se ovek ponaa nerazumno i mehaniki, animalno, bez ikakve savesti. Takoe postoje "organski portali",
ljudska tela koja nemaju ljudsku duu ve su nastanjena drugim svesnim entitetima. O knjizi Putovanje dua
videti na http://www.ivantic.net/ostale_knjiige.htm
25

Sada je upravo obrnut sluaj. Kako da se postane gospodar? Kako da se stavi um na


njegovo mesto, gde moete da ga koristite; gde, ako ne elite da ga koristite, moete ga
ostaviti po strani i ostati smireni. Mora se razumeti ceo mehanizam uma. Sada bi trebalo ui u
sutru.
Prvo:
Modifikacija uma ima pet. One mogu biti ili izvor bola ili nepostojanja bola.
Prva stvar koju treba razumeti je da um nije neto razliito od tela, zapamtite. Um je
deo tela. On je telo, ali jako suptilno stanje tela, vrlo delikatno, vrlo profinjeno. Ne moete ga
uhvatiti, ali kroz telo moete uticati na njega. Ako uzmete drogu, ako uzmete LSD, marihuanu
ili neto drugo, ili alkohol, odjednom je um obuzet njihovim uticajem. Alkohol ulazi u telo, ne
u um, ali je um pod uticajem. Um je najsuptilniji deo tela.
Obrnuto je takoe istina. Dejstvom uma i telo biva pod njegovim uticajem. To se
deava u hipnozi. Osoba koja ne moe hodati, koja kae da ima paralizu, moe hodati pod
hipnozom. Vi nemate paralizu, ali ako vam se pod hipnozom kae: "Sada je vae telo
paralisano; vi ne moete hodati", neete moi da hodate. Paralizovan ovek moe hodati pod
hipnozom. ta se dogaa? Hipnoza dopire u um, sugestija odlazi u um. Onda telo to sledi.
Prva stvar koju treba razumeti: um i telo nisu dvoje. Ovo je jedno od najdubljih
Patanjalijevih otkria. Moderna nauka je to tek nedavno priznala na Zapadu. Sada oni kau:
telo-um, potpuno su srodni, podela nije ispravna. Dakle, oni kau to je psihosoma: to je umtelo. Ova dva izraza su samo dve funkcije jednog fenomena. Jedan pol je um, a drugi pol je
telo, stoga se to naziva psihosomatskom pojavom.
Telo ima pet organa aktivnosti - pet indriyani, pet orua aktivnosti. Um ima pet
modifikacija, pet naina delovanja. Um i telo su jedno. Telo je podeljeno u pet funkcija; um je
takoe podeljen u pet funkcija. Detaljno emo ui u svaku funkciju.
Drugi deo ove sutre je:
One mogu biti ili izvor bola ili nepostojanja bola.
Ovih pet modifikacija uma, ova celovitost uma, moe vas voditi u duboki bol, u
dukkhu, ili patnju. Ili ako ispravno koristite um, njegovo delovanje, moe vas odvesti do
nepostojanja bola ili patnje. Moe vas odvesti u potpuno osloboenje od patnje.
Re "nemanje patnje" je vrlo znaajna. Patanjali ne kae da e vas to voditi u
anandu, u blaenstvo, ne. Um moe da vas vodi u patnju ako ga nepravilno koristite, ako
postanete njegov rob. Ako postanete gospodar, um vas moe voditi do nemanja patnje - ne u
blaenstvo, jer blaenstvo je vaa priroda; um vas ne moe voditi do nje. Ali ako ste u
"nemanju patnje", unutranje blaenstvo zapoinje da tee.
Blaenstvo uvek postoji unutra, u vaoj sutinskoj unutranjoj prirodi. To nije neto
to treba da se ostvari ili zaradi; to nije neto to treba da se negde postigne. Vi ste roeni s
tim; ve to imate; to je ve sluaj. Zbog toga Patanjali ne kae da vas um moe voditi u
patnju, a moe vas voditi i u blaenstvo - ne! On je vrlo nauan, vrlo precizan. On nee
koristiti ak nijednu re koja moe dati vama bilo koju neistinitu informaciju. On jednostavno
kae, ili patnja ili nepostojanje patnje.
Buddha takoe kae mnogo puta, kad god tragaoci dou kod njega, a tragaju za
blaenstvom, tako da e pitati Buddhu: "Kako moemo dostii blaenstvo, krajnje
blaenstvo?" On e rei: "Ne znam. Mogu vam pokazati put koji vodi do nemanja patnje,
samo odsustvo patnje. Ja ne kaem nita o pozitivnom blaenstvu, samo negativnom. Mogu
vam pokazati kako da se kreete u svetu nemanja patnje."
To je sve to metode mogu uiniti. Jednom kada ste u stanju nemanja bede, unutranje
blaenstvo poinje da tee. Ali to ne dolazi iz uma, to dolazi iz vaeg unutranjeg bivstva,
Sopstva. Dakle um nema nita da ini s tim; um ne moe stvoriti to. Ako je um u patnji, onda
um postaje prepreka. Ako je um u nemanju patnje, onda um postaje jedan otvoren prolaz. Ali
on nije kreativan; on ne ini nita.
Vi otvorite prozore i sunevi zraci ulaze. Otvaranjem prozora vi ne stvarate sunce.
Sunce je ve bilo tu. Da ono nije bilo tu, onda samo otvaranjem prozora, zraci ne bi uli. Va
prozor moe biti prepreka - sunevi zraci mogu biti spolja a prozor je zatvoren. Prozor ih
26

moe spreiti ili im otvoriti put. On moe da postane prolaz, ali on ne moe biti kreativan. On
ne moe kreirati zrake; zraci su tu.
Va um, ako je u nevolji, postaje zatvoren. Zapatite, jedna od karakteristika patnje je
zatvorenost. Kad god ste u patnji, vi postajete zatvoreni. Obratite panju - kad god oseate
neku muku, vi ste zatvoreni za svet. ak i za vaeg najdraeg prijatelja vi ste zatvoreni. ak i
za svoju enu, vau decu, vaeg voljenog, vi ste zatvoreni kada ste u patnji, jer patnja vam
daje povlaenje unutra. Vi se povlaite. Sa svih strana vi ste zatvorili vrata.
Zbog toga u patnji ljudi zapoinju da misle na samoubistvo. Samoubistvo znai
totalno zatvaranje - nema mogunosti ni za kakvu komunikaciju, nema mogunosti ikakvih
vrata. ak i zatvorena vrata su opasna. Neko moe da ih otvori, tako da srui vrata, uniti sve
mogunosti. Samoubistvo znai: "Sada u unititi sve mogunosti nekog otvaranja. Tako u
biti zatvoren u sebe potpuno."
Kad god ste u nevolji vi zapoinjete da mislite o samoubistvu. Kad god ste sreni ne
moete misliti o samoubistvu; to ne moete zamisliti. Ne moete ak ni zamisliti: "Zato ljudi
izvravaju samoubistvo? ivot je takva radost, ivot je tako snana muzika, zato ljudi
unitavaju ivot." To izgleda nemogue.
Zato, kada ste sreni, to izgleda nemogue? Jer ste otvoreni; ivot tee u vama. Kada
ste sreni vi imate veu duu, proirenu. Kada ste nesreni vi imate manju duu, stegnutu.
Kada je neko nesrean, dodirnite ga, uzmite njegovu ruku u svoju ruku. Osetiete da je
njegova ruka mrtva. Nita ne tee kroz nju - nema ljubavi, nema topline. Ona je ba hladna,
kao da pripada leu. Kada je neko srean, dodirni njegovu ruku, postoji komunikacija,
energija tee. Njegova ruka nije samo mrtva ruka, njegova ruka je postala most. Kroz njegovu
ruku neto dolazi do vas, prenosi se, dovodi u vezu. Toplota klizi. On dosee do vas. On ini
svaki napor da se izlije u vas i dozvoljava vama takoe da se izlijete u njega.
Kada su dve osobe srene, one postaju jedno. Zbog toga u ljubavi jedinstvo se dogaa
i ljubavnici zapoinju da oseaju da oni nisu dvoje. Oni su dvoje, a poinju oseati da nisu
dvoje jer su u ljubavi tako sreni da se deava stapanje.
Oni se stapaju jedno u drugo; oni se ulivaju jedno u drugo. Granice se rastvaraju,
odrednice su nejasne, i oni ne znaju ko je ko. U tom momentu oni postaju jedno.
Kada ste sreni, vi se moete izliti u druge i moete dopustiti drugima da se izliju u
vas; to je ono to slavljenje znai. Kada dozvoljavate svakome da tee u vama, a vi se izlivate
u svakoga, vi slavite ivot. Slavljenje je najvea molitva, najvii vrhunac meditacije.
U patnji vi poinjete misliti da izvrite samoubistvo; u nevolji, poinjete da mislite o
destrukciji. U patnji, vi ste samo na suprotnom polu slavljenja. Vi osuujete. Ne moete
slaviti. Vi ste kivni na svakoga. Sve je pogreno i vi ste negativni, i ne moete se izliti, vi se
ne moete dovesti u vezu, i ne moete dozvoliti nikome da se izlije u vas. Vi ste postali ostrvo
- potpuno zatvoreni. Ovo je iva smrt. ivot je samo kada ste otvoreni i teete, onda ste
neuplaeni, neustraivi, otvoreni, osetljivi, slavite.
Patanjali kae da um moe initi dve stvari. On moe stvoriti patnju. Moete ga
koristiti na takav nain da moete postati jadni, i koristili ste ga. Nije potrebno mnogo
govoriti o tome; vi to ve znate. Vi znate umetnost kako da stvorite patnju, nevolju. Moda
niste svesni, ali to je ono ta vi inite, neprekidno. ta god da dodirnete postaje izvor patnje.
Kaem: bilo ta!
Vidim siromane ljude. Oni su u patnji, oevidno. Oni su siromani; osnovne potrebe
ivota nisu im ispunjene. A onda vidim bogate ljude, oni su takoe u patnji. A oni misle, ovi
bogati ljudi, da bogatstvo ne vodi nikuda. To nije ispravno. Bogatstvo moe voditi do slavlja,
ali vi nemate um da slavite. Tako ako ste siromani vi ste u patnji; ako postanete bogati vi ste
vie u patnji. Onog momenta kada dodirnete bogatstvo, vi ste ga unitili.
Jeste li uli grku priu o kralju Midasu? Sve to bi dodirnuo pretvorilo bi se u zlato.
Vi dotaknete zlato, odmah ono postane blato. Ono se pretvori u prainu, a onda vi mislite da
ne postoji nita u svetu, ak i bogatstvo je beskorisno. Ono nije beskorisno. Ali va um ne
moe slaviti, va um ne moe uestvovati ni u jednom nemanju patnje. Ako ste pozvani u raj,
tamo neete nai raj, stvoriete pakao. Gde god bili, ta god inili vi ete nositi svoj pakao sa
sobom.
27

Postoji arapska poslovica, da pakao i raj nisu geografska mesta, ona su gledita,
stanovita. Niko ne ulazi u pakao ili raj, svako ulazi sa rajem ili paklom. Gde god idete vi
imate svoju projekciju pakla ili projekciju, predstavu raja sa vama. Vi imate unutra projektor.
Odmah projektujete.
Meutim, Patanjali je paljiv. On kae: "Patnja ili nemanje patnje" - pozitivna patnja
ili negativna patnja - ali ne blaenstvo. Um vam ne moe dati blaenstvo; niko vam ga ne
moe dati. Ono je skriveno u vama, i kada je um u stanju nemanja patnje to blaenstvo
zapoinje da tee. Ono ne dolazi od uma, ono dolazi iza uma. Zbog toga on kae da stanja
uma mogu biti bilo izvor jada ili nemanja jada. Modifikacija uma ima pet.
Druga sutra:
One su ispravno znanje, pogreno znanje, imaginacija (mata), spavanje i pamenje.
(I, 6)
Prvo je pramana, ispravno znanje. Sanskritska re pramana je vrlo duboka i zaista ne
moe biti prevedena. Ispravno znanje je upravo senka, nije tano znaenje, jer ne postoji re
kojom moe da se prevede pramana. Pramana dolazi od korena prama. Mnoge stvari treba
shvatiti u vezi toga.
Patanjali kae da um ima sposobnost. Ako je ta sposobnost usmerena pravilno, onda
sve to se zna jeste istinito; to je samo-oevidno istinito. Mi nismo svesni o tome jer nikada to
nismo koristili. Ta sposobnost je ostala neiskoriena. To je kao Soba je mrana, vi uete
unutra, imate baklju, ali je ne koristite - tako da soba ostaje mrana. Stalno se spotiete na
stvarima, na stolu, na stolici, a imate baklju, ali baklja mora da se upali. Kada jednom upalite
baklju, odmah tama iezava. I gde god je baklja okrenuta vi znate. Barem to mesto postaje
oigledno i jasno.
Um ima sposobnost za pramanu, za ispravno znanje, za mudrost. Jednom kada znate
kako da ga upalite, onda gde god da usmerite to svetlo, samo pravo znanje se otkriva. Bez
takvog znanja, ta god da znate bie pogreno.
Um ima sposobnost za pogreno znanje, takoe. To pogreno znanje se naziva na
sanskritu viparyaya - lano, mithya. I vi imate tu sposobnost takoe. Uzmete alkohol. ta se
deava? Ceo svet postaje viparyaya; ceo svet postaje laan. Poinjete da vidite stvari koje ne
postoje.
ta se dogodilo? Alkohol ne moe stvoriti stvari. Alkohol ini neto unutar vaeg tela i
mozga. Alkohol zapoinje da deluje na centar koji Patanjali zove viparyaya. Um ima centar
koji moe izokrenuti sve. Jednom kada taj centar zapone da funkcionie, sve je izokrenuto.
Podsetio sam se na Jednom se dogodilo da su Mula Nasrudin i njegov prijatelj pili u
krmi. Izali su sasvim pijani, a Nasrudin je bio stari, iskusni pijanac. Drugi je bio nov, tako
da je bio vie obuzet pijanstvom. Pitao je: "Sada ne mogu videti, ne mogu uti, ne mogu ak
ni hodati valjano. Kako u stii do kue? Kai mi Nasrudine, molim te pokai mi put. Kako
mogu stii do moje kue?"
Nasrudin je rekao: "Prvo kreni. Posle mnogo koraka doi e do mesta gde postoje dva
puta: jedan ide desno, drugi ide levo. Ti idi na levo jer onaj koji vodi na desno ne postoji. Ja
sam bio mnogo puta na tom desnom takoe, ali sam sada iskusan ovek. Videe dve staze.
Odaberi levu, nemoj izabrati desnu stazu. Ta desna ne postoji. Mnogo puta sam iao njom, a
onda nikada da stigne, nikada ne stigne svojoj kui."
Jednom je Nasrudin uio svog sina prvoj lekciji iz pijanstva. Rekao mu je Sin je
pitao, on je bio radoznao. Pitao je: "Kada ovek treba da prestane?" Nasrudin je odgovorio:
"Pogledaj na onaj sto. etiri osobe sede tamo. Kada pone da vidi osam, prestani!" Mladi
je rekao: "Ali oe, tamo samo dve osobe sede!"
Um ima dar. Taj dar funkcionie kada ste pod bilo kojim uticajem droge, bilo kakvog
opojnog sredstva. Tu sposobnost Patanjali zove viparyaya, pogreno znanje, centar
izopaavanja.
Tano nasuprot njemu postoji centar koji ne znate. Tano naspram njega postoji
centar. Ako meditirate duboko, smireno, drugi centar e poeti da funkcionie. Taj centar se
naziva pramana, ispravno znanje. Kroz funkcionisanje tog centra, sve to znate jeste ispravno.
Nije pitanje ta znate, nego je pitanje odakle znate.
28

Zbog toga su sve religije bile protiv alkohola. To nije na nekoj moralnoj osnovi, ne!
To je zato to alkohol utie na centar izopaavanja. A svaka religija je za meditaciju, jer
meditacija znai stvaranje sve vie i vie smirenosti, vie i vie postajete tihi.
Alkohol uvek ini sasvim suprotno, ini vas sve vie i vie potresenim, uzbuenim,
smetenim. Drhtanje ulazi u vas. Pijanica ne moe ak ni hodati kako valja. Njegova ravnotea
je izgubljena. Ne samo u telu, ve je i u umu.
Meditacija znai sticanje unutarnje ravnotee. Kada steknete unutarnju ravnoteu i
nema drhtanja, celo telo i um postaju smireni, onda centar ispravnog znanja poinje da
funkcionie. Kroz taj centar sve to se saznaje jeste istinito.
Gde ste vi? Vi niste alkoholiari, niste meditanti, morate biti negde izmeu njih. Vi
niste ni u jednom centru. Vi ste izmeu ova dva centra, pogrenog znanja i ispravnog znanja.
Zbog toga ste zbunjeni.
Ponekad imate letimino sagledavanje. Naginjete malo prema centru ispravnog znanja,
onda odreena letimina sagledavanja vam dolaze. Naginjete se prema centru koji je
izopaavanje, onda izopaenost ulazi u vas. I sve je pomeano, vi ste u haosu. Zbog toga, ili
ete morati da postanete meditanti ili ete morati da postanete alkoholiari, jer pometnje je
previe. I to su ta dva puta.
Ako izgubite sebe u opijenosti, onda ste u spokojstvu. Barem ste zadobili centar moda onaj sa pogrenim znanjem, ali ste usrediteni. itav svet moe rei da niste u pravu.
Vi ne mislite tako, vi mislite da itav svet nije u pravu. Barem u tim momentima nesvesnosti
vi ste usrediteni, usrediteni u pogrenom centru. Ali vi ste sreni, jer ak i pogreno
usreditenje vam daje odreenu sreu. Vi uivate u tome, otuda tako velika privlanost
alkohola.
Vlade su se borile vekovima. Zakon je donesen, zabrana i sve, ali nita ne pomae.
Dok oveanstvo ne postane meditativno, nita ne moe pomoi. Ljudi e nastaviti, oni e
nai nove naine i nova sredstva da postanu opijeni. Ne mogu se spreiti, a to vie
pokuavate da ih spreite, s vie zakona zabrane, vie ih to privlai.
Amerika je uradila to i morala je da se povue. Pokuali najbolje to su mogli, ali kada
je alkohol bio zabranjen vie se koristio. Oni su pokuali; nisu uspeli. Indija je pokuavala
nakon sticanja nezavisnosti. Nije uspela, i mnoge drave su to pokrenule ponovo. To se ini
beskorisno.
Dok se ovek ne promeni u sebi, ne moete ga prisiliti ni na kakvu zabranu.
Nemogue je, jer e onda ovek poludeti. To je njegov nain da ostane normalan. Za nekoliko
sati on postane drogiran, "okamenjen", onda je u redu. Onda nema patnje; onda nema jada.
Patnja e doi, jad e doi, ali je to barem odloeno. Sutra ujutru patnja e biti tu, jad e biti tu
- on e morati da se suoi s tim. Meutim, do veeri se moe opet nadati - uzee pie i bie
spokojan.
Postoje dve alternative. Ako niste meditativni, pre ili kasnije moraete nai neku
drogu. Postoje suptilne droge. Alkohol nije suptilan, on je vrlo grub. Postoje suptilne droge.
Seks moe postati za vas droga. Kroz seks moete upravo gubiti svoju svesnost. Sve moete
koristiti kao drogu. Samo meditacija moe pomoi. Zato? Meditacija vam daje usreditenost
na centar koji Patanjali zove praman.
Zato svaka religija toliko istie meditaciju? Meditacija mora da ini neko unutranje
udo. Ovo je to udo: meditacija vam pomae da osvetlite ispravno znanje. Onda gde god se
kreete, na ta god da se usmerite, ta god da spoznate - jeste istinito.
Buddhi su postavljali hiljade i hiljade pitanja. Neko ga je pitao jednom kada su doli k
njemu s novim pitanjima: "Nismo ak ni postavili pitanje, a vi ste poeli da odgovarate.
Nikada ne razmiljate o tome. Kako se to deava?"
Na to je Buddha odgovorio: "To nije pitanje razmiljanja. Vi postavite pitanje i
jednostavno, ja posmatram to. I ta god je istina to se otkriva. To nije pitanje zamiljanja i
razmiljanja oko njega. Odgovor ne dolazi kao logini zakljuak. To je samo usredsreivanje
na pravi centar."
Buddha je kao baklja. Gde god se baklja pokrene, ona otkriva. Kakvo god da je
pitanje, to nije poenta. Buddha ima svetlost, kad god ta svetlost padne na neko pitanje,
29

odgovor e biti otkriven. Odgovor e doi iz te svetlosti. To je jednostavan fenomen,


otkrovenje.
Kada vas neko pita, treba da razmislite o tome. Ali kako moete razmiljati ako ne
znate? Ako znate, nije potrebno razmiljati. Ako ne znate, ta ete uraditi? Traiete u
pamenju, nai ete mnogo reenja. Samo ete nainiti krpe. Vi zapravo ne znate; inae
odgovor bi doao odmah.
Sluao sam o uiteljici, uiteljici iz osnovne kole. Pitala je decu: "Imate li neka
pitanja?" Jedan mali deak je ustao i rekao: "Ja imam jedno pitanje i ekao sam da li ete
pitati da postavimo pitanja. Koliko je teka cela zemlja?"
Bila je zateena i uznemirena, jer nikada nije mislila o tome, nikada nije itala o tome.
Koja je teina cele zemlje? Stoga je izvela trik koji uitelji znaju. Oni su morali da izvode
trikove. Rekla je: "Da, pitanje je znaajno. Dakle sutra, svako treba da nae odgovor."
Trebalo joj vreme. "Dakle, sutra u vam postaviti to pitanje. Ko god da pravilan odgovor
dobie poklon."
Sva deca su istraivala i istraivala, ali nisu mogla da nau odgovor. Uiteljica je
odjurila u biblioteku. Cele noi je istraivala, i upravo pred jutro nala je teinu zemlje. Bila je
vrlo srena. vratila se natrag u kolu, a deca su bila tu. Ona su bila iscrpljena. Rekli su da nisu
mogli otkriti. "Pitali smo majku i oca, svakoga smo pitali. Niko ne zna. Ovo pitanje izgleda
tako teko."
Uiteljica se smejala i rekla: "To nije teko. Ja znam odgovor, ali sam pokuala da
saznam da li vi to moete otkriti ili ne. Ovo je teina zemlje" Onaj mali deak koji je
postavio pitanje, ustao je i rekao: "Sa ljudima ili bez ljudi?" Dakle ista situacija.
Vi ne moete staviti Buddhu u takvu situaciju. Nije u pitanju nalaenje odgovora
negde; nije zaista pitanje da odgovorite. Vae pitanje je upravo jedno opravdanje. Kada
postavite pitanje, on jednostavno pokree svoju svetlost prema pitanju i ta god je otkriveno
jeste otkriveno. On vam daje odgovor; to je duboki odgovor njegovog istinskog centra praman.
Patanjali kae da postoje pet modifikacija uma. Ispravno znanje. Ako centar
ispravnog znanja zapone da funkcionie u vama, vi ete postati mudrac, svetac. Postaete
religiozni. Pre toga ne moete postati religiozni.
Zbog toga su Isus ili Muhamed izgledali ludi - jer oni se nisu raspravljali niti
dokazivali; nisu postavljali svoj sluaj logiki, oni su jednostavno tvrdili. Ako biste pitali
Isusa: "Jesi li ti zaista sin Boiji?" On e rei: "Da." A ako traite od njega, "Dokai to," on e
se smejati. On e rei: "Nema potrebe dokazivati. Ja znam. Takav je sluaj; to je samo
oevidno." Za nas to izgleda nelogino. Taj ovek izgleda da je neurotian, tvrdi neto bez
ikakvog dokaza.
Ako ovaj praman, ovaj centar prame, ovaj centar ispravnog znanja pone da
funkcionie, vi ete biti isti: tvrdiete, ali neete moi da dokaete. Kako moete dokazati?
Ako ste u ljubavi, kako moete dokazati da ste u ljubavi? Ne moete jednostavno dokazati.
Imate bol u svojoj nozi; kako moete dokazati da imate bol? Vi jednostavno tvrdite to: "Ja
imam bol." Vi znate negde unutra. To saznanje je dovoljno.
Ramakrinu su pitali: "Ima li Boga?" On je rekao: "Da." Pitali su ga: "Onda dokai
to." On je odgovorio: "Nije potrebno. Ja znam. Za mene, nije potrebno. Za tebe postoji
potreba, stoga ti trai dokaz. Niko ne moe to dokazati meni, a ja ne mogu to dokazati tebi. Ja
sam morao da traim; morao sam da naem. I ja sam naao. Boga ima!"
Tako funkcionie ispravni centar. Zato Ramakrina ili Isus izgledaju apsurdno. Oni
tvrde odreene stvari bez davanja ikakvih dokaza. Oni ne prigovaraju, ne polau pravo ni na
ta. Odreene stvari su im otkrivene jer imaju delovanje novog centra koji vi nemate. Zato to
ga nemate vi morate imati dokaz.
Zapamtite, dokazivanje dokazuje da vi nemate unutranje oseanje niega - sve mora
da bude dokazano, ak i ljubav mora biti dokazana. A ljudi to stalno rade. Ja znam mnogo
parova. Mu stalno dokazuje da voli, a nije ubedio enu u to; i ena stalno dokazuje da ga ona
voli, a da nije ubedila supruga. Oni ostaju neubeeni a to ostaje kao konflikt. Stalno oseaju
da drugi nije dokazao.
30

Ljubavnici stalno tragaju. Oni kreiraju situacije u kojima morate dokazati da volite. I
postepeno oboje ponu da se dosauju od ovog besplodnog napora da dokau, a nita se ne
moe dokazati. Kako moete dokazati ljubav? Moete dati poklone, ali nita se time ne
dokazuje. Moete ljubiti, grliti i pevati, moete plesati, ali nita se ne dokazuje. Moda se
samo pretvarate.
Prva modifikacija uma je ispravno znanje. Meditacija vodi do ove modifikacije. A
kada moete ispravno znati i ne postoji potreba za dokazom, tada sam um moe biti obaen,
ne pre toga. Kada nije potrebno dokazivati, um nije potreban, jer um je orue logike.
Potreban vam je svakog momenta. Treba vam da razmislite, otkrijte ta je pogreno a
ta je ispravno. Svakog trenutka postoji izbor i alternativa. Vi imate izbor. Samo kada praman
deluje, kada ispravno znanje deluje, moete odbaciti um, jer sada biranje nema znaaj. Vi se
kreete bez izbora. Sve to je ispravno otkriva vam se.
Definicija mudraca je onaj koji nikada ne bira. On nikada ne bira dobro protiv loeg.
On se jednostavno kree u pravcu onoga to je dobro. On je kao suncokret. Kada je sunce na
istoku, cvet se okree prema istoku. Nikada ne bira. Kada se sunce kree prema zapadu, cvet
se okree na zapad. On se jednostavno kree sa suncem. On ne bira kretanje, on ne odluuje.
Ne donosi odluku: "Sada u se kretati jer se sunce kree prema zapadu."
Mudrac je ba kao suncokret. Gde god je dobro, on se kree jednostavno. Dakle, ta
god da on uini jeste dobro. Upaniade kau: "Ne sudi o mudracu. Vaa obina merila nee
delovati." Vi morate da inite dobro protiv zla, on nema nita da bira. On se jednostavno
kree, gde god je dobro. Vi ga ne moete promeniti jer to nije pitanje izbora. Ako kaete: "To
je zlo", on e rei: "U redu, to je moda loe, ali tako se ja kreem, na taj nain se moje bie
kree."
Oni koji znaju - a ljudi u danima Upaniada su znali - oni su odluili tako: "Mi
neemo suditi o mudracima." Jednom kada je osoba postala usreditena u sebi, kada je osoba
postigla meditaciju, jednom kada je osoba postala smirena i um je odbaen, ona je izvan nae
moralnosti, izvan tradicije. Ona je izvan naih ogranienja. Ako moemo slediti, moemo
slediti njega, a ako ne moemo slediti, mi smo bespomoni. Inae nita se ne moe uiniti, i
ne treba da sudimo.
Ako ispravno znanje funkcionie, ako je va um preuzeo modifikaciju ispravnog
znanja, vi ete postati religiozni. Pogledajte, to je potpuno razliito. Patanjali ne kae ako
idete u damiju, u gurudvar, u hram, izvodite neke rituale, molite se Ne, to nije religija.
Morate uiniti da proradi va centar ispravnog znanja. Tada bilo da idete u hram ili ne, to je
beznaajno; to nije vano. Ako va centar ispravnog znanja deluje, ta god da inite je
molitva, i gde god idete - jeste hram.
Kabir je rekao: "Gde god krenem ja nalazim tebe, Boe moj. Gde god se kreem ja se
kreem u tebi, naiem na tebe. ta god da inim, samo hodajui, jedui, to je molitva." Kabir
kae: "Spontanost je moj samadhi. Samo da budem spontan moja je meditacija."
Druga modifikacija uma je pogreno znanje. Ako deluje va centar pogrenog znanja,
onda sve to inite bie pogreno, i ta god odaberete bie pogreno odabrano. ta god
odluite bie pogreno jer vi ne odluujete, to pogrean centar deluje.
Postoje ljudi koji se oseaju vrlo nesreni, jer sve to ine ispadne pogreno. Oni
pokuavaju da opet ne ine pogreno, ali to ne pomae jer centar mora da bude promenjen.
Njihovi umovi funkcioniu na pogrean nain. Oni moda misle da ine dobro, ali uinie zlo.
Sve njihove dobre elje ne mogu pomoi; oni su bespomoni.
Mula Nasrudin je obino poseivao jednog sveca. Poseivao ga je za mnogo, mnogo
dana. Svetac je bio utljiv, nije govorio nita. Onda je Mula Nasrudin morao da kae:
"Dolazio sam mnogo puta, oekujui da ete neto rei, a vi niste rekli nita. Dok ne kaete, ja
ne mogu razumeti, stoga dajte mi poruku za moj ivot, pravac tako da se mogu kretati u tom
smeru."
31

Na to je taj sufi mudrac rekao: "Neki kar kuyen may dal; ini dobro i baci to u bunar."
To je jedna od najstarijih sufi izreka; "ini dobro i baci to u bunar." To znai ini dobro i
odmah to zaboravi; ne nosi to kao "Ja sam uinio dobro."
Onda je sledeeg dana Mula Nasrudin pomogao jednoj staroj eni da pree ulicu, a
onda je gurnuo u bunar.
"Neki kar kuyen may dal; ini dobro i baci to u bunar."
Ako funkcionie va pogrean centar, sve to uinite Moete itati Kuran, moete
itati Gitu, i nai ete znaenja - Krina e biti okiran, Muhamed e biti okiran da vidi da
moete nai takva znaenja.
Mahatma Gandi je napisao autobiografiju s namerom da ona pomogne ljudima. Onda
je primio mnoga pisma jer je opisao svoj seksualni ivot. Bio je iskren, jedan od najiskrenijih
ljudi, stoga je napisao sve - sve to se dogodilo u njegovoj prolosti - kako se previe
preputao onog dana kada mu je otac umirao; nije mogao da sedi pokraj njega. ak i tog dana
je otiao sa svojom enom u krevet.
Doktor je rekao: "Ovo je zadnja no. Va otac ne moe preiveti jutro. Umree do
jutra." Ba oko dvanaest, jedan, te noi, poeo je da osea elju, seksualnu elju. Otac je
spavao, pa je on otiao kod svoje ene, prepustio se seksu. A ena je bila trudna. U devetom
mesecu. Otac je umirao, a dete je takoe umrlo onog momenta kada se rodilo. Otac je umro te
noi, tako da se celog ivota Gandi duboko kajao to nije mogao biti sa svojim umiruim
ocem. Seks je bio opsesivan.
Dakle, on je napisao sve, bio je iskren i poten da bi pomogao drugima. Ali mnoga
pisma su poela da mu dolaze, i bila su takva da su ga okirala. Mnogi ljudi su mu pisali:
"Vaa autobiografija je takva da smo postali seksualniji nego to smo bili pre. Samo itajui
vau autobiografiju mi smo postali seksualniji i podatni. Ona je erotska."
Ako pogrean centar funkcionie, onda nita ne moe da se uradi. ta god da inite,
itate, kako god da se ponaate, bie pogreno. Kretaete se prema pogrenom. Imate centar
koji vas prisiljava da se kreete prema pogrenom. Moete otii kod Buddhe, ali neto
pogreno ete videti u njemu. Odmah! Vi se ne moete sastati s Buddhom, neto pogreno
ete videti odmah. Imate usredsreenost na pogreno, imate dubok podsticaj da naete svuda
pogreno, svuda.
Ovu modifikaciju Patanjali zove viparyaya. Viparyaya znai izopaenost. Izokreete
sve. Interpretirate sve na takav nain da to postane izopaenost.
Omar Khayam pie: "uo sam da je Bog milostiv." To je lepo. Muslimani stalno
ponavljaju, "Bog je rehman, samislost; rahim, saoseanje." Oni to stalno ponavljaju,
neprekidno. Stoga Omar Khayam kae: "Ako je on zaista milostiv, ako je zaista saoseajan,
onda nije nuno da se bude uplaen. Ja mogu nastaviti da inim greh. Ako je on milostiv,
onda emu strah? Mogu uiniti sve to elim i on je milostiv - dakle, kad god stanem ispred
njega, rei u, rahim, rehman; Bog je milostiv, greio sam, ali ti si milostiv. Ako si ti zaista
milostiv, onda imaj saoseanja za mene." Tako je on nastavio da pije, nastavio je da ini sve
to je mislio da je greh. On je interpretirao to na vrlo izopaen nain.
Svuda u svetu su ljudi to inili. U Indiji mi kaemo: "Ako ode Ganeu, ako se kupa
u Gangu, tvoji gresi se rastvaraju." To je sam po sebi lep koncept. To pokazuje mnoge stvari.
To pokazuje da greh nije neto mnogo duboko, on je samo kao praina na vama. Stoga ne
budite previe opsednuti s njim; ne oseajte se krivim, on je samo kao praina, a vi ostajete
unutra isti. ak i kupanje u Gangu moe pomoi.
Ovako se kae samo zato da ne postanete mnogo opsednuti sa grehom, kao to su
hriani postali. Krivica je postala samo toliko tegobna, da e ak i kupanje u Gangu pomoi.
Nemojte se toliko bojati. Ali sada smo mi interpretirali to. Mi kaemo: "Onda je u redu
nastaviti da ini greh." Uskoro kada osetite kako ste ih poinili dovoljno, dajete priliku
Gangu da vas proisti; onda se vratite natrag i inite ih opet. Ovo je centar izopaenosti.
Tree je imaginacija. Um ima sposobnost da mata. To je dobro, to je lepo. Sve to je
lepo dolo je kroz matu. Slike, umetnost, ples, muzika, sve to je lepo dolo je kroz
32

imaginaciju. Ali, i sve to je runo takoe je dolo kroz matu. Hitler, Mao, Musolini, svi su
oni doli kroz matu.
Hitler je matao o svetu natoveka. Verovao je u Fridriha Niea koji je rekao: "Uniti
sve one koji su slabi. Uniti sve one koji nisu super. Ostavi samo natoveka na zemlji."12
Tako da ih je on unitio. Upravo mata, ba utopijska mata - da unitavanjem slabih,
unitavanjem runih, samo unitavanjem fiziki obogaljenih imaete lep svet. Ali samo
unitavanje je najrunija mogua stvar u svetu - pravo unitenje.
Inae on je delovao kroz matu. On je imao matu, utopijsku imaginaciju - bio je
najmatovitiji ovek! Hitler je jedan od najmatovitijih. Njegova mata je postala tako
fantastina i tako luda, da je za njegov zamiljeni svet pokuao potpuno da uniti ovaj svet.
Njegova mata je poludela.
Imaginacija vam moe dati poeziju, slikanje i umetnost, ali imaginacija vam takoe
moe dati ludilo. Zavisi kako je koristite. Sva velika nauna otkria dola su kroz imaginaciju
ljudi koji su mogli matati, koji su mogli zamisliti nemogue, kako moemo leteti u vazduhu,
kako moemo otii na Mesec.
Ovo su nedokuiva matanja. ovek je matao vekovima, milenijumima, kako da leti,
kako da ode na Mesec. Svako dete je roeno s eljom da ode na Mesec, da dohvati Mesec. Ali
mi smo dosegli. Kroz imaginaciju kreativnost dolazi, ali kroz imaginaciju i unitenje dolazi.
Patanjali kae da je mata trei oblik uma. Moete ga koristiti na pogrean nain, i
onda e vas on unititi. Moete ga koristiti na ispravan nain, i onda su to imaginativne
meditacije. One zapoinju sa matom, ali ubrzo imaginacija postaje suptilnija i suptilnija.
Onda se imaginacija na kraju odbacuje, i vi ste licem u lice sa istinom.
Sve hrianske i muslimanske meditacije su zasnovane na imaginaciji. Prvo morate
zamiljati neto. I kada stalno neto zamiljate, onda kroz imaginaciju stvarate atmosferu oko
sebe. Probajte to, ta je sve mogue kroz imaginaciju. Mogue je ak i nemogue.
Ako mislite da ste lepi, ako zamiljate da ste lepi, odreena lepota e poeti da se
deava u vaem telu. Stoga kad god ovek kae eni "Ti si lepa", ena se odmah promeni.
Ona moda nije bila lepa. Upravo pre tog trenutka ona moda nije bila lepa - samo domaica,
jednostavna. Ali ovaj ovek joj je dao matu.
Zato svaka ena koja je voljena postaje lepa, svaki ovek koji je voljen postaje lepi.
Osoba koja nije voljena - moe biti lepa - postaje runa jer ona ne moe zamiljati, ne moe
matati. Ako imaginacija nije prisutna, vi se steete.
Emil Kue, jedan od psihologa sa Zapada, pomogao je milionima ljudi da samo kroz
matu budu izleeni od mnogih, mnogih bolesti. Njegova formula je bila vrlo jednostavna. On
bi rekao: "Samo zaponite da oseate da ste u redu. Upravo nastavite da ponavljate unutar
uma, meni postaje bolje i bolje. Svakog dana sam bolje." Nou dok spavate nastavite da
mislite da ste zdravi, postajete zdraviji svakog momenta, i do jutra ete biti najzdravija osoba
u svetu. Nastavite da zamiljate."
On je pomogao milionima ljudi. ak i neizleive bolesti su bile izleene. To je
izgledalo kao udo; a to nije nita. To je samo osnovni zakon: va um sledi imaginaciju. Sada
psiholozi kau da ako kaete deci "Vi ste glupi, glupaci" ona postaju glupa. Vi ih prisiljavate
da budu glupi. Vi im dajete imaginaciju, sugestiju da oni jesu glupi.
Sprovedeni su mnogi eksperimenti. Kaite detetu: "Ti si glup. Ne moe uraditi nita;
ne moe reiti ovaj matematiki problem." Zadajte mu problem i kaite mu: "Sada probaj",
ono nee moi da ga rei. Vi ste zatvorili vrata. Kaite detetu: "Ti si inteligentan, nisam video
nijednog inteligentnog deaka kao to si ti; za tvoj uzrast, za tvoje godine ti si natproseno
inteligentan. Pokazuje mnogo potencijala; moe reiti svaki problem; sada pokuaj ovo", i
on e biti sposoban da rei to. Vi ste mu dali imaginaciju.
Sada ima naunih dokaza, novih naunih otkria, da ta god imaginacija uhvati, to
postaje seme. Cela generacija se menja, itavo doba, cele zemlje su se menjale, upravo kroz
imaginaciju.

12

Ovo Nie nije rekao niti je Hitler sledio Niea. Mala Osho-va zabluda.
33

Idite u Pendab. Jednom sam putovao iz Delhija u Manali. Moj voza je bio sikh,
sardar. Put je bio opasan, a kola su bila vrlo velika. Voza se mnogo puta preplaio. Mnogo
puta bi rekao: "Sada ne mogu ii dalje. Moraemo se vratiti natrag." Pokuali smo na svaki
nain da ga nagovorimo. Na jednom mestu se toliko uplaio da je zaustavio kola, izaao iz
kola i rekao: "Ne, odavde se ne mogu pomeriti. Opasno je "To moda nije opasno za vas; vi
ste moda spremni da umrete. Ali ja nisam i elim da se vratim natrag."
Sluajno jedan od mojih prijatelja koji je takoe bio sardar i veliki policijski
slubenik, takoe je putovao, sledei mene, da poseti kamp u Manaliu. Prispela su njegova
kola, pa sam mu rekao: "Uini neto! ovek je izaao iz kola." Taj policijski zvaninik je
doao i rekao: "Ti kao sardar, i sikh - kako moe biti kukavica? Ulazi u kola." ovek je
odmah uao u kola i krenuo. Pitao sam ga: "U emu je stvar?" Rekao je: "Sada je on dotakao
moj ego. Rekao je, ti si sardar?" Sardar znai voa ljudi. "Jedan sikh? A kukavica? On je
dodirnuo moju imaginaciju. Dirnuo je u moj ponos. Sada moemo krenuti. Mrtvi ili ivi, ali
emo stii u Manali."
A ovo se nije desilo jednom oveku. Ako odete u Pendab, videete da se to dogaa
milionima. Pogledajte hinduse iz Pendaba i sikhe iz Pendaba. Njihova krv je ista; oni
pripadaju istoj rasi. Pre pet stotina godina svi su bili hindusi. A onda je nastao razliit tip rase,
vojnika rasa je bila roena. Samo putanjem brade, promenom vaeg lica, vi ne moete
postati hrabri. Ali moete! Imaginacijom.
Guru Nanak je dao tu imaginaciju: "Vi ste drugaiji tip rase. Vi ste nepobedivi."
Jednom kada su poverovali, jednom kada je ta zamisao poela da deluje, u Pendabu, tokom
pet stotina godina, nova rasa, potpuno razliita od Pendabskih hindusa je nastala. Nita nije
drugaije. Ali u Indiji, niko nije hrabriji od njih. Ova dva svetska rata su dokazala da se na
celoj zemlji niko ne moe uporediti sa sikhima. Oni se mogu boriti neustraivo.
ta se dogodilo? Sama njihova mata je stvorila atmosferu oko njih. Oni oseaju da
time to su sikhi su razliiti. Mata radi. Moe od vas da naini hrabrog oveka, moe da
naini i kukavicu.
uo sam da je Mula Nasrudin sedeo u krmi pijui. On nije bio hrabar ovek, jedan je
od najveih kukavica. Ali alkohol mu je dao hrabrost. A onda je ovek, div od oveka, uao u
krmu, izgledao je divlje, opasno, kao ubica. U svako drugo vreme, po svojoj prirodi, Mula
Nasrudin bi se uplaio. Ali sada je bio pijan, tako da ga nije uopte nije bilo strah.
Taj ovek divljeg izgleda je priao Muli, i videvi da se on uopte ne plai, nagazio je
njegova stopala. Mula se naljutio, pobesneo, i rekao: "ta to radite? inite li ovo sa nekom
namerom ili je samo neka vrsta ale?" Ali tada, ustavii, Mula se povratio od alkohola.
Otreznio se, vratio se svojoj pameti. Ali ve je rekao: "ta to radite? inite li ovo sa nekom
namerom ili je samo neka vrsta ale?"
Ludi ovek je rekao: "Sa namerom." Mula Nasrudin je rekao: "Onda hvala vam, to je
u redu, jer ja ne volim ovakvu vrstu ala."
Patanjali kae: imaginacija je trea sposobnost. Vi stalno zamiljate. Ako pogreno
zamiljate, moete kreirati obmanu oko sebe, iluzije, snove - moete biti izgubljeni u njma.
LSD i druge droge pomau rad na ovom centru. Dakle, koju god unutra mogunost imate, va
LSD trip e vam pomoi da razvijete to. Dakle, nita nije sigurno. Ako imate srene
imaginacije, trip sa drogom e biti sreno poigravanje, uzvieno. Ako imate jadne
imaginacije, none more, trip e biti lo.
Zbog toga mnogi ljudi izvetavaju kontradiktorno. Haksli kae da to moe postati
klju za vrata raja, a Rajner kae da je to najvei pakao. To zavisi od vas; LSD ne moe
uraditi nita. On jednostavno skoi na va centar imaginacije i tamo poinje da deluje
hemijski. Ako imate imaginaciju tipa komara, onda ete razviti to i proi ete kroz pakao. A
ako ste skloni lepim snovima, moete dostii raj.
Mata moe da funkcionie bilo kao pakao ili kao raj. Vi moete koristiti to da
potpuno poludite. ta se dogodilo ludacima u ludnicama? Oni su koristili svoju matu, a
koristili su je na takav nain da su obuzeti njome. Ludak moe da sedi sam i da govori
34

nekome na glas. Ne samo da govori, on odgovara takoe. On pita, on odgovara, on govori i za


drugog koji je odsutan. Moete misliti da je on lud, ali on govori stvarnoj osobi. U njegovoj
mati osoba je stvarna, a on ne moe prosuditi ta je mata a ta je istinito.
Deca to ne mogu prosuditi. Toliko puta deca mogu izgubiti svoju igraku u snu, a
onda e ujutru plakati, "Gde je moja igraka?" Ona ne mogu suditi da san je san, a realnost je
realnost. Da nisu izgubila nita, samo su sanjala. Granice su zamagljene. Ona ne znaju gde se
san zavrava, a gde realnost poinje.
Lud ovek je takoe smuen. On ne zna ta je realno, ta je nerealno. Ako se mata
koristi ispravno, onda ete znati da je to mata i ostaete svesni da je to mata. Moete uivati
u tome, ali to nije realno.
Dakle, kada ljudi meditiraju mnogo stvari se deava kroz njihovu imaginaciju.
Zapoinju da vide svetla, boje, vizije, razgovaraju sa samim Bogom, ili se sreu sa Isusom, ili
pleu sa Krinom. Ovo su matovite stvari, a meditant treba da zapamti da su to funkcije
mate. Moete uivati u tome; nita nije pogreno u njima - one su zabava. Nemojte misliti da
su one stvarne.
Zapamtite, samo je svedoea svest stvarna; nita drugo nije stvarno. ta god da se
dogodi moe biti lepo, vredno uivanja - uivajte u tome. Lepo je plesati sa Krinom, nita
nije pogreno u tome. Plei! Ali neprekidno se seajte da je to mata, divan san. Ne budite
izgubljeni u tome. Ako ste izgubljeni, onda je mata postala opasna. Mnogi religiozni ljudi su
to samo u mati. Oni se kreu u mati i troe svoje ivote.
etvrto je spavanje u dubokom snu. Spavanje znai nesvesnost u odnosu na spoljanje
kretanje svesti. Ona je otila duboko u sebe. Aktivnost se zaustavila; svesna aktivnost se
zaustavila. Um ne funkcionie. Dubok san bez snova je nefunkcionisanje uma. Ako sanjate,
onda to nije dubok san. Dok sanjate vi ste upravo u sredini, izmeu budnosti na javi i
dubokog sna bez snova. Ostavili ste budnost, a jo niste uli u dubok san. Vi ste upravo u
sredini.
Dubok san oznaava potpuno besadrajno stanje, nema aktivnosti, nema kretanja u
umu. Um je potpuno apsorbovan, oputen. Dubok san je lep; on daje ivot. Moete ga
koristiti. I ako znate da ga koristite, moe postati samadhi. Jer samadhi i dubok san nisu
mnogo razliiti. Samo jedna razlika postoji, a to je da ete u samadhiju biti budni. Sve drugo
e biti isto.
U dubokom snu sve je isto, samo onda vi niste budni. Vi ste u istom blaenstvu u koje
je Buddha uao, u kome je Ramakrina iveo, u kome je Isus nainio svoj dom. U dubokom
snu vi ste u istom blaenom stanju, ali niste budni. Ujutru ete oseati da je no bila dobra,
ujutru ete se oseati osveeni, vitalni, podmlaeni, ujutru ete oseati da je no bila lepa - ali
to je samo jedan odsjaj. Vi ne znate ta se dogodilo, ta se stvarno dogodilo. Niste bili budni.
Dubok san moe biti korien na dva naina. Samo kao prirodan odmor - vi ste ak i
to izgubili. Ljudi stvarno ne odlaze na spavanje. Oni neprekidno nastavljaju da sanjaju.
Ponekad, za nekoliko sekundi, oni dodirnu dubok san, i opet ponu da sanjaju. Tiina
dubokog sna, blaena muzika spavanja, postala je nepoznata. Vi ste je unitili. ak i prirodno
spavanje je uniteno. Vi ste tako uznemireni i uzbueni da um ne moe pasti potpuno u
zaborav.
Inae Patanjali kae da je prirodno spavanje dobro za telesno zdravlje, a ako moete
postati budni u dubokom snu to moe postati samadhi, to moe postati duhovna pojava. Stoga
postoje tehnike - docnije emo raspravljati o njima - kako spavanje moe postati budno. Gita
kae da jogin ne spava ak ni u dubokom snu. On ostaje budan. Neto unutra nastavlja da biva
svesno. Celo telo je zaspalo, um zapada u spavanje, ali svedoenje ostaje. Neko posmatra uvar na kuli ostaje. Onda spavanje postaje samadhi. To postaje krajnja ekstaza.
I poslednje je pamenje. Pamenje je peta modifikacija uma. To takoe moe biti
korieno i zloupotrebljeno. Ako je pamenje zloupotrebljeno, ono kreira zabunu. Zaista,
moete se seati neega, ali ne moete biti sigurni da li se to dogodilo na taj nain ili nije.
Vae pamenje nije pouzdano. Moete dodati mnoge stvari u njega; mata moe ui u njega.
35

Moete izbrisati mnoge stvari iz njega, moete uraditi mnoge stvari za njega. A kada kaete:
"Ovo je moje pamenje", to je vrlo profinjena i izmenjena stvar. To nije realno.
Svako kae: "Moje detinjstvo je bilo kao u raju", a pogledajte decu. Ova deca e
takoe rei kasnije da je njihovo detinjstvo bilo raj, a ona pate. I svako dete arko eli da
poraste uskoro, da postane odraslo. Svako dete misli da odrasli uivaju, sve to je vredno
uivanja oni uivaju. Oni su snani; oni mogu initi sve, a ono je bespomono. Deca misle da
pate, ali ona e odrasti kao to ste vi porasli, a onda e docnije rei da je detinjstvo bilo
najlepe, kao raj.
Vae pamenje nije pouzdano. Vi zamiljate, upravo kreirate svoju prolost. I niste
istiniti prema njoj. Odbacujete mnoge stvari iz nje - sve to je runo, sve to je tuno, sve to
je bilo bolno vi odbacujete; sve to je bilo lepo vi zadravate. Sve to je bilo podrka vaem
egu vi pamtite, a sve to nije bilo podrka vi odbacujete, zaboravljate to.
Tako svako ima veliko skladite odbaenih seanja. I ta god da kaete o njima nije
istina, vi se ne moete istinski seati. Svi vai centri su pobrkani, oni ulaze jedan u drugi i
ometaju se meusobno.
Ispravno pamenje. Buddha je koristio rei ispravno pamenje za meditaciju.
Patanjali kae da ako je pamenje ispravno, to znai da je ovek totalno iskren prema sebi.
Onda, samo onda, moe pamenje biti ispravno. ta god da se dogodilo, loe ili dobro, ne
menjajte to. Znajte to kakvo jeste. To je vrlo teko! To je naporno! Vi birate i menjate. Znanje
svoje prolosti kakva jeste promenie ceo va ivot. Ako ispravno znate svoju prolost kakva
jeste, neete eleti da je ponavljate u budunosti. Upravo sada svako razmilja kako da ponovi
to u modifikovanom obliku, ali ako znate svoju prolost tano kakva jeste bila, neete eleti
da je ponovite.
Ispravno pamenje e vam dati podsticaj kako da budete slobodni od svih ivota. Ako
je pamenje ispravno, onda moete ii ak i u prole ivote. Ako ste iskreni, onda moete ii u
prole ivote. Onda imate samo jednu elju: kako da transcendirate sve te besmislice. Inae vi
mislite da je prolost lepa, i mislite da e budunost biti lepa, samo ova sadanjost je
pogrena. Ali ta prolost je bila prisutna pre nekoliko dana, a budunost e postati prisutna
nekoliko dana posle. I u svako vreme svaka sadanjost je pogrena, a sva prolost je lepa i sva
budunost je lepa. Ovo je pogreno pamenje. Gledajte direktno. Ne menjate. Gledajte u
prolost kakva je bila. Ali mi smo nepoteni.
Svaki ovek mrzi svog oca, ali ako nekoga pitate rei e: "Ja volim mog oca. Potujem
svog oca." Svaka ena mrzi svoju majku, ali pitajte i svaka ena e rei: "Moja majka, ona je
boanstvena." Ovo je pogreno pamenje.
Gibran ima priu. On kae, jedne noi jedna majka i erka su bile probuene usled
strane buke. Obe su bile meseari, a u vreme kada se dogodila iznenadna buka u susedstvu
one su obe hodale u bati, u snu. Bile su meseari.
Mora da je to bio ok, jer u snu je stara dama, majka, rekla erki: "Zbog tebe, kurvo,
zbog tebe, moja mladost je izgubljena. Ti si me unitila. I svako ko doe u kuu gleda tebe.
Niko ne gleda u mene." Velika je ljubomora koja dolazi svakoj majci kada erka postane
mlada i lepa. To se dogaa svakoj majci, ali to je unutra.
A erka je rekla: "Ti matora gaduro Zbog tebe ne mogu da uivam u ivotu. Ti si
prepreka. Svuda si ti prepreka, smetnja. Ne mogu da volim; ne mogu da uivam."
Iznenada usled buke, obe su se probudile. I stara ena je rekla: "Dete moje, ta radi
ovde? Moe da nazebe. Doi unutra." A erka je rekla: "A ta ti radi ovde? Nisi se oseala
dobro, a no je hladna. Doi, majko. Doi u krevet."
Prva stvar koja se dogodila dolazila je od nesvesnog. Sada se obe pretvaraju; probudile
su se. Nesvesno je otilo natrag, svesno je nastupilo. Sada su one licemeri. Vaa svesnost je
licemerna.
Da bi bio istinski iskren sa svojim vlastitim pamenjima ovek e morati zaista da
proe kroz veliki napor. A vi morate biti istiniti, o svemu. Morate biti ogoljeno istiniti, morate
znati ta zaista mislite o svom ocu, o svojoj majci, o svom bratu, o svojoj sestri - zaista. A ono
36

to imate u prolosti, ne meajte, ne menjajte, ne ulepavajte; pustite to da bude kakvo jeste.


Ako se to dogodi, onda, Patanjali kae, to e biti sloboda. Vi ete odbaciti to. Cela stvar je
besmislena, i vi neete eleti da projektujete to opet u budunosti. 13
Onda neete biti licemer. Biete realni, istiniti, iskreni - postaete autentini. A kada
postanete autentini, vi ete postati kao stena. Nita ne moe da vas promeni; nita ne moe
da vam stvori zabunu.
Postaete kao ma. Uvek ete sei sve to je pogreno; moete odeliti sve to je
ispravno od pogrenog. Onda se postie jasnoa uma. Ta jasnoa moe vas voditi prema
meditaciji; ta jasnoa moe da postane osnovni temelj za rast - za rast s one strane.

Poglavlje 4
S ONE STRANE UMA, PREMA SVESTI
28. decembar 1873.
Prvo pitanje:
Vi ste rekli da za ljude postoje samo dve alternative, ili ludilo ili meditacija, meutim
milioni ljudi na zemlji nisu dostigli ni jedno od ta dva. Da li mislite da hoe?
Oni su dostigli! Nisu dosegli do meditacije, ali su stigli do ludosti! Razlika izmeu
ludaka koji su u ludnici i ludaka koji su izvan je samo u stepenima. Nema kvalitativne razlike,
razlika je samo u kvantitetu. Vi moete biti manje ludi, oni mogu biti vie ludi, ali ovek
kakav jeste, je lud.
Zato ja nazivam oveka, kakav jeste, ludim? Ludost znai mnogo stvari. Jedna, vi
niste usrediteni. Ako niste usrediteni vi ste umobolni. Neusrediteni, mnogi su glasovi u
vama - vi ste mnogi, vi ste mnotvo. Niko nije gospodar u kui, a svaki sluga iz kue tvrdi da
je gospodar. Postoji konfuzija, konflikt, i neprekidna borba. Vi ste u neprekidnom
graanskom ratu. Ako se graanski rat ne odvija, onda ete biti u meditaciji. To se nastavlja
danju i nou, dvadeset etiri sata. Zabeleite sve to prolazi u vaem umu za nekoliko minuta,
i budite iskreni. Zapiite tano sve to se odvija, i sami ete osetiti da je to ludilo.
Ja imam posebnu tehniku koju koristim s mnogo osoba. Traim od njih da sede u
zatvorenoj sobi i da zaponu govoriti glasno, sve to im doe u um. Izgovarajte glasno svoje
misli tako da ih moete uti. Samo petnaest minuta govora, i vi ete osetiti da sluate ludog
oveka. Apsurdni, bezvezni, nepovezani fragmenti plove u umu. I to je va um! Dakle, vi
moete biti devedeset devet posto ludi, a neko je preao granicu, on je otiao izvan sto posto.
One koji su otili izvan sto posto mi stavljamo u ludnicu. Ne moemo staviti sve vas u ludnicu
jer nema tako mnogo ludnica. I ne moe ih biti - onda bi cela zemlja postala ludnica.
Halil Dubran je napisao malu anegdotu. On kae da je jedan od njegovih prijatelja
postao lud, pa je stavljen u ludnicu. Onda je samo iz ljubavi, saoseanja, on otiao da ga vidi,
da ga poseti. Sedeo je ispod drveta u bati ludnice, okruene velikim zidom. Halil Dubran je
otiao tamo, seo pored prijatelja na klupi i pitao ga: "Da li ikada razmilja zato si ovde?"
Ludi ovek se nasmejao i rekao: "Ja sam ovde jer sam eleo da napustim onu veliku ludnicu
spolja. Ovde sam miran. U ovoj ludnici - koju ti naziva ludnicom - niko nije lud."
13

Sav teret prolosti i sva oekivanja u budunosti mi nosimo samo u iskrivljenom obliku. Sama prolost kakva
jeste nikada se ne bi lepila za nas i optereivala nas. Mi je sami drimo i to uvek u iskrivljenom obliku.
37

Ludi ljudi ne mogu misliti da su oni ludi; to je jedna od osnovnih karakteristika


ludosti. Ako ste ludi, vi ne moete misliti da ste ludi. Ako moete misliti da ste ludi, postoji
mogunost. Ako moete misliti i shvatiti da ste ludi, vi ste jo uvek malo razboriti. Ludost se
nije pojavila u svojoj totalnosti. Dakle, ovo je paradoks: oni koji su stvarno normalni, oni
znaju da su ludi, a oni koji su potpuno ludi, oni ne mogu misliti da su ludi.
Vi nikada ne mislite da ste ludi. To je deo ludosti. Niste usrediteni, ne moete biti
razboriti. Vaa razboritost je samo povrna, prilagoena. Samo na povrini izgleda da ste
razboriti. Zbog toga, neprekidno, morate da obmanjujete svet oko sebe. Morate mnogo da
skrivate, morate da spreavate mnogo. Ne dozvoljavate sve da izae van. Vi potiskujete.
Moda mislite jedno, ali ete govoriti neto drugo. Vi se pretvarate, i zbog tog pretvaranja
moete imati minimum povrne razboritosti oko sebe; a unutra vi kljuate.
Ponekad se dogodi erupcija. U ljutnji vi eksplodirate i ludilo koje ste skrivali izlazi
napolje. Ono slomi sva vaa usaglaavanja. Tako psiholozi kau da je ljutnja privremena
ludost. Vi ete opet zadobiti ravnoteu; opet ete skrivati svoju realnost; opet ete doterivati
svoju povrinu; vi ete opet postati razboriti. I rei ete: "To je bilo pogreno. Uinio sam to u
ljutnji. Nikada to nisam mislio, zato oprostite mi." Ali ste mislili to! To je bilo najrealnije.
Pitanje za oprotaj je samo pretvaranje. Opet vi odravate svoju povrinu, svoju masku.
Razborit ovek nema masku. Njegovo lice je izvorno; ta god da on jeste, on jeste.
Ludak mora svesno da promeni svoje lice. Svakog momenta on mora da koristi razliitu
masku za razliitu situaciju, za razliite odnose. Samo posmatrajte sebe kako menjate svoja
lica. Kada doete kod svoje ene imate jedno lice; kada odete svojoj voljenoj, svojoj
ljubavnici, imate sasvim razliito lice.
Kada govorite svome slugi imate jednu masku, a kada govorite svom gazdi, sasvim
drugaije lice. Moe biti da va sluga stoji desno od vas, a ef levo, onda imate dva lica
istovremeno. Na levo imate jedno lice, na desno imate drugo lice, jer slugi ne moete pokazati
isto lice. Ne trebate. Vi ste ef tamo, tako da e ta strana lica biti ef. To lice ne moete
pokazati svom efu, jer ste tamo vi sluga; vaa druga strana e pokazati ponizno dranje.
Ovo se neprekidno odvija. Vi ne posmatrate, zbog toga niste svesni. Ako posmatrate
postaete svesni da ste ludi. Vi nemate nikakvo lice. Izvorno lice je izgubljeno. Meditacija
oznaava ponovno zadobijanje izvornog lica.
Zato zen majstor kae: "Idite i naite svoje izvorno lice - lice koje ste imali pre nego
to ste bili roeni, to lice ete imati kada budete umrli." Izmeu roenja i smrti vi imate lana
lica. Vi neprekidno nastavljate da obmanjujete - ne samo druge: kada stojite ispred ogledala vi
varate sebe. Nikada u ogledalu ne vidite svoje pravo lice. Nemate dovoljno hrabrosti da se
suoite sa sobom. To lice u ogledalu je takoe lano. Vi ga stvarate, uivate u njemu, ono je
naslikana maska.
Mi ne varamo samo druge; obmanjujemo sebe takoe. Zaista mi ne moemo obmanuti
druge, ako ve nismo obmanuli sebe. Tako moramo verovati u svoje vlastite lai, samo tada
moemo uiniti da drugi veruju. Ako ne verujete u svoje lai, niko drugi nee biti obmanut.
I ova munina koju nazivate svojim ivotom ne vodi nigde. To je luda spletka. Radite
previe. Preoptereujete se i trite. I celog ivota se borite, a ne stiete nigde. Ne znate odakle
dolazite, ne znate gde lutate, ne znate kuda idete. Ako sretnete oveka na putu i pitate ga:
"Odakle dolazite gospodine?" a on kae: "Ne znam", a vi ga pitate: "Kuda idete" a on kae:
"Ne znam", i jo kae: "Ne odvraajte me, u urbi sam", zaista ta ete misliti o njemu?
Misliete da je lud.
Ako ne znate odakle dolazite i kuda idete, onda emu urba? Ali to je situacija sa
svakim, svako je na putu. ivot je put, vi ste uvek u sredini. I vi ne znate odakle ste doli, ne
znate kuda idete. Nemate znanje o izvoru, nemate znanje o cilju, ali u velikoj ste urbi,
ulaete veliki napor da ne stignete nigde.
Kakva je ovo vrsta razumnosti? A iz itave ove borbe, ne dolaze vam ak ni bljeskovi
sree - ak ni nagovetaji. Vi se jednostavno nadate da jednog dana, sutra, prekosutra, ili posle
smrti, u nekom buduem ivotu - srea vas oekuje. Ovo je samo trik, samo odgaanje, samo
da se ne oseate previe jadno upravo sada.
38

Nemate nikakav bljesak blaenstva. Kakva je ovo vrsta razumnosti? Neprekidna


patnja - i, povrh toga, ta patnja nije stvorena ni od koga drugog. Vi stvarate svoju patnju. Koja
je ovo vrsta razumnosti? Vi stvarate svoju patnju neprekidno! Ja to zovem ludou.
Razumnost e biti ovo: postaete svesni da niste usrediteni. Dakle, prva stvar koju
treba uraditi je da se bude centriran, da doete do sredita, da imate sredite unutar sebe
odakle moete voditi svoj ivot, moete disciplinovati svoj ivot, da imate vlast unutar sebe
odakle moete usmeravati, moete se kretati. To je prva stvar koja treba da bude
iskristalisana, a onda druga stvar je da se ne stvara patnja za samog sebe. Odbacite sve to
stvara patnju - sve motive, elje, nade koje stvaraju patnju.
Ali vi niste svesni. Vi jednostavno nastavljate da je stvarate; ne vidite da to sebi
stvarate. ta god da radite, vi sejete neko seme. Onda plodovi e uslediti, a ta god da ste
posejali, vi ete ponjeti to. A kad god anjete neto, postoji patnja, ali nikada ne vidite da ste
vi posejali seme. Kad god vam se dogodi patnja, mislite da ona dolazi od neega drugog,
mislite da je to neki nesretan sluaj ili neke zle sile deluju protiv vas.
Tako ste izmislili avola. avo je samo rtveni jarac - vi ste avo. Vi stvarate svoju
patnju. Jer kad god patite, vi jednostavno bacate to na avola, avo je neto uradio. Onda ste
spokojni. Onda nikada ne postajete svesni svog vlastitog porenog naina ivota, glupog
naina ivota.
Ili vi to nazivate sudbinom, ili kaete: "Bog me iskuava." Ali nastavljate da
izbegavate osnovnu injenicu da ste vi iskljuivi uzrok svega ta god da vam se deava. I nita
nije sluajno. Sve ima uzronu vezu, a vi ste uzrok.
Na primer, vi se zaljubite. Ljubav vam da oseanje, oseanje da blaenstvo je negde u
blizini. Oseate po prvi put da ste nekome dobrodoli, barem vam jedna osoba eli
dobrodolicu. Vi zapoinjete da cvetate. Jedna osoba vam eli dobrodolicu, eka vas, voli
vas, brine za vas i vi zapoinjete da cvetate. Samo u poetku, a onda odmah va pogrean
obrazac uma poinje da deluje - vi odmah elite da posedujete to drago, voljeno bie. A
posedovanje ubija. Onog momenta kada posedujete ljubavnika, vi ste ga ubili. Zato i patite.
Onda plaete i zapomaete, a zatim mislite da ljubavnik je pogrean, da je sudbina loa,
"Sudbina mi nije naklonjena." Ali vi ne znate da ste otrovali ljubav kroz posedovanje, kroz
posesivnost.
Ali svaki ljubavnik ini to i svaki ljubavnik pati. Ljubav koja vam moe dati najdublje
blagoslove postaje najdublja patnja. Tako su stare kulture, naroito u Indiji u drevnim danima,
potpuno unitile pojavu ljubavi. Oni su ugovarali brakove za decu - nema mogunosti
zaljubljivanja, jer ljubav dovodi do patnje. Ovo je bio tako poznat fenomen - da ako dopustite
ljubav, onda ljubav vodi do patnje - tako je bolje nemati tu mogunost. Neka deca, mala deca,
budu venana. Pre nego to mogu da se zaljube, neka se venaju. Oni nikada nee znati ta je
ljubav, i tako nee biti u patnji.
Ali ljubav nikada ne stvara patnju. Vi je otrujete. Ljubav je uvek radost, ljubav je uvek
proslava. Ljubav je najdublja ekstaza koju vam priroda doputa. Ali vi je unitavate. Tako da
se ne bi palo u nevolju, u Indiji i drugim starim, drevnim zemljama, mogunost ljubavi je
potpuno zatvorena. Tako neete zapasti u patnju, ali onda ete takoe propustiti jedinu
ekstazu koju priroda dozvoljava. Tako ete imati osrednji ivot. Nema patnje, nema sree,
samo nekakvo guranje napred. Takav je brak bio u prolosti.
Sada Amerika pokuava, Zapad pokuava da oivi ljubav. Ali mnogo patnje dolazi
kroz to, i pre ili kasnije zapadne zemlje e se ponovo odluiti za deje brakove. Nekoliko
psihologa su ve predloili da deji brakovi treba da se vrate natrag jer ljubav stvara tako
mnogo bede. Ali ja opet kaem, ljubav nije uzrok tome. Ljubav ne moe da stvara patnju. To
ste vi, va obrazac ludila je ono to stvara patnju. Ne samo u ljubavi, svuda. Svuda ste
prisiljeni da u to unesete svoj um.
Mnogi ljudi dolaze kod mene. Na primer, oni zaponu da meditiraju. U poetku
postoje iznenadni bljeskovi, ali samo u poetku. Jednom kada su upoznali odreena iskustva,
kada su upoznali odreene bljeskove, sve staje. I oni dolaze plaui i jadikujui mi, pitajui:
"ta se dogodilo? Neto se deavalo, a sada je sve prestalo. Mi pokuavamo najbolje to
moemo, ali nita, nita iz toga ne dolazi."
39

Ja im odgovaram: "U poetku se to dogodilo jer to niste oekivali. Sada oekujete,


tako da se itava situacija promenila. Kada ste po prvi put imali to besteinsko oseanje
lakoe, oseanje da ste ispunjeni neim nepoznatim, oseanje da ste bili preneti iz svog
mrtvog ivota, oseanje ekstatinih trenutaka, vi to niste oekivali, nikada niste znali takve
trenutke. Po prvi put oni su pali na vas. Nesvesni ste bili, ne oekujui nita. Takva je bila
situacija.
Sada ste promenili situaciju. Sada svakog dana sedite da meditirate oekujui. Sada ste
lukavi, pametni, proraunati. Kada ste po prvi put imali kratak uvid, bili ste nevini, ba kao
dete. Vi ste se igrali s meditacijom, ali nije bilo oekivanja. Onda se to dogodilo. Dogodie se
to opet, ali onda ete morati opet da budete nevini.
Sada vam va um donosi nevolju, i ako nastavite da insistirate 'Moram imati iskustvo
ponovo i ponovo' izgubiete ga zauvek. Dok ga sasvim ne zaboravite, moe potrajati
godinama. Dok ne postanete potpuno ravnoduni da je takav dogaaj nekada u prolosti
postojao, onda e vam mogunost ponovo biti otvorena."
Ovo ja nazivam ludou. Vi unitavate sve. ta god doe u vae ruke, vi to odmah
unitavate. I zapamtite, ivot vam daje mnoge darove, netraene. Vi niste nikada zatraili od
ivota, a ivot vam je dao mnoge darove. Ali vi unitavate svaki dar, a svaki dar moe postati
vei i vei. To moe rasti jer ivot vam nikada ne daje nita mrtvo. Ako vam je ljubav data,
ona moe da raste. Ona moe da raste do nepoznatih dimenzija, ali na samom poetku vi je
unitavate.
Ako vam se meditacija dogodi, samo oseajte zahvalnost boanskom i zaboravite to.
Samo oseajte zahvalnost, i zapamtite dobro da vi nemate nikakvu sposobnost da je imate,
niste ni na koji nain autorizovani da je imate; ona je bila dar. Ona je bila jedno bujanje
boanskog. Zaboravite je. Ne oekujte je; ne zahtevajte je. Doi e sledeeg dana opet dublja, via, monija. Ona nastavlja da se iri, ali svakog dana ispustite je iz uma.
Nema kraja njenim mogunostima. Ona e postati beskonana; itav kosmos e postati
ekstatian za vas. Ali va um mora da bude isputen. Va um je ludost. Dakle, kada kaem da
postoje samo dve alternative, ludost i meditacija, ja mislim um i meditacija. Ako ostanete
ogranieni u umu, vi ete ostati ludi. Dok ne transcendirate um, ne moete transcendirati
ludost.
Najvie to moete biti je funkcionalni lan drutva, to je sve. I moete biti
funkcionalni lan drutva, jer celo drutvo je isto kao i vi. Svako je lud, tako da je ludost
pravilo.
Postanite svesni, i ne mislite da su drugi ludi. Oseajte duboko da ste vi ludi i neto
treba da se uradi. Odmah! To je hitno! Ne odlaite to jer e doi momenat kada neete moi
uiniti nita. Moete postati tako mnogo ludi da ne moete nita initi.
Upravo sada moete uiniti neto. Jo ste unutar granica. Neto moe da se uradi; neki
napor moe da se uini; obrazac moe da se promeni. Inae moe doi momenat kada ne
moete uiniti nita, kada postanete potpuno poremeeni i izgubite ak i svesnost.
Ako moete oseati da ste ludi, to je pravi znak koji daje nadu. To pokazuje da moete
biti svesni svoje vlastitoj realnosti. Vrata postoje; vi moete postati zaista normalni. Barem
toliko razboritosti postoji - da moete razumeti.
Drugo pitanje:
Kapacitet ispravnog znanja je jedna od pet sposobnosti uma, ali to nije stanje uma.
Kako je onda mogue da ta god ovek vidi kroz ovaj centar jeste istinito? Da li ovaj centar
ispravnog znanja deluje posle prosvetljenja, ili moe ak meditant, sadhaka biti u tom centru?
Da, sredite ispravnog znanja, praman, jo je unutar uma. Neznanje je od uma;
znanje je takoe od uma. Kada odete s one strane uma, nema ni jednog ni drugog; niti ima
neznanja, niti znanja. Znanje je takoe bolest. To je dobra bolest, zlatna bolest, ali je bolest!
Tako, zapravo, za Buddhu se ne moe rei da on zna, ne moe se rei ni da on ne zna. On je
otiao izvan. Nita se ne moe dokazati o tome, bilo da on zna ili da li je neznalica.
40

Kada nema uma, kako moete znati ili ne znati? Znanje je kroz um, neznanje je takoe
kroz um. Kroz um moete znati pogreno, kroz um moete znati ispravno. Kada nema uma,
znanje i neznanje oboje prestaju. Ovo e biti teko razumeti, ali je lako ako sledite: um zna,
stoga moe biti neznalica; kada nema uma, kako moete biti neznalica i kako moete biti
upueni da znate. Vi jeste, ali znanje i neznanje oboje su prestali.
Um ima dva centra; jedan, ispravnog znanja. Ako taj centar funkcionie on zapoinje
da deluje kroz usredsreenost, meditaciju, kontemplaciju, molitvu - onda bilo ta to znate
jeste istina. Postoji pogrean centar; on funkcionie ako ste pospani, ivite u stanju slinom
hipnozi, opijeni s neim, sa seksom, muzikom, drogama ili bilo ime.
Moete se odati looj navici s hranom; onda to postaje jedan opijat. Moete jesti
previe. Vi ste ludi, opsednuti hranom. Onda hrana postaje alkohol. Sve to zaposedne va
um, sve bez ega ne moete da ivite, to postaje opijanje. Dakle, ako ivite kroz opijate onda
va centar pogrenog znanja funkcionie, i ta god da znate jeste lano, neistinito. ivite u
svetu lai.
Ali oba ova centra pripadaju umu. Kada um otpadne i meditacija doe u svojoj
potpunosti Na sanskritu mi imamo dva izraza: jedan izraz je dhyana; dhyana znai
meditacija; drugi izraz je samadhi. Samadhi znai savrena meditacija gde ak i meditacija
postaje nepotrebna, gde ak i da se vri meditacija postaje besmisleno. Ne moete to da radite,
vi ste postali to - onda je to samadhi.
U ovom stanju samadhija ne postoji um. Nema ni znanja niti neznanja, postoji samo
isto postojanje.14 Ovo isto bivanje je potpuno razliita dimenzija. To nije dimenzija
saznavanja, to je dimenzija bivanja.
ak i ako takav ovek, Buddha ili Isus, eli da komunicira s vama, on e morati da
koristi um. Za komunkaciju e morati da koristi um. Ako vi postavite odreena pitanja, on e
morati da koristi svoj centar uma za ispravno znanje. Um je orue za komunikaciju, za
razmiljanje, za saznavanje.
Ali ako vi ne pitate nita, a Buddha sedi ispod svog bo drveta, on nije ni neznalica ni
znalac. On je tu. Zaista, ne postoji razlika izmeu drveta i Buddhe. Ne postoji razlika. Postoji
razlika, ali na nain da nema odvajanja. On je postao kao drvo; on samo postoji. Nema
kretanja, ak ni znanja. Sunce e se podii, ali on nee znati da se sunce podiglo. Ne znai da
e on ostati neznalica - ne, jednostavno to nije sada njegovo kretanje. On je postao smiren,
tako tih, da se nita ne pokree. On je ba kao drvo. Drvo je potpuna neznalica. Ili moete rei
da je drvo samo ispod uma. Um jo nije poeo da funkcionie. Drvo e postati ovek u nekom
ivotu, drvo e postati ludo kao vi u nekom ivotu, i drvo e pokuati da meditira u nekom
ivotu, i drvo e jednog dana postati Buddha. Drvo je ispod uma, a Buddha sedei pod
drvetom je iznad uma. Oni su oboje bez uma. Jedan e tek postii um, a drugi je postigao i
preao iznad njega.
Dakle, kada se um transcendira, kada se postigne nemanje uma, vi ste isto bivanje,
sat-it-ananda. Nema dogaanja u vama. Niti delovanje postoji niti saznavanje postoji. Ali to
je teko za nas. Spisi stalno kazuju da je svaka dualnost transcendirana.
Znanje je takoe deo dualnosti neznanje - znanje. Ali takozvani mudraci nastavljaju da
govore da je Buddha postao "znalac". Onda mi prianjamo uz dualnost. Zbog toga Buddha
nikada ne odgovara. Mnogo puta, milionima puta pitali su ga: "ta se deava kada osoba
postane Buddha?" On je ostao nem. Samo je rekao: "Postani i znaj." Nita se ne moe rei o
tome ta se deava, jer ta god moe biti reeno bie reeno vaim jezikom, a va jezik je u
osnovi dualistiki. Dakle ta god da se kae bie neistinito.
Ako se kae da on zna, to e biti neistinito, ako bi se reklo da je on postao besmrtan, to
e biti neistinito, ako bi se reklo da je on postigao blaenstvo, to bi bilo neistinito - jer sva
dualnost iezava. Patnja iezava, srea iezava. Neznanje iezava, znanje iezava. Tama
iezava, svetlost iezava. Smrt iezava, ivot iezava. Nita se ne moe rei. Ili, samo
ovoliko se moe rei - da ta god moete zamisliti nee biti to, bilo ta moete shvatiti nee
biti to. I jedini nain je da se postane to. Samo onda znate.
14

Bivanje, Bitak, Jastvo, Sopstvo.


41

Tree pitanje:
Rekli ste da ako vidimo vizije Boga ili da pleemo sa Krinom, da zapamtimo da je to
samo mata. Meutim, druge veeri ste rekli da ako smo prijemivi moemo komunicirati sa
Hristom, Buddhom, ili Krinom odmah sada. Da li je ta komunikacija takoe imaginacija
koja se dogaa, ili postoje meditativna stanja u kojima su Hrist ili Buddha zaista tu? Malo je
teko da se razume.
Prva stvar: od sto sluajeva, devedeset devet sluajeva e biti od mate. Vi zamiljate
- zbog toga se hrianinu Krina nikada ne pojavljuje u viziji, hindusu se Muhamed nikada ne
javlja u njegovim vizijama. Ostavite Muhameda i Isusa; oni su daleko. Inae ainu se nikada
Rama ne javlja u viziji, ne moe se pojaviti. Hindusima se Mahavira nikada ne pojavljuje.
Zato? Nemate nikakvu imaginaciju za Mahaviru.
Ako ste roeni kao hindu, vi ste hranjeni konceptom Rame i Krine. Ako ste roeni
kao hrianin vi ste hranjeni - va kompjuter, va um, je hranjen - s likom Isusa. Kad god
ponete da meditirate, pohranjena slika dolazi u um; bljesne u umu.
Isus se pojavljuje vama; Isus se nikada ne pojavljuje Jevrejima. A on je bio Jevrejin.
Roen je kao Jevrejin, umro je kao Jevrejin, ali on se nikada ne javlja Jevrejima, jer oni
nikada nisu verovali u njega. Oni su mislili da je on samo vagabund, raspeli su ga kao
kriminalca. Isus se nikada ne javlja Jevrejima, iako je pripadao Jevrejima - imao je jevrejske
krvi i kosti.
uo sam priu da su u nacistikoj nemakoj vojnici iz Hitlerove vojske ubijali Jevreje
u gradu. Mnogi su ubijeni. Nekoliko Jevreja je pobeglo. Bilo je to nedeljno jutro. Pobegli su;
doli su do hrianske crkve jer su mislili da e to biti najbolje mesto da se sakriju. Crkva je
bila puna hriana, jer to bilo u nedelju ujutro. Tako se tamo sakrilo desetak Jevreja.
Meutim, vojnici su saznali da su neki Jevreji pobegli u crkvu i da se tamo kriju, pa su
otili u crkvu. Rekli su sveteniku: "Zastavi slubu!" Predvodnik vojnika je uao i rekao: "Ne
moete nas obmanuti. Ima nekoliko Jevreja koji se kriju ovde. Dakle, svako ko je Jevrejin
treba da izae i stane u red. Ako sledite nae naredbe moete spasiti sebe. Ako neko pokua
da obmane, odmah e biti ubijen."
Ubrzo su Jevreji izali iz crkve i stali u red. Onda je iznenada cela gomila postala
svesna da je Isus iezao, Isusova statua. On je takoe bio Jevrejin, tako da je stao napolju u
redu.
Isus se nikada nije javljao Jevrejima. On nije bio ni hrianin. On nikada nije pripadao
nijednoj hrianskoj crkvi, da se sada vrati ne bi ni prepoznao hriansku crkvu, on je iao u
sinagogu, odlazio bi u jevrejsko drutvo. Iao bi da vidi rabina, ne bi mogao otii da vidi
katolikog ili protestantskog svetenika. On ih ne zna. Ali se nikada ne pojavljuje Jevrejima
jer nikada nije bio posejan u njihovoj mati. Oni su ga odbacili, tako da seme nije tu.
Dakle, ta god da se dogodi, devedeset devet mogunosti ima da ste upravo nahranjeni
znanjem, konceptima, slikama. One bljesnu pred vaim umom, i kada ponete da meditirate vi
postajete osetljivi. Postajete senzitivni tako da moete postati rtva svoje vlastite mate. A
mata e izgledati tako realno da ne postoji nain da se prosudi da li je stvarna ili nestvarna.
Samo jedan procenat sluajeva nee biti izmiljen, ali kako da se zna? U tom jednom
procentu sluaja zaista nee biti nita izmiljeno. Neete oseati da Isus stoji pred vama
raspet, neete oseati da Krina stoji pred vama niti ete plesati s njim, vi ete samo oseati
prisustvo, ali tu nee biti lika, vizije, zapamtite to. Osetiete sputanje boanskog prisustva.
Biete ispunjeni s neim nepoznatim, ali bez ikakvog oblika. Nee biti plesa Krine i nee biti
raspetog Isusa i nee biti Buddhe koji sedi u sidhasani, ne! Jednostavno e biti samo
prisustva, ivog prisustva koje tee unutar vas, unutra i van. I vi ste preplavljeni, vi ste u
okeanu tog prisustva.
Isusa nee biti u vama, vi ete biti u Isusu. To e biti razlika. Krina nee biti u vaem
umu, kao slika, vi ete biti u Krini. Ali onda Krina e biti bezoblian. To e biti jedno
iskustvo, ali ne i jedna slika.
42

Onda zato ga nazivati Krinom? Nee biti forme. Zato to nazivati Isusom? Oni su
jednostavno simboli, jeziki simboli. Vi ste upoznati s reju "Isus", tako kada to prisustvo
ispuni vas i vi postanete deo toga, vibrirajui deo toga; kada postanete kap u tom okeanu,
kako to da izrazite? Vi znate da najlepa re za vas moe biti "Isus" ili najlepa re moe biti
"Buddha" ili "Krina" - ovim reima je hranjen um, tako da vi birate te odreene rei da
iskau to prisustvo.
Ali to prisustvo nije jedna zamisao; to nije san, to uopte nije vizija. Vi moete
koristiti Isusa, moete koristiti Krinu, moete koristiti Hrista, bilo ta, bilo koje ime koje vam
se svia, koje ima ljubavnu privlanost za vas. To zavisi od vas. Ta re i to ime, i ta slika e
doi iz vaeg uma, ali smo iskustvo je nezamislivo. To nije samo jedna imaginacija.
Jedan katoliki svetenik je posetio zen majstora, Nan-ina. Nan-in nikada nije uo za
Isusa, pa je taj katoliki svetenik mislio: "To e biti dobro. Ja u proitati neke delove iz
Propovedi na gori, i videu kako Nan-in reaguje. A ljudi kau da je on prosvetljen."
Tako je katoliki svetenik otiao kod Nai-ina i rekao: "Uitelju, ja sam hrianin, ja
imam knjigu i volim je. eleo bih da vam proitam neto iz nje samo da vidim kako vi
reagujete." Onda je proitao nekoliko redova iz Propovedi na gori - iz Novog Zaveta. Preveo
je to na japanski, jer Nan-in je razumeo samo japanski.
Kada je poeo da prevodi, itavo lice Nan-ina se potpuno promenilo. Suze su poele
da teku iz njegovih oiju, rekao je: "To su rei Buddhe." Hrianski svetenik je rekao: "Ne,
ne, ovo su rei Isusove." Meutim Nam-in je rekao: "Dajte mu koje god hoete ime, ali ja
oseam ovo su rei Buddhe jer ja znam Buddhu, a ove rei mogu doi samo kroz Buddhu.
Ako vi kaete da su dole kroz Isusa, onda je Isus bio Buddha; to ne ini nikakvu razliku.
Onda u rei mojim uenicima da je Isus bio budista."
Takvo e biti oseanje. Ako vi oseate prisustvo boanskog, onda su imena
beznaajna. Imena su obavezna da budu razliita za svakoga jer imena dolaze iz obrazovanja,
imena dolaze iz kulture, imena dolaze iz naroda kome pripadate. Meutim, ovakvo iskustvo
ne pripada nijednom drutvu, ovakvo iskustvo ne pripada nijednoj kulturi, ovakvo iskustvo ne
pripada vaem umu, kompjuteru - ono pripada vama.
Stoga zapamtite, ako vidite vizije, one su mata. Ako ponete da oseate prisustva bezoblina, egzistencijalna iskustva - obavijeni ste njima, stopljeni s njima, rastvoreni u
njima, onda ste stvarno u kontaktu.
Moete nazvati to prisustvo Isusom, moete zvati to prisustvo Buddhom, to zavisi od
vas, nema razlike. Isus je Buddha, a Buddha je Hristos. Oni koji su otili izvan uma, oni su
takoe otili izvan linosti. Oni su takoe otili van formi. Ako Isus i Buddha stoje zajedno, tu
e biti dva tela, ali samo jedna dua. Bie dva tela, ali ne dva prisustva, jedno prisustvo.
To je isto kao kada stavite dve lampe u sobu. Lampe su dve, samo po svom obliku, ali
svetlo postaje jedno. Ne moete razgraniiti da ovo svetlo pripada ovoj lampi, a ono svetlo
pripada onoj lampi. Svetla su sjedinjena. Samo materijalni deo lampe je ostao odvojen,
meutim nematerijalni deo postaje jedan.
Ako Buddha i Isus dou blizu, ako stanu zajedno, videete dve lampe, odvojene, ali
njihova svetla su se ve sjedinila. Oni su postali jedno. Svi oni koji su spoznali istinu, postali
su jedno. Njihova imena su razliita za njihove sledbenike; za njih, sada nema imena.
etvrto pitanje:
Molimo objasnite da li je svest takoe jedna od modifikacija uma.
Ne, svest nije deo uma. Ona tee kroz um, ali ona nije deo uma. To je ba kao ova
sijalica - elektricitet tee kroz nju, ali elektricitet nije deo sijalice. Ako razbijete sijalicu, vi
niste slomili elektricitet. Izraaj e biti spreen, ali potencijal ostaje skriven. Stavite drugu
sijalicu, i elektricitet poinje da tee.
Um je samo jedan instrument. Svest nije deo njega, ali svest tee kroz njega. Kada je
um transcendiran, svest ostaje u sebi. Zbog toga kaem da e ak i Buddha morati da koristi
um ako vam govori, ako ima veze s vama, jer onda trebae mu tok kojim e tei njegov
43

unutarnji izvor. On e morati da koristi instrumente, medijume, i onda e um funkcionisati.


Inae um je samo vozilo.
Vi se kreete u vozilu, ali niste vozilo. Vi idete u kolima, ili letite u avionu, ali vi niste
ta vozila. Um je samo vozilo. I vi ne koristite um u njegovom totalnom kapacitetu. Ako
koristite um u njegovom potpunom kapacitetu, to e postati ispravno znanje.
Mi koristimo na um kao neko to koristi avion kao autobus. Moete isei krila avionu
i koristiti ga kao autobus na putu. To e delovati; on e raditi kao autobus. Ali vi ste budalasti.
Taj autobus moe leteti! Ne koristite ga u njegovom pravom kapacitetu!
Vi koristite svoj um za snove, matanja, ludosti. Vi ga niste iskoristili, isekli ste mu
krila. Ako ga koristite s krilima, to moe postati ispravno znanje; to moe postati mudrost. Ali
to je takoe deo uma; to je takoe vozilo. Korisnik ostaje u pozadini; korisnik ne moe biti
korien. Vi koristite to, vi ste svest. I svi napori meditacije jesu sredstvo za upoznavanje ove
svesti u njenoj istoti, bez ikakvog medijuma. Jednom kada znate nju bez ikakvog
instrumenta, vi je moete znati! A ovo se moe saznati samo kada je um prestao da
funkcionie. A kada um prestane da funkcionie - vi ete postati svesni da je ta svest tu, vi ste
ispunjeni s njom. Um je bio samo vozilo, prolaz. Sada, ako elite, moete koristiti um; ako ne
elite, ne treba da ga koristite.
Telo i um, oboje su vozila. Vi niste vozilo, vi ste gospodar skriven iza ovih vozila. Ali
ste zaboravljeni potpuno. I postali ste dvokolica; vi ste postali vozilo. To je ono to Gurijev
naziva identifikacijom. To je ono to su, u Indiji, jogini nazvali tadatyma, postajanje jedno sa
neim to vi niste.
Peto pitanje:
Molimo objasnite kako je mogue da samo pomou posmatranja, pomou svedoenja
zapisa u modanim elijama, izvori procesa miljenja mogu prestati da postoje.
Oni nikada ne prestaju da postoje, ali samim svedoenjem je identifikacija prekinuta.
Buddha je iveo u svom telu etrdeset godina posle svog prosvetljenja; telo nije prestalo
postojati. Neprekidno etrdeset godina on je govorio, objanjavao, inio da ljudi razumeju ta
mu se dogodilo i kako isto moe da se dogodi njima. On je koristio um; um nije prestao. Kada
je doao posle dvanaest godina u svoj rodni grad, prepoznao je svog oca, prepoznao je svoju
enu, prepoznao je svog sina. Um je bio tu, pamenje je bilo tu; inae prepoznavanje nije
mogue.
Um zaista nije prestao da postoji. Kada mi kaemo um prestaje, mislimo vaa
identifikacija je prekinuta. Sada vi znate: ovo je um, a ovo je "Ja sam". Most je sruen. Sada
um nije gospodar. On je postao samo jedno orue; on je pao na svoje pravo mesto. Dakle kad
god vam je on potreban, moete ga koristiti. To je isto kao ventilator. Ako elite da ga
koristite, ukljuite ga, onda ventilator pone da funkcionie. Sada mi ne koristimo ventilator,
tako da je on neaktivan. Ali je on ovde, on nije prestao da postoji. Svakog momenta moete
da ga koristite. On nije iezao.
Samo pomou svedoenja, identifikacija iezava, ne um. Ako identifikacija iezne,
vi ste totalno novo bie. Po prvi put vi ste saznali svoju pravu pojavu, vau pravu realnost. Po
prvi put vi ste upoznali ko ste. Sada je um samo deo mehanizma oko vas.
To je isto kao da ste pilot i letite u avionu. Koristite mnogo instrumenata; vae oi
rade na mnogim instrumentima, neprekidno svesni ovoga i onoga. Ali vi niste ti instrumenti.
Ovaj um, ovo telo i mnoge psihofizike funkcije samo su oko vas, mehanizam. U
ovom mehanizmu vi moete postojati na dva naina. Jedan nain egzistencije je da zaboravite
sebe i oseate kao da ste mehanizam. To je ropstvo, to je patnja; to je svet, samsara.
Drugi nain funkcionisanja je ovaj: postajui svesni da ste odvojeni, vi ste razliiti.
Onda nastavljate da ga upotrebljavate, ali sada to stvara veliku razliku. Sada mehanizam niste
vi. Ako neto krene pogreno u mehanizmu, moete pokuati da to ispravite, vi neete biti
uznemireni. ak i ako itav mehanizam iezne, vi neete biti uznemireni.
Buddhino umiranje i vae umiranje su dve razliite pojave. Buddha umirui zna da
samo mehanizam umire. On je bio korien, i sada nije potreban. Teret je uklonjen; on postaje
44

slobodan. On e se kretati sada bez oblika. Ali vae umiranje je neto sasvim razliito. Vi
patite, vi plaete, jer oseate da vi umirete, ne mehanizam. To je vaa smrt. Onda to postaje
jedna silna patnja.
Samo uz pomo svedoenja, um ne prestaje i modane elije nee prestati. Pre e
postati ivlji jer e biti manje konflikta, vie energije. Oni e postati sveiji. I moete ih
koristiti mnogo ispravnije, mnogo preciznije, neete biti optereeni njima i nee vas prisiliti
da inite neto. Nee vas gurati i vui ovde i onde. Vi ete biti gospodar.
Inae kako se to deava samo uz pomo svedoenja? Zato to se to tako dogodilo,
ropstvo se dogodilo uz pomo nesvedoenja. Ropstvo se dogodilo zato to niste bili svesni,
stoga ropstvo e ieznuti ako postanete svesni. Ropstvo je samo nesvesnost. Nita drugo nije
potrebno: postanite vie svesni, ta god da radite.
Vi sedite ovde i sluate me. Moete sluati sa svesnou, moete sluati bez svesnosti.
Bez svesnosti takoe e sluanje biti tu, ali e to biti razliita stvar, kvalitet e se razlikovati.
Onda vae ui sluaju, a va um deluje negde drugde.
Onda nekako, nekoliko rei e ui u vas. Ali one e biti pomeane i va um e ih
interpretirati na svoj vlastiti nain. On e staviti svoje vlastite ideje u njih. Sve e biti smutnja
i nered. Vi ste sluali, ali mnoge stvari e biti proputene, mnoge stvari se nee uti. Vi ete
birati. Onda e cela stvar biti izobliena.
Ako ste svesni, onog momenta kada postanete svesni, miljenje prestaje. Sa panjom
vi ne moete misliti. itava energija postaje svesna, nije vie preostalo energije da se preseli u
miljenje. Kada ste svesni makar za jedan trenutak, vi jednostavno sluate. Nema prepreke.
Vae rei nisu tu da bi mogle biti pomeane. Vama nije potrebno tumaenje. Uticaj je
direktan.
Ako sluate sa budnou, onda ono to ja kaem moe biti znaajno ili moe biti bez
znaenja, ali vae sluanje s budnou uvek e biti upueno u smisao. Sama budnost stvorie
vrhunac vae svesnosti. Prolost e se rastvoriti, budunost e nestati. Neete biti nigde
drugde, vi ete biti samo ovde i sada. A u tom momentu tiine kada miljenja nema, biete
duboko u kontaktu sa svojim vlastitim izvorom. A taj izvor je blaenstvo, taj izvor je
boanski. Dakle, jedina stvar koju treba uraditi je da se sve radi sa budnou.
Poslednje, esto pitanje:
Dok ste govorili o Lao Ce-u vi ste postali taoistiki mudrac, dok ste govorili o tantri
vi ste postali tantrista, dok ste govorili o bhakti vi ste postali prosvetljeni bhakta, a dok
govorite o jogi vi postajete savreni jogin. Molim vas hoete li nam objasniti kako je taj
fenomen postao mogu?
Kada vi niste, samo onda to moe biti mogue. Ako vi jeste, onda to ne moe postati
mogue. Ako vi niste, ako je domain potpuno iezao, onda gost postaje gazda. Dakle gost
moe biti Lao Ce, gost moe biti Patanjali. Gazda nije tu, tako da gost zauzima njegovo
mesto potpuno, on postaje domain. Ako vi niste onda moete postati Patanjali; ne postoji
tekoa. Moete postati Krina, moete postati Hrist. Ako ste vi tu, onda je to vrlo teko. Ako
ste vi tu, ta god da kaete bie pogreno.
Zbog toga kaem da ovo nisu komentari. Ja ne komentariem Patanjalija. Ja sam
jednostavno odsutan, doputajui to Patanjaliju. Stoga ovo nisu komentari. Komentarisati
znailo bi da je Patanjali neto odovojeno. I da sam je odvojen i da ja komentariem
Patanjalija. To e sigurno biti izoblieno, jer kako mogu da komentariem Patanjalija? Ma
ta da kaem bie to moje rei, i ma ta da kaem bie to moje tumaenje. Ja ne mogu biti
sam Patanjali. I to sve nee biti dobro. Bie destruktivno. Stoga ja ne komentariem uopte.
Ja jednostavno doputam da se to izrazi kroz mene, a ovo doputanje je mogue samo ako ja
nisam tu.
Ako postanete svedok, ego iezava. A kada ego iezne, vi postajete vozilo, postajete
prolaz, postajete flauta. A flauta moe biti stavljena na Patanjalijeve usne, flauta moe biti
poloena na Krinine usne, i flauta moe biti stavljena na Buddhine usne - flauta ostaje ista.
Ali kada je na Buddhinim usnama, Buddha tee.
45

Dakle, ovo nije komentar. Teko je ovo razumeti jer ne moete dopustiti. Vi ste toliko
mnogo unutar sebe da ne moete dozvoliti nikome. A oni nisu osobe. Patanjali nije osoba;
Patanjali je prisustvo. Ako ste vi odsutni, njegovo prisustvo moe da deluje.
Ako pitate Patanjalija, on e isto rei. Ako pitate Patanjalija, on nee rei da je ove
sutre stvorio on. On e rei: "One su vrlo drevne - sanatan." On e rei: "Milioni i milioni
mudraca su ih videli. Ja sam samo vozilo. Ja sam odsutan, a one govore." Ako pitate Krinu
on e rei: "Ja ne govorim. Ovo je najvea drevna poruka. To je uvek bilo tako. Ako pitate
Isusa, on e rei: "Ja nisam vie, ja nisam tu."
emu ovo insistiranje? Svako ko postane odsutan, ko postane bez ega, zapoinje da
funkcionie kao vozilo, kao prolaz - prolaz za sve to je istina, prolaz za sve to je skriveno u
egzistenciji, to moe da tee. Vi ete moi da razumete ta god da ja govorim samo kada
barem za trenutak budete odsutni.
Ako ste previe ovde, va ego je ovde, onda ma ta ja da kaem ne moe tei u vas. To
nije samo intelektualna komunikacija. To je neto dublje.
Ako ste makar za trenutak bez ega, osetiete prodor razumevanja. Tada e neto
nepoznato ui u vas, i u tim trenucima ete razumeti. I nema drugog naina da razumete.

Poglavlje 5
ISTINITO I NEISTINITO ZNANJE
29. decembar 1973.
I, 7:

pratyakanumanagamah pramanani.
Neposredno zrenje (pratyaka), logino zakljuivanje (anumana) i predanje
zasnovano na proverenim tradicijama (agama) su [iskljuivi izvori] istinostnih
spoznavanja (pramana).
I, 8:

viparyaya mithyajnanatadrupapratitham.
Zabluda (viparyaya) je [ona vrsta] pogrenog saznanja koje proizilazi iz formi
razliitih od ovih [napred navedenih].
I, 9:

abdajnananupati vastuunyo vikalpah.


Afektivno uivljavanje u imaginativnom (vikalpa) je [onaj obrt] koji proizilazi
kao rezultat verbalnog saznanja (sabdajnana) a kojem nedostaje realna potpora.
I, 10:

abhavapratyayalambana vrttirnidra.
Spavanje (nidra) je onaj obrt koji kao potporu poticaju energija (pratyaya)
ima odsutnost.
I, 11:

anubhutaviayasampramoah smrtih.
Neisputanje (asampramoa) onog [jednom ve] iskuenog jeste seanje

(smrti).
Prva sutra:
Ispravno znanje ima tri izvora: direktno saznanje, zakljuivanje i rei probuenih
ljudi.
Pratyaka, direktno saznanje, je prvi izvor istinitog znanja. Direktno saznanje
oznaava susret licem-u-lice, bez ikakvog sredstva, bez ikakvog posrednika. Kada vi znate
46

neto direktno, saznavalac gleda u znano odmah. Nema nikoga da to povezuje, nema
premoavanja. Onda je to ispravno znanje. Ali onda se javljaju mnogi problemi.
Obino, pratyaka, direktno saznanje, je prevoeno, interpretirano, komentarisano, na
vrlo pogrean nain. Sama re pratyaka znai pred oima, neposredno zrenje. Ali same oi
su posredovanje, saznavalac je skriven u pozadini. Oi su sredstva. Vi sluate mene, ali to nije
direktno; to nije neposredno. Vi sluate mene kroz ula, kroz ui. Vidite mene kroz oi.
Vae oi mogu pogreno da vas izveste. Nikome ne treba verovati; nijednom
posredniku ne treba verovati, jer vi se ne moete osloniti na posrednika. Ako su vae oi
bolesne, one e izvestiti razliito; ako su vae oi drogirane, one e izvestiti razliito; ako su
vae oi ispunjene seanjem, one e izvestiti razliito.
Ako ste u ljubavi, onda vidite neto drugo. Ako niste u ljubavi onda to nikada ne
moete videti. Jedna obina ena moe postati najlepa osoba u svetu ako je gledate kroz
ljubav. Kada su vae oi ispunjene ljubavlju, onda one izvetavaju neto drugo. A ista osoba
moe izgledati najrunija ako su vae oi ispunjene s mrnjom. One nisu pouzdane.
Vi ujete kroz ui. Ui su instrumenti, one mogu da funkcioniu pogreno; one mogu
da uju neto to nije bilo reeno; one mogu propustiti neto to je reeno. ula ne mogu biti
pouzdana; ula su samo mehanika sredstva.
Onda ta je pratyaka? ta je direktno saznanje? Direktnog saznanja moe biti samo
kada ne postoji posrednik, ak ni ula. Patanjali kae da je onda to ispravno znanje. To je
prvi osnovni izvor istinskog znanja: kada znate neto a ne morate zavisiti ni od ega drugog.
Samo u dubokoj meditaciji vi transcendirate ula. Tada direktno saznanje postaje
mogue. Kada Buddha saznaje svoje najunutarnije bie, to najskrivenije bie je pratyaka; to
je direktna spoznaja. Nikakva ula nisu ukljuena; niko nije izvestio to; ne postoji nita slino
posredniku. Saznavalac i saznavano su licem u lice. Ne postoji nita izmeu. To je
neposrednost, a neposrednost samo moe biti istinita.
Dakle, prvo istinito znanje moe samo biti ono od unutarnjeg Sopstva.15 Moete znati
ceo svet, ali ako niste saznali najdublju sr svoga bia itavo vae znanje je apsurdno, to nije
pravo znanje, ono ne moe biti istinito, jer prvo, osnovno ispravno znanje se nije dogodilo
vama. Cela vaa graevina je lana. Moete znati mnoge stvari. Ako niste spoznali Sebe, sve
vae znanje je zasnovano na izvetajima, izvetajima datim od ula. Ali kako moete biti
sigurni da vas ula izvetavaju pravilno?
Nou vi sanjate. Dok sanjate poinjete verovati u san, da je on istinit. Vaa ula
izvetavaju o snu - vae ui ga uju, vae oi ga vide, moete da to dodirujete. Vaa ula vas
tako izvetavaju; zbog toga padate pod iluziju da je to realno. Vi ste ovde; to moe biti samo
san. Kako moete biti sigurni da vam govorim u realnosti? Da li je mogue da je ovo samo
san, da me sanjate. Svaki san je istinit dok sanjate.
uang Ce je jednom sanjao da je postao leptir. Ujutru je bio tuan. Uenici su ga
pitali: "Zato ste tako alosni?" uang Ce je rekao: "Ja sam u nevolji. U takvoj neprilici u
kakvoj nikada ranije nisam bio. Zagonetka mi izgleda nemogua; ne moe se reiti. Prole
noi videh u snu da sam postao leptir!"
Uenici su se nasmejali. Rekoe: "Kakva je to stvar? To nije zagonetka. San je samo
san." uang Ce je rekao: "Ali ujte, ja sam u nevolji. Ako uang Ce moe sanjati da je postao
leptir, leptir moda sada sanja da je postao uang Ce. Dakle, kako presuditi da li se ja sada
suoavam s realnou ili opet sanjam. Ako je uang Ce mogao postati leptir, zato leptir ne bi
mogao sanjati da je postao uang Ce?"
To nije nemogue, i obrnuto se moe dogoditi. Ne moete se osloniti na ula. U snu
vas ona obmanjuju. Ako uzmete drogu, LSD ili neto, vaa ula poinju da vas obmanjuju;
zapoinjete da vidite stvari koje nisu tu. Ona vas mogu zavesti do takvog stepena da moete
poeti da verujete u stvari tako potpuno, da moete biti u opasnosti.
Jedna devojka je skoila u Njujorku sa esnaestog sprata, jer je pod uticajem LSD
mislila da moe da leti. uang Ce nije pogreio: devojka je zaista izletela kroz prozor.

15

Od Jastva, Atmana, unutarnjeg bia, ili Bitka.


47

Naravno, umrla je. Ali ona za to nikada ne bi bila sposobna da nije bila zavedena svojim
ulima pod uticajem droge.
ak i bez droge mi imamo obmane. Prolazite kroz mranu ulicu, i iznenada se
prestravite - zmija je tu. Poinjete da trite, a docnije saznate da to nije bila zmija, tamo je
samo lealo ue. Ali kada ste osetili da je tamo bila zmija, bila je zmija. Oi su vas obavestile
da je tamo zmija i vi ste se ponaali saglasno tome - pobegli ste s tog mesta.
ulima se ne moe verovati. Onda ta je direktno saznanje? Direktno saznanje je neto
to se zna bez ula. Dakle, prvo istinito znanje moe biti samo od unutranjeg Sopstva, jer
samo tamo ula nee biti potrebna. Svuda drugde ula e biti potrebna. Ako elite da vidite
mene moraete da me vidite kroz oi, ali ako elite da vidite sebe, oi nisu potrebne. ak i
slep ovek moe videti sebe. Ako elite da vidite mene svetlo e biti potrebno, ali ako elite
da vidite sebe tama je u redu, svetlo nije potrebno.
ak i u najmranijoj peini vi moete znati sebe. Nikakav medijum - svetlost, oi, bilo
ta - nije potreban. Unutarnje iskustvo je neposredno, trenutno, a neposredno iskustvo je
osnova sveg istinitog znanja.
Jednom kada ste ukorenjeni u tom unutranjem iskustvu onda e mnoge stvari
zapoeti da vam se dogaaju. Nee biti mogue razumeti ih odmah. Ukorenjeni u svom
centru, u svom unutarnjem biu, vi oseate to kao direktno iskustvo, onda vas ula ne mogu
obmanuti. Vi ste probueni. Onda vas oi ne mogu zavesti, onda vas ui ne mogu obmanuti,
onda vas nita ne moe obmanuti. Prevara je izostala.
Moete biti zavedeni jer ivite u samoobmani, ali ne moete biti obmanuti jednom
kada postanete pravi znalac. Ne moete biti zavedeni! Onda sve ubrzo uzima oblik istinitog
znanja. Jednom kada znate sebe, ta god da znate postae automatski istinito jer ste vi sada
istiniti. Ovo je razlika koju treba zapamtiti: ako ste istiniti, onda sve postaje istinito; ako ste
neistiniti, onda sve postaje pogreno. Dakle nije pitanje injenja neega spolja, to je pitanje
injenja neega unutra.
Ne moete obmanuti Buddhu - to nije mogue. Kako moete varati Budu? On je
ukorenjen u sebi. Vi ste providni za njega; ne moete ga zavesti. Pre nego to znate, on zna
vas. ak i svetlucanje misli u vama on jasno vidi. On prodire u vas do samog vaeg bitka.
Vae prodiranje ide do istog stepena u druge, kao to ide u vas same. Ako moete
prodreti u sebe, do istog stepena moete prodreti u sve. to se dublje kreete unutra, dublje se
moete kretati spolja. A vi se niste pomerili unutra nijedan in, tako da ta god inite spolja je
samo kao san.
Patanjali kae da je prvi izvor ispravnog znanja neposredno, direktno saznanje
pratyaka. On se ne bavi arvakama, starim materijalistima, koji su govorili da pratyaka,
ono to je pred oima, jeste jedina istina.
Zbog ove rei pratyaka, direktno saznanje, mnogo nerazumevanja se dogodilo.
Indijska kola materijalista je arvaka. Izvor indijskog materijalizma je bio Brihaspati - vrlo
pronicljiv mislilac, samo mislilac; vrlo dubok filozof, samo filozof - ne ostvarena dua. On je
rekao da je samo pratyaka istina, a pod pratyakom on podrazumeva da sve to znate kroz
ula jeste istina. I on kae da ne postoji nain znanja iega bez ula, tako je samo ulno znanje
istinito za arvake.
Dakle, on porie da postoji bilo kakav Bog jer niko ga nikada nije video. A ono to se
moe videti jedino je realno; ono to se ne moe videti ne moe biti istinito. Boga nema jer ga
ne moete videti; due nema jer je ne moete videti. I on kae: "Ako postoji Bog, dovedi ga
ispred mene tako da ga mogu videti. Ako ga ja vidim onda on postoji, jer samo je vienje
istinito."
On je takoe koristio re pratyaka, ali njegovo znaenje je potpuno razliito. Kada
Patanjali koristi re pratyaka njegovo znaenje je na sasvim drugom nivou. On kae da
znanje koje nije izvedeno ni iz kakvog instrumenta, nije izvedeno ni iz kakvog posrednika,
neposredno, jeste istinito. A jednom kada se ovo znanje dogodi, vi ste postali istiniti. Tada
nita lano ne moe da se vam desi. Kada ste vi istiniti, autentino ukorenjeni u istini, onda
iluzije postaju nemogue.
48

Zbog toga je reeno da Buddhe nikada ne sanjaju, onaj ko je probuen nikada ne


sanja. Jer ak ni san njemu ne moe da se dogodi; on ne moe biti obmanut. On spava, ali ne
kao vi. On spava na potpuno razliit nain, kvalitet je razliit. Samo njegovo telo spava,
relaksira se. Njegovo bie ostaje budno.
A ta budnost ne doputa nikakav san da se dogodi. Moete sanjati samo kada se
budnost izgubi. Kada niste budni, kada ste duboko hipnotisani, onda poinjete da sanjate.
Sanjanje moe da se dogodi samo kada ste potpuno nesvesni. Vie nesvesnosti, vie snova e
biti prisutno. Vie svesnosti, manje snova. Potpuna svesnost, nema snova. ak i dubok san
bez snova postaje nemogu za onoga ko je ukorenjen u samome sebi, koji je neposredno
spoznao unutarnje bivstvo (Sopstvo).
Ovo je prvi izvor ispravog znanja. Drugi izvor je zakljuivanje. To je sekundarno, ali
to je takoe vredno razmatranja jer, takvi kakvi ste sada, vi ne znate da li postoji Sopstvo
unutra ili ne. Nemate direktno znanje svog unutarnjeg bitka. ta da se radi? Postoje dve
mogunosti. Jednostavno moete poricati da ne postoji unutarnja sr vaeg bia, da nema
due, kao to arvake ine, ili su na Zapadu inili, Epikur, Marks, Engels i drugi.
Meutim, Patanjali kae da ako vi znate, nije potrebno zakljuivanje, ali ako ne
znate, onda e biti korisno da se zakljuuje. Na primer, Dekart, jedan on najveih mislilaca
Zapada, zapoeo je svoje filozofsko traganje kroz sumnju. On je zauzeo gledite od samog
poetka da nee verovati ni u ta to nije neosporno i oevidno. U ono u ta se moe sumnjati,
on e sumnjati. I pokuae da otkrije taku s koje se ne moe sumnjati, i samo sa tog mesta e
stvoriti celu graevinu svog miljenja. Lep gest - iskren, teak za dostizanje, opasan.
Dakle, on je poricao Boga, jer moete sumnjati. Mnogi su sumnjali, a niko nije mogao
da odgovori na njihove sumnje. On je nastavio da osporava. Sve u ta se moglo sumnjati, to
je shvaeno kao nepouzdano, on je osporavao. Godinama je neprekidno bio u unutranjem
meteu. Onda je pao na taki koja je bila nosporna: nije mogao porei sebe; to je bilo
nemogue. Ne moete rei: "Ja nisam". Ako kaete to, samo vae izgovaranje dokazuje da vi
jeste. Stoga je to bio temelj, to "ne mogu porei sebe samoga; ne mogu rei da nisam. Ko e
rei to? ak i da bih sumnjao u sebe, ja sam neophodan da bih sumnjao".
Ovo je zakljuak. Ovo nije direktno saznanje. Ovo je kroz logiku i dokaz, ali to daje
senku, to daje letimino sagledavanje, to vam daje mogunost, jedno otvaranje. Onda je
Dekart imao stenu, a na ovoj steni veliki hram moe biti izgraen. Jedna neosporna injenica,
i vi moete stii do apsolutne istine. Ako zaponete sa sumnjivom stvari, nikada neete stii
nigde. U samoj osnovi, sumnja ostaje.
Patanjali kae da je zakljuivanje drugi izvor istinitog znanja. Ispravna logika,
ispravna sumnja, ispravan dokaz moe vam dati neto to moe pomoi na putu prema
pravom znanju. To on naziva zakljuivanjem, anumana. Direktno vi niste videli, ali sve
dokazuje to, to mora biti tako. Dokazi su tako postavljeni da to mora biti tako.
Na primer, vi gledate okolo iroki univerzum. Moda neete moi da shvatite da
postoji Bog, ali ne moete osporiti - jer ceo univerzum je ureen sistem, kohernetna celina,
osmiljena. To ne moete porei. Osmiljenost je tako oigledna da ak ni nauka to ne moe
porei. Naprotiv, nauka stalno nalazi sve vie i vie planova, vie i vie zakona.
Ako je svet samo jedna sluajnost, onda nauka nije mogua. Ali ne izgleda da je svet
jedna sluajnost, izgleda da je planiran, i pokree se prema odreenim zakonima, a ovi zakoni
se nikada ne naruavaju.
Patanjali e rei da plan univerzuma ne moe da se porekne, a ako jednom osetite da
postoji plan, planer je uao. Ali to je jedan zakljuak, vi ga niste spoznali direktno - ve samo
plan univerzuma, planiranje, zakone, red. A red je tako velianstven! On je tako detaljan, tako
sjajan, tako beskonaan! Red postoji; sve bruji u jednom poretku, muzika harmonija celog
univerzuma. Neko je izgleda skriven u pozadini, ali to je jedan zakljuak.
Patanjali kae da zakljuivanje takoe moe biti pomo prema ispravnom znanju, ali
to mora da bude ispravno zakljuivanje. Logika je opasna; ona je s dve otrice. Moete
koristiti logiku pogreno; onda ete takoe postii zakljuak.
Na primer, rekao sam vam da plan postoji, model postoji; svet ima izvestan red, lep
red, savren. Ispravan zakljuak e biti da izgleda da postoji neka ruka iza toga. Moda
49

neemo biti direktno svesni, moda neemo biti u direktnom dodiru s tom rukom, ali ruka
izgleda da je tu, skrivena. Ovo je ispravno zakljuivanje.
Ali iz iste premise vi moete zakljuiti i pogreno. Postojali su mislioci koji su rekli...
Didro je rekao: "Zbog reda ja ne mogu verovati da postoji Bog. Svetom izgleda vlada savren
poredak. Zbog tog reda, ne mogu da verujem da postoji Bog." Koja je njegova logika? On
kae, ako postoji neka osoba u pozadini, onda ne moe biti tako velikog reda. Ako je osoba u
pozadini toga, onda ona mora poiniti ponekad greke. Ponekad on mora biti kapriciozan,
pogubljen, ponekad se mora promeniti. Zakoni ne mogu biti tako savreni ako je neko u
pozadini. Zakon moe biti savren ako nema nikoga iza i oni su jednostavno mehaniki.
To takoe ima privlanost. Ako sve ide savreno, to izgleda mehaniki jer se o oveku
kae, greiti je ljudski. Ako je tu neka osoba, onda ona ponekad mora greiti - dosaivae se s
tako mnogo savrenstva. Ponekad ona mora eleti promenu.
Voda vri na sto stepeni. Ona je kljuala na sto stepeni milenijumima, uvek i svugde.
Bogu mora postati dosadno, ako je on u pozadini, Didro kae, dakle samo radi promene,
jednog dana e on rei: "Od sada na dalje voda e kljuati na devedeset stepeni." Ali se to
nikada nije dogodilo, prema tome izgleda da nema osobe.
Oba argumenta izgledaju savrena. Meutim Patanjali kae da je ispravno
zakljuivanje ono koje vam daje mogunosti za rast i napredak. Nije pitanje da li je logika
savrena ili ne. Pitanje je da va ishod treba da postane jedno otvaranje. Ako nema Boga, on
postaje zatvaranje. Onda ne moete da rastete. Ako zakljuite da postoji neka skrivena ruka,
svet postaje misterija. A onda vi niste ovde samo sluajno. Onda va ivot postaje znaajan.
Onda ste deo velike eme. Onda je neto mogue; moete uiniti neto, moete se uzdii u
svesti.
Ispravno zakljuivanje oznaava zakljuivanje koje vam moe dati rast; pogreno
zakljuivanje je ono koje, ma kako savreno da izgleda, zatvara va rast. Zakljuivanje moe
biti takoe izvor istinitog znanja. ak i logika se moe iskoristiti da bude izvor ispravnog
znanja, ali morate biti vrlo svesni ta radite. Ako ste samo logini, moete poiniti
samoubistvo kroz to. Logika moe da postane samoubistvo. To je postala za mnoge.
Ba pre nekoliko dana bio je ovde jedan tragalac iz Kalifornije. On je putovao dugo.
Doao je da se sretne sa mnom. A onda je rekao: "Pre nego to meditiram i pre nego to mi
kaete da meditiram, uo sam da ko god doe kod vas vi ga gurnete u meditaciju, tako da pre
nego to me gurnete, imam pitanja." Imao je listu barem od sto pitanja. Mislim da nije
ispustio nijedno koje je mogue - o Bogu, o dui, o istini, o nebu, paklu - lista je bila puna
pitanja. Rekao je: "Dok ne reite ova pitanja, ne idem da meditiram."
On je logian na nain to kae: "Dok se na moja pitanja ne odgovori, kako mogu
meditirati? Dok ne osetim pouzdano da ste vi ispravni, dok ne odgovorite na moje sumnje,
kako mogu poi u nekom pravcu koji vi izlaete i pokazujete? Vi ste moda neistiniti. Dakle,
moete dokazati vau ispravnost samo ako ieznu moje sumnje."
A njegove sumnje su takve da ne mogu nestati. Ovo je dilema: ako on meditira sumnje
e nestati, ali on kae da e meditirati samo kada ne bude bilo sumnji. ta da se radi? On
kae: "Prvo dokaite da ima Boga." Niko to nije dokazao, niti e ikada neko moi. To ne
znai da Bog ne postoji, nego da ne moe biti dokazan. On nije mala stvar koja se moe
dokazati ili pobiti. To je tako vitalna stvar, morate je iveti da biste je znali. Nikakav dokaz ne
moe da pomogne.
Ali on je logino u pravu. On kae: "Dok ne dokaete kako mogu zapoeti? Ako nema
due, ko e meditirati? Tako prvo dokaite da postoji Sopstvo, onda mogu meditirati."
Ovaj ovek izvrava samoubistvo. Niko nee nikada moi da mu odgovori. On je
stvorio sve prepreke, a kroz te barijere nee moi da raste. Ali on je logian. ta mogu da
uradim s takvom osobom? Ako ponem da odgovaram na njegova pitanja, osoba koja moe
stvoriti stotinu sumnji moe stvoriti milione, jer sumnjanje je nain postojanja uma. Moete
odgovoriti na jedno pitanje, kroz va odgovor on e stvoriti jo deset jer um ostaje isti.
On trai sumnje, ako odgovorim logino ja pomaem njegov logini um da bude
hranjen, da bude vie ojaan. Ja ga hranim. To nee pomoi. On treba da bude izbaen iz
svoje loginosti.
50

Tako sam mu ja rekao: "Jesi li ti ikada bio zaljubljen?" On je rekao: "Ali zato? Vi
menjate predmet razgovora." Ja sam mu rekao: "Vratiu se natrag na tvoja pitanja, ali mi je
iznenadno postalo vrlo znaajno da te pitam jesi li ikada voleo." On je rekao: "Da!" Lice mu
se promenilo. Pitao sam: "Pre nego to si se zaljubio, jesi li sumnjao u celu tu pojavu?"
Onda je bio uznemiren. Bilo mu je neugodno. Rekao je: "Ne, nikada nisam mislio o
tome. Jednostavno sam se zaljubio, a onda sam postao toga svestan." Onda sam ja rekao:
"Uini suprotno. Prvo misli o ljubavi, da li je ljubav mogua, da li ljubav postoji, da li ljubav
uopte moe postojati. Prvo neka bude dokazana, naini joj uslov da dok ne bude dokazana
nee voleti nikoga."
On je rekao: "ta govorite? Vi ete unititi moj ivot. Ako nainim taj uslov, onda ne
mogu voleti." A ja sam mu rekao: "To je isto to ti ini. Meditacija ja ista kao ljubav. Mora
prvo da je upozna. Bog je upravo kao ljubav. Zbog toga je Isus stalno govorio kako je Bog
ljubav. To je isto kao ljubav. Prvo ovek mora to da iskusi."
Logini um moe biti zatvoren, i to tako logino da nikada nee oseati da je zatvorio
svoja vrata za sve mogunosti rasta. Stoga ispravno zakljuivanje, anumana, znai
razmiljanje na koji nain se taj rast pomae. Onda ono moe postati izvor istinitog znanja.
A tree je najlepe. Nigde drugde to nije uinjeno izvorom ispravnog znanja - rei
probuenih osoba, agama. Vodila se velika polemika oko ovog treeg izvora. Patanjali kae
da moete znati direktno, onda je to u redu. Moete i zakljuiti ispravno, onda ste takoe na
pravoj stazi i dostii ete izvor.
Meutim, postoje neke stvari koje ne moete nikada zakljuiti, niti ih neposredno
spoznati. Inae vi niste prvi na ovoj zemlji, niste prvi tragalac. Milioni su traili tokom
miliona godina - i ne samo na ovoj planeti, ve na drugim planetama takoe. Traganje je
veno i mnogi su stigli. Oni su postigli cilj, oni su uli u hram. Njihove rei su takoe izvor
ispravnog znanja.
Agama oznaava rei onih koji su spoznali. Buddha je rekao neto, ili je Isus rekao
neto... mi ne znamo ta su oni govorili. Mi nismo iskusili to, tako da nemamo nain da
sudimo o tome. Ne znamo ta i kako da zakljuujemo ispravno kroz njihove rei. A rei su
kontradiktorne, tako da moete zakljuiti sve to elite.
Ima ih nekoliko koji misle da je Isus bio psihotian. Zapadni psihijatri su pokuali da
dokau da je on psihotian, da je bio manijak. Oni tvrde: "Ja sam sin Boiji, jedini sin" - on je
bio lud, ego-manijak, psihotian. Moe se dokazati da je bio psihotian jer ima mnogo
psihotinih ljudi koji tvrde iste takve stvari. Moete to otkriti. U ludnicama ima mnogo takvih
ljudi.
To se jednom dogodilo u Bagdadu. Kalif Omar je bio kralj, a jedan ovek je
objavljivao na ulicama Bagdada: "Ja sam poslanik, ja sam prorok. Sada je Muhamed izbaen
jer sam ja ovde. Ja sam zadnja re, poslednja poruka od boanskog. I sada nema potrebe za
Muhamedom, njegovo vreme je prolo. On je bio izaslanik do sada, ali sada sam ja doao.
Moete zaboraviti Muhameda."
To nije bila hinduistika zemlja. Hindus moe da tolerie sve, niko nije tolerantan kao
hindus. Oni mogu tolerisati sve jer kau: "Dok mi ne znamo tano, ne moemo rei 'da', ne
moemo rei 'ne'. On moe biti izaslanik, ko zna?"
Ali muslimani su razliiti, vrlo dogmatini. Oni ne mogu tolerisati. Tako je Kalif
Omar, uhvativi novog proroka, bacio ga u tamnicu i rekao mu: "Data su ti dvadeset etiri
sata. Ponovo promisli. Ako kae da nisi prorok, Muhamed je prorok, onda e biti
osloboen. Ako vrsto ostaje u svojoj ludosti, onda u posle dvadeset etiri sata doi u
tamnicu i bie ubijen."
ovek se smejao. Rekao je: "Gledaj! Ovo je zapisano u spisima - proroci e uvek biti
tretirani ovako, kao to ti postupa sa mnom." On je bio logian. Sam Muhamed je bio tretiran
tako, tako da to nije nita novo. ovek je rekao Omaru: "Ovo nije nita novo. Ovako e se
stvari prirodno razvijati. A ja nisam u nekom poloaju da ponovo promiljam. Ja nisam vlast.
Ja sam samo poslanik. Samo Bog moe to da promeni. Za dvadeset etiri sata ti moe doi,
nai e da sam isti. Samo moe da promeni onaj ko me je postavio."
51

Dok se ovaj razgovor odvijao, drugi ludak, koji je bio vezan lancem za stub, poeo je
da se smeje. Omar ga je pitao: "Zato se ti smeje?" Odgovorio je: "Ovaj ovek apsolutno nije
u pravu. Ja ga nikada nisam postavio! Ne bih to dozvolio. Posle Muhameda nisam poslao
nijednog poslanika." U svakoj ludnici ovi ljudi su prisutni, i za Isusa moe se dokazati da je
slian sluaj.
I rei su tako kontradiktorne i nelogine. Svaka osoba koja zna je primorana da govori
kontradiktorno, paradoksalno, jer istina je takva da moe biti izraena samo kroz paradokse.
Njihove tvrdnje nisu jasne; one su misteriozne. I vi moete zakljuiti bilo ta iz njih na
osnovu svojih zakljuaka. Svojih zakljuaka. Va um je tu; zakljuak je postao va zakljuak.
Zato Patanjali kae, trei izvor. Vi ne znate. Ako znate direktno, onda nema pitanja,
onda nema potrebe ni za kakvim drugim izvorom. Ako imate direktno saznanje, onda nema
potrebe za zakljuivanjem ili za reima prosvetljenih ljudi, vi sami ste postali prosvetljeni.
Onda moete odbaciti druga dva izvora. Ali ako se to nije dogodilo, onda moe pomoi
zakljuivanje, ali zakljuivanje e biti vae. Ako ste ludi, onda e va zakljuak biti lud. Onda
je vredno pokuati s treim izvorom - s reima prosvetljenih.
Ne moete ih dokazati, ne moete ih ni opovrgnuti. Samo moete imati poverenje, a to
poverenje je hipotetino; ono je vrlo nauno. U nauci takoe ne moete napredovati bez
hipoteza. Ali hipoteze nisu verovanja. To je samo radna klasifikacija. Hipoteze su samo
usmerenje; moraete da eksperimentiete. Ako se eksperiment pokae ispravnim, onda
hipoteza postaje teorija. Ako eksperiment ispadne pogrean, onda se hipoteza odbacuje. Rei
prosvetljenih ljudi treba da se uzmu na poverenje, kao hipoteze. Onda ih primenite u svom
ivotu. Ako se pokau istinitim, onda su hipoteze postale verodostojne; ako se pokau
neistinitim, onda hipoteze treba da budu odbaene.
Odete kod Buddhe. On e rei: "ekaj! Budi strpljiv, meditiraj, i za dve godine nemoj
postaviti nikakvo pitanje." To morate preduzeti na poverenje; nema drugog puta.
Moete misliti: "Ovaj ovek me moda samo obmanjuje. Onda su dve godine mog
ivota izgubljene. Ako se posle dve godine pokae da je ovaj ovek bio samo hokus-pokus,
samo varalica, ili je u samoobmani - u iluziji da je postao prosvetljen - onda su moje dve
godine izgubljene." Ali ne postoji drugi put. Morate rizikovati. Ako bez poverenja u Buddhu
ostanete tu, ove dve godine e biti beskorisne - jer dok nemate poverenje ne moete raditi. A
rad je tako naporan da samo ako imate poverenje moete napredovati u njemu u celosti,
potpuno u njemu. Ako nemate poverenje, onda stalno odbijate neto. A to odbijanje nee vam
dopustiti da iskusite ono to Buddha nagovetava.
Rizik postoji, ali sam ivot je rizik. Za vii ivot, vii e biti rizik. Vi se kreete
opasnom stazom. Ali zapamtite, postoji samo jedna greka u ivotu, a to je ne pokretati se
uopte, to je samo strah, sedeti, potpuno uplaeni da neto moe krenuti nepovoljno, tako da
je bolje ekati i sedeti. Ovo je jedina greka. Neete biti u opasnosti, ali rast nee biti mogu.
Patanjali kae da postoje stvari koje ne znate, ima stvari koje vaa logika ne moe
zakljuiti. Morate primiti na poverenje. Zbog ovog treeg izvora, guru, uitelj, postaje
neophodan, neko ko zna. Morate preuzeti ovaj rizik, i kaem da je to rizik jer ne postoji
garancija. Cela stvar moe da se pokae samo kao gubitak, ali bolje je prihvatiti rizik, jer ak i
da dokaete da bilo beskorisno, nauili ste mnogo. Sada nijedna druga osoba nee moi da vas
obmane tako lako. Barem ste toliko nauili.
Ako se kreete s poverenjem, ako se kreete sasvim sledei Buddhu kao senka, stvari
mogu zapoeti da se deavaju, jer su se one deavale ljudima; ovom Gautama Buddhi, Isusu,
Mahaviru. One su se dogaale i oni znaju stazu; oni su je proli. Ako raspravljate s njima,
biete gubitnik. Oni ne mogu biti gubitnici. Oni e vas jednostavno ostaviti po strani.
U ovom veku to se dogodilo sa Gurijevom. Tako mnogo ljudi bilo je privueno k
njemu, ali on je kreirao takvu situaciju za nove uenike da dok oni nisu verovali potpuno,
morali su da odustanu odmah - dok ne budu verovali ak i u besmislice. A te besmislice su
bile planirane. Gurijev bi stalno lagao. Ujutru bi rekao neto, poslepodne bi rekao neto
drugo. A vi niste stigli ni da pitate! On bi razbio va logiki um potpuno.
Ujutru bi on rekao: "Kopaj rupu. I to se mora. Do veeri ovo mora biti zavreno." I
celog dana biste to kopali. Vi ste se trudili, umorni ste, preznojiete se, niste uzimali hranu, a
52

predvee on bi doao i rekao: "Vrati ovu zemlju u rupu! To morate zavriti pre nego to odete
u krevet."
Dakle, ak i jedan obian um e rei: "Kako to mislite? Ceo dan sam izgubio. Mislio
sam da je ovo neto vrlo bitno, do uvee je trebalo da bude zavreno, a sada kaete: "Bacaj
zemlju natrag!" Ako biste pitali takvu stvar, Gurijev bi rekao: "Jednostavno odustanite! Idite
odmah! Ja nisam za vas; vi niste za mene."
Nije stvar u rupi ili kopanju. Ono to on isprobava je da li moete imati poverenje u
njega ak i kada je on apsurdan. A jednom kada zna da mu moete verovati, da se moete
kretati s njim gde god on vodi, samo tada e uslediti prave stvari. Onda je ispit zavren, vi ste
isprobani i utemeljeni istinski - kao pravi tragalac koji moe raditi i koji moe imati
poverenje. A onda prave stvari mogu da vam se dogode, nikada ranije.
Patanjali je uitelj, a ovaj trei izvor on zna vrlo dobro kroz svoje vlastito iskustvo sa
hiljadama i hiljadama uenika. Mora da je radio s mnogima, mnogim uenicima i tragaocima,
samo onda je mogue napisati takvu raspravu kao to su Joga Sutre. To nije od mislioca. To je
od onoga ko je eksperimentisao s mnogim tipovima umova i koji je pronikao u mnoge slojeve
umova, svakog tipa osobe sa kojim je radio. Ovo je on nainio treim izvorom: rei
probuenih ljudi.
Druga sutra:
Pogreno znanje je pogreno poimanje koje ne odgovara stvarima kakve jesu.
Jo neke definicije e pomoi razumevanju definicije viparyaye - neispravnog znanja.
Pogreno znanje je netano shvatanje neega to ne odgovara stvari kakva ona jeste. Svi mi
imamo veliko breme pogrenog znanja jer pre nego to se susretnemo s injenicom, mi ve
imamo predubeenja.
Ako ste hindus i neko vam je predstavljen, i reeno vam je da je on musliman, odmah
imate pogreno gledite da taj ovek mora biti nepodesan. Ako ste hrianin i neko vam je
predstavljen kao Jevrejin, neete pokuavati da zaista upoznate tog oveka; neete ulaziti u
tog odreenog oveka. Rekavi vam da je "Jevrejin", vaa predrasuda je ula unutra; ve znate
tog oveka. Sada nije potrebno upoznavati ga, znate koji je to tip oveka - Jevrejin.
Imate predubeenja, pristrasan um, a taj pristrasan um vam daje pogreno znanje.
Jevreji nisu loi. Niti su svi hriani dobri, niti su svi muslimani loi. Niti su svi hindusi dobri.
Zaista, dobrota i ravost ne pripadaju nijednoj rasi, to pripada osobama, individuama. Moe
biti loih muslimana, loih hindusa; dobrih muslimana, dobrih hindusa. Dobrota i ravost ne
pripadaju nijednoj naciji, nijednoj rasi, nijednoj kulturi, to pripada pojedincima, linostima.
Ali teko je suoiti se s osobom bez ikakve predrasude. A samo tada ete imati ispravan uvid.
Jednom se to meni dogodilo. Putovao sam. Uao sam u moj kupe. Mnogi ljudi su doli
da me isprate, pa je osoba koja se sedela u kupeu, drugi putnik, odmah dotakla moja stopala i
rekla: "Vi mora da ste veliki svetac. Toliko mnogo ljudi je dolo da vas isprati!"
Onda sam rekao tom oveku: "Ja sam musliman. Moda sam veliki svetac, ali sam
musliman." On je bio okiran! Dodirnuo je muslimanu stopala, a bio je Brahmin! Poeo je da
se znoji, bio je nervozan. Pogledao me je ponovo i rekao: "Ne, vi se alite." Samo da bi uteio
sebe rekao je: "Vi se alite." "Ne alim se. Zato bih se alio? Morali ste da se raspitate pre
nego to ste dotakli moja stopala!"
Onda smo bili zajedno u kupeu. esto me je posmatrao i uzdisao duboko. Razmiljao
je verovatno da ode i da se okupa. Ali nije se sukobljavao sa mnom. Ja sam tu, a on se bavio s
konceptom "muslimana", on je bio Brahmin, postao je neist dodirujui me.
Niko se ne sukobljava sa stvarima, osobama, kakve one jesu. Vi imate predrasude.
Ove predrasude stvaraju viparyayu; ove predrasude stvaraju pogreno znanje. ta god da
mislite, ako niste neposredno doli do injenica to e biti pogreno. Ne unosite svoju prolost,
ne unosite svoje predrasude. Odloite na stranu svoj um i suoite se s injenicom. Samo vidite
ma ta da gledate. Nemojte projektovati svoje zamisli.
Stalno projektujemo zamisli. Na um je potpuno ispunjen i fiksiran od samog
detinjstva. Sve nam je dato na gotovo, a kroz to unapred dato znanje itav na ivot postaje
jedna iluzija. Nikada ne susreete stvarnu osobu, nikada ne vidite pravi cvet. im ujete:
"Ovo je rua" vi mehaniki kaete: "Divno". Niste osetili lepotu; niste saznali lepotu; niste
53

dodirnuli cvet. Ali, "Rua je lepa" je samo u vaem umu; onog momenta kada ujete "rua",
um projektuje misao na nju i kae: "Lepa je!"
Moete verovati da ste stekli oseanje da je rua lepa, ali to nije tako. To je lano.
Samo pogledajte. Zbog toga deca dolaze do stvari mnogo dublje nego odrasli ljudi - jer ona ne
znaju imena. Ona jo nisu pristrasna. Ako je rua lepa, onda e samo ona biti lepa; sve rue
nisu lepe. Deca prilaze blie stvarima, njihove oi su iste i neiskusne. Ona vide stvari kakve
jesu jer ne znaju kako da projektuju misli.
Ali mi smo uvek u urbi da ih uinimo odraslim, da ih uinimo punoletnim. Punimo
njihov um sa znanjem, informacijama. Ovo je jedno od najveih nedavnih otkria psihologa,
da kada deca krenu u kolu ona su inteligentnija nego kada napuste univerzitet. Poslednja
otkria to dokazuju. U prvi razred, kada deca uu, ona su vie inteligentna. Imae manje i
manje inteligencije kako rastu u znanju.
Vremenom kada postanu diplomci, magistri i doktori, oni su dokrajeni. Kada se vrate
sa doktorskom diplomom, ostavili su svoju inteligenciju negde na univerzitetu. Oni su mrtvi,
ispunjeni znanjem, pretrpani znanjem, ali to znanje je lano - predubeenja o svemu. Sada ne
mogu oseati stvari direktno, ne mogu oseati ive osobe direktno, ne mogu iveti direktno,
sve je postalo verbalno, reito. To sada nije realno; to je postalo mentalno.
Pogreno znanje je lana koncepcija, koja ne odgovara stvarima kakve jesu.
Stavite na stranu svoje predrasude, znanje, koncepcije, preformulisane informacije, i
gledajte istim pogledom, nevino, postanite opet dete. A to treba da se radi svakog trenutka,
jer svakog trenutka vi ih sakupljate.
Jedan od najstarijih joga aforizama je: umiri svakog trenutka tako da moe biti roen
svakog trenutka. Umri svakog trena za prolost, odbaci svu prainu koju si sakupio, i
posmatraj iznova. Meutim, ovo treba da se ini neprekidno, jer sledeeg momenta praina se
ponovo nakupila.
Nan-in je bio u potrazi za Zen uiteljem kada je bio tragalac. iveo je sa svojim
uiteljem mnogo godina, a onda je uitelj rekao: "Sve je u redu. Skoro si postigao." Ali je
kazao: "skoro", pa je Nan-in pitao: "ta vam to znai?" uitelj je odgovorio: "Morau da te
poaljem na nekoliko dana kod drugog uitelja. To e ti dati poslednji zavrni in."
Nan-in je bio veoma uzbuen. Rekao je: "Poaljite me odmah!" Dato mu je pismo. A
on je bio tako uzbuen, mislio je da je poslat kod nekoga ko je vei uitelj nego to njegov
sopstveni. Ali kada je stigao do tog oveka, on nije bio niko, samo uvar jedne krme, vratar
jedne gostionice.
Oseao je veliko razoarenje pa je pomislio, "Ovo mora biti neka vrsta ale. Ovaj
ovek e biti moj poslednji uitelj? On e mi dati zavrni dodir?" Ali poto je ve doao,
pomislio je: "Bolje da ostanem ovde nekoliko dana, barem da se odmorim, onda u se vratiti
natrag. Ovo je bilo dugako putovanje." Tako je rekao uvaru: "Moj uitelj mi je dao ovo
pismo."
Onda je uvar krme rekao: "Ali ja ne mogu da itam, tako da moe zadrati tvoje
pismo, ono nije potrebno. A ti moe biti ovde." Nan-in je rekao: "Ali ja sam poslat da
nauim neto od tebe."
uvar krme je rekao: "Ja sam samo jedan uvar, nisam majstor, nisam uitelj. Moda
je dolo do nekog nesporazuma. Moda ste doli kod pogrene osobe. Ja sam uvar, ne mogu
poduavati, ne znam nita. Inae kad si ve doao, moe samo da me posmatra. To moe da
bude korisno. Odmaraj se i posmatraj."
Meutim nije bilo niega da se posmatra. Ujutru bi otvorio vrata krme. Gosti bi doli
a on bi istio njihove stvari - lonce, potreptine i sve - i sluio bi ih. Nou opet, kada bi svi
otili, a gosti otili da spavaju u svojim krevetima, on bi opet istio stvari, lonce, potreptine,
sve. I ujutru opet isto.
Ali treeg dana Nan-inu je bilo dosadno. Rekao je: "Nema ta da se posmatra. Stalno
isti potreptine, stalno obavlja uobiajene poslove, tako da moram otii." uvar se smejao,
ali nije rekao nita.

54

Nan-in se vratio natrag, mnogo je bio ljut na svog majstora pa je rekao: "Zato, zato
ste me poslali na tako daleko putovanje, bilo je muno, a taj ovek je samo uvar? Nije me
nauio niemu, jednostavno je rekao: 'Posmatraj', a nije imalo ta da se posmatra."
Tada je majstor rekao: "Ipak, bio si tamo tri-etiri dana. ak i ako nije imalo ta da se
posmatra, mora da si posmatrao. ta si radio?" On je odgovorio: "Posmatrao sam. Nou bi
istio upotrebljene lonce, stavljao je sve tamo, a ujutru je ponovo istio."
Majstor je rekao: "To je uenje! To je ono zbog ega si bio poslat! On je istio te lonce
nou, ali ujutru je opet istio te iste lonce. ta to znai? ak i tokom noi, kada se nita nije
dogaalo, oni su postali opet neisti, neto praine je opet palo. Dakle, moe biti ist, sada i
jesi. Moe biti bezazlen, ali svakog trenutka mora nastaviti ienje. Moe da ne radi
nita, a ipak postaje neist samo od prolaenja vremena. Iz trenutka u trenutak, samo
prolaenjem, ne radei nita, samo sedenjem ispod drveta, ti postaje neist. Ta neistoa nije
zato to si ti neto radio loe ili neto pogreno, to se deava samo prolaenjem vremena.
Praina se sakuplja. Stoga mora stalno da se isti, i to je taj poslednji dodir, jer oseam da si
postao ponosan to si ist, i sada se ne brine za konstantan napor ienja."
Iz trenutka u trenutak ovek mora da umire i da se ponovo raa. Samo onda ste
slobodni od pogrenog znanja.
Tree:
Lik, zazivan neprekidno reima bez ikakve sutine u njegovoj pozadini, je vikalpa imaginacija.
Imaginacija nastaje samo kroz rei, verbalne strukture. Vi kreirate stvar - ona nije tu,
ona nije realnost. Ali vi je kreirate kroz vae mentalne likove. I moete stvarati to do takvog
opsega da postanete obmanuti od nje i mislite da je realna. Ovo se dogaa u hipnozi.
Hipnotiete osobu i kaete ta god hoete; ona priziva taj lik, i on postane realan. Vi to moete
uraditi. To inite na mnogo naina.
Jedna od najuvenijih amerikih glumica, Greta Garbo, napisala je u svojim
memoarima. Bila je jedna obina devojka, ba jednostavna, obina devojka, vrlo siromana i
radila je u berbernici samo za nekoliko novia, stavljala je sapun na lice muterija. Radila je
to tri godine.
Jednog dana jedan ameriki filmski reiser bio je u toj berbernici, i ona je stavila
sapun na njegovo lice, i kao to to amerikanci ine - on moda nije ni mislio o tome jednostavno je pogledao u ogledalo, odraz devojke i rekao: "Kako je lepa!" Upravo tog
momenta Greta Garbo je roena!
Ona je pisala: iznenada je postala drugaija; nikada nije mislila o sebi da je lepa; nije
mogla to da pojmi. Nikada nije od nikoga ula da je lepa. Po prvi put ona je takoe pogledala
u ogledalo i lice joj bilo razliito - taj ovek ju je uinio lepom. I itav ivot se promenio.
Sledila je tog oveka i postala je jedna od najuvenijih filmskih glumica.
ta se dogodilo? Samo hipnoza, hipnoza kroz re "lepa" - delovala je. To deluje, to
postaje hemija. Svako veruje neto o sebi. To verovanje postaje stvarnost, jer verovanje
zapoinje delovati na vas.
Imaginacija je sila. Ali to je prizvana, zamiljena sila. Moete je koristiti i moete biti
iskorieni od nje. Ako moete da je koristite, ona e postati korisna, a ako ste korieni od
nje, ona je fatalna, ona je opasna. Mata moe da postane ludilo svakog momenta; imaginacija
moe biti korisna ako kroz nju stvarate situaciju za va unutranji rast i kristalizaciju.
Kroz rei se prizivaju stvari. Za ljudska bia rei, jezik, verbalne konstrukcije postale
su znaajne toliko da sada nita nije znaajnije. Ako iznenada neko kae: 'Vatra', re 'vatra'
odmah e vas promeniti. Moda nema vatre, ali vi ete prestati da me sluate. Nee biti
napora da se stane; iznenada ete prestati da me sluate, poeete da trite tamo-amo. Re
'vatra' obuzela je matu.
Na vas rei utiu na taj nain. Ljudi u poslovima oglaavanja znaju koje rei da koriste
da bi prizvali slike. Kroz ove rei mogu da vas dohvate, mogu zarobiti celo trite. Ima
mnogo takvih rei. Oni ih stalno menjaju sa modom.
55

Zadnjih nekoliko godina re "novo" je ovladala. Tako sve, ako pogledate oglase, jeste
"novo" - "novi" Lux sapun. "Lux sapun" nee delovati. "Novi" privlai odmah. Svako je za
novo; svako traga za novim, neim novim, jer svakome je dosadno sa starim. Tako sve novo
ima privlanost. To moda nee biti bolje od starog, moe biti gore, ali sama re "novo"
otvara vidike u umu.
Ove rei i njihov uticaj treba duboko razumeti. Jer osoba koja je u potrazi za istinom
mora biti svesna uticaja rei. Politiari, ljudi u oglaavanju, koriste rei i mogu kreirati kroz
rei takvu imaginaciju da moete dati svoj ivot - moete odbaciti svoj ivot samo za rei.
Koje su to rei "Nacija", "nacionalna zastava" - samo rei! "Hinduizam" - moete rei:
"hinduizam je u opasnosti" i iznenada mnogi ljudi su spremni da uine neto ili ak da umru.
Samo nekoliko rei. Naa nacija je uvreena. ta je "naa nacija"? Samo rei. Zastava nije
nita drugo do komad platna, ali cela nacija moe umreti za zastavu jer je neko uvredio
zastavu, ponizio je. Kakve besmislice se deavaju u svetu zbog rei! Rei su opasne. One
imaju duboke izvore uticaja unutar vas. One aktiviraju neto u vama, i moete biti zarobljeni.
Mata mora da se razume kae Patanjali, jer na putu meditacije rei e biti odbaene
tako da uticaj od drugih moe biti odbaen. Zapamtite, rei su nauene od drugih; vi niste
roeni s reima. Njima su vas nauili, a kroz rei i mnogim predrasudama. Kroz rei religija,
kroz rei mitova - sa svim tim ste napunjeni. Re je medijum, vozilo kulture, drutva,
informacija.
Ne moete pobuditi ivotinje da se bore za naciju. Ne moete zato to one ne znaju ta
je "nacija". Zbog toga nema ratova u ivotinjskom carstvu. Ne postoje ratovi, nema zastava,
nema hramova, nema damija. Ako bi ivotinje mogle pogledati u nas bile bi prinuene da
misle da ljudi imaju neku opsesiju s reima, jer ratovi nastaju oko njih, milioni bivaju ubijeni
samo zbog rei.
Neko je Jevrejin, "Ubij ga" - samo zbog rei 'Jevrejin'. Promeni etiketu, on postane
hrianin, onda ga ne treba ubiti. Ali on nije spreman da promeni etiketu. On e rei: "Neka
me i ubiju ali neu promeniti svoju etiketu. Ja sam Jevrejin." On je takoe vrst u svom
ubeenju, kao i drugi. Ali to su samo rei.
an Pol Sartr je napisao svoju autobiografiju i dao joj je naslov: "Rei". To je divno
jer to se tie uma itava biografija svakog uma sastoji se samo od rei i niega drugog.
Patanjali kae da ovek treba da bude svestan ovoga, jer na stazi meditacije, rei treba da
budu ostavljene u pozadini. Nacije, religije, spisi, jezici, moraju biti ostavljeni iza i ovek
mora da postane bezazlen, slobodan od rei. Kada ste slobodni od rei nee biti mate, a kada
nema imaginacije vi se moete suoiti sa istinom. Inae, nastaviete da je stvarate.
Ako doete da se sretnete s Bogom, morate ga sresti bez ikakvih rei. Ako imate neke
rei, on moda nee pristajati i odgovarati vaoj ideji. Jer ako hindus misli da on ima hiljadu
ruku, a Bog doe samo sa dve ruke, hindus e ga odbaciti: "Ti nisi uopte Bog. Samo s dve
ruke? Bog ima hiljadu ruku. Pokai mi svoje druge ruke. Samo onda ti mogu verovati."
To se dogodilo. Jedna od najlepih osoba iz prolog stolea bio je Sai Baba iz irdija.
On je imao prijatelje i sledbenike. Sai Baba je bio musliman. Niko nije znao da li je bio
musliman ili hindus, ali je iveo u damiji pa se zato verovalo da je musliman. Sledbenik
hindus je bilo tamo, voleo ga je i potovao, imao mnogo vere u Sai Babu. Svakog dana bi
dolazio za svoj daran, ne bi otiao dok ga ne vidi. Ponekad se dogaalo da bi ekao celog
dana, ali bez vienja on ne bi odlazio, a ne bi uzimao ni hranu dok ne bi video Sai Babu.
Jednom se dogodilo da je ceo dan proao, mnotvo se sakupilo i velika gomila - a on
nije mogao da ue. Kada su svi otili, uvee, on je dodirnuo njegova stopala.
Sai Baba mu je rekao: "Zato nepotrebno eka? Nije nuno da me vidi ovde, ja
mogu doi tamo. Prekini sa tim od sutra. Sada u ja delovati. Pre nego to uzme hranu
videe me svakog dana."
Uenik je bio vrlo srean. Tako da je sledeeg dana ekao i ekao, nita se nije
dogodilo. Mnoge stvari su se dogodile stvarno, ali nita se nije dogodilo prema njegovoj
koncepciji. Do veeri je postao vrlo srdit. Nije uzeo hranu, a Sai Baba se nije pojavio pa je
opet ekao. Rekao je: "Obeao si, a nisi ispunio obeanje?"
56

Sai Baba je rekao: "Ali ja sam se pojavio tri puta, ne samo jednom. Prvi put kada sam
doao, bi sam prosjak a ti si mi rekao: "Skloni se dalje! Ne dolazi ovamo!" Drugi put kada
sam doao bio sam starica, a ti nisi hteo da me pogleda, zatvorio si oi" - jer sledbenici imaju
naviku da ne gledaju ene; on je praktikovao ne gledanje ene, stoga je zatvorio oi. Sai Baba
je rekao: "Ja sam dolazio, ali ta si ti oekivao? Treba li da uem u tvoje oi, zatvorene oi?
Stajao sam tamo, ali ti si zatvorio oi. Onog momenta kada si me ugledao, zatvorio si oi.
Onda sam trei put doao kao pas, a ti mi nisi dozvolio da uem unutra. Sa tapom si stajao na
vratima."
Te tri stvari su se dogodile. I ove tri stvari se dogaaju celom oveanstvu. Boansko
dolazi u mnogim oblicima, ali vi imate predubeenja; imate unapred stvorene koncepcije; ne
moete videti. Bog mora da se pojavi saglasno s vaim oekivanjima, a on se ne pojavljuje
nikada u saglasnosti s vama. On se nikada nee pojaviti prema vaim oekivanjima. Vi ne
moete postavljati pravila za njega i ne moete postavljati nikakve uslove.
Kada sve zamisli otpadnu, samo tada se istina pojavljuje. Jer zamisli stalno stvaraju
uslove i istina kakva jeste ne moe se pojaviti. Samo u otvorenom umu, samo u golom,
praznom umu, istina se javlja, jer je tada vi ne moete izobliiti.
etvrta sutra:
Modifikacija uma koja je zasnovana na odsustvu ma kakvog sadraja u njemu, jeste
spavanje.
Ovo je definicija spavanja u dubokom snu, etvrte modifikacije uma, kada ne postoji
sadraj. Um je uvek sa sadrajem, izuzev dubokog sna bez snova. Neto je uvek tu. Neka
misao se kree, neka strast se kree, neka elja se kree, neko seanje, neka budua zamisao,
neka re, neto se kree. Neto se nastavlja neprekidno.16 Samo kada vrsto zaspite, u
dubokom snu, sadraji prestaju. Um iezava, a vi ste u sebi bez ikakvog sadraja.
Ovo treba zapamtiti jer e takvo biti takoe stanje samadhija, samo s jednom
razlikom: vi ete biti svesni. U dubokom snu, vi ste nesvesni, um odlazi potpuno u
nepostojanje. Vi ste sami, ostali ste sami - nema misli, samo vae bie. Ali niste svesni. Um
nije tu da vam smeta, ali vi niste svesni, budni.
Inae spavanje moe biti prosvetljenje. Besadrajna svest je tu, ali svesnost nije
aktuelna, budna. Ona je skrivena - ba kao seme. U samadhiju seme je niklo, svest postaje
aktuelna, budna. A kada je svesnost aktuelna i budna a nema sadraja, to je cilj. Spavanje
sa sveu je cilj.17
Ovo je etvrta modifikacija uma - dubok san. Ali taj cilj, spavanje sa svesnou, nije
modifikacija uma, to je izvan uma. Svest je iza uma. Ako moete spojiti spavanje bez snova i
svesnost zajedno, vi ste postali prosvetljeni. Meutim to je teko, jer i kada smo budni tokom
dana mi nismo svesni. ak i kada smo budni na javi, mi nismo budni. Re je netana. Kada
spavamo, kako moemo biti budni? Kada smo budni mi nismo probueni.
Stoga morate poeti na javi, kada ste budni po danu. Morate biti vie probueni, vie i
vie, jae probueni. Onda treba da pokuate sa snovima, dok sanjate morate biti budni. Samo
ako uspete sa budnim stanjem, na javi, zatim sa stanjem sanjanja, onda ete moi da uspete sa
treim stanjem dubokog sna bez snova.
Pokuajte prvo s budnou na ulici. Probajte da budete budni. Samo ne hodajte uvek
automatski, mehaniki. Budite paljivi, svesni svakog pokreta, svakog daha koji uzmete.
Izdahnite, udahnite - budite budni. Svakog pokreta oiju koji nainite, svake osobe u koju
pogledate, budite svesni. Sve to radite, budite budni i radite to sa svesnou.
16

Svo to kretanje je od prakrti, prirode, to ona samu sebe osmiljava pod privlanim dejstvom Duha u nama. Sve
misli su od prakrti, nisu nae. Mi ih samo koristimo i identifikujemo se sa njima.
17
Drugim reima: budnost za vreme sna koji sainjava ovaj svet. To je svrha inkarnacija dua. Izvan roenja u
telu, izmeu inkarnacija, due su u svom autentinom stanju (svarupa - vidi Joga sutre 1.3). Raaju se u ovaj
svet iluzije individualnosti i odvojenosti da bi se ovde probudile za ono to uvek jesu. Na taj nain Boansko,
ije su due samo emanacije, postaje aktuelno u svim planovima svoga postojanja. Zato je u naem ivotu pojava
lucidnih snova ili vantelesnih iskustava vrlo vana kao obuka na tom putu buenja. Zapravo iskustva buenja u
snu se sama prva pojavljuju kao posledica ispravne meditacije.
57

A onda tokom noi, dok se uspavljujete, pokuajte da ostanete budni. Poslednja faza
dana e prolaziti, seanja e ploviti. Ostanite budni, i pokuajte da se uspavate sa budnou.
To e biti teko, ali ako pokuate, unutar nekoliko sedmica, imaete kratko iskustvo: vi ste
uspavani i budni. Makar za jedan trenutak, a to je tako lepo, tako ispunjeno blaenstvom, da
nikada neete opet biti isti.
A onda vie neete govoriti da je spavanje samo gubljenje vremena. To moe postati
najdragocenija sadhana, jer kada budno stanje odlazi i spavanje zapone, postoji promena,
promena brzine unutra. To je ba kao promena brzine u autu. Kada menjate brzinu od jedne
do druge, za jedan trenutak, izmeu te dve brzine, postoji neutralan hod, nema zupanika. Taj
trenutak neutralnosti je vrlo znaajan.
Isto se dogaa u umu. Kada se od budnog stanja kreete prema spavanju, postoji
trenutak kada ste niti budni niti uspavani. U tom trenutku ne rade zupanici, mehanizam ne
funkcionie. Vaa automatska linost je ponitena u tom trenutku. U tom trenutku vae stare
navike nee vas prisiljavati na odreene obrasce. U tom trenutku moete pobei i postati
budni.
Ovaj trenutak se u Indiji nazivao sandhya, trenutak izmeu. Postoje dve sandhye, dva
meu-momenta: jedan uvee kada idete od budnosti do spavanja, a drugi ujutru kada se opet
kreete od spavanja do budnosti. Ova dva trenutka hindusi su nazvali trenucima molitve,
sandhyaka - period izmeu jer onda vaa linost nije tu za jedan trenutak. U tom jednom
trenutku vi ste isti, bezazleni. Ako u tom trenutku moete postati svesni, ceo va ivot e se
promeniti. Postavili ste osnovu za preobraaj.
Zatim pokuajte da u stanju sanjanja budete budni. Postoje metode kako da budete
budni u stanju sanjanja. Uradite jednu stvar, ako elite da pokuate... Prvo pokuajte u
budnosti, onda ete moi da uspete u sanjanju. Jer sanjanje je dublje, vei napor e biti
potreban. I teko je takoe, jer ta da se radi u snu i kako to da se radi?
Za sanjanje Gurijev je razvio lepu metodu. To je jedna od tibetanskih metoda, a
tibetanski tragaoci su vrlo duboko istraivali svet snova. Metoda je: za vreme padanja u san
pokuavate da zapamtite jednu stvar, bilo koju stvar, samo cvet rue. Samo vizualizujte ruin
cvet. Nastavite da razmiljate da ete videti to u snu. Vizualizujte to i nastavite da mislite o
tome u snu, ta god da sanjate, ruin cvet mora biti prisutan. Vizualizujte njene boje, njen
miris - sve. Oseajte je tako da postane iva u vama. I sa tom ruom, padnite u san, zaspite.
Za nekoliko dana uspeete da unesete cvet u svoj san. Ovo je veliki uspeh jer sada ste
stvorili barem deo sna. Sada ste majstor. Barem je doao jedan deo sna, cvet. Onog momenta
kada vidite cvet, vi ete se odmah setiti da je to san.
Nita drugo nije potrebno. Cvet i "ovo je san" postali su spojeni jer ste stvorili cvet u
snu. I mislili ste neprekidno da se taj cvet pojavi u snu, i cvet se pojavio. Odmah ete
prepoznati da je to san, i itav kvalitet sanjanja e se promeniti, sanjani cvet i sve oko
sanjanja. Postali ste budni.
Onda moete uivati u snu na nov nain, ba kao u filmu, ako elite da zaustavite
sanjanje jednostavno ga moete zaustaviti, odloiti. Ali za to e trebati vie vremena i vie
prakse. Onda moete kreirati svoje vlastite snove. Nije potrebno da budete rtva snova.
Moete stvoriti svoje vlastite snove; moete iveti svoje vlastite snove. Moete imati temu
upravo pre nego to se uspavate; moete reirati svoje snove kao filmski reiser. I moete
kreirati temu iz njih.
Tibetanci su koristili kreirane snove, jer kroz kreiranje sna moete potpuno promeniti
va um, njegovu strukturu. A kada uspete u snovima, onda moete uspeti u dubokom snu bez
snova. Ali za dubok san ne postoji tehnika, jer tamo nema sadraja. Tehnika moe delovati
samo sa sadrajem. Zato ako nema sadraja, nijedna tehnika ne moe pomoi. Ali kroz
sanjanje vi ete nauiti sa budete svesni, a ta svesnost se moe preneti u dubok san bez snova.
Poslednja sutra:
Pamenje je prizivanje prolih iskustava.
Ovo su definicije. On razjanjava stvari tako da ih kasnije ne pobrkate. ta je
pamenje? Prizivanje prolih iskustava. Pamenje se neprekidno deava. Kad god vidite
58

neto, odmah seanje ue unutra i izoblii to. Videli ste me ranije. Vidite me opet, odmah
seanje ue unutra. Ako ste me videli pre pet godina, onda slika od pre pet godina, prola
slika, dolazi u vae oi i ispunjava ih. I videete me kroz tu sliku.
Zbog toga ako odavno niste videli prijatelja, onog momenta kada ga vidite odmah
kaete: "Izgleda vrlo mrav" ili "Izgleda vrlo nezdravo," ili "Izgleda vrlo debelo." Odmah!
Zato? Jer uporeujete; seanje je ulo unutra. Sam ovek nije svestan da je sakupio salo, ili je
postao mrav, ali postaje svestan tako to odmah uporeuje. Prolost, prola slika ue unutra, i
odmah moete uporediti.
I ovo pamenje koje je neprekidno tu, biva projektovano na sve to vidite. Ova seanja
iz prolosti treba da budu odbaena. Ne treba da bude konstantnog meanja u vaem
saznavanju jer vam to ne dozvoljava da znate novo. Uvek znate novo u obrascu starog. To
vam ne dozvoljava da osetite novo, to ini sve starim i ukorenjenim. Zbog ovog seanja,
svakom je dosadno; celom oveanstvu je dosadno. Pogledajte lice bilo ije, njemu je
dosadno, smrtno dosadno. Nema niega novog, nema ekstaze.
Zato su deca tako ekstatina. I za tako male stvari vi ne moete zamisliti kako se ta
ekstaza deava. Samo zbog nekoliko obojenih kamenia na plai ona poinju da pleu. ta se
njima deava? Zato vi ne moete plesati? Jer vi znate da je to samo kamenje; vae seanje je
tu. Za tu decu nema seanja, ovo kamenje je nova pojava - kao da su stigli sa Meseca.
itao sam kada je prvi ovek doao na Mesec svuda u svetu je vladalo uzbuenje. Svi
su gledali TV, ali kada se sve zavrilo, za petnaest minuta svima je bilo dosadno. ta sad da se
radi? ovek hoda na mesecu. Posle samo petnaest minuta, a san da se stigne tamo trajao je
milionima godina... Niko sada nije zainteresovan ta se dogaa.
Sve postaje staro. im neto postane seanje, to postaje staro. Ako biste mogli da
odbacite svoje pamenje! Odbacivanje ne znai da prestajete da se seate, odbacivanje samo
znai prestanak ovog konstantnog meanja. Kada vam treba, moete seanje povui natrag u
sredite panje. Kada vam ne treba, samo ga pustite da bude tu, tiho, bez neprekidnog
nametanja.
Prolost, ako je stalno prisutna, nee dozvoliti sadanjosti da postoji. A ako propustite
sadanjost, vi proputate sve.

Poglavlje 6
ISTOTA JOGE
30. decembar 1973.
Pitanje prvo:
Rekli ste da je Patanjalijeva nauka egzaktna nauka, apsolutno logina, u kojoj je
rezultat izvestan kao to dva plus dva ine etiri. Ako postignue nepoznatog i beskonanog
moe biti svedeno samo na logiku, nije li istinito i u isto vreme apsurdno da je beskonani
fenomen unutar orbite konanog uma?
To izgleda apsurdno, to izgleda nelogino, ali egzistencija je apsurdna i egzistencija je
nelogina. Nebo je beskonano, ali se moe reflektovati u vrlo malenoj barici, beskonano
nebo se moe reflektovati u malom ogledalu. Naravno ono celo se nee reflektovati; ne moe
biti reflektovano. Ali deo je takoe celina i deo takoe pripada nebu.
Ljudski um je samo ogledalo. Ako je ist onda beskonano moe biti reflektovano u
njemu. Refleksija nee biti beskonana, bie samo deo, samo delimian uvid. Ali i taj
59

delimian uvid postaje prolaz. Onda, postepeno, moete ostaviti ogledalo i kroz taj uvid ui u
beskonano, ostaviti refleksiju i ui u realno.
Izvan vaeg prozora, malog okvira prozora, beskonano nebo je tu. Moete gledati
kroz prozor, neete videti celo nebo, naravno, ali koliko god da vidite jeste nebo. Dakle,
jedina stvar koju treba zapamtiti jeste da ne mislite da to to ste videli jeste beskonano. To
moe biti od beskonanog, to nije beskonano. Dakle ta god ljudski um moe shvatiti moe
biti boansko, ali je samo deo njega, jedan uvid. Ako se stalno seate toga, onda nema greke.
Onda uskoro, razbijete okvir, uskoro unitite um potpuno tako da on kao ogledalo vie nije tu,
osloboeni ste od refleksije i ulazite u samu realnost.
Povrno gledano izgleda apsurdno. Kako, u tako malenom umu, moe biti ikakvog
kontakta sa venim, sa beskonanim, sa beskrajnim? Druga stvar treba takoe da se razume.
Ovaj siuni um nije malen zaista, jer je i deo beskonanog. On izgleda malen zbog vas; on
izgleda konaan zbog vas. Vi ste stvorili te granice. Granice su lane. Va maleni um pripada
beskonanom; on je deo njega.
Ima mnogo stvari koje treba razumeti. Jedna od najparadoksalnijih stvari o
beskonanom je ovo: da je deo uvek jednak celini - jer ne moete deliti beskonano. Sve
podele su lane. Moe biti korisno deliti ga. Ja mogu rei da je nebo nad mojom kuom, nad
mojom terasom, moje nebo kao to Indija kae da je nebo iznad indijskog kontinenta indijsko
nebo. ta pod tim mislite? Ne moete deliti nebo. Ono ne moe biti indijsko ili kinesko, ono
je jedno nedeljivo prostranstvo. Nigde ne poinje i nigde se ne zavrava.
Isto se deava sa umom. Vi to nazivate vaim umom; to "vae" je greka. Um je deo
beskonanog. Upravo kao to je materija deo beskonanog, um je deo beskonanog. Vaa
dua je takoe deo beskonanog.
Kada je "moje" izgubljeno, vi ste beskonani. Dakle, ako vi izgledate ogranieni, to je
jedna iluzija. Ogranienja nisu realna, to su samo koncepcije, iluzije. I zbog vae koncepcije
vi ste ogranieni u tome. Ma ta da mislite, vi to postajete. Buddha je rekao - i ponavljao je to
neprekidno etrdeset godina - da ta god vi mislite to postajete. Miljenje ini ma ta da jeste.
Ako ste ogranieni, to je stajalite koje ste uzeli. Odbacite to stajalite i postaete beskonani.
Ceo proces joge je kako da se to odbaci - kako da se odbaci okvir, kako da se uniti
ogledalo, kako da se kreete od refleksije do realnosti, kako da odete izvan granica.
Granice ste sami stvorili; one stvarno nisu tu. One su samo misli. Zbog toga, kad god
nema misli u umu, vi niste. Um bez misli je bez ega; nerazmiljajui um je bezgranian um,
nerazmiljajui um je ve beskonaan. ak i za jedan trenutak, ako nema misli, vi ste
beskonani - jer bez misli ne moe biti granice; bez misli vi iezavate i boansko se sputa.
Da se bude u mislima, znai da se bude ovek; da se bude ispod misli je da se bude
ivotinja; a da se bude iznad misli je biti boanski. Meutim, logini um e postavljati pitanja.
Logini um e rei: "Kako deo moe biti jednak celini? Deo mora biti manji nego celina. To
ne moe biti jednako."
Uspenski pie, u jednoj od najboljih, u jednoj od nekoliko najboljih knjiga u svetu,
Tertium organum, da deo ne moe samo biti jednak celini, on moe biti ak vei nego celina.
Inae on to naziva viom matematikom. Matematika pripada Upaniadama. U isha vasyi (Ia
upaniada) je reeno: "Moete izvaditi celo iz celog, a jo celo ostaje celo. Moete staviti celo
u celo, a jo celog staje u celom."18
To je apsurdno. Ako elite da zovete to apsurdom, moete nazvati apsurdom, ali je
realnost, to je via matematika gde se granice gube i kap postaje okean. A okean nije nita
drugo nego kap.
Logika postavlja pitanja, nastavlja da ih postavlja. To je priroda loginog uma, da
postavlja pitanja. Ako nastavite da sledite ta pitanja, moete ii dalje ad infinitum. Ostavite po
strani um - njegovu logiku, njegovo rezonovanje i za nekoliko trenutaka pokuajte da budete
bez misli. ak i za jedan trenutak ako biste mogli postii to stanje bez misli, vi ete shvatiti da
je deo jednak celini, jer iznenada ete videti da su sve granice iezle. One su bile granice iz
sna. Sve podele su iezle, a vi i celina postali ste jedno.
18

Drugi prevod: Puno je ono, puno je ovo. Iz punoe puno izvire. Od punoe kad se puno uzme, punoa opet
ostaje.
60

Ovo moe biti samo iskustvo; to ne moe biti logiko zakljuivanje. Ali kada kaem
da je Patanjali logian, ta mislim? U zakljucima niko ne moe biti logian to se tie
unutarnjeg, duhovnog, najvieg iskustva. Ali dok ste na stazi moete biti logini. to se tie
najviih rezultata joge, Patanjali takoe ne moe biti logian; niko ne moe biti. Ali da bi
postigli taj cilj moete da sledite logian put.
U tom smislu Patanjali je logian i racionalan, matematiki nauan. On ne trai
nikakvu veru. On trai samo hrabrost za eksperiment, hrabrost za kretanje, hrabrost da se
skoi u nepoznato. On ne kae: "Veruj, i onda e iskusiti." On kae: "Iskusi, i onda e
poverovati."
On je napravio strukturu kako da se napreduje korak po korak. Njegova staza nije
nasumina, ona nije kao lavirint, ona je kao odlian autoput. Sve je isto i ide se najkraim
moguim putem. Ali morate ga slediti u svakom detalju, inae kretaete se izvan staze i u
divljini.
Zbog toga kaem da je logian, i videete kako je logian. On zapoinje od tela jer vi
ste ukorenjeni u telu. On zapoinje i radi s vaim disanjem, jer vae disanje je va ivot. Prvo
on radi na telu, onda on radi na prani - na drugom sloju egzistencije - vaem disanju; onda
zapoinje da radi na mislima.
Ima mnogo metoda koje zapoinju direktno sa mislima. One nisu tako logine i
naune jer ovek s kojim radite je ukorenjen u telu. On je soma, telo. Nauni pristup mora
zapoeti sa telom. Vae telo prvo mora biti promenjeno. Kada se vae telo menja, onda vae
disanje moe biti promenjeno. A kada se vae disanje promeni, tada vae misli mogu da se
promene. I kada se vae misli promene, onda vi moete biti promenjeni.
Moda niste primetili da ste vi gusto isprepleten sistem od mnogo slojeva. Ako trite,
onda se vae disanje menja jer je potrebno vie kiseonika. Kada trite vae disanje se menja, a
kada se vae disanje menja i vae misli se odmah menjaju.
Na Tibetu kau da ako ste ljuti, onda samo trite. Napravite dva ili tri kruga oko kue,
a onda se vratite natrag da vidite da li je ljutnja prestala - jer ako trite brzo, vae disanje se
menja; ako se vae disanje menja, obrazac vaih misli ne moe ostati isti, on mora da se
promeni.
Nije potrebno da se tri. Moete jednostavno uzeti pet dubokih udisaja - izdahnite,
udahnite - i vidite gde je vaa ljutnja otila. Teko je promeniti ljutnju direktno. Lake je
promeniti telo, onda disanje, pa onda ljutnju. Ovo je nauni proces. Zbog toga kaem da je
Patanjali naunik.
Niko nije bio tako nauan. Ako odete kod Buddhe on e rei: "Odbaci ljutnju."
Patanjali nikada nee to rei. On e rei da ako ste ljuti, to znai da imate obrazac disanja
koji pomae ljutnju, i dok se obrazac disanja ne promeni vi ne moete odbaciti ljutnju. Moete
se boriti, ali to nee pomoi - ili, to moe uzeti vrlo dugo vreme. Nepotrebno. Dakle, on e
posmatrati va obrazac disanja, ritam disanja, ako imate odreen ritam disanja, to znai da
imate odreeni telesni stav za to.
Najgrublje je telo, a najsuptilniji je um. Nemojte zapoinjati od suptilnog, jer e to biti
tee. To je nejasno; ne moete shvatiti to. Zaponite sa telom. Zbog toga Patanjali zapoinje
sa poloajima tela.
Moda niste zapazili, jer smo mi tako nesvesni u ivotu, da kad god imate odreeno
raspoloenje u umu vi imate odreeni poloaj tela spojen s njim. Ako ste ljuti, moete li sedeti
oputeno? Nemogue. Ako ste ljuti poloaj vaeg tela e se menjati; ako ste paljivi onda e
se va poloaj tela promeniti; ako ste pospani poloaj vaeg tela e se promeniti.
Ako ste potpuno smireni sedeete kao Buddha, hodaete kao Buddha. Ako hodate kao
Buddha, osetiete izvesnu tiinu kako se sliva unutar vaeg srca. Izvestan tihi most je stvoren
vaim hodom nalik Buddhi. Samo sednite ispod drveta kao Buddha. Samo sedite, samo
telesno. Iznenada ete videti da se vae disanje menja. Ono je mnogo oputenije; ono je
mnogo harmoninije. Kada je disanje harmonino i oputeno, osetiete da je um manje napet.
Misli je manje, manje oblaka, vie prostora, vie neba. Osetiete kako unutra i spolja tee
tiina.
61

Zato kaem da je Patanjali naunik. Ako elite da promenite poloaj tela, Patanjali
e vam rei da promenite svoje navike hrane, jer svaka navika hrane stvara suptilne poloaje
tela. Ako ste mesoder ne moete sedeti kao Buddha. Ako niste vegetarijanac va poloaj e
biti razliit, ako ste vegetarijanac va poloaj e biti drugaiji - jer telo je izgraeno od hrane.
To nije sluajnost. ta god da stavite u telo, telo e to odraavati.
Stoga vegetarijanstvo za Patanjalija nije moralistiki kult, to je nauna metoda. Kada
jedete meso vi ne uzimate samo hranu, vi dozvoljavate odreenoj ivotinji, od koje je meso,
da ue u vas. Meso je bilo deo odreenog tela; meso je bilo deo odreenog obrasca instinkta.
Meso je bilo ivotinja samo pre nekoliko sati, i to meso nosi sve impresije ivotinje, sve
navike ivotinje. Kada jedete meso mnoga vaa stanovita i dranja e biti uslovljena njme.
Ako ste senzitivni moete postati svesni da kad god pojedete odreene stvari, odmah
dolaze izvesne promene. Moete uzeti alkohol i onda niste isti. Odmah nova linost stie
unutra. Alkohol ne moe kreirati linost, ali on menja va obrazac tela. Telo je hemijski
promenjeno. Sa promenom hemije tela, um mora da promeni svoj obrazac; a kada um
promeni obrazac nova linost je stigla unutra.
uo sam jednu od najstarijih kineskih pria, da se desilo da je boca rakije pala sa stola
- sluajno; moda je skoila maka. Boca se razbila i rakija se razlila svuda po podu. Nou su
tri mia pila rakiju, jedan mi je odmah rekao: "Sada, idem kod kralja, u palatu, da ga stavim
na njegovo pravo mesto." Drugi je rekao: "Ja se ne brinem za kraljeve. Ja u sam biti car
celog sveta." A trei je rekao: "Radite vi, drugari, ta god elite. Ja idem na sprat da vodim
ljubav sa makom."
itava linost se promenila - mi razmilja da vodi ljubav sa makom? To se moe
dogoditi; to se deava svakog dana. ta god pojedete menja vas, ta god popijete menja vas,
jer telo je veliki deo vas. Devedeset procenata, vi ste vaa tela.
Patanjali je naunik jer on zapaa sve - hranu, poloaje, nain kako spavate, nain
kako ustajete ujutru, kada ustajete ujutru, kada idete da spavate. On uzima sve u obzir tako da
vae telo postane mesto za neto vie.
Onda on obraa panju na vae disanje. Ako ste tuni, vi imate razliit ritam disanja.
Samo to zabeleite. Probajte, moete imati vrlo lep eksperiment. Kad god ste tuni samo
posmatrajte svoje disanje - koliko dugo udiete, a onda koliko dugo izdiete. Samo to
zapazite, beleite. Samo brojte unutra; jedan, dva, tri, etiri, pet Brojite do pet i onda je
udisanje zavreno. Onda brojte izdisanje - brojanje dolazi do deset; izdisanje je zavreno.
Samo posmatrajte to tano tako da moete saznati odnos. Onda, kad god oseate sreu, odmah
probajte da diete po tom obrascu tuge - pet, deset. Sva srea e ieznuti.
Obrnuto je takoe istina. Kad god se osea srenim, primeti kako die. I kad god se
osea tunim, probaj taj obrazac. Tuga e odmah nestati, jer um ne moe postojati u
vakuumu. On postoji u sistemu, a disanje je za um najdublji sistem.
Disanje je misao. Ako prestane disati, misli odmah stanu. Pokuaj na sekundu.
Zaustavi disanje. Odmah nastaje pauza u procesu miljenja; proces je prekinut. Miljenje je
nevidljivi deo vidljivog disanja.
To je ono to mislim kada kaem da je Patanjali nauan. On nije pesnik. Ako kae:
"Ne jedi meso", on to ne kae zato to je jedenje mesa nasilje, ne. Kae zato to je jedenje
mesa samodestruktivno. Ima pesnika koji kau da je biti nenasilan lepo; Patanjali kae da
biti nenasilan znai biti zdrav, da je biti nenasilan dobro za tebe. Ne saosea s nekim drugim,
saosea sa sobom.
On je zaokupljen tobom i transformacijom. A ne moe promeniti stvari samo
razmiljanjem o promeni. Mora stvoriti situaciju. Inae, svuda po svetu ljubav se poduava,
ali ljubav nigde ne postoji, jer ne postoji situacija. Kako moe voleti ako si mesoder? Ako
jede meso, tu je nasilje. A s tako dubokim nasiljem, kako moe voleti? Tvoja e ljubav biti
samo lana. Ili, ona moe biti samo oblik mrnje.

62

Ima jedna stara indijska pria. Hranski misionar prolazio je umom. Naravno, on je
verovao u ljubav, tako da nije nosio puku. Odjednom je spazio tigra kako se pribliava.
Uplaio se. Poeo je misliti: "Sada Jevanelje ljubavi nee delovati. Bilo bi pametno da sam
uzeo puku."
Ali neto se moralo uiniti, i to hitno. Onda se setio da je neko negde rekao da e,
ako tri, tigar krenuti za tobom, i za as e te uhvatiti i ti si mrtav. Ali ako zuri u tigrove oi,
onda postoji mogunost, moda ga impresionira, hipnotie. Moda promeni miljenje. I
postoje prie da su mnogo puta tigrovi promenili miljenje, odunjali su se dalje.
Dakle, vredelo je pokuati, nije bilo koristi od bega. Misionar je zurio. Tigar je priao
blizu. I on je zurio u misionarove oi. Pet minuta stajali su licem u lice, zurei jedan drugome
u oi. Onda je odjednom misionar ugledao udo. Tigar je odjednom sastavio ape i sagnuo se
preko njih u vrlo moliteljskoj pozi - kao da moli.
To je bilo previe! ak ni misionar nije oekivao tako neto - da bi tigar poeo da se
moli. Bio je srean. Ali onda je pomislio: "ta sad uiniti? ta u sad?" Ali, za to vreme je i
on postao hipnotisan, ne samo tigar - tako pomisli: "Bolje da sledim tigra."
I on se sagnuo, poeo moliti. Prolo je jo pet minuta. Onda je tigar otvorio oi i
rekao: "ovee. ta to radi? Ja izgovaram zahvalnicu, ali ta ti radi?" Tigar je bio
religiozan, poboan - ali samo u mislima. U stvari je bio tigar, i bie opet tigar. Doao je da
ubije oveka; izgovara zahvalnicu.
Takvo je stanje kod svih ljudi, celog oveanstva - pobonost samo u mislima; u
delima, ovek ostaje ivotinja. I uvek e biti tako dok se ne prestanemo vezivati za misli i
ponemo stvarati situacije u kojima se misli menjaju.
Patanjali nee rei da je dobro voleti. On e vam pomoi da stvorite situaciju u kojoj
ljubav moe cvetati. Zbog toga kaem da je on nauan. Ako ga sledite korak po korak
videete u sebi mnoge procvate koji su pre bili neshvatljivi, nezamislivi. Nikada niste mogli
niti sanjati o njima. Ako promenite hranu, ako promenite poloaje tela, ako promenite obrasce
spavanja, ako promenite uobiajene navike, videete da se u vama uzdie nova osoba. A onda
su mogue i drugaije promene. Nakon jedne promene i druga promena postaje mogua.
Korak po korak otvara se vie mogunosti. Zbog toga kaem da je on logian. On nije logini
filozof, on je logian, praktian ovek.
Pitanje drugo.
Jue ste govorili o zapadnom misliocu koji je poeo sumnjati u sve u to se moe
posumnjati, ali koji nije mogao sumnjati u sebe. Rekli ste da je to veliko postignue u pravcu
otvaranja prema Boanskom. Kako?
Otvaranje prema vioj svesti podrazumeva da u sebi morate imati neto to je
nesumnjivo; to znai oslonac. Morate imati barem jednu pouzdanu taku, u koju ne moete
posumnjati sve i da hoete. Zato sam rekao da je Dekart doao do te take, svojim logikim
istraivanjem doao je do toga da "Ne moemo sumnjati u sebe. Ne mogu sumnjati da ja
jesam, jer ak i da kaem 'ja sumnjam', ja moram biti tu. Sama tvrdnja 'Ja sumnjam' dokazuje
da ja jesam."
Sigurno ste uli uvenu Dekartovu izjavu: Cogito, ergo sum - "Mislim, dakle jesam".
Sumnjanje je miljenje: sumnjam, dakle jesam. Ali to je samo jedan otvor, a Dekart nije
nikada, nikada otiao dalje od tog otvora. Vratio se nazad. Moete se vratiti i sa samih vrata.
On je bio srean to je naao centar, nesumnjivi centar, a onda je poeo da smilja filozofiju.
Tako je sve ono to je ranije negirao uvukao unutra kroz zadnja vrata: "Zato to jesam, mora
postojati i Tvorac koji me stvorio." I tu je zastranio - onda su nebesa i pakao, Bog i greh, i sva
hrianska teologija uli na zadnja vrata.
On je to uzeo kao filozofsko istraivanje. On nije bio jogin; zapravo nije ni bio u
potrazi za svojim biem, bio je u potrazi za teorijom. Ali vi to moete upotrebiti kao otvor.
Otvor znai da ga morate nadii; morate poi dalje; morate to prevazii; morate proi kroz to.
Ne smete se uhvatiti za to. Ako se uhvatite, svaki otvor e se zatvoriti.
63

Dobro je spoznati da barem "ne mogu sumnjati u sebe". Onda e ispravan korak biti
ovaj: "Ako ne mogu sumnjati u sebe, ako oseam da jesam, onda moram znati ko sam ja."
Tada to postaje pravo istraivanje. Tada zalazi u religiju, jer kada pita: "Ko sam ja?",
postavio si fundamentalno pitanje. Ne filozofsko ve egzistencijalno. Niko ne moe
odgovoriti ko si ti; niko ti ne moe dati unapred pripremljen odgovor. Mora traiti sam u
sebi; morae to iskopati unutar sebe.
Sama logika izvesnost da "Ja jesam" nije od velike koristi ako ne krene napred i
pita: "Ko sam ja?", a to i nije pitanje, to e postati potraga. Pitanje te moe odvesti filozofiji,
potraga te vodi religiji. Tako, ako osea da ne zna sebe, nemoj nikoga pitati "Ko sam ja?"
Niko ti ne moe odgovoriti. Ti si tamo unutra, skriven. Mora prodreti u tu dimenziju u kojoj
jesi, susresti sebe.
To je drugaija vrsta putovanja, unutarnja. Sva naa putovanja su vanjska: gradimo
mostove da stignemo do neeg ili nekog drugog. Potraga znai da mora sruiti sve mostove
ka drugima. Sve to si uinio izvana mora se odstraniti, i neto novo mora biti zapoeto
unutra. To e biti teko, samo zato to si postao tako fiksiran na vanjsko. Uvek razmilja o
drugima; nikada ne razmilja o sebi.
To je udno, ali niko ne razmilja o sebi - svi razmiljaju o drugima. Ako ponekad
razmilja o sebi, to je takoe u odnosu na druge. To nikada nije isto. Naprosto nije samo o
tebi. Onda kada misli samo o sebi razmiljanje se mora prekinuti, jer ta moe misliti? O
drugima moe misliti, misliti znai "o" neemu. ta moe misliti o sebi? Morae prekinuti
razmiljanje i morae pogledati unutra - ne misliti, ve gledati, promatrati, uoavati,
svedoiti. Celi proces e se promeniti. ovek mora traiti sebe.
Sumnja je dobra. Ako sumnja, i ako trajno sumnja, postoji samo jedan fenomen
koji je kao stena, u koji se ne moe sumnjati, a to je tvoje postojanje. Tada e se pojaviti novo
traganje, i to nee biti pitanje. Morae se zapitati "Ko sam ja?"
Ramana Mahari celog svog ivota svojim je uenicima davao samo jednu tehniku.
On bi rekao: "Samo sedni, zatvori oi, i pitaj se 'Ko sam ja?, Ko sam ja?' Koristi to umesto
mantre." To nije mantra. Ne smete to koristiti kao mrtve rei. To mora postati unutarnji
prodor.
Nastavi se pitati to. Tvoj e um mnogo puta odgovoriti da si dua, da si sopstvo, da si
boanski, ali nemoj sluati te stvari, one su sve pozajmljene, te stvari si uo. Ostavi ih po
strani sve dok ne sazna ko si ti. I ako nastavi ostavljati um po strani, jedan dan doi e do
eksplozije. Um eksplodira, i sve pozajmljeno znanje nestaje iz tebe. I po prvi put ti se nalazi
licem u lice sa sobom, gledajui unutar sebe. To je otvaranje. I to je put, to je potraga.
Pitaj se ko si ti i ne kai se za jeftine odgovore. Svi odgovori dati od drugih su
bezvredni. Pravi odgovor moe doi jedino iz tebe. Ba kao to pravi cvet moe doi jedino iz
samog stabla, ne moe ga tamo staviti izvana. Moe, ali to e onda biti mrtav cvijet. To
moe zavarati druge, ali nee zavarati samo stablo. Stablo zna da "to je samo mrtvi cvet koji
visi na mojoj grani. On je samo optereenje. To nije srea, to je samo teret." Stablo ga ne
moe slaviti; ne moe ga prihvatiti.
Stablo moe prihvatiti jedino ono to je stiglo iz samog korenja, iz unutarnjeg bia,
najdublje sri. A kada doe iz najdublje sri, cvet postaje dua stabla. I kroz cvet stablo
izraava svoj ples, svoj pev. Njegov celi ivot postaje smislen. Ba tako e odgovor stii iz
tebe, iz tvog korenja. Tada e plesati. Tada e tvoj celi ivot postati smislen.
Ako je odgovor dat izvana on e biti samo oznaka, mrtvi znak. Ako dolazi iznutra,
nee biti znak, bie znaenje. Zapamti ove dve rei - "znak" i "znaenje". Znak moe biti dat
izvana; znaenje moe procvetati samo iznutra. Filozofija se bavi znakovima, konceptima,
reima. Religija se bavi znaenjem. Ona nije zaokupljena reima, znakovima i simbolima.
Ali to e biti jedno mukotrpno putovanje, jer zapravo niko ne moe pomoi, i svi
pomagai su na neki nain prepreke. Ako se neko ponaa previe pokroviteljski i daje vam
odgovor, on je va neprijatelj. Patanjali vam nee dati odgovor, samo e vam naznaiti stazu,
put na kojem e se pojaviti va vlastiti odgovor, na kojem ete susresti odgovor.
Veliki Uitelji davali su samo metode, nisu davali odgovore. Filozofi su davali
odgovore, ali Patanjali, Isus ili Buddha, oni nisu davali odgovore. Vi traite odgovore, a oni
64

vam daju metode, daju vam tehnike. Morate sami pronai odgovor iz sebe, kroz svoje napore,
kroz svoju patnju, kroz svoj prodor, kroz svoju tapascharyu.19 Samo tako odgovor moe doi,
i on moe postati znaenje. Tako postiete ispunjenje.
Pitanje tree:
Buddha je naposletku preneo Mahakashyapi ono to nikome drugome nije mogao
preneti reima. Kojoj kategoriji znanja to pripada: neposrednom, zakljuivanju, ili reima
probuenoga? ta je bila poruka?
Najpre, ti pita "ta je bila poruka?" Ako Buddha to nije mogao preneti reima, ne
mogu ni ja. To nije mogue.
Ispriau vam jednu anegdotu. Jedan uenik priao je Muli Nasrudinu i upitao ga:
"uo sam da ti poseduje tajnu, konanu tajnu, klju koji otvara sva vrata misterija." Nasrudin
ree: "Da, imam je. Pa ta s tim? Zato pita za nju?" ovek se baci dole pred njegova stopala
i ree: "Traio sam te, Uitelju. Ako ima klju i tajnu, reci je meni."
Nasrudin ree: "To je takva tajna da mora razumeti kako se ona ne moe lako izrei.
Morae ekati." Uenik upita: "Koliko dugo?" Nasrudin ree: "Ni to nije sigurno. Zavisi od
tvog strpljenja - tri godine ili trideset godina." Uenik je ekao. Nakon tri godine pitao je
ponovo. Nasrudin ree: "Ako opet pita, onda e trebati trideset godina. Samo ekaj. To nije
obina stvar. To je konana tajna."
Trideset je godina prolo i uenik ree: "Uitelju, sada je sav moj ivot proao.
Nisam dobio nita. Sada mi daj tajnu." Nasrudin ree: "Pod jednim uslovom: morae mi
obeati da e uvati tajnu, da nee nikome rei." Onda ovjek ree: "Obeavam ti da u
uvati tajnu do smrti. Nikome je neu spomenuti."
Nasrudin ree: "Hvala ti. To je ono to je moj Uitelj i meni rekao. To sam i ja
obeao mome Uitelju. I ako bi je ti mogao uvati do smrti, ta misli, da ja ne mogu uvati
tajnu?"
Ako je Buddha bio tih, onda i ja moram biti tih oko toga. Postoji neto to ne moe
biti reeno. To nije poruka, jer poruke se uvek mogu rei. Ako se ne mogu rei, to ne mogu
biti poruke. Poruka je neto izreeno, neto to se govori, to se moe rei. Poruka je uvijek
verbalna.
Buddha nije imao poruku; zato je nije mogao ni izrei. Tamo je bilo deset hiljada
uenika. Samo Mahakashyapa je dobio jer je mogao razumeti Buddhinu tiinu. To je tajna
tajne. Mogao je razumeti tiinu.
Jednog jutra je Buddha ostao u tiini pod svojim stablom. A zapravo se spremao
odrati besedu, i svi su ekali. Ostao je u tiini, ostao je tih. Uenici su se uznemirili. To se
nikada pre nije dogodilo. On bi doao, i govorio, i otiao. Ali pola sata je prolo. Sunce je
izalo, svima je bilo vrue. Na povrini je vladala tiina, ali se svako iznutra oseao
uznemireno, brbljajui iznutra i pitajui se "Zato je Buddha danas tih?"
A on je sedeo tamo ispod svog stabla sa cvetom u ruci i nadalje promatrao cvet, kao
da ak nije ni svestan tih deset hiljada uenika okupljenih da ga uju. Stigli su iz vrlo, vrlo
udaljenih sela. Sakupili su se iz cele zemlje.
Onda neko rekao, neko je skupio hrabrost i rekao: "Zato ne govori? Mi ekamo."
Reeno je da je Buddha odgovorio: "Govorim. Ovih pola sata ja sam govorio."
To je bilo previe paradoksalno. Bilo je vie nego apsurdno - on je ostao tih, nije
rekao nita. Ali rei Buddhi "Ti govori apsurdnosti" nije bilo mogue. Uenici su opet
utihnuli - sada u jo veoj nevolji.
Odjednom se jedan uenik, Mahakashyapa, poeo smejati. Buda ga je pozvao blie,
dao mu cvet i rekao: "Sve to moe biti reeno rekao sam drugima, a ono to se ne moe rei
dajem tebi." On mu je samo dao cvet, ali taj cvet je samo simbol. Sa cvetom mu je takoe dao
19

Asketski napor, tapas, doslovno znai ar, gorljivost. Vie ukazuje na energiju uloenog truda, predanost
jednom cilju, nego na asketizam sam po sebi.
65

i odreeno znaenje. Taj cvet je samo znak, no predao mu je i neto to se ne moe preneti
reima.
I vi poznajete odreene oseaje koji se ne mogu preneti. Kada ste u dubokoj ljubavi,
ta radite? Oseaete da je besmisleno ponavljati "Volim te, volim te". Ako to budete previe
govorili, drugome e dosaditi. Ako nastavite ponavljati, drugi e misliti da ste samo papagaj.
Ako nastavite, drugi e misliti da ne znate ta je ljubav.
Kada oseate ljubav, besmisleno je rei da volite. Morate uiniti neto - neto
znaajno. To moe biti poljubac, to moe biti zagrljaj, moete samo uzeti neiju ruku u svoju,
ne radei nita - ali to je puno znaenja. Prenosite neto to se ne moe preneti reima.
Buddha je preneo neto to se ne moe preneti reima. Dao je cvet, to je bio dar.
Darovanje je vidljivo; neto nevidljivo preneseno je tim darom. Kada uzmete ruku svog
prijatelja u svoju, to je vidljivo. Samo uzimanje njegove ruke u svoju nema mnogo smisla, ali
neto drugo se prenosi. To je razmena. Prenosi se neka energija, neto to se osea tako
duboko da se reima ne moe izraziti. To je znak; ruka je samo znak. Znaenje je nevidljivo;
ono se prenosi. To nije poruka, to je dar, milost.
Buddha je dao sebe, nije dao nikakvu poruku. On je izlio sebe u Mahakashyapu. Iz
dva razloga je Mahakashyapa postao sposoban to da primi. Jedan je: ostao je potpuno tih dok
je Buddha bio tih. I drugi su bili tihi, ali samo prividno, u sebi nisu bili. Neprestano su mislili:
"Zato je Buddha tih?" Gledali su se meusobno, gestikulirajui: "ta se dogodilo Buddhi?
Poludeo je? Nikada nije bio tako tih."
Niko nije bio tih. Samo Mahakashyapa, u tom ogromnom skupu od deset hiljada
redovnika, bio je tih. On nije imao problema; on nije razmiljao. Buddha je promatrao cvet, a
Mahakashyapa je promatrao Buddhu. A ne moete pronai velianstveniji cvet od Buddhe.
On je bio najvii cvet ljudske svesti. Tako je Buddha i dalje promatrao cvet, a Mahakashyapa
je i dalje promatrao Budu. Samo dve osobe nisu razmiljale. Buddha nije razmiljao,
promatrao je. Ni Mahakashyapa nije razmiljao, i on je promatrao. To je bila jedna stvar koja
ga je uinila sposobnim za primanje.
A druga stvar je bila to to se smejao. Ako tiina ne moe postati slavlje, ako tiina
ne moe postati smeh, ako tiina ne moe postati ples, ako tiina ne moe postati ekstaza,
onda je patoloka. Onda e postati tuga. Onda e se pretvoriti u bolest. Onda tiina nee biti
iva, bie mrtva.
Moete postati tihi naprosto tako da postanete mrtvi, ali onda neete primiti
Buddhinu milost. Onda se Boansko ne moe spustiti u vas. Boansko treba dve stvari: tiinu
i razigranu tiinu, ivu tiinu. A u tom trenutku on je bio oboje. Bio je tih, i kada su svi bili
ozbiljni, on se smejao. Buda je izlio sebe; to nije poruka.
Postigni te dve stvari; onda se ja mogu izliti u tebe. Budi tih, i nemoj uiniti tu tiinu
tunom. Dopusti da bude nasmejana i rasplesana. Tiina mora biti poput deteta, puna energije,
vibrantna, ekstatina. Ne smije biti mrtva. Tada, samo tada, ono to je Buddha uinio
Mahakashyapi moe biti uinjeno tebi.
Sav moj napor je taj da jednog dana neko postane Mahakashyapa. Ali to nije poruka.
Pitanje etvrto:
esto ste govorili da je veina spisa puna onog to se zove interpolacija ili umetanje.
Da li Patanjalijeve joga-sutre takoer pate od tog defekta, i kako ete vi postupiti s tim?
Ne, Patanjalijeve joga-sutre su apsolutno iste. Niko nikada nije nita umetnuo u
njih. Postoje razlozi zato se to ne moe uiniti. Prvo, Patanjalijeve yoga-sutre nisu
popularan spis. To nije kao Gita, to nije kao Ramajana, to nije kao Biblija. iroke mase
nikada se nisu zanimale za njega. Kada se iroke mase zanimaju za neto, uine to neistim.
Neminovno je tako, jer se tada spisi moraju odvui dole, na njihov nivo. Patanjalijeve jogasutre ostale su samo za znalce. Za njih e se zainteresovati samo nekolicina odabranih. Nee
se svi zainteresovati. I ako sluajno, nekom zgodom, naie na Patanjalijeve joga-sutre,
moi e proitati samo nekoliko stranica i onda e ih baciti. Nije to za tebe. To nije pria, to
nije alegorija. To je jednostavna, nauna rasprava - samo za nekolicinu.
66

I nain na koji su napisane takav je da e oni koji nisu spremni za njih automatski
okrenuti lea. Slian se sluaj u ovom veku dogodio sa Gurijevim. Tokom trideset godina
pripremao je jednu knjigu. ovek Gurijevog kalibra takvo delo moe napraviti za tri dana.
ak i tri dana bila bi vie nego dovoljna. Lao Ce uinio je tako: ceo Tao Te ing bio je
napisan u tri dana. Gurijev je to mogao uiniti u tri dana; bez potekoa. Ali je trideset
godina pisao prvu knjigu. I ta je uradio? Napisao bi jedno poglavlje, zatim bi dopustio da se
proita pred njegovim uenicima. Uenici bi sluali poglavlje, a on ih je promatrao. Ako
mogu razumeti, promenio bi ga. To je bio uslov: ako mogu razumeti, on e promeniti. Ako bi
video da prate, onda ne valja. Stalno, tokom trideset godina, svako poglavlje proitano je
hiljadu i jedan put, i on je svaki put promatrao. Dok knjiga nije postala potpuno nemogua,
tako da je niko nije mogao itati i razumeti...
ak i vrlo inteligentna osoba morala bi je proitati barem sedam puta; tada bi poeli
stizati bljeskovi znaenja. A i to bi bili samo bljeskovi. Ako bi elela da prodre dalje, onda bi
morala da praktikuje to god je rekao, i kroz praksu znaenje bi postalo jasno. A potreban je
barem jedan celi ljudski ivot da bi se postiglo potpuno razumevanje onoga to je pisao.
Takva vrsta knjige ne moe se interpolirati. Zaista, za njegovu prvu knjigu reeno je
da ju je celu proitalo tek nekoliko ljudi. To je teko - hiljadu stranica. Tako, kada je
objavljeno prvo izdanje, objavljeno je pod jednim uslovom: samo sto stranica, uvodni deo,
bilo je razrezano. Sve druge stranice nisu bile razrezane, i na knjizi je stajalo obavetenje:
"Ako moete proitati prvih sto stranica i nameravate itati dalje, razreite ostale stranice.
Inae vratite knjigu izdavau i uzmite svoj novac nazad."
Reeno je da ima samo nekoliko ivih ljudi koji su knjigu proitali u celosti. Pisana
je na takav nain da e vas zamoriti. Proitati dvadeset-dvadeset i pet stranica, to je dovoljno;
i taj se ovek ini mahnitim.
Ovo su sutre, Patanjalijeve sutre. Sve je saeto u seme. Neko me upitao: "Patanjali
je saeo sutre...", ba neki dan neko je doao i pitao, "...a ti govori tako puno o tim sutrama".
Moram, jer on je od stabla napravio seme, a ja seme opet moram napraviti stablom.
Svaka sutra je kondenzovana, potpuno saeta. Nita ne moe uiniti s njima, niti to
ikoga zanima. To je bila jedna od metoda kako bi se knjiga sauvala istom. A knjiga nije
napisana mnogo hiljada godina, uenici su je samo pamtili; jedni drugima su je predavali kao
seanje. Nije bila napisana, pa joj niko nije mogao nita uiniti. Ona je bila sveto seanje,
sauvano. Pa i kada je knjiga napisana, napisana je na takav nain da bi se odmah otkrilo ako
bi neto bilo umetnuto u nju.
Ukoliko to ne pokua osoba Patanjalijevog kalibra, vi ne moete uiniti nita. Samo
promisli, ako ima jednu Ajntajnovu formulu, ta joj moe napraviti? Ako bilo ta napravi,
to e se odmah primetiti. Ukoliko se um poput Ajntajnovog ne pokuava igrati s njom, vi ne
moete nita. Formula je potpuna - nita se ne moe dodati, nita se ne moe izbrisati. Ona je
celina sama po sebi. ta god napravi, bie uhvaen.
Ovo su savrene formule. Ako dodate ijednu re, svako ko radi na putu joge odmah
e opaziti da je to pogreno.
Ispriau vam anegdotu. Dogodila se ba u ovom veku. Jedan od najveih pesnika
Indije, Rabindranat Tagore, preveo je svoju knjigu, Gitanjali, s bengalskog na engleski jezik.
Sam ju je preveo, a onda se malo pokolebao je li prevod dobar ili ne. Pitao je C. F. Andrewsa,
jednog prijatelja i uenika Mahatme Gandija: "Samo pregledaj to. Kako ti izgleda prevod?" C.
F. Anrews nije bio pesnik, on je bio samo jedan Englez - dobro obrazovan, poznavalac jezika,
gramatike i svega - ali nije bio pesnik.
Rekao je Rabindranatu da na etiri mesta, u etiri take, promeni odreene rei: "One
su negramatike, Englezi ih nee shvatiti." Tako je Rabindranat naprosto promenio sve to mu
je Andrews rekao. Sveukupno je promenio etiri rei. Zatim je otiao u London, po prvi put
na skup pesnika... Jedan engleski pesnik toga vremena, Yeats, organizovao je taj skup. Po prvi
put proitan je taj prevod.
Svi su posluali itanje celog prevoda, i Rabindranat upita: "Imate li kakvih
primedbi? Jer ovo je samo prevod, a engleski nije moj maternji jezik."
67

A poeziju je vrlo teko prevesti. Yeats, koji je bio pesnik Rabindranatovog kalibra,
rekao je: "Samo u etiri take neto je krivo". I to su bile upravo one etiri rei koje je
predloio Andrews!
Rabindranat nije mogao verovati. On ree: "Kako, kako si otkrio? Jer te etiri rei
nisam ja preveo. Andrews ih je predloio, a ja sam ih uvrstio." Yeats ree: "Cela poezija tee,
samo su ove etiri kao kamenje. Tok je prekinut. Izgleda kao da je neko drugi uradio posao.
Tvoj jezik moda nije gramatiki, tvoj jezik nije sto posto taan. Ne moe biti; to moemo
razumeti. Ali to je stopostotna poezija. Te etiri rei dole su od kolskog uitelja. Gramatika
je postala ispravna, ali je poezija pola ukrivo."
S Patanjalijem ne moe uiniti nita. Svako ko se bavi jogom odmah e primetiti
da je neko ko nita ne zna umetnuo neto. Postoji samo nekoliko knjiga koje su jo uvek iste,
ija je istota sauvana. Ovo je jedna od njih. Nita nije promenjeno, ni jedna jedina re. Nita
nije dodano; ona je onakva kakva je Patanjali hteo da bude.
Ovo je delo objektivne umetnosti. Kada kaem "delo objektivne umetnosti", imam na
umu odreenu stvar. Preduzeta je svaka predostronost. Kada su se ove sutre kondenzovale,
preduzeta je svaka predostronost kako ne bi mogle biti unitene. Konstruisane su na takav
nain da bi bilo to strano, ikakav strani element, postao remetilaki faktor. Ali kaem,
pokua li ovek poput Patanjalija, on to moe uiniti.
Ali, ovek poput Patanjalija nikada ne bi pokuao takvu stvar. Uvek samo nii
umovi pokuavaju interpolirati. A nii umovi mogu pokuati, i stvar se moe nastaviti,
interpolirana, jedino kad to postane masovna stvar. Mase nisu svesne, ne mogu biti svesne.
Samo Yeats je bio svestan da je neto krivo. Skupu su prisustvovali i mnogi drugi; niko nije
bio svestan, samo Yeats.
Ovo je tajni kult, tajno naslee. Knjiga je ipak napisana,20 ali se knjiga kao forma
nije smatrala pouzdanom. Jo ima ivih ljudi koji su Patanjalijeve sutre dobili neposredno od
svog uitelja, a ne iz knjige. Tradicija se jo odrava ivom, i nastavie se, jer knjiga nije
pouzdana. Ponekad se knjige mogu zagubiti. S knjigama mnoge stvari mogu poi krivo.
Dakle, tajna tradicija postoji. Tradicija se odrava, i oni koji znaju preko rei uitelja
stalno proveravaju je li u knjizi neto pogreno ili je neto menjano.
To se nije sprovodilo za druge spise. Biblija ima previe interpolacija, umetanja i
izmena; ako bi se Isus vratio, ne bi bio u stanju da razume ta se dogodilo, kako su te stvari
dospele tamo. Jer dve stotine godina od Isusove smrti... Nakon dvesta godina Biblija je po
prvi put zabeleena. U tih dvesta godina mnoge stvari su nestale. ak su i njegovi uenici
priali razliite prie.
Buddha je umro. Njegove su rei zabeleene petsto godina nakon njegove smrti.
Postoje mnoge kole, mnogi spisi, i niko ne moe rei ta je lano, a ta istinsko. Ali Buddha
je govorio masama, tako da on nije saet kao Patanjali. On je govorio masama, obinim,
uobiajenim ljudima. On je stvar obrazloio u detalje. U tim detaljima mogle su se dodati
mnoge stvari, mnoge stvari mogle su se izbrisati, a da niko ne bi primetio da je neto
uinjeno.
Ali Patanjali nije govorio masama. On je govorio samo nekolicini odabranih, grupi
- grupi od samo nekoliko osoba, ba kao Gurijev. Gurijev nikada nije govorio pred
masama. Vrlo probrana grupa njegovih uenika mogla ga je sluati, i to pod mnogim
uslovima. Skup nikada nije bio najavljen unapred. Ako bi govorio te veeri u osam i trideset,
oko osam sati dobili biste naznaku da e Gurijev negde govoriti. I morali ste krenuti odmah,
jer u osam i trideset vrata e se zatvoriti. A tih trideset minuta nikada nije bilo dovoljno. Kada
stignete, moete otkriti da je otkazao. Sledeeg dana, opet...
Jednom je otkazivao sedam dana za redom. Prvi dan je dolo etiri stotine ljudi,
zadnji dan samo etrnaest. Dan za danom su se obeshrabrivali. A onda se inilo nemoguim
da e govoriti. Zadnji dan, samo etrnaest ljudi... kad je video, ree: "Sada je ostao pravi broj
ljudi. Mogli ste ekati sedam dana i niste se obeshrabrili, pa ste sada zasluili to. Sada u
20

Smatra se da je Patanjali samo zapisao joga sutre koje su se dugo prenosile usmenim putem kao tajno uenje.
Taj njegov zapis su ove joga sutre koje imamo.
68

govoriti, i samo ovih etrnaest moi e sluati ovu seriju. Neka niko drugi ne bude obaveten
da sam poeo govoriti."
Ovaj nain rada je drugaiji. Patanjali je radio s vrlo zatvorenim krugom. Zato iz
toga nije proizala nikakva religija, nikakva organizacija. Patanjali nije imao sektu. Takva
ogromna snaga, ali on je ostao zatvoren unutar male grupe. I izveo je to na takav nain da se
istota moe odravati. Ona se odrala do danas.
Pitanje peto:
Da li biste, molim vas, objasnili delovanje te nepoznate sile koja ljudski um dri
vezanim za zemaljske stvari i navike, uprkos tome to smo potpuno svesni da konaan rezultat
nije nita drugo do beda?
Svest nije potpuna, svest je samo intelektualna. Logiki, ti prihvata da "to god
radio, to me vodi u bedu", ali to nije tvoje egzistencijalno iskustvo. Ti razume samo
racionalno. Kada bi ti bio samo razum, onda ne bi bilo problema, ali ti si takoe i "nerazum".
Kada bi imao samo svesni um, onda bi bilo u redu. Ti ima nesvesni um, takoe. Svesni um
zna da ti svakoga dana zapada u bedu svojim vlastitim naporima; stvara svoj vlastiti pakao.
Ali nesvesni nije svestan, a nesvesni je devet puta vei od tvog svesnog uma. I nesvesni
nastavlja istrajavati na vlastitim navikama.
Odluio si da se vie nee ljutiti jer ljutnja nije nita drugo do trovanje tvog vlastitog
sistema. Ona ti donosi bedu. Ali sledei put, kada te neko uvredi, nesvesno e ostaviti po
strani tvoj svesni razum, provalie, i ti e biti ljut. A to nesvesno uopte nije ni znalo za tvoju
odluku, i to nesvesno ostaje aktivna sila.
Svesni um nije aktivan, on samo misli. On je mislilac; nije initelj. Dakle, ta se
mora uiniti? Samo mislei svesno da je neto pogreno nee to zaustaviti. Morae raditi na
disciplini, a kroz disciplinu e to svesno znanje prodreti u nesvesno poput strijele.
Kroz disciplinu, kroz jogu, kroz praksu meditacije, svesna odluka e dopreti do
nesvesnog. A kada dopre do nesvesnog, samo tada e biti od neke koristi. Inae e nastaviti
misliti o neemu, a napravie upravo suprotno.
Sv. Augustin je rekao da "to god znam da je dobro - i uvek mislim da u napraviti
tako - kad se ukae prilika da tako postupim, uvek u napraviti to god je pogreno." To je
ljudska dilema.
A joga je put za premoavanje svesnog i nesvesnog. I kada zaemo dublje u
disciplinu shvatie kako se to moe postii. To se moe postii. Dakle, ne oslanjaj se na
svesno, ono je neaktivno. Nesvesno je aktivno. Promeni nesvesno; samo onda e tvoj ivot
imati drugaiji smisao. Inae e biti u jo veoj bedi.
Mislei jedno, a radei neto drugo, stalno e stvarati kaos - i malo-pomalo
izgubie samopouzdanje. Malo-pomalo oseae da si apsolutno nesposoban, impotentan, da
ne moe nita uiniti. Pojavie se samooptuivanje. Oseae krivicu. A krivica je jedini
greh.

69

Poglavlje 7
STALNA UNUTARNJA PRAKSA
31. decembar 1973.
I, 12:

abhyasavayragyabhyam tannirodhah.
Vebanje i [duevna] proienost vode ka toj umirenosti (nirodha) [o kojoj je
prethodno bilo rei u YS, I, 2].
I, 13:

tatra sthitau yatno 'bhyasah.


Napor da se tu [u umirenosti ovek] ustali jeste [ono to sutinski odreuje]
vebanje (abhyasa).
I, 14:

sa tu dirghakalanairantaryasatkarasevito drdhabhumih.
Ovo [vebanje] pak postaje efikasno ukoliko se kroz dugi period, neprekidno i
sa panjom obavlja.
ovek nije samo njegov svesni um. On ima takoe devet puta vie od svesnog,
nesvesni sloj uma. Ne samo to, ovek ima telo, soma, u kome njegov um prebiva. Telo je
apsolutno nesvesno. Ono deluje preteno nevoljno. Samo povrina tela jeste voljna.
Unutranji izvori su nehotini, ne moete uiniti nita oko njih. Vaa volja nije delotvorna.21
Ovaj obrazac ljudske egzistencije treba da se razume pre nego to ovek ue u sebe. A
razumevanje ne treba da ostane samo intelektualno. Ono mora ii dublje. Ono mora prodreti u
nesvesne slojeve; ono mora dopreti do celog tela.
Otuda vanost abhyase - konstantne unutranje prakse. Ove dve rei su vrlo znaajne;
abhyasa i vairagya. Abhyasa oznaava neprekidnu unutranju praksu, a vairagya oznaava
nevezanost, beeljnost. Sledee Patanjalijeve sutre bave se s ova dva znaajna koncepta, ali
pre nego to uemo u sutre, onaj obrazac ljudske linosti, koji nije potpuno intelektualan,
treba biti vrsto shvaen.
Da je on samo intelekt, ne bi bilo potrebe za abhyasom - konstantnim, ponavljanjem
napora. Vi moete razumeti odmah sve, ako je to racionalno, kroz um, ali samo to
razumevanje nee delovati. Moete razumeti lako da je ljutnja rava, otrovna, ali ovo
razumevanje nije dovoljno za ljutnju da vas ostavi, da iezne. Uprkos vaem razumevanju
ljutnja e se nastaviti, jer ljutnja opstaje u mnogim slojevima naeg nesvesnog uma - ne samo
u umu, nego i vaem telu takoe.
Telo ne moete razumeti samo pomou verbalne komunikacije. Samo vaa glava moe
razumeti, ali telo ostaje nedirnuto. A dok razumevanje ne dopre do samog korena tela, ne
moete biti preobraeni. Ostaete isti. Vae ideje mogu nastaviti da se menjaju, ali vaa
linost e ostati ista. Onda e se novi konflikt pojaviti. Biete u veem nemiru nego ikada, jer
sada moete znati ta je pogreno a i dalje istrajavate da inite to; nastavljate da radite to.
Stvoren je oseaj krivice i osude sebe samoga. Poinjete da mrzite sebe, poinjete da
mislite o sebi kao greniku. A to vie razumete, vie osuda raste, jer vidite kako je to teko,
gotovo nemogue, da promenite sebe.
Joga ne veruje u intelektualno razumevanje. Ona veruje u telesno razumevanje, u
totalno razumevanje u kome je vaa celovitost ukljuena. Ne samo da se menjate u svojoj
glavi, ve se duboki izvori vaeg bia takoe menjaju.
Kako oni mogu da se menjaju? Konstantno ponavljanje posebne prakse postaje
nevoljno. Ako sprovodite odreenu praksu konstantno - samo ponavljajui je neprekidno
ubrzo to ispada iz svesti, dosee nesvesno i postaje deo nesvesnog. Jednom kada postane deo
nesvesnog, to zapoinje da funkcionie iz tog dubljeg izvora.

21

Podela nervnog sistema na autonomni i periferni.


70

Sve moe postati nesvesno ako nastavljate da ponavljate to neprekidno. Na primer,


vae ime je ponavljano tako neprekidno od vaeg detinjstva. Sada ono nije deo svesnog, ono
je postalo deo nesvesnog. Vi moda spavate sa sto osoba u sobi, a ako neko doe i pozove
"Ram, je li Ram tu?" devedeset devet osoba koje nisu povezane s imenom nastavie da
spavaju. Njima to nee smetati. Ali osoba koja nosi ime "Ram" iznenada e pitati: "Ko me
zove? Zato mi smetate u spavanju?"
ak i u spavanju on zna da je njegovo ime Ram. Kako je to ime doseglo tako duboko?
Samo pomou neprestanog ponavljanja. Svako ponavlja svoje ime, svako poziva sebe,
predstavlja sebe. Neprekidna upotreba. Sada to nije svesno. To je dospelo do nesvesnog.
Jezik, va maternji jezik, postaje deo nesvesnog. Sve to jo nauite kasnije nikada
nee biti tako nesvesno; to e ostati svesno. Zbog toga e va nesvesni jezik neprekidno
uticati da va svesni jezik.
Ako Nemac govori engleski, to je drugaije; ako Francuz govori engleski, to je
razliito; ako Indijac govori engleski, to je razliito. Razlika nije u engleskom, razlika je u
njihovim unutarnjim obrascima. Francuz ima razliit obrazac - nesvesni uzorak. To utie.
Tako, sve to nauite kasnije bie pogoeno vaim maternjim jezikom. Ako padnete u
nesvesno stanje, onda samo va maternji jezik moe prodreti.
Seam se jednog od mojih prijatelja koji je bio maharashtrian. 22 Bio je u Nemakoj
dvadeset godina, ili ak vie. Potpuno je zaboravio svoj vlastiti maternji jezik, marathi. Nije
mogao da ga ita, nije mogao da govori na njemu. Svesno, jezik je bio potpuno zaboravljen
zato to nije korien.
Onda se razboleo. I u toj bolesti on bi postao nesvestan. Kad god bi postao nesvestan,
potpuno razliit tip linosti se ispoljavao. Poeo bi da se ponaa na drugaiji nain. U svom
nesvesnom stanju izgovarao bi rei iz marathia, ne iz nemakog. Kada je bio nesvestan, onda
bi izgovarao rei koje su iz marathi jezika. A posle nesvesti, kada bi se vratio natrag u
svesnost, za nekoliko trenutaka ne bi mogao da razume nemaki.
Konstantno ponavljanje u detinjstvu ide dublje jer dete nema pravu svesnost. Ono ima
vie nesvesnog vrlo blizu povrine; sve ulazi u nesvesno. Kako ono ui, kako postaje vie
obrazovano, svesnost e postati deblji sloj - onda sve manje i manje prodire prema
nesvesnom.
Psiholozi kau da se gotovo pedeset posto vaeg uenja obavlja do sedme godine. U
sedmoj godini vaeg detinjstva, vi ste gotovo upoznali polovinu stvari koje ete ikada znati.
Pola vaeg obrazovanja je zavreno, a ta polovina e postati osnova. Dakle sve drugo e biti
samo nadograeno na tome. I ti dublji obrasci e ostati iz detinjstva.
Zbog toga moderna psihologija, moderna psihoanaliza, psihijatrija, svi pokuavaju da
prodru u vae detinjstvo, jer ako ste mentalno bolesni, seme negde treba da se nae u vaem
detinjstvu - ne u sadanjosti. Obrazac mora biti lociran tamo u detinjstvu. Jednom kada je
duboki obrazac lociran, onda neto moe da se uradi i moete biti preobraeni.
Ali kako prodreti dotle? Joga ima metodu. Metoda se naziva abhyasa. Abhyasa
oznaava konstantnu, ponavljajuu praksu odreene stvari. Zato, kroz ponavljanje, neto
postaje nesvesno? Ima nekoliko razloga za to.
Ako elite da nauite neto, moraete to da ponavljate. Zato? Ako proitate pesmu
samo jednom, zapamtiete nekoliko rei tu i tamo; ali ako je proitate dva puta, tri puta,
mnogo vie puta, onda moete zapamtiti redove, strofe. Ako ponovite sto puta, onda je
moete zapamtiti kao ceo uzorak. Ako je ponovite ak i vie, onda ona moe da se nastavi,
istraje u vaem pamenju godinama. Neete moi da je zaboravite. yyy
ta se deava? Kada ponavljate odreenu stvar, to je vie ponavljate, vie se urezuje u
modane elije. Neprekidno ponavljanje je (kao) konstantno udaranje ekiem. Onda se to
urezuje. To postane deo vaih modanih elija. A to vie postane deo vaih modanih elija,
manje svesnosti je potrebno. Vaa svesnost moe da ode; sada ona nije potrebna.
Dakle, ta god nauite duboko, za to ne treba da budete svesni. U poetku, ako uite
vonju, kako da vozite kola, onda je to konstantan napor. Zbog toga ima tako mnogo nevolje,
22

Stanovnik Maharatra drave u Indiji.


71

jer morate biti oprezni neprekidno, a ima tako mnogo stvari da ih se bude svestan - put,
saobraaj, mehanizam, volan, pedala za gas, konice, i sve drugo, kao i saobraajna pravila na
putu. Morate neprekidno biti svesni svega. Dakle vi ste tako mnogo angaovani u tome, to
postaje teko, to postaje veoma naporno.
Ali ubrzo, vi ete moi kompletno da zaboravite sve. Voziete a vonja e postati
nesvesna. Nije potrebno da unosite svoj um u to, moete nastaviti da mislite ta god elite, vi
moete gde god elite, a kola e se kretati nesvesno. Sada je vae telo to nauilo. Sada itav
mehanizam zna to. To je postalo jedno nesvesno uenje.
Kad god neto postane tako duboko da vi ne treba da budete svesni o tome, to pada u
nesvesno. A jednom kada stvar padne u nesvesno, to e zapoeti da menja vae bie, va
ivot, va karakter. I promena e biti sada nenaporna; ne treba da se brinete o tome.
Jednostavno ete se kretati u pravcu gde vas nesvesno vodi.
Joga je radila vrlo mnogo na abhyasi, na konstantnom ponavljanju. Ovo konstantno
ponavljanje je potrebno samo da bi dovelo vae nesvesno u rad. A kada nesvesno pone da
funkcionie, vi ste spokojni. Nikakav napor nije potreban; stvari postaju prirodne. Kae se u
starim spisima da mudrac nije onaj koji ima dobar karakter, jer ak i ta svesnost pokazuje da
"protiv" jo postoji, suprotnost jo postoji. Mudrac je ovek koji ne moe initi loe, ne moe
misliti o tome. Dobrota je postala nesvesna; postala je kao disanje. ta god da on uradi to e
biti dobro. To je postalo tako duboko u njegovom biu da nikakav napor nije potreban. To je
postalo njegov ivot. Tako da ne moete rei mudracu da je on dobar ovek. On ne zna ta je
dobro, ta je loe. Sada ne postoji konflikt. Dobro je prodrlo tako duboko da ne postoji
potreba da se bude svestan toga.
Ako ste svesni o vaoj dobroti, ravost jo postoji uporedo. I postoji stalna borba. I
svaki put kada morate da se pokrenete u akciju, morate izabrati: "Moram initi dobro; ne
smem initi ravo." I ovaj izbor e biti veliki nemir, konstantno unutranje nasilje, unutranji
rat. Ako konflikt postoji, ne moete se oseati udobno, kod kue.
Sada emo ui u sutru. Prestajanje uma jeste joga, ali kako moe um, i njegove
modifikacije, da prestanu?
Njihov prekid nastaje uz pomo trajnog unutranjeg napora i nevezivanja.
Dve stvari - kako um moe da prestane sa svim svojim modifikacijama; jedna abhyasa, istrajna unutranja praksa, a druga - nevezivanje. Nevezivanje e stvoriti situaciju,
uporna praksa je tehnika koja se koristi u toj situaciji. Pokuajte da razumete oboje.
ta god da radite, vi radite jer imate odreene elje. A ove elje mogu biti ispunjene
samo injenjem odreenih stvari. Dok ove elje ne budu odbaene, vae aktivnosti ne mogu
biti odbaene. Vi imate neko ulaganje u ovim aktivnostima, u ovim akcijama. Ovo je jedna od
nedoumica ljudskog karaktera i uma, da moete eleti da zaustavite odreene akcije jer vas
one vode u nevolju.
Ali zato ih inite? Vi ih vrite jer imate odreene elje, a ove elje ne mogu biti
ispunjene bez njihovog izvoenja. Dakle ovo su dve stvari. Jedna, vi morate initi odreene
stvari. Na primer, ljutnja. Zato postajete ljuti? Vi postajete ljuti samo kada negde, na neki
nain, neko stvara prepreku. Nameravate postii neto, a neko stvori prepreku. Vaa elja je
ometena. Vi postajete ljuti.
Moete postati ljuti ak i na stvari. Ako se kreete, i pokuavate da stignete negde
odmah, a stolica vam se nae na putu, vi se naljutite na stolicu. Pokuavate da otkljuate
vrata, a klju ne radi, postanete ljuti na vrata. To je apsurdno, jer ljutiti se na stvar jeste
besmislica. Sve to stvara bilo koju vrstu prepreke stvara ljutnju.
Imate elju da dosegnete, da uradite, da postignete neto. Ko god se isprei na putu do
vae elje izgleda da je va neprijatelj. elite da ga unitite. To je ono to znai ljutnja; elite
da unitite prepreke. Inae ljutnja vodi do nevolje; ljutnja postaje jedno oboljenje. Dakle, vi
elite da ne budete ljuti.
Inae kako moete odbaciti ljutnju ako imate eljene ciljeve? Ako imate elje i ciljeve,
onda ljutnja je obavezna da bude tu jer ivot je sloen, vi niste sami ovde na ovoj zemlji.
Milioni i milioni se bore za svoje vlastite elje, oni se ukrtaju jedni s drugima, dolaze jedni
72

drugima na stazu. Ako imate elje, onda je nuno da ljutnja bude tu, frustracija e obavezno
biti tu, nasilje e nuno biti tu. I sve to doe na vau stazu, va um e misliti da uniti.
Ovaj odnos prema unitenju prepreka jeste ljutnja. Inae ljutnja stvara nevolju, ako
elite da ne budete ljuti. Ali samo eleti da ne budete ljuti nee biti od velike pomoi jer
ljutnja je deo veeg obrasca - od uma koji eli, uma koji ima ciljeve, uma koji eli da stigne
negde. Ne moete odbaciti ljutnju.
Dakle, prva stvar je elja. S njom je odbaeno pola mogunosti ljutnje; osnova je
odbaena. Ali onda takoe nije nuno da ljutnja treba da iezne, jer ste bili ljuti milionima
godina. Ona je postala duboko ukorenjena navika.
Moete odbaciti elje, ali ljutnja e jo odoleti. Ona nee biti tako snana, ili e
istrajati jer sada je navika. Tokom mnogo, mnogo ivota vi ste je nosili. Ona je postala vae
nasledstvo. Ona je u vaim elijama; telo je preuzelo. Ona je sada hemijska i psiholoka.
Samo vaim odbacivanjem svojih elja vae telo nee promeniti svoj obrazac. Obrazac je vrlo
star. Moraete da promenite i ovaj obrazac.
Za tu promenu, ponavljajua praksa e biti potrebna. Da se promeni unutranji
mehanizam, ponavljajua praksa e biti potrebna - preuslovljavanje itavog obrasca telo-um.
Ali ovo je mogue samo ako ste odbacili eljenje.
Pogledajte to s druge take gledita. Jedan ovek je doao kod mene i rekao: "Ne
elim da budem alostan, ali sam uvek tuan i snuden. Ponekad ne mogu ak ni da osetim
razlog zato sam tuan, ali jesam tuan. Nema vidljivog uzroka, nita na ta mogu tano
pokazati da je razlog. Izgleda da je da je to ba postalo moj stil da budem tuan. Ne seam
se," rekao je: "da li sam ikada bio srean. Ne elim da budem tuan, to je izvestan teret. Sad
sam najnesrenija osoba. Zaista, kako mogu to odbaciti?"
Tako sam ga pitao: "Jesi li neto uloio u svoju oaloenost?" On je rekao: "Zato bih
imao bilo kakvo ulaganje?" Ali jeste. Znao sam dobro tu osobu. Znao sam ga mnogo godina,
ali on nije bio svestan da postoji neko steeno interesovanje za to. Tako da nije eleo da
odbaci alost, nije bio svestan zato tuga postoji. On je smatrao da su to neki drugi razlozi
koje nije mogao da povee.
Njemu treba ljubav, ali da bi bio voljen... Ako vam treba ljubav treba da budete
zaljubljeni. Ako traite ljubav, treba da date ljubav, a treba da date vie nego to moete
traiti. Ali on je tvrdica, on ne moe dati ljubav. Davanje je nemogue, on ne moe dati nita.
Upravo od rei "davanje", on e se stegnuti u sebi. On moe samo da uzima; on ne moe da
daje. On je zatvoren kada je davanje u pitanju.
Ali bez ljubavi ne moete cvetati. Bez ljubavi ne moete postii nikakvu radost; ne
moete biti sreni. A on ne moe voleti jer ljubav izgleda kao davanje neega. To je davanje,
davanje svega to imate, to jeste takoe. On ne moe dati ljubav, on ne moe primiti ljubav.
Onda ta da radi? Inae on arko udi, kao to svako arko udi za ljubavlju. To je osnovna
potreba ba kao hrana. Bez hrane telo e umreti, a bez ljubavi vaa dua e se stegnuti. To je
neminovno.
Onda je on stvorio zamenu, a ta zamena je saoseanje. On ne moe dobiti ljubav jer ne
moe dati ljubav, ali moe dobiti sauee. Sauee je siromana zamena za ljubav. Stoga je
on alostan. Kada je on tuan ljudi mu daju sauee. Ko god mu doe ima saoseanje jer on
uvek plae i zapomae. Njegovo raspoloenje je uvek kao kod vrlo nesrenog oveka. Ali on
uiva! Kada god mu pruite saoseanje on uiva u tome. On postaje vie nesrean, jer to je
vie nesrean, vie moe dobiti saoseanja.
Stoga sam mu ja rekao: "Vi imate odreeno ulaganje u vau alost. Ovaj ceo obrazac,
samo alost ne moe se odbaciti. Ona je ukorenjena negde drugde. Prestanite da traite
saoseanje. Moete prestati da traite saoseanje samo kada zaponete da dajete ljubav, jer to
je zamena. A jednom kada zaponete da dajete ljubav, ljubav e vam se dogoditi. Onda ete
biti sreni. Onda je stvoren razliit obrazac."
Sluao sam, ovek je uao u jedan auto-park. Bio je u vrlo smenom poloaju.
Izgledalo je skoro nemogue kako je hodao, jer se bio pogurio kao da vozi auto. Ruke su mu
se na nekom nevidljivom volanu pokretale, a noga na nevidljivom gasu; a on je hodao. A to je
73

bilo tako teko, skoro nemogue, kako je on hodao. Gomila se sakupila tu. On je radio neto
nemogue. Oni su pitali pratioca: "ta se deava? ta ovaj ovek radi?"
Taj pratilac je rekao: "Ne pitaj glasno. ovek je u svojim prolim voljenim kolima.
Bio je jedan od najboljih vozaa. On je ak doneo nacionalnu nagradu na auto trkama. Ali
sada, usled nekog mentalnog nedostatka, on se srozao. Nije mu dozvoljeno da vozi kola, (to
mu je) inae ba stari hobi."
Iz gomile su rekli: "Ako znate to, onda zato mu to ne kaete," kaite mu: "Nemate
auto, ta radite ovde?" ovek je odgovorio: "To je ono zbog ega ja kaem: "Ne govorite
naglas." Ja ne mogu to uiniti, jer mi on daje jedan rupi dnevno da operem kola. To ja ne
mogu uiniti. Ja ne mogu rei: "Vi nemate kola". On e parkirati kola , a onda u ih ja oprati."
To ulaganje od jednog rupija, steena korist, postoji. Imate mnogo steenih koristi u
vaoj nevolji takoe, u vaem bolu takoe, u vaoj bolesti takoe. A onda nastavljate govoriti:
"Mi ne elimo. Mi ne elimo da budemo ljuti, ne elimo da budemo ovo i ono." Ali dok ne
doete do uvida kako su se sve te stvari dogodile vama, dok ne uvidite ceo uzorak, nita se ne
moe promeniti.
Najdublji obrazac uma je elja. Vi ste ono to jeste jer imate odreene elje, grupu
elja. Patanjali kae: "Prva stvar je nevezivanje." Odbacite sve elje; ne budite vezani. A
onda, abhyasa.
Na primer, neko doe kod mene i kae: "Ne elim da sakupljam vie masti u svom
telu, ali nastavljam da jedem. Ja elim da prestanem, ali nastavljam da jedem."
eljenje je povrinsko. Postoji obrazac unutra, zato on jede vie i vie. ak i ako
prestane za nekoliko dana, onda opet s vie ukusa on jede. I on e sakupiti veu teinu nego
to je izgubio kroz nekoliko dana posta ili dijete. A to se deavalo neprekidno, godinama. To
nije pitanje da se jede manje. Zato on jede vie? Telu to ne treba, onda negde u umu hrana je
postala zamena za neto.
On se moda boji smrti. Ljudi koji se boje smrti jedu vie jer jedenje izgleda da je
osnova ivota. to vie jedete vie ivite. Ovo je aritmetika u njihovom umu. Jer ako ne jedete
vi umirete. Dakle ne jedenje je ekvivalentno smrti, a vie jedenja je ekvivalentno sa vie
ivota. Dakle, ako se bojite smrti vi ete jesti vie, ili ako vas niko ne voli vi ete jesti vie.
Hrana moe postati zamena za ljubav, jer dete u poetku, dolazi (do toga) da povee
hranu i ljubav. Prva stvar za koju e dete biti svesno jeste majka, hrane od majke i ljubavi od
majke. Ljubav i hrana ulaze u njegovu svest istovremeno. A kad god majka voli, ona daje vie
mleka. Dojka se daje sreno. Ali kad god je majka ljuta, nije milostiva, ona otrgne dojku.
Hrana se uklanja kad god majka nije milostiva (ne voli); hrana se daje kad god ona
voli. Ljubav i hrana postaju jedno. U umu, u dejem umu, oni postaju udrueni. Tako, kad
god dete dobije vie ljubavi, ono e smanjiti svoju hranu, jer ljubavi je toliko mnogo da hrana
nije nuna. Kad god nema ljubavi, ono e jesti vie jer ravnotea mora da se odrava. Ako
uopte nema ljubavi, onda e ono oseati svoj stomak.
Moete biti iznenaeni - kad god su dve osobe u ljubavi, one izgube debljinu. Zbog
toga devojke postaju deblje onog momenta kada se udaju. Kada je ljubav utvrena brakom,
zapoinju da se debljaju jer sada nema nedostatka. Ljubav i svet ljubavi je, na neki nain,
okonan.
U zemljama gde vie preovlauju razvodi, ene pokazuju bolje figure. U zemljama
gde razvodi nisu rasprostranjeni, ene ne brinu o svojim figurama, jer ako je razvod mogu
onda e ena morati da nae nove ljubavnike i svesno istie svoju figuru. Traganje za
ljubavlju pomae telesnoj pojavi. Kada je ljubav utvrena, ona je dovrena u ivotu. Ne treba
da brinete o telu; ne treba uopte da se merite.
Dakle, ova osoba se moda boji smrti; moda ona nije u nekoj dubokoj, intimnoj
ljubavi s nekim. A ovo dvoje su opet povezani. Ako ste u dubokoj ljubavi, vi se ne bojite
smrti. Ljubav je tako ispunjavajua da ne brinete ta e se dogoditi u budunosti. Ljubav sama
je ispunjenje. ak i ako smrt doe, ona moe biti dobrodola. Ali ako niste u ljubavi, onda
smrt kreira strah; jer vi niste ak ni voleli jo, a smrt se pribliava. Smrt e se desiti i vie nee
biti vremena i nema budunosti posle nje.
74

Ako ne postoji ljubav, straha od smrti e biti vie. Ako ima ljubavi, manje je straha od
smrti. Ako ima potpune ljubavi, smrt potpuno iezava. Ovo je sve povezano unutra. ak i
vrlo jednostavne stvari su duboko ukorenjene u veim obrascima.
Mula Nasrudin je jednom stajao ispred svog veterinara sa psom i insistirao je: "Isecite
rep mom psu." Doktor je rekao: "Ali zato, Nasrudine? Ako iseem rep vaem psu, ovaj lepi
pas e biti upropaen. Izgledae runo. Zato zahteva to?" Nasrudin je rekao: "Meu nama,
ne kaite to nikome, elim odsei psu rep jer moja tata e uskoro doi a ja ne elim nikakav
znak dobrodolice u mojoj kui. Uklonio sam sve. Samo ovaj pas je ostao, on moe izraziti
dobrodolicu mojoj tati."
ak i psei rep ima vei uzrok od mnogih uzajamnih odnosa. Ako Mula Nasrudin ne
moe (izraziti) dobrodolicu svojoj tati ak ni kroz svog pasa, on ne moe biti u ljubavi sa
svojom enom; to je nemogue. Ako ste u ljubavi sa svojom suprugom, iskazaete
dobrodolicu i svojoj tati. Biete ljubazni prema njoj.
Jednostavne stvari na povrini duboko su ukorenjene u kompleksnim stvarima, i sve je
meusobno zavisno. Dakle, vi samo menjate miljenje, a nita se ne menja. Dok vi ne odete
do kompleksnog obrasca, ne uslovljavajui to, dovodei u red to, stvarajui novi uzrok, samo
onda novi ivot moe nastati iz toga. Dakle, ove dve stvari treba da se obave: nevezivanje,
nevezivanje to se tie svega.
To ne znai da treba da prestanete da uivate. Ovo pogreno razumevanje je postojalo,
a joga je pogreno interpretirana na mnogo naina. U jednom od njih - izgleda da joga kae
da vi umirete u ivotu jer nevezivanje znai da vi ne elite nita. Ako ne elite nita, niste
vezani ni uz ta, ako ne volite nita, onda ete biti samo mrtav le. Ne. To nije znaenje.
Nevezivanje znai da ne budete zavisni ni od ega, da ne inite svoj ivot i sreu
zavisnim ni od ega. Davanje preimustva je u redu, vezivanje nije u redu. Kada ja kaem
davanje preimustva je u redu, mislim da moete vie voleti, vi morate davati prvenstvo. Ako
su mnoge osobe prisutne, morate voleti nekoga, morate odabrati nekog, morate biti ljubazni
prema nekom. Dajte prvenstvo nekome, ali ne budite vezani.
Koja je razlika? Ako budete vezani, onda to postaje jedna opsesija. Ako osoba nije tu,
vi ste nesreni. Ako je osoba odsutna, vi ste u patnji. A vezanost je takva bolest da ako osoba
nije tu vi ste u nevolji, a ako je osoba prisutna vi ste indiferentni. Uzeto za prihvatljivo da je
to u redu. Ako je osoba tu, onda je u redu - nita vie od toga. Ako osoba nije tu, onda ste u
nevolji. To je vezanost.
Davanje prvenstva je ba suprotno. Ako osoba nije tu, vi ste u redu; ako je osoba tu, vi
se oseate srenim, zahvalnim. Ako je osoba tu vi ne prihvatate to zdravo za gotovo. Vi ste
sreni, uivate u tome, slavite to. Ako osoba nije tu, vi ste u redu. Vi ne zahtevate, niste
opsednuti. Vi takoe moete biti sami i sreni. Vie biste voleli da je osoba bila tu, ali to nije
opsesija.
Izbor je dobar, vezivanje je bolest. ovek koji ivi sa davanjem prednosti ivi ivot u
dubokoj srei. Ne moete ga uiniti nesrenim. Moete ga samo uiniti srenim, vie srenim.
Ali ne moete ga uiniti nesrenim. A osobu koja ivi s vezanou ne moete uiniti srenom,
moete je uiniti samo vie nesrenom. I vi znate ovo, znate ovo vrlo dobro. Ako je va
prijatelj tu, vi mnogo ne uivate; ako prijatelj nije tu, nedostaje vam mnogo.
Upravo je pre nekoliko dana dola kod mene devojka. Videla me pre mesec dana sa
svojim momkom. Stalno su se meusobno tukli, a to je postalo ba jedna bolest, pa sam im
rekao da se razdvoje na nekoliko sedmica. Rekli su mi da im je nemogue da ive zajedno, pa
sam ih poslao daleko odvojeno.
Tako je devojka bila ovde za badnje vee, i ona je rekla: "Ova dva meseca, mnogo mi
je nedostajao moj momak! Stalno mislim na njega. ak i u mojim snovima poeo je da se
javlja. Nikada se to ranije nije dogaalo. Kada smo bili zajedno, nikada ga nisam videla u
snovima. U snovima sam vodila ljubav s drugim mukarcem. Ali sada, stalno mi je u snovima
moj momak. Dozvoli nam sada da ivimo zajedno."
Onda sam joj ja rekao: "to se mene tie, moete iveti opet zajedno. Ali seti se da ste
iveli zajedno upravo pre dva meseca i da nikada niste bili sreni."
75

Vezanost je bolest. Kada ste zajedno, vi niste sreni. Ako imate bogatstvo vi niste
sreni. Biete nesreni ako ste siromani. Ako ste zdravi, vi nikada ne oseate zahvalnost.
Ako ste zdravi, nikada ne oseate zahvalnost za egzistenciju. Ali ako ste bolesni vi proklinjete
ceo ivot i egzistenciju. Sve je beznaajno, i ne postoji Bog.
ak i obina glavobolja je dovoljna da izbrie sve bogove. Ali kada ste sreni i zdravi,
nikada se ne oseate kao da idete u crkvu ili hram samo da mislite: "Ja sam srean i ja sam
zdrav, a nisam to zasluio. Ovo su jednostavno darovi od tebe."
Mula Nasrudin je jednom pao u reku, i skoro da se udavio. On nije bio religiozan
ovek, ali iznenada, na ivici smrti, on je zavapio: "Alahu, boe, molim te spasi me, i od danas,
moliu se i iniu sve to je zapisano u spisima."
Dok je izgovarao "Boe, pomozi mi," uhvatio se za granu koja je visila iznad reke.
Dok je grabio i iao prema sigurnom, osetio je oputenost i rekao: "Sada je uredu. Sada ne
treba da brine." Opet je rekao Bogu: "Sada ne treba da brine. Sada sam siguran." Iznenada
se grana slomila i on je opet pao. Tako da je rekao: "Ne moe li da prihvati prostu alu?"
Inae, tako se kreu nai umovi. Vezanost e vas uiniti vie i vie jadnim, ono to se
vie voli e vas uiniti sve srenijim i srenijim. Patanjali je protiv vezanosti, nije protiv
onog to se vie voli. Ako hrana po vaoj sklonosti nije dostupna, onda ete odabrati drugu
hranu i biete sreni, jer ete znati da prva nije dostupna, ta god je dostupno treba u tome da
se uiva. Neete plakati i zapomagati. Prihvatiete ivot kakav vam se deava.
Inae osoba koja je stalno vezana uz sve, nikada ne uiva ni u emu i nikada ne
postie cilj. itav ivot postaje neprekidna patnja. Ako niste vezani, vi ste slobodni; imate
mnogo energije; ne zavisite ni od ega. Vi ste nezavisni, a ova energija moe da se premesti u
unutranji napor. To moe da postane praksa. To moe postati abhyasa. ta je abhyasa?
Abhyasa je borba sa starim obrascem navike. Svaka religija je razvila mnoge vebe, ali
osnova je ova Patanjalijeva sutra.
Na primer, kad god nastaje ljutnja, nainite stalnom praksom da pre ulaska u ljutnju
uzmete pet dubokih udisaja. Jednostavna praksa, oevidno uopte nije povezana sa ljutnjom.
Svakoga to moe nasmejati, "Kako e to pomoi?" Ali to e pomoi. Kad god osetite da
ljutnja dolazi, pre nego to je izrazite, uzmite pet dubokih udisaja i izdisaja.
ta e to uiniti? To e uiniti mnogo stvari. Ljutnje moe biti samo ako ste nesvesni,
a ovo je svestan napor. Upravo pre nego to se naljutite svesno udahnite i izdahnite pet puta.
Ovo e uiniti va um ivahnim, opreznim, a sa opreznou ljutnja ne moe ui. To nee samo
uiniti va um ivahnim, uinie takoe i vae telo ivahnim, jer sa vie kiseonika u telu, telo
je ivahnije. U ovom ivahnom momentu, iznenada ete osetiti da je ljutnja iezla.
Drugo, va um moe biti samo na jedno usmeren. Um ne moe misliti o dve stvari
istovremeno; to je nemogue za um. On moe menjati od jedne do druge (stvari) vrlo brzo, ali
ne moete imati dve stvari zajedno u umu istovremeno. Jedna stvar u jednom trenutku. Um
ima vrlo uzan prozor, samo jedna stvar u jednom vremenu. Tako ako je ljutnja tu, ljutnja je tu.
Ako vi udahnete i izdahnete pet puta, neoekivano um je usmeren na disanje. On se odvratio.
Sada se kree u razliitom pravcu. ak i ako se preselite ponovo na ljutnju, ne moete biti isto
ljuti opet jer vanost je izgubljena.
Gurijev kae: "Kada je moj otac umirao, rekao mi je da zapamtim samo jednu stvar;
"Kad god si ljut, saekaj dvadeset etiri sata, a onda uini ta god eli. ak i ako eli da
ubije, idi i ubij, ali ekaj za dvadeset etiri sata."
Dvadeset etiri sata je previe, dvadeset etiri sekunde e delovati. Samo ekanje vas
promeni. Energija koja je tekla prema ljutnji uzela je novi pravac. To je ista energija. Ona
moe postati ljutnja, ona moe postati saoseanje. Samo joj pruite priliku.
Tako stari spisi kau: "Ako dobra misao doe u tvoj um, nemojte je odgaati; delujte
odmah. A ako rava misao doe u va um, odloite je; nikada ne delujte odmah." Inae mi
smo vrlo lukavi ili vrlo pametni, mi mislimo. Kad god dobra misao doe mi je odgodimo.
Mark Tven je pisao u svojim memoarima da je sluao svetenika u crkvi za deset
minuta. Predavanje je bilo divno, i on je mislio u svom umu: "Danas u dati donaciju od deset
dolara. Svetenik je divan. Crkva mora da se pomogne!" Odluio se da pokloni deset dolara
76

posle predavanja. Posle deset minuta je poeo da misli da bi deset dolara bilo previe, pet e
biti dovoljno. Posle jo deset minuta je mislio: "Ovaj ovek ak ne vredi ni pet."
On vie nije sluao. Brinuo je o svojih deset dolara. Nije nikome govorio, ali sada
ubeuje sebe da je ovo previe. Vremenom je rekao: "Predavanje se zavrilo, odluio sam da
ne dam nita. A kada je ovek doao blizu mene da uzme priloge, dok se kretao, pomislio sam
da uzmem nekoliko dolara i pobegnem iz crkve!"
Um se stalno menja. On nikada nije statian, on je teenje. Ako je neto ravo tu,
saekajte malo. Ne moete privrstiti um, um je teenje. Samo ekajte! Samo saekajte malo,
i neete biti sposobni da uinite zlo. Ako je tu neko dobro i elite da ga uinite, uinite to
odmah jer um se menja, posle nekoliko minuta neete biti sposobni to da uinite. Dakle ako je
to delo ljubavi, ne odlaite ga. Ako je neto nasilno ili destruktivno, odgodite to malo.
Ako ljutnja doe, odloite je makar za nekoliko udisaja, i neete biti sposobni da je
iskaete. Onda ste slobodni da delujete. Nastavite neprekidno. To postaje navika; ne treba da
mislite. Onog momenta kada ljutnja ue, odmah va mehanizam zapoinje da die brzo,
duboko. Unutar nekoliko godina postae vam apsolutno nemogue da budete ljuti. Neete biti
sposobni da budete ljuti.
Bilo koja praksa, bilo koji svesni napor, moe promeniti vae stare obrasce. A to nije
posao koji se moe obaviti odmah; to e traiti vreme - jer ste stvorili va obrazac navika u
mnogim, mnogim ivotima. ak ni u jednom ivotu vi ne moete promeniti to - to je previe
rano.
Moji sannyasini mi dolaze i kau: "Kada e se to dogoditi?" a ja kaem: "Ubrzo." A
oni kau: "ta mislite pod vaim "uskoro", jer ste nam godinama govorili "uskoro"?."
ak i u jednom ivotu se to deava - to je ubrzo. Kad god se to dogodi, to se desilo pre
njegovog vremena jer ste vi stvorili ovaj obrazac u tako mnogo ivota. To treba da bude
uniteno, osveeno. Tako u neko vreme, ak u nekom ivotu, to nije prekasno.
Njihov prekid nastaje uz pomo trajnog unutranjeg napora i nevezivanja.
Od ovo dvoje, abhyasa unutranja praksa je napor da se bude vrsto utvren u sebi
samom.
Sutina abhyase je da se bude usrediten u sebi. ta god da se dogodi, ne treba odmah
da se uzbuujete i reagujete. Prvo treba da budete usrediteni u sebi, iz te usredsreenosti da
posmatrate okolo i onda odluite.
Neko vas uvredi i vi ste povueni njegovom uvredom. Vi ste uzbueni bez
savetovanja sa svojim centrom. ak i bez vraanja do centra ni za jedan trenutak, vi ste
uzbueni.
Abhyasa oznaava unutranju praksu. Svesni napor znai: "Pre nego to se pokrenem
van, moram se pokrenuti unutra. Prvo kretanje mora biti prema mom centru. Tamo,
usrediten, pogledau situaciju i onda odluiti." A ovo je tako ogroman, tako preobraavajui
fenomen. Jednom kada ste usrediteni unutra, cela stvar izgleda drugaija; perspektiva se
promenila. To moda nee izgledati kao uvreda. Onda ovek moe samo da izgleda glup. Ili,
ako ste stvarno usrediteni, vi ete saznati da je on u pravu. "To nije jedna uvreda. Nije nita
rekao pogreno o meni."
uo sam da se jednom dogodilo - ne znam da li je to istina ili ne, ali sam uo ovu
anegdotu - da je jedan novinar neprekidno pisao protiv Riarda Niksona, neprekino! klevetajui ga, osuujui ga. Onda je Riard Nikson otiao kod izdavaa i rekao: "ta inite?
Govorite lai o meni i to dobro znate!" Izdava je rekao: "Da, znamo da govorimo lai o
vama, ali ako ponemo govoriti istinu o vama, biete u veoj nevolji!"
Dakle, ako neko govori neto o vama on moda lae, ali samo pogledajte okolo. Ako
je on stvarno taan, to moe biti gore. Ili, sve to on kae moe da se primeni na vas. Ali kada
ste vi usrediteni, moete posmatrati sebe takoe bespristrasno.
Patanjali kae da od ova dva, abhyasa unutranja praksa - jeste napor da se bude
vrsto utvren u sebi. Pre pokretanja u delo, bilo koje vrste delovanja, krenite u sebe. Prvo
budite utvreni tamo - makar samo za jedan jednini trenutak - i vaa akcija e biti totalno
razliita. To ne moe biti neki nesvesni obrazac od nekada. To e biti neto novo, to e biti
jedan ivi odgovor. Samo pokuajte to. Kad god oseate da ete ii da delujete ili uinite
77

neto, pokrenite se prvo unutra, jer ta god da ste inili do sada postalo je slino robotu,
mehaniko. Vi nastavljate initi to neprekidno u ponovljenom ciklusu.
Samo nainite dnevnik za trideset dana - od jutra do veeri, trideset dana, i moi ete
da vidite obrazac. Vi se kreete kao maina; vi niste ovek. Vai odgovori su mrtvi. Sve to
inite jeste predvidljivo. A ako izuite svoj dnevnik pronicljivo moda ete moi da
deifrujete obrazac - da ste ponedeljkom, svakog ponedeljka ste ljuti; svake nedelje ulni,
seksualni; svake subote ste borbeni. Ili ujutru ste dobri, posle podne oseate gorinu, a uvee
ste protiv celog sveta. Moete videti obrazac. Jednom kada sagledate obrazac, moete zapaziti
da radite kao robot. A biti robot je ono to je nevolja. Treba da budete svesni, a ne mehanika
stvar.
Gurijev je imao obiaj da kae: "ovek, ovakav kakav jeste, je maina". Vi postajete
ovek samo kada postanete svesni. A ovaj konstantan napor da se bude utvren u sebi uinie
vas svesnim, oslobodie vas mehaninosti, uinie vas nepredvidljivim, uinie vas
slobodnim. Onda neko moe da vas vrea a vi ete se jo smejati; ranije se nikada niste
smejali. Neko moe da vas uvredi, a vi da oseate ljubav prema oveku; ranije to niste oseali.
Neko moe da vas uvredi, a vi moete biti zahvalni prema njemu. Neto novo se rodilo. Sada
vi stvarate svesno bie u sebi.
Inae prva stvar koju treba uraditi pre kretanja u akciju - jer delovanje znai kretanje
spolja - je kretanje unutra, a onda prema drugima, odlaenje od sebe. Svaki in je odlaenje
dalje od sebe. Pre nego to odete dalje (od sebe), pogledajte, imajte kontakt, uronite u
unutranje bie (postojanje). Prvo budite utvreni.
Pre svakog momenta, neka bude momenat meditacije; to je ono ta je abhyasa. ta
god da radite, pre rada zatvorite svoje oi, ostanite smireni, kreite se unutra. Samo postanite
bestrasni, nevezani, tako da moete gledati na (sve) kao posmatra, nepristrasno - kao da niste
ukljueni, vi ste samo svedok. A onda se kreite!23
Jednog dana, ba ujutru, ena Mule Nasrudina je rekla Muli: "Noas dok si ti spavao,
uvredio si me. Govorio si stvari protiv mene. ta si time mislio? Mora mi objasniti." Mula
ree: "Ali ko kae da sam spavao? Ja nisam spavao. Ba stvari koje elim da kaem, ne mogu
rei danju. Ne mogu skupiti tako mnogo hrabrosti." U vaim snovima, u vaoj budnosti,
konstantno inite stvari, a te stvari se svesno ne ine - kao da ste prisiljeni da ih uinite. ak i
u vaim snovima vi niste slobodni. Ovo konstantno mehaniko ponaanje je ropstvo. Dakle
kako da se bude utvren u sebi? Kroz abhyasu.
Sufiji su neprekidno utvreni u Bogu. ta god da kau, ine; sede, stoje, bilo ta Pre
nego to sufi uenik ustane, on e uzeti Alahovo ime. Prvo e uzeti boje ime. Ako sedne, on
e uzeti boje ime. Jedna akcija treba da se izvede - ak i sedenje je akcija - on e rei:
"Alah!" Tako, sedajui, on e rei: "Alah!" Ustajui on e rei; "Alah!" Ako nije mogue rei
glasno, on e rei u sebi. Svaka akcija se izvodi kroz seanje. A ubrzo, ovo seanje postaje
konstantna barijera izmeu njega i akcije - podela, procep.
A to vie taj procep raste, vie on moe da gleda na svoje akcije kao da on nije akter.
Neprekidnim ponavljanjem Alah, ubrzo, on poinje da vidi da je samo Alah akter. "Ja nisam
akter. Ja sam samo vozilo ili jedno orue." A onog momenta kada ovaj procep raste, sve to je
zlo otpada. Vi ne moete biti zli. Moete initi zlo samo kada nema procepa izmeu aktera i
akcije. Sada dobro tee automatski.
to je vei procep izmeu aktera i akcije, bolje je. ivot postaje sveta stvar. Vae telo
postaje hram. Sve to vas ini budnim, utvrenim unutar sebe, jeste abhyasa.
Od ovo dvoje, abhyasa unutranja praksa je napor da se bude vrsto utvren u sebi
samom.
To postaje vrsto utemeljeno u neprekidnom postojanju za dugo vreme, bez prekida i
sa smernom predanou.
Dve stvari. "Neprekidna praksa za dugo vreme." Koliko dugo? To e zavisiti. To e
zavisiti od vas, od svake osobe, koliko dugo. Duina e zavisiti od intenziteta. Ako je jaina

23

Ovo je ujedno i opis prakse budistike meditacije vipassana i satipatthana.


78

totalna, onda ubrzo se to moe dogoditi, vrlo skoro. Ako intenzitet nije tako jak, onda e uzeti
dui period.
uo sam da je jednog jutra sufi mistik, Junaid, poao u etnju van svog sela. Jedan
ovek je dotrao i pitao Junaida: "Glavni grad ovog kraljevstva elim da stignem u glavni
grad, jo koliko u morati da putujem? Koliko vremena e trebati?"
Junaid je pogledao u oveka, i ne odgovorivi mu, opet poeo da hoda. ovek je
mislio: "Ovaj stari ovek izgleda da je gluv." Pa je po drugi put pitao mnogo glasnije. "elim
znati koliko vremena mi treba da stignem do glavnog grada!"
Meutim, Junaid je opet nastavio da hoda. Nakon hodanja dve milje s tim ovekom,
Junaid ree: "Moraete da hodate najmanje deset sati." Onda je ovek rekao: "Ali mogli ste
mi to rei ranije!" Junaid je kazao: "Kako sam mogao to rei? Prvo sam morao znati vau
brzinu. To zavisi od vae brzine. Na ove dve milje ja sam posmatrao koja je vaa brzina.
Samo onda sam mogao da odgovorim." To zavisi od vae jaine, vae brzine.
Prva stvar je neprekidna praksa za dugi vremenski period bez prekida. Ovo treba
zapamtiti. Ako prekinete, ako radite za nekoliko dana, a onda ostavite za nekoliko dana, itav
napor je izgubljen. A kada zaponete ponovo, to je opet poetak.
Ako meditirate a onda kaete za nekoliko dana da nema problema, oseate lenjost,
oseate pospanost ujutru i kaete: "Mogu da odgodim, mogu to raditi sutra," - ak i za jedan
proputen dan, vi ste izgubili rad od mnogo dana, zato to ne radite meditaciju danas, ve ete
raditi mnoge druge stvari. Te mnoge druge stvari pripadaju vaem starom obrascu, tako je
stvoren sloj. Vae jue i vae sutra je odseeno. Danas je postalo sloj, razliit sloj. Kontinuitet
je izgubljen, a kada sutra ponete ponovo to je opet poetak. Ja vidim, mnoge osobe
zapoinju, prestaju, opet zapoinju. Rad koji moe biti obavljen za nekoliko meseci onda traje
godinama.
Dakle ovo treba zapamtiti: bez prekidanja. Koju god praksu da ste odabrali, izaberite
je za ceo ivot, i nastavite da kujete po njoj, ne sluajte um. Um e pokuati da vas ubedi, a
um je najvei zavodnik. On moe dati sve vrste razloga da je danas nuno da se ne radi jer se
oseate bolesnim, postoji glavobolja, ne moete spavati nou, toliko ste bili umorni da danas
samo moete odmarati. Meutim to su trikovi uma.
Um eli da sledi svoj stari obrazac. Zato um eli da sledi svoj stari obrazac? Jer
postoji najmanji otpor; to je lake. Svako eli da sledi laki put, laki smer. Umu je lako samo
da sledi staro. Novo je teko.
Dakle um se opire svemu to je novo. Ako ste u praksi, u abhyasi, ne sluajte um,
nastavite da radite. Ubrzo ova nova praksa e ui duboko u va um, a um e prestati da se
odupire tome jer e to onda postati lake. Onda e umu biti lake da tee. Dok on ne postane
jedan lagani tok, nemojte prekidati. Moete ponititi dug napor od malo lenjosti. Dakle, to
mora da bude neprekidno.
I drugo, sa smernom predanou. Moete vriti praksu mehaniki, bez ljubavi, nema
predanosti, nema oseanja svetosti u tome. Onda e trajati jako dugo, jer kroz ljubav stvari
prodiru lako u vas. Kroz predanost vi ste otvoreni, vie otvoreni. Seme pada dublje.
Bez predanosti vi moete raditi istu stvar. Pogledajte u hram, moete imati
unajmljenog svetenika. On e raditi molitve neprekidno godinama, bez rezultata, bez
ispunjenja kroz njih. On ih vri kako je propisano, ali to je posao bez predanosti. On moe
pokazati predanost, ali je samo sluga. Zainteresovan je samo za svoju platu - ne za molitvu, ne
za puu, ne za ritual. To mora da bude uraeno - to je dunost; to nije ljubav. Stoga e on to
raditi, godinama. ak i za ceo svoj ivot on e biti iznajmljeni svetenik, plaen ovek. Na
kraju, on e umreti kao da se nikada nije molio. Umree u hramu molei - ali e umreti kao da
se nikada nije molio, jer nije bilo predanosti.
Stoga ne vrite abhyasu, praksu, bez predanosti, jer onda nepotrebno rasipate energiju.
Mnogo moe doi iz toga ako predanosti ima. Kakva je razlika? Razlika je u dunosti i
ljubavi. Dunost je neto to morate da uradite, ali ne uivate da radite to. Morate da iznesete
to nekako; morate da zavrite to pre. To je ba kao vidljivi posao. Ako je takav odnos, kako
onda moe prodreti u vas?
79

Ljubav nije dunost, vi uivate. Ne postoji granica u njenom uivanju, nema urbe da
se zavri to. to je dua, bolje je. Nje nikada nije dovoljno. Uvek oseate neto vie, neto
vie. Ona je uvek nezavrena. Ako je ovakvo dranje, onda stvari idu duboko u vas. Seme
dosee dublju zemlju. Predanost znai da ste u ljubavi sa posebnom abhyasom, praksom.
Posmatram mnoge ljude, radim s mnogim ljudima. Ovo vidim vrlo jasno. Oni koji
praktikuju meditaciju kao da rade samo tehniku, oni nastavljaju da je rade godinama, ali se
promene ne deavaju. To moe pomoi malo, telesno. Oni mogu biti zdraviji, njihova telesna
graa e dobiti neke dobrobiti iz toga. Ali to je samo jedna veba. A onda oni dolaze kod
mene i kau: "Nita se ne dogaa."
Nita se i nee dogoditi, jer nain na koji oni to rade je neto spoljanje, upravo kao
rad - kao kada idu do kancelarije u devet i odlaze iz nje u pet. Bez uea oni mogu ii u
dvoranu za meditaciju. Mogu meditirati za jedan sat i vratiti se natrag, bez uea. To nije u
njihovom srcu.
Druga kategorija ljudi je ona koja to ini s ljubavlju. To nije pitanje da se ini neto.
To nije kvantitativno, to je kvalitativno - koliko ste ukljueni, koliko duboko volite to, koliko
mnogo uivate u tome - nije cilj, nije kraj, nije rezultat, ve sama praksa.
Sufiji kau ponavljanje imena Boga - ponavljanje imena Alaha - u sebi je blaenstvo.
Oni nastavljaju s ponavljanjem i uivaju. Ovo postaje njihov ceo ivot, samo ponavljanje
imena.
Nanak24 kae nam smaram - seanje imena je dovoljno. Vi jedete, odlazite da spavate,
kupate se, a neprekidno vae srce je ispunjeno seanjem. Samo nastavljajte sa ponavljanjem
"Ram" ili "Alah" ili bilo ta, ali ne kao re, (ve) kao predanost, kao ljubav.
Celo vae bie osea se ispunjeno, vibrira s tim, to postaje va najdublji dah. Ne
moete iveti bez toga. Ubrzo to stvara unutranju harmoniju, muziku. itavo vae bie
zapoinje da pada u harmoniju. Ekstaza se raa, brujea senzacija, slast vas okruuje. Ubrzo
ova slatkoa postaje vaa priroda. Onda ta god da kaete, to postaje ime Alaha; ta god
kaete, to postaje seanje na boansko.
Svaka praksa bez prekida i sa smernom predanou... za zapadni um je vrlo teka. Oni
mogu razumeti praksu, ali ne mogu razumeti smernu predanost. Oni su potpuno zaboravili taj
jezik, a bez tog jezika prakse zapadni tragaoci dolaze kod mene i kau: "ta god da kaete mi
emo uraditi," i oni slede tano onako kako im je reeno. Ali oni rade na tome upravo kao to
rade na bilo kojoj drugoj tehnici. Oni nisu u ljubavi s tim; oni nisu postali ludi; oni nisu
izgubljeni u tome. Oni ostaju manipulanti.
Oni su majstori, i oni nastavljaju da manipuliu tehnikom ba kao to e sa svakim
mehanikim izumom manipulisati. Upravo kao kada ukljuite dugme i ventilator startuje nema potrebe ni za kakvom smernom predanou za dugme ili za ventilator. A sve u ivotu vi
radite tako, ali abhyasa se ne moe raditi na taj nain. Morate biti duboko povezani sa svojom
abhyasom, svojom praksom, da vi postanete sporedni, a praksa da postane primarna, da vi
postanete senka, a praksa da postane dua - kao da to niste vi koji vrite praksu. Tako praksa
poinje da se odvija sama od sebe, a vi ste samo deo nje, vibrirate s njom. Onda moe biti da
nikakvo vreme ne bude potrebno.
Sa dubokom predanou rezultati mogu uslediti odmah. U jednom trenutku predanosti
moete ponititi, otkopati mnogo ivota iz prolosti. U momentu duboke predanosti moete
postati potpuno slobodni od prolosti.
Inae je teko objasniti to, tu smernu predanost. Postoji prijateljstvo, postoji ljubav,
postoji razliit kvalitet prijateljstva plus ljubav to je nazvano smernom predanou.
Prijateljstvo i ljubav postoje izmeu jednakih. Ljubav izmeu suprotnog pola, prijateljstvo s
istim polom, ali na istom nivou - vi ste jednaki.
Saoseanje je upravo suprotno smernoj predanosti. Saoseanje potie od vieg izvora
prema niem izvoru. Sauee je kao reka koja tee sa Himalaja do okeana. Buddha je
saoseanje. Ko god doe kod njega, njegovo saoseanje tee nanie. Potovanje je ba
suprotno, kao da Gang tee od okeana prema Himalajima, od nieg prema viem.
24

Guru Nanak, duhovni uitelj Sika.


80

Ljubav je izmeu jednakih, saoseanje je od vieg prema niem; predanost je od nieg


prema viem. Saoseanje i predanost su oboje iezli; samo prijateljstvo je ostalo. A bez
sauea i predanosti prijateljstvo samo visi izmeu. Mrtvo, jer dva pola nedostaju. A ono
moe da postoji, ivi, samo izmeu ova dva pola.
Ako ste u predanosti, onda e pre ili kasnije saoseanje zapoeti da tee prema vama.
Ako ste u predanosti, onda neki vii vrhunac e zapoeti da tee prema vama. Ali ako niste u
predanosti, saoseanje ne moe tei prema vama, vi niste otvoreni prema njemu.
Sva abhyasa, sva praksa, je da se postane smeran, najnii tako da najvie moe da
utie u vas - da postanete smerni. Kao to je Isus rekao: "Samo oni koji stoje poslednji,
postae prvi u mom carstvu Bojem." 25
Postanite najnii... poslednji. Iznenada, kada ste najnii, vi ste sposobni da primate
najvie. A samo prema najnioj dubini najvie je privueno, tegljeno. To postaje magnet. "Sa
predanou" znai vi ste najnii. Zbog toga budisti biraju da budu prosjaci, sufiji su izabrani
da budu prosjaci - ba najnii, prosjaci. Mi smo videli da se u ovim prosjacima najvie
dogodilo.
Ali to je njihov izbor. Oni su stavili sebe u poslednje. Oni su zadnji ljudi - ne u
nadmetanju sa nekim, samo slini dolini, niski, najnii.
Zbog toga se u starim sufi izrekama kae: "Postani rob Boiji" - ba rob, ponavljajui
njegovo ime, stalno zahvaljujui njemu, stalno oseajui zahvalnost, stalno ispunjeni s tako
mnogo blagoslova koje je on izlio na vas.
Sa ovim potovanjem, praktikovaete abhyasu, bez ometanja. Patanjali kae: "Ovo
dvoje, vairagya i abhyasa, pomau umu da prestane. A kada um prestane, vi Jeste, po prvi
put, zaista ste ono to ste namenjeni da budete, ono to je vaa sudbina."

Poglavlje 8
ZAUSTAVI SE, I TO JE OVDE!
1. januara 1974.
Prvo pitanje:
Patanjali je istakao vanost nevezivanja, a to znai, prestanak elja, da se bude
ukorenjen u sebi samom. Inae da li je nevezivanje zaista na poetku putovanja, ili na samom
kraju?
Poetak i kraj nisu dve stvari. Poetak je kraj, stoga ih ne delite i ne razmiljajte u
terminima dualnosti. Ako elite da budete smireni na kraju, moraete da budete smireni od
samog poetka. U poetku tiina e biti kao seme, na kraju e biti kao drvo. Inae drvo je
skriveno u semenu, tako poetak je ba seme.
Koji god da je krajnji cilj, on mora biti skriven ovde i sada, ba u vama, na samom
poetku. Ako nije tu u poetku, ne moete ga postii na kraju. Naravno, tu e postojati razlika
- u poetku to moe biti samo seme; na kraju to e biti potpuno cvetanje. Moda ga neete
moi prepoznati kada je seme, ali je prisutan bilo da ga prepoznajete ili ne. Tako kada
25

"Blago smernima duhom, jer njihovo je carstvo nebesko" to je pogreno prevedeno u Bibliji kao blago
siromanima duhom". Radi se o smernosti, o svoenju sebe na pravu, istinitu meru i usklaenost, biti s pravom
merom u odnosu na boansko, a ne o mentalnom siromatvu i tuposti.
81

Patanjali kae da je nuno nevezivanje na samom poetku putovanja, on ne kae da to nee


biti potrebno na kraju.
Nevezanost u poetku e biti s naporom; nevezanost na kraju e biti spontana. U
poetku vi ete morati da budete svesni toga, na kraju nee biti potrebno da imate svest o
tome. To e biti samo va prirodan tok.
U poetku morate praktikovati to. Konstantna budnost e biti potrebna. Postojae
borba s vaom prolou, sa vaim obrascima vezanosti; borba e biti prisutna. Na kraju nee
biti borbe, nema alternative, nema izbora. Vi ete jednostavno tei u pravcu beeljnosti. To e
morati da postane vaa priroda.
Ali zapamtite, koji god da je cilj, on mora biti praktikovan od samog poetka. Prvi
korak je takoe i poslednji. Dakle ovek mora biti vrlo paljiv oko prvog koraka. Ako je u
prvom ispravan smer, samo onda e zadnji biti ostvarljiv. Ako izostavite prvi korak, vi ste
propustili sve.
Ovo e dolaziti esto u va um, stoga shvatite to duboko jer mnoge stvari e Patanjali
rei koje izgledaju kao ciljevi. Nenasilje je cilj - kada osoba postane tako saoseajna, tako
duboko ispunjena ljubavlju, da ne postoji nasilje, nema mogunosti za nasilje. Ljubav ili
nenasilje je cilj. Patanjali e rei da praktikujete to od samog poetka.
Cilj mora biti u vaem vidokrugu od samog poetka. Prvi korak putovanja mora biti
apsolutno posveen cilju, usmeren prema cilju, kreui se prema cilju. To ne moe biti
apsolutna stvar u poetku, niti Patanjali oekuje to. Vi ne moete biti totalno nevezani, ali
moete pokuati. Sam napor e vam pomoi.
Imaete neuspeha mnogo puta; esto ete postati vezani. A va um je takav da ete ak
biti vezani uz nevezivanje. Va obrazac je tako svestan, ali napor, svesni napor, uskoro e vas
uiniti paljivim i svesnim. Jednom kada ponete oseati bedu vezanosti, manja e biti
potreba za naporom, jer niko ne eli da bude jadan, niko ne eli da bude nesrean.
Mi smo nesreni jer ne znamo ta inimo, ali enja u svakom ljudskom biu je prema
srei. Niko ne ezne za patnjom; svako stvara patnju jer ne znamo ta radimo. Ili se mi moda
kreemo u eljama prema srei, ali obrazac naeg uma je takav da se mi zapravo kreemo
prema nevolji.
Od samog poetka, kada je dete je roeno, odgajano, pogreni mehanizmi su uvoeni
u njegov um, pogreno dranje je hranjeno. Niko ne pokuava da naini sebe neispravnim, ali
nepravilni ljudi su svuda okolo. Oni ne mogu biti nita drugo, oni su bezuspeni i
bespomoni.
Dete je roeno bez ikakvog obrasca. Samo duboka enja za sreom je prisutna, ali
ono ne zna kako da postigne to; nije poznato kako.
Ono zna, to je sigurno, da ta srea treba da bude postignuta. Ono e se boriti celog
svog ivota, ali sredstva, metode kako to treba da se postigne, gde to treba da se postigne, gde
treba da ide da nae to, ono ne zna. Drutvo ga ui kako da postigne sreu, a drutvo nije kako
treba, ono je nepravedno, nepodesno, neistinito, nemoralno.
Dete eli sreu, ali mi ne znamo da ga nauimo da bude sreno. emu god da ga
uimo to postaje put prema patnji. Na primer, mi ga uimo da bude dobro. Mi ga uimo da ne
ini odreene stvari, a da ini izvesne stvari ak i bez razmiljanja da li je to prirodno ili
neprirodno. Kaemo: "Radi ovo, nemoj raditi ono." Nae "dobro" moe da bude neprirodno ako ga neemu uimo da je dobro, a to je neprirodno, onda mu stvaramo obrazac patnje.
Na primer, dete je ljuto, a mi mu kaemo: "Ljutnja je loa. Ne budi ljuto." Inae ljutnja
je prirodna, i samo govorei: "Ne budi ljuto," mi ne unitavamo ljutnju, mi samo uimo dete
da potisne to. Potiskivanje e postati patnja, jer sve to je potisnuto postaje otrovno. To se
kree u same hemikalije tela; to je toksino. A neprekidnim uenjem, "Ne budi ljuto," mi ga
uimo da otruje svoj vlastiti sistem.
Jednoj stvari ga ne uimo: kako da bude ljuto. Jednostavno ga uimo da suzbija
ljutnju. A mi ga moemo prisiliti zato to je zavisno od nas. Ono je bespomono, mora da nas
sledi. Ako kaemo: "Ne budi ljuto," onda e se ono nasmejati. Taj osmeh e biti laan. Iznutra
ono kljua, unutra je u meteu, unutra postoji vatra, a spolja se smeje.
82

Malo dete - od njega mi pravimo licemera. Ono zna da je njegov osmeh laan, njegova
ljutnja je prava, ali realno treba da bude potisnuto, a nerealno da bude prinueno. Ono e biti
rascepljeno. Ubrzo, rascep e postati tako dubok, da kad god se ono nasmeje, osmeh e biti
laan.
A ako ono ne moe zaista biti ljuto, ono ne moe zaista biti ita jer realnost je
odbaena. Ono ne moe izraziti svoju ljubav, ono ne moe izraziti svoju ekstazu - ono ne
moe postati uplaeno od realnog. Ako odbacite deo realnog, cela realnost je odbaena, jer
realnost ne moe biti podeljena i dete ne moe deliti.
Jedna stvar je sigurna: dete je dolo do shvatanja da ono nije prihvaeno. Kakvo ono
jeste, nije prihvatljivo. Realno je ponekad zlo, dakle ono mora biti lano. Ono mora da koristi
lica, maske. Jednom kada ono naui ovo, ceo ivot e se kretati u lanoj dimenziji. A la
moe samo voditi do nevolje, la ne moe voditi do sree. Samo istina, autentina realnost,
moe vas voditi prema ekstazi, prema vrhuncu iskustva ivota - ljubavi, radosti, meditaciji,
kako god to nazivate.
Svako je odgajan po ovom obrascu, tako vi eznete za sreom, ali ta god da inite
kreira bedu. Prva stvar prema srei je da prihvatite sebe, a drutvo vas nikada ne ui da
prihvatite sebe. Ono vas ui da osuujete sebe, da budete krivi negde u sebi samom, da
odsecate mnoge delove. Ono vas obogaljuje, a obogaljen ovek ne moe dostii cilj. Svi smo
mi obogaljeni.
Vezanost je patnja, inae od samog poetka dete je ueno za vezanost. Majka bi
govorila detetu: "Voli me, ja sam tvoja majka." Otac bi rekao: "Voli me, ja sam tvoj otac" kao da, ako je neko otac ili majka, onda on automatski postaje dopadljiv.
Upravo da se bude majka ne znai mnogo ili ba da se bude otac ne znai mnogo. Biti
otac znai prolaziti kroz veliku disciplinu. ovek mora da bude dopadljiv. Da se bude majka
nije samo da se raa. Da se bude majka oznaava veliki trening, veliku unutranju disciplinu.
Ona mora biti dopadljiva.
Ako majka jeste dopadljiva, onda e je dete voleti bez ikakvog vezivanja. Kad god
ono otkrije da je neko dopadljiv, ono e voleti. Ali majke nisu dopadljive, oevi nisu
dopadljivi; oni nikada nisu razmiljali u ovim terminima - da ljubav jeste kvalitet. Vi morate
da ga stvorite; vi to morate postati.
Morate da rastete. Samo onda moete stvoriti ljubav u drugima. To ne moe biti
traeno. Ako traite to, to moe biti jedna vezanost, ali ne ljubav. Dakle dete e voleti majku
jer je ona njegova majka. Majka ili otac, oni postaju ciljevi. Ovo su uzajamni odnosi, ne
ljubav. Onda ono postane vezano za porodicu, a porodica je destruktivna sila jer porodica
suseda je odvojena. Ona nije dopadljiva, jer vi ne pripadate njoj. Onda vaa zajednica, vaa
nacija... inae susedna nacija je neprijatelj.
Ne moete voleti celo oveanstvo. Vaa porodica nije izvorni uzrok. Porodica vas
nije vaspitala da budete dopadljiva osoba - i zaljubljena osoba. To je prisiljavanje nekih
uzajamnih odnosa. Vezanost je uzajamni odnos, a ljubav - ljubav je stanje uma. Va otac vam
nee rei: "Budite zaljubljeni," jer ako ste zaljubljeni vi moete biti zaljubljeni u bilo koga.
ak ponekad i sused vam moe biti vie dopadljiv nego va otac, ali otac to ne moe da
prihvati - da bilo ko moe biti vie dopadljiv od njega, jer je on va otac. Tako uzajamni
odnos treba da bude nauen, ne ljubav.
Ovo je moja zemlja; zbog toga ja moram voleti ovu zemlju. Ako je jednostavno to
ueno, ta ljubav, onda ja mogu voleti svaku zemlju. Inae politiar e biti protiv toga, jer ako
volim neku zemlju, ako volim ovo tlo, onda ja ne mogu biti uvuen u rat. Dakle politiari e
uiti: "Voli ovu zemlju. Ovo je vaa zemlja. Vi ste roeni ovde. Vi pripadate ovoj zemlji; va
ivot, vaa smrt, pripadaju ovoj zemlji." Tako vas on rtvuje za nju. Celo drutvo vas ui
uzajamnim odnosima, vezivanjima, ne ljubavi. Ljubav je opasna jer ona ne zna za granice.
Ona moe da se kree; ona je sloboda. Dakle vaa ena e vas uiti: "Voli me jer ja sam tvoja
ena." Mu ui enu: "Voli me jer ja sam tvoj mu." Niko ne ui ljubavi.
Ako se ljubav poduava, onda bi ena rekla: "Ali druga osoba je vie dopadljiva." Ako
je svet zaista slobodan da voli, onda upravo biti mu ne moe nositi nikakvo znaenje, ba biti
ena ne znai nita. Onda e ljubav slobodno tei. Ali to je opasno; drutvo ne moe dozvoliti
83

to, porodica ne moe dozvoliti to, religija ne moe dozvoliti to. Tako u ime ljubavi oni ue
vezanost, i svako je u bedi.
Kada Patanjali kae: "Nevezanost", on nije protiv ljubavi. Nevezanost znai biti
prirodan, zaljubljen, tean, ali ne postanite opsednuti i s loom navikom, odani poroku. Loa
navika je problem. Onda je to kao bolest. Vi ne moete voleti nikoga osim svog deteta - to je
loa navika. Onda ete biti u patnji. Vae dete moe umreti; onda nema mogunosti za vau
ljubav da tee. ak i ako vae dete nee umreti, ono e odrasti. A to vie odraste, vie e
postati nezavisno. A onda e biti bola. Svaka majka pati, svaki otac pati.
Dete e postati odraslo, ono e se zaljubiti u neku drugu enu. A onda majka pati;
suparnik je uao. Inae, to je zbog vezanosti. Ako majka zaista voli dete, pomoi e mu da
bude nezavisno. Pomoi e mu da se kree u svetu i naini koliko je mogue vie ljubavnih
kontakata, jer e ona znati da to vie volite vie ste ispunjeni. A kada se njeno dete zaljubi u
neku enu, ona e biti srena; plesae od radosti.
Ljubav vam nikada ne daje patnju ako volite nekoga, vi volite njegovu sreu. Ako ste
vezani za nekoga, vi ne volite njegovu sreu, volite samo svoju sebinost; vi ste usredsreeni
samo na svoje vlastite egoistine potrebe.
Frojd je otkrio mnoge stvari. Jedna od njih je majina ili oeva fiksacija (obrazovanje
navike, zaustavljanje psihikog razvoja). On kae: "Najopasnija je ona majka koja prisiljava
dete da je voli toliko da ono postaje fiksirano, i nee biti sposobno da voli nikoga drugog.
Tako ima miliona ljudi koji pate od takvih fiksiranosti.
to se tie mog izuavanja drugih ljudi... Gotovo svi muevi, barem devedeset devet
procenata, pokuavaju da nau svoje majke u svojim enama. Naravno, ne moete nai svoju
majku u vaoj eni; vaa ena nije vaa majka. Ali u dubokoj fiksiranosti na majku, oni su
nezadovoljni sa enom jer ona se ne ponaa materinski s njima. A svaka ena traga za ocem u
muu. Nijedan mu nije va otac. Ako nije zadovoljna sa oinskim ponaanjem, onda je
razoarana.
Ovo su fiksiranja. U Patanjalijevom jeziku, on ih naziva vezanostima. Frojd ih naziva
fiksacijama. Re se razlikuje ali znaenje je isto. Nemojte biti fiksirani; budite teni.
Nevezanost znai da niste fiksirani. Ne budite kao ledene kocke, budite kao voda - teni. Ne
budite smrznuti.
Svaka vezanost postaje smrznuta stvar, mrtva. Ona ne vibrira sa ivotom; ona nije
konstantno pokretna reakcija. Ona nije iz momenta u momenat iva, ona je fiksirana. Vi volite
osobu - ako je to ljubav, onda ne moete predvideti ta e se dogoditi sledeeg momenta.
Nemogue je to predvideti; raspoloenje se menja kao (atmosfersko) vreme. Ne moete rei
da e sledeeg momenta va ljubavnik biti zaljubljen u vas. Sledeeg momenta moda on nee
oseati zaljubljenost. Ne moete to oekivati.
Ako sledeeg momenta on takoe bude voleo vas, to je dobro, vi ste zahvalni. Ako vas
ne voli sledeeg momenta, nita se ne moe uraditi, vi ste bespomoni. Morate prihvatiti
injenicu da on nema takvu sklonost. Nikako ne plaite zbog toga, jednostavno ne postoji
naklonost! Prihvatite situaciju. Ne prisiljavajte ljubavnika da se pretvara, jer pretvaranje je
opasno.
Ako oseam zaljubljenost prema vama, kaem: "Ja vas volim," ali sledeeg trenutka
mogu rei: "Ne, ja ne oseam nikakvu ljubav u ovom momentu." Tako postoje dve
mogunosti - bilo da prihvate moje nezaljubljeno raspoloenje, ili prisiljavate: "Bilo da me
volite ili ne, barem pokaite da me volite." Ako me prisiljavate, onda ja postajem neiskren i
uzajamni odnos postaje pretvaranje, licemerje. Onda nismo iskreni jedno prema drugom. A
kada dve osobe nisu iskrene jedna prema drugoj, kako one mogu biti u ljubavi? Njihov
uzajamni odnos e postati fiksiranost.
ena i mu, oni su fiksirani, mrtvi. Sve je izvesno. Oni se ponaaju jedno prema
drugom kao stvari. Doete kod svoje kue, va nametaj e biti isti jer nametaj je mrtav.
Vaa kua e biti ista jer kua je mrtva. Ali vi ne moete oekivati od svoje ene da bude ista,
ona je iva, (ona je) osoba. Ako oekujete od nje da bude ista kao to je bila kada ste ostavili

84

kuu, onda je prisiljavate da bude samo kuni nametaj, samo stvar. 26 Vezanost prisiljava
povezane osobe da budu stvari, a ljubav pomae osobama da budu vie slobodne, da budu
vie nezavisne, da budu vie istinite. Inae istina moe biti samo u konstantnom teenju, ona
nikada ne moe biti zamrznuta. Kada Patanjali kae: "Nevezanost" on ne kae da ubijete
svoju ljubav. Pre, nasuprot tome, on kae: "Ubijte sve to truje vau ljubav, ubijte sve
prepreke, unitite sve prepreke koje ubijaju vau ljubav." Samo jogin moe da voli. Svetovna
osoba ne moe biti zaljubljena, ona moe biti samo vezana.
Zapamtite ovo: vezanost oznaava fiksaciju - i ne moete prihvatiti nita novo u njoj,
samo prolost. Ne dozvoljavate sadanjosti, ne dozvoljavate budunosti da ita promeni. A
ivot je promena. Samo smrt je nepromenljiva.
Ako ste nevezani, onda iz momenta u momenat se kreete bez ikakvog fiksiranja.
Svakog momenta ivot e doneti nove sree, nove nevolje. Bie tamnih noi, a bie i sunanih
dana, ali vi ste otvoreni; nemate fiksiran um. Kada nemate fiksiran um ak i bedne situacije ne
mogu vam dati patnju, jer nemate nita da ih uporedite. Niste oekivali neto protiv toga,
stoga ne moete biti frustrirani.
Postajete frustrirani zbog vaih potreba. Mislili ste da kada se vratite kui, vaa ena
e upravo stajati napolju da vam izrazi dobrodolicu. Ako ona ne stoji napolju da vam iskae
dobrodolicu, vi ne moete to prihvatiti. To vam stvara frustraciju i patnju. Vi zahtevate, a
kroz zahtevanje stvarate patnju. Zahtevanje je mogue samo ako ste vezani. Ne moete
zahtevati (nita) od osobe koja vam je stranac. Samo sa vezanou zahtevanje ulazi unutra.
Zbog toga vezivanje postaje pakleno.
Patanjali kae: "Ne budite vezani." To znai tecite, prihvatajte, ta god ivot donese.
Ne zahtevajte i ne prisiljavajte. ivot nee slediti vas. Ne moete prisiliti ivot da bude po
vama. Bolje je tei s rekom radije nego je gurati. Samo tecite s njom! Postaje mogue mnogo
sree. Ve ima mnogo sree oko vas, ali je ne moete videti zbog vaih pogrenih fiksiranosti.
Inae ova nevezanost u poetku bie samo seme. Na kraju, nevezanost e znaiti
beeljnost, nepostojanje elje. U poetku, nemanje potrebe, na kraju nepostojanje elje.
Inae ako elite da dostignete taj cilj nemanja elje, zaponite od nemanja potrebe.
ak i za dvadeset etiri asa probajte Patanjalijevu formulu. Upravo za dvadeset etiri sata,
tecite s ivotom ne zahtevajui nita. ta god da ivot da, oseajte zahvalnost, blagodarnost.
Nepristrasno se kreite za dvadeset etiri sata u pobonom stanju uma - ne pitajui, ne
zahtevajui, ne oekujui - i imaete novi poetak. Ovih dvadeset etiri sata e postati novi
prozor. I osetiete kako ekstatini moete postati.
Inae moraete biti budni, oprezni, u poetku. Ne moe se oekivati da tragaocu
nevezanost bude spontan in.
Drugo pitanje:
Kako to da prosvetljen ovek predaje sebe samo oveku, kao to je Buddha to uinio u
sluaju Mahakashyape? Zaista, ovo je specifina Budistika tradicija da uenik prima
svetlost (direktne spoznaje uenja) neprekidno od osam generacija. Zar nije bilo mogue
grupi da bude njegov primalac?
Ne, to nikada nije mogue jer grupa nema duu, grupa nema Sopstvo. Samo pojedinac
moe biti onaj koji prima, primalac, jer samo individua ima srce. Grupa nije osoba.
Vi ste ovde, ja govorim, ali ja ne govorim grupi jer sa grupom ne moe biti
komunikacije. Ja govorim ovde svakom pojedincu. Vi ste se sakupili u grupi, ali me ne sluate
kao grupa; vi me sluate kao pojedinci. Zaista, grupa ne postoji. Samo pojedinci postoje.
"Grupa" je samo re. Ona nema realnost, nema sutinu. To je samo ime kolektiva.
Ne moete voleti grupu, ne moete voleti naciju, ne moete voleti oveanstvo.
Meutim postoje osobe koje tvrde da vole oveanstvo. One obmanjuju sebe jer ne postoji
nigde nita slino oveanstvu, samo postoje ljudska bia. Idi i trai, nikada nee negde nai
oveanstvo.
26

Ovde Osho govori braku na osnovu iskustva u Indiji, gde je brak formalna institucija strogo determinisana.
85

Zaista, one osobe koje tvrde da vole oveanstvo, to su osobe koje ne mogu voleti
osobe. One su nesposobne da budu u ljubavi sa osobama. Onda velika imena - oveanstvo,
nacija, univerzum. One ak mogu voleti Boga, ali ne mogu voleti osobu, jer da se voli osoba
jeste naporno, teko. To je borba. Morate promeniti sebe. Da volite oveanstvo, nema
problema - ne postoji oveanstvo; vi ste sami. Istina, lepota, ljubav ili bilo ta to je znaajno
uvek pripada pojedincu. Samo pojedinci mogu biti primaoci.
Deset hiljada monaha je bilo tamo kada je Buddha izlio svoje bie u Mahakashyapu,
ali grupa je bila nesposobna. Nijedna grupa ne moe biti sposobna, jer svest je individualna,
svesnost je pojedinana. Mahakashyapa se uzdigao do najvie take gde je mogao da primi
Budu. Druge individue mogu takoe postati najvia taka, ali ne grupa.
Religija u osnovi ostaje individualistika, a to ne moe biti drugaije. To je jedna od
osnovnih borbi izmeu komunizma i religije. Komunizam razmilja u terminima grupe,
drutva, kolektiva, a religija misli u terminima individualne osobe, Sopstva. Komunizam misli
da drutvo moe biti promenjeno kao celina, a religija misli da samo individue mogu biti
promenjene. Drutvo ne moe biti promenjeno kao celina jer drutvo nema duu, ono se ne
moe preobraziti. Zapravo, ne postoji drutvo, samo pojedinci.
Komunizam kae da ne postoje individue, samo drutvo. Komunizam i religija, oni su
apsolutno antagonistiki, a ovo je antagonizam - ako komunizam postane nadmoan, onda
individualna sloboda iezava. Onda samo drutvo postoji. Individui zaista nije dozvoljeno da
bude tu. Ona moe postojati samo kao deo, kao zubac u toku. Individui ne moe biti
dozvoljeno da bude bie.
uo sam jednu anegdotu. Jedan ovek je izvestio moskovsku policiju da je njegov
papagaj izgubljen. Tako je on upuen slubeniku koji je nadlean. Slubenik je zapisao, i
pitao: "Da li papagaj govori? On govori?" ovek se uplaio, malo se uznemirio, bilo mu je
neudobno. ovek je rekao: "Da, on govori. Inae koju god politiku opciju on izraava, te
politike opcije su njegove vlastite!" Papagaj! Ova osoba se uplaila jer papagaj misli da ove
politike opcije moraju pripadati njegovom gospodaru. Papagaj jednostavno imitira.
Individualnost nije dozvoljena. Ne moete imati svoja miljenja. Miljenja su briga
drave, grupnog uma. Grupni um je najnia mogua stvar. Individue mogu dosegnuti vrh;
nijedna grupa ne moe nikada postati slina Budi, ili slina Isusu. Samo individualni vrhovi.
Buda predaje svoje itavo ivotno iskustvo Mahakashyapi, jer ne postoji drugi nain.
To ne moe biti predato nijednoj grupi. To ne moe biti; to je nemogue. Komunikacija moe
biti samo izmeu dve individue. Ona je lina, duboko lina vera. Grupa je bezlina. A
zapazite da grupa moe uiniti mnoge stvari - mahnitost je mogua u grupi, ali Budinstvo nije
mogue. Grupa moe biti luda, ali grupa ne moe biti prosvetljena.
to je nia pojava, grupa moe u njoj uestvovati vie. Tako svi veliki grehovi su
poinjeni od grupe, ne od pojedinaca. Pojedinac moe da ubije nekoliko ljudi, ali pojedinac ne
moe postati "Faizam", on ne moe ubiti milione. Faizam moe ubiti milione, i to sa
mirnom saveu!
Posle drugog svetskog rata svi ratni zloinci izjasnili su se da oni nisu odgovorni;
njima je samo bilo nareeno odozgo, i oni su sledili zapovesti. Oni su samo bili deo grupe.
ak i Hitler i Musolini su bili veoma mnogo osetljivi u svojim privatnim ivotima. Hitler je
imao obiaj da slua muziku. Ponekad je ak imao obiaj da slika, voleo je slikanje. Izgleda
nemogue, Hitler je voleo slikanje, tako osetljivo, a ubijao je milione Jevreja bez ikakve
neugodnosti, bez ikakvog nemira u svojoj savesti, ak i bez titanja. On nije bio "odgovoran".
Onda je on bio voa grupe.
Kada se kreete u gomili, moete poiniti sve jer oseate: "Gomila to ini. Ja sam
samo deo nje." Sami, vi ete promisliti tri puta, da li da to uinite ili ne. U gomili odgovornost
se gubi, vae individualno miljenje se gubi, vaa diskriminacija se gubi, vaa svesnost se
gubi. Vi postajete samo deo gomile. Gomila moe da poludi. Svaka zemlja zna, svako vreme
zna da gomila moe da poludi, a onda mogu uiniti sve. Inae nikada se nije ulo da gomila
moe postati prosvetljena.

86

Via stanja svesnosti mogu da postignu samo pojedinci. Vie odgovornosti mora da se
oseti - vie individualne odgovornosti, vie svesnosti. to vie oseate da ste odgovorni, vie
oseate da morate biti svesni, vie postajete individualni.
Buda saoptava Mahakashyapi svoje tiho iskustvo, svoj mirni sambodhi, svoje tiho
prosvetljenje, jer Mahakashyapa je takoe postao vrh, visina, a dve visine mogu da se sretnu
sada. To e uvek biti tako. Dakle, ako elite da dosegnete najvii vrh, ne razmiljajte u
terminima grupa, razmiljajte u terminima svog vlastitog identiteta. Grupa moe biti korisna u
poetku, ali to vie rastete, grupa sve manje i manje moe da bude korisna.
Nastupa taka kada grupa ne moe biti ni od kakve pomoi, vi ste ostavljeni sami. A
kada ste totalno sami i poinjete da rastete iz svoje usamljenosti, po prvi put ste se
kristalizovali. Vi postajete dua, Sopstvo.
Tree pitanje:
Praksa je vrsta uslovljavanja na fizikom i mentalnom nivou, a kroz uslovljavanje
drutvo dri oveka svojim robom. U tom sluaju kako je Patanjalijeva praksa orue za
oslobaanje?
Drutvo vas uslovljava da bi od vas nainilo roba, poslunog lana, tako da izgleda
valjano samo zato jer vi brkate dva tipa uslovljavanja.
Doli ste kod mene, preli ste put. Kada se vraate natrag, putovaete istim putem. Um
moe da pita: "Put koji me je doveo ovde, kako moe da me vrati natrag, isti put?" Staza e
biti ista, va pravac e biti razliit - sasvim suprotan. Dok ste dolazili prema meni vi ste bili
okrenuli lice prema meni, kada odlazite okreete lice u suprotnom pravcu, a staza e biti ista.
Drutvo vas uslovljava da vas naini poslunim lanom, da vas naini robom. Samo
put. Isti put treba da se pree da vas uini slobodnim, samo pravac treba da bude suprotan.
Ista metoda treba da se koristi da se oslobodite uslovljenosti.
Seam se jedne parabole. Jednom je Buddha doao kod svojih monaha; iao je da
odri propoved. Seo je ispod drveta. U ruci je drao maramicu. itavo bratstvo je posmatralo
ta on radi. Onda je on vezao pet vorova na maramici i pitao: "ta treba da uinim da bih
odvezao vorove ove maramice? ta treba da uinim?" Postavio je dva pitanja. Jedno: "Da li
je maramica ista kada nije bilo vorova na njoj ili je razliita?"
Jedan bhikkhu, jedan monah, je rekao: "U nekom smislu je ista jer se kvalitet
maramice nije promenio. ak i sa vorovima ona je ista, ista maramica. Inherentna
(unutranja) priroda ostaje ista. Ali u jednom smislu se promenila jer se neto novo pojavilo.
vorovi nisu bili, a sada vorova ima. Dakle, povrinski ona se promenila, ali duboko dole
ona je ostala ista."
Buda je rekao: "Ovo je reenje ljudskog uma. Duboko dole on ostaje nevezan u
vorove. Kvalitet ostaje isti." Kada postanete Buda, prosvetljen ovek, vi neete imati
razliitu svest. Kvalitet e biti isti. Razlika je samo da ste sada vezani u vorove kao
maramica; vaa svest ima nekoliko vorova.
Druga stvar, pitao je Buda: "ta treba da uradim da bih razvezao vorove na
maramici?" Drugi monah je rekao: "Dok ne znamo kako ste je vezali u vorove, ne moemo
rei nita, jer e morati da se primeni obrnuti proces. Nain na koji ste napravili vorove prvo
mora da se zna, jer e to u obrnutom redosledu biti opet put da se odveu vorovi." Onda je
Buddha rekao: "Ovo je druga stvar. Sada ste doli u ovo ropstvo, ovo treba razumeti. Kako ste
uslovljeni u vaem ropstvu, to treba razumeti, jer isti e biti proces, u obrnutom redosledu, da
sebe oslobodite uslovljenosti ."
Ako je vezanost uslovljavajui faktor, onda nevezanost e biti faktor oslobaanja
uslovljenosti. Ako vas oekivanje vodi u patnju, onda neoekivanje e vas voditi u nemanje
patnje. Ako ljutnja stvara pakao u vama, onda saoseanje e kreirati raj. Dakle kakav god da
je proces nevolje, obrnuto e biti proces sree. Oslobaanje, uslovljavanje znai da ste
razumeli itav, u vor vezan, fenomen ljudske svesti kakav on jeste. Ceo proces joge je (nita
drugo do) razumevanje sloenih vorova i njihovo odvezivanje, njihovo oslobaanje
uslovljavanja. To nije preuslovljavanje, zapamtite. To je jednostavno uklanjanje
87

uslovljavanja; to nije negativno. Ako bi to bilo preuslovljavanje, onda biste opet postali rob novi tip roba i novo utamnienje. Dakle ovu razliku treba zapamtiti; to je oslobaanje
uslovljenosti, ne preuslovljavanje.
Zbog ovoga su nastali mnogi problemi. Krinamurti nastavlja da govori da ako bilo ta
uinite to e postati preuslovljavanje, stoga ne inite nita. Ako uinite ma ta, to e postati
preuslovljavanje, moete biti bolji rob, ali ete ostati rob. Sluajui njega, mnogi ljudi su
prekinuli sve delatnosti. Ali to ih nije uinilo osloboenim. Oni nisu osloboeni. Uslovljenost
je prisutna. Oni se ne preuslovljavaju. Sluajui Krinamurtija, oni su se zaustavili, oni nisu
preuslovljeni. Ali takoe nisu ni osloboeni uslovljenosti. Oni ostaju robovi.
Zato ja ne preuslovljavam, niti je Patanjali za preuslovljavanje (prepravljanje). Ja
sam za oslobaanje uslovljavanja, i Patanjali je takoe za uklanjanje uslovljavanja. Samo
razumite um. Koja god da je bolest, razumite bolest, dijagnozirajte je, i uklonite u obrnutom
sledu.
Kakva je razlika? Uzmimo neki realan primer. Ljutnja je uslovljavanje; to ste nauili.
Psiholozi kau da je to naueno, to je programirana stvar. Vae drutvo vas ui tome. Postoje
ak i sada drutva koja se nikada ne ljute. Postoje drutva, male plemenske zajednice jo
postoje, koje nikada nisu upoznale nikakvu borbu, nisu ratovali.
Na Filipinima, postoje mala praistorijska plemena. Za tri hiljade godina nisu upoznala
nikakvu borbu, nijedno ubistvo, nijedno samoubistvo. ta se dogodilo njima? Oni su najvei
ljubitelji mira, najsreniji. Njihovo drutvo od samog poetka nikada ih ne uslovljava za
ljutnju. U tom plemenu, ak i u vaim snovima ako ubijete nekoga, morate otii i moliti za
oprotaj - ak i u snu. Ako se naljutite na nekoga u snu i potuete se, sledeeg dana morate
objaviti selu da ste uradili neto pogreno. Onda e se selo sakupiti zajedno, i mudri ljudi
postaviti dijagnozu vaeg sna i preporuie vam ta sada treba da uradite - ak i mala deca!
itao sam analize njihovih snova. Izgleda da su oni jedni od najpronicljivijih ljudi.
Malo dete sanja. U snu ono vidi deaka iz susedstva, vrlo tunog. Ono ispria san svom ocu
ujutru: "Video sam deaka iz susedstva vrlo tunog." Tako otac razmilja o tome, zatvori
svoje oi, meditira, i onda kae: "Ako si ga video tunog, to znai na neki nain je njegova
alost povezana s tobom. Niko drugi nije sanjao o njemu da je on tuan, tako da si znajui i
neznajui uinio neto to je stvorilo njegovu alost. Ili, ako ti nisi uradio, u budunosti e to
uraditi. Dakle, san je samo predskazanje za budunost. Idi sa mnogo slatkia, mnogo poklona.
Daj slatkie i poklone deaku za njegov oprotaj - bilo da je neto uinjeno u prolosti ili e
neto uraditi u budunosti."
Tako dete odlazi, daje voe, slatkie, darove, i moli njegov oprotaj jer je nekako, u
snu, on odgovoran za njegovu alost. Od samog poetka dete se odgaja na taj nain. Ako je
ovo pleme postojalo bez borbe, ubistva, samoubistva, to nije udo. Oni ne mogu to pojmiti.
Drugaija vrsta uma tamo funkcionie.
Psiholozi kau da mrnja ili ljutnja nisu prirodni. Ljubav je prirodna; mrnja i ljutnja
su samo stvorene. One su prepreka u ljubavi, i drutvo vas uslovljava njima. Neuslovljavanje
znai da ta god je drutvo uradilo, ono je uradilo. Nema koristi nastavljati osuivati ga; to je
ve sluaj. Govorei jednostavno da je drutvo odgovorno, vama se ne pomae. To je
uraeno. Sada, ba sada, moete ukloniti uslovljenost. Dakle, kakav god da je va problem,
pogledajte duboko u problem. Prodrite u njega, analizirajte ga, i vidite kako ste uslovljeni
njime.
Na primer, postoje drutva koja nikada ne oseaju nadmetanje. ak u Indiji, ima
drevnih plemena u kojima ne postoji nadmetanje. Naravno, oni ne mogu biti vrlo napredni, po
naim merilima, jer na napredak moe jedino da bude kroz nadmetanje. Oni nisu
konkurentni. Zato to nisu konkurentni, oni nisu ljuti, nisu ljubomorni, nisu tako ispunjeni
mrnjom, nisu nasilni. Oni ne oekuju mnogo, a s onim ta god da im ivot d, oseaju se
sreni i zahvalni.
Vama, ma ta da ivot d, vi se neete oseati zahvalni. Uvek ete biti frustrirani, jer
uvek traite vie. I nema kraja vaim oekivanjima i eljama. Tako, ako se oseate bedno,
pogledajte u nevolju i analizirajte je. Koji su uslovljavajui faktori koji kreiraju patnju? Nije
88

mnogo teko da se to razume. Ako moete stvoriti patnju, ako ste tako sposobni da stvorite
nevolju, nije teko razumeti je. Ako je moete stvoriti, moete je razumeti.
itavo Patanjalijevo gledite je ovo: posmatrajui ljudsku patnju, otkriveno je da je
ovek sam odgovoran za nju. On ini neto da bi je stvorio. To injenje je postalo navika, tako
da on nastavlja to da ini. To je postalo ponavljanje, mehaniko, slino robotu. Ako postanete
paljivi, moete odbaciti to. Moete jednostavno rei: "Ja sam kooperativan." Mehanizam e
poeti tako da vas neko uvredi. Vi samo ostanite mirni, ostanite tihi. Mehanizam e zapoeti,
on e doneti proli obrazac. Ljutnja e dolaziti, dim e se dizati, a vi ete se oseati na ivici da
postanete ludi. Ali mirujte. Nemojte saraivati i samo posmatrajte ta mehanizam ini.
Osetiete obrtanja, kotrljanja unutra u vama, ali ona su nemona jer vi ne saraujete.
Ili, ako oseate da je nemogue ostati u takvom mirnom stanju, onda zatvorite svoja
vrata, krenite u sobu, imajte jastuk pred sobom, i udarajte po jastuku. Budite ljuti na jastuk. A
kada ga udarate, postajui ljuti i ludi s jastukom, upravo nastavite da posmatrate ta radite, ta
se dogaa, kako se obrazac sam ponavlja.
Ako moete ostati mirni, to je najbolje. Ako oseate da je to teko, povucite se, onda
krenite u sobu i budite ljuti na jastuk, jer s jastukom svoju ludost moete potpuno da vidite;
ona e postati transparentna. A jastuk nee reagovati pa moete posmatrati mnogo lake. Ne
postoji opasnost, nema, ne postoji problem bezbednosti. Moete posmatrati. Lagano,
podizanje ljutnje i opadanje ljutnje.
Posmatrajte oboje, ritam. A kada je vaa ljutnja iscrpljena, ne oseate se vie kao da
udarate jastuk, ili ste zapoeli da se smejete ili se oseate smenim, zatvorite svoje oi, sednite
na pod, i meditirajte o tome to se deavalo. Da li jo uvek oseate ljutnju prema osobi koja
vas je uvredila, ili je to baeno na jastuk? Oseate neki mir koji vas obuzima. Neete oseati
ljutnju sad na dotinu osobu. Pre ete oseati saoseanje prema njoj.
Pre dve godine ovde je bio jedan ameriki mladi. On je pobegao iz Amerike samo
zbog jednog problema, jedne opsesije: stalno je mislio da ubije svog oca. Otac mora da je bio
opasan ovek; mora da je previe guio ovog mladia. U svojim snovima razmiljao je da
ubije, u svojim dnevnim sanjarenjima takoe je razmiljao da ubije svog oca. Pobegao je od
kue samo zato da tu ne bude vie oca. Inae, svakog dana neto se moglo dogoditi. Kad je
ludilo tu, ono moe buknuti svakog momenta.
Bio je ovde sa mnom. Rekao sam mu: "Nemoj guiti to." Dao sam mu jastuk i rekao:
"Ovo je tvoj otac. Sada uini ta god eli." U poetku je poeo da se smeje, smejao se
ludaki. Rekao je: "To izgleda smeno." Ja sam mu rekao: "Pusti neka bude smeno. Ako je to
u umu, pusti to da izae." Petnaest dana je on stalno tukao i cepao jastuk, i radio je to.
esnaestog dana je doao s noem. Ja mu to nisam rekao. Pa sam ga pitao: "ta e ti taj no?"
Rekao je: "Sada me ne zaustavljaj. Pusti me da ubijem. Sada jastuk nije za mene
jastuk. Jastuk je zaista postao moj otac." Onda je poeo da plae; suze su lile iz njegovih
oiju. Postao je smiren, oputen i rekao mi je: "Oseam mnogo ljubavi prema mom ocu,
mnogo saoseanja. Dozvoli mi sada da se vratim natrag."
On se vratio sada. Odnos se potpuno promenio. ta se dogodilo? Samo mehanika
opsesija je izbaena.
Ako moete ostati mirni kada neki stari obrazac hvata va um, to je dobro. Ako ne
moete, onda mu dozvolite da se dogodi na dramatian nain, ali sam, ne sa nekim. Jer kad
god ispoljavate va obrazac, i to delite sa nekim, to stvara novu reakciju i to je zlokoban krug.
Najznaajnija stvar je da se bude oprezan za obrazac - bilo da stojite smireno ili
odraujete vau ljutnju i mrnju. Ako moete uvideti mehanizam, moete ga ponititi.
Svi koraci u jogi su samo za ponitavanje neega to ste inili. Oni su negativni; nita
novo ne treba da se kreira. Samo nepravilno treba da bude uniteno, i ispravno je ve tu. Nita
pozitivno ne treba da se ini, samo neto negativno. Pozitivno je skriveno tu. To je ba kao to
je potok tu, skriven ispod stene. Vi ne treba da stvarate potok. Stena je tu. Stena mora da bude
uklonjena. Jednom kada je stena uklonjena, potok zapoinje da tee.
Blaenstvo, srea, radost ili kako god da to nazivate je tu, ve tee u vama. Samo neke
stene su tu. Ove stene su uslovljavanja iz drutva. Uklonite njihovo uslovljavanje. Ako
oseate vezanost, ona je stena, onda uinite napor za nevezivanje. Ako oseate ljutnju, ona je
89

stena, onda uloite napore za nemanje ljutnje. Ako oseate pohlepu, ona je stena, onda uloite
napore za nemanje pohlepe. Samo uinite suprotno. Nemojte guiti ljutnju. Samo inite
suprotno, uinite neto to nije ljutnja. Nemojte samo potiskivati ljutnju; inite neto to nije
ljutnja. U Japanu, kada se neko naljuti, imaju tradicionalno uenje. Ako se neko naljuti,
odmah mora da uini neto to nije ljutnja. Ista energija koja bi krenula u ljutnju, odlazi u neljutnju. Energija je neutralna. Ako oseate ljutnju na nekoga i elite da oamarite njegovo lice,
dajte mu cvet i posmatrajte ta se dogaa.
elite da pljusnete njegovo lice, elite da uinite neto - to je bila ljutnja. Dajte mu
cvet i samo posmatrajte ta se dogaa u vama - vi inite neto to je od nemanja ljutnje. A ista
energija je htela da pokrenete svoju ruku pokrenue vae srce. Ista energija koja je htela da ga
udari sada e mu dati cvet. Ali kvalitet se promenio. Uinili ste neto. A energija je neutralna.
Ako ne uinite neto, onda vi potiskujete - a potiskivanje je otrovno. Uinite neto, ali samo
suprotno. A to nije novo uslovljavanje, uklanjanje starog uslovljavanja. Kada je staro iezlo,
nije nuno da brinete ni o emu. Onda moete tei spontano.
Poslednje, etvrto pitanje:
Rekli ste da spiritualno nastojanje moe da uzme dvadeset do trideset godina ivota,
ili ak ivot, i da je ak i tada rano. Meutim, zapadni um izgleda da je orijentisan na
rezultate, nestrpljiv i previe praktian. On eli odmah rezultate. Religijske tehnike dolaze i
odlaze kao drugi hirovi na zapadu. Kako onda nameravate da uvedete jogu u zapadni um?
Ja nisam zainteresovan za zapadni um ili istoni um. Ovo su dva aspekta uma. Ja sam
zainteresovan za um. A ova istono-zapadna dihotomija nije mnogo znaajna, nije ak bitna
sada. Ima istonih umova na Zapadu, a ima i zapadnih umova na Istoku. Sada je cela stvar
postala izmeana. Stari Istok je iezao potpuno.
Seam se taoistike anegdote. Tri taoista su meditirali u peini. Jedna godina je prola.
Bili su smireni, sedeli su i meditirali. Jednog dana je proao u blizini jedan konjanik. Oni su
ga ugledali. Jedan od trojice pustinjaka je rekao: "Konj koga je jahao bio je beo." Druga
dvojica su ostali nemi. Posle jedne godine, drugi pustinjak je rekao: "Konj je bio crn, nije bio
beo." Onda je opet prola jo jedna godina. Trei pustinjak je rekao: "Ako e biti rasprave, ja
odlazim! Ometate moju tiinu!"
ta znai da li je konj bio beo ili crn? Tri godine. Meutim, ovakav je tok na Istoku.
Vremena nema. Istok nije svestan vremena uopte. Istok ivi u venosti, kao da vreme ne
prolazi. Sve je bilo statino.
Inae taj Istok vie ne postoji. Zapad je pokvario sve; Istok je iezao. Kroz zapadno
obrazovanje sada je sve zapadno. Samo je nekoliko ljudi slinih ostrvima koji su istonjaci oni mogu biti na Zapadu, mogu biti na Istoku, nisu ni na koji nain ogranieni na Istoku.
Inae svet kao celina, svet u potpunosti je postao zapadni.
Joga kae - i pustite da to prodre u vas vrlo duboko jer e to biti vrlo znaajno - joga
kae da to ste vie nestrpljivi, vie vremena e biti potrebno za va preobraaj. to ste vie u
urbi, vie ete biti zadrani. urba stvara takvu konfuziju da e odlaganje biti rezultat.
to ste manje u urbi, ranije e biti rezultata. Ako ste beskonano strpljivi, ba ovog
momenta transformacija se moe dogoditi. Ako ste spremni da ekate zauvek, moda neete
ekati ak ni do sledeeg trenutka. Ba ovog momenta stvar se moe dogoditi, jer to nije
pitanje vremena, to je pitanje kvaliteta vaeg uma.
Beskonano strpljenje. Jednostavno nemanje enje za rezultatima daje vam mnogo
dubine. urba vas ini plitkim. Vi ste u takvoj urbi da ne moete biti duboki. Ovog trenutka
vi niste zainteresovani ovde u ovom momentu, nego ta e se dogoditi u sledeem.
Zainteresovani ste za rezultat. Kreete se ispred sebe; vaa dinamika je luda. Tako moete
juriti previe, moete putovati previe, a da ne stignete nigde jer cilj koji treba postii je ba
ovde. Treba da se bacite u to, ne da ga dostiete bilo gde. A baciti se moete samo ako ste
potpuno strpljivi.
Reci u vam jednu zen anegdotu. Jedan zen monah je prolazio kroz umu. Iznenada je
postao svestan da ga tigar sledi, pa je poeo da tri. Ali njegovo tranje je zenovskog tipa; on
90

se nije urio. On nije lud. Njegovo tranje je takoe glatko, harmonino. Uivao je u tome.
Reeno je da monah misli u umu: "Ako tigar uiva u tome, zato ne bih ja?"
A tigar ga je sledio. Onda je doao blizu provalije. Upravo da bi pobegao od tigra
obesio se o granu drveta. Onda je pogledao dole. Lav je stajao dole ekajui na njega. Onda je
stigao tigar, stao je pokraj drveta na vrhu breuljka. On je visio izmeu, samo na grani, a lav
je ekao na njega, duboko dole. On se smejao. Onda je pogledao. Dva mia su upravo grickala
granu... jedan beo, a jedan crn. Onda se on smejao vrlo glasno. Rekao je: "Ovo je ivot. Dan i
no, beo i crni mi grickaju. Gde god da krenem, smrt me eka. Ovo je ivot!" Reeno je da je
tada dostigao satori - prvo svetlucanje prosvetljenja. Ovo je ivot! Nita ne treba brinuti; tako
stvari idu. Gde god vi krenete smrt eka, a ak i ako ne idete nikuda dan i no seckaju va
ivot. Stoga se on glasno smejao.
Onda je pogledao okolo, jer sada je fiksiran. Sada nema brige. Kada je smrt sigurna,
emu briga? Samo u nesigurnosti ima brige. Kada je sve izvesno, nema brige; sada je to
postala sudbina. Stoga je traio kako da uiva u ovih nekoliko momenata. Postao je svestan,
upravo pored grane nekoliko jagoda, ubrao ih i pojeo. Bile su najbolje u njegovom ivotu.
Uivao je u njima, i kae se da je tog momenta postao prosvetljen.
Postao je Buddha jer smrt je tako blizu a ak ni tada nije bio u urbi. Mogao je da
uiva u jagodama. To je slatko! Ukus je sladak! On zahvaljuje Bogu. Kae se da u tom
momentu sve iezava - tigar, lav, grana, on sam. On je postao kosmos.
Ovo je strpljenje, apsolutno strpljenje! Gde god da ste, u tom momentu uivajte bez
pitanja za budunost. Nema budunosti u umu - samo sadanji momenat, sadanjost trenutka,
a vi ste zadovoljni. Onda nije potrebno da se ide nigde. Gde god ste, sa same te take vi ete
se baciti u okean; postaete jedno s kosmosom.
Inae um nije zainteresovan za ovde i sada. Um je zainteresovan negde u budunosti
za neke rezultate. Dakle, pitanje je, na nain relevantan za takav um, moderan um, hoe li biti
bolje nazvati ga tako, nego zapadnim. Moderan um je stalno opsednut budunou, sa
rezultatima, ne sa ovde i sada.
Kako se taj um moe nauiti jogi? Ovaj um se moe nauiti jogi jer ova orjentacija ka
budunosti ne vodi nigde. Ova orjentacija ka budunosti je kreiranje konstantne patnje za
moderni um. Mi smo stvorili pakao, stvorili smo ga previe. Sada, ili e ovek morati da
iezne sa ove planete zemlje, ili e morati da preobrazi sebe. Ili e oveanstvo morati da
umre kompletno - jer ovaj pakao se vie ne moe nastaviti - ili emo mi morati da proemo
kroz preobraaj.
Otuda, joga moe postati vrlo sadrajna i bitna za moderni um, jer joga moe da
izbavi. Ona vas moe nauiti kako da budete ovde i sada - kako da zaboravite prolost, kako
da zaboravite budunost, i kako da ostanete u sadanjem trenutku sa takvim intenzitetom da
ovaj trenutak postane bezvremen, sam trenutak da postane venost.
Patanjali moe postati vie i vie znaajan. Kako se ovo stolee primie svom kraju,
tehnike o ljudskom preobraaju e postati sve vanije i vanije. One ve nastaju svuda u svetu
- bilo da ih nazivate joga, zen ili sufi metodama ili ih nazivate tantra metodama. Na mnogo,
mnogo naina, sve stare tradicionalne tehnike se razbuktavaju. Neka duboka potreba postoji, a
oni koji razmiljaju, svuda, u bilo kom delu sveta, mogu postati zainteresovani da otkriju
ponovo kako je oveanstvo u prolosti ivelo sa takvim blaenstvom, takvim ushienjem. Sa
tako nepovoljnim uslovima, kako su bogati ljudi iveli u prolosti, a mi, s tako bogatim
stanjem, zato smo mi tako siromani.
Ovo je paradoks, moderni paradoks. Po prvi put na zemlji mi smo stvorili bogata,
nauna drutva, a ona su najrunija i najnesrenija. A u prolosti nije bilo naune tehnologije,
ni obilja, nita od udobnosti, ali oveanstvo je ivelo u tako ozbiljnoj, mirnoj ivotnoj sredini
- sreno, zahvalno.
Ta egzistencija je ovde i sada, a nestrpljiv um ne moe biti u kontaktu s njom.
Nestrpljenje je kao grozniavo, ludo stanje uma; vi nastavljate da trite. ak i ako cilj doe,
ne moete stati tamo, jer jurenje je postalo vaa navika. ak i ako postignete cilj vi ete ga
promaiti, vi ete ga propustiti jer se ne moete zaustaviti. Ako se moete zaustaviti, cilj se ne
treba traiti.
91

Zen majstor Hui-Hai je rekao: "Trai, i izgubie; ne trai i dobie to odmah. Stani, i
to je ovde. Tri, to nije nigde."

Poglavlje 9
PRAKSA I BEELJNOST
3. januar 1974.
I, 15:

drtanuravikaviayavitrinasya vaikarasamjna vairagyam.


Oseanje da se zagospodarilo (vaikarasamjna) u sluaju onoga koji ne osea
vie e ni za objektima iz oblasti ula niti za onima iz oblasti slovesnosti
(anusravikaviaya) oznaava se [tehnikim terminom] - proienost (vairagya).
I, 16:

tatparam puruakyatergunavaitrnyam.
Ova je [proienost] dostigla vrhunac kada se u zrenju sve-transcendirajuesubjektivnosti (purua) i e za [samim] energetskim izvorima [u kojima su i sve
potencijalnosti prisutne] (guna) - gubi.
Abhyasa i vairagya - stalna unutranja praksa i beeljnost; to su dva osnovna kamena
temeljca Patanjalijeve joge. Konstantan unutranji napor je potreban jer neto treba da se
postigne, ali zbog pogrenih navika. Borba nije protiv prirode, borba je protiv navika. Priroda
je tu, svakog momenta dostupna da se ulije, da postane jedno s tim, ali ste dobili pogrean
obrazac navika. Ove navike stvaraju prepreke. Borba je protiv ovih navika, a dok se one ne
unite, priroda, vaa inherentna priroda, ne moe tei, ne moe se kretati, ne moe dostii
sudbinu za koju je namenjena da bude.
Stoga zapamtite prvu stvar: borba nije protiv prirode. Borba je protiv pogrenog
vaspitanja, pogrenih navika. Vi ne tuete sebe; vi se borite s neim drugim to je bilo
uvreno u vama. Ako se ovo ne shvati pravilno, onda svi vai napori mogu ii u pogrenom
pravcu. Moete zapoeti da se borite sa sobom, a ako jednom zaponete borbu sa sobom vi
bijete izgubljenu bitku. Nikada ne moete biti pobednik. Ko e biti pobednik, a ko e biti
pobeeni? - jer vi ste oboje. Onaj ko se bori i onaj s kim se borite jeste isti.
Ako obe moje ruke ponu da se bore, ko e pobediti? Jednom kada zaponete da se
borite sa sobom vi ste gubitnik. A tako mnogo osoba, u svojim nastojanjima, u svom traganju
za duhovnom istinom, padaju u tu greku. Oni postaju rtve ove greke; oni zapoinju da se
bore sa sobom. Ako se borite sa sobom, postaete vie i vie umobolni. Biete vie i vie
podeljeni, rascepljeni. Postaete izofreniar. To je ono to se deava na Zapadu.
Hrianstvo je uilo - ne Hrist - hrianstvo je uilo da se borite sa sobom, da
osuujete sebe, da poriete sebe. Hrianstvo je stvorilo veliku podelu izmeu nieg i vieg.
Nema nieg vieg i nieg u vama, ali hrianstvo govori o niem biu i viem biu, ili telu i
dui. Inae hrianstvo vas na neki nain deli i stvara borbu. Ova borba e biti beskrajna; nee
voditi nigde. Krajnji rezultat moe samo da bude samounitenje, izofrenini haos. To je ono
to se dogodilo na Zapadu.
Joga vas nikada ne deli, ali jo uvek postoji borba. Borba nije protiv vae prirode.
Naprotiv, borba je za vau prirodu. Vi imate akumulirane mnoge navike. Ove navike su vaa
postignua pogrenih obrazaca iz mnogih ivota. Zbog ovih pogrenih obrazaca vaa priroda
ne moe da se kree spontano, ne moe da tee spontano, ne moe da dosegne svoju sudbinu.
Ove navike moraju biti unitene, i one su samo navike. One vam mogu izgledati kao priroda
jer ste im se tako mnogo prepustili. Moda ste postali identifikovani s njima, ali one nisu vi.
92

Ova razlika mora jasno da se ima na umu, inae moete pogreno interpretirati
Patanjalija. Sve to je dolo u vas spolja i jeste pogreno mora da bude uniteno tako da ono
to je u vama moe da tee, moe da cveta. Abhyasa, neprekidna unutranja praksa, je protiv
navika.
Druga stvar, drugi kamen temeljac, je vairagya, beeljnost. To vas takoe moe voditi
u pogrenom pravcu. I zapamtite, ovo nisu pravila, ovo su jednostavno uputstva. Kada kaem
da ovo nisu pravila, ja mislim da ne treba da se slede kao jedna opsesija. Njih treba razumeti smisao, znaenje. A to znaenje treba da bude noeno u ovekovom ivotu.
To e biti razliito za svakoga, stoga to nije fiksno pravilo. Vi ne treba da sledite to
dogmatski. Treba da razumete njihovo znaenje i da im dozvolite da rastu u vama. Cvetanje
e biti razliito kod svakog pojedinca. Dakle, ona nisu mrtva, dogmatska pravila, ovo su
jednostavna uputstva. Ona pokazuju pravac. Ona vam ne daju detalje.
Seam se jednom je Mula Nasrudin radio kao uvar u muzeju. Prvog dana kada je
postavljen, pitao je za pravila: "Koja pravila treba da se slede?" Data mu je knjiga pravila koja
treba da slede uvari. On ih je zapamtio; uloio je svu brigu da ne zaboravi nijedan detalj.
Prvog dana kada je bio na dunosti, doao je prvi posetilac. Rekao je posetiocu da
ostavi svoj kiobran tamo spolja kod njega na vratima. Posetilac je bio zapanjen. Rekao je:
"Ali ja nemam nikakav kiobran." Na to je Nasrudin rekao: "U tom sluaju, moraete da se
vratite natrag. Donesite jedan kiobran jer to je pravilo. Dok posetilac ne ostavi svoj kiobran
ovde spolja, ne moe mu se dozvoliti da ue unutra."
Ima mnogo ljudi koji se pridravaju pravila. Oni ih slede slepo. Patanjali nije
zainteresovan da vam daje pravila. Sve to e on uraditi je da vam da jednostavna uputstva ne da bi se sledila, nego da bi se razumela. Sleenje e proizai iz tog razumevanja. A obrnuto
ne moe da se dogodi - ako sledite pravila, razumevanje nee doi; ako razumete pravila,
sleenje e doi automatski, kao senka.
Beeljnost je uputstvo. Ako sledite to kao pravilo, onda ete zapoeti da ubijate svoje
elje. Mnogi su to uradili, milioni su to uradili. Oni ponu da ubijaju svoje elje. Naravno,
ovo je matematiki, ovo je logiki. Ako beeljnost treba da se postigne, onda je ovo najbolji
put: da se ubiju sve elje. Onda ete biti bez elja. Ali takoe ete biti i mrtvi. Vi ste sledili
pravilo tano, ali ako ubijete sve elje vi ubijate sebe, izvravate samoubistvo - jer elje nisu
samo elje, one su tok ivotne energije. Beeljnost treba da se postigne bez ubijanja iega.
Beeljnost treba da se postigne sa vie ivota, sa vie energije - ne manje.
Na primer, moete ubiti seks lako ako izgladnjujete telo, jer seks i hrana su duboko
povezani. Hrana je potrebna za vae preivljavanje, za preivljavanje pojedinca, a seks je
potreban za preivljavanje rase, vrste. Oni su oboje hrana na neki nain. Bez hrane individua
ne moe preiveti, a bez seksa rasa ne moe preiveti. Inae primaran je pojedinac. Ako
pojedinac moe da preivi, onda se ne postavlja pitanje rase.
Dakle, ako izgladnjujete svoje telo, ako mu dajete tako malo hrane da se energija
stvorena od nje iscrpljuje u svakodnevnom rutinskom radu - vaem hodanju, sedenju,
spavanju - ne akumulira se ni malo vika energije, onda e seks ieznuti jer seksa samo moe
biti kada pojedinac skupi vie energije, vie nego to mu je potrebno za preivljavanje. Onda
telo moe misliti o preivljavanju za rasu. Ako ste vi u opasnosti, onda telo jednostavno
zaboravlja na seks.
Otuda toliko privlanosti u postu, jer u postu seks iezava - ali to nije beeljnost To je
samo postajanje sve vie i vie mrtvim, manje i manje ivim. U Indiji su zen monasi postili
neprekidno ba radi tog cilja, jer ako postite neprekidno i stalno ste na dijeti gladovanja, seks
iezava; nita drugo nije potrebno - nikakav preobraaj uma, nikakav preobraaj unutranje
energije. Jednostavno gladovanje pomae.
Onda vi postajete naviknuti na gladovanje. Ako to radite neprekidno godinama,
jednostavno ete zaboraviti da seks postoji. Nikakva energija se ne stvara, nikakva energija se
ne kree do seksualnog centra. Nema energije da se kree. Osoba egzistira ba kao mrtvo
bie. Nema seksa.
Meutim, ovo nije ono to Patanjali misli. Ovo stanje bez elja. To je jednostavno
jedno impotentno ili nemono stanje; tu ne postoji energija. Dajte telu hranu... Vi ste moda
93

izgladnjivali telo za trideset ili etrdeset godina - dajte pravu hranu telu i seks se ponovo
pojavljuje. Vi se niste promenili. Seks je upravo skriven tu i eka energiju da potee. Kad god
energija potee, on e opet postati iv.
Dakle, ta je merilo? Kriterijum treba da se zapamti. Biti vie iv, biti vie ispunjen sa
energijom, vitalnou, a postati be elja. Samo onda, ako vas vaa beeljnost ini vie ivim,
onda ste sledili ispravno uputstvo, ako vas uini jednostavno mrtvom osobom, vi ste sledili
pravilo. Lako je slediti pravilo jer se ne zahteva inteligencija. Lako je slediti pravilo jer
jednostavni trikovi to mogu uiniti. Post je jednostavan trik. Nita mnogo nije sadrano u
njemu; nikakva mudrost nee proizai iz toga.
Sproveden je jedan eksperimenat na Oksfordu. Za trideset dana je grupa od dvadeset
studenata totalno gladovala, mladi, zdravi ljudi. Posle sedam ili osam dana oni su poeli da
gube interesovanje za devojke. Slike golih devojaka su im date, a oni su bili nezainteresovani.
A ta nezainteresovanost nije bila ba telesna, ak i njihovi umovi nisu bili zainteresovani - jer
sada postoje metode za prosuivanje uma.
Kad god mladi, zdrav mladi, gleda sliku gole devojke, zenice njegovih oiju postaju
velike. One su vie otvorene da prime golu figuru. A vi ne moete kontrolisati svoje zenice;
one nisu voljne. Tako vi moete rei da ste nezainteresovani za seks, ali slike e pokazati da li
ste zainteresovani ili ne. Vi ne moete uraditi nita voljno, ne moete kontrolisati zenice
svojih oiju. One se ire jer je neto tako interesantno dolo ispred njih, da se otvaraju vie,
kapci se otvaraju vie da bi vie mogli primiti unutra. Ne, ene nisu zainteresovane za golog
mukarca kada su zainteresovane za male bebe, tako ako im daju lepe slike beba njihove oi
se ire.
Svaka predostronost je preduzeta da se vidi da li su zainteresovani - nije bilo
zainteresovanosti. Ubrzo, njihov interes je opao. ak i u svojim snovima su prestali da viaju
devojke, prekinuti su seksualni snovi. Krajem druge sedmice, etrnaestog ili petnaestog dana,
oni su jednostavno bili mrtvi leevi. ak i ako bi lepa devojka prila blizu, oni je ne bi gledali.
Ako bi neko izrekao neku seksualnu alu, oni se ne bi smejali. Trideset dana su gladovali.
Tridesetog dana, cela grupa je bila neseksualna. Nije bilo seksa u njihovom umu, ni u
njihovom telu.
Onda im je data hrana opet. Prvog dana oni su ostali isti. Sledeeg dana oni su bili
zainteresovani, a treeg dana svi koji su gladovali trideset dana su iezli. Sada nisu bili samo
zainteresovani, bili su opsesivno zainteresovani - kao da je taj proces pomogao. Za nekoliko
sedmica oni su bili opsesivno seksualni, mislei samo na devojke i ni na ta vie. Kada je
hrana bila u telu, devojke su opet postale vane.
Inae ovo je uraeno u mnogim zemljama irom sveta. Mnoge religije su sledile ovaj
post. Onda su ljudi poeli misliti da su otili izvan seksa. Vi moete otii izvan seksa, ali post
nije nain. To je trik. A ovo moe da se uradi na svaki nain. Ako ste u postu vi ete biti
manje ljuti, a ako postanete naviknuti na post, onda e mnoge stvari iz vaeg ivota
jednostavno otpasti jer osnova je otpala; hrana je osnova.
Kada imate vie energije, vi se kreete u vie dimenzija. Kada ste ispunjeni sa obiljem
energije, vae obilje energije vas vodi u mnoge, mnoge elje. elje nisu nita do izrazi
energije. Dakle mogua su dva puta. Jedan je: vaa elja se menja, energija ostaje; drugi je:
energija se uklanja, elja ostaje. Energija moe biti uklonjena vrlo lako. Jednostavno moete
biti operisani, kastrirani, i energija iezava. Neki hormoni mogu biti uklonjeni iz vaeg tela.
To je ono to ini post - neki hormoni iezavaju; onda moete postati neseksualni.
Meutim, ovo nije cilj Patanjalija. Patanjali kae da energija treba da ostane, elje
da ieznu. Samo kada elja iezne, a vi ste ispunjeni energijom, moete postii to blaeno
stanje koje joga ima za cilj. Mrtva osoba ne moe postii boansko. Boansko moe biti
postignuto samo kroz bujanje energije, obilje energije, jedan okean energije.
Ovo je druga stvar koju treba neprekidno pamtiti - nemojte unititi energiju, unitite
elju. To e biti teko. To e biti teko, naporno, jer to trai totalnu transformaciju vaeg bia.
Meutim Patanjali je za to. Zato on deli njegovu vairagyu, njegovu beeljnost, u dva koraka.
On daje dve sutre.
Prva sutra:
94

Prvo stanje vairagye, bezeljnost je obustava preputanja ei za ulnim uivanjima,


sa svesnim naporom.
Mnoge stvari su sadrane i treba da se razumeju. Jedna, odavanje ulnim uivanjima.
Zato traite ulna uivanja? Zato um stalno misli o preputanju? Zato se kreete opet i opet
u istom obrascu preputanja?
Za Patanjalija i za sve one koji su spoznali, razlog je to vi niste blaeni u nutrini;
otuda, elja za uivanjem. Na uivanje orjentisan um znai da kakvi jeste, u sebi, vi ste
nesreni. Zbog toga nastavljate da traite sreu negde drugde (spolja). Osoba koja je nesrena
je prisiljena da se kree u eljama. elje su putevi nesrenog uma da trai sreu. Naravno,
nigde taj um ne moe nai sreu. Najvie to moe je da nae nekoliko odsjaja. Ova odbljesci
izgledaju kao uivanje. Uivanje oznaava letimina sagledavanja sree. A zabluda je da ovaj
um koji traga za uivanjem misli da ovi odsjaji i uivanje dolaze odnekud drugde. To uvek
dolazi iznutra.
Pokuajmo sada da razumemo. Vi ste u ljubavi s nekom osobom. Ulazite u seks. Seks
vam daje letimino sagledavanje uivanja: to vam daje odsjaj sree. Za jedan momenat vi
oseate spokojstvo. Sve nevolje su iezle; sve duevne patnje nema vie. Za jedan trenutak vi
ste ovde i sada, zaboravili ste sve. Za jedan trenutak nema prolosti i nema budunosti. Zbog
ovoga - nema prolosti i nema budunosti, i za jedan momenat vi ste ovde i sada - iznutra iz
vas tee energija. Vae unutranje bie tee u tom momentu, i vi imate svetlucanje sree.
Meutim vi mislite da svetlucanje dolazi od partnera, od ene ili od mukarca. To ne
dolazi od mukarca ili ene. To dolazi od vas! Drugi je jednostavno pomogao vama da
padnete u sadanjost, da padnete izvan budunosti i prolosti. Drugi vam je jednostavno
pomogao, da donesete sebe u sadanjost ovog trenutka.
Ako se moete preseliti u ovu sadanjost bez seksa, seks e ubrzo postati beskoristan,
on e ieznuti. On onda nee biti elja. Ako elite da se preselite u seks, moete se premestiti
iz zabave, ali ne iz elje. Onda nema opsesije u tome jer vi ne zavisite od toga.
Sednite ispod drveta jednog dana - upravo ujutru dok sunce nije izalo, jer s raanjem
sunca vae telo je nemirno, i teko je biti miran unutra. Zbog toga na Istoku su uvek meditirali
pre izlaska sunca, oni su to nazivali brahma muhurt - trenutak boanskog. Oni su u pravu, jer
sa suncem energije se bude i zapoinju da teku u starom obrascu koji ste stvorili.
Ba ujutru, kada sunce jo nije izalo na horizontu, sve je smireno i priroda je vrsto
uspavana - drvee spava, ptice spavaju, ceo svet spava, vae telo je takoe unutra uspavano, a
vi dolazite da sednete ispod drveta. Sve je smireno. Samo pokuajte da budete ovde u ovom
momentu. Ne inite nita; nemojte ak ni meditirati. Ne inite nikakav napor. Samo zatvorite
svoje oi, ostanite tihi, u toj tiini prirode. Iznenada ete imati ista letimina sagledavanja,
odbljeske koja su dolazila kroz seks, ili ak vea, dublja. Iznenada ete osetiti navalu energije
koja tee iznutra. Sada ne moete biti obmanuti, jer nema drugog, to sigurno dolazi iz vas. To
sigurno tee iznutra. Niko drugi vam je ne daje, vi je dajete sebi.
Inae situacija je nuna - tiina, energija, ne u uzbuenju. Vi ne radite nita, samo ste
tu ispod drveta, i imaete odsjaj. A to zaista nee biti uivanje, to e biti srea, jer sada
gledate u pravi izvor, pravi smer. Jednom kada znate to, onda ete odmah kroz seks
prepoznati da je drugi (partner) bio samo ogledalo, vi ste se upravo reflektovali u njemu ili
njoj. A vi ste bili ogledalo za drugog. Vi ste pomagali jedno drugom da padnete u sadanjost,
da se kreete daleko od razmiljajueg uma do nerazmiljajueg stanja bivanja.27
to je vie um ispunjen brbljanjem, vie seks ima privlanosti. Na Istoku, seks nikada
nije bio takva opsesija kao to je bio opsesija na Zapadu. Filmovi, prie, romani, poezija,
magazini, sve je postalo seksualno. Ne moete prodati nita dok ne stvorite seksualnu
privlanost. Ako treba da prodate kola, moete ih prodati samo kao seksualni objekat. Ako
elite da prodate pastu za zube, moete je prodati kroz neku seksualnu reklamu. Nita se ne
moe prodati bez seksa. Izgleda da samo seks ima cenu, ima vanost, nita drugo.
Svaka vanost dolazi kroz seks. Ceo um je opsednut seksom. Zato? Zato se to nije
nikada deavalo ranije? To je neto novo u ljudskoj istoriji. Razlog je to je sada Zapad
27

Do Bitka, Sopstva ili Jastva.


95

potpuno apsorbovan u mislima, nema mogunosti da se bude ovde i sada, izvan seksa. Seks je
ostao jedina mogunost, i ba to se deava.
Modernom oveku je ak ovo postalo mogue - da dok vodi ljubav moe misliti o
drugim stvarima. Jednom kada postanete tako sposobni da dok vodite ljubav nastavljate da
mislite o neemu - o vaim raunima u banci, ili nastavljate da razgovarate sa prijateljem, ili
nastavljate da budete negde drugde - dok vodite ljubav ovde - seks e takoe biti okonan.
Onda e biti samo dosada, frustracija, seks nije bitan. Stvar je bila samo u ovome - zato to se
seksualna energija kree tako brzo, va um dolazi do zaustavljanja, seks prevladava. Energija
tee tako brzo, tako vitalno, da se va obian obrazac miljenja zaustavlja.
uo sam, jednom se dogodilo da je Mula Nasrudin prolazio kroz umu. Naiao je na
lobanju. Upravo radoznao, kakav je uvek bio, pitao je lobanju: "ta vas je dovelo ovde
gospodine?" Bio je zapanjen kada je lobanja rekla: "Prianje me je dovelo dovde, gospodine,"
Nije mogao da veruje u to, ali je uo to i potrao je na dvor kod kralja. Rekao je: "Video sam
udo! Lobanja, lobanja koja govori, lei ba pored naeg sela u umi."
Kralj takoe nije mogao da veruje, ali je takoe bio radoznao. Ceo dvor ih je sledio,
otili su umu. Nasrudin je priao blizu lobanje i pitao: "ta te je dovelo ovde, gospodine?" ali
lobanja je ostala nema. Pitao je ponovo, opet i opet, ali lobanja je bila mrtvaki nema.
Kralj je rekao: "Znao sam od ranije, Nasrudine, da si laov. Ali sada je previe.
Napravio si takvu alu da e morati da pati zbog nje." Naredio je svom uvaru da mu odsee
glavu i baci je pored lobanje mravima da je pojedu. Kada su svi otili - kralj, njegov dvor lobanja je poela opet da govori. Pitala je: "ta vas je dovelo ovde, gospodine?" Nasrudin je
odgovorio: "Prianje me je dovelo ovde, gospodine."
Govorenje je dovelo oveka dovde - do situacije koja je danas. Konstantno brbljajui
um ne dozvoljava nikakvu sreu, nikakvu mogunost sree, jer samo smireni um moe gledati
unutra, samo smireni um moe sluati tiinu, sreu, koja uvek kljua ovde. Ali ona je tako
suptilna da s bukom iz uma ne moete je uti.
Samo u seksu buka ponekad prestaje. Ja kaem: "Ponekad". Ako ste postali naviknuti
na seks, kao to muevi i ene postaju, onda se ona nikada ne zaustavlja. Ceo in postaje
automatizovan, a um nastavlja po svom vlastitom. Onda je seks takoe dosada.
Sve ima privlanost, ako vam moe dati odsjaj. Moe izgledati da odsjaj ili letimina
sagledavanja dolaze spolja; oni uvek dolaze iznutra. Spolja moe biti samo nepristrasno
ogledalo. Kada srea tee iznutra reflektovana je spolja, to se naziva zadovoljstvom. Ovo je
Patanjalijeva definicija - srea tee iznutra reflektovana od neega u spoljanjem, spoljanje
deluje kao ogledalo. Ako mislite da ta srea dolazi spolja, ona je nazvana uivanjem. Mi smo
u potrazi za sreom, ne u potrazi za uivanjem. Tako da dok ne moete imati odsjaj sree, ne
moete zaustaviti vae napore traganja za sreom. Preputanje uivanju znai traganje za
zadovoljstvom.
Potreban je svestan napor. Za dve stvari. Jedna: kad god osetite da je trenutak uivanja
prisutan, preobrazite ga u meditativnu situaciju. Kad god osetite da oseate zadovoljstvo,
sreu, veselje, zatvorite svoje oi i pogledajte unutra, i vidite odakle to dolazi. Ne gubite taj
momenat; to je dragoceno. Ako niste svesni moete nastaviti da razmiljate da to dolazi
spolja, i to je zabluda sveta.
Ako ste svesni, meditativni, ako tragate za pravim izvorom, pre ili kasnije ete saznati
da to dolazi iznutra. Jednom kada saznate da to uvek tee iznutra, da je to neto to ve imate,
preputanje e otpasti, a to e biti prvi korak beeljnosti. Onda ne tragate, ne udite arko. Ne
ubijate elje, ne borite se sa eljama, vi ste jednostavno nali neto vee. elje sada ne
izgledaju tako vane. One venu.
Zapamtite ovo: one ne treba da budu ubijene i unitene; one venu. Jednostavno ih
zanemarujete jer imate moniji izvor. Vi ste magnetski privueni prema njemu. Sada se itava
vaa energija kree prema unutra. Ove elje se jednostavno zanemaruju.
Vi ih ne zaboravljate. Ako se borite s njima nikada neete pobediti. To je kao kada
biste imali neko kamenje, obojeno kamenje u svojim rukama. I odjednom saznate o
dijamantima, a oni lee okolo. Vi bacate obojeno kamenje da biste stvorili prostor za
96

dijamante u svojim rukama. Vi se ne borite s kamenjem. Kada su dijamanti tu, vi jednostavno


ispustite kamenje. Ono je izgubilo svoj znaaj.
elje moraju izgubiti svoj znaaj. Ako se borite, znaaj im se ne gubi. Naprotiv, ba
kroz borbu dajete im vei znaaj. Onda one postaju vanije. To se dogaa. Oni koji se bore sa
nekom eljom, ta elja postaje njihov centar uma. Ako se borite sa seksom, seks postaje
centar. Onda ste neprekidno angaovani u tome, zauzeti s tim. To postaje kao rana. Gde god
da pogledate, ta rana se odmah projektuje, i ta god vidite postaje seksualno.
Um ima mehanizam, jedan stari mehanizam preivljavanja, ili borbe ili bekstva. Dva
su puta uma: ili se moete boriti s neim, ili moete pobei od toga. Ako ste jaki, onda se
borite. Ako ste slabi, onda beite, jednostavno pobegnete. Ali u oba sluaja neto drugo je
vano, drugo je centar. Moete se boriti ili pobei iz sveta - iz sveta gde su elje mogue;
moete otii na Himalaje. To je takoe borba, borba slabog.
uo sam: jednom je Mula Nasrudin kupovao u selu. Ostavio je svog magarca na ulici i
otiao u trgovinu da kupi neto. Kada se vratio bio je besan. Neko je obojio njegovog magarca
potpuno u crveno, svetlo crveno. Bio je gnevan raspitivao se: "Ko je to uinio? Ubiu tog
oveka!"
Tu je stajao mali deak. Rekao je: "Jedan ovek je to uinio, upravo je taj ovek uao
u krmu." Tako je Nasrudin otiao tamo, pourio je tamo, ljut, lud. Rekao je: "Ko je to
uradio? Ko je obojio mog magarca?"
Vrlo krupan ovek, vrlo jak, ustao je i rekao: "Ja sam, pa ta?" Na to je Nasrudin
rekao: "Hvala vam, gospodine. Uradili ste tako lep posao. Doao sam da vam kaem da je
prvi premaz suv."
Ako ste jaki, onda ste spremni da se borite. Ako ste slabi, onda ste spremni da
pobegnete. Ali u oba sluaja, vi ne postajete jai. U oba sluaja drugi je postao centar vaeg
uma. Ovo su dva dranja, boriti se ili pobei - a oba su pogrena jer kroz njih um se jaa.
Patanjali kae da postoji trea mogunost: ne borite se i ne beite. Samo budite
budni. Samo budite svesni. Kakav god da je sluaj, samo budite svedok. Svesni napor znai,
prvo: traganje za unutranjim izvorom sree; i drugo: svedoenje starog obrasca navika - ne
boriti se s tim, samo svedoiti to.
Prvo stanje vairagye, beeljnost je obustava preputanja ei za ulnim uivanjima, sa
svesnim naporom.
Svesni napor jeste kljuna re. Svesnost je potrebna, i napor je takoe potreban.
Napor treba da bude svestan jer moe postojati i nesvestan napor. Moete biti trenirani na
takav nain da moete odbaciti odreene elje bez znanja da ste ih odbacili.
Na primer, ako ste roeni u vegetarijanskoj kui vi ete jesti vegetarijansku hranu.
Nevegetarijanska hrana jednostavno nije pitanje. Nikada je niste odbacili svesno. Bili ste
odgajani na takav nain da je nesvesno odbaena sama od sebe. Ali vam to nee dati neki
integritet; nee vam to dati neku duhovnu snagu. Dok neto ne uinite svesno, to se ne stie.
Mnoga drutva su probala ovo za svoju decu, da ih podignu na takav nain da izvesne
pogrene stvari jednostavno ne uu u njihove ivote. One ne ulaze, ali nita se ne stie kroz to
jer realna stvar koju treba zadobiti jeste svesnost. Svesnost moe biti zadobijena kroz napor.
Ako je bez napora neto uslovljeno u vama, to uopte nije dobitak.
Dakle u Indiji ima puno vegetarijanaca. aini, Brahmani, mnogi ljudi su vegetarijanci.
Nita se ne stie time to ste samo roeni u ainskoj porodici, biti vegetarijanac ne znai nita.
To nije svestan napor; niste uinili nita oko toga. Ako ste roeni u nevegetarijanskoj
porodici, vi biste bili dovedeni do nevegetarijanske ishrane na slian nain.
Dok neki svesni napor nije uinjen, vaa kristalizacija se nikada ne dogaa. Morate
uiniti neto sami. Kada neto uinite sami, vi dobijate neto. Nita se ne dobija bez svesnosti,
zapamtite to. To je jedna od osnovnih stvari. Nita se ne dobija bez svesnosti! Moete postati
savreni svetac, ali ako to niste postali kroz svesnost, to je uzaludno, beskorisno. Morate se
boriti in po in, jer kroz borbu vie svesti e biti potrebno. A to vie svesnosti praktikujete,
vie svesni vi postajete. Dolazi momenat kada postajete ista svest.
Prvi korak je:
97

...obustava preputanja ei za ulnim uivanjima, sa svesnim naporom.


ta da se radi? Kad god ste u stanju uivanja - seks, hrana, novac, mo, bilo ta to
vam prua uivanje - meditirajte o tome. Ba pokuajte da naete to, odakle to dolazi. Vi ste
izvor, ili je izvor negde drugde? Ako je izvor negde drugde, onda nema mogunosti za bilo
kakvu transformaciju jer ete ostati zavisni od izvora.
Ali sreom, izvor nije nigde drugde, on je u vama. Ako meditirate, vi ete ga nai. On
kuca svakog trenutka iznutra, Ja sam ovde! Jednom kada imate oseanje da tu kuca svakog
momenta - i vi ste stvarali samo situacije spolja u kojima se to se deavalo - to se moe
dogoditi bez situacija. Onda ne treba da zavisite ni od koga, od hrane, od seksa, od moi, bilo
ega. Vi ste dovoljni sebi. Jednom kada doete do tog oseanja, oseanja samodovoljnosti,
preputanje - um koji se preputa - iezava.
To ne znai da neete uivati u hrani. Uivaete vie. Ali sada hrana nije izvor vae
sree, vi ste izvor. Vi ne zavisite od hrane, niste naklonjeni njoj.
To ne znai da ne uivate u seksu. Moete uivati vie, ali sada je to veselje, igra; to je
samo slavljenje. Ali niste zavisni od toga, to nije izvor. A jednom kada dve osobe, dvoje
ljubavnika, mogu nai ovo - da drugi nije izvor njihovog uivanja - oni prestaju da se bore
jedno s drugim. Oni zapoinju da vole jedno drugo po prvi put.
Inae ne moete voleti osobu od koje ste zavisni ni na koji nain. Vi ete mrzeti, jer je
ona vaa zavisnost. Bez nje ne moete biti sreni. Dakle, ona je bila klju, a osoba koja ima
klju vae sree va je tamniar. Ljubavnici se bore jer vide da drugi ima klju, "Ona me
moe uiniti srenim ili nesrenim." Jednom kada saznate da ste vi izvor, a drugi je izvor
njegove vlastite sree, moete deliti svoju sreu; to je druga stvar, ali vi niste zavisni. Moete
podeliti. Moete slaviti zajedno. To je ono ta ljubav znai: slavljenje zajedno, deljenje
zajedno - ne ganjati jedno drugo, ne eksploatisati jedno drugo.
Zato to eksploatacija ne moe biti ljubav. Onda koristite drugog kao sredstvo, a koga
god koristite kao sredstvo, on e vas mrzeti. Ljubavnici mrze jedno drugo jer koriste,
eksploatiu jedno drugo, a ljubav - koja treba da bude najdublja ekstaza - postaje najruniji
pakao. Ali jednom kada znate da ste vi izvor svoje sree, niko drugi nije izvor, moete
podeliti to slobodno. Onda drugi nije va neprijatelj, nije ak ni jedan prisan neprijatelj. Po
prvi put prijateljstvo se stvara, moete uivati u svemu.
A moi ete da uivate samo kada ste slobodni. Samo nezavisna osoba moe uivati.
Osoba koja je luda i opsednuta hranom ne moe uivati. Ona moe napuniti stomak, ali ne
moe uivati. Njeno jedenje je nasilno. To je vrsta ubijanja. Ona ubija hranu; ona unitava
hranu. A ljubavnici koji oseaju da njihova srea zavisi od drugog, bore se, pokuavaju da
dominiraju nad drugim. Pokuavajui da ubiju drugog, da unite drugog. Vi ete biti sposobni
u svemu da uivate vie kada znate da izvor jeste unutra. Onda ceo ivot postaje igra, iz
momenta u momenat moete nastaviti da uivate beskonano.
Ovo je prvi korak, sa naporom. Svesnost i napor, vi postiete beeljnost. Patanjali
kae da je ovo prvo, jer ak napor, ak svesnost, nije dobra, jer to znai da se neka borba,
neka skrivena borba, jo odvija.
Drugi i poslednji korak vairagye, poslednje je stanje beeljnosti:
...obustava svih elja uz pomo saznavanja unutarnje prirode purue, vrhovnog
Sopstva.
Prvo morate znati da ste vi izvor sve sree koja se vama deava. Drugo, morate znati
svu prirodu vaeg unutranjeg bia. Prvo, vi ste izvor. Drugo, Kakav je ovo izvor? Prvo,
upravo je toliko dovoljno, da ste vi izvor sree. A drugo, ta je ovaj izvor u svojoj ukupnosti,
ovaj purua, unutranje Sopstvo: "Ko sam ja?" u svojoj ukupnosti.
Jednom kada znate ovaj izvor u njegovoj totalnosti, vi ste upoznali sve. Onda ceo
univerzum je unutra, ne samo srea. Onda sve to postoji, postoji unutra - ne samo srea.
Onda Bog ne sedi negde u oblacima, on postoji unutra. Onda ste vi izvor, koreni izvor svega.
Onda ste vi centar.
Jednom kada postanete centar egzistencije, jednom kada znate da ste centar
egzistencije, sva patnja e ieznuti. Tada beeljnost postaje spontana, sahaa. Nikakav
98

napor, nikakvo nastojanje, nikakvo odravanje nije potrebno. To je lako, to je postalo


prirodno. Ne vuete to, niti gurate to. Sada nema ja koje moe da vue i gura.
Zapamtite ovo: borba stvara ego. Ako se vi borite u svetu, to stvara veliki grubi ego:
"Ja sam neko s novcem, sa ugledom, sa snagom." Ako se borite unutra, to stvara suptilni ego:
"Ja sam ist; ja sam svetac; ja sam mudrac," ali Ja ostaje sa borbom. Dakle, postoje poboni
egoisti koji imaju vrlo suptilan ego. Oni moda nisu svetovni ljudi, nisu; oni su drugaije
svetovni. Meutim borba postoji. Oni su postigli neto. To postignue jo nosi poslednju
senku od Ja.
Drugi korak i konani korak beeljnosti za Patanjalija je totalno iezavanje ega.
Upravo sleenje prirode. Nema ja, nema svesnog napora. To ne znai da neete biti svesni,
vi ete biti savrena svest - ali nikakav napor nije sadran u bivanju svesnim. Nee postojati
samosvesti - line svesti. Vi ste prihvatili sebe i egzistenciju kakva ona jeste.
Totalno prihvatanje - to je ono to Lao Ce zove Tao, reka tee prema okeanu. Ona ne
ini nikakav napor; nije u urbi da stigne do okeana. ak i ako ne stigne, nee biti frustrirana.
ak i ako stigne za milione godina, sve je u redu. Reka jednostavno tee jer teenje je njena
priroda. Nikakvog napora nema. Ona e nastaviti da tee.
Kada su elje po prvi put primeene i opaeni napor nastane, suptilni napor. ak i prvi
korak je suptilan napor. Vi zapoinjete pokuavati da budete svesni, "Odakle moja srea
dolazi?" Morate uiniti neto, a to injenje e kreirati ego. Zbog toga Patanjali kae da je
samo poetak, i morate zapamtiti da nije kraj. Na kraju, ne samo da su elje iezle, vi ste
takoe iezli. Samo unutranje bie je ostalo u svom toku.
Ovaj spontani tok je vrhovna ekstaza jer za njega nije mogua patnja. Patnja dolazi
kroz oekivanje, potrebe. Nema niko da se oekuje, da je potreban, tako da sve to se dogodi
jeste dobro. Sve to se dogodi, to je blagoslov. Ne moete porediti ni sa im drugim, to je taj
sluaj. I zato to nema poreenja sa prolou i sa budunou - nema nikoga da uporeuje ne moete gledati ni na ta kao jad, kao bol. ak i ako se bol dogodi u toj situaciji, to nee biti
bolno. Pokuajte da razumete ovo. Ovo je teko.
Isus je bio raspet na krstu. Hriani su slikali Isusa vrlo tunog. Rekli su ak da se on
nikada nije smejao, i u svojim crkvama imaju svuda tune figure Isusa. Ovo je ljudsko; vi
moete razumeti to, jer osoba koja je razapeta na krstu mora biti tuna. Mora da je bio u
unutranjoj agoniji; mora da je patio.
Tako hriani nastavljaju da govore da je Isus ispatao za nae grehe - ali on je patio.
Ovo je potpuno pogreno! Ako pitate Patanjalija ili mene, ovo je sasvim pogreno. Isus ne
moe da pati. Nemogue je da Isus pati. Ako on pati, onda ne postoji razlika izmeu vas i
njega.
Bol postoji, ali Isus ne moe patiti. Jer u momentu kada je Isus raspet na krstu,
napadnut, njegovo telo je uniteno. Bol postoji, ali Isus ne moe patiti, jer u momentu kada je
raspet na krstu, on ne moe traiti. On ne moe zahtevati. On ne moe rei: "Ovo je pogreno.
Ovo ne treba da bude tako. Moram biti krunisan, a ja sam raspet na krstu."
Ako je on to imao u svom umu - da: "Moram biti krunisan, ali sam raspet," - onda e
biti bola. Ako nije imao budueg u umu da: "Ja treba da budem krunisan," nikakvog
oekivanja za buduim, nikakav odreeni cilj da dostigne, gde god se naao onda jeste cilj. A
on ne moe porediti. Ovo ne moe biti drugaije. Ovo je sadanji trenutak koji mu je dat. Ovo
raspee je krunisanje.
On ne moe patiti jer patnja znai otpor. Morate se odupreti neemu, samo onda
moete patiti. Pokuajte to. Bie vam teko da budete raspeti, ali postoje mala, svakodnevna
raspinjanja na krst. Ona e delovati.
Imate bol u nozi ili u glavi, imate glavobolju. Moda niste uoili mehanizam toga.
Imate glavobolju, i stalno se borite i opirete. Ne elite to. Vi ste protiv toga, podeljeni ste.
Negde se zanimate unutar glave i glavobolja je tamo. Vi ste odvojeni i glavobolja je rasturena,
i insistirate da ne treba da bude tako. Ovo je realan problem.
Pokuajte jednom da se ne borite. Tecite sa glavoboljom, postanite glavobolja. I recite:
"Ovo je sluaj. Ovakva je moja glava u ovom momentu, i u ovom trenutku nita nije mogue.
To moe doi u budunosti, ali u ovom momentu glavobolja je ovde." Ne opirite se. Dozvolite
99

joj se da se deava; postanite jedno s njom. Ne odvajajte sebe, tecite u tome. A onda e biti
iznenadnog napretka nove vrste sree koju niste znali. Kada nema nikoga da se odupire, ak i
glavobolja nije bolna. Borba stvara bol. Bol uvek znai boriti se protiv bola. - to je stvarna
bol.
Isus prihvata. Na taj nain njegov ivot je doao na krst. Ovo je sudbina. To su na
istoku uvek nazivali sudbinom, bhagya, kismat. Dakle nije glavna stvar u dokazivanju s
vaom verom, nije u pitanju ni borenje s njom. Ne moete initi nita; to se deava. Samo vam
je mogua jedna stvar - moete tei s njom (prihvatiti je) ili se moete boriti s njom. Ako se
borite, to postaje vea agonija. Ako teete s tim, agonija je manja. Ako moete potpuno tei,
agonija iezava. Postali ste tok.
Pokuajte kada imate glavobolju, pokuajte to kada vam je telo bolesno, pokuajte
kada imate neki bol - samo sledite to. A jednom, ako moete dopustiti, moraete doi do jedne
od najdubljih tajni o ivotu - da bol iezava ako vi teete s njim. A ako moete tei potpuno,
bol postaje srea.
Inae to nije neto logino da bi se razumelo. Moete shvatiti to intelektualno, ali to
nee delovati. Pokuajte to egzistencijalno. Postoje svakodnevne situacije. Svakog momenta
neto je nepravilno. Tecite sa tim i vidite kako e se preobraziti cela situacija. A kroz taj
preobraaj vi transcendirate to.
Buda nikada ne moe biti u bolu; to je nemogue. Samo jedan ego moe biti u bolu.
Ego mora biti u bolu. Ako je ego tu vi moete preobraziti svoje uivanje takoe u bol; ako ego
nije tu moete preobraziti svoj bol u uivanje. Tajna lei uz ego.
Poslednje stanje vairagye, beeljnost je obustava svih elja uz pomo saznavanja
unutarnje prirode purue, vrhovnog Sopstva.
Kako se to dogaa? Upravo znajui najunutarnjiju sr sebe samoga, puruu,
stanovnika unutra. Ba znajui to! Patanjali kae, Buddha kae, Lao Ce kae, jednostavno
znajui to, sve elje iezavaju.
Ovo je misteriozno, a logini um je prinuen da pita kako se to deava da upravo
pomou poznavanja sebe samih sve elje iezavaju. To se dogaa jer sada znajui sami sebe
sve elje su nastale. elje su jednostavno neznanje o sebi. Zato? Sve to traite kroz elje je
tu, skriveno u biu. Ako znate sebe, elje e ieznuti.
Na primer, traite snagu. Svako trai mo. Mo stvara ludilo u svakome. Izgleda da je
samo ljudsko drutvo egzistiralo na takav nain da se svako odaje moi.
Dete se rodi; ono je bespomono. To je prvo oseanje koje svi uvek nosite u sebi. Dete
se rodi, ono je bespomono, a bespomono dete eli snagu. To je prirodno jer svako je
snaniji od njega. Majka je snanija, otac je snaniji, braa su snanija, svako je snaniji, a
dete je apsolutno bespomono. Naravno, prva elja koja se javi je da ima mo - kako da
izraste snano kako da bude dominantno. I dete zapoinje da bude politiar od samog tog
momenta. Ono zapoinje da ui trikove kako da vlada.
Ako plae previe, saznaje da moe vladati kroz plakanje. Moe dominirati itavom
kuom samo uz pomo plakanja. Ono ui da plae. ene nastavljaju s tim ak i kada vie nisu
deca. One su nauile tajnu, nastavljaju to. A treba da nastavljaju s tim jer ostaju bespomone.
To je politika moi.
Ono zna trik, i moe stvoriti smetnju. Moe kreirati takvu smetnju da morate prihvatiti
nagodbu s njim. I svakog momenta ono osea duboko da jedina stvar koju treba jeste snaga,
vie moi. Ono e uiti, ii e u kolu, ono e rasti, ono e voleti, ali u pozadini svega njegovog obrazovanja, ljubavi, igre - ono e nalaziti kako da dobije vie snage. Kroz
obrazovanje ono e eleti da dominira, kako da bude prvo u razredu tako da moe dominirati,
kako da dobije vie novca tako da moe dominirati, kako da napreduje u irenju uticaja i
teritorije dominacije. itavog ivota ono e biti za mo.
Mnogo ivota je jednostavno protraeno. ak i ako dobijete snagu, ta ete raditi?
Jednostavne detinjaste elje su ispunjene. Dakle, kada postanete Napoleon ili Hitler, iznenada
postajete svesni da je ceo napor bio beskoristan, uzaludan. Upravo detinjasta elja je bila
ispunjena, to je sve. Sada ta da se ini? ta da se ini sa tom snagom? Ako je elja ispunjena
vi ste frustrirani. Ako elja nije ispunjena vi ste frustrirani, a ona apsolutno ne moe biti
100

ispunjena, jer niko ne moe biti tako moan da moe oseati, Sada je dovoljno - niko! Svet
je tako kompleksan da se ak i Hitler osea nemonim u nekim momentima, ak i Napoleon
e se oseati slabim u (nekim) trenucima. Niko ne moe da osea apsolutnu snagu, i nita ne
moe da vas zadovolji.
Ali kada neko upozna svoje Sopstvo, on dolazi do izvora apsolutne snage. Onda elja
za snagom iezava jer znate da ste ve kralj, a samo ste mislili da ste prosjak. Vi ste se borili
da postanete vei prosjak, moniji prosjak, a ve ste bili kralj. Iznenada ste shvatili da vam ne
nedostaje nita. Vi niste bespomoni. Vi ste izvor svih energija, vi ste istiniti izvor ivota. To
oseanje nemonosti u detinjstvu kreirano je od drugih. A to je jogunast krug koji su oni
stvorili u vama jer su to stvorili u njima njihovi roditelji, i tako dalje i tako dalje.
Vai roditelji su stvorili oseanje u vama da ste nemoni. Zato? Jer su se samo kroz
to oni mogli oseati snanim. Moda mislite da veoma volite decu. Izgleda da to nije sluaj.
Vi volite mo, a kada dobijete decu, kada postanete majke i oevi, vi ste moni. Moda vas
niko ne slua; moda niste nita u svetu, ali ste barem u granicama svoje kue jaki. Moete
svakako kinjiti malu decu.
Pogledajte oeve i majke; oni mue! Oni kinje na tako ljubei nain da im ak ne
moete rei: "Vi muite." Oni mue 'za njihovo vlastito dobro, radi dobra same dece!
Pomau im da rastu. Oni se oseaju jaki. Psiholozi kau da mnogi ljudi biraju uiteljski poziv
ba da bi bili uticajni, jer sa tridesetoro dece na raspolaganju, vi se oseate ba kao kralj.
Govorilo se da je Aurangajeba zatvorio njegov sin. Kada je bio uhapen, on je napisao
pismo u kome je rekao: "Samo jedna elja, ako je moe ispuniti, bie dobro, i ja u biti
srean. Samo mi poalji tridesetoro dece tako da ih mogu poduavati u mom zatvoru."
Kae se da je sin rekao: "Moj otac je uvek ostao kralj, i on ne moe izgubiti svoje
kraljevstvo. Tako da je ak i u zatvoru njemu trebalo tridesetoro dece da bi ih poduavao."
Gledajte! Idite u kolu! Uitelj sedi na svojoj stolici - i apsolutna mo, ba je gospodar
svega to se tamo dogaa. Ljudi ele decu ne zbog ljubavi, jer da vole zaista, svet bi bio
drugaiji. Ako volite svoje dete, svet e biti drugaiji. Neete mu pomagati da bude
bespomono, da se osea bespomono, daete mu tako mnogo ljubavi da e oseati da je jako.
Ako mu date ljubav, onda ono nikada nee traiti mo. Ono nee postati politiki lider; ono
nee ii na izbore. Ono nee pokuavati da gomila novac i da poludi za njim, jer ono zna da je
to beskorisno - ono je ve mono; dovoljna je ljubav.
Ako niko ne daje ljubav, onda e ono stvoriti zamene. Sve vae elje, bilo za uticajem,
novcem, ugledom, pokazuju da ste neemu ueni u vaem detinjstvu, neto je bilo uslovljeno
u vaem bio-kompjuteru i vi sledite to uslovljavanje bez gledanja unutra, poto, bilo ta da
traite ve jeste tu.
Patanjali je sav napor uloio da va bio-kompjuter bude u tiini tako da se ne ometa.
To je meditacija. To je postavljanje vaeg bio-kompjutera, za izvesne momente, u tiinu, u
stanje bez vibracija, tako da moete pogledati unutra i uti svoju najdublju prirodu. Samo brz
pogled, letimino sagledavanje e vas promeniti, jer onda ovaj bio-kompjuter ne moe vas
obmanuti. Ovaj bio-kompjuter nastavlja da govori: Uradi ovo, uradi ono! On nastavlja
neprekidno da vas manipulie da morate imati vie snage; inae niste niko.
Ako gledate unutra, nije potrebno da budete neko; nije potrebno da budete vana
linost. Vi ste ve prihvaeni kakvi jeste. itava egzistencija vas prihvata, srena je to se tie
vas. Vi ste cvetanje - individualno cvetanje, razliito od svakog drugog, jedinstveno, i Bog
vam eli dobrodolicu; inae ne biste bili ovde. Vi ste ovde samo zato to ste prihvaeni. Vi
ste ovde samo zato jer Bog vas voli, univerzum vas voli i potrebni ste egzistenciji. Vi ste
neophodni.
Jednom kada znate svoju unutarnju prirodu, to Patanjali zove purua - purua znai
unutranji stanovnik... Telo je kao kua. Unutranji stanovnik, unutranja svest, jeste purua.
Jednom kada znate ovu unutranju svest, nita nije potrebno. Vi ste dovoljni, vie nego
dovoljni. Vi ste savreni kakvi jeste. Potpuno ste prihvaeni, dobrodoli. Egzistencija postaje
blagoslov. elje iezavaju; one su bile deo neznanja sebe. Sa znanjem sebe, one iezavaju,
one izvetre.
101

Abhyasa, konstantna unutranja praksa, svesni napor da se bude sve vie budan, da se
bude sve vie gospodar sebe, da se manje bude pod dominacijom navika, mehaninosti,
robotu slinim mehanizmima - i vairagya, beeljnost; ovo dvoje kada se postignu ovek
postaje jogin; kada se ovo dvoje dostignu ovek je postigao cilj.
Ponoviu: samo nemojte stvarati borbu. Dozvolite da se sve ovo deava, da se bude
sve vie spontan. Ne borite se sa negativnim. Bolje kreirajte pozitivno. Ne borite se sa
seksom, sa hranom, ni sa im. Bolje, naite ono to vam daje vie sree, odakle ona dolazi kreite se u tom pravcu. elje, ubrzo iezavaju.
I drugo, budite sve vie i vie svesni. ta god da se deava, budite sve vie svesni.
Ostanite u tom trenutku, prihvatite taj momenat. Ne traite neto drugo. Onda neete stvarati
patnju. Ako postoji bol, neka bude tu. Ostanite u tome i tecite u tome. Jedini uslov je, ostanite
budni. Znalaki, paljivo, uite u to, tecite u tome. Ne opirite se!
Kada bol iezne, elja za uivanjem takoe iezava. Kada niste u bolu, vi ne traite
putanje na volju uivanjima. Kada nema jada, preputanje zadovoljstvima postaje bez
znaaja. I sve vie nastavljate da padate u unutranji ambis. A to je tako blaeno, to je tako
duboka ekstaza, da ak i brz pogled, letiminim sagledavanjem toga ceo svet postaje
beznaajan. Onda sve to vam ovaj svet moe dati postaje beskorisno.
Ni to ne sme postati borbeno dranje - ne treba da postanete ratnik, treba da postanete
meditant. Ako ste meditativni, spontano e vam se stvari dogaati koje e vas preobraziti i
promeniti. Zaponite borbu i zapoeli ste guenje. A guenje e vas voditi do sve vie patnje.
Tako se ne moete obmanuti.
Mnogi ljudi postoje koji ne obmanjuju samo druge, nego nastavljaju da obmanjuju
sebe. Oni misle da nisu u patnji; nastavljaju da govore da nisu u nevolji. Ali itava njihova
egzistencija je jadna. Kada kau da nisu u bedi, njihova lica, njihove oi, njihovo srce, sve je
u bedi.
Ispriau vam jednu anegdotu, a onda u zavriti. uo sam da se jednom dogodilo da
su dvanaest dama stigle u istilite. Slubujui aneo ih je pitao: "Da li je neka od vas bila
neverna svom muu dok ste bile na zemlji? Ako je neka bila neverna svom muu, ona treba
da podigne ruku." Srameljivo, oklevajui, ubrzo su jedanaest dama podigle svoje ruke.
Aneo na dunosti je uzeo telefon i pozvao: "Halo! Da li je to pakao? Imate li tamo mesta za
dvanaest nevernih ena? - jedna od njih, gluva je ko kamen!"
To nije potrebno, bilo da to kaete ili ne. Vae lice, samo vae bie, pokazuje sve. Vi
moete rei da niste jadni, ali nain na koji to kaete, nain na koji jeste, pokazuje da ste
jadni. Ne moete obmanuti, jer niko ne moe obmanuti nikoga drugog, moete obmanuti
samo sebe.
Zapamtite, ako ste jadni, vi ste stvorili sve to. Pustite da to prodre duboko u vae srce
da ste stvorili svoje patnje jer e ovo biti formula, klju. Ako ste stvorili svoje patnje, samo
onda moete da ih unitite. Vi ste stvorili njih kroz pogrene navike, pogrena gledita,
predavanja poroku, kroz elje.
Odbacite ovaj obrazac! Gledajte ivahno! A sam ovaj ivot je najvea radost koja je
mogua ljudskoj svesti.

Poglavlje 10
UZROK VAE PATNJE
4. januar 1974.
Prvo pitanje:
Kako to da opisujete ivot koji je zaista na, a koji ste vi transcendirali, tako
ispravno i u svakom detalju, dok mi ostajemo tako neuki o tome? Zar nije to paradoksalno?
102

To izgleda paradoksalno, ali nije, jer moete razumeti samo kada ste transcendirali.
Dok ste u odreenom stanju uma, ne moete razumeti to stanje uma; upleteni ste u to, tako ste
mnogo identifikovani s tim. Za razumevanje je potreban prostor, rastojanje je potrebno, a tu
nema rastojanja. Kada transcendirate stanje uma, samo tada ete postati sposobni da razumete
to jer tada postoji distanca. Stojite podalje, odvojeno. Moete gledati objektivno,
neidentifikovani. Sada postoji perspektiva.
Dok ste u ljubavi, ne moete razumeti ljubav. Moete je oseati, ali je ne moete
razumeti. Vi ste tako mnogo u njoj. Za razumevanje, izdvojenost, nevezana izdvojenost je
potrebna. Za razumevanje treba da budete posmatra. Dok ste u ljubavi, posmatra se gubi. Vi
ste postali akter, vi ste ljubavnik. Ne moete biti svedok toga. Samo kada transcendirate
ljubav, kada ste prosvetljeni i doprli s one strane ljubavi, vi ete biti sposobni da razumete to.
Dete ne moe razumeti ta je detinjstvo. Kada se detinjstvo izgubi, moete gledati
natrag i razumeti. Mladost ne moe razumeti ta je mladost. Samo kada postanete stari i
sposobni da gledate unatrag, izdaleka, udaljeno, onda ete biti sposobni da razumete to. ta
god je shvaeno, shvaeno je samo pomou neshvatljivog. Neshvatjivo je osnova sveg
razumevanja. Zbog toga to se deava svakog dana - moete dati savete, dobar savet, nekome
drugom ko je u nevolji; ako ste vi u nekoj nevolji, ne moete dati tako dobar savet samome
sebi.
Kad je neko drugi u nevolji, vi imate prostor da gledate, prouavate; moete svedoiti.
Vi moete dati dobar savet. Kada ste u istoj nevolji, neete biti tako sposobni. Moete biti
(sposobni) ako moete ak i onda biti izdvojeni. Ako ak i onda moete gledati na problem
kao da niste u problemu, spolja, stojei na brdu i gledajui dole.
Svaki problem moe biti reen ako ste makar za jedan trenutak izvan toga i moete
gledati na to kao svedok. Svedoenje reava sve. Inae, ako ste duboko u nekom stanju, teko
je da se bude svedok. Vi ste tako mnogo identifikovani. Dok ste u ljutnji, vi postajete ljutnja.
Niko nije preostao pozadi ko moe videti, prouiti, odluiti. Niko nije ostao iza. Dok ste u
seksu, vi ste pobueni potpuno. Sada nema centra, neukljuenog.
U Upaniadama je reeno da osoba koja posmatra sebe jeste kao drvo na kome dve
ptice sede - jedna ptica upravo skae, uivajui, jedui, pevajui, a druga ptica upravo sedi na
vrhu drveta gledajui u prvu pticu.
Ako moete imati svedoee sopstvo na vrhu koje nastavlja da posmatra dramu dole
gde ste vi akter, gde vi uestvujete, igrate, skaete, pevate i razgovarate i postajete upleteni;
ako neko duboko u vama moe nastaviti da posmatra ovu dramu, ako moete biti u takvom
stanju gde takoe igrate kao glumac na pozornici i istovremeno sedite u gledalitu i
posmatrate to; ako moete biti oboje: glumac i gledalac - svedoenje je stiglo unutra.
Svedoenje e vas uiniti sposobnim za upuenost, razumevanje, mudrost.
Tako to izgleda paradoksalno. Ako odete kod Bude, on moe ulaziti duboko u detalje
vaih problema, ne zato to je on u problemu, zato jer nije u problemu. On moe prodreti u
vas. Moe staviti sebe u vau situaciju, i jo ostati svedok.
Tako oni koji su u svetu ne mogu razumeti svet. Oni koji su otili izvan njega, samo
oni ga razumeju. Dakle, ta god da elite razumeti, idite izvan toga. Ovo izgleda
paradoksalno. ta god elite znati, idite izvan toga - onda e se znanje dogoditi. Kreui se
kao insajder u bilo emu moete sakupiti mnogo informacija, ali neete postati mudar ovek.
Moete praktikovati to iz momenta u momenat. Moete initi oboje; biti akter i biti
gledalac. Kada ste ljuti moete menjati um. Ovo je duboka umetnost, ali ako pokuate biete u
stanju. Moete menjati.
U jednom trenutku moete biti ljuti. Onda biti uzdrani, gledati u ljutnju, na vaem
vlastitom licu u ogledalu. Gledajte ta radite, gledajte ta se dogaa oko vas, gledajte ta ste
uradili drugima, kako oni reaguju. Pogledajte za momenat, a onda opet budite ljuti, uite u
ljutnju. Onda opet postanite posmatra. Ovo se moe uraditi, ali onda je potrebna vrlo duboka
praksa.
Probajte to. Dok jedete, za momenat budite onaj koji jede. Uivajte, postanite hrana,
postanite onaj koji jede - zaboravite da postoji bilo ko, ko moe posmatrati to. Kada ste se
103

preneli dovoljno, onda za jedan jedini momenat se udaljite. Nastavite da jedete, ali ponite da
posmatrate to - hranu, sebe, a vi stojite iznad i posmatrate to.
Ubrzo ete postati efikasni, i moete premestiti orua uma od aktera do gledaoca, od
uesnika do posmatraa.
A kada vam se to otkrije, onda ete videti da kroz identifikovano uestvovanje nita
nije mogue znati, samo kroz objektivno posmatranje stvari postaju otkrivene i znane. Zbog
toga oni koji su ostali u svetu, postali su predvodnici. Oni koji su otili s one strane, oni su
postali majstori (uitelji).
Frojd je obino govorio svojim uenicima... To je vrlo teko, jer Frojdovi uenici,
psihoanalitiari, nisu bili ljudi koji su transcendirali. Oni su iveli u svetu. Oni su samo
strunjaci. Ali ak je i Frojd predlagao njima da dok sluaju pacijenta, nekoga ko je bolestan,
mentalno bolestan: ostanite nepristrasni, izdvojeni. Nemojte se emocionalno uplitati. Ako se
upletete, onda je va savet beskoristan. Samo ostanite posmatra.
ak i to izgleda vrlo okrutno. Neko jaue, plae, a vi moete takoe oseati jer ste
ljudska bia. Ali Frojd kae, ako radite kao psihijatar, kao psihoanalitiar, ostanite neupleteni.
Gledajte osobu kao da je ona upravo problem. Ne gledajte na njega kao da je ljudsko bie.
Ako gledate na njega kao na ljudsko bie, vi ste odmah upleteni, vi ste postali uesnik, onda
ne moete savetovati. Onda sve to kaete bie pristrasno. Onda niste izvan toga.
To je teko, vrlo teko, stoga su frojdovci to inili na mnogo naina. Frojdovski
psihoanalitiar se nee suoiti sa pacijentom direktno, jer kada se suoite licem u lice teko je
ostati neupleten. Ako osobu pogledate u oi, vi ulazite u nju. Stoga frojdovski psihoanalitiari
sede iza, dok pacijent lei na divanu.
To je takoe vrlo vano, jer Frojd je shvatio da ako osoba lei, a vi sedite ili stojite, ne
gledajui u nju, manja je mogunost da budete upleteni. Zato? Osoba koja lei postaje
problem, kao na hirurgovom stolu. Moete da ga secirate. Obino, ovo se nikada ne deava.
Ako odete da sretnete osobu, nee vam govoriti leei ili sedei, dok nije pacijent, dok nije u
bolnici.
Stoga je Frojd insistirao da njegovi pacijenti treba da lee na kauu. Tako
psihoanalitiar nastavlja da osea da je osoba pacijent, bolesnik. Njemu mora da se pomogne.
On trenutno nije osoba ve problem, a vi ne treba da se upliete s njim. On ne treba da se
suoava licem u lice sa osobom, ne treba da istupi pred pacijenta - samo skriven iza, on e ga
sluati. Frojd je rekao ne dodirujte pacijenta, jer ako ga dodirnete, ako uzmete pacijentovu
ruku u svoju ruku, postoji mogunost da budete upleteni.
Ove predostronosti treba preduzeti jer psihoanalitiari nisu prosvetljene osobe. Inae
ako odete kod Bude, nije potrebno da leite, nije potrebno da se skrivate iza zavese. Buddhi
nije potrebno da pazi da ne postane upleten; on ne moe biti upleten. Koji god da je sluaj, on
ostaje neupleten. On moe oseati samilost prema vama, ali on ne moe biti saoseajan,
zapamtite ovo. Pokuajte da razumete razliku izmeu saoseanja i samilosti. Samilost je iz
vieg izvora. Buddha moe ostati samilostan prema vama. On vas razume - da ste u tekoi ali on nije saoseajan s vama jer zna da ste u tekoi zbog svoje nerazumnosti, zbog vae
gluposti ste u tekoi.
On ima samilost, pokuae na svaki nain da vam pomogne da izaete iz svoje
gluposti. Ali vaa glupost nije neto to e on simpatisati. Dakle, na neki nain on e biti vrlo
srdaan, a na neki nain e biti vrlo ravnoduan. Bie srdaan to se tie samilosti, a bie
apsolutno ravnoduan to se tie saoseanja.
Obino, ako odete kod Buddhe osetiete da je on ravnoduan - jer vi ne znate ta je
samilost i ne znate toplinu samilosti. Samo ste upoznali toplinu saoseanja, a on nije
saoseajan. On izgleda okrutan, hladan. Ako jecate i plaete, on nee jecati i plakati s vama.
Ako bi on plakao, onda ne bi postojala mogunost da vam od njega doe pomo. On bi bio u
istom poloaju. On ne moe plakati, a vi ete se oseati povreeni: Ja jadikujem i plaem, a
on ostaje ba kao statua, kao da je bez srca. On ne moe saoseati s vama. Saoseanje je iz
istog uma prema istom umu. Samilost je iz vieg izvora.

104

On moe da vas gleda. Vi ste providni za njega, potpuno goli, i on zna zato vi patite.
Vi ste uzrok, i on e pokuati da vam objasni uzrok. Ako moete da ga sluate, sam in
sluanja e vam pomoi mnogo.
To izgleda paradoksalno, ali nije. Buddha je takoe iveo kao vi. Ako ne u ovom
ivotu, onda u nekim prethodnim ivotima. On je proao kroz iste nevolje. Bio je glup kao vi,
patio je kao vi, upinjao se kao vi. Za mnogo, mnogo ivota on je bio na istoj stazi. On zna sve
muke, sva upinjanja, konflikt, jad. On je svestan, vie svestan nego vi, jer sada su svi proli
ivoti pred njegovim oima - ne samo njegov, nego vai takoe. On je iveo sve probleme
koje svako ljudsko bie moe da ivi, stoga on zna. Ali on ih je transcendirao, tako sada zna
koji su uzroci, a takoe zna kako oni mogu biti transcendirani.
On e pomoi na svaki nain da razumete da ste vi uzrok svojih patnji. Ovo je vrlo
teko. Najtea je stvar razumeti da Ja jesam uzrok mojih patnji. Ovo pogaa duboko; ovek
se osea povreenim. Kad neko kae da je neko drugi uzrok, vi oseate da je u redu. Ta osoba
izgleda saoseajna. Ako on kae: "Vi ste paenik, rtva, a drugi vas eksploatiu, drugi nanose
tetu, drugi su nasilni," vi se oseate dobro. Ali ova dobrota nee dugo trajati. To je trenutna
uteha, a opasna, sa velikom cenom, jer pomae va uzrok patnje.
Dakle, oni koji izgledaju saoseajni prema vama su vai pravi neprijatelji, jer njihova
naklonost pomae vaem uzroku da bude ojaan. Pravi izvor patnje je ojaan. Vi oseate da
ste u redu a ceo svet je pogrean - patnja dolazi iz neega drugog.
Ako odete kod Bude, kod jedne prosvetljene osobe, on je prinuen da bude tvrd, jer e
vas prisiliti da shvatite injenicu da ste vi uzrok. Jednom kada ponete oseati da ste uzrok
svog pakla, transformacija je ve poela. Onog momenta kada osetite ovo, pola posla je ve
uraeno. Vi ste ve na stazi; ve ste se pokrenuli. Velika promena je stigla kroz vas.
Pola patnji e iznenada ieznuti jednom kada razumete da ste vi uzrok, jer onda ne
moete saraivati sa njim. Onda neete biti tako neuki da pomaete jaanje uzroka koji
stvaraju patnje. Vaa saradnja e se prekinuti. Jadi e se jo nastaviti za kratko upravo zbog
navike.
Jednom je Mula Nasrudin bio prisiljen da doe na sud jer su ga nali opet pijanog na
ulici. Sudija za prekraje je rekao: "Nasrudine, seam se da sam vas video tako mnogo puta
radi istog prekraja. Imate li neko objanjenje za vae uobiajeno pijanstvo? Nasrudin je
rekao: "Naravno, imam objanjenje za moje uobiajeno pijanstvo. Ovo je moje objanjenje:
uobiajena e."
ak i ako postanete budni, uobiajeni obrazac e vas prisiliti za kratko da se kreete u
istom pravcu. Ali to ne moe trajati za dugo; energije vie nema. To se moe nastaviti kao
mrtav obrazac, ali ubrzo to e uvenuti. To je potrebno svakog dana hraniti, to je potrebno
svakog dana ojaavati. Vaa saradnja je neprekidno potrebna.
Jednom kada postanete svesni da ste vi uzrok vaih patnji, saradnja otpada. Dakle, sve
to vam ja govorim jeste da vas uini spremnim za jednu injenicu - da gde god ste, ta god
ste, vi ste uzrok. Nemojte postati pesimistini oko toga, u ovome ima nade. Ako je neko drugi
uzrok, onda nita ne moe da se uini.
Stoga Mahavira kae: "Ako postoji Bog, onda je ovek bespomoan." Dakle on ne
kae: "Ja ne verujem u Boga." Razlog nije filozofski, razlog je veoma psiholoki. Razlog je
takav da vi ne moete uiniti nikoga odgovornim za sebe. Da li Bog postoji ili ne, to nije
pitanje.
Mahavira kae: "elim da razumete da ste vi uzrok ta god da ste." A to je daje veliku
nadu. Ako ste vi uzrok, vi moete to promeniti. Ako vi stvarate pakao, vi moete stvoriti raj.
Vi ste gospodar.
Stoga ne oseajte beznadenost. to vie inite druge odgovornim za va ivot, vie
ste rob. Ako kaete: "Moja ena me ini ljutim" onda ste vi rob. Ako kaete da vam va mu
stvara nevolju, onda ste rob. ak i ako vam va mu zaista stvara nevolju, vi ste odabrali tog
mua. Vi ste eleli tu nevolju, tu vrstu nevolje - to je va izbor. Ako vaa ena stvara pakao, vi
ste izabrali tu enu.
Neko je pitao Mula Nasrudina: "Kako si upoznao svoju enu? Ko te je predstavio?"
On je rekao: "To se jednostavno dogodilo. Ne mogu kriviti nikoga."
105

Niko ne moe kriviti nikoga. A to nije samo deavanje, to je izbor. Poseban tip
mukarca bira poseban tip ene. No nije sluajno. A on je bira iz posebnih razloga. Ako ta
ena umre, on e ponovo izabrati isti tip ene. Ako se razvede od te ene, opet e se oeniti
istim tipom ene.
Moete nastaviti da menjate ene, ali dok se mu ne promeni nee biti stvarne
promene - samo imena se menjaju - jer ovaj ovek nema izbor. On voli odreeno lice, on voli
naroit nos, on voli pojedine oi, on voli specifino ponaanje.
A to je kompleksna stvar. Ako volite poseban nos - jer nos nije samo nos. On nosi
ljutnju, on nosi ego, on nosi tiinu, on nosi mir, on nosi mnogo stvari - ako elite naroit nos,
vi moda volite osobu koja vas moe prisiliti da budete ljuti. Egoistina osoba ima drugaiji
tip nosa. Ona moe biti lepa. Ona izgleda lepo samo zato to ste vi u potrazi za nekim ko
moe stvoriti pakao oko vas. Pre ili kasnije stvari e uslediti. Moda neete biti sposobni da ih
poveete. ivot je kompleksan, a vi ste tako mnogo upleteni u njemu da ne moete spojiti.
Biete sposobni da vidite samo kada transcendirate.
To je upravo slino kao da letite u avionu iznad Bombaja. itav Bombaj se pojavljuje,
itav obrazac. Ako ivite u Bombaju i kreete se ulicama, ne moete videti itav uzorak. Ceo
Bombaj ne moe videti onaj ko ivi u Bombaju. To moe videti samo onaj ko leti iznad. Onda
se ceo model pojavljuje. Onda stvari pokazuju obrazac. Transcendencija oznaava odlaenje
izvan ljudskih problema. Onda moete ui i videti.
Mnogo godina sam posmatrao mnoge osobe. ta god da one rade, one nisu svesne ta
rade. Ljudi postaju svesni samo kada dou rezultati. Nastavljaju da bacaju seme u zemlju; oni
nisu svesni. Meutim kada dou do etve oni e postati svesni. Oni ne mogu spojiti da su
izvor i da su eteoci.
Jednom kada razumete da ste vi uzrok, pokrenuli ste se na stazi. Sada mnoge stvari
postaju mogue. Sada moete uiniti neto oko problema koji je va ivot. Moete ga
promeniti. Upravo promenom sebe vi ga moete promeniti.
Jedna ena je dola kod mene - pripada vrlo bogatoj familiji, vrlo dobroj porodici,
kulturnoj, profinjenoj, obrazovanoj. Pitala me je: "Ako ponem da meditiram, da li e to na
bilo koji nain ometati moj odnos sa suprugom?" Sama je rekla, pre nego to sam odgovorio:
"Znam da to nee biti smetnja jer ako postanem bolja, mirnija i zaljubljenija - kako to moe
smetati mom odnosu?"
Meutim, ja sam joj rekao: "Greite. Odnos e bi ometan. Bilo da postanete dobri ili
loi, to je nevano. Vi se menjate, jedan partner se menja - odnos e biti ometan. A ovo e
postati udo: ako vi postanete loi, odnos nee biti ometen tako mnogo. Ali ako postanete
dobri i bolji, odnos e biti poljuljan, jer kada jedan partner pada dole i postaje lo, drugi se
osea relativno bolje. To nije povreda ega. Pre je to zadovoljavanje ega."
Dakle, ena se osea dobro ako mu pone da pije, jer sada ona postaje moralni
propovednik. Sada ona dominira nad njim vie. Sada kad god on ue u kuu on ulazi kao
kriminalac. Samo zato to on pije, sve to radi postaje pogreno. Toliko je dovoljno, jer ena
moe izneti taj argument esto, bilo gde. Tako, sve je osueno.
Meutim ako mu ili ena postanu meditativni, onda e biti jo ozbiljnijih problema
jer ego drugog e biti povreen - jedan postaje superiorniji, a drugi e pokuati na svaki nain
da se to ne dogodi. On e kreirati sve mogue nevolje. ak i ako se to dogodi, on e pokuati
da ne veruje u to, da se to dogodilo. On e kazati da se to jo nije dogodilo. Nastavie da
govori: "Ti meditira godinama i nita se nije dogodilo. Kakve koristi od toga? Beskorisno. Ti
se jo uvek ljuti, jo uvek ini ovo i ono, ostaje isti." Drugi e pokuati da ubedi da se nita
ne dogaa. Ovo je zakljuak.
Ako se zaista neto dogodilo, ako su se mu i ena zaista promenili, onda se ovaj
odnos ne moe nastaviti. To je nemogue dok drugi nije takoe spreman na promenu. A da se
postane spreman na promenu sebe vrlo je teko jer to povreuje ego. To znai ta god da vi
jeste, vi ste neistiniti. Samo onda potreba za promenom je prisutna.
Dakle, niko nikada ne misli da on mora da se menja: "Ceo svet mora da se menja, ne
ja. Ja sam u pravu, apsolutno ispravan, a itav svet je kriv jer on ne odgovara meni." Sav
106

napor svih Buddha je vrlo jednostavan: nastoji da vas uini svesnim da ta god da ste vi, vi ste
uzrok.
Drugo pitanje:
Zato tako mnogo osoba na stazi joge usvajaju stanovite borbe, upinjanja, potpunog
zanimanja za pridravanje strogih pravila, i ratniku slinih puteva? Da li je to nuno da bi se
bio pravi jogin?
To je apsolutno nepotrebno - ne samo nepotrebno, to stvara sve vrste prepreka na stazi
joge. Ako ponete da se borite, vi delite sebe.
A to je najvea bolest; da se bude podeljen, da se postane izofrenian. itava nevolja
je beskorisna, ona nikuda nee odvesti. Niko ne moe da pobedi. Na obe strane vi jeste. Dakle
uglavnom se moete igrati; moete igrati igru skrivanja i traenja. Ponekad deo A pobeuje,
ponekad deo B. Na taj nain moete se kretati. Ponekad ono to nazivate dobrim pobeuje.
Inae borei se sa zlom, pobeujui zlo, dobar deo postaje iscrpljen, a zli deo sakuplja
energiju. Tako pre ili kasnije zli deo e izai gore, a ovo se moe odvijati beskonano.
Inae, zbog ega se ovo, ratniku slino dranje, deava? Zato veina ljudi zapoinje
borbom? Onog momenta kada oni misle o preobraaju, zapoinju da se bore. Zato? Jer vi
znate samo metod pobeivanja, a to je borba.
U svetu spolja, u spoljanjem svetu, postoji jedan nain da se bude pobedonosan, a to
je borba - borba i unitenje drugog. To je jedini nain u spoljanjem svetu da se bude
pobedonosan. A vi ste iveli u ovom spoljanjem svetu milionima i milionima godina i borili
ste se - ponekad bivajui poraeni ako se ne borite dobro, ponekad postajui pobedonosni ako
se borite dobro. Dakle, to je postao unutra izgraen program "Bori se estoko." Postoji samo
jedan nain da se bude pobedonosan, a to je ljuta borba.
Kada napredujete unutra, vi sprovodite isti program jer ste upoznati samo sa ovim. U
unutranjem svetu, upravo je obrnut sluaj: ako se borite - biete pobeeni, jer nema nikog da
se s njim borite. U unutranjem svetu, preputanje je put da se bude pobedonosan, predanost
je put da se bude pobedonosan, dozvoljavajui unutranjoj prirodi da tee, ne boriti se, jeste
put da se bude pobedonosan. Doputanje reci da tee, ne gurajui je, jeste put kada je u
pitanju unutranji svet. Ovo je upravo obrnuto. Inae, vi ste obaveteni samo o spoljanjem
svetu, tako da je ovo obavezno da bude samo u poetku. Ko god se kree unutra, on e nositi
ista oruja, isto dranje, iste borbe, istu odbranu.
Makijaveli je bio za spoljanji svet; Lao Ce i Buddha su za unutranji svet. A oni ue
razliite stvari. Makijaveli kae: napad je najbolja odbrana; "Ne ekajte da drugi napadne, jer
onda ste ve na gubitku. Ve ste izgubili, jer drugi je zapoeo. On je ve dobio, stoga je uvek
bolje zapoeti. Nemojte ekati da se branite, uvek budite agresor. Pre nego to neko napadne
vas, vi napadnite njega i borite se s onoliko vetine koliko je mogue, s onoliko nepotenja
koliko je mogue. Budite nepoteni, budite lukavi i budite agresivni." Makijaveli je jedan
iskren ovek; zbog toga on predlae tano sve to je potrebno.
Inae, ako pitate Lao Cea, Patanjalija ili Budu, oni govore o razliitom tipu pobede o unutranjoj pobedi. Tamo, podmuklost, nee delovati, obmanjivanje nee delovati, borba
nee delovati, agresija nee delovati jer koga ete obmanjivati? Koga ete pobediti? Vi ste
sami tu. U spoljanjem svetu nikada niste sami. Drugi su prisutni, oni su neprijatelji. U
unutranjem svetu vi ste tu sami. Ne postoji drugi. Ovo je totalno nova situacija za vas. Vi
ete nositi stara oruja, ali ova stara oruja e postati uzrok vaeg poraza. Kada promenite
svet iz svoje unutranjosti, ostavite sve to ste nauili iznutra. To nee biti od pomoi.
Neko je pitao Ramanu Maharija: "ta treba da nauim da bih postao smiren, da znam
sebe samog?" Pria se da je Ramana Mahari rekao: "Za dosezanje unutranjeg Sopstva ne
treba da uite nita. Potrebno vam je zaboravljanje, uenje nee pomoi. To vam pomae da
napredujete spolja. Zaboravljanje e pomoi."
Sve to ste nauili, zaboravite to, zanemarite to, odbacite to. Kreite se unutra nevino,
bezazleno - bez lukavosti i vetina, ve s detinjastim poverenjem i nevinou; ne razmiljajui
u terminima da e vas neko napasti. Nema nikoga, tako ne oseajte se nesigurno i ne
107

sprovodite nikakve dogovore za odbranu. Ostanite ranjivi, prijemljivi, otvoreni. To je ono ta


shraddha, poverenje, znai.
Sumnja je nuna spolja jer drugi je prisutan. On moda misli da vas obmane, stoga
treba da sumnjate i da budete skeptini. Unutra, nema sumnje, nikakav skepticizam nije
potreban. Nikog nema tamo da vas vara. Moete ostati tamo onakvi kakvi jeste.
Zbog toga svako ima dranje slino ratniku, ali ono nije nuno. To je smetnja, najvea
prepreka. Odbacite to van. Moete nainiti to glavnom stvari koja treba da se zapamti, da sve
to je nuno spolja unutra e postati smetnja. Bilo ta, kaem, bezuslovno. A ba obrnuto
treba da se proba.
Ako sumnja pomae spolja u naunim istraivanjima, onda e vera pomoi unutra u
religijskim istraivanjima. Ako agresivnost pomae spolja u svetu moi, prestia, drugih,
onda e neagresivnost pomoi unutra. Ako lukav, proraunati um pomae spolja, onda nevin,
neproraunat, bezazlen um e pomoi unutra.
Zapamtite ovo: ta god da pomae spolja, upravo obrnuto e pomagati unutra. Dakle,
itajte Makijavelijevo delo Vladalac (Il Principe). To je put spoljanje pobede. Upravo kada
obrnete Makijavelijevog Vladara, moete stii unutra. Ba preokrenite Makijavelijevo
gledite, i on postaje Lao Ce - kao u shirshasanu, stoju na glavi. Makijaveli stojei na svojoj
glavi postaje Patanjali.
Dakle, itajte delo Vladalac; ono je divno - najjasnije tvrdnje za spoljanju pobedu, a
onda itajte Lao Ceov Tao Te ing ili Patanjalijeve Joga sutre ili Budinu Dhammapadu ili
Isusovu Propoved na gori. Oni su ba kontradiktorni, upravo obrnuti, ba suprotni.
Isus kae: "Blagosloveni su oni koji su krotki, jer e naslediti zemlju" - krotki, nevini,
a ne slabi, nejaki, ni u kom smislu. "Blagosloveni su siromani u duhu, jer e ui u carstvo
boje." Isus to ini jasnim: "siromani u duhu". Oni nemaju nita na ta bi polagali pravo. Oni
ne mogu rei: "Ja sam dobio ovo." Oni ne poseduju nita - znanje, bogatstvo, mo, presti.
Oni ne poseduju nita, oni su siromani. Oni ne mogu polagati pravo: "Ovo je moje."
Oni nastavljaju da tvrde: "Ovo je moje, ovo je moje. to vie mogu polagati pravo,
vie oseam da ja jesam." U spoljanjem svetu, to je vea teritorija vaeg uma, vie vi jeste.
U unutranjem svetu, to je manja teritorija uma, vi ste vei. A kada teritorija iezne
kompletno i vi ste postali nula, onda - onda ste najvei. Onda ste pobedonosni. Onda se
pobeda dogodila.
Ratniku slino dranje - naporna borba, previe velika zainteresovanost za pravila,
uredbe, proraunatost, planiranje - ovaj um je prenesen unutra jer ste nauili to i ne znate nita
drugo. Otuda, potreba za uiteljem. Inae, nastaviete da pokuavate svojim putevima koji su
u toj stvari apsolutno apsurdni.
Otuda, nuna je inicijacija. Inicijacija oznaava nekoga ko moe da vam pokae put
gde vi nikada niste putovali, nekoga ko moe da vam da letimino sagledavanje sveta kroz
njega, dimenzija koja je vama potpuno nepoznata. Vi ste gotovo slepi za to. Ne moete videti
to jer oi mogu videti samo ono to su one nauile da vide.
Ako doete ovde i ako ste kroja, onda ne gledate lica, gledate odela. Lica vam ne
znae mnogo; samo gledajui u odelo vi znate koji je to tip oveka. Vi znate jezik.
Ako ste obuar, nije vam potrebno da gledate u odelo; cipele e biti dovoljne. Obuar
moe upravo nastaviti da posmatra na ulici, i znae ko prolazi, da li je osoba veliki lider upravo gledajui u cipele - da li je ona jedan umetnik, boem, hipik, bogat ovek, da li je
kulturan, obrazovan, neobrazovan, seljak - samo posmatranje cipela daje sve pokazatelje ko je
ona. On zna jezik. Da li ovek pobeuje u ivotu, cipela ima razliit sjaj. Ako je pobeen u
ivotu, cipela je poraena. Onda je cipela tuna, ne mari se za nju. Obuar zna to. Nije mu
potrebno da gleda u vae lice. Cipela e rei sve to on eli da zna.
Mi uimo sve i onda postajemo fiksirani u tome. Onda je to ono ta vidimo. Vi ste
nauili neto, a potroili ste mnogo ivota uei to. Sada je to duboko ukorenjeno, utisnuto.
To je postalo deo vaih modanih elija. Dakle kada se kreete unutra tamo je jednostavno
tama, nita, vi ne moete videti nita. itav svet koji znate iezao je.
To je ba kao kada znate jedan jezik i iznenada ste poslati u zemlju gde niko ne
razume va jezik i vi ne moete razumeti niiji jezik. A ljudi razgovaraju i askaju, a vi
108

oseate jednostavno da su oni ludi. Izgleda kao da izgovaraju besmislice, a to izgleda vrlo
buno jer ne moete razumeti. Izgleda vam da oni govore preglasno. Ako ih moete razumeti,
onda se cela stvar menja; vi postajete deo toga. Onda to nije mrmljanje; to postaje sadrajno.
Kada uete unutra vi znate jezik spoljanjeg. Unutra postoji tama. Vae oi ne mogu
videti, vae ui ne mogu uti, vae ruke ne mogu oseati. Neko je potreban, neko da vas
inicira, da uzme vau ruku u svoju ruku i pokrene vas na ovoj nepoznatoj stazi dok ne
postanete upoznati, dok ne zaponete da oseate, dok ne postanete svesni neke svetlosti nekog
znaenja, nekog smisla oko vas.
Jednom kada imate prvu inicijaciju, stvari e poeti da se deavaju. Inae prva
inicijacija je teka stvar, jer je to skoro sasvim jedan obrt, skoro totalan obrt. Iznenada va
svet znaenja iezava. Vi ste u nepoznatom svetu. Ne razumete nita - gde da se kreete, ta
da inite i ta da nainite od ovog haosa. Majstor samo oznaava nekoga ko zna. A ovaj haos,
unutranji haos, za njega nije haos, to je red, kosmos, i on vas moe voditi u njega.
Intuicija oznaava gledanje kroz unutranji svet kroz oi nekog drugog. Bez poverenja
to je nemogue jer vi neete dozvoliti da vaa ruka bude uzeta od nekoga da vas vodi u
nepoznato. A on vam ne moe dati nikakvu garanciju. Nikakva garancija ne bi bila ni od
kakve koristi. ta god da on kae, vi morate uzeti to na poverenje.
U drevnom vremenu kada je Patanjali pisao sutre, poverenje je bilo vrlo lako, jer u
spoljanjem svetu takoe, naroito na Istoku i specijalno u Indiji, oni su stvorili spoljanji
obrazac intuicije. Na primer, zanati, profesije, pripadali su porodicama kroz naslee. Otac bi
inicirao dete u zanimanje, a dete je prirodno verovalo svom ocu. Otac bi odveo dete na farmu
ako je ratar i farmer, i inicirao ga u njegovu poljoprivredu. Koji god posao da je radio, on bi
uveo dete.
U spoljanjem svetu takoe, postojala je inicijacija na Istoku. U sve je trebalo da se
bude iniciran - neko koji zna bi vas uveo. Ovo je pomagalo vrlo mnogo jer ste bili upoznati sa
inicijacijom s nekim ko bi vas vodio. Dakle, kada doe vreme za inicijaciju, vi ste mogli
verovati.
A poverenje, shraddha, vera, bila je laka u svetu koji nije bio tehnoloki.
Tehnolokom svetu treba otroumnost, lukavost, kalkulacija, matematika, promuurnost - ne
nevinost. U tehnolokom svetu, ako ste nevini izgledaete smeno; ako izgledate otroumno,
izgledaete mudri, inteligentni. Nai univerziteti ne ine nita do ovo; ine vas domiljatim,
lukavim, proraunatim. Vie proraunatosti, vie lukavosti, i uspeniji ete biti u svetu.
Sasvim obrnut je bio sluaj sa Istokom u prolosti. Ako ste bili lukavi za vas ne bi bilo
mogue da uspete ak ni u spoljanjem svetu. Samo nevinost je bila prihvatana. Tehnika nije
uvaavana previe, ali unutranji kvalitet je vrednovan previe.
Ako je osoba lukava i pravi bolje cipele, niko ne bi iao kod nje na Istoku u prolosti.
Odlazili bi kod osobe koja je nevina. Ona moda ne bi pravila bolje cipele, ali oni bi odlazili
kod osobe koja je bezazlena jer cipela nije ba bilo ta, ona nosi kvalitet osobe koja je
napravila. Dakle ako bi postojao lukav i domiljat tehniar, niko ne bi iao kod njega. On bi
trpeo, ne bi bio uspean. Ali ako bi bio ovek kvaliteta, karaktera, bezazlenosti, ljudi bi ili
kod njega. ak i ako su gore, ljudi bi vie cenili njegove stvari.
Kabir je bio tka i ostao je tka. ak i kada je postigao prosvetljenje, nastavio je da
tka. On je bio tako ekstatian, da njegovo tkanje nije moglo biti vrlo dobro. On je pevao,
plesao i tkao! Bilo je mnogo greaka i mnogo neispravnosti, ali njegove stvari su bile odlino
cenjene.
Mnogi ljudi bi ba ekali kada e Kabir doneti neto - to nije bila samo stvar, artikal,
to je bilo od Kabira! Sama stvar u sebi bila je unutranjeg kvaliteta, dola je iz Kabirovih
ruku. Kabir je dodirnuo. Kabir je plesao oko nje dok je tkao. I neprekidno se seao
boanskog, tako je stvar - tkanina, odea ili bilo ta - postala duhovna, sveta. To je davalo
kvalitet stvarima. Tehnika strana je sporedna; ljudska strana je bila primarna.
Tako ak i u spoljanjem svetu na Istoku, oni su sproveli obrazac tako da kada se
okrenete unutra neete biti totalno neupoznati sa unutarnjim svetom; neto ete znati, neka
uputstva, neka svetla u vaoj ruci. Neete se kretati u totalnoj tami.
109

A ovo poverenje u spoljanje odnose bilo je svuda. Mu nije mogao verovati da


njegova ena moe biti neverna. To je bilo gotovo nemogue. A ako mu umre, ena bi umrla
s njim jer ivot je bio takav zajedniki fenomen. Tada je bilo besmisleno iveti bez nekoga s
kojim je ivot postao tako zajednika stvar.
To je kasnije postalo runo, ali u poetku je to bila jedna od najlepih stvari koja se
ikada desila na zemlji. Vi ste voleli nekoga i on je iezao - eleete da ieznete s njim. Da se
bude bez njega bilo bi gore nego smrt. Smrt je bolja i vredna izbora - takvo je bilo verovanje u
spoljanje stvari takoe. Odnos ene i mukarca je spoljanja stvar. Celo drutvo se kretalo
oko poverenja, istinskog deljenja, onda je to bilo korisno. Kada je jednom vreme dolo da se
krene unutra, sve ove stvari bi njemu pomogle da bude iniciran lako - da veruje nekome, da se
preda.
Borba, upinjanje, agresivnost su prepreke. Ne sprovodite ih. Kada se kreete prema
unutra, ostavite ih pred vratima. Ako ih nosite, propustiete unutranji hram; nikada ga neete
dostii. S ovim stvarima vi se ne moete kretati prema unutra.
Tree pitanje:
Nije li vairagya, nevezivanje ili beeljnost, dovoljna u sebi da oslobodi oveka od
svetovnog robovanja? Kakva je onda korist od jogijske discipline, od abhyase?
Vairagya je dovoljna, beeljnost je dovoljna. Onda nikakva disciplina nije potrebna.
Ali gde je ta beeljnost? Ona nije tu. Zato je potrebna pomo discipline. Disciplina je
potrebna samo zato jer ta beeljnost nije u svojoj celosti unutar vas. Ako je beeljnost tu, onda
ne postoji pitanje praktikovanja iega; nikakva disciplina nije potrebna. Vi neete doi da
sluate mene; neete ii da itate Patanjalijeve sutre. Ako je beeljnost potpuna, Patanjali je
beskoristan. Zato gubiti vae vreme sa Patanjalijem sutrama? Ja sam beskoristan, zato da
dolazite kod mene?
Vi ste u potrazi za disciplinom. Vi se kreete u potrazi za nekom disciplinom, koja vas
moe preobraziti. Vi ste uenik (disciple"), a disciple" oznaava osobu koja je u potrazi za
disciplinom. Nemojte obmanjivati sebe. ak i ako odete kod Krinamurtija, vi ste u traganju
za disciplinom - jer onaj koji nije u nudi nee ii. ak i ako Krinamurti kae da nikome ne
treba da bude uenik i nikakva disciplina nije potrebna, zato ste vi tu? I ove rei e postati
vaa disciplina, stvoriete obrazac, i poeete da sledite taj obrazac.
Beeljnost ne postoji, dakle, vi ste u patnji. A niko ne eli da pati, i svako eli da
transcendira patnju. Kako da je transcendira? To je ono to e disciplina pomoi da uinite.
Disciplina e vas samo uiniti spremnim za skok, za skok u beeljnost. Disciplina oznaava
trening.
Vi jo niste spremni, imate vrlo grub mehanizam. Vae telo, va um, oni su grubi. Oni
ne mogu primiti suptilno. Niste usaglaeni. Da biste primili suptilno, morate biti usklaeni.
Vaa grubost mora da iezne. Zapamtite ovo - da biste primili suptilno moraete da postanete
suptilni. Kakvi jeste, boansko moe biti oko vas, ali vi ne moete biti u dodiru s njim.
To je ba kao radio. Lei dole u sobi, ali ne funkcionie. Neke ice su pogreno
povezane, ili su neke ice pokidane, ili nedostaje neki prekida. Radio postoji, radio talasi
neprekidno prolaze, ali radio ne moe biti podeen i ne moe postati sposoban da prima.
Vi ste ba kao radio, niste u stanju u kome moete da funkcioniete. Mnoge stvari
nedostaju, mnoge svari su pogreno spojene. "Disciplina" znai da vi uinite va radio
funkcionalnim, sposobnim da prima, podeenim. Boanski talasi su svuda oko vas. Jednom
kada ste usaglaeni oni postaju manifestovani. A oni mogu postati manifestovani samo kroz
vas, i dok ne postanu manifestovani kroz vas, ne moete znati njih. Oni mogu postati
manifestovani kroz mene, oni mogu postati manifestovani kroz Krinamurtija, ili nekog
drugog, ali oni ne mogu postati vae preoblikovanje, vaa transformacija.
Vi ne moete znati stvarno ta se deava u Krinamurtiju u Gurijevu - ta se deava
iznutra, koja vrsta usaglaavanja se dogaa, kako je njihov mehanizam postao tako suptilan da
prima suptilne poruke iz univerzuma, kako egzistencija zapoinje da manifestuje sebe kroz to.
110

Disciplina oznaava promenu vaeg mehanizma, da ga podesi, da ga naini podesnim


instrumentom da bude izrazito prijemiv. Ponekad bez discipline, takoe, ovo moe sluajno
da se dogodi. Radio moe pasti sa stola. Upravo padom, sluajno, neke ice mogu da se
poveu ili prekinu. Ba padom, radio moe biti povezan sa stanicom. Onda e zapoeti da
objavljuje neto, ali to e biti haos.
To se deavalo mnogo puta. Ponekad kroz sluajnost ljudi bi doli do saznanja
boanskog i osetili boansko. I onda oni polude jer nisu disciplinovani da prime tako moan
fenomen. Oni nisu spremni. Oni su tako mali, a toliko veliki okean ih zapljusne. Ovo se
deavalo. U sufi sistemu oni nazivaju takve osobe lude za bogom - masti, tako ih oni zovu.28
Mnogi ljudi ponekad bez discipline - kroz neki sluaj, kroz nekog majstora, kroz
milost nekog uitelja ili upravo kroz prisustvo nekog uitelja - postaju usaglaeni. itav
njihov mehanizam nije spreman, ali deo zapoinje da funkcionie. Onda su oni izvan obiaja.
Onda ete oseati da su ludi, jer e zapoeti da govore stvari koje izgledaju nepovezane, ali ne
mogu uiniti nita. Neto je zapoelo u njima; oni ne mogu zaustaviti to. Oni oseaju
odreenu sreu. Zbog toga su nazvani masti, sreni ljudi. Inae oni nisu slini Budi, oni nisu
prosvetljeni. Kae se za maste, za ove srene ljude koji su poludeli, da je vrlo veliki uitelj
potreban jer oni sada ne mogu uiniti nita sa sobom. Oni su upravo u konfuziji - sreni u
njoj, jer su u neredu. Oni ne mogu sami initi nita.
U drevnim danima, veliki sufi majstori su se kretali po zemlji. Kad god bi uli za
nekog masta, otili bi kod njega da mu pomognu da se usaglasi.
U ovom veku samo Meher Baba je obavljao taj posao - veliki posao svog vlastitog
tipa, redak posao. Neprekidno, tokom mnogo godina, on je putovao svuda po Indiji, a mesta
koja je poseivao bile su ludnice, jer u ludnicama ive mnogi masti. Inae vi ne moete
napraviti nikakvu razliku ko je lud, a ko je mast; oboje su ludi. Ko je stvarno lud, a ko je lud
upravo zbog boanskog sluaja - jer neko usaglaavanje se dogodilo kroz neki sluaj! Vi ne
moete nainiti nikakvu razliku.
Mnogi masti su ovde. Meher Baba bi putovao i iveo bi u ludnicama, i on bi pomagao
i sluio maste, lude ljude. Mnogi od njih su izali iz svoje ludosti i zapoeli svoje putovanje
prema prosvetljenju.
Na zapadu mnogi ljudi su u ludnicama, utoitima za lude, mnogi kojima ne treba
nikakva psihijatrijska pomo jer psihijatri ih samo mogu opet uiniti normalnim.
Njima treba pomo nekoga ko je prosvetljen, ne psihijatar, jer oni nisu bolesni. Ili, ako
su bolesni, bolesni su od boanske bolesti. Vae zdravlje nije nita pred tom boleu. Ta
bolest je bolja - vredna gubljenja sveg vaeg "zdravlja". Disciplina je potrebna.
U Indiji ovaj fenomen nije bio tako znaajan kao to je bio u islamskim zemljama.
Zbog toga sufiji imaju specijalne metode da pomognu ovim mast ljudima, ludim ljudima za
Bogom.
Inae Patanjali je stvorio tako suptilan sistem da nije potreban nikakav sluaj.
Disciplina je tako nauna da ako proete kroz ovu disciplinu, vi ete dostii Budinstvo a da ne
postanete ludi na stazi. To je kompletan sistem.
Sufizam jo nije kompletan sistem. Mnoge stvari nedostaju u njemu, a one nedostaju
usled svojeglavog dranja muslimana. Oni ne bi dozvolili tome da se razvije do svoje najvie
vrednosti i vrhunca. A sufi sistem mora da sledi obrazac islamske religije. Zbog strukture
islamske religije, sufi sistem nije mogao otii izvan nje.29
Patanjali ne sledi nijednu religiju, on sledi samo istinu. On ne pravi nikakav
kompromis sa hinduizmom, islamizmom ili bilo kojim izmom. On sledi naunu istinu. Sufiji
su morali da naine kompromis sa islamom, morali su to. Zato to je bilo nekih sufija koji su
pokuali da ne naine nikakav kompromis; na primer, Bayazit iz Bisthama, ili Al-Hillaj
Mansoor, oni nisu nainili nikakav kompromis i zaklani su, oni su bili ubijeni.
28

I u drugim tradicijama se spominju, kao na primer jurodivi u hrianstvu, ludije ili boanski ludaci u
Tibetu.
29
Sufizam je mnogo stariji sistem duhovnog probuenja nego islamska religija. Kada je islam nastao, on je
nasilno unitavao drevne sufijske kole i ubijao uitelje, a oni koji su preostali bili su asimilovani u islam. Sva
duhovnost koja danas postoji u islamu potie od uticaja sufizma deformisanog islamskim uenjem.
111

Tako su sufisti poeli da se skrivaju. Nainili su svoju nauku sasvim tajnom, i nisu
dopustili da nijedan fragment bude poznat, samo oni fragmenti koji su podesni za islam i
njegov obrazac. Svi drugi fragmenti bili su skriveni. Tako da ceo sistem nije poznat; on ne
deluje. Tako su mnogi ljudi, kroz fragmente, postali ludi.
Patanjalijev sistem je kompletan, a disciplina je potrebna. Pre nego to se krene u
nepoznati svet unutranjosti, ozbiljna disciplina je potrebna tako da se nikakav nesrean sluaj
ne dogodi.
Vairagya je dovoljna, ali ta "dovoljna" vairagya nije prisutna u vaem srcu. Ako
postoji, onda nema pitanja. Onda zatvorite Patanjalijevu knjigu i ostavite je. Apsolutno je
nepotrebna. Ali ta "dovoljna" vairagya ne postoji. Bolje je kretati se na stazi discipline, korak
po korak, tako da ne postanete rtva neke nesree. Udesi... mogunost postoji.
Mnogi sistemi deluju u svetu, ali ne postoji tako savren sistem kao Patanjalijev, jer
nijedna zemlja nije radila toliko dugo. Patanjali nije zaetnik ovog sistema, on je samo
zapisniar. Pre Patanjalija, hiljadama godina, sistem je bio razvijan. Mnogi ljudi su radili na
tome. Patanjaliju je data sutina hiljadugodinjeg rada.
Inae on je nainio to na takav nain da se moete kretati sigurno. Upravo pre nego to
krenete unutra nemojte misliti da se kreete u sigurnom svetu. To moe biti nesigurno. To je
takoe opasno; moete biti izgubljeni u tome. Ako se izgubite u tome, vi ete poludeti. Zbog
toga uitelji kao Krinamurti koji insistiraju da nikakav uitelj nije potreban, jesu opasni, jer
ljudi koji su neinicirani mogu zauzeti svoje gledite i mogu zapoeti da rade sami po svome.
Zapamtite, ak i va runi asovnik ne radi tano, vi imate tenju i radoznalost - jer
ona dolazi od majmuna - da ga otvorite i uradite neto. Teko je odupreti se tome. Ne moete
verovati da ne znate o tome. Moete biti vlasnik sata, ali to ne znai da znate bilo ta o satu.
Ne otvarajte ga! Bolje je dati ga pravoj osobi koja poznaje te stvari. asovnik je jednostavan
mehanizam; um je tako kompleksan mehanizam. Nikada ne otvarajte sami jer ta god da
uradite bie pogreno.
Ponekad se dogaa da se va asovnik pokvari - vi ga samo prodrmate i poinje da
radi. Meutim to nije nauka. Ponekad se deava da vi neto uradite, i samo sreom, sluajno,
oseate da se neto dogaa. Ali vi niste postali majstor. Ako se to dogodilo jednom, ne
pokuavajte to ponovo, jer ako sledei put protresete svoj sat on e moda stati. Ovo nije
nauka.
Ne pokreite se uz pomo sluaja. Disciplina je jedina zatita. Ne kreite se
nasumino! Kreite se sa uiteljem koji zna ta radi, a on zna ako neto krene pogreno da to
vrati na pravi put, koji je svestan vae prolosti i koji je takoe svestan vae budunosti, i koji
moe spojiti zajedno vau prolost i budunost.
Otuda tako veliko naglaavanje uitelja u indijskoj tradiciji. A oni su znali, ustanovili
da ne postoji mehanizam tako kompleksan kao ljudski um, nema kompjutera tako sloenog
kao ljudski um.
ovek nije mogao jo da razvije nita slino ljudskom umu - i ja mislim da se nikada
nee razviti, jer ko e to razviti? Ako ljudski um moe razvijati neto, to e uvek biti nie i
manje nego to je um koji stvara. Barem jedna stvar je sigurna: da sve to ljudski um stvori, ta
stvorena stvar ne moe kreirati ljudski um. Tako da ljudski um ostaje najsuperiorniji,
najsavreniji sloeni mehanizam.
Ne inite nita samo radi radoznalosti, ili zato to drugi to rade. Postanite inicirani, i
kreite se s nekim koji zna valjano stazu. Inae ludilo moe da bude rezultat. A to se deavalo
ranije; to se deava mnogim ljudima upravo sada.
Patanjali ne veruje u sluajnosti. On veruje u nauni red. Tako je on dao jedan-pojedan korak. Ovo dvoje je on nainio svojom bazom - vairagya, beeljnost i abhyasa,
konstantna, svesna veba. Abhyasa je sredstvo, a vairagya je cilj. Beeljnost je cilj, a
konstantna, svesna unutranja praksa je sredstvo.
Inae cilj zapoinje od samog poetka i ciljevi su skriveni u poetku. Drvo je skriveno
u semenu, tako da poetak sadri u sebi kraj, odnosno cilj. Zbog toga on kae da je beeljnost
potrebna u poetku takoe. Poetak sadri cilj u sebi, a cilj e takoe imati poetak u sebi.
112

Tako kada ak i majstor postane usavren, potpun, on nastavlja da veba. Ovo e vama
izgledati apsurdno. Vi treba da vebate jer ste na poetku i cilj treba da bude postignut, ali
kada je cilj postignut ak i tada se veba nastavlja. To postaje sada spontano, ali se nastavlja.
To se nikada ne zaustavlja. Ne moe, jer cilj i poetak nisu dve stvari. Ako je drvo u semenu,
onda na drvetu e ponovo doi seme.
Neko je pitao Buddhu - jedan od njegovih uenika, Purnakashyapa - pitao je: "Mi
znamo, bhante, da vi jo sledite odreenu disciplinu."
Buda, jo sledi izvesnu disciplinu. On se kree na odreen nain, on sedi na odreen
nain, on ostaje budan, on jede odreene stvari, on se ponaa, sve izgleda da je
disciplinovano.
Stoga Purnakashyapa kae: "Vi ste postali prosvetljeni, ali mi oseamo da vi jo imate
odreenu disciplinu." Buddha je odgovorio: "To je postalo tako ukorenjeno da sada ne sledim
to, to sledi mene. To je postalo senka. Ne treba da mislim o tome. To je tu, uvek tu. To je
postalo senka."

Kraj prve knjige komentara o Patanjalijevim Joga sutrama

113

Osho
YOGA: ALFA I OMEGA
Knjiga 2
Poglavlje 1

ZNAENJE SAMADHIJA
Izlaganje 1. januara 1975. u Buddha dvorani.
I, 17:

vitarkavicarananadasmitarupanugamatsamprajnatah.
Kada proizlazi iz Razlikovanja, Razgonetnutosti, Uitka ili Oseanja
samodovoljnosti [usredsreenost, (samadhi)] je [jo uvek po karakteru]
opojmljavajua (samprajnata).
I, 18:

viramapratyayabhyasapurvah samskaraeo 'nyah.


Nakon to se vebanjem dostigne stanje zaustavljenosti [bilo kakvih] poticaja
[spolja] (viramapratyaya) [i samo] ranije oformljene predisponiranosti (samskara) ostaju
[ta usredsreenost predstavlja onu] drugu [vrstu koja nije spoznavajua
(asamprajnata)].
I, 19:

bhavapratyayo videhaprakrtilayanam.
Roenjem je dat [asamprajnatasamadhi] onih neinkarniranih (videha) i onih
[ije su se pojedinane forme] u pramateriji (prakrti) apsorbovale.
I, 20:

raddhaviryasmrtisamadhiprajnapurvaka itaream.
Inae [da bi se na drugi nain stiglo do asamprajnatasamadhija potrebno je da]
prethodi [itav niz posredujuih uslova:] predanost, energinost, pribranost,
koncentrisanost i mo jasnog razaznavanja.
Patanjali je najvei naunik unutarnjeg. Njegov pristup je pristup naunog uma; on
nije pesnik. I na taj nain on je vrlo redak, jer oni koji ulaze u unutranji svet skoro uvek su
pesnici, a oni koji ulaze u spoljanji svet skoro su uvek naunici.
Patanjali je redak cvet. On ima nauni um, ali njegovo putovanje je unutranje. Zbog
toga je postao prva i zadnja re; on je alfa i omega. Za pet hiljada godina niko nije mogao da
ga nadmai. Izgleda da je on nenadmaan. On e ostati zadnja re - jer samota kombinacija je
nemogua. Da se ima nauno dranje i da se ue u unutranje, skoro je nemogua
verovatnoa. On govori kao matematiar, kao logiar. On govori kao Aristotel i on je
Heraklit.
Pokuajte da razumete svaku njegovu re. To e biti teko jer njegovi termini e biti
izrazi iz logike, rezonovanja, ali njegov nagovetaj je ka ljubavi, prema ekstazi, ka Bogu.
Njegovi struni izrazi su terminologija oveka koji radi u naunoj laboratoriji, inae njegova
laboratorija je u unutranjem biu. Stoga ne budite zavedeni njegovom terminologijom, i
sauvajte oseanje da je on matematiar najvie poezije. On je neobian, ali nikada ne koristi
neobian jezik. On to ne moe. Dri se vrlo vrste logine pozadine ili podloge. Analizira,
secira, ali njegov cilj je sintetizovanje. On analizira samo da bi nainio sintezu.
114

Dakle, uvek imajte na umu cilj - ne budite zavedeni putem - dostignite krajnji cilj kroz
nauni pristup. Zato je Patanjali impresionirao tako mnogo zapadni um. Patanjali je uvek
bio uticajan. Gde god je njegovo ime stiglo, on je vrio uticaj jer ga lako moete razumeti; ali
nije dovoljno razumeti ga. Razumeti njega isto je tako lako kao razumeti Ajntajna. On govori
intelektu, ali njegov cilj, njegova meta je srce. Ovo treba da zapamtite.
Kretaemo se po opasnom terenu. Ako zaboravite da je on takoe pesnik, biete
zavedeni. Onda postajete previe vezani uz njegovu terminologiju, jezik, rezonovanje, i
zaboravite njegov cilj. On trai od vas da odete izvan miljenja, rasuivanja, ali kroz
zakljuivanje. To je mogunost. Moete iscrpeti miljenje tako potpuno da transcendirate.
Idite kroz rasuivanje, ne izbegavajte ga. Koristite razum kao korak da odete izvan njega.
Sluajte sada njegove rei. Svaka re treba da bude analizirana.
Samprajnata samadhi je samadhi koji je praen rasuivanjem, razmiljanjem,
blaenstvom i oseajem istog bivanja.
On deli samadhi, izvorno, u dva koraka. Izvorno to ne moe biti podeljeno. To je
nedeljivo i zapravo, nema koraka. Meutim, da bi pomogao umu, tragaocu, on to deli u dva.
Prvi korak naziva samprajnata samadhi - samadhi u kome je um sauvan u svojoj istoti.
Prvi korak: um mora da bude profinjen i proien. Vi ga jednostavno ne moete
ostaviti, Patanjali kae - nemogue ga je izostaviti jer neistoe imaju tendenciju da
prijanjaju. Moete ga ostaviti samo kada je um apsolutno ist - tako profinjen, tako suptilan,
da nema tendenciju da se lepi.
On ne kae "Odbaci um", kao to kae Zen uitelj. On kae da je to nemogue;
govorite besmislicu. Vi kaete istinu, ali to nije mogue jer neist um ima breme. On pada kao
kamen. A neist um ima elje, milione elja, neispunjenih, eznue da budu ispunjene, traie
da budu ispunjene, milioni nesavrenih misli su u njemu. Kako to moete odbaciti? Jer
nesavreno uvek pokuava da bude upotpunjeno, usavreno.
Zapamtite, kae Patanjali, moete ostaviti stvar samo kada je dovrena. Jeste li
zapazili? Ako ste slikar i slikate, dok se slikanje ne dovri, vi ga ne moete zaboraviti. Ono se
produava, spopada vas. Ne moete spavati dobro; ono je tu. U umu ono struji skriveno ispod
povrine. Ono se kree, trai da bude dovreno. Ne moete na to zaboraviti. Um ima tenju ka
dovravanju. Um je perfekcionista, tako da sve to je nedovreno jeste napetost, pritisak za
um. Patanjali kae da ne moete ostaviti razmiljanje dok ono ne postane tako savreno da
nema vie nita da se ini s njim. Jednostavno ga moete ostaviti i zaboraviti.
Ovo je sasvim dijametralno suprotan put od Zena, od Heraklita. Prvi samadhi, koji je
samadhi samo zbog imena, jeste samprajnata - samadhi sa fino proienim umom. Drugi
samadhi je asampajnata - samahi bez uma. Inae Patanjali kae da kada um iezne, onda,
takoe nema misli, onda se isto tako, suptilno seme iz prolosti zadrava u nesvesnom.
Svesni um je podeljen na dva dela. Prvi, samprajnata - um sa proienim stanjem,
upravo kao proieni maslac. On ima svoju sopstvenu lepotu, ali je tu. A koliko god lep, um
je odvratan. Ma koliko ist i smiren, sam fenomen uma je neist. Vi ne moete proistiti
otrov. On ostaje otrov. Nasuprot tome, to ga vie proiavate, postaje mnogo otrovniji. On
moe izgledati vrlo, vrlo lepo. Moe imati svoju vlastitu boju, prelive, ali jo je neist.
Prvo proistite; onda ostavite. Ali onda se putovanje ne zavrava, jer sve je ovo u
svesnom umu. ta ete initi sa nesvesnim? Upravo iza slojeva svesnog uma jeste irok
kontinent nesvesnog. Tamo u nesvesnom ima semena iz svih vaih prolih ivota.
Onda Patanjali deli nesvesno na dva dela. On kae sabija (sabia), samadhi kada je
nesvesno tu, a um je ostavljen svesno, to je samadhi sa semenom - sabija. A kada je ovo seme
takoe spaljeno, onda postiete savreni - nirbija (nirbia) samadhi; samadhi bez semena.
Dakle svesno u dva koraka, onda nesvesno u dva koraka. A kada je nirbia samadhi,
krajnja ekstaza bez ikakvog semena unutar vas da klija, cveta i da vas vodi na dalja putovanja
u egzistenciji onda vi iezavate.
U ovim sutrama on kae:
115

Samprajnata samadhi je samadhi koji je praen rasuivanjem, razmiljanjem,


blaenstvom i oseajem istog bivanja.
Meutim, ovo je prvi korak; mnogi su zavedeni - oni misle ovo je zadnji korak zato
to je tako ist i oseate se tako blaenim i tako srenim da mislite da sada nema vie niega
da se postigne. Ako pitate Patanjalija, on e rei satori iz Zena je samo prvi samadhi. To nije
najvee, krajnje; krajnje je jo daleko.
Rei koje on koristi ne mogu se tano prevesti jer sanskrit je najsavreniji jezik;
nijedan jezik nije ni priblian kao on. Tako da u morati da vam ih objasnim. Koriena je re
vitarka; na engleskom je prevedena kao miljenje, zakljuivanje. To je nezadovoljavajui
prevod. Vitarka se mora razumeti. Tarka znai logiko zakljuivanje; onda Patanjali kae da
postoje tri tipa logike. Jedan (tip) on naziva kutarka - miljenje orijentisano prema
negativnom; uvek mislei u terminima poricanja (ne), osporavanja, sumnje, nihilizma.
Bilo ta da kaete, ovek koji ivi u kutarki - negativnoj logici - uvek misli kako da to
ospori. On se uvek ali, guna. On uvek osea da je negde neto pogreno - vazda ga ne
moete postaviti pravino, dobro, jer je takva njegova orijentacija. Ako mu kaete da
posmatra sunce, on nee gledati sunce. On e videti suneve pege, nai e uvek tamniju stranu
stvari; to je kutarka. To je kutarka - pogreno razmiljanje - ali izgleda kao rasuivanje.
To vodi na kraju do ateizma. Onda poriete Boga, jer ako ne moete videti svetlije
strane ivota, kako moete videti Boga? Vi jednostavno poriete. Onda itava egzistencija
postaje tamna. Onda je sve greno, i oko sebe moete stvoriti pakao. Ako je sve pogreno,
kako moete biti sreni? A to je vaa kreacija, i moete uvek nai neto pogreno, jer ivot se
sastoji od dualnosti.
U ruinom bunu ima lepih cvetova, ali i trnja takoe. ovek kutarke e uvek ceniti
trnje, a onda e doi do saznanja da ova rua mora biti zasnovana na obmani; ona ne moe
postojati. Opkoljena s toliko mnogo trnja, milionima trnja, kako moe rua postojati? To je
nemogue, porie se suta mogunost. Neko obmanjuje.
Mula Nasrudin je bio vrlo, vrlo tuan. Otiao je kod svetenika i rekao "ta da radim?
Moja etva je opet unitena. Nema kie." Svetenik je odgovorio, "Ne budi tako tuan
Nasrudine. Gledaj svetliju stranu ivota. Moe biti srean jer jo ima mnogo. Uvek veruj u
Boga koji je snabdeva. On ak snabdeva ptice u vazduhu, stoga zato si zabrinut?" Nasrudin
je rekao, "Da!" vrlo gorko, "Od mog ita! Bog snabdeva ptice u vazduhu mojim itom."
On ne moe videti poentu. Njegova etva je unitena od tih ptica, a Bog ih snabdeva
"a moja etva je unitena." Ova vrsta uma e uvek nai neto i uvek e biti napeta.
Nespokojstvo e ga uvek slediti kao senka. Ovo Patanjali zove kutarka - negativna logika,
negativno razmiljanje.
Onda postoji tarka - jednostavno razmiljanje. Jednostavno rezonovanje ne vodi
nigde. To je kretanje u krugu jer nema cilja. Moete nastaviti da razmiljate i razmiljate i
razmiljate, ali neete doi do nikakvog zakljuka jer rezonovanje moe doi do zakljuka
samo kada od samog poetka postoji cilj. Vi se kreete u (odreenom) pravcu, onda stiete
negde. Ako se kreete u svim pravcima - ponekad prema jugu, ponekad prema istoku,
ponekad prema zapadu - gubite energiju.
Razmiljanje bez cilja se naziva tarka; razmiljanje sa negativnim dranjem se naziva
kutarka; razmiljanje sa pozitivnim uzemljenjem se naziva vitarka. Vitarka oznaava
specijalno razmiljanje. Dakle, vitarka je prvi elemenat samprajnata samadhia. ovek koji
eli da dopre do unutranjeg mira mora da bude treniran u vitarki - posebnom razmiljanju.
On uvek gleda svetliju stranu, pozitivnu. On ceni cvetove, a zaboravlja trnove - ne da ne
postoji trnje, ali on se ne bavi njima. Ako volite cvee i cenite cvee, dolazi momenat kada ne
moete verovati u trnje, jer kako je to mogue kada postoje tako lepi cvetovi, kako trnje moe
postojati? Neto mora biti varljivo.
ovek kutarke ceni trnje; onda cvetovi postaju varljivi. ovek vitarke ceni cvetove;
onda trnje postaje iluzorno. Zbog toga Patanjali kae: vitarka je prvi elemenat. Samo onda je
mogue blaenstvo. Kroz vitarku ovek dospeva u boansko. ovek svuda oko sebe kreira
svoj vlastiti raj.
116

O vaem gleditu se radi. ta god da naete oko sebe jeste vaa sopstvena tvorevina nebo ili pakao. A Patanjali kae da moete ii izvan logike i umovanja samo kroz pozitivno
miljenje. Kroz negativno nikada ne moete otii izvan, jer to vie govorite ne, vie nalazite
stvari da bi se iskazalo - ne, odricanje. Onda, uskoro, unutra postajete konstantno negativni mrana no, samo trnje i nikakvi cvetovi u vama ne mogu procvetati - pustinja
Kada govorite 'da', nalazite vie i vie stvari za koje bi se reklo 'da'. Kada govorite 'da',
postajete zagovornik 'da'. ivot je potvren, a vi apsorbujete kroz svoje 'da' sve to je dobro,
lepo, sve to je istinito. 'Da' postaje kapija u vama za ulazak boanskog; 'ne' postaje zatvorena
kapija. Ako je zatvorena kapija, vi ste pakao; a otvorena vrata, sve kapije otvorene,
egzistencija buja u vama. Vi ste svei, mladi, ivahni; vi postajete cvet.
Vitarka, viara, ananda: Patanjali kae ako ste usklaeni sa vitarkom - pozitivnim
miljenjem - onda moete biti mislilac, nikada pre toga. Onda razmiljanje nastaje. On ima
sasvim razliito znaenje za miljenje. Vi takoe mislite da mislite. Patanjali se nee
saglasiti. On kae da vi imate misli, ali ne razmiljanje. Zbog toga kaem da je njega teko
protumaiti.
On kae da vi imate misli, lutajue misli sline gomili, ali ne razmiljanje. Izmeu vas
i misli ne postoji unutranji tok (unutranje kretanje). One su iupane stvari; ne postoji
unutranje planiranje. Vae miljenje je haos, ono nema unutranju disciplinu. To je upravo
kao to vidite brojanice. Postoje zrna; njih zajedno dri nevidljivi konac to ide kroz njih.
Misli su zrna; miljenje je konac. Vi imate zrnca - previe, zapravo vie nego to vam treba ali ne postoji unutranji spoj konca kroz njih. Taj unutranji konac, spoj, Patanjali je nazvao
miljenjem - viara. Vi imate misli, ali ne miljenje. Ako se to nastavi dalje i dalje, vi ete
postati ludi. Lud ovek je onaj koji ima milione misli, a nema miljenje, a samprajnata
samadhi je stanje u kome nema misli, ali je miljenje savreno. Ovu odliku treba razumeti.
Vae misli, pre svega, nisu vae. Vi ste ih sakupili. Upravo u mranoj sobi, (kada)
ponekad zrak svetla prodre kroz tavanicu vi ugledate milione estica praine kako plove u
zraku. Kada pogledam u vas, vidim istu pojavu; milione estica praine. Vi ih nazivate
mislima. One se kreu u vama i van vas. Iz ovekove glave one ulaze u drugu, a onda idu
dalje. One imaju svoj vlastiti ivot.
Misao je stvar; ima svoju vlastitu egzistenciju. Kada osoba umre, sve njene lude misli
odmah se oslobode i zaponu da trae okrilje negde ili drugde. Odmah ulaze u one koji su
okolo. One su kao klice, imaju svoj vlastiti ivot. ak i kada ste ivi, nastavljate da izbacujete
svoje misli svuda oko sebe. Kada razgovarate, onda naravno, ubacujete svoje misli u druge.
Ali kada ste tihi, onda takoe izbacujete svoje misli svuda okolo. Prva stvar je da one nisu
vae.
ovek sa pozitivnim miljenjem napustie sve misli koje nisu njegove sopstvene. One
nisu autentine; on ih nije naao kroz svoje vlastito iskustvo. On ih je akumulirao od drugih;
pozajmio. One su neiste. Bile su u mnogim rukama i glavama. Razuman ovek nee
pozajmljivati. On e eleti da ima svoje vlastite nove snane misli. Ako ste pozitivni i ako
pazite na lepotu, na istinu, na cvee, ako postanete sposobni da vidite u najtamnijoj noi da se
jutro pribliava, postaete sposobni za razmiljanje.
Onda moete stvoriti svoje vlastite misli. Misao koju ste vi stvorili zaista je potencijal;
ona ima svoju vlastitu snagu. One misli koje pozajmite gotovo su mrtve jer su one putovale putovale milionima godina. Njihovo ishodite je izgubljeno; izgubile su svaki kontakt sa
svojim izvorom. One su upravo kao praina koja lebdi okolo. Moete ih uhvatiti. Ponekada ih
ak postanete svesni, ali zato to je vaa svest takva da ne moe videti kroz stvari
Ponekad, vi sedite. Iznenada postanete neveseli bez ikakvog razloga. Ne moete nai
razlog. Gledate okolo; nema niega, nita se nije dogodilo. Vi ste isti, a iznenada tuga nastupi.
Misao prolazi; vi ste joj upravo na putu. To je jedna sluajnost. Misao je prolazila kao oblak turobna, od nekoga otputena misao. To je jedna nesrea. Vi ste epani. Ponekad misao
uporno ostaje. Ne znate zato nastavljate da mislite o tome. Ona izgleda apsurdna; izgleda da
je neupotrebljiva. Ali ne moete uiniti nita. Ona nastavlja da kuca na kapiju. Kae: "Misli
me". Misao eka na vratima kucajui. Ona kae: "Daj mi prostor. Ja bih elela da uem
unutra."
117

Svaka misao ima svoj vlastiti ivot. Ona se kree. I ima mnogo snage, a vi ste tako
nemoni jer ste tako nesvesni, tako da ste pokretani mislima. itav va ivot se sastoji od
takvih sluajeva. Sretnete ljude i itav va ivotni obrazac se menja. Ponekad ue u vas. Onda
postanete zaposednuti, i zaboravite gde ste poli. Menjate svoj smer; sledite ovu misao. A to
je samojedna sluajnost. Vi ste kao deca.
Patanjali kae da to nije razmiljanje. To je stanje odsustva miljenja; to nije
miljenje. Vi ste zakreni. Nemate centar u sebi koji moe misliti. Kada se ovek kree u
disciplini vitarke, ispravnog rasuivanja, onda postaje ubrzo sposoban za razmiljanje.
Miljenje je sposobnost; misli nisu. Misli mogu biti nauene od drugih; razmiljanje nikada.
Razmiljanje treba da nauite sami.
Ovo je razlika izmeu indijskih kola za uenje i modernih univerziteta; na modernim
univerzitetima vi dobijate misli; a u drevnim kolama za uenje, kolama mudrosti, oni su
uili razmiljanje, ne misli.
Razmiljanje je kvalitet vaeg unutranjeg bia. ta razmiljanje znai? To znai da
zadrite svoju svesnost, da ostanete budni i svesni, da se suoite s problemom. Problem je
prisutan; vi istupite pred njega sa svojom totalnom svesnou. Onda se javlja reenje odgovor. To je razmiljanje. Pitanje je postavljeno; vi imate gotov odgovor. Pre nego to ste i
razmiljali o tome, odgovor dolazi. Neko pita: "Ima li Boga?" A ak i pre nego to je on to
izgovorio vi kaete, "Da." Vi klimnete svojom drvenom glavom; kaete: "Da, postoji."
Da li je to vaa misao? Jeste li istinski mislili o problemu sada, ili nosite gotov
odgovor u svom pamenju? Neko vam ga je dao - vai roditelji, vai uitelji, vae drutvo.
Neko vam ga je dao, i nosite ga kao dragoceno blago, a ovaj odgovor je doao iz tog
pamenja.
ovek miljenja koristi svoju svest svaki put kada ima problem. Nanovo, on koristi
svoju svest. Susree se s problemom, a onda se u njemu javlja misao koja nije deo pamenja.
Ovo je razlika. ovek misli je ovek seanja ili pamenja; on nema sposobnost razmiljanja.
Ako mu postavite novo pitanje, on e biti izgubljen. On ne moe odgovoriti. Ako mu
postavite pitanje na koje zna odgovor, odmah e odgovoriti. Ovo je razlika izmeu pundita30 i
oveka koji zna; oveka koji moe misliti.
Patanjali kae - ispravno rasuivanje vodi do razmiljanja - viara. Razmiljanje viara, vodi do blaenstva. Ovo je odsjaj, naravno, a to je letimino sagledavanje. To e doi i
bie izgubljeno. Ne moete to zadrati za dugo. To je bio samo odsjaj, kao to se za trenutak
pojavi munja i vidite da je sva tama iezla. Ali opet tama je prisutna - kao da su iezli oblaci
i vi ste za sekundu ugledali mesec - pa su opet oblaci tu.
Ili, u sunanom jutru, pokraj Himalaja, za trenutak moete letimino ugledati
Gourishankar - najvii vrh. Onda ima izmaglice, a onda ima oblaka, i vrh se izgubi. To je
satori. Stoga nikada ne pokuavajte da prevedete satori kao samadhi. Satori je svetlucanje,
letimino sagledavanje. Mnogo ima da se radi nakon to se on postigne. Zapravo, pravi rad
zapoinje posle prvog satoria, prvog svetlucanja, jer ste okusili beskonano. Sada pravo
istinsko traganje zapoinje. Pre toga, bilo je i ovako i onako, bez poleta, jer niste bili stvarno
samouvereni, sigurni, ta radite, kuda idete, ta se deava.
Pre toga, to je bila vera, poverenje. Pre toga uitelj je bio potreban da vam pokae, da
vas opet i opet vraa natrag. Ali nakon to se satori dogodio, sada to vie nije vera. To je
postalo saznanje, hotimino. Sada vera nije neki napor. Sada verujete jer vam je vae vlastito
iskustvo pokazalo. Posle prvog letiminog sagledavanja, posle odsjaja, pravo traganje
zapoinje. Pre ste samo ili okolo i okolo. Pravilno rasuivanje vodi do ispravnog
razmiljanja, pravilno razmiljanje vodi do stanja blaenstva, a ovo stanje blaenstva vodi do
opaanja i razumevanja istog bivanja.
Negativan um je uvek egoista. To je neisto stanje bivanja. Vi oseate ja, ali oseate
ja radi pogrenih razloga. Samo motrite, nadzirete. Ego se hrani ili napaja na ne. Kad god
kaete ne, ego se pojavljuje. Kad god kaete da, ego ne moe da se javi jer egu treba borba,
egu treba izazov, egu treba da stavi sebe protiv nekoga, neega. On ne moe da postoji sam,
30

Bramanski uenjaci i svetenici u Indiji koji su napamet nauili svete spise i rukovode obredima.
118

njemu je neophodna dualnost. Egoista je uvek u potrazi za borbom - sa nekim, sa neim, sa


nekom situacijom. On uvek pokuava da nae neto da kae ne - da bi nadvladao, da bude
pobedonosan.
Ego je nasilan, a ne je najlukavije nasilje. Kada kaete ne za obine stvari, ak i
tamo se ego javlja. Malo dete kae majci: "Mogu li ii van da se igram?" a ona odgovara
"Ne". Ne. Nita skoro nije obuhvaeno, meutim kada majka kae "ne!" ona osea da je neko.
Kada odete na elezniku stanicu i zatraite kartu, a slubenik vas jednostavno i ne pogleda.
On se pravi da radi ak i ako nema posla. Time on govori, "ne! ekaj!" On osea da je neko,
vana linost. Zbog toga, svuda na alterima uete ne. Da je retko, vrlo retko. Jedan
obian slubenik moe rei ne svakome, ko god da ste vi. On se osea uticajnim.
Ne vam daje oseaj snage - zapamtite to. Ako nije apsolutno nuno, nikada nemojte
rei ne. ak i ako je bezuslovno potrebno, kaite to na takav afirmativan nain da se ego ne
pojavi. Moete tako rei. ak i ne moe da se kae na takav nain da izgleda kao da.
Moete rei da na takav nain da izgleda kao ne. To zavisi od tona; zavisi od dranja; to
zavisi od gestikulisanja.
Zapamtite ovo tragaoci: treba uvek da se seate da konstantno ivite sa aromom da.
To je ono to ini oveka od vere; on kae da. ak i kada je ne potrebno, on kae da. On
ne vidi da postoji bilo kakav antagonizam u ivotu. On potvruje, svedoi. On govori da
svom telu, on kae da svom umu, on kazuje da svakome; on govori da celoj egzistenciji.
Maksimalni procvat se deava kada bez uslova kaete kategorino da. Neoekivano ego
pada; on ne moe opstati. Njemu treba dra ne. Negativno stanovite kreira ego. Ako je
dranje pozitivno - ego otpada, a onda je bie, ili bivanje isto.
Sanskritska re za ja - ahamkara i asmita. Teko je to prevesti. Ahamkara31 je
pogrean oseaj o ja koji dolazi iz izgovaranja ne. Asmita je ispravan smisao ja koji
dolazi iz izgovaranja da. Oboje su "ja". Jedno je neisto; ne je neistoa. Vi negirate,
unitavate. Ne je destruktivno, vrlo suptilna destrukcija. Nikada ga ne koristite. Izostavljate
ga koliko je god mogue. Kad god ste budni, ne koristite ga. Pokuajte da naete zaobilazan
put. ak i kad morate da ga izgovorite, kaite na takav nain da ima izgled da. Uskoro ete
postati prilagoeni, usklaeni, i osetiete istotu kako vam dolazi kroz da.
Onda asmita; asmita je bezlini ego. Nema oseanja ja prema nikome (protiv
nikoga). Samo oseate sebe bez postavljanja protiv ikoga. Samo oseate svoju totalnu
usamljenost, a totalna usamljenost je najistije od (svih) stanja. Ja jesam - kada kaemo ja
je ahamkara; jesam je asmita, samo oseanje Sebstva bez ja u njemu, samo oseanje
egzistencije, postojanje u 'da' je lepo, 'ne' je runo.
U asamprajnata samadhiju prestaju sve mentalne aktivnosti, a um jedino zadrava
nemanifestovane utiske.
Samprajnata samadhi je prvi korak. Ispravno miljenje, ispravno umovanje, stanje
blaenstva, letimino sagledavanje, svetlucanje blaenstva, i oseanje jesam-stva - ista
jednostavna egzistencija bez ikakvog ega u sebi - ovo vodi do asamprajnata samadhia. Prvi
je istota; drugi je iezavanje, jer ak i najistije je neisto poto je tu. 'Ja' je pogreno,
'jesam' je takoe nepodesno - vie nego 'ja', ali vea je mogunost prisutna kada takoe
iezne 'jesam' - ne samo ahamkara, ve i asmita. Vi ste neisti, onda postajete isti. Ali ako
zaponete oseati "ja sam ist" (u nameri da proistite sebe), istoa sama postaje neistoa.
To takoe mora da iezne.
Iezavanje neistoe takoe je samprajnata. Iezavanje istoe takoe, jeste
asamprajmnata. Postoji prestajanje sve mentalne aktivnosti. Misli iezavaju u prvom stanju.
U drugom stanju takoe iezava miljenje. Trnje iezava u prvom stanju. U drugom stanju,
cvetovi takoe iezavaju. Kada 'ne' iezne u prvom stanju, ostaje 'da'. U drugom stanju 'da'
takoe iezava jer 'da' je takoe povezano sa 'ne'. Kako moete zadrati 'da' bez 'ne'? Oni su
zajedno; ne moete ih odvojiti. Ako 'ne' iezne, kako moete rei 'da'? Duboko ispod 'da'
31

Aham znai ja sam a kara znai inilac, to zajedno daje ja sam inilac, iluziju da smo posebne individue
koje neto ine svojom voljom. To je osnova ega.
119

kazuje ne za 'ne'. Negacija negacije - inae suptilno ne postoji. Kada kaete 'da', ta radite? Vi
ne kaete 'ne', ali 'ne' je unutra. Vi ga ne iznosite napolje; ono je nemanifestovano.
Vae 'da' ne moe znaiti nita ako nemate 'ne' unutar sebe. ta e to znaiti? To e
biti bez znaenja. 'Da' ima znaenje samo zbog 'ne'; 'ne' ima znaenje samo radi 'da'. Oni su
dualitet. U samprajnata samadhiju, 'ne' je izostavljeno; sve to je pogreno jeste ostavljeno. U
asamprajnata samadhiju, 'da' je izostavljeno. Sve to je ispravno, sve to je dobro, to je
takoe ostavljeno. U samprajnata samadhiju vi odbacujete avola; u asamprajnata samadhiju
vi ostavljate Boga takoe, jer kako Bog moe postojati bez avola? Oni su dva aspekta istog
novia.
Sva aktivnost prestaje. 'Da' je takoe jedna aktivnost, a aktivnost je naprezanje. Neto
se odvija, ak i lepo, ali se jo neto deava. Posle izvesnog vremena ak i lepo postaje
odvratno. Posle odreenog razdoblja vama je takoe dosadno ak i sa cveem. Posle (nekog)
perioda vremena, aktivnost, ak i vrlo suptilna i ista, stvara vam naprezanje; ona postaje
neko nespokojstvo, neka briga ili nemir.
U asamprajnata samadhiju prestaju sve mentalne aktivnosti, a um jedino zadrava
nemanifestovane utiske.
Ali ipak, to nije cilj - jer ta e se dogoditi svim vaim utiscima koje ste sakupili u
prolosti? Mnogo, mnogo ivota koje ste iveli, dejstvovali, reagovati. Uinili ste mnoge
stvari, ponitili mnoge stvari. ta e se dogoditi s tim? Svesni um je postao ist; svesni um je
odbacio ak i aktivnost za istotom. Meutim, nesvesno je neizmerno, i tamo vi nosite svo
seme, nacrte. Oni su unutar vas.
Drvo je iezlo; vi ste sasvim isekli drvo. Ali semenke koje su pale, one lee u zemlji.
One e klijati kada njihova sezona nastupi. Vi ete imati drugi ivot, biete opet roeni.
Naravno, va kvalitet e sada biti drugaiji. Ali ete biti ponovo roeni jer ove semenke jo
nisu spaljene.
Odsekli ste ono to se manifestovalo. Lako je odsei sve to je u manifestaciji; lako je
odrezati svo drvee. Moete ui u batu i potpuno iupati celu livadu, svu travu; moete ubiti
sve. Meutim za dve sedmice trava e porasti ponovo, jer ono to se uinili odnosi se samo na
manifestovano. Seme koje lei u zemlji jo niste ni dotakli. To treba da se uradi u treem
stadijumu.
Asamprajnata samadhi je jo sabia - sa semenom. Postoje metode kako da se spali
ovo seme, kako da se stvori plamena vatra o kojoj je Heraklit govorio, kako da se stvori ova
vatra i spri nesvesno seme. Kada ono takoe iezne, onda je tlo apsolutno isto; nita se ne
moe pojaviti iz njega. Onda nema raanja, nema umiranja. Onda se svo okretanje zaustavlja
za vas, vi ste ispali iz obrtanja. Ispadanje iz drutva nee vam pomoi dok ne ispadnete iz
okretanja. Onda savreno ispadate. Buddha je savreno ispao; Mahavira, Patanjali savreno
su nestali. Oni nisu nestali iz ustanove drutva. Oni su ispali iz samog kruenja ivota i smrti.
To se deava samo kada je svo seme spreno. Konani je nirbia samadhi - bez semena.
U asamprajnata samadhiju prestaju sve mentalne aktivnosti, a um jedino zadrava
nemanifestovane impresije.
Videhe i prakrti-laye postiu asamprajna samadhi jer su prestali da identifikuju sebe
sa svojim telima u svojim prethodnim ivotima. Oni se ponovo raaju zato to je ostalo seme
elje.
ak i Buddha je roen. U njegovom prolom ivotu on je dostigao asamprajnata
samadhi, ali seme je bio tu prisutno. On je morao da doe jo jednom. ak i Mahavira je
roen - jednom - seme donosi i njega. Ali ovo e biti poslednji ivot. Posle asamprajnata
samadhia, samo jedan ivot je mogu. Ali onda kvalitet ivota e biti sasvim razliit, jer ovaj
ovek nee biti identifikovan sa telom. I ovaj ovek zaista nema nita da ini, jer aktivnost
120

uma je prestala. ta e on onda initi? Za ta je taj jedan ivot potreban? Upravo je morao da
dozvoli ovom semenu da bude manifestovano, i on e ostati svedok. Ovo je vatra.
Jedan ovek je doao i pljunuo Buddhu; bio je ljut. Buddha je obrisao svoje lice i
pitao: "ta jo ima da kae?" ovek nije mogao da razume. Bio je zaista ljut, usijan. Nije
mogao ni da razume ta je Buddha govorio. Cela stvar je bila tako apsurdna, jer Buddha nije
reagovao. ovek je bio izgubljen ne znajui ta da ini, ta da kae. Udaljio se; cele noi nije
mogao da spava. Kako moete spavati kada uvredite nekoga, a nema reakcije? Onda se vaa
uvreda vraa natrag vama. Vi ste bacili strelu, ona nije bila primljena. Ona se vraa natrag,
vraa se natrag izvoru ne nalazei utoite. On je uvredio Budu, ali uvreda nije mogla nai
utoite tamo. Dakle, gde e otii? Dolazi izvornom gazdi.
Cele noi je bio u groznici, nije mogao verovati ta se dogodilo. Onda je poeo da se
kaje, da je pogreio - da nije uradio dobro. Sledeeg jutra, rano je otiao kod Bude i zamolio
ga za oprotaj. Buddha je rekao: "Ne brini zbog toga. Mora da sam ti uradio neto pogreno u
prolosti. Sada je raun namiren. I ja neu reagovati. Inae opet i opet Zavreno je! Ja
nisam reagovao. Zato to je postojalo neko seme negde, to je moralo da se okona. Sada je
moj raun s vama namiren."
U ovom ivotu kada videha - ovek koji je shvatio da on nije telo, koji je dostigao
asamprajnata samadhi - dolazi u svet upravo da okona raune Ceo njegov ivot se sastoji
od okonavanja rauna; milioni ivota, mnogi uzajamni odnosi, mnoga uplitanja, mnoga dela
- sve mora da bude zatvoreno, poravnato.
Desilo se da je Buddha doao u selo. Okupilo se itavo selo; eljni su bili da ga uju.
Bila je to retka prilika. ak i glavni gradovi su pozivali neprekidno Budu, a on nije dolazio. A
doao je u ovo malo selo izvan puta - bez ikakvog poziva, jer metani nikada nisu mogli
skupiti hrabrost da ga pitaju da doe u njihovo selo - samomalo selo, nekoliko koliba, i on je
doao bez poziva. Celo selo plamti od uzbuenja, a on sedi ispod drveta i ne govori.
Oni su rekli: Koga ekate sada? Svi su ovde; celo selo je ovde. Zaponite." Buddha je
rekao: Ali moram ekati jer sam doao radi neke osobe koja nije ovde. Obeanje treba
ispuniti, raun se mora namiriti. ekam nju." Onda je dola devojka, i Buddha je zapoeo.
Onda, nakon to je govorio, oni su pitali: Jeste li ekali ovu devojku?"
Budui da je devojka pripadala nedodirljivima - najnioj kasti, niko nije ni pomislio da
je Buddha ekao nju. On je rekao: Da, ekao sam nju. Kada sam dolazio srela me je na putu i
rekla: ekaj me, jer ja idem radi nekog posla u drugi grad. Ali brzo u se vratiti. U prolim
ivotima negde sam joj obeao da u, kada postanem prosvetljen, doi i ispriati joj ta mi se
dogodilo. Taj raun je morao da se podmiri. To obeanje je visilo iznad mene, a da ga nisam
ispunio, morao bih ponovo da doem."
Videha ili prakriti-laya; obe rei su lepe. Videha znai bestelesan. Kada dostignete
asamprajnata samadhi telo je prisutno, ali vi postajete bestelesni. Vi vie niste telo. Telo
postaje prebivalite, vi niste identifikovani.
Dakle, ova dva izraza su lepa. Videha oznaava onoga koji zna da on nije telo - zna,
pamti, on nije vie prakrti - priroda.
Telo pripada materijalnom. Jednom kada niste identifikovani sa materijom u vama, vi
niste identifikovani sa materijom izvan, spolja. ovek koji dostigne to, vie nije telo, poto
nije vie manifestovan - nije prakrti - njegova priroda se istopila. Nema vie sveta za njega;
on nije identifikovan. On je postao svedok sveta. Takav ovek je takoe roen najmanje
jednom, jer je morao da izravna mnoge raune; mnoga obeanja da budu ispunjena, mnoge
karme da budu otputene.
Dogodilo se da je Budin roak Devadata bio protiv njega. Pokuavao je da ga ubije na
mnogo naina. Kada je Buddha sedeo ispod drveta meditirajui, on je gurnuo na njega veliku
stenu s brda. Dok je stena nailazila, svi su pobegli. Buddha je ostao da sedi ispod drveta. Bilo
je opasno, stena ga je samo dotakla, oeavi se o njega. Ananda ga je pitao, Zato niste
pobegli kada smo se mi razbeali? Bilo je dovoljno vremena."
Buda je rekao: Za vas ima dovoljno vremena. Moje vreme je isteklo. A Devadata je
morao to da uradi. Nekada u prolosti u nekom ivotu postojala je neka karma. Mora da sam
121

mu naneo neku bol, neku muku, neku brigu. To je moralo da se zakljui. Ako bih pobegao,
ako bih uinio neto, opet bi nov put zapoeo."
Videha, ovek koji je postigao asamprajnata, ne reaguje. On jednostavno posmatra,
svedoi. A to je vatra svedoenja koja pali svo seme u nesvesnom. Dolazi momenat kada je
tlo apsolutno isto. Ne postoji seme koje eka da proklija. Onda ne postoji potreba da se vraa
natrag. Prvo se priroda rastvara, a onda on rastvara sebe u univerzumu.
Videhe i prakrti-laye postiu asamprajnata samadhi jer su prestali da identifikuju sebe
sa svojim telima u svojim prethodnim ivotima. Oni se ponovo raaju zato to je ostalo seme
elje.
Ja sam ovde da ispunim neto, vi ste ovde da zatvorite, da okonate moj raun. Vi
niste ovde sluajno. Postoje milioni ljudi u svetu. Zato ste vi ovde, a ne neko drugi? Neto
mora da bude zatvoreno.
Drugi koji su dostigli asamprajnata samadhi, to postiu kroz veru, trud, seanje,
usredsreenost i razlikovanje.
Dakle, postoje dve mogunosti. Ako ste postigli asamprajnata samadhi u vaem
prolom ivotu, u ovom ivotu vi ste roeni Buddha - upravo nekoliko semenki koje treba da
budu ispunjene, koje treba da budu ostavljene, velikim delom sprene. Zbog toga ja kaem vi
ste roeni gotovo kao Buda. Nije vam potrebno nita da inite, jednostavno morate posmatrati
sve to se dogaa.
Otuda Krinamurtijevo neprekidno insistiranje da nije potrebno da se ini nita. Za
njega je to ispravno; ali to nije ispravno za njegove sluaoce. Njegovi sluaoci treba mnogo da
urade, i oni e biti zavedeni ovom tvrdnjom. On govori o sebi. On je roen kao asamprajnata
Buda. Roen je kao videha; roeni je prakrti-laya.
Kupao se kada je imao samo pet godina pokraj Adyara, i jedan od najveih teozofa,
Lidbiter, ga je zapazio. Bio je sasvim drugaiji tip deteta. Ako bi neko bacio blato na njega,
on ne bi reagovao. Mnoga deca su se igrala. Ako bi ga neko gurnuo u reku, on se jednostavno
nije opirao. Da, nije se ljutio, nije se borio. Bio je sasvim razliitog kvaliteta - kvaliteta jednog
asamprajnata Bude.
Lidbiter je pozvao Eni Besant da posmatra to dete. On nije bio obino dete i itav
teozofski pokret se vrteo oko njega. Oni su se veoma nadali da e postati jedan avatar - da e
postati savreni majstor za ovo doba. Ali problem je bio dubok. Izabrali su pravu osobu, ali
nade su im bile pogrene - jer ovek koji je roen asamprajnata Buddha ne moe ak ni biti
aktivan kao avatar. Jer sva aktivnost je prestala. On moe jednostavno posmatrati; moe biti
svedok. Ne moete ga uiniti mnogo aktivnim. On moe biti samo pasivan. Izabrali su
ispravnu osobu, ali i pored toga pogreno.
Mnogo su se nadali. Onda se ceo pokret okretao oko Krinamurtija. Onda ga je on
napustio, rekavi: Ne mogu initi nita jer nita nije potrebno," ceo pokret je pretrpeo potpun
neuspeh jer su se previe nadali u tog oveka, tada se cela stvar potpuno preokrenula. Ali to se
moglo prorei.
Eni Besant, Lidbiter i drugi, bili su vrlo, vrlo fine osobe, ali zaista nisu bili svesni
istonih metoda. Mnogo su uili iz knjiga, spisa, ali nisu znali tano tajnu koju je Patanjali
pokazao; kada se jedan asamprajna, videha, rodi, on nije aktivan. On je pasivan. Mnogo se
moe dogoditi kroz njega, ali se to moe samo dogoditi ako neko doe i preda se njemu. Zato
to je pasivan, ne moe vas prinuditi da uinite neto. On je dostupan, ali ne moe biti
agresivan. Njegov poziv je za svakoga i sve. To je jedan otvoreni poziv, ali vam ne moe
poslati poziv pojedinano, jer ne moe biti aktivan. On je jedna otvorena kapija; ako elite, vi
moete proi. Poslednji ivot je apsolutna pasivnost, upravo svedoenje. Ovo je nain kako su
asamprajna Bude roene iz svog prolog ivota.
Meutim, moete postati asamprajnata Buddha u ovom ivotu takoe. Za njih
Patanjali kae:
122

Shraddha virya smriti samadhi prajna: Drugi koji su dostigli asamprajnata samadhi,
to postiu kroz veru, trud, seanje, usredsreenost i razlikovanje.
Gotovo je nemogue prevesti ovo, stoga u vam radije objasniti nego prevoditi,
upravo da vam dam oseaj, jer rei e vas dovesti u zabludu.
Shraddha nije sasvim isto to i vera. To je vie kao poverenje. Poverenje je vrlo, vrlo
razliito od vere. Vera je neto u emu ste roeni; a poverenje je neto u emu vi rastete.
Hinduizam je vera; da se bude hrianin; da se bude musliman jeste vera. Ali da se bude
uenik ovde kod mene jeste poverenje. Ja ne mogu polagati pravo na veru - zapamtite. Isus
takoe nije mogao polagati pravo na veru, jer vera je neto u emu ste roeni. Jevreji su verni;
oni imaju veru. Zapravo, zbog toga su oni unitili Isusa jer su mislili da ih on odvodi van
njihove vere, da unitava njihovu veru.
On je traio poverenje. Poverenje je lina intimnost; to nije drutveni fenomen. Vi ga
dostiete kroz svoj vlastiti odziv. Niko ne moe biti roen sa poverenjem; u veri svakako da.
Vera je mrtvo poverenje; poverenje je iva vera. Stoga pokuajte da razumete razliku.
Shraddha - poverenje - ovek mora da izraste u njemu. A to je uvek lino. Prvi uenici
Isusa su postigli poverenje. Oni su bili Jevreji, roeni Jevreji. Oni su izali iz svoje vere. To je
pobuna. Vera je praznoverje; poverenje je pobuna. Poverenje vas prvo udaljava od vae vere.
To mora biti tako, jer ako ivite u naputenom groblju, onda morate prvo biti izvedeni iz
njega. Samo onda moete biti opet uvedeni u ivot. Isus je pokuao da vodi ljude prema
shradhi, prema poverenju. To je uvek izgledalo kao unitavanje njihove vere.
Sada kada hriani dou kod mene, situacija se opet ponavlja. Hrianstvo je vera, isto
kao to je judaizam bio vera u Isusovo vreme. Kada hrianin doe kod mene, opet ja moram
da ga izvedem iz njegove vlastite vere i da mu pomognem da raste prema poverenju. Religije
su vere, a da se bude religiozan mora se biti u poverenju. Da se bude religiozan ne znai da se
bude hrianin, hinduista ili musliman jer poverenje nema ime; ono nije imenovano. To je kao
ljubav. Da li je ljubav hrianska, hindu ili muslimanska? Brak je hrianski, hindu,
muslimanski. A ljubav? Ljubav ne zna za kaste, ne zna za razlike. Ljubav ne zna hinduse, ne
zna hriane.
Brak je kao vera; ljubav je kao poverenje. Morate da izrastete u njemu. To je jedna
avantura. Vera nije avantura. Vi ste roeni u njoj; ona je lagodna. Bolja je ako traite utehu i
udobnost; bolje je ostati u veri. Budite hinduista, budite hrianin; sledite pravila. Inae to e
ostati mrtva stvar dok ne odgovorite iz svog srca, dok ne uete u religiju na svoju vlastitu
odgovornost; ne da ste roeni kao hrianin. Kako se moete roditi kao hrianin? Kako je sa
roenjem spojena religija? Roenje vam ne moe dati religiju; to vam samo moe dati
drutvo, ispovedanje vere, sekta; to vam moe dati praznoverje. Re "praznoverje"
(superstition) je vrlo, vrlo znaajna. Njeno znaenje je "nepotrebna vera". Re "super" znai
nepotrebno, izlino - vera koja je postala nepotrebna, prazna, vera koja je postala mrtva;
nekada je moda bila iva. Religija mora da bude roena esto (opet i opet).
Zapamtite, vi niste roeni u religiji, religija mora biti roena u vama. Onda je to
poverenje. Opet i opet. Vi ne moete dati svojoj deci vau religiju. Oni e morati da trae i
nau svoju vlastitu. Svako mora da trai i nae svoju vlastitu. To je avantura - najvea
avantura. Vi se kreete u nepoznatom. Patanjali kae sraddha je prva stvar, ako elite da
postignete asamprajnata samadhi. Za samprajnata samadhi, razmiljanje je potrebno,
ispravno rezonovanje. Vidite li razliku? Za samprajnata samadhi, ispravno rasuivanje,
ispravno razmiljanje jeste osnova; za asamprajnata samadhi, pravo poverenje - a ne
rasuivanje.
Nerasuivanje je ljubav. A ljubav je slepa. Izgleda slepa prema rasuivanju, jer ona
skae u tamu. Razum pita: "Gde idete? Ostanite u poznatoj teritoriji. Kakva je korist da se
kreete prema novom fenomenu? Zato ne ostanete u starom omotu? To je prikladno, udobno
i ta god vam treba, to moe snabdeti." Inae svako mora nai svoj vlastiti hram. Samo onda
je on iv, svestan.
Vi ste ovde sa mnom. Ovo je poverenje. Kada ja vie nisam ovde, vaa deca mogu biti
sa mnom. To e biti vera. Poverenje se deava samo sa ivim uiteljem; vera sa mrtvim
123

uiteljima koji vie nisu ovde. Prvi uitelji imaju religiju. Druga, trea generacija ubrzo gubi
religiju, ona postaje sekta, vera. Onda je jednostavno sledite jer ste roeni u njoj. To je
dunost, nije ljubav. To je drutvena institucija. To pomae, ali to nije nita duboko u vama.
To vam ne donosi nita; to nije deavanje; to nije otvaranje dubine u vama. To je upravo
povrina, lice. Idite i pogledajte u crkvi. Nedeljom ljudi odlaze, ak se i mole. Ali ekaju,
kada e se to zavriti.
Mali deak je sedeo u crkvi. Doao je prvi put, ima samo etiri godine. Majka ga je
pitala: "Kako ti se svidelo?" On je odgovorio: "Muzika je dobra, ali reklame su previe duge."
To su reklame kada vi nemate poverenje. Shradha je ispravno poverenje; vera je pogreno
poverenje. Ne primajte religiju od nekog drugog. Vi je ne moete pozajmiti; to je obmana.
Dobijate je bez plaanja za nju, a sve treba da se plati. Nije jeftino dospeti do asamprajna
samadhia. Morate platiti punu cenu, a puna cena je vae celokupno bie.
Da se bude hrianin samo je "nalepnica"; da se bude religiozan nije "nalepnica". Celo
vae bie je ukljueno, to je obavezivanje. Ljudi mi dou i kau: "Mi vas volimo. ta god vi
kaete je dobro. Ali ne elimo da preuzmemo sannyas jer ne elimo da se obavezujemo."
Meutim, dok se ne obaveete, ukljuite, ne moete rasti, jer onda ne postoji uzajamni odnos.
Izmeu vas i mene onda ima rei, nema povezanosti. Onda ja mogu biti uitelj, ali vama
nisam majstor (guru). Onda vi moete biti uenik, ali ne pristalica, sledbenik.
Shradha, poverenje, prva su vrata, a druga su virya. Ovo je takoe teko. Prevedeno je
kao napor. Ne, napor je jednostavno deo toga. Re virya znai mnogo stvari, ali duboko
izvorno ona oznaava bioenergiju. Jedno od znaenja rei virya je sperma, seksualna mo.
Ako zaista elite da je prevedete tano, virya je bioenergija, vaa celovita energetska pojava vi kao energija. Naravno, ova energija moe biti privuena kroz trud; otuda, jedno od
znaenja je "napor".
Inae to je nedovoljno - nije tako bogato kao re virya. Virya znai da vaa itava
energija mora da bude uneta u to. Samo um nee biti dovoljan. Moete, iz uma moete rei
da, to nee biti dovoljno. Vaa totalnost, bez zadravanje iega u pozadini; to je znaenje
rei virya. A to je mogue samo kada postoji poverenje. Inae vi ete se drati neega, samo
da budete sigurni, bezbedni, jer, "Ovaj ovek moda vodi nekuda pogreno, stoga se moemo
povui svakog momenta. Svakog momenta moemo rei: Bez sumnje je dovoljno; sada ne
vie."
Zadrite deo sebe upravo da biste bili predostroni, gde taj ovek vodi. Ljudi mi dou
i kau: "Mi posmatramo. Pustite nas prvo da posmatramo ta se dogaa." Oni su vrlo bistri domiljate budale - jer ove stvari ne mogu biti posmatrane spolja. Ono to se deava
unutranji je fenomen. tavie, vi ne moete ni videti kome se to deava mnogo puta. Mnogo
puta samo ja mogu videti ta se deava. Vi samo docnije postajete svesni, ta se dogodilo.
Drugi ne mogu posmatrati. Ne postoji mogunost da se to posmatra spolja. Kako
moete posmatrati spolja? Pokrete moe videti; moete videti da ljudi rade meditaciju. Ali ta
se dogaa iznutra, to je meditacija. Ono to oni rade spolja, samo je stvaranje situacije.
To se dogodilo; postojao je vrlo veliki sufi majstor, Jalaludin. Imao je malu kolu
izuzetnih sledbenika, neobinih, jer je bio vrlo probirljiv ovek. On ne bi odobrio pristup
nikome dok on ne bude izabran. Radio je samo za malobrojne, ali ljudi su ponekad dolazili u
prolazu da vide ta se tamo deava. Dola je jedna grupa ljudi, bili su profesori. Oni su uvek
vrlo oprezni ljudi, vrlo bistri, i posmatrali su. U dvoritu majstorove kue sedela je grupa od
pedeset ljudi, izvodei ludake pokrete neki su se smejali, neki su plakali, neki su skakali.
Profesori su posmatrali.
Rekli su: ta se deava? Ovaj ovek ih vodi prema ludosti. Oni su ve ludi, budale su
- jer jednom kada poludite bie teko vratiti se natrag. A ovo je besmislica; nikada nismo
(ovako neto) uli. Kada ljudi meditiraju, oni sede smireno."
Meu njima se vodila velika rasprava. Grupa njih je rekla: "Zato to ne znamo ta se
deava, nije dobro donositi neki sud." Meu njima bila je i trea grupa koji su rekli: "ta god
da je to, vredno je uivanja. Voleli smo ovo da posmatramo. Lepo je. Zato ne bismo uivali u
tome? to bismo se brinuli ta oni rade. Lepa je stvar posmatrati ih."
124

Onda posle nekoliko meseci, ista grupa je opet dola u kolu da posmatra. ta je tada
dogaalo? Svi su bili smireni. Bilo je tu pedeset osoba, majstor je bio prisutan - sedeli su tiho,
tako smireno, kao da nije bilo nikoga, poput statua. Opet je dolo do rasprave. Bila je grupa
koja je rekla: "Oni su sada beskorisni. ta ima da se vidi? Nita! Kada smo prvi put dolazili
bilo je lepo. Uivali smo u tome. Sada su ba dosadni." Druga grupa je rekla "Mislimo da
sada meditiraju. Prvi put su jednostavno bili ludi. Ovo je prava stvar koju ine; ovako se radi
meditacija. O tome pie u spisima, opisana je na ovaj nain."
Meutim, postojala je jo trea grupa, koja kae: "Mi ne znamo nita o meditaciji.
Kako moemo suditi?"
Onda, posle nekoliko meseci grupa je opet dola. Sada nije bilo nikoga. Samo je
uitelj sedeo, smeei se. Svi sledbenici su iezli. Onda su oni pitali: "ta se deava? Kada
smo prvi put doli bila je luda gomila, mislili smo da je to beskorisno; da vi upravljate ludim
ljudima. Sledei put kada smo doli bilo je vrlo dobro. Ljudi su meditirali. Gde su svi otili?"
Majstor je rekao: "Posao je obavljen, sledbenici su iezli. Ja se smeim srean jer se
cela stvar dogodila. A vi ste budale, ja to znam! Ja sam takoe posmatrao - ne samo vi. Znam
koje su se rasprave vodile, i ta ste mislili prvi put i drugi put." Jalaludin je rekao: "Napor koji
ste uloili da doete ovde tri puta dovoljan je za vas da postanete meditanti. A rasprava koju
ste vodili, toliko energije je bilo dovoljno da vas uini smirenim. U istom periodu, ovi
sledbenici su iezli, a vi ste ostali na istom mestu. Uite, ne gledajte spolja" Oni su rekli:
"Da! Zbog toga mi dolazimo iznova, da posmatramo ta se dogaa. Kada smo sigurni, onda
Inae mi ne elimo da budemo obavezni."
Bistri ljudi nikada ne ele da budu obavezni, ali ima li ikakvog ivota bez
obavezivanja? Meutim bistri ljudi misle da je obavezivanje ropstvo. Inae postoji li sloboda
bez stege? Prvo morate da se kreete u (nekom) odnosu, u vezi, samo onda moete otii izvan
toga. Prvo treba da se kreete u dubokoj obaveznosti, od dubine do dubine, od srca do srca, i
samo onda moete to transcendirati. Nema drugog puta. Ako se samo kreete posmatrajui,
nikada neete ui u hram - hram je obavezivanje. A onda ne moe biti veze, ni odnosa.
Majstor i sledbenik su u odanom odnosu, u najvioj ljubavi koja je mogua. Dok
uzajamni odnos ne postoji, ne moete rasti. Patanjali kae: "Prvo je poverenje - shradha drugo je energija - napor." itava vaa energija treba da bude uvedena unutra, (njen) deo nee
delovati. Ako samo pristupite nepotpuno i ostanete van parcijalno, ona moe biti destruktivna,
jer e to postati "pukotina" u vama. To e u vama stvoriti napetost; to e postati pre
uznemirenost nego blaenstvo.
Blaenstvo je gde ste vi u svojoj celokupnosti; uznemirenost je gde vi niste potpuni,
jer onda ste podeljeni i postoji napetost, a dva dela idu odvojenim putevima.
"Drugi koji su dostigli asamprajnata samadhi, to postiu kroz veru, trud, seanje,
usredsreenost i razlikovanje."
Ova re priseanje je smrti: to je pamenje - ono ta Gurijev zove seanje sebe. To je
smrti. Vi se ne seate sebe. Moete se seati miliona stvari, ali neprekidno nastavljate
zaboravljati sebe, ta vi jeste. Gurijev je imao tehniku. Dobio ju je od Patanjalija. Zapravo,
sve tehnike su dole od Patanjalija. On je prvi majstor tehnika. Smrti je seanje ili pamenje
- svest o sebi pri svemu to inite. Hodate i seate se u dubini: "Ja hodam, ja jesam." Ne
budite izgubljeni u hodanju. Hodanje postoji - kretanje, aktivnost - i unutranji centar je tu,
upravo svestan, posmatra, svedoi.
Nije potrebno to da ponavljate u umu: "Ja hodam." Ako ponavljate, to nije seanje.
Morate biti neverbalno svesni toga: "Ja hodam, ja jedem, ja govorim, ja sluam." ta god da
inite ne treba unutra "Ja" da bude zaboravljeno; ono treba da ostane. To nije samosvest koja
je svest o svojoj linosti. Svest o svojoj linosti je ego, a svesnost o Sopstvu je asmita istota, upravo bivanje svesnim da "ja jesam".
Obino vaa svesnost je usmerena prema predmetu. Vi gledate u mene; itava vaa
svesnost se kree prema meni kao strela. Vi ste usmereni prema meni. Seanje na sebe znai
da imate duplo usmerenu strelu: jedna njena strana pokazuje prema meni, druga strana
pokazuje prema vama. Duplo usmerena strela je smrti - seanje sebe ili svest o sebi.
125

To je vrlo teko, jer lako je seati se objekta, a zaboraviti sebe samog. Suprotno je
takoe lako - seati se sebe, a zaboraviti objekat. Oboje su laki; zbog toga oni koji su na
trnici, u svetu, i oni koji su u manastiru, izvan sveta, jesu isti. Oboje su jednousmereni. Na
trgu oni gledaju u stvari, objekte. U manastiru, oni gledaju u sebe.
Smrti nije ni na trgu, ni u manastiru. Smrti je fenomen svesti o sebi kada su oboje, i
subjekat i objekat, zajedno u svesti. To je najtea stvar u svetu. Ako moete dospeti dotle
makar za jedan momenat, jedan odvojen trenutak, imaete odmah odbljesak satorija. Odmah
ete se premestiti iz tela, negde drugde.
Pokuajte to. Ali zapamtite, ako nemate poverenje to e postati napetost. Ovi problemi
su obuhvaeni. To e postati takva napetost da moete poludeti, jer to je vrlo napeto stanje.
Zbog toga teko je zapamtiti oba - objekat i subjekat, spoljanje i unutranje. Da se seamo
oba vrlo je, vrlo teko. Ako ima poverenja, to poverenje e smanjiti napetost, jer poverenje je
ljubav. To e vas umiriti; to e biti umirujua sila oko vas. Inae napetost moe postati tako
velika, da ne biste bili sposobni da spavate. Neete moi da budete na miru nijednog trenutka,
jer e to biti konstantan problem. Biete upravo neprekidno uznemireni.
Zbog toga moemo uini jedno, to je lako. Otii u manastir, zatvoriti oi, seati se
sebe, zaboraviti svet. Ali ta vi inite? Vi ste jednostavno obrnuli ceo proces, nita drugo.
Nema promene. Ili zaboravite ove manastire, hramove i ove majstore, i budite u svetu,
uivajte u svetu. To je takoe lako. Teka je stvar da se bude svestan oba. Kada ste svesni
oba, i energija je istovremeno svesna, usmerena u dijametralno suprotnim pravcima,
dimenzijama, postoji nadilaenje, transcendencija. Vi jednostavno postajete tree; postajete
svedok oba. A kada tree ue, prvo pokuajte da vidite objekat i sebe samog. Ali ako pokuate
da vidite oboje, ubrzo, uskoro, osetiete da se neto deava u vama - jer postajete tree, vi ste
izmeu dvoje, izmeu objekta i subjekta. Vi sada niste ni objekat ni subjekat.
Postignite to kroz veru, trud, seanje, usredsreenost i razlikovanje.
Shradha, poverenje, virya, apsolutna predanost, celokupna energija treba da budu
uneseni unutra, itav va potencijal treba da bude unet unutra. Ako ste stvarno tragalac za
istinom, vi ne moete traiti nita drugo. To je potpuna angaovanost. Ne moete nainiti to
sporednim poslom i da: Ponekad ujutru meditiram, a onda odlazim". Meditacija mora da
vam postane neprekidna dvadeset etiri asa. ta god da radite, meditacija neprekidno mora
da bude prisutna u pozadini. Energija e biti potrebna; itava vaa energija e biti potrebna.
A sada nekoliko stvari. Ako je potrebna itava vaa energija, seks automatski iezava
jer nemate energiju za gubljenje. Brahmacharya za Patanjalija nije disciplina, to je
posledica. Vi uloite svoju itavu energiju, stoga nemate nikakvu energiju za seks. To se
deava u obinom ivotu takoe. Moete videti velikog slikara; on potpuno zaboravlja svoju
enu. Kada slika u njegovom umu ne postoji seks, jer se kree itava energija. Nemate
nikakvu suvinu energiju.
Veliki pesnik, veliki peva, veliki plesa koji se kree potpuno u svojoj predanosti,
automatski biva u celibatu. On za to nema disciplinu. Seks je suvina energija, seks je
sigurnosni ventil. Kada ste previe u sebi i ne moete uiniti nita s tim, priroda je nainila
sigurnosni ventil ako je ne moete izbaciti. Morate je osloboditi, izbaciti, inae poludeete ili
izgoreti - eksplodirati. Ako pokuate da je suzbijete, onda ete takoe poludeti, jer
potiskivanje nee pomoi. To trai preobraaj, a preobraaj dolazi iz totalnog poverenja i
predanosti. Ratnik, ako je zaista ratnik, nepogreiv ratnik, bie iznad seksa. Njegova itava
energija se kree u drugom smeru.
Postoji vrlo lepa pria o velikom filozofu, misliocu, njegovo ime je Vaaspati... Toliko
je bio angaovanom u svom izuavanju da, kada ga je njegov otac pitao: Dakle, ja sam sve
stariji i ne znam kada u umreti - to se moe svakog asa dogoditi - a ti si mi sin jedinac, pa
bih eleo da se oeni", on je odgovorio: U redu." On nije uo ta je otac rekao. Tako se
oenio. Oenio se, ali je potpuno zaboravio da ima enu, toliko je bio angaovan.
Ovo se moe dogoditi samo u Indiji; ne moe se dogoditi nigde drugde. ena ga je
toliko volela da nije elela da mu smeta. Kae se da je prolo osam godina. Ona je sluila
njemu kao senka, starala se na svaki nain, ali mu nije smetala, niti je ikada kazala: Ja sam
ovde, a ta ti radi?" On je neprekidno pisao komentar - jedan od najveih koji je ikada
126

napisan. Pisao je komentar o Badarayaninim (Veda Vyasa) Brahma-sutrama i bio je toliko


angaovan, da ne samo da je zaboravio svoju enu, ve nije bio svestan ni ko mu donosi
hranu, ko odnosi posue, ko dolazi uvee i pali svetlo u lampi, ko priprema njegov krevet.
Prolo je dvanaest godina i nastupilo je vee kada je komentar zavren. Upravo ispred
pisanja poslednje rei, on se zavetovao, da kada komentar bude okonan on e postati
sanyasin. Onda se nee baviti umom, i sve je zavreno. Ovo je jedina karma koja treba da
bude okonana, ispunjena.
Te noi se malo opustio, jer zadnju reenicu je napisao oko ponoi, i po prvi put je
postao svestan svoje okoline. Lampa je slabo svetlela i trebalo joj je vie ulja. Lepa ruka je
nalivala ulje u nju. Pogledao je natrag da vidi ko je to. Nije mogao prepoznati lice, pa je pitao:
Ko si ti i ta radi ovde?" ena je rekla: Sada kada ste me pitali moram vam rei da ste me
pre dvanaest godina doveli kao svoju enu, ali ste bili toliko angaovani, tako mnogo predani
svom poslu, a ja nisam elela da vas prekidam i smetam vam."
Vaaspati je poeo da plae, poeo je da lije suze. ena je pitala: U emu je stvar?"
On je odgovorio: Ovo je vrlo sloeno. Izgubljen sam, komentar sam zavrio i sada sam
sanyasin. Ja ne mogu biti domain, ne mogu biti suprug. Zavrio sam komentar i zavetovao
sam se, nemam vie vremena, odmah u otii. Zato mi nisi ranije rekla? Mogao sam da te
volim. ta mogu uiniti za tvoje sluenje, tvoju ljubav, tvoju predanost?"
Stoga je on nazvao svoj komentar brahma-sutra, bhamati. Bhamati je bilo ime
njegove ene. Ime je apsurdno, jer da se nazovu Badarayanine brahma-sutre i njihov
komentar bhamati, to nema veze. Meutim, on je rekao: Sada nita drugo ne mogu da
uinim. Poslednja stvar je da napiem ime knjige, stoga mogu da je nazovem bhamati kako bi
to uvek bilo zapameno."
Ostavio je kuu. ena je plakala, ali ne u bolu ve u apsolutnom blaenstvu. Rekla je:
Ovo je dovoljno. Ovaj gest, ova ljubav u vaim oima, dovoljna je. Dovoljno sam dobila; ne
oseajte se krivim. Idite! I zaboravite me potpuno. Ne bih elela da budem breme u vaem
umu. Nije potrebno da me se seate."
Ako ste totalno angaovani mogue je da seks potpuno iezne, jer seks je sigurnosni
ventil. Kada imate neiskorienu energiju, onda seks postaje avetna, pojavna stvar okolo vas.
Kada je energija potpuno iskoriena, seks iezava. A to je stanje brahmacharya, virya;
stanje cvetanja sveg vaeg potencijala.
Trud, seanje, usredsreenost i razlikovanje:
Shradha - poverenje; virya - vaa totalna bioenergija, vae potpuno obavezivanje i
trud; smrti - svest o sebi; i samadhi. Re samadhi oznaava stanje uma gde ne postoji tekoa.
Ona dolazi od rei samadhan - stanje uma kada se oseate apsolutno u redu, bez problema,
bez pitanja, skladno stanje uma. To nije koncentracija, nije usredsreenost. Usredsreenost je
upravo kvalitet koji nastupa u umu koji je bez problema. Teko je to prevesti.
Usredsreenost je delimina, nepotpuna - ona se deava. Pogledajte dete koje je
apsorbovano u svojoj igri, ono je usredsreeno bez ikakvog napora. Usredsreenost je
uzgredan proizvod. Ono je tako obuzeto igrom da se dogaa usredsreenost. Ako se smiljeno
usredsredite na neto, onda postoji trud, onda ima napetosti, onda ete biti umorni.
Samadhi se deava automatski, spontano, ako ste apsorbovani. Ako sluate mene, to je
samadhi. Ako me sluate potpuno, nema potrebe ni za kakvom meditacijom. To postaje
usredsreenost. Ne da se vi usredsreujete - ako sluate odano, s puno ljubavi, usredsreenost
sledi sama.
U asamprajnata samadhiju, kada je poverenje potpuno, kada je pregnue potpuno,
kada je seanje duboko, samadhi se deava. ta god da inite, vi inite sa totalnom
usredsreenou - bez ikakvog truda da vrite usredsreivanje. A ako usredsreenost iziskuje
napor, to je opasno. To e biti kao bolest u vama; biete tim uniteni. Usredsreenost treba da
bude ishod, posledica. Volite neku osobu, i upravo bivajui s njom, biete usredsreeni.
Zapamtite, nikada se ne koncentriite na neto. Bolje sluajte duboko, sluajte potpuno, i
imaete usredsreenost koja e doi sama od sebe.
127

Takoe razlikovanje - prajna. Prajna nije razlikovanje; razlikovanje je opet deo


prajne. Prajna znai mudrost - spoznavajua svesnost. Buddha je rekao da kada plamen
meditacije gori visoko, svetlost koja okruuje plamen jeste prajna. Samadhi unutra, a onda
svuda oko vas svetlost, jedna aura vas sledi. U svakom vaem delu vi ste mudri; ne da vi
pokuavate da budete mudri, to se jednostavno deava jer ste totalno svesni. ta god da inite
deava se da je mudro - a ne da neprekidno mislite da inite ispravnu stvar.
ovek koji neprekidno misli da ini ispravnu stvar, nee biti sposoban da uini nita nee biti sposoban ak ni da uini neto pogreno, jer e to postati takva napetost za njegov
um. ta je ispravno, a ta je pogreno? Kako moete odluiti, zakljuiti? ovek mudrosti,
ovek razumevanja, ne bira. On jednostavno osea. On jednostavno izbaci svoju svest svuda, i
u tom svetlu se kree. Gde god da se kree ispravno je.
Ispravno ne pripada stvarima; to pripada vama - oveku koji se kree. Nije Buddha
namerno inio ispravne stvari. ta god da je spontano inio bilo je ispravno. Razlikovanje je
nedovoljna, oskudna re. ovek razumevanja ima razlikovanje. On ne misli o tome; njemu je
to ba lako. Ako elite da izaete iz ove sobe, jednostavno proete kroz vrata. Ne pipate. Ne
idete prvo do zida i ne pokuavate da naete put. Jednostavno izaete. ak i ne razmiljate da
su ovo vrata.
Ali kada slep ovek mora da izae napolje on pita: "Gde su vrata?" i onda pokuava da
ih nae. On e kucati mnoga mesta svojim tapom, opipavae mislei neprekidno u umu:
"Jesu li ovo vrata ili zid? Idem li ispravno ili pogreno?" A kada doe do vrata, on misli: "Da,
sada su ovo vrata."
Sve se ovo deava jer je on slep. Morate razmiljati jer ste slepi, morate verovati u
ispravno i pogreno jer ste slepi; morate biti u disciplini i moralnosti jer ste slepi. Kada
razumevanje cveta, kada plamen razlikovanja i uoavanja postoji, jednostavno vidite sve
jasno. Kada imate unutarnju jasnou, sve je jasno; poinjete da uoavate, imate mo opaanja.
ta god da inite jednostavno je ispravno. Nije tako ispravno zato to vi to radite, niti vi to
radite zato to je 'ispravno', nego vi radite to s razumevanjem prave prirode stvari, i zato je
ispravno.
Shradha, virya, smriti, samadhi, prajna. Drugi koji dostiu asamprajnata samadhi
postiu to kroz poverenje, beskonanu energiju, trud, totalno samopriseanje, neispitujui um
i plamen razumevanja.

Poglavlje 2

PRIVLANOST TEKOG
Izlaganje 2. januara 1975. u Buddha dvorani.
Prvo pitanje:
Ono to ste govorili o Heraklitu, Hristu i Zenu izgleda slino uenjima dejeg vrtia u
poreenju sa Patanjalijem. Heraklit, Hrist i Zen ine zavrni korak naizgled povezano;
Patanjali ini da ak i prvi korak izgleda gotovo nemogu. Izgleda da su zapadnjaci, kao mi,
teko poeli da shvataju obim rada koji treba uloiti.
Lao Ce kae: Ako se Tao-u ne bi smejali, to ne bi bio Tao." A ja bih eleo da vam
kaem: Ako me pogreno ne shvatite, vi neete biti vi. Vi ste prinueni pogreno da shvatite.
Vi niste razumeli ta sam ja govorio u Heraklitu, Hristu i Zenu; a ako ne moete razumeti
Heraklita, Zen i Isusa, onda neete moi da razumete ni Patanjalija.
Prvo pravilo za razumevanje, nije da se uporeuje. Kako moete porediti? ta vi znate
o unutarnjem stanju Heraklita ili Baoa, Bude, Isusa ili Patanjalija? Ko ste vi da
uporeujete? - jer poreenje je procenjivanje. Ko ste vi da procenjujete? Inae um eli da
procenjuje, jer se u procenjivanju um osea superiornim. Postajete sudija, znalac; va ego se
osea vrlo, vrlo dobro. Vi hranite ego. Kroz ocenjivanje i uporeivanje vi mislite da znate.
128

Oni su razliiti tipovi cvetova - neuporedivi. Kako moete uporediti ruu sa lotosom?
Ima li ikakve mogunosti da se uporeuju? Ne postoje mogunosti jer oboje su razliiti
svetovi. Kako moete uporeivati mesec sa suncem? Ne postoji mogunost. Oni su razliite
dimenzije. Heraklit je divlji cvet; Patanjali je kultivisana bata. Patanjali nikada nee biti
blii vaem intelektu, Heraklit blii vaem srcu. Meutim, kako idete dublje, razlike se gube.
Kada vi sami zaponete da cvetate, onda novo razumevanje svie u vama - razumevanje da se
cvetovi razlikuju u svojoj boji, oni se razlikuju u svom mirisu, oni se razlikuju u svom obliku
i imenu.
Inae u cvetanju oni se ne razlikuju. Cvetanje, fenomen da su oni procvetali, isti je.
Heraklit je, naravno, drugaiji; mora da bude. Svaka individua je jedinstvena; Patanjali je
drugaiji. Ne moete ih staviti u istu kategoriju. Ne postoje pregrade gde ih moete prinuditi,
kategorizovati ih. Ali kada i vi procvetate, onda ete razumeti da cvetanje je isto bilo da je
cvet lotos ili rua - nema razlike. Unutarnji fenomen energije koja se rascvetava je isti.
Oni govore razliito; oni imaju razliite obrasce uma. Patanjali je nauni mislilac. On
je gramatiar, lingvista. Heraklit je neobuzdani pesnik. On ne brine o gramatici, jeziku i
formi. A kada kaete, da sluajui Patanjalija, oseate da Heraklit, Bao i Zen izgledaju
detinjasto, uenja iz dejeg vrtia, vi ne kaete nita o Patanjaliju ili Heraklitu, vi govorite o
sebi. Kaete da ste osoba orijentisana na um.
Patanjalija moete razumeti; Heraklit vam jednostavno izmie. Patanjali je mnogo
vri, ozbiljniji. Moete ga dohvatiti i razumeti. Heraklit je oblak, ne moete ga uopte
uhvatiti. Patanjalija moete uhvatiti i za glavu i za rep"; on izgleda racionalan. ta ete
uiniti sa Heraklitom, sa Baoom? Ne, jednostavno oni su tako iracionalni. Razmiljanjem o
njima, va um postaje apsolutno impotentan. Kada iskaete takve stvari kao poreenja, ocene,
vi govorite neto o sebi - ono ko ste vi.
Patanjali moe biti shvaen; nema sumnje u to. On je apsolutno racionalan, moe da
se sledi, nema problema s tim. Sva njegova uenja mogu da se sprovedu jer vam on
objanjava kako, a 'kako' uvek je lako razumeti. ta da se ini? Kako da se ini? On vam daje
tehnike.
Pitajte Baoa ili Heraklita ta da radite, oni e jednostavno rei da nema nita da se
ini. Onda ste izgubljeni. Ako neto treba da se uini vi moete to uraditi, ali ako nita ne
treba da se ini, vi ste izgubljeni. Jo uvek, vi ete nastaviti da pitate opet i opet, ta da
uradim? Kako da uradim? Kako da postignem ovo o emu vi govorite?"
Oni govore o izvornom, glavnom, ne kazujui o putu koji vodi do toga. Patanjali
govori o putu, nikada ne govori o cilju. Patanjali se bavi sredstvima, Heraklit sa ciljem. Cilj
je misteriozan. To je poezija; to nije matematiko reenje. To je misterija. Ali staza je nauna
stvar, tehnika, znati kako; to vas privlai. Inae ovo pokazuje neto o vama, ne o Heraklitu ili
Patanjaliju. Vi ste osoba orijentisana na um, osoba orijentisana na glavu. Pokuajte da
uvidite ovo. Ne uporeujte Patanjalija i Heraklita. Jednostavno pokuajte da vidite stvar - da
ona pokazuje neto o vama. Ako ona pokae neto o vama, vi neto moete uraditi.
Nemojte misliti da znate ta je Patanjali i ta je Heraklit. Ne moete razumeti ak ni
obian cvet u bati, a oni su beskrajno rascvetavanje postojanja. Dok ne cvetate na isti nain,
neete biti sposobni da razumete. Ali moete porediti, moete ocenjivati, a kroz ocenjivanje
propustiete celu poentu.
Dakle, prvo pravilo razumevanja je nikada ne ocenjivati. Nikada ne ocenjujte i nikada
ne uporeujte Budu, Mahavira, Muhameda, Hrista, Krinu; nikada ne uporeujte! Oni postoje
u dimenziji izvan poreenja, a ta god da znate o njima zaista je nita - samo fragmenti. Vi ne
moete imati totalno shvatanje. Oni su toliko iznad. Zapravo, vi jednostavno vidite njihovu
refleksiju u ogledalu svog uma.
Vi niste videli mesec; videli ste mesec odraen u jezeru. Niste videli realnost;
jednostavno ste videli odraz; a odraz zavisi od ogledala. Ako je ogledalo manjkavo, odraz je
razliit. Va um je vae ogledalo.
Kada kaete da Patanjali izgleda vrlo velik, i uenje je vrlo veliko, vi jednostavno
govorite da ne moete uopte razumeti Heraklita. A ako ga ne moete razumeti, to
jednostavno pokazuje da je on vie iznad vas nego to je Patanjali. Barem moete razumeti
129

ovoliko - da izgleda da Patanjali jeste teak. Sada me sledite paljivo. Ako je neto teko, vi
se moete latiti toga. Ma koliko da je teko, moete prionuti! Nuan je mnogo vei napor, ali
se to moe uraditi.
Heraklit nije lak; on je jednostavno nemogu. Patanjali je teak. Teko moete
razumeti, moete neto uiniti, moete uloiti svoju volju u to, svoj napor, svu svoju energiju,
moete uiniti neto, i to moe biti reeno. Teko moe biti uinjeno lakim, mnogo suptilnije
metode mogu biti otkrivene. Ali ta ete uiniti sa nemoguim? Ono se ne moe uiniti
lakim. Ali vi moete obmanuti sebe. Moete rei da nema niega u tome, to je uenje dejeg
vrtia, a vi ste tako odrasli, pa to nije za vas; to je za decu, ne za vas.
Ovo je trik uma da se izbegne nemogue, jer vi znate da to neete moi da reite.
Stoga je jedini najlaki smer jednostavno rei: To nije za mene; to je ispod mene - uenje
dejeg vrtia," a vi ste odrasla, zrela osoba. Vama treba univerzitet; vama ne treba kola
dejeg vrtia. Patanjali vam odgovara, izgleda vrlo teak, moe biti odgonetnut. Nemogue
ne moe biti objanjeno.
Ako elite da razumete Heraklita, ne postoji nain izuzev da potpuno odbacite svoj
um. Ako elite da razumete Patanjalija, postoji postepen put. On vam daje korake koje da
inite; ali zapamtite, on e vam na kraju, konano takoe rei: Odbacite um." ta Heraklit
kae na poetku, on e rei na kraju, ali na stazi, celim putem, moete biti zaluivani. Na
kraju on e rei istu stvar, ali ipak e biti razumljiv jer on gradi stupnjeve, a skok ne izgleda
kao skok kada imate korake.
Upravo je ovakva situacija: Heraklit vas dovodi do ambisa i kae Skoi!" Vi gledate
dole; va um jednostavno ne moe da shvati ta on govori. To izgleda samoubistveno. Ne
postoje koraci. Pitate, Kako"? On kae: Ne postoji kako, jednostavno skoi. ta e ti kako?"
Jer ne postoje koraci, stoga kako" ne moe biti objanjeno. Vi jednostavno skoite, a on
kae: Ako ste spremni ja vas mogu gurnuti, inae nema drugih metoda." Ima li ikakve
metode da se skoi? Skok je iznenadan, nagao. Metode postoje kada je to postepen proces.
Nalazei da je to nemogue, vi se okreete u krugu. Inae da bi uteili sebe da niste takav
slabi, vi kaete: Ovo je za decu. Ovo nije dovoljno teko." Ovo nije za vas.
Patanjali vas dovodi do istog ambisa, ali on je nainio korake. On kae: korak po
korak. To privlai! Moete razumeti. Matematika je jednostavna; preduzmite jedan korak
onda drugi. Ne postoji skok. Meutim, zapamtite, pre li kasnije on e vas dovesti do take
odakle morate skoiti. Korake je on kreirao, ali oni ne dovode do dna - samo do sredine, a dno
je jo daleko udaljeno, moete tano rei da je to ambis bez dna.
Dakle, koliko koraka vi nainite ne pravi razliku. Ambis ostaje isti. On e vas voditi
devedeset devet koraka, i vi ste vrlo sreni - kao da ste pokrili ambis, i sada se dno pribliilo.
Ne, dno ostaje isto onoliko udaljeno kao pre. Ovih devedeset devet koraka samo su obmana
vaeg uma, samo da vam prue tehniku, kako". Onda pri stotom koraku, on kae, Sada
skoi!" A ambis ostaje isti, opseg je isti.
Nema razlike jer bezdan je beskonaan, Bog je beskonaan. Kako moete sresti njega
postepeno? Ali ovih devedeset devet koraka e vas obmanuti. Patanjali je mnogo bistriji,
mudriji. Heraklit je nevin; on vam jednostavno kae: To je to; ambis je ovde. Skoi!" On vas
ne nagovara; on vas ne zavodi. On jednostavno kae: To je to. Ako elite da skoite, skoite;
ako ne elite da skoite, udaljite se."
A on zna da je beskorisno da se naine koraci, jer ovek na kraju mora da skoi. Inae
ja mislim da e za vas biti dobro da sledite Patanjalija jer vas on, ubrzo zavede. Vi
preduzmete barem jedan korak, onda drugi korak postaje laki, onda trei. A kada ste
preduzeli devedeset devet koraka, teko e biti da se vratite natrag, jer onda e to izgledati
apsolutno protiv vaeg ega da se vratite natrag; jer onda e se itav svet smejati, a vi ste
postali tako veliki mudrac, a vraate se natrag u svet! Postali ste takav maha-yogi - veliki
yogi, i zato se vraate natrag? Sada sve uhvaeni, i ne moete se vratiti natrag.
Heraklit je jednostavan, nevin. Njegovo uenje nije kola iz dejeg vrtia, ali on jeste
dete - to je u redu, nevin kao dete, mudar takoe kao dete. Patanjali je lukav, bistar, ali
Patanjali e vam odgovarati vie jer vama je potreban neko ko vas moe voditi na
130

otroumnom, lukavom putu do take odakle se ne moete vratiti natrag. To postaje


jednostavno nemogue.
Gurijev je imao obiaj da kae da postoje dva tipa majstora; jedan je nevin i
jednostavan, drugi je lukav, otrouman. On sam je rekao: Ja pripadam drugoj kategoriji."
Patanjali je izvor svih lukavih majstora. Oni vas vode do vrta rua, a onda, iznenada, ambis.
I vi ste uhvaeni u takvom zahvatu svog vlastitog delanja, da se ne moete vratiti natrag. Vi
ste meditirali, ostavili ste svet, odrekli se ene i dece. Godinama ste radili asane (yoga
poloaje), meditirali, i stvorili ste takvu jednu auru oko sebe da su vas ljudi oboavali.
Milioni ljudi su gledali u vas kao u boga, a sada dolazi ambis. Sada upravo da bi ste se spasli
morate skoiti, upravo da bi ste sauvali svoj ugled. Gde da odete? Sada ne moete otii.
Buda je jednostavan, Patanjali je lukav. Sva nauka je lukavost, vetina. Ovo treba da
se razume, a ja ne govorim ni u kakvom smislu tetnom po ugled, zapamtite; ja ne osuujem.
Sva nauka je lukavost!
Reeno je da je jedan sledbenik Lao Ce-a, jedan stari ovek, seljak, crpeo vodu iz
bunara, i umesto da koristi volove ili konje, on je sam - jedan star ovek - sa svojim sinom,
radio slino volu i izvlaio vodu iz bunara, znojei se; starac je pri tome teko disao. To je
bilo teko.
Sledbenik Konfuija je prolazio. Rekao je starom oveku, Zar niste uli? Ovo je vrlo
primitivno. Zato gubite svoj dah? Sada se mogu koristiti volovi, konji se mogu koristiti. Zar
niste uli da u varoi, u gradovima, sada niko ne radi ovako kao to vi radite. Ovo je vrlo
primitivno. Nauka je brzo napredovala."
Stari ovek je rekao: Saekaj, i ne govori tako glasno. Kada moj sin ode onda u
odgovoriti." Kada je sin otiao da obavi neki posao, on je rekao: Sada ste vi opasna osoba.
Ako moj sin ikada uje o ovome, odmah e rei: U redu! Onda ne elim ovo da vuem. Ne
mogu obavljati ovaj posao vola. Potreban je vo."
Konfuijev uenik je pitao: ta je pogreno u tome?" Starac je rekao: Sve je
pogreno u tome jer je to lukavstvo. To je varanje vola; to je obmanjivanje konja. Jedna stvar
vodi do druge. Ovaj deak koji je mlad i nije mudar, ako jednom sazna da vi moete biti veti
s ivotinjama, on e se pitati zato ne biste bili veti i lukavi s ljudima. Jednom kada sazna da
kroz vetinu i lukavost moete eksploatisati, onda ne znam gde e se zaustaviti. Molim vas
idite odavde i nikada se ne vraajte natrag ovim putem. Nemojte donositi takve lukave stvari
u ovo selo. Mi smo sreni."
Lao Ce je protiv nauke. On kae nauka je lukavost. Ona je obmanjivanje,
iskoriavanje prirode - kroz puteve lukavstva, prisiljava prirodu. to vie ovek postaje
nauan, vie je lukav i spretan. A Patanjali znajui dobro da biti nauan jeste lukavost,
takoe zna da ovek moe samo biti vraen natrag prirodi kroz novi pronalazak, novo
lukavstvo.
Yoga je nauka o unutranjem biu, ili postojanju. Zato to niste nevini, mora vam se
pribliiti lukavim nainom. Ako ste nevini, nikakva sredstva nisu potrebna, nikakve metode
nisu nune. Jednostavno razumevanje i vi ete biti preobraeni. Ali vi niste. Zbog toga oseate
da Patanjali izgleda vrlo velik. To je zbog vaeg na glavu orijentisanog uma i vae lukavosti.
Druga stvar da se zapamti: on izgleda teak. A vi mislite Heraklit je jednostavan? On
izgleda teak, to takoe postaje privlano za ego. Ego uvek eli da uini neto to je teko, jer
nasuprot tekoi vi oseate da ste neko. Ako je neto vrlo jednostavno, kako ego moe biti
nahranjen time?
Ljudi mi dolaze i kau: Ponekad vi uite da upravo sedenjem i ne injenjem niega to
moe da se dogodi. Kako to moe biti tako jednostavno? Kako to moe biti tako lako?" uang
Ce kae: Lako i udobno je ispravo," ali ovi ljudi kau: Ne! Kako to moe biti lako? To mora
biti teko - vrlo, vrlo teko, naporno."
elite da radite teke stvari jer kada se borite protiv tekoe, protiv struje, oseate da
ste neko - pobednik. Ako je neto jednostavno, neto je tako lako da ak i dete moe to da
uradi, gde e onda va ego biti? Vi traite prepreke, traite tekoe, a ako ih nema vi ih
stvarate, tako da se moete boriti, tako da se moete baciti protiv jakog vetra i moete oseati:
Ja sam neko - pobednik!"
131

Ali ne budite tako pametni. Znate frazu pametni Aleksandar?32 Moda ne znate
odakle to dolazi - to dolazi od Aleksandra. Re aleck" dolazi od rei Aleksandar, kao kratica.
Ne budite pametni Aleksandar." Budite jednostavni: ne pokuavajte da budete pobednik, jer
to je besmisleno. Nemojte pokuavati da budete neko.
Inae Patanjali je privlaan; Patanjali je mnogo privlaan indijskom egu, dakle
Indija je stvorila najsuptilnije egoiste u svetu. Nigde ne moete nai suptilnije egoiste u svetu
kao to moete nai u Indiji. Gotovo je nemogue nai jednostavnog jogina. Jogin ne moe
biti jednostavan, jer radi toliko mnogo asana, toliko mnogo mudri, od radi tako marljivo,
kako onda moe biti jednostavan? On misli da bude na vrhu - pobednik. Celi svet mora da mu
se klanja; on je krem - sama so ivota.
Odete li da posmatrate jogine, nai ete u njima vrlo, vrlo prefinjen ego. Oni su postali
vrlo suptilni; mogu postati tako suptilni da izgleda da su vrlo ponizni; ali ako paljivo
posmatrate u njihovoj skromnosti nai ete takoe ego.
Oni su svesni da su ponizni, to je potekoa. Stvarno ponizna osoba nije svesna da je
skromna. Stvarno skromna osoba je jednostavno ponizna, nije svesna, i stvarno ponizna osoba
nikada ne tvrdi: Ja sam ponizan," jer sve tvrdnje su od ega. Poniznost se ne moe traiti, ne
moe se na nju polagati pravo; poniznost nije tvrdnja, to je stanje postojanja. Sva polaganja
prava, tvrdnje i traenja ispunjavaju ego. Zato se ovo deava? Zato Indija postaje vrlo
suptilna egoistika zemlja? Kada je tu ego, postajete slepi.
Sada pitajte indijske jogine; oni krive i osuuju itav svet. Oni kau 'zapad je
materijalistiki - samo Indija je spiritualna'. itav svet je materijalistiki, kao da tu postoji
povlastica, monopol. A oni su tako slepi, ne mogu videti injenicu da je upravo obrnut sluaj.
to sam vie posmatrao indijski i zapadni um, oseam da je zapadni um manje
materijalistiki nego indijski. Indijski um je vie materijalistiki, prijanja uz stvari vie, ne
moe sudelovati, ne moe deliti; on je tvrdica. Zapadni um moe deliti, sudelovati; manje je
krt. Zato to je zapadni um stvorio toliko mnogo materijalistikog obilja, ne znai da je on
materijalista, a zato to je Indija siromana, ne znai da je duhovna.
Ako je siromatvo duhovnost, onda bi impotencija bila brahmacharya. Ne,
materijalizam ne pripada stvarima, on pripada stanovitu. Niti duhovnost pripada oskudici,
ona pripada unutranjem, nevezanom uestvovanju. Ne moete nai u Indiji nikoga ko deli
ita. Niko ne moe deliti, svako gomila. Zato to su takvi grabljivci, oni su siromani. Jer mali
broj ljudi previe zgre, onda mnogi ljudi postaju siromani.
Zapad je delio. Zbog toga se celo drutvo uzdiglo iz siromatva do obilja. U Indiji,
nekoliko ljudi postaju tako bogati, tako bogate ljude nigde ne moete nai - ali nekolicina - a
itavo drutvo se vue u siromatvu, a procep meu njima je ogroman. Nigde ne moete nai
takav jaz, jaz izmeu bogataa i prosjaka je ogroman. Takav jaz ne moe postojati nigde, ne
postoji nigde. Bogatih ljudi ima i na Zapadu, i siromanih ljudi ima na Zapadu, ali jaz meu
njima nije tako ogroman. Ovde je jaz jednostavno beskonaan. Ne moete zamisliti takav jaz.
On se ne moe okonati, premostiti. Ne moe biti prevazien jer ljudi su materijalisti. Inae
kakav i koliki je ovaj jaz? emu ovaj jaz? Ne moete li sudelovati, deliti? Nemogue! Inae
ego kae da je itav svet, ceo svet je materijalistiki.
Do ovoga je dolo jer su ljudi bili privueni Patanjaliju i ljudi su davali teke metode.
Nije nita pogreno sa Patanjalijem, ali indijski ego je naao lep, suptilan izlaz da bude
egoista.
Isto se dogaa vama. Patanjali vas poziva, privlai; on je teak. Heraklit je deji
vrti" jer je on tako jednostavan. Jednostavnost nikada ne privlai ego. Meutim, zapamtite,
ako jednostavnost moe postati privlana, staza nije duga. Ako tekoa postane privlana,
onda e staza biti vrlo duga jer, od samog poetka, radije nego da odbacite ego, vi ste poeli
da ga akumulirate.
Ja ne govorim o Patanjaliju da vas nainim veim egoistom. Paljivo motrite. Uvek
se bojim govoriti o Patanjaliju, a nikada se ne bojim govoriti o Heraklitu, Baou, Budi.
Bojim se zbog vas. Patanjali je divan, ali vi moete biti privueni iz pogrenih razloga, i to
32

Smart Aleck.
132

e biti pogreni povodi ako mislite da je on teak, sama tekoa postaje jedna privlanost.
Neko je pitao Hilari Edmunda, koji je osvojio Everest - najvii vrh, jedini vrh koji je bio
neosvojen - neko je pitao: Zato? Zato ste se upustili u tu nevolju? ta vam je to trebalo?
ak i ako dospete do vrha, ta ete raditi? Moraete da se vratite natrag."
Hilari je rekao: To je izazov ljudskom egu. Jedan neosvojeni vrh mora da bude
osvojen!" Nema druge koristi... ta ete vi uiniti? ta je on uradio? Otiao je tamo, postavio
zastavu i vratio se natrag. Kakva besmislica! Mnogi ljudi su umrli u tom nastojanju. Gotovo
etiri stotina godina mnoge grupe su pokuavale. Mnogi su umrli, bili su izgubljeni, pali su u
provaliju, nikada se nisu vratili natrag, ali to je to bilo tee postii, vie je privlailo.
Zato ii na Mesec? ta ete uiniti? Nije li Zemlja dovoljna? Ali ne, ljudski ego ne
moe to tolerisati - da mesec ostane neosvojen. ovek mora stii tamo, jer je to teko, on
mora da bude osvojen. Tako vi moete biti privueni iz pogrenih razloga. Dakle, odlazak na
Mesec nije pesniko nastojanje; to nije kao kada mala deca podignu ruke i pokuavaju da
dohvate mesec.
Otkad je oveanstvo nastalo svako dete je eznulo da dosegne mesec. Svako dete je
pokuavalo, ali razlika se mora dobro razumeti. Nastojanje deteta je lepo. Mesec je tako lep.
To je pesniki napor da se dosegne mesec, da se dopre do njega. Ne postoji ego. To je
jednostavno privlanost, ljubavni dogaaj. Ako moete nai dete koje nije privueno
mesecom, kakva je to vrsta deteta?
Mesec stvara suptilnu poeziju, suptilnu privlanost. ovek bi voleo da ga dodirne i da
ga osea; ovek bi eleo da ode na mesec. Ali to nije razlog za naunike. Za naunike mesec
postoji kao izazov. Kako se mesec usuuje da bude tu neprekidno, da bude izazov, a oveku
koji je ovde nije dostupan! On mora da stigne tamo.
Moete biti privueni iz pogrenih razloga. Patanjali je teak - najtei - jer on
analizira itavu stazu, i svaki deo izgleda da je vrlo teak, ali tekoa ne treba da bude poziv,
da bude privlanost - zapamtite to. Vi ete proi kroz Patanjalijeva vrata, ali ete se zaljubiti
ne u tekoe, ve u uvid - u lakou koju Patanjali baca na stazu. Zaljubiete se u lakou, ne u
tekou na stazi. To e biti pogrean razlog.
to ste govorili o Heraklitu, Hristu i zenu izgleda kao deji vrti u poreenju sa
Patanjalijem.
Molim vas ne uporeujte. Uporeivanje je takoe iz ega. U stvarnoj egzistenciji, stvari
postoje bez ikakvog poreenja. Drvo koje dosegne do etiri stotine stopa u nebo, i sasvim,
sasvim mali cvet trave, oboje su isti to se tie egzistencije. Ali vi idete dalje i kaete: Ovo je
veliko drvo, a ta je ovo? Samo obina trava." Vi uvodite poreenje, a kad god doe do
poreenja, nastupa runoa. Vi ste unitili fenomen lepote.
Drvo je bilo veliko i divno u svojoj drvenosti" a trava je bila divna u svojoj
travnatosti". Drvo se moda uzdiglo etiri stotine stopa. Njegovo cvee moda cveta na
najviem nebu, a trava samo prijanja uz zemlju. Njeni svetovi e biti vrlo, vrlo mali. Niko ne
moe biti ak ni svestan kada oni cvetaju ni kada uvenu. Inae kada ova trava cveta, fenomen
cvetanja je isti, slavljenje je isto, nema ni malo razlike. Zapamtite ovo: to je egzistencija,
nema uporeenja; um donosi poreenje. On kae: Vi ste lepi." Zar ne moe jednostavno
rei: Vi ste lepi"? Zato unositi vie lepi" ili lepi"?
Mula Nasrudin je bio zaljubljen u enu, i kao to su ene sklone da pitaju, kada je
Mula Nasrudin poljubio ena je pitala: Da li me ljubi kao prvu enu? Jesam li ja prva ena
koju ljubi? Da li je tvoj poljubac prvi koji daje eni?" Nasrudin je odgovorio: Da, prvi i
najslai."
Uporeivanje je u vaoj krvi. Ne moete ostati sa stvarima kakve jesu. ena takoe
trai uporeivanje; inae zato bi marila da li je to prvi poljubac ili drugi? Svaki poljubac je
nov, sladak i devianski. On nema nikakvu vezu s nekim drugi poljupcem iz prolosti ili
budunosti. Svaki poljubac je egzistencija za sebe. On postoji sam u svojoj usamljenosti. To
je vrhunac u sebi; to je celina - nije ni na koji nain povezana sa prolou ili budunou.
Zato pitati da li je to prvi? Kakvu lepotu donosi prvi? A zato ne drugi, zato ne trei?
133

Meutim, um eli da uporeuje. Zato um eli da uporeuje? Jer se kroz uporeivanje


ego hrani, poto: Ja sam prva ena; ovo je prvi poljubac." Vi niste zainteresovani za poljubac
- za kvalitet poljupca. Ovog momenta poljubac otvara vrata srca; vi niste zainteresovani za to,
to nije nita. Zainteresovani ste da li je prvi ili ne. Ego je uvek zainteresovan za uporeivanje,
a egzistencija ne zna za poreenje. Ljudi kao Heraklit, Patanjali, iveli su u egzistenciji, ne u
umu. Ne uporeujte ih.
Mnogi ljudi mi dolaze i kau: Ko je vei, Buddha ili Hrist?" Kakva besmislenost
pitati to! Buddha je vei od Hrista, a Hrist je vei od Bude, i ja im kaem: Zato nastavljate
da uporeujete? Suptilna stvar tu deluje. Ako ste sledbenici Hrista, eleete da Hrist bude
vei, jer vi moete biti veliki ako je Hrist najvei. To je zadovoljenje vaeg vlastitog ega.
Kako moe va majstor (guru) da ne bude najvei? On (to) mora biti, jer ste vi tako veliki
sledbenik. A ako Hrist nije najvei, gde e onda hriani biti? Ako Buddha nije najvei, ta e
se onda dogoditi s egom budista?
Svaka rasa, svaka religija, svaka zemlja, misli da je sama najvea - ne zato to je neka
zemlja velika, ne zato to je neka rasa velika; u ovoj egzistenciji sve je najvee. Egzistencija
kreira samo najvee, svako bie je jedinstveno. Ali to ne privlai um jer je onda veliina tako
uobiajena. Je li svako velik? Kakva je onda korist od toga! Neko mora biti nizak. Hijerarhija
mora da bude stvorena.
Jedne noi itao sam knjigu ora Mikea, koji je rekao da se u Budimpeti, u
Maarskoj gde je on roen, zaljubila jedna Engleskinja u njega. U Maarskoj se Engleskinja
zaljubila u njega. On nije bio mnogo zaljubljen; ali nije eleo da bude neutiv, pa kada ga je
ona pitala: Moemo li se oeniti?" on je rekao: To e biti teko jer mi majka nee dozvoliti,
ona nee biti srena ako se oenim strankinjom." Engleskinju je to veoma mnogo povredilo.
Rekla je: ta, ja sam stranac? Ja nisam stranac! Ja sam Engleskinja! Ti si stranac, a tvoja
majka takoe!" Mike je pitao: U Budimpeti, u Maarskoj, jesam li ja stranac?" ena je
odgovorila: Da! Istina ne zavisi od geografije."
Svako razmilja na taj nain. Um pokuava da ispuni svoje elje, da bude najvii,
najvei. Van regionalne rase, zemlje, svega, ovek mora da bude paljiv - vrlo paljiv. Samo
onda moete otii izvan ovog suptilnog fenomena ega.
Heraklit, Hrist i Zen ine zavrni korak naizgled zakljuni (dobro uravnoteen);
Patanjali ini da ak i prvi korak izgleda gotovo nemogu.
Jer on je oboje. On je blie od najblieg i dalji od najdaljeg", kae Upaniada. On je
oboje, i blizu i daleko. Mora da bude, jer ko e biti daleko onda? On mora da bude blizu
takoe, jer ko e biti blizu vas? On dodiruje vau kou, i on je proiren izvan granica. On je
oboje!
Heraklit istie blizinu jer on je jednostavan ovek. On kae da je tako blizu, nita nije
potrebno initi da se on dovede blie. On je gotovo tu; on samo gleda u vrata, kucajui na
vrata, ekajui blizu vaeg srca. Nita ne treba da se uradi. Vi jednostavno budite tihi i
pogledajte; samo sedite smireno i posmatrajte. Nikada ga niste izgubili. Istina je blizu.
Zapravo, pogreno je rei da je ona blizu jer vi ste takoe istina. ak i blizina izgleda
da je vrlo, vrlo daleka; ak i blizina pokazuje da postoji rastojanje, udaljenost, procep. ak i
taj jaz ne postoji, nije tu; vi ste to! Kae Upanishada: Ti si to: tat tvam asi." Vi ste ve to:
ak i toliko rastojanje ne postoji, da bi se reklo da je on blizu.
Zato to Heraklit i zen ele od vas da skoite" odmah - ne ekajte. Patanjali kae da
je on vrlo daleko. On je takoe u pravu; on je takoe vrlo daleko. On e vas privlaiti vie, jer
ako je on tako blizu a niste dospeli do njega, vi ete se oseati vrlo obeshrabreno. Ako je on
tako blizu, upravo iza ugla, stojei pored vas, ako je on jedini sused, i svuda vas okruuje a vi
ga niste dostigli, va ego e se oseati vrlo izigrano, frustrirano. Tako veliki ovek kao vi, i
cilj vam je tako blizu a vi to proputate? To izgleda vrlo frustrirajue. Ali ako je on vrlo
daleko, onda je sve u redu jer vreme je potrebno, napor je nuan - nita nije pogreno u vama,
on je tako daleko.
134

Daljina je tako neizmerna stvar. Uzee vam vreme, vi ete ii, kretaete se, i jednog
dana ete stii, uspeti. Ako je on blizu, onda ete oseati kvalitet. Zato ga onda ne dostiete?
itajui Heraklita, Baoa i Budu, ovek se osea neudobno. Nikada se to ne deava sa
Patanjalijem. ovek se s njim osea spokojno, udobno.
Pogledajte paradoks uma. Sa najlakim ljudima ovek se osea neudobno. Neudobnost
dolazi od vas. Da se kreete sa Heraklitom ili Isusom vrlo je neudobno jer oni uporno
nastavljaju da tvrde da je carstvo boje u vama, a vi znate da nita ne postoji u vama osim
pakla. A oni tvrde da je carstvo nebesko u vama; to postaje neudobno.
Ako je carstvo boje u vama, neto je pogreno kod vas. Zato ga ne moete videti? A
ako je tako prisutno, zato se ne deava upravo ovog momenta. To je poruka zena - da je ono
trenutno, neposredno. Nije potrebno ekati, nije potrebno gubiti vreme. To se moe dogoditi
odmah sada, ba ovog momenta. Nema opravdanja. Ovo stvara neudobnost; vi oseate
neudobnost, ne moete nai nikakav izgovor. S Patanjalijem moete nai milion opravdanja,
poto je on vrlo daleko. Nastojanje milionima ivota je nuno. Da, to se moe postii, ali uvek
u budunosti. Vi ste spokojni. Nema urbe oko toga, i vi moete biti kakvi ste upravo sada. Vi
ete sutra ujutru zapoeti da se kreete na stazi, a sutra nikada ne dolazi.
Patanjali vam daje prostor, budunost. On kae: Uradi ovo i ono, i uskoro e
postii - jednog dana, niko ne zna kada - u nekom buduem ivotu." Vi ste spokojni, nema
urbe. Moete biti kakvi jeste; nema urbe.
Ovi zen ljudi, ne dovode li vas oni do ludila, i ne nagone li vas da budete jo lui? - jer
ja govorim s obe strane, dakle nepristrasno. Upravo je ovo put. Ovo je koan. Ovo je nain da
vas nagna u ludilo. Heraklita ja koristim, Patanjalija koristim, ali ovo su trikovi da vas
nagnam u ludilo. Vama se jednostavno ne moe dopustiti da se opustite. Uvek kad ima
budunosti, vi ste u redu. Onda um ne mora eleti Boga, i s vama nije nita pogreno. Sam
fenomen je takav da e zahtevati vreme. Ovo postaje jedan izgovor.
Sa Patanjalijem moete odgaati, sa zenom ne moete odgaati. Ako odgaate, to ste
vi koji odgaate, ne Bog. Sa Patanjalijem moete odgaati jer sama priroda Boga je takva da
se on moe postii samo postepenim metodama. Vrlo, vrlo teko, zbog toga sa tekoom vi se
oseate udobno, i ovo je paradoks: s ljudima koji kau to je lako, vi se oseate neudobno; a s
ljudima koji kau teko, vi se oseate udobno. To bi trebalo biti upravo drugaije.
Istinito je i jedno i drugo, dakle, to zavisi od vas. Ako elite da odlaete, Patanjali je
savren. Ako elite to ovde i sada, onda ete morati da sluate zen i moraete da odluite. Da
li vam je hitno? Niste li patili dovoljno? elite li da patite vie? Onda je Patanjali savren.
Sledite Patanjalija. Onda negde u dalekoj budunosti ete dospeti do blaenstva. Ali ako ste
dovoljno patili - a to je ono ta zrelost jeste; dovoljno ste patili da biste razumeli to.
I vi smatrate Heraklita i zen da su za decu? Deji vrti? Ovo je jedina zrelost, shvatiti:
Dovoljno sam patio." Ako ovo oseate, onda je hitnost stvorena, onda je vatra stvorena.
Neto mora da se uini upravo sada! Ne moete odlagati to; nema znaenja u odlaganju. Ve
ste dovoljno odlagali. Ali ako elite budunost, eleete da patite malo vie, moraete postati
naklonjeni paklu, makar samo jedan dan da ostane isto, ili ete eleti neke modifikacije...
To je ono to Patanjali kae: Uradi ovo, uradi ono, polako. Uradi jednu stvar, onda
drugu stvar," milione stvari treba uraditi, a one se ne mogu uraditi odmah, tako da vi
nastavljate da menjate sebe. Danas usvojite zavet da neete biti nasilni, sutra ete usvojiti
drugi zavet. Onda prekosutra biete u celibatu, na taj nain se to nastavlja dalje i dalje, a onda
postoje milioni preostalih stvari. Laganje treba da se odbaci, nasilje treba ostaviti, agresiju
treba ostaviti; ljutnju, mrnju, ljubomoru, posesivnost - uskoro, imate milion stvari. A u
meuvremenu ostajete isti.
Kako moete ostaviti ljutnju ako niste odbacili mrnju? Kako moete ostaviti ljutnju
ako niste ostavili ljubomoru? Kako moete ostaviti ljutnju ako niste odbacili agresivnost? Oni
su meusobno zavisni. Tako kaete da sada vie neete biti ljuti, ali ta govorite? Besmislicu!
Zato to ete ostati puni mrnje, ostaete agresivni, eleete da dominirate, voleete da budete
na vrhu, a odbacujete mrnju? Kako je moete odbaciti? Sve je to meusobno zavisno.
Ovo kae zen: Ako elite da ostavite neto, shvatite pojavu da je sve meusobno
povezano. Ili ostavite to odmah, ili to nikada neete ostaviti. Ne obmanjujte se. Jednostavno
135

moete se pravdati; malo ovde, malo zakrpe onde, a stara kua ostaje sa svom starou. A dok
nastavljate da radite, bojei zidove, krpei rupe, i ovo i ono, mislite da stvarate nov ivot, a u
meuvremenu nastavljate s istim. A to vie s njim nastavljate, postajete vie i dublje
ukorenjeni.
Ne obmanjujte se. Ako moete razumeti, razumite odmah bez odlaganja. Ovo je
poruka zena. Ako ne moete razumeti, onda neto mora da se uini, i Patanjali e biti dobar.
Sledite Patanjalija. Jednog dana doi ete do razumevanja gde ete uvideti da je cela ova
stvar bila trik - trik vaeg uma da izbegne realnost, da izbegne i skloni se - i tog dana iznenada
e se stiati.
Patanjali je postepen, zen je iznenadan. Ako ne moete biti iznenadni, onda je bolje
da budete postepeni. Bolje nego da ne budete nita, ni ovo ni ono, bolje je da budete
postepeni. Patanjali e vas dovesti takoe do iste situacije, ali e vam dati malo prostora. To
je mnogo udobnije - teko, ali mnogo udobnije. Nikakva brza transformacija se ne zahteva, a
sa postepenim napretkom, um moe da se prilagodi.
Heraklit, Hrist i zen ine da zavrni korak izgleda blizak; a Patanjali ini da ak i
prvi korak izgleda gotovo nemogu. To izgleda kao da smo mi zapadnjaci teko poeli da
shvatamo vanost i koliinu rada koji treba da se obavi.
To zavisi od vas, ako elite da obavite posao, vi ga moete obaviti. Ako elite
ostvarenje bez obavljanja rada, to je takoe mogue. To je takoe mogue! Izbor zavisi od
vas! Ako elite naporno da radite, ja u vam dati teak posao. Mogu kreirati ak i vie koraka.
Patanjali moe biti nainjen ak duim, proirenim. Mogu postaviti cilj ak daljim odavde,
mogu vam dati nemogue stvari da radite. To je va izbor. Ili ako elite zaista da shvatite,
onda se to moe uraditi ba ovog momenta. To zavisi od vas. Patanjali je nain posmatranja,
Heraklit je takoe nain posmatranja.
Jednom se to dogodilo. Prolazio sam ulicom i video malog deaka kako jede vrlo
veliku lubenicu. Lubenica je bila prevelika za njega, pa sam primetio da mu je teko da je
pojede. Stoga sam ga pitao, rekao sam mu: Izgleda prevelika, zar ne?" Deak me je pogledao
i rekao: Ne! Nije dovoljna za mene."
On je takoe u pravu. Sve se moe gledati s dva stanovita. Bog je blizu i daleko. Sada
je na vama da odluite odakle elite da skoite - iz blizine ili iz daleka. Ako elite da skoite
iz daleka, onda dolaze sve tehnike, jer e vas one baciti daleko, odatle ete skoiti. To je
upravo kao da stojite na ovoj obali okeana; okean je ovde i tamo, na drugoj strani obale
takoe - koja je potpuno nevidljiva, vrlo, vrlo udaljena. Moete nainiti skok sa ove obale jer
je to isti okean, ali ako odluite da skoite s druge obale, Patanjali vam daje amac.
itava yoga je amac za prelaz do druge obale, da bi se nainio skok. To zavisi od vas.
Moete uivati u putovanju; niega nema pogrenog u tome. Ja ne kaem da je to pogreno.
To je do vas. Moete uzeti amac i otii do druge obale, i skoiti odatle. Inae isti okean
postoji. Zato to ne uiniti s ove strane? Skok e biti isti, okean e biti isti, i vi ete biti isti.
Kakva se razlika pravi ako se ode na drugu obalu? Tamo mogu biti ljudi na drugoj obali, i oni
mogu pokuavati da dou ovamo. Tamo takoe ima Patanjalija; oni su tamo napravili
amce. Oni dolaze ovamo da bi skoili iz daleka.
To se dogodilo; jedan ovek je pokuavao da pree put. Bilo je to u vreme najveeg
saobraaja, pa je teko bilo prei put; tako mnogo kola jure velikom brzinom, a on je bio vrlo
slab ovek. Pokuao je mnogo puta, a onda se vraao natrag. Onda je video Mula Nasrudina
na drugoj strani - starog poznanika. Povikao je: Nasrudine, kao ste preli put?" Nasrudin je
odgovorio: Nikada nisam prelazio. Ja sam roen na ovoj strani."
Ima ljudi koji uvek misle o udaljenoj obali. Udaljeno uvek izgleda lepo, udaljeno ima
svoj vlastiti magnetizam, jer je pokriveno izmaglicom. Meutim, okean je isti. Izbor je na
vama. Nije nita pogreno otii do tog okeana, ali otii radi pravih razloga. Moda
jednostavno izbegavate skok sa ove obale. Onda ak i ako vas amac odveze do druge obale,
onog momenta kada dospete do druge obale poeete da mislite o ovoj obali, jer e onda ona
biti udaljena taka. I mnogo puta, u mnogo ivota, vi ste uradili ovo. Vi ste promenili obalu,
ali niste nainili skok.
136

Video sam prelaenje okeana s ove strane na onu, i sa one strane na ovu. Zato to je to
problem; ta obala je udaljena jer ste vi ovde; kada budete tamo, ova obala e biti udaljena. A
vi ste u takvom spavanju da esto potpuno zaboravljate da ste takoe bili na toj obali.
Vremenom kada stignete do druge obale, zaboravljate obalu koju ste ostavili za sobom.
Vremenom dok stignete, zaborav preovlada.
Gledate u udaljeno, i opet neko kae: Evo amca gospodine, moete prei na drugu
obalu, i moete skoiti odatle jer Bog je vrlo, vrlo daleko." I vi opet poinjete da se
pripremate da napustite ovu obalu. Patanjali vam daje amac da odete na drugu obalu, ali
kada stignete do nje, zen e vam uvek dati skok. Zavrni skok je iz zena. U meuvremenu
moete uraditi mnoge stvari; to nije glavna stvar. Kad god da nainite skok to e biti
iznenadan skok. On ne moe biti postepen!
Sva postupnost" je odlazak s ove obale na onu. Inae u tome nema niega pogrenog.
Ako uivate da putujete, to je lepo, jer Bog je ovde, on je u sredini, on je na obali takoe. Nije
ni potrebno da idete na drugu obalu. Moete skoiti takoe u sredini, upravo iz amca. Onda
amac postaje obala. Odakle skaete to je obala. Svakog momenta vi moete skoiti; onda to
postaje obala. Ako ne skoite, onda to vie nije obala. Zapamtite ovo dobro: to zavisi od vas.
Zato ja govorim o svim kontradiktornim gleditima, tako da moete razumeti od
svuda, i moete videti realnost od svuda, pa onda moete odluiti. Ako odluite malo da
ekate, lepo. Ako odluite da krenete ba sada, lepo. Za mene, sve je lepo i sjajno, i ja nemam
izbor. Jednostavno odbacite sve izbore. Ako kaete: eleo bih malo da ekam," ja kaem;
Dobro! Blagosiljam vas. ekajte malo." Ako kaete: Ja sam spreman i elim da skoim, ja
kaem: Skoi, s mojim blagoslovom."
Za mene ne postoji izbor - ni Heraklit, niti Patanjali. Ja jednostavno otvaram sva
vrata za vas s nadom da ete ui kroz neka vrata. Ali zapamtite trikove uma. Kada govorim o
Heraklitu, vi mislite to je previe nejasno, previe misteriozno, previe jednostavno. Kada
govorim o Patanjaliju, mislite to je previe teko, gotovo nemogue. Ja otvaram vrata, a vi
interpretirate neto, ocenjujete i zaustavljate se. Vrata nisu otvorena da ocenjujete. Vrata su
vam otvorena da uete.
Drugo pitanje:
Govorili ste o kretanju od vere do poverenja. Kako moemo koristiti um koji osciluje
od sumnje do verovanja da odemo izvan ova dva pola?
Sumnja i verovanje nisu razliiti - dva su aspekta istog novia. Ovo prvo treba
razumeti, jer ljudi misle kada veruju da su otili izvan sumnje. Vera je ista kao sumnja, jer
oboje se tiu uma. Va um raspravlja, obrazlae, kae 'ne', ne nalazi dokaz da kae 'da'; vi
sumnjate. Onda va um nalazi argumente da kae 'da', dokaze da kae 'da', vi verujete. Ali u
oba sluaja verujete u razum; u oba sluaja verujete u argumente. Razlika je samo na povrini,
duboko dole vi verujete u rezonovanje, poverenje se odbacuje od strane rezonovanja. To je
ludost! To je iracionalno! To je apsurd!
A ja kaem poverenje nije vera; poverenje je lini susret. Vera se opet daje i
pozajmljuje. To je uslovljavanje. Vera je uslovljavanje roditelja, kulture; drutvo vam je daje.
Vi ne brinete o tome; ne inite to linim interesom, vlastitim zanimanjem. To je data stvar, a
to je dato i nije bilo lini rast, samo je fasada, lano lice, nedeljno lice (Nedeljom se ljudi pri
odlasku na slubu boju prikazuju s lanim licem).
est dana ste drugaiji; a kada ulazite u crkvu stavljate masku. Pogledajte kako se ljudi
ponaaju u crkvi; tako krotko, tako oveno - isti ljudi! ak i ubica dolazi u crkvu i moli se,
vidite njegovo lice - izgleda tako lepo i nevino, a onaj ovek je ubijen. U crkvi morate koristiti
odgovarajue lice, a vi znate kako da ga koristite. To je bilo uslovljavanje. Od samog
detinjstva to vam je dato.
Vera je data; poverenje je rast u kome susreete realnost, suoavate se s njom, ivite
realnost i ubrzo dolazite do razumevanja da sumnja vodi u pakao, bedu. to vie sumnjate,
vie jadni postajete. Ako moete potpuno sumnjati, biete u savrenoj bedi. Ako niste u
savrenoj patnji, to je stoga to ne moete sumnjati potpuno; vi jo uvek imate poverenje. ak
137

i ateista, on takoe veruje. ak i ovek koji sumnja da li svet postoji ili ne, on takoe ima
poverenje; inae ne bi mogao da ivi, ivot bi bio nemogu.
Ako sumnja postane totalna, ne moete iveti nijednog trenutka. Kako moete disati
ako sumnjate? Ako zaista sumnjate, ko zna nije li disanje otrovno? Ko zna ne unose li se
milioni klica? Ko zna dolazi li rak kroz disanje? Ako stvarno sumnjate, ne moete ak ni
disati. Ne moete iveti nijednog trenutka; odmah ete umreti. Sumnja je samoubistvo.
Meutim, nikada ne sumnjate savreno, tako da se zamajavate. Zamajavate se; nekako se
razvlaite. Meutim, va ivot nije potpun. Upravo razmislite; ako je totalna sumnja
samoubistvo, onda e totalno poverenje biti apsolutno mogui ivot.
To je ono to se deava oveku poverenja; on ima poverenje, i vie poklanja
poverenje, postaje sposobniji da ima poverenje. to vie postaje sposoban da ima poverenje,
vie ivota se otvara. On osea vie, on ivi vie, on ivi intenzivnije. ivot postaje autentino
blaenstvo. Sada moete imati vie poverenja. Ne znai da sada neete biti zavedeni, jer ako
imate poverenje, to ne znai da vas niko nee obmanuti. Zapravo, vie ljudi e vas obmanuti
jer postajete ranjivi, osetljivi. Ako imate poverenje, vie ljudi e vas obmanuti, ali niko vas ne
moe uiniti tunim; ovo je detalj koji treba razumeti. Oni vas mogu obmanuti, mogu ukrasti
stvari od vas, mogu pozajmiti novac koji vam nikada nee vratiti - ali niko vas ne moe uiniti
nesrenim - to postaje nemogue. ak i ako vas ubiju, ne mogu vas uiniti alosnim.
Vi imate poverenje, a poverenje vas ini osetljivim, ranjivim - ali takoe apsolutno
pobedonosnim, jer niko vas ne moe pobediti. Oni mogu obmanuti, mogu krasti, vi moete
postati prosjak, ali pored toga ete biti car. Poverenje ini careve od prosjaka, a sumnja ini
prosjake od careva. Pogledajte jednog cara koji ne moe imati poverenje; on se uvek boji. On
ne moe verovati svojoj vlastitoj eni, ne moe imati poverenje u svoju decu, zato to kralj
poseduje toliko mnogo njegov sin e ga ubiti, njegova ena e ga otrovati. On ne moe imati
poverenje ni u koga. On ivi u takvom nepoverenju da je ve u paklu. ak i kada spava, on se
ne moe opustiti. Ko zna ta e se dogoditi!
Poverenje vas ini sve vie i vie otvorenim. Naravno, kada ste otvoreni, mnoge stvari
e postati mogue. Kada ste otvoreni, prijatelji e dopreti do vaeg srca; naravno, neprijatelj
moe takoe dopreti do vaeg srca - vrata su otvorena. Dakle, postoje dve mogunosti. Ako
elite da budete sigurni, potpuno zatvorite vrata. Stavite rezu, zakljuajte ih i sakrijte se
unutra. Sada nikakav neprijatelj ne moe ui, ali takoe ne moe ui ni prijatelj. ak i ako
Bog doe, ne moe ui. Sada niko ne moe da vas obmane, ali u emu je poenta? Vi ste u
grobu. Vi ste ve mrtvi. Niko vas ne moe ubiti, ali ste ve mrtvi: ne moete izai van. ivite
u sigurnosti, naravno, ali kakav je to nain ivota? Vi uopte ne ivite. Onda otvorite vrata.
Sumnja je zatvaranje vrata. Kada otvorite vrata, sve alternative postaju mogue.
Prijatelj moe ui, neprijatelj moe ui. Vetar e doi; donee miris cvea; donee takoe
klice bolesti. Sada je sve mogue - dobro i loe. Ljubav e doi; mrnja e doi takoe. Sada
Bog moe doi, avo moe takoe doi. Ovo je strah da neto moe krenuti nepovoljno, stoga
zatvorite vrata. Ali onda sve ide nepovoljno. Otvorite vrata - neto je mogue da krene
nepovoljno, ali za vas, nita, ako je vae poverenje totalno. ak i u neprijatelju ete nai
prijatelja i ak u avolu ete nai Boga. Poverenje je takav preobraaj da ni u emu ne moete
nai nita tetno, jer se itavo vae gledite promenilo.
Ovo je znaenje Isusove izreke: Voli svoje neprijatelje." Kako moete voleti svog
neprijatelja? Meutim, ovek poverenja moe to da ini, jer ovek poverenja ne zna za
neprijatelje. ovek poverenja zna samo prijatelje. U kojoj god formi on da doe nema razlike.
Ako doe da krade on je prijatelj; ako doe da primi, on je prijatelj; u kojoj god formi doe.
Dogodilo se da je Al-Hilaj Mansur, veliki mistik, veliki sufi, bio ubijen, uklonjen,
raspet. Poslednje rei su mu bile - on je pogledao u nebo - i rekao: Ali vi me ne moete
obmanuti." Mnogi ljudi su bili prisutni, a Al-Hilaj se smeio, i rekao obraajui se nebu:
Vidi, ne moe me obmanuti." Neko ga je pitao: ta podrazumeva pod tim? Kome
govori?" On je rekao: Govorim mom Bogu; u bilo kom obliku da doe ne moe me
obmanuti. Ja te znam dobro. Sada si doao kao smrt. Ne moe me obmanuti."
ovek poverenja ne moe biti obmanut. U bilo kom obliku, bilo ta da doe, uvek
boansko dolazi njemu jer poverenje ini sve svetim. Poverenje je alhemija. Ono preobraava
138

ne samo vas; ono preobraava za vas itav svet. Gde god pogledate nalazite Boga; u prijatelju,
u neprijatelju; u noi, u danu. Da, Heraklit je u pravu. Bog je leto i zima, dan i no, Bog je
sitost i glad. Ovo je poverenje. Patanjali ini poverenje osnovom - osnovom sveg rasta.
Govorili ste o kretanju od vere do poverenja...
Vera je ono to je dato; poverenje je ono to se nalazi. Veru vam daju vai roditelji;
poverenje vi morate nai. Veru vam daje drutvo; za poverenje morate istraivati, tragati i
ispitivati. Istina je lina, intimna; vera je kao roba iroke potronje. Moete je kupiti na
trnici.
Moete je kupiti u prodavnici - kada ja kaem to, kaem to sa vrlo promiljenim
umom. Moete otii i postati musliman; moete otii i postati hindus. Idite u jedan Arja hram
i biete preobraeni da budete hindus. Nema problema. Vera se moe kupiti u trnici. Od
muslimana moete postati hindus, od hindusa moete postati ain. To je tako jednostavno da
svaki neozbiljan svetenik moe to uiniti. Meutim, poverenje - nije roba iroke potronje.
Ne moete otii i nai ga na tritu, ne moete ga kupiti. Morate proi kroz mnoga iskustva.
Ubrzo se ono pojavljuje; uskoro vas ono menja. Novi kvalitet, novi plamen dolazi u vae bie.
Kada uvidite da je sumnja nevolja i patnja, onda dolazi poverenje. Kada vidite da je
vera mrtva, onda dolazi poverenje. Vi ste hrianin, hindus, musliman; jeste li ikada primetili
da ste sasvim mrtvi? Koji ste vi tip hrianina? Ako ste zaista hrianin, vi ete biti Hrist nita manje od toga. Poverenje e vas uiniti Hristom, vera e vas uiniti hrianinom - vrlo
siromanom imitacijom. Koji ste tip hrianina? Da li odlazite u crkvu zato to itate Bibliju?
Vaa vera nije znanje. To je neznanje.
Ovo se dogodilo u jednom Rotari klubu. 33 Doao je veliki ekonomista da govori.
Govorio je strunim jezikom ekonomista. Prisutan je bio i gradski svetenik i sluao je
njegovo izlaganje. Posle govora, priao mu je i rekao: Odrali ste divan govor, ali da budem
iskren, ja ne mogu slediti ni jednu re." Ekonomista je rekao: U tom sluaju, ja u vam rei
ta da kaete svojim sluaocima; morate..."
Kada ne moete razumeti, kada ste neznalica, celo drutvo kae: Imaj veru." Ja u
vam rei: Bolje je sumnjati, jer sumnja e stvoriti patnju. Vera je uteha; sumnja e stvoriti jad,
nevolju. A ako postoji nevolja, vi ete traiti poverenje. Ovo je problem dileme koja se javila
u svetu. Zbog vere vi ste zaboravili da traite poverenje. Zbog vere vi ste ostali bez poverenja;
vi ste hriani, hinduisti, muslimani, i propustili ste celu poentu. Zbog vere vi mislite da ste
religiozni. Onda istraivanje prestaje.
Iskrena sumnja je bolja od neiskrene vere. Ako je vera lana - a svaka vera je lana
ako niste izrasli u njoj, ako ona nije vae oseanje i vae bie i vae iskustvo - svaka vera je
lana! Budite iskreni! Sumnjajte! Patite! Samo patnja e vas dovesti do razumevanja. Ako
patite istinski, jednog dana ete razumeti da je sumnja ta koja ini da patite. Onda preobraaj
postaje mogu.
Ako me pitate: Kako moemo koristiti um koji osciluje od sumnje do verovanja da
odemo izvan ova dva pola?
Ne moete ga koristiti, jer nikada niste iskreno sumnjali. Vaa vera je lana; duboko
ispod je skrivena sumnja. Samo na povrini se nalazi premaz vere. Duboko ispod vi ste
nesigurni - ali se bojite da znate da ste ispunjeni sumnjom, tako nastavljate da prianjate uz
veru, nastavljate da inite gestove vere. Moete izvoditi gestove, ali kroz njih ne moete stii
do realnosti. Moete ii da se klanjate u hramu, da inite rituale oveka koji veruje. Ali neete
rasti, jer duboko ispod nema poverenja, samo sumnja. Vera je upravo nametnuta.
To je kao ljubljenje osobe koju ne volite. Spolja sve je isto, vi inite gest ljubljenja. Ni
jedan naunik ne moe nai ikakvu razliku. Ako ljubite osobu, fotografija, psiholoka pojava,
prenoenje miliona klica s jednih usana na druge, sve je sasvim isto bilo da volite ili ne. Ako
naunik gleda i prati, kakva e biti razlika? Nema razlike - nema ak nijedne trunice razlike.
On e rei oba poljupca su sasvim ista.
33

Lokalni klub koji okuplja biznismene zbog veza i interesa, spadaju u nii rang masonskih organizacija, i pod
kontrolom su masona.
139

Meutim vi znate da kada volite osobu onda neto nevidljivo tee, to ne moe biti
otkriveno nijednim instrumentom. Kada ne volite osobu, onda moete dati poljubac, ali nita
se ne deava. Nema prenoenja energije, nikakvo prisno optenje se ne deava. Isto je sa
verom i poverenjem. Poverenje je poljubac s ljubavlju, s duboko zaljubljenim srcem, a vera je
poljubac bez ljubavi.
Dakle, odakle poeti? Prva stvar je istraivanje u dubini. Odbaciti lanu veru. Postati
iskreni sumnjalica - iskreni. Vaa iskrenost e pomoi, jer ako ste iskreni, kako moete
propustiti glavnu stvar da sumnja stvara patnju? Ako ste iskreni, vi ste prinueni to da znate.
Pre ili kasnije doi ete do spoznaje da je sumnja stvorila vie patnje - to vie ulazite u
sumnju, vie ima patnje. Samo kroz jad ili nevolje ovek raste.
A kada stignete do take gde jad ili patnju vie nije mogue tolerisati, nepodnoljiva
je, vi je ostavljate, odbacujete. Ne odbacujete je vi; sama nepodnoljivost postaje odbacivanje.
A kada jednom nema sumnje, a vi ste patili kroz nju, zapoinjete da se kreete prema
poverenju.
Poverenje je preobraaj - shraddha; a Patanjali kae, da je shradha - poverenje osnova svakog samadhia, svakog krajnjeg iskustva boanskog.
Poglavlje 3

POTPUNO NASTOJANJE ILI PREDANOST


Izlaganje 3. januara 1975. u Buddha dvorani.
I, 21:

tivrasamveganamasannah.
Onima koji arko ele [asamprajnatasamadhi] je na domaku.

I, 22:

mrdumadhyadhimatratvat tato 'pi vieah.


Postoji nadalje [u relaciji jogin - samadhi pedagoki relevantna] razlika [s
obzirom na injenicu] nedovoljnosti, odmerenosti ili prekomernosti [joginove
motivacije].
I, 23:

ivarapranidhanad va.
U predanosti Uzvienom [nalazi se] takoe [jedan od naina da se dostigne
samadhi].
I, 24:

kleakarmavipakaayairaparamrtah puruaviea ivarah.


[Taj] Uzvieni [ideal] (ivara) predstavlja onu izuzetnu svetranscendirajuu-individualnost (purua), koja je iznad [svega to se javlja kao]
zapreenost [klea) [realizaciji istine], iznad inova i njihovih [neposrednih i posrednih]
plodova (karmavipaka), iznad [svih] determinirajuih ostataka ranijih iskustava
(aaya).
I, 25:

tatra niratiayam sarvajnabijam.


Tu je klica istinskog znanja dostigla svoj najvii domet.

Postoje tri tipa tragaoca. Prvi tip dolazi na stazu zbog radoznalosti. Patanjali to
naziva katuhal. On nije zaista zainteresovan. Kao da je uplovio u to sluajno. Moda je neto
itao. Moda je sluao nekoga da govori o Bogu, istini, krajnjem osloboenju, i zainteresovao
se.
Interesovanje je intelektualno, kao dete koje postane zainteresovano za sve i svaku
stvar, a onda, posle nekog vremena skree daleko od toga jer sve vie i vie ljubopitljivosti
uvek otvara njihova vrata.
Takav ovek nikada nee postii istinu. Iz radoznalosti vi ne moete postii istinu, jer
istina trai istrajan napor, kontinuitet, postojanost, to radoznali ovek ne moe izvriti.
140

Ljubopitljiv ovek moe initi izvesnu stvar za odreeni period vremena prema svojoj udi,
onda nastupa praznina, a u tom procepu sve to je uinjeno iezava, ostaje nedovreno. Opet
e zapoeti od samog poetka, i ista stvar e se dogoditi.
On ne moe ponjeti rezultat. On ne moe zasaditi seme jer ne moe ekati, milioni
novih interesovanja ga uvek pozivaju. On ide na jug, onda se seli na istok, a onda ide na
zapad, onda na sever. On je kao drvo noeno po moru. Ne ide nikuda, njegova energija se ne
kree do pouzdanog cilja. Koja god okolnost ga gurne... On je sluajan, a sluajan ovek ne
moe postii boansko. Moda izvri neku veliku aktivnost, ali to je nekorisno, jer danju e je
on uiniti, a nou ponititi. Istrajnost je potrebna; neprekidno kovanje je nuno.
alaludin Rumi je imao malu kolu - kolu mudrosti. Imao je obiaj da odvede svoje
uenike u polja, na oblinja imanja. Posebno bi na jedan posed odvodio sve svoje nove
uenike da pokae ta se tamo deava. Kad god bi uenik doao, odveo bi ga na to imanje.
Tamo je bilo neto vredno. Seljak je bio primer odreenog stanja uma. Seljak je kopao bunar,
meutim, kopao bi deset stopa, petnaest stopa, a onda bi se predomislio. Ovo mesto nije
naroito dobro" - tako da bi poinjao da kopa drugu jamu, a onda jo jednu.
Ve vie godina on je to radio. Sada je tu bilo osam nedovrenih jama. Celo imanje je
bilo uniteno, a on je radio na devetoj. Jalaludin bi rekao svojim novim uenicima,
Pogledajte, nemojte biti kao ovaj seljak. Da je uloio sav svoj napor u jednu jamu, do sada bi
jama bila barem sto stopa. On je uloio veliki napor, ali nije mogao ekati. Deset, dvanaest,
petnaest stopa, onda mu postane dosadno. Onda zapoinje novu jamu. Na ovaj nain ceo
posed e biti pokriven jamama, a nikada nee biti bunara."
Ovo je radoznao ovek, koji neoekivano ini stvari, a kada zapone, on ima veliko
oduevljenje - zapravo, preveliko. Ovo preveliko oduevljenje ne moe ostati neprekidno. On
zapoinje s takvom snagom i oduevljenjem, tako da znate da e se ubrzo zaustaviti.
Drugi tip oveka koji dolazi do unutranjeg traganja je ovek od istraivanja - jigyasa.
On ne dolazi iz radoznalosti. On dolazi sa jednim jakim traganjem. On podrazumeva to, ali to
takoe nije dovoljno jer njegove namere su u osnovi intelektualne. On moe postati filozof,
ali ne moe postati religiozan ovek. On e istraivati duboko, ali njegovo istraivanje je
intelektualno. On ostaje orjentisan na glavu; to je problem koji treba reiti.
ivot i smrt nisu obuhvaeni; to kod njega nije pitanje ivota i smrti. To je zagonetka,
nereiv problem. On uiva reavajui to ba kao to vi uivate reavajui zagonetku
ukrtenice jer vam prua izazov. To mora da se rei, oseaete se vrlo dobro ako je moete
reiti. Meutim, to je intelektualno, duboko dole ukljuen je ego. Ovaj ovek e postati
filozof. Naporno e raditi. Razmiljae, kontemplirae, ali nikada nee meditirati. Razmiljae
logino, racionalno; nai e mnogo reenja. On e kreirati sistem, ali cela stvar bie njegova
vlastita projekcija.
Istina vas treba totalno. ak i devedeset devet procenata nee delovati; nuno je tano
sto posto vas, a glava je samo jedan procenat. Vi moete iveti bez glave". ivotinje ive
bez glave", drvee ivi bez glave". Glava nije tako bitna stvar u egzistenciji. Vi moete lako
iveti - zapravo, moete mnogo lake iveti bez glave". Ona stvara milione komplikacija.
Glava nije ba apsolutno nuna i priroda zna to. Ona je suvian luksuz. Ako nemate dovoljno
hrane, telo zna gde hrana treba da ide; ono prestaje da je daje glavi.
Zbog toga, u siromanim zemljama, intelekt se ne moe razviti, jer intelekt je luksuz.
Kada je sve zavreno, kada telo u potpunosti dobija sve, samo tada se energija kree prema
glavi. ak i u vaem ivotu se to deava svakog dana, ali niste svesni. Ako pojedete previe
hrane - odmah ete se oseati pospano. ta se deava? Telu je potrebna energija za probavu.
Glava moe biti zaboravljena, energija se kree prema stomaku. Glava osea vrtoglavicu,
pospanost. Energija se ne kree, krv se ne kree, prema glavi. Telo ima svoju vlastitu
ekonomiju.
Postoje osnovne stvari, a ima stvari koje nisu osnovne. Osnovne stvari treba prvo da
budu ispunjene, jer one koje nisu osnovne mogu ekati. Nema velike potrebe za tim. Inae va
stomak ne moe ekati, on mora biti prvo napunjen; ta glad je mnogo osnovnija. Zbog ove
osnovne realizacije mnoge religije su pokuale post, jer ako postite glava ne moe da misli, jer
141

energija nije tako velika; ne moe biti data glavi. Ali ovo je varka. Kada energija bude tu,
glava e zapoeti da misli opet. Ova meditacija je la.
Ako postite dugo, neprekidno za nekoliko dana, glava ne moe da misli. Niste vi
dospeli do ne-uma, do transcendencije; jednostavno u vama ne postoji suvina energija. Telu
je potrebna prvo; telesne potrebe su osnovne, bitne; potrebe glave su sekundarne, suvine. To
je kao da imate jednu ekonomiju u vaoj kui. Ako vae dete umire, vi ete prodati TV aparat.
U tome nema mnogo toga sadranog. Moete prodati nametaj kada dete umire; kada ste
gladni, moete prodati ak i kuu. Prvo osnovne stvari - to je znaenje ekonomije - zatim
druge stvari. A glava je poslednja; ona je samo jedan posto vas, i to takoe suvian. Moete
postojati bez glave".
Moete li postojati bez stomaka? Moete li postojati bez srca? Meutim, moete
postojati bez glave (razmiljanja). A kada posvetite preveliku panju glavi (umu), vi ste
potpuno u neredu. Radite stoj na glavi; shirshasana. Potpuno ste zaboravili da glava nije
bitna.
Kada date samo glavi (umu) da istrauje, to je jigyasa. To je luksuz. Moete postati
filozof i sedeti u fotelji; odmarati se i razmiljati. Filozofi su kao luksuzni nametaj. Ako to
moete priutiti, dobro; ali to nije problem ivota i smrti. Stoga Patanjali kae da ovek
radoznalosti - katuhale - ne moe to dostii; ovek jigyase - istraivanja - postae filozof.
Onda postoji trei ovek koga Patanjali zove ovek mumukshe.
Teko je prevesti re mumuksha, stoga u je objasniti. Mumuksha oznaava elju da se
bude beeljan; elja da se bude potpuno osloboen, elja da se izae iz kruenja egzistencije,
elja da se ne bude roen ponovo, da se ponovo ne umre, oseanje - da je dovoljno - biti roen
milionima puta, umirati stalno i kretati se u istom izopaenom krugu. Mumuksha znai da se
konano ispadne iz samog obrtanja egzistencije. Dosaivan, napaen ovek eli da izae iz
nje. Istraivanje postaje sada pitanje ivota i smrti. itavo vae postojanje je dovedeno u
pitanje. Patanjali kae samo ovek mumukshe, u kome se elja za osloboenjem - moksha probudila, moe postati religiozan ovek, jer je on vrlo, vrlo logian mislilac.
Onda takoe ima tri tipa ljudi koji pripadaju mumuksha kategoriji. Prvi tip oveka koji
pripada mumukshi ulae jednu treinu bia u svoje nastojanje. Ulaui jednu treinu vaeg
bia u vaem nastojanju vi ete postii neto. Ono to dostignete bie negativno postignue;
neete biti napeti - ovo treba shvatiti vrlo duboko - ali, neete biti ni spokojni. Vi neete biti
napeti; napetost e se smanjiti. Ali neete biti ni spokojni, tihi, staloeni. Postignue e biti
negativno. Neete biti bolesni, ali takoe neete biti ni zdravi. Bolest e ieznuti. Neete se
oseati razdraeno, neete oseati frustraciju. Oseaete i ispunjenje, takoe. Negativnost e
otpasti, bodlje e otpasti, ali cvetanje se nee dogoditi.
Ovo je prvi stepen mumukshe. Moete nai mnoge ljude koji su se u njemu zaglavili.
Osetiete izvestan kvalitet u njima: oni ne reaguju, nisu razdraeni, ne moete ih naljutiti, ne
moete ih uznemiriti. Oni su postigli neto, ali jo oseate da neto nedostaje. Oni nisu
oputeni. ak i ako nisu ljuti, nemaju saoseanje ni samilost. Oni moda nisu ljuti na vas, ali
ne mogu oprostiti. Suptilna je razlika. Oni nisu ljuti, to je uredu. Ali ak i ako nisu ljuti ne
postoji opratanje. Oni su oholi, uobraeni.
Oni ne mare za vas, vau uvredu, ve su, na neki nain, iskljueni iz uzajamnog
odnosa. Oni ne mogu sudelovati. Pokuavajui da ne budu ljuti, oni su izali iz svih
uzajamnih odnosa. Postali su kao ostrva - zatvoreni. A kada ste jedno ostrvo, zatvoreni, vi ste
iupani iz korena. Ne moete cvetati, ne moete biti sreni, ne moete imati blagostanje. To
je negativno postignue. Neto je odbaeno, ali nita nije postignuto. Staza je jasna, naravno.
ak je vrlo dobro odbaciti neto, jer sada nastaje mogunost; moete neto postii.
Patanjali zove njih mridu; meki, slabi. Prvi stepen postignua, odricanje ili negiranje.
Nai ete mnoge sannyasine u Indiji, mnoge monahe u katolikim manastirima, koji su
prionuli uz prvi stepen. Oni su dobri ljudi, ali ete otkriti da su dosadni. 34 Vrlo je dobro ne biti
ljut, ali to nije dovoljno. Neto nedostaje; nita pozitivno se nije dogodilo. Oni su prazne

34

Glupavi, jednolini, mlitavi, sumorni, tupi.


142

posude. Oni su ispraznili sebe, ali se na neki nain nisu ponovo ispunili. Ono vie se nije
spustilo, a nie je odbaeno.
Onda postoji drugi stepen mumukshe - drugi stepen istinitog tragaoca - koji ulae sam
dve treine napora. Jo se ne zalae totalno, ve samo osrednje. Zbog osrednjosti, Patanjali
naziva njega madhya - osrednji ovek. On postie neto. ovek prvog stepena je u njemu, ali
neto vie je dodato. On je u tiini - smiren, staloen, sabran. ta god da se desi u svetu, ne
utie na njega. On ostaje nedirnut, izdvojen. On postaje kao planinski vrh; vrlo miran.
Ako doete blizu njega osetiete njegov mir kako vas okruuje; isto kao kada odete u
vrt i miris cvea i pevanje ptica vas okruuju; oni vas dodiruju, to moete osetiti. Sa ovekom
prvog stupnja, mridu, neete osetiti nita. Osetiete samo prazninu - stvorenje nalik pustinji.
Prvi tip oveka e vas isisati. Ako doete blizu njega, osetiete da ste ispranjeni - neko vas je
isisao, jer je on pustinja". S njim ete osetiti da ste isueni, i bojaete se.
Ovo ete osetiti s mnogim sannyasinima. Ako im priete blizu, osetiete da vas
isisavaju, ne znajui to. Oni su postigli prvi stepen. Oni su postali prazni, a sama praznina je
postala kao jama i ona vas automatski usisava.
Reeno je na Tibetu da, ako je ovaj ovek prvog stepena negde, ne treba mu dozvoliti
da se kree u gradu. Kada lame na Tibetu dostignu prvi stupanj, njima je zabranjeno da izlaze
van manastira - jer ako ovaj ovek doe blizu vas, on usisava. To sisanje je izvan njegove
kontrole; on ne moe uiniti nita u pogledu toga. On je kao pustinja. Sve to doe blizu njega
biva usisano, iskorieno.
Lamama prvog stupnja nije dozvoljeno da dodiruju drvo, jer je zapaeno da drvo
umire. ak i na Himalajima, hindu sannyasinu nije dozvoljeno da dodiruje drvee - ono e
umreti. On je sisajui fenomen. Ovom lami prvog stepena nije dozvoljeno da prisustvuje
niijem venanju, jer e postati destruktivna sila. Njemu nije dozvoljeno da blagoslovi
nikoga, jer on ne moe blagosloviti. ak i kada blagosilja, on isisava. Vi moda ovo niste
znali, da su za ove lame prvog stepena, sannyasine, sadhue, stvoreni manastiri, tako da mogu
iveti u svom vlastitom zatvorenom svetu, nije im dozvoljeno da se kreu van. Dok ne
postignu drugi stupanj, nije im dozvoljeno da blagosiljaju nikoga.
Tragalac drugog stepena koji je uloio svoje dve treine bia postaje miran, spokojan.
Ako mu priete blizu, on se uliva u vas, on uestvuje, deli. Sada on vie nije pustinja, sada je
zelena uma. Mnoge stvari nadolaze u njemu - tiho, smireno, blago. Vi ete osetiti to.
Meutim ovo takoe nije cilj; mnogi su se zalepili u tome. Nije dovoljno jednostavno biti
smiren. Koja je to vrsta postignua? Samo da se bude smiren? To je kao smrt, nema kretanja,
nema aktivnosti. Vi ste u spokojstvu, naravno, kod kue naravno, ali nema slavljenja, nema
blaenstva.
Tragalac treeg stepena ulae svoju celokupnost u to i stie do blaenstva. Blaenstvo
je pozitivan fenomen; mir je upravo na putu. Kada blaenstvo doe blie, vi postanete mirni.
To je udaljeni uticaj blaenstva koje stie blizu vas. To je kao pribliavanje reci; s velike
udaljenosti vi poinjete da oseate da vazduh osveava, kvalitet zelenila se menja. Drvee je
zelenije s vie listova. Vazduh je sve. Reku jo niste videli, ali je ona negde blizu, izvor vode
je negde blizu. Kada je izvor ivota negde blizu, vi postajete mirni, ali jo (to) niste dostigli upravo ste na putu. Patanjali zove takvog oveka madhya; proseni ovek.
On takoe nije cilj. Dok ne moete plesati sa ekstazom... Ovaj ovek ne moe plesati,
ovaj ovek ne moe pevati, jer pevanje e izgledati kao ometanje mira, ples e izgledati
besmislen - ta vi to radite? Ovaj ovek moe samo sedeti kao mrtva statua - tih, naravno, ali
ne cvetajui; zelen, ali cvetovi se jo nisu dogodili; poslednji in nije nastupio. Onda postoji
ovek treeg stepena koji moe da plee, koji e izgledati lud jer ima toliko mnogo. On se ne
moe obuzdati, i zato to se ne moe uzdrati pevae, igrae i delie, bacae kad god moe
seme koje ga zapljuskuje neogranieno. Ovo je ovek treeg stepena.
Patanjali kae:
Uspeh je blii onima iji su napori intenzivni i iskreni.
Izgledi za uspeh variraju prema stepenu nastojanja.
143

Uspeh je blii onima iji su napori intenzivni i iskreni.


Nuna je vaa celokupnost. Zapamtite, iskrenost je kvalitet koji se deava kad god ste
u neemu totalno, ali ljudi veim delom nisu u pravu u svojim zamislima iskrenosti. Oni misle
da biti ozbiljan znai biti iskren. Biti ozbiljan ne znai biti iskren. Iskrenost je kvalitet koji se
deava kad god ste potpuno u neemu. Dete koje se igra sa svojim igrakama je iskreno,
potpuno u tome, apsorbovano, nita ne preostaje u pozadini, nema zadravanja pozadine; ono
nije tu, samo se igra odvija.
Budui da se ne drite niega, gde ste vi? Vi ste potpuno postali jedno sa delovanjem.
Delatelj vie ne postoji, inilac vie nije tu. Kada inioca nema, postoji iskrenost. Ne moete
biti ozbiljni, jer ozbiljnost pripada iniocu. Dakle, u damijama, hramovima, crkvama, nai
ete dva tipa ljudi - iskrene i ozbiljne. Ozbiljni e biti sa izduenim licima, kao da rade vrlo
vanu stvar - neto sveto, neto iz drugog sveta. Ovo je takoe ego, kao da inite neto veliko,
kao da obavezujete ceo svet time to se molite.
Pogledajte religiozne ljude - takozvane religiozne ljude - oni hodaju na takav nain
kao da usluuju ceo svet. Oni su so zemlje. Ako oni ieznu, itava egzistencija e ieznuti.
Oni je podravaju. Zbog njih ivot postoji - zbog njihovih molitvi. Nai ete da su oni
ozbiljni.
Ozbiljnost pripada egu, iniocu. Pogledajte oca koji radi u trgovini, ili negde u
kancelariji. Ako voli svoju enu, svoju decu, bie ozbiljan jer to je dunost. On ini to, i
obavezuje svakoga okolo. On e rei: Ja to radim za moju enu, za moju decu." Taj ovek e
sa svojom ozbiljnou postati mrtav kamen koji visi oko vrata njegove dece, a ona nikada
nee moi to da mu oproste jer nikada nije voleo.
Ako volite, vi nikada ne izgovarate takve rei. Ako volite svoju decu, idete pleui u
svoju kancelariju. Vi volite njih, to nije neto ime ih obavezujete. Vi ne izvravate dunost;
to je vaa ljubav. Sreni ste to vam je dozvoljeno da uradite neto za svoju decu. Sreni ste i
blaeni da moete uiniti neto za svoju enu jer ljubav osea takvu bespomonost; ljubav eli
da uini toliko mnogo stvari, a ne moe uiniti. Ljubav uvek osea: ta god da inim manje
je nego to treba da se uini." A dunost? Dunost uvek osea: inim vie nego to je
potrebno." Dunost postaje ozbiljna; ljubav je iskrena. Ljubav je biti sasvim sa nekom
osobom, biti tako potpuno s osobom da dunost iezava - barem na momente - ne postoji
dualnost, jedan postoji u dvoje, izvreno je premoavanje. Ljubav je iskrena, nikada ozbiljna.
Kad god moete staviti svoje ukupno bie u neto, to postaje ljubav. Ako ste batovan i volite,
vi unosite celo svoje bie u to. Onda se iskrenost deava.
Iskrenost ne moete kultivisati. Ozbiljnost moete kultivisati, ali iskrenost ne.
Iskrenost je senka totalnog postojanja u neemu. Patanjali kae:
Uspeh je blii onima iji su napori intenzivni i iskreni.
Naravno, nije nuno rei intenzivni i iskreni. Iskrenost je uvek intenzivna. Zato onda
Patanjali kae intenzivni i iskreni (napori)? Iz odreenog razloga. Iskrenost je uvek
intenzivna, ali intenzivnost nije uvek nuno iskrena. Vi moete biti jaki u neemu, ali ne i
iskreni, moete da ne budete iskreni. Otuda, on dopunjava blie odreenje, intenzivno i
iskreno, jer moete biti jaki ak i u vaoj ozbiljnosti. Moete biti jaki samo sa delom svoga
bia, moete biti moni u odreenoj sklonosti, moete biti intenzivni u svojoj ljutnji, vi
moete biti estoki u svojoj poudi, moete biti moni u milionima stvari, a moete da ne
budete iskreni, jer iskrenosti pripadate kada ste totalno u njoj.
Moete biti moni u seksu, a moete da ne budete iskreni, jer seks nije nuno i ljubav.
Moete biti vrlo, vrlo estoki u svojoj seksualnosti - ali kada je jednom seksualnost
zadovoljena, ona je okonana, estina nestaje. Ljubav moe da ne izgleda tako jaka, ali je
iskrena - a stoga to je iskrena, snaga joj je trajna. Zapravo, ako ste stvarno u ljubavi to
postaje bezvremeno. To je uvek jako. Nainite jasnu razliku; ako ste jaki bez iskrenosti, ne
moete biti zauvek jaki. Samo trenutno moete biti moni; kada se elja probudi vi ste moni.
To nije zaista vaa mo. To je iznueno eljom.
Seks se pojavi. Vi oseate glad, udnju. itavo telo, itava bioenergija trai
oslobaanje; vi postajete moni. Ali ta snaga nije vaa; to uopte ne dolazi iz vaeg bia. To je
upravo samo iznueno od biolokih naslaga oko vas; to je telesno nametanje vaem biu. To
144

ne dolazi iz centra. To je nametnuto sa periferije. Vi ete biti jaki, a onda kada je seks izvren,
mo nestaje, onda ne marite za enu.
Mnoge ene su mi rekle kako oseaju da su obmanute, oseaju da su prevarene,
oseaju se iskoriene, jer kad god vode ljubav s muevima, u poetku kad oseaju da su tako
zaljubljeni, tako jako oseajni; srene su. Ali onog momenta kada se seks zavri, oni se
okreu i odlaze da spavaju. Uopte ne mare ta se dogaa sa enom. Nakon voenja ljubavi,
vi ak ne kaete ni do vienja, i ne zahvalite se; ena se osea iskorienom.
Vaa snaga je bioloka, telesna; nita ne dolazi iz vas. U seksualnoj jaini postoji
predigra, ali ne i igra" posle ina. Ta re stvarno ne postoji. Video sam hiljade napisanih
knjiga o seksu; re afterplay" ne postoji. Koji je to tip ljubavi? Telesna potreba je ispunjena,
okonana. ena je bila iskoriena, sada je moete odbaciti kao kada upotrebite neto a onda
odbacite - na primer, plastinu ambalau - iskoristite, a onda bacite. Zavreno! Kada se elja
probudi, onda opet gledate enu, i za tu enu ste jako strastveni.
Ne, Patanjali ne misli na taj tip strastvenosti, siline. Uzeo sam seks da bih vam
objasnio, jer je to jedina snaga, strast, koja je preostala u vama. Nije mogu drugi primer. Vi
ste postali tako mlaki u svom ivotu, postojite na tako niskom nivou energije da ne postoji
silina. Nekada kada krenete u kancelariju, samo stanite na uglu ulice dok ljudi ure prema
svojim kancelarijama; posmatrajte samo njihova lica - sanjiva.
Kuda idu? Zato idu? Izgleda kao da nemaju nigde drugde da odu, stoga odlaze na
dunost. Oni tu ne mogu pomoi; jer ta e raditi kod kue? Stoga odlaze u kancelariju,
dosadno, automatski, poput robota, odlaze jer svako ide na dunost i vreme je za odlazak. ta
da se ini ako ne elite da idete? Praznici postaju takva patnja, nema siline. Vraajui se
natrag - pogledajte ljude uvee; vraaju se natrag kuama ne znajui zato se ponovo vraaju,
meutim nema se gde otii, ivot se na neki nain vue. Mlaka pojava, slabe energije.
Zbog toga sam uzeo primer seksa - jer ja ne mogu nai neku drugu snagu u vama. Vi
ne pevate, ne pleete, nemate nikakvu mo. Vi se ne smejete, ne plaete. Sva snaga je nestala.
U seksu, malo snage ima; a to je takoe zbog prirode - ne od vas.
Patanjali kae: snano i iskreno". Religija je zaista kao seks - dublja nego seks, via
nego seks, svetija nego seks, ali slina seksu. To je jedan individualan susret sa celinom; to je
duboki orgazam. Vi se stapate sa celinom, potpuno iezavate. Molitva je kao ljubav. Yoga, u
stvari, sama re yoga" znai susretanje, sjedinjavanje, susret dvoje - tako dubok, snaan i
iskren susret da dvoje iezavaju. Granice postaju zamagljene i samo jedno postoji. To ne
moe biti na bilo kom putu. Ako niste iskreni i jaki, ako ne dajete vae totalno postojanje
(bie). Samo onda je mogue najvie. Morate se sami odluiti, manje od toga nee delovati.
Izgledi za uspeh variraju prema stepenu nastojanja.
Ovo je jedan put - put volje. Patanjali se u osnovi bavi stazom volje, ali on zna, on je
svestan, da druga staza takoe postoji, stoga on daje upravo fusnotu.
Ta fusnota je:
Ishwarapranidhanatwa: Uspeh takoe postiu oni koji se predaju Bogu.
Upravo ova fusnota treba da naznai da druga staza takoe postoji. Ovo je staza volje intenzivan trud, iskren, potpun. Daj svoju celovitost tome. Inae Patanjali je svestran; svi oni
koji znaju, jesu svestrani. Patanjali je vrlo obazriv, on je vrlo nauan um; nee ostaviti
nijednu sitnicu". Ali ovo nije njegova staza, stoga on jednostavno daje fusnotu upravo da
podseti da druga staza postoji.
Ishwarapranidhanatwa: Uspeh takoe postiu oni koji se predaju Bogu.
Trud ili predanost, meutim, osnovna stvar je ista; potrebna je celovitost. Staze se
razlikuju. Ali se ne mogu potpuno razlikovati. Njihov oblik, njihov pravac moe da se
razlikuje, ali njihovo unutranje znaenje i vanost treba da ostane isto jer oboje vode do
boanskog. Trud trai vau celovitost. Predanost takoe zahteva vau celovitost. Tako za
mene postoji samo jedna staza, a to je: dajte svoju celovitost.
Bilo da je dajete kroz trud - yoga - to zavisi od vas, ili je dajete kroz samarpan predanost, preputanje - to zavisi od vas. Ali zapamtite da je totalnost uvek potrebna; morate
145

uloiti sebe potpuno. To je igra - kockanje s nepoznatim. A niko ne moe rei kada e se to
dogoditi - niko ne moe predvideti, niko vam ne moe dati garanciju. Vi se kockate. Moete
pobediti, moete izgubiti. Mogunost da ne pobedite je uvek prisutna jer je to vrlo sloen
fenomen. To nije jednostavno kao to izgleda. Inae, ako nastavite da se kockate, to se mora
desiti jednog dana.
Ako ne postignete cilj odjednom, nemojte biti snudeni, jer ak i Buddha je bio
prinuen da ne postigne cilj mnogo puta. Ako ne postignete cilj, samo ustanite i odluite se da
ponovo rizikujte. Ponekad, na neki nepoznat nain, itava egzistencija se angauje da vam
pomogne. Ponekad na neki nepoznat nain, vi pogaate cilj tano i u pravo vreme kada su
vrata bila otvorena. Ali morate pogaati mnogo puta. Nastavljate da bacate svoje strele
svesnosti. Ne brinite o rezultatu. Vrlo je mrano i cilj nije odreen, on nastavlja da se menja.
Tako da vi nastavljate da bacate svoju strelu u mrak. Mnogo puta ete promaiti, a ja vam
kaem, ne budite potiteni. Svako promai mnogo puta, tako je to. Ali ako s tim nastavite i ne
budete potiteni, to e se dogoditi. To se uvek dogaalo. Zbog toga je potrebno beskonano
strpljenje.
ta je predavanje Bogu? Kako se moete pokoriti? Kako e predanost postati mogua?
To takoe postaje mogue ako ulaete velike napore, a nastavljaju se neuspesi. Vi inite
mnoge napore, zavisite od samog sebe; napor zavisi samo od vas. To je snaga volje - staza
volje. Vi zavisite od sebe. Vi ne uspete, i ne uspete, i ne uspete. Ustanete, opet padnete (ne
uspete), ustanete opet, i ponovo ponete da hodate. Kada niste uspevali i niste uspevali, onda
dolazi momenat da uvidite da je va napor uzrok, jer va napor je ostao va ego.
To je problem staze volje. Jer ovek koji radi na stazi volje - ulaui napore, metode,
koristei tehnike, radei ovo i ono - prinuen je da akumulira odreen oseaj ja jesam". Ja
sam vii, nadmoniji, poseban izuzetan. Ja radim ovo i ono - odricanje, post, sadhanu. Toliko
toga sam uradio."
Na stazi volje ovek mora biti vrlo, vrlo oprezan prema egu, jer ego e obavezno
izbiti. Ako moete posmatrati ego, a da ne akumulirate ego, nije nuno predavati se - jer ako
nema ega, nema ta da se predaje. Ovo treba shvatiti vrlo, vrlo duboko. A kada razumete pokuavanje da se razume Patanjali - vrlo je bitna stvar.
Ako za mnogo ivota neprekidno ulaete svoj napor, ego je prinuen da se pojavi.
Morate biti vrlo paljivi. Treba da radite, treba da ulaete velike napore, ali nemojte gojiti
ego. Onda nema potrebe za predavanjem, moete pogoditi cilj bez predavanja. Nema potrebe
jer bolest ne postoji.
Ako je ego prisutan, onda se javlja potreba za predavanjem. Zbog toga Patanjali kae
- nakon govora o snanom, iskrenom totalnom naporu, on iznenada kae Ishwarapranidhanatwa: Uspeh takoe postiu oni koji se predaju Bogu.
Ako konstantno ne uspevate, onda zapamtite da neuspeh nije zbog boanskog.
Neuspeh se deava usled vaeg ega, odakle je strela baena, iz izvora vaeg bia, tamo se
neto dogaa - diverzija. Ego se sabira tamo. Onda postoji samo jedna mogunost: predajte
ga! Niste imali uspeha s njim totalno, na toliko mnogo naina. inili ste ovo i ono, pokuavali
ste da uradite ovo i ono, i niste uspevali, podbacili ste, i niste postigli cilj. Kada prepreka
postane konana i ne znate ta da inite, Patanjali kae: Sada, predajte se Bogu."
Patanjali je vrlo neobian u ovom smislu. On ne veruje u Boga; on nije boji vernik.
Bog je takoe tehnika. Patanjali ne veruje u nekog Boga, da postoji neki Bog. Ne, on kae
Bog je tehnika. Oni koji nisu uspeli, za njih je ova tehnika - konano. Takoe ako ne uspete u
tome, ne postoji put. Patanjali kae da to nije pitanje da li Bog postoji ili ne; uopte nije stvar
u tome. Stvar je da je Bog hipotetiki. Bez Boga bilo bi teko predati se. Vi ete pitati,
Kome?"
Stoga Bog je upravo hipotetika stvar, jednostavno da pomogne predavanju. Kada ste
se predali znaete da nema Boga, ali to se deava kada ste se predali i kada ste spoznali. Za
Patanjalija ak i Bog je hipoteza, pretpostavka da vam se pomogne. To je la. Zbog toga sam
vam rekao da je Patanjali lukav uitelj. Samo da bi pomogao. Predanost je osnovna stvar, ne
146

Bog. Ovu razliku morate zapaziti, jer postoje ljudi koji misle da je Bog osnovna stvar - zato
to ima Boga, vi se predajete.
Patanjali kae da zato to se morate predati, pretpostavljate Boga. Bog je
pretpostavljena stvar. Kada se budete predali, smejaete se. Ne postoji Bog, kao jedna stvar;
postoje bogovi - ne Bog - mnotvo bogova, jer kad god se predate vi postajete Bog. Nemojte
biti zbunjeni sa Patanjalijevim Bogom i judeohrianskim Bogom. Patanjali kae: Bog je
potencijalnost svakog bia. ovek kao da je seme Boga - svaki ovek. A kada seme procveta,
doe do ispunjenja, postalo je Bog. Dakle, svaki ovek, svako bie, postae na kraju Bog.
Bog" oznaava upravo najvii vrhunac, krajnje cvetanje. Ne postoji Bog, samo ima
bogova - beskonano bogova. Ovo je potpuno razliita koncepcija. Ako pitate muslimane, oni
e rei da postoji samo jedan Bog. Ako pitate hriane, oni e takoe rei da postoji samo
jedan Bog. Meutim, Patanjali je vie nauan. On kae Bog je mogunost. Svako nosi tu
mogunost unutar srca. Svako je samo seme, potencijalnost da postane Bog. Kada doprete do
najvieg, izvan kojeg nita ne postoji, vi postajete Bog. Mnogi su postigli to pre vas, mnogi e
postii posle vas.
Svako na kraju postaje Bog, jer svako je potencijalno Bog, beskonano bogova. Zbog
toga je hrianima postalo teko da to shvate. Vi zovete Ramu bogom, vi nazivate Krinu
bogom, zovete Buddhu bogom, vi nazivate Mahaviru bogom. ak i Radnea nazivate
bogom.
Za hrianina je to postalo nemogue da se razume. ta inite? Za njih samo jedan
Bog postoji koji je stvorio svet. Za Patanjalija niko nije stvorio svet. Milioni bogova postoje,
i svako je na putu da postane Bog. Bilo da vi to znate ili ne, vi nosite Boga u svojoj utrobi.
Moete da ne primetite to mnogo puta, ali kako to najzad moete propustiti? Ako nosite to u
sebi, jednog dana seme e procvetati. Ne moete potpuno propustiti to.
Ovo je totalno razliita koncepcija. Hrianski Bog izgleda kao diktator, dominira
itavom egzistencijom. Patanjalijev je vie demokrata - nije despot, nije diktator, nije Staljin,
nije car koji sedi na najviem tronu, sa svojim jedino roenim sinom Hristom sa strane i
apostolima okolo. To je besmislica. itav koncept kao da je nainjen prema liku imperatora
na prestolu. Ne, Patanjali je apsolutno demokrata. On kae da je pobonost svaiji kvalitet.
Vi nosite to; od vas zavisi da li ete ga dovesti do njegove potpunosti. Ako ne elite, to je
takoe na vama.
Niko ne sedi kao despot nad svetom; niko vas ne prisiljava ili stvara. Sloboda je
apsolutna. Vi moete greiti zbog slobode, moete se udaljavati zbog slobode. Vi patite zbog
slobode, a kada to razumete, nije potrebno da patite; moete se vratiti natrag, to je takoe
usled slobode. Niko vas ne vraa natrag, i nee biti sudnjeg dana. Nema nikog da vam sudi,
izuzev vaeg vlastitog bia. Vi ste inilac, vi ste sudija, vi ste kriminalac, vi ste zakon. Vi ste
sve! Vi ste minijaturna egzistencija.35
Bog je vrhovni vladar. On je individualna jedinica boanske svesti. On je netaknut od
nesrea ivota, delovanja i njegovih rezultata.
Bog je stanje svesti. To nije osoba, zaista, ali je individualan", tako da ete morati da
razumete razliku izmeu linosti i individualnosti. Linost je periferija. Kako vi izgledate
drugima, to je vaa linost. Vi kaete: Prefinjena linost, lepa linost, runa linost" - kako vi
izgledate drugima. Vaa linost je izbor, miljenje drugih o vama. Ako ste sami na zemlji,
hoete li imati ikakvu linost? Nikakvu linost, jer ko e rei da ste lepi, ko e rei da ste
glupi, i ko e rei da ste veliki voa ljudi? Nikoga nema da kae bilo ta o vama. Miljenje
nee postojati, vi neete imati nikakvu linost. Re linost dolazi od grke rei persona. U
grkoj drami, glumci su koristili maske. Ove maske su se zvale persona. Od te persone dolazi
re personality (linost). Lice koje nosite kada gledate u svoju enu i osmehujete se, to je
linost - persona. Vi ne oseate da elite da se osmehujete, ali se morate osmehivati. Gost
doe i vi mu iskaete dobrodolicu, a duboko ispod nikada niste eleli da vam doe, duboko
35

Mikrokosmos.
147

dole vi ste uznemireni - ta sada da radim s ovim ovekom?" - ali se osmehujete, iskazujete
dobrodolicu i govorite Tako sam radostan".
Linost je ono to vi uzimate, stav koji stavljate na lice, maska. Ali ako nema nikoga u
vaem kupatilu, nemate nikakvu linost dok ne pogledate u ogledalo. Onda odmah linost
dolazi jer vi sami poinjete da vrite rad drugog miljenja. Gledate u lice i kaete, Lepo".
Sada ste podeljeni, sada ste vi dvoje, dajui miljenje o sebi. Inae u kupatilu kada nema
nikoga, a vi se uopte ne plaite da vas neko posmatra kroz kljuaonicu... Jer ako neko gleda
kroz kljuaonicu, linost ulazi unutra, vi poinjete da se ophodite.
Samo u kupatilu vi odbacujete linost. Zbog toga je kupatilo tako osveavajue. Iz
kupanja izlazite tako lepi, svei, bez linosti; vi postajete individua. Individualnost je ono to
vi jeste; linost je ono to vi pokazujete da jeste. Linost je vae lice, individualnost je vae
bie, bivanje. Bog u Patanjalijevoj koncepciji, nema linost. On je jedna individualna
jedinica. Kada sazrite, ubrzo, miljenje drugih postaje detinjasto. Ne brinete o njima;
beznaajno je ta oni kau. Ono to oni kau nije to to nosi znaenje. To ste vi, ono to vi
jeste nosi znaenje, ne ono ta oni kau, Lepo". To je beskorisno. Ako ste lepi, to je glavna
stvar. ta oni kau je nevano. ta vi jeste - stvarno, autentini vi - to je vaa individualnost.
Kada odbacite linosti, vi postajete sannyasin, postajete individualna jedinica. Sada
ivite kroz svoj autentini centar. Ne pozirate. Kada ne pozirate, niste zabrinuti. Kada ne
pozirate, vi ste nedirnuti onim to drugi kau. Kada ne pozirate, ostajete izdvojeni. Linost ne
moe ostati izdvojena. To je vrlo lomljiva stvar. To postoji izmeu vas i drugog, i to zavisi od
drugog. On se moe predomisliti, moe vas potpuno unititi. Pogledate enu koja se smei, i
oseate se lepo zbog njenog smeka. A ako se ona jednostavno preobrati sa mrnjom u svojim
oima, vi ste jednostavno smodeni. Zapravo, vi ste smodeni jer je vaa linost baena pod
noge. Ona vas je pregazila, ak vas nije ni pogledala.
Svakog momenta se bojite da neko moe slomiti vau linost. Onda ceo svet postaje
jedna briga. Bog ima jednu individualnost, ali ne linost. ta god da on jeste, to je ono to on
pokazuje. ta god da je on unutra, on je spolja. Zapravo, unutra i spolja iezavaju za njega.
Bog je najvii.
U engleskom je to prevedeno: bog je vrhovni vladar. Zbog toga kaem da postoji
nerazumevanje o Patanjaliju. Na sanskritu on ga naziva purusha-vishesha - vrhovno bie, ne
vladar. Ja bih voleo da prevedem Bog" kao najvii, vrhovni". On je individualna jedinica
boanske svesti - individualna, ne univerzalna, jer Patanjali kae svaka individua je Bog.
On je netaknut od nesrea ivota, delovanja i njegovih rezultata.
Zato? Jer to vie postanete individua, vie ivot uzima razliit kvalitet. Nova
dimenzija se otvara - dimenzija igre. to se vie bavite s linou i spoljanjim, ljuskom,
periferijom... Vaa dimenzija ivota je dimenzija rada; zabrinuti oko rezultata, zabrinuti o
tome da li ete dostii cilj ili ne, uvek zabrinuti da li e vam stvari pomoi ili ne, ta e se
dogoditi sutra.
ovek iji je ivot postao igra ne brine se za sutra, jer on postoji samo danas. Isus
kae: Pogledajte ljiljane. Tako su lepi," jer za njih ivot nije rad. Pogledajte reke, pogledajte
zvezde. Izuzev oveka, sve je lepo i sveto jer itava egzistencija je igra. Niko se ne brine oko
rezultata. Da li se drvo brine hoe li e cvetovi doi ili ne? Da li se reka brine hoe li dostii
okean ili ne? Izvan oveka, ne postoji briga. Zato je ovek zabrinut? Zato to gleda ivot kao
borbu a ne kao igru - a itava egzistencija je igra.
Patanjali kae: kada ovek postane usredsreen u sebi, on postaje igra; on se igra.
ivot je igra i to je lepo; nije potrebno brinuti o rezultatu. Rezultat nije vaan, to je
jednostavno nevano. Stvar koju radite u sebi ima vrednost. Ja vam govorim; vi me sluate.
Ali vi sluate sa svrhom, a ja govorim bez cilja. Vi sluate sa svrhom, jer kroz sluanje vi ete
postii neto - neko znanje, neka reenja, neke tehnike, metode, neko razumevanje, a onda
ete otii da ih odradite. Vi ste za rezultat. Ja vam govorim bez cilja. Ja jednostavno uivam.
148

Ljudi me pitaju: Zato nastavlja da govori svakog dana?" Ja uivam, to je upravo


kao to ptice pevaju. Kakva je svrha? Pitajte ruu zato nastavlja da cveta? Koja je svrha? Ja
vam govorim jer ovo deljenje mene samog s vama je samo po sebi vrednost, to ima istinsku
unutranju vrednost. Ja ne traim rezultat; nisam zabrinut da li ete vi biti preobraeni kroz
ovo ili ne. Ne postoji zabrinutost. Ako vi mene sluate, to je sve. Ako niste ni zabrinuti, onda
se preobraaj moe dogoditi ba ovog momenta. Zato to ste zabrinuti kako ete to iskoristiti bilo ta to kaem, kako da koristite to, ta da se radi oko toga...
Vi ste ve u budunosti. Vi niste ovde; ne igrate igru. Vi ste u radionici ili na
seminaru. Vi igrate igru. Razmiljate da dobijete neke rezultate iz toga, a ja sam apsolutno
beskoristan. Tako ja delim sebe s vama. Ja ne govorim da se radi neto u budunosti; ja
govorim jer se upravo sada, kroz ovo deljenje, neto deava, a to je dovoljno.
Zapamtite rei: svojstvena unutranja vrednost", i nainite svaki svoj in jednom
svojstvenom unutranjom vrednou. Ne brinite oko rezultata - jer onog momenta kada
razmiljate o rezultatu, ta god da inite postaje sredstvo, a cilj je u budunosti. Nainite
sredstva sama ciljem; nainite stazu ciljem. Nainite upravo ovaj trenutak najviim; ne postoji
nita izvan njega. Ovo je stanje Boga i kad god igrate, vi imate neka kratka vienja tog stanja.
Deca se igraju, i ne moete nai nita boanstvenije od dejeg igranja. Otuda Isus
kae: Dok ne postanete kao deca, neete ui u carstvo Boije." Postanite slini deci.
Znaenje nije da se postane detinjast, jer da se bude detinjast potpuno je razliita stvar; a da se
bude slian deci totalno je razliita stvar. Detinjasto treba da bude odbaeno. To je
mladalako, neozbiljno. Treba da se poveava slinost deci. To je nevinost - besciljna
nevinost. Profit donosi otrov; rezultat vas truje. Onda se nevinost gubi.
Bog je vrhovni. On je individualna jedinica boanske svesti. On je netaknut od nesrea
ivota, delovanja i njegovih rezultata.
Moete postati Bog upravo sada jer ste ve to - samo stvar treba da se realizuje, shvati.
Vi ste ve ono to mislite da treba da budete.36 Nije potrebno da izrastete u Boga. Zaista, treba
da shvatite da ste ve to. Ovo se dogaa kroz predanost.
Patanjali kae: verujte u Boga, imajte poverenje u Boga tamo, negde, visoko u
univerzumu, na vrhu, i predajte se. Taj Bog je upravo oslonac, pomaga koji pomae
predavanje. Kada se predavanje dogodi, vi postajete Bog, jer predavanje znai: Sada se ne
bavim rezultatom, ne interesujem se za budunost, ne brinem se za sebe uopte. Ja se
predajem."
Kada kaete: Ja se predajem", ta se predaje? Ja - ego. A bez ega kako moete misliti
o svrsi, rezultatu? Ko e misliti o tome? Onda se preputate. Onda idete gde god to vodi. Sada
itava volja odluuje; vi ste se predali svojoj odluci. Patanjali kae da postoje dva puta.
Uinite napor totalnim. Ako ne akumulirate ego, onda taj totalni napor e postati predanost u
sebi. Ako akumulirate ego, onda postoji put; predanost Bogu.
U Bogu seme je razvijeno do svog najvieg opsega.
Vi ste seme, Bog je manifestacija. Vi ste seme, a Bog je ostvarenje. Vi ste
potencijalnost, on je aktuelnost. Bog je vaa sudbina, i vi nosite tu svoju sudbinu ve mnogo
ivota, a ne vidite je, jer vae oi su fiksirane negde u budunost. One ne gledaju u sadanjost.
Sada je ovde sve kao to treba da bude ako ste spremni da gledate. Nita nije potrebno;
nikakvo injenje nije potrebno. Egzistencija je savrena svakog pojedinog trenutka. Ona
nikada nije bila nesavrena, jer onda kako bi postala savrena? Ko bi je onda nainio
savrenom?
Egzistencija je savrena; uopte nita nije potrebno da se uradi. Ako ovo razumete,
predanost je onda dovoljna. Nema napora, nema pranayame, nema bhastrike, nema
shirshasane, nema yoga asana (poloaja), nema meditacije, niega, ako razumete ovo da je
egzistencija savrena kakva jeste. Pogledajte unutra, pogledajte spolja; sve je tako savreno da
nita ne moe da se uradi osim slavljenja. ovek koji se predaje zapoinje slavlje.
36

I samim miljenjem o tome odvajamo se od onoga to jesmo ovde i sada, projektujemo se u vreme, nae
"ostvarenje" je vazda u budunosti. Otuda nunost transcendencije uma.
149

Poglavlje 4

NAI UVEK PRISUTNI CVET


Izlaganje 4. januara 1975. pre podne u Buddha dvorani.
Prvo pitanje:
Molimo vas, objasnite kako seme moe procvetati bez vremenskog razmaka.
Seme moe procvetati bez procepa, bez vremenskog rastojanja, jer seme ve cveta. Vi
ste ve ono to postajete. Da nije tako, onda se seme upravo sada ne bi moglo razviti u cvet.
Onda vreme ne bi bilo potrebno. Onda zen nije mogu. Onda je samo Patanjali put.
Ako treba da postanete neto, nuan e biti proces vremena. Ovo je poenta koju treba
razumeti; svi oni koji su upueni u znanje, takoe su saznali da je postajanje san. Vi ve
postojite; savreni ste kakvi jeste.
Nesavrenstvo se javlja kada ste vrsto uspavani. Cvet ve cveta; samo vae oi su
zatvorene. Ako seme nije stiglo do cvetanja, onda e mnogo vremena trebati, a to nije obian
cvet; Bog e da se rascveta u vama. Onda ak ni venost nee biti dovoljna, onda je to gotovo
nemogue. Ako morate procvetati, onda je to gotovo nemogue. To se nee dogoditi; to se ne
moe dogoditi. Bie potrebna venost.
Ne, nije u tome stvar. To se moe dogoditi odmah sada, ba ovog trenutka. ak ni
jedan trenutak ne mora da bude izgubljen. Nije stvar u tome da seme postaje cvet. Stvar je u
otvaranju oiju. Vi moete sada odmah otvoriti svoje oi, i onda ete otkriti da je cvet uvek
cvetao. Nikada to nije drugaije; nikada nije moglo biti drugaije. 37
Bog je uvek prisutan u vama; samo pogled i on je manifestovan. Nije on bio skriven u
semenu; vi niste gledali u to. Dakle, samo toliko je potrebno - da pogledate u to. ta god da
ste vi, pogledajte u to, postanite svesni toga. Ne kreite se kao mesear.
Zbog toga je saopteno da su se mnogi zen majstori grohotom smejali kada su postali
probueni. Njihovi uenici nisu mogli razumeti, njihovi saputnici nisu mogli razumeti ta se
dogodilo. Zato ludo urliu? emu taj smeh? Oni su se smejali zbog opte besmislenosti.
Traili su ono to su ve bili, trali su za neim to je ve bilo u njima; traili su neto negde
drugde to je bilo skriveno u samom tragaocu.
Tragalac je traen; putnik je cilj. Ne treba da stignete negde drugde. Vi samo treba da
stignete do sebe. Ovo se moe dogoditi za jedan trenutak; ak i deli trenutka je dovoljan.
Ako seme treba da postane cvet, onda venost nije dovoljna jer to je cvet od Boga. Ako ste
ve Bog, onda upravo pogledajte natrag, pogledajte unutra, tada se to moe dogoditi.
Onda emu Patanjali? Patanjali je potreban zbog vas. Vama treba toliko mnogo
vremena da izaete iz sna, treba vam toliko mnogo vremena da izaete iz vaih snova, tako
ste mnogo angaovani u snovima, toliko ste mnogo investirali u svoje snove, zbog toga je
potrebno. Vreme nije potrebno jer seme treba da postane cvet; vreme je nuno jer ne moete
otvoriti svoje oi. Sa zatvorenim oima toliko ste postali naviknuti, to je postalo jaka navika.
Ne samo to; vi ste sasvim zaboravili da ivite sa zatvorenim oima. Potpuno ste zaboravili to.
Mislite: O kakvoj besmislici govorite. Moje oi su ve otvorene." A vae oi su zatvorene.
Ako ja kaem: Izaite iz vaih snova," vi odgovarate; Ja sam ve budan", a to je
takoe san. Vi moete sanjati da ste budni; moete sanjati da su vam oi otvorene. Onda e
trebati mnogo vremena - ne da cvet jo nije procvetao - ve je vama bilo tako teko da se
probudite. Ima mnogo ulaganja. Ova ulaganja moraju da se shvate. Ego je osnovno
angaovanje. Ako otvorite svoje oi, vi iezavate. Otvaranje oiju izgleda kao smrt. To i
jeste. Tako vi govorite o tome, sluate o tome, razmiljate o tome, ali nikada ne otvarate oi,
37

Stvar je u probuenju. Samo u snu postoji vreme, iluzija odvojenosti, i nekog procesa postizanja bezvremenog
jedinstva. Mi smo uvek ve u njemu, ali sanjamo da nismo.
150

jer ako zaista otvorite oi takoe znate da ete ieznuti. Onda ko ete biti? Niko i nita. Ova
nitavnost je prisutna kada otvorite oi; stoga je bolje verovati da su oi ve otvorene, a vi
ostajete neko.
Ego je prvo uplitanje, angaovanje. Ego moe postojati samo dok ste uspavani, upravo
kao to snovi mogu postojati dok ste uspavani. Ego moe postojati samo dok ste uspavani metafiziki uspavani, egzistencijalno uspavani. Kad otvorite oi prvo vi iezavate; onda se
Bog pojavljuje; ovo je problem. A vi se bojite da ete ieznuti, ali to su vrata, tako sluate o
tome, razmiljate o tome, ali nastavljate da odgaate - sutra, sutra i sutra.
Zbog toga je Patanjali nuan. Patanjali kae da nije potrebno otvarati oi odmah,
ima mnogo koraka. Moete izai iz svog sna u koracima, u stupnjevima. Odreene stvari
radite danas, odreene sutra, onda prekosutra, i to e dugo potrajati. Patanjali privlai jer
vam daje vreme da spavate. On kae nije nuno da izaete iz spavanja odmah sada; samo
okretanje e delovati. Onda odspavajte jo malo; onda neto drugo. Onda ubrzo, u
stadijumima...
On je sjajan podstreka, usmeriva. On vas nagovara da izaete iz vaeg spavanja. Zen
vas protrese da izaete iz vaeg spavanja. Zbog toga zen majstor moe da vas udari u glavu;
nikada Patanjali. Zen majstor moe da vas izbaci kroz prozor; nikada Patanjali. Zato to zen
majstor koristi ok tretman - moete udarcem biti izbaeni iz sna, dakle zato nastavljati sa
pokuajima i nagovarati vas? Zato gubiti vreme?
Patanjali vas pribliava postepeno. Izvodi vas van a da vi ak niste ni svesni ta on
radi. On radi kao majka, ali obrnuto. Majka nagovara dete na spavanje. Moe da peva
uspavanku, doputa detetu da osea da je ona tu, da ne treba da se plai. Ponavljajui stalno
isti stih, dete se osea namamljeno u san. Ono pada u san drei ruku svoje majke. Ne mora
da brine. Majka je tu i ona peva, a pevanje je lepo! Majka ne kae: Idi da spava," jer e to
ometati odlazak u san, uznemiriti. Ona jednostavno nagovara indirektno. Onda, ubrzo izvlai
svoju ruku, pokriva dete ebetom, izlazi iz sobe, i dete je brzo uspavano.
Isto ini Patanjali u obrnutom redosledu. Ubrzo vas on izvodi iz vaeg sna. Zbog toga
je vreme potrebno; inae cvet ve cveta. Pogledajte: on je ve tu. Otvorite oi i on je tu,
otvorite vrata i on stoji tamo ekajui vas. On je uvek tamo stajao.
To zavisi od vas. Ako elite ok tretman, onda je zen staza. Ako elite vrlo postepen
proces, onda je yoga put. Birajte! U biranju ste vi takoe vrlo varljivi. Pitate me: Kako mogu
da izaberem?" Ovo je takoe trik. Sve je jasno. Ako vam treba vreme, izaberite Patanjalija.
Ali izaberite! Inae, ako ne izaberete, to e postati odlaganje. Onda kaete: Teko je
izabrati", a dok ne izaberete kako se moete pokrenuti?
ok tretman je trenutan. On vas odmah sputa na zemlju. Moje vlastite metode su ok
tretman. One nisu postepene. Sa mnom se moete nadati da postignete u ovom ivotu; sa
Patanjalijem mnogo ivota e vam trebati. Sa mnom se takoe moete nadati da postignete
ba sada, ali imate mnogo stvari da uradite pre nego to postignete.
Vi znate da e ego ieznuti, vi znate da e seks ieznuti. Nema mogunosti za seks,
jednom kada postignete; to postaje apsurdno, smeno. Tako vi mislite: Jo malo. ta je
pogreno u ekanju? Pustite me da uivam jo malo." Ljutnja nee biti mogua, nasilje nee
biti mogue, ljubomora nee postojati; posesivnost, manipulacija sve to e ieznuti.
Vi iznenada oseate: Ako sve ovo iezne, ta u onda ja biti?" - jer vi niste nita do
kombinacija svega ovoga, breme svega ovoga, a ako sve ovo iezne, preostaje samo
nepostojanje, nitavilo. To nepostojanje je sve to vas uasava. To izgleda kao bezdan. eleli
biste da zatvorite svoje oi i sanjate jo malo, upravo kao to se ujutru probudite ali biste
eleli da se okrenete na stranu barem pet minuta i jo malo sanjate, jer to je tako lepo.
Jedne noi Mula Nasrudin je probudio svoju enu i rekao joj: Donesi mi odmah
naoare. Imao sam tako lep san, a jo vie je obeano."
elje nastavljaju da vam obeavaju - uvek se vie obeava - i one kau: Uradite ovo i
ono, zato da se urite kada je prosvetljenje uvek mogue? Moete ga postii bilo kada; nema
potrebe za urbom. Moete to odlagati. To je pitanje venosti, briga venosti; zato ne uivati
ovog momenta?
151

Vi ne uivate, ali um kae: Zato ne uiva ovog trenutka?" A vi nikada niste uivali;
jer ovek bez unutranjeg razumevanja ne moe uivati ni u emu. On jednostavno pati; za
njega sve postaje patnja. Ljubav - stvar kao ljubav - on pati ak i u tome. Najlepa mogua
pojava za uspavanog oveka jeste ljubav, ali on pati ak i kroz to. Nita nije mogue da bude
bolje kada ste uspavani. Ljubav je najvea mogunost, ali vi ak patite od toga. Jer to nije
pitanje ljubavi ili neeg drugog - spavanje je patnja tako da ta god da se dogodi, vi ete
patiti. Spavanje okree svaki san u nonu moru. To zapoinje lepo, ali neto negde uvek krene
pogreno. Na kraju stiete u pakao.
Svaka elja vodi u pakao. Kau da svaki put vodi u Rim - ne znam, ali u jednu stvar
sam siguran: svaka elja vodi u pakao. U poetku elja vam daje mnogo nade, snove; to je
trik. Tako vi bivate uhvaeni. Ako bi elja od samog poetka rekla: Budi paljiv, ja te vodim
u pakao," vi je ne biste sledili. elja vam obeava raj, obeava: Samo nekoliko koraka i vi
ete to dostii; samo doite sa mnom" - zavodi vas, hipnotie i obeava vam mnoge stvari, a
vi bivajui u patnji, mislite: ta je pogreno pokuati? Kuajmo malo i ovu elju takoe."
To e vas takoe voditi u pakao jer elja kao takva jeste put do pakla. Otuda Buddha
kae: Dok ne postanete bez elja, ne moete biti blaeni." elja je patnja, elja je san, i elja
postoji samo kada ste beivotni, uspavani. Kada ste budni i ivahni, elje vas ne mogu
obmanuti. Onda vidite skroz, onda je sve tako jasno da ne moete biti obmanuti. Kako novac
moe da vas obmane i kae da ete biti vrlo, vrlo sreni kada ima novca? Onda pogledajte
bogate ljude; oni su takoe u paklu - moda u bogatom paklu, ali to ne ini razliku. Bogatiji
pakao e biti gori od siromanog pakla. Sada su oni stekli novac, i jednostavno su u stanju
stalne nervoze.
Mula Nasrudin je sakupio veliko bogatstvo, a onda je otiao u bolnicu jer nije mogao
spavati. Bio je nervozan i stalno je drhtao i bojao se, ali ne neega odreenog. Siromaan
ovek se boji neega odreenog; a bogat ovek se jednostavno boji. Ako se bojite neega
odreenog, neto se moe uraditi. Ali on se jednostavno plaio, nije znao zato, jer je imao
sve; nije bilo potrebno da se boji; ali se jednostavno plaio i drhtao.
Otiao je u bolnicu, a za doruak su mu doneli nekoliko stvari, a meu tim stvarima
bila je posuda sa drhtavim" elatinom. On je rekao: Ne, ne mogu jesti ovo." Doktor je pitao:
Zato ste tako nepokolebljivi u vezi s tim?" On je rekao: Ne mogu jesti nita to je
nervoznije od mene!"
Inae bogat ovek je nervozan. Kakva je njegova nervoza, njegov strah? Zato se on
tako plai. Iako je svaka elja ispunjena, jo ostaje frustracija. Sada on ne moe ak ni da
sanja, jer je proao kroz sve snove; oni ne vode nikuda. Ne moe sanjati i ne moe sakupiti
hrabrost da otvori oi takoe, jer postoje angaovanja, uplitanja. On je obeao mnoge stvari u
svom snu.
One noi kada je Buddha naputao svoju palatu, eleo je da kae svojoj eni: Ja
odlazim." eleo je da dodirne dete koje se upravo prethodnog dana roeno, jer se nee vraati
opet. Priao je samo do vrata sobe. Pogledao je enu. vrsto je spavala, mora da je sanjala;
lice joj je bilo lepo, osmeh, dete u njenim rukama. Saekao je nekoliko sekundi na vratima;
onda se okrenuo. eleo je da kae neto; ali onda se uplaio. Ako bi neto rekao, onda bi ena
bila prinuena da plae, jadikuje i pravi scenu.
On se bojao sebe takoe, jer ako ona plae i jadikuje, onda moe postati svestan svojih
vlastitih obeanja: Ja u te voleti zauvek, i biu s tobom stalno i veno." A ta je sa ovim
detetom koje se prethodnog dana rodilo? Ona bi naravno iznela dete pred mene, i rekla bi:
Vidi ta si mi uinio. Onda zato ti se rodilo ovo dete? A sada ko e biti njegov otac? Jesam
li ja sama odgovorna za njega? Da li bei kao kukavica? Dole su mu sve ove misli, jer u
spavanju svako obeava. Svako nastavlja da obeava ne znajui kako e ispuniti obeanja, ali
u spavanju to se deava, jer niko nije svestan ta se deava.
Iznenada je postao svestan da e sve ove stvari nastupiti a onda e se porodica sakupiti
- otac i svi ostali - a on je samo sin, a otac oekuje od njega, u svom snu on je obeao njemu
takoe. Onda je on jednostavno pobegao; jednostavno je pobegao kao lopov.
Posle dvanaest godina, kada se vratio natrag, prva stvar koju ga je ena pitala bilo je
da li mu je ona pala na um one noi kada je odlazio. Pitala je: Zato mi nisi rekao? Prva stvar
152

koju eli da pitam - a ekala sam te ovih dvanaest godina - zato mi nisi rekao? Kakva je to
vrsta ljubavi? Jednostavno si me napustio. Ti si kukavica."
Buda je sluao smireno. Kada je ena uutala on je rekao: Sve te misli su mi dole.
Doao sam do vrata, ak sam ih i otvorio. Pogledao sam te; u snu sam ti obeao mnoge stvari.
Ali ako u postati budan, ako izlazim iz spavanja, onda ne mogu odrati obeanja data u snu.
Ako pokuam da odrim obeanja, onda se ne mogu probuditi."
Dakle, ti si u pravu. Moe misliti da sam kukavica; moe misliti da sam pobegao iz
palate kao lopov, ne kao ratnik, ne kao hrabar ovek. Ali ja ti kaem, sasvim je obrnut sluaj,
jer kada sam beao, za mene u tom momentu, bio je trenutak najvee hrabrosti jer itavo moje
bie je govorilo: Ovo nije dobro. Ne budi kukavica. A da sam se zaustavio, da sam sluao
moje uspavano bie, onda za mene ne bi bilo mogunosti da se probudim."
A sada sam doao k tebi; sada mogu ispuniti neto, jer samo ovek koji je prosvetljen
moe ispuniti. ovek koji je neznalica, kako moe ita ispuniti? Sada sam ti doao. Tog
trenutka da sam stao, ne bih ti mogao dati nita, ali sada donosim veliko blago sa mnom, i
sada ti ga mogu dati. Ne plai, ne jadikuj; otvori oi i pogledaj me. Ja nisam isti ovek koji je
otiao te noi. Potpuno razliito bie je dolo pred tvoja vrata. Ja nisam tvoj mu. Ti moe
biti moja ena, jer je to tvoj poloaj. Pogledaj u mene - ja sam potpuno druga osoba. Sada ti
donosim blaga. Mogu te takoe uiniti svesnom i prosvetljenom."
ena je sluala. Isti problem uvek dolazi svima. Poela je da razmilja o detetu. Ako
postane sanyasin i krene s ovim prosjakom - s njenim bivim muem, koji je sada prosjak ako ona krene... ta e se dogoditi sa detetom? Nije rekla nita, ali Buddha je rekao: Znam
ta misli, jer sam ja proao period gde su obeanja data u usnulom stanju i celog drutva
skupa, i kae: ta radi? A dete... Ti misli ovo: Neka dete postane malo starije, neka se
oeni, onda moe preuzeti palatu i kraljevstvo, a onda e me slediti. Ali zapamti, nema
budunosti, ne postoji sutra. Ili me sledi sada ili me ne sledi."
Inae, njegova ena... enski um je vie uspavan nego muki. Postoji razlog za to, jer
ena je vei sanjar, ona ivi vie u nadi i snovima. Ona mora da bude vei spava jer bilo bi
teko prirodi da je koristi kao majku. ena mora biti u dubokom hipnotikom stanju, samo
onda moe nositi dete devet meseci u materici i patiti, onda ga roditi i patiti, onda ga podizati
i patiti, a onda jednog dana dete je jednostavno ostavi i odlazi drugoj eni... i pati.
U tako dugoj patnji, ena je prinuena da bude vei spava od oveka. Inae kako
moete patiti toliko? A ona se uvek nada. Onda se ona nada s drugim detetom, onda sa jo
jednim, i njen ivot je izgubljen, opustoen.
Dakle, Buddha je rekao, Znam ta misli, i znam da si ti vei sanjar od mene. Ali ja
sam sada doao da iseem svo korenje moga spavanja. Dovedi dete. Gde je moj sin? Dovedi
ga." enski um je ponovo odigrao ulogu. Ona je dovela Rahula, dete koje je sada imalo
dvanaest godina, i rekla je: Ovo je tvoj otac. Pogledaj ga - on je postao prosjak - i pitaj ga
koje je njegovo nasledstvo, ta ti on moe dati. Ovo je tvoj otac; on je kukavica! Pobegao je
kao lopov, ak i ne rekavi mi, napustio je tek jue roeno dete. Trai mu tvoje naslee!"
Buda se nasmejao i rekao Anandi: Donesi moju prosjaku posudu." Dao je prosjaku
posudu Rahulu i rekao: Ovo je moje naslee. inim te prosjakom. Ti si iniciran. Postaje
sanyasin." A svojoj eni je rekao: Isekao sam sasvim koren. Sada nema potrebe za
sanjanjem. Ti si takoe probuena jer ovo je bio koren. Rahul je ve sanyasin; ti se takoe
probudi, Jasodara, ti se takoe probudi, i postani sanyasin."
Trenutak uvek dolazi kada ste u prelaznom periodu odakle se spavanje okree u
budnost. itava prolost vas zadrava, a prolost je mona. Budunost je nemona za
pospanog oveka. Za oveka koji nije pospan, budunost je mona; a za oveka koji je vrsto
uspavan, prolost je jaka, jer ovek koji je vrsto uspavan zna samo da sanja da je sanjao u
prolosti. On nije svestan nikakve budunosti. ak i ako misli o budunosti, to nije nita do
samo opet refleksija prolosti, to je opet samo projekcija prolosti. Samo onaj ko je svestan
postaje svestan budunosti. Onda prolost nije nita.
Imajte to na umu. Moda neete moi da razumete odmah sada, ali jednog dana moi
ete da razumete. Za uspavanog oveka, uzrok je mnogo snaniji od posledice; seme je
mnogo monije nego cvet. Za oveka koji je budan, posledica je mnogo snanija od uzroka,
153

cvet je mnogo moniji nego seme. Logika spavanja je: uzrok proizvodi posledicu, seme
proizvodi cvet. Logika probuenog oveka je upravo obrnuta: cvet proizvodi seme; posledica
je ono to proizvodi uzrok; budunost proizvodi prolost, a ne da prolost proizvodi
budunost. Ali za uspavani um, prolost, mrtvo, ono to je otilo, jeste mnogo monije. To
nije...
Ono to tek treba da bude je mnogo snanije; ono to treba da bude roeno mnogo je
jae jer ivot je tamo. Prolost nema ivot. Kako ona moe biti snana? Prolost je ve
groblje. ivot se ve premestio odatle; zbog toga je to prolost. ivot je napustio nju, groblja
su vrlo mona za vas. Ono to tek treba da bude, ono to tek treba da bude roeno, novo, ono
to e se dogoditi, za oveka koji je probuen to postaje mnogo jae. Prolost njega ne moe
zadrati.
Prolost vas zadrava. Uvek mislite o prolim delima; uvek se razvlaite oko groblja.
Odlazite esto da posetite groblje i izrazite svoje potovanje mrtvom. Uvek izraavajte
potovanje onome to tek treba da se rodi, jer ivot je tamo.
Molimo vas, objasnite kako seme moe procvetati bez vremenskog razmaka.
Da, seme moe cvetati jer ono ve cveta. Cvet stvara seme, a ne seme cvet.
Rascvetavanje je bit, ono je stvorilo svako seme. Ali zapamtite: samo otvaranje je potrebno.
Otvorite vrata; sunce je tu, oekuje vas. ivot nije zapravo napredak u realnosti. On izgleda
kao napredak u spavanju.
Postojanje, bivanje je ve ovde - sve kako jeste ve je savreno, apsolutno, ekstatino nita ne moe biti dodato, ne postoji nain da se to popravlja. Onda ta je potrebno? Samo
jedna stvar: da postanete svesni i vidite to. To se moe dogoditi na dva naina. Bilo da moete
biti prodrmani u svom spavanju; to je zen. Ili moete biti dovedeni, nagovoreni da izaete iz
vaeg sna; to je yoga. Izaberite! Nemojte samo da visite izmeu.
Drugo pitanje:
Da li je predavanje Ishvari - Bogu - i predavanje guruu isto?
Predavanje ne zavisi od objekta. To je kvalitet koji vi unosite u vae bie. Kome se
predajete je irelevantno. Bilo koji objekat e delovati. Moete se predati drvetu; moete se
predati reci; moete se predati bilo emu - svojoj eni, vaem muu, vaem detetu. Ne postoji
problem u objektu, svaki objekat e delovati. Problem je predati se.
Dogaaj se deava zbog predanosti, ne usled onoga kome ste se predali. A ovo je
najlepa stvar koju treba razumeti: kome god da se predate, taj objekat postaje Bog. Nije u
pitanju predavanje Bogu. Gde ete nai Boga da mu se predate? Nikada ga neete nai.
Predajte se! Kome god da se predate, Bog je tamo. Dete postaje Bog, mu postaje Bog, ena
postaje Bog, Guru postaje Bog, ak i kamen moe postati Bog.
ak i kroz kamenje ljudi su dostigli, jer uopte nije pitanje emu se predajete. Vi se
predajete, a to donosi celu stvar, to otvara vrata. Predavanje, napor da se preda, donosi vam
otvaranje. A ako ste otvoreni kamenu, postajete otvoreni itavoj egzistenciji, jer je to samo
pitanje otvaranja. Kako moete biti otvoreni kamenu, a da ne budete otvoreni drvetu? Jednom
kada znate otvaranje, jednom kada uivate u euforiji koju ono donosi, ekstazi koja se desi
upravo otvaranjem kamenu, onda ne moete nai takvog neozbiljnog oveka koji e se
zatvoriti odmah preostaloj egzistenciji. Kada vam samo otvaranje kamenu daje tako
ekstatino iskustvo, onda zato se ne otvoriti svemu?
U poetku ovek se predaje neemu, a onda je ovek predat svemu. Znaenje toga je
da ako ste se predali majstoru, u iskustvu predavanja, vi ste nauili putokaz, vodilju kako se
moete predati svemu. Majstor postaje upravo prolaz kroz koji se prolazi. On postaje vrata, a
kroz ta vrata moete gledati u celo nebo. Zapamtite, ne moete nai Boga da mu se predate,
mada mnogi ljudi misle na taj nain; oni su vrlo prepredeni ljudi. Oni misle: Kad Bog bude

154

tu, mi emo se predati."38 Dakle, to je nemogue jer Bog je tu samo ako se predate. Predanost
ini sve boanskim. Predanost vam daje oi, a sve to se donese pred te oi postaje boansko.
Boanstvenost je kvalitet koji se dobija pomou predanosti.
U Indiji, hriani, Jevreji i muslimani smeju se hindusima, jer oni moda oboavaju
drvo, ili moda oboavaju kamen - ak i neoblikovan, koji nije ak ni statua. Mogu nai
kamen pored puta i od njega odmah nainiti boga. Nikakav umetnik nije potreban jer
predavanje je umetnost. Nije potrebno vajanje, nije potreban skupocen kamen, ak ni mermer.
Bilo koji obian kamen, koji je odbaen - ne moe se kupiti na trnici i stoga lei tamo pored
puta - i hindusi mogu odmah nainiti boga od njega. Ako se moete predati, on postaje
boanski. Oi predanosti ne mogu nai nita drugo nego boanstvo.
Drugi se tome smeju; ne mogu to razumeti. Oni misle da su ovi ljudi oboavaoci
kamena, oboavaoci idola. Oni to nisu! Hindusi su bili pogreno shvaeni. Oni nisu
oboavaoci idola. Oni su nali klju, a taj klju je da sve moete uiniti boanskim ako se
predate. A ako se ne predate, moete nastaviti da tragate za Bogom za milione ivota. Nikada
ga neete sresti, jer nemate kvalitet koji susree, koji moe da sretne, koji moe da nae.
Dakle, pitanje je subjektivne predanosti, ne kome se objektivno predajete.
Inae, naravno, postoje problemi. Vi se ne moete tako iznenadno predati kamenu, jer
va um nastavlja da govori: Ovo je samo kamen. ta to radi? A ako um nastavlja da govori:
Ovo je kamen; ta radi? - onda se ne moete predati, jer predanost trai vau celovitost.
Otuda znaaj majstora. Majstor oznaava nekoga ko stoji na granici - na granici
ljudskog i boanskog. Neko ko je bio ljudsko bie kao vi, ali vie nije kao vi - neto se
dogodilo - on je sada vie, vie ljudsko bie. Dakle, ako pogledate u njegovu prolost, on je
upravo kao vi - ali ako pogledate njegovu sadanjost i budunost, onda gledate neto vie.
Onda je on boanski.
Teko je predati se kamenu, reci - vrlo, vrlo teko - ak i predati se uitelju jeste tako
teko. Onda predavanje kamenu e nuno biti vrlo teko, jer kad god vidite uitelja, onda opet
va um kae da on je ljudsko bie kao vi, dakle zato se predavati njemu? A va um ne moe
videti sadanjost; um moe videti samo prolost - da je taj ovek roen kao vi, stoga zato se
predavati njemu? On je upravo kao vi.
On jeste, a ipak nije. On je oboje i Isus i Hrist - Isus je ovek, sin oveiji, a Hrist je
vii poloaj. Ako gledate samo vidljivo, onda je on kamen; vi se ne moete predati. Ako
volite, ako postanete intimni, ako dozvolite da njegovo prisustvo ue duboko u vas, ako
moete nai vezu - o tome je re - s njegovim biem, postojanjem - onda iznenada postajete
svesni vieg. On je vie nego ovek. Na neki nepoznat nain, on je neto to vi niste dobili.
Na neki nevidljivi nain on je prodro izvan granica ljudskog. Ali to moete osetiti samo ako
postoji odnos, veza.
To je ono to Patanjali kae, shraddha - poverenje; poverenje stvara odnos, vezu.
Odnos, veza je unutranja harmonija dvoje nevidljivih; ljubav je odnos, veza. S nekim ste
jednostavno prilagoeni kao da ste oboje roeni jedno za drugo. Vi to zovete ljubav. Na
momenat, ak i na prvi pogled, neko vam jednostavno odgovara, kao da ste zajedno stvoreni i
bili razdvojeni; a sada ste se opet sreli.
U starim mitologijama svuda u svetu, reeno je da su ovek i ena stvoreni zajedno. U
indijskoj mitologiji postoji vrlo lep mit. Mit je da su ena i mu na samom poetku stvoreni
kao blizanci, brat i sestra. Zajedno su bili roeni - ena i mu kao blizanci, spojeni zajedno u
jednoj materici. Postojao je odnos, veza od samog poetka. Od prvog momenta postojala je
veza. Bili su zajedno u materici drei jedno drugo, a to je odnos. Onda, usled neke nesree,
taj fenomen je iezao sa zemlje. Meutim mit kae da uzajamni odnos jo postoji. ovek i
ena... ovek moe da bude roen ovde, a ena moe da bude roena negde u Africi, u
Americi, ali postoji veza, i dok ne nau jedno drugo bie teko. Vrlo je teko nai jedno
drugo. Svet je tako prostran, a vi ne znate gde da traite i gde da naete. Ako se to desi, to se
deava sluajno.
38

Veina vernika ima ubeenje da su 'nali Boga' samo zato da bi izbegli pravu predaju. Koliko im je ego vrst,
toliko im je takva vera jaka. Njihova predanost je samo metod ouvanja ega, a 'Bog' je uvek u obliku nekog
simbola, relikvije ili fetia.
155

Naunici takoe veruju da emo pre ili docnije moi da ocenimo vezu uz pomo
naunih instrumenata, i pre nego to neko stupi u brak. Par mora otii u laboratoriju tako da
mogu otkriti da li je njihova bioenergija podesna ili ne. Ako nije podesna, onda su oni u
zabludi. Ovaj brak ne moe... Oni moda misle da e biti vrlo sreni, ali ne mogu biti jer
njihova bioenergija nije podesna.
Tako vi moete voleti nos ene, a ena moe voleti vae oi, ali to nije poenta.
Voljenje nosa nee pomoi, voljenje oiju nee pomoi, jer posle dva dana niko ne gleda u
nos i niko ne gleda u oi. Onda je problem bioenergija. Unutranje energije se susreu i
meaju jedna s drugom; ili se pak odbijaju. To je upravo kao to vrite transfuziju krvi; ili je
vae telo prihvata ili odbacuje, jer postoje razliiti tipovi krvi. Ako su istog tipa, samo onda
telo prihvata; inae jednostavno odbacuje.
Isto se dogaa u braku. Ako se bioenergija slae, brak je prihvatljiv, i ne postoji
svestan nain da se to zna. Ljubav je vrlo obmanljiva, jer ljubav je uvek usredsreena na
neto. Glas ene je dobar, i vi ste privueni. Ali u tome nije poenta. To je parcijalna stvar.
Celina, ukupnost mora odgovarati. Vae bioenergije treba da prihvate jedna drugu tako
potpuno da duboko ispod vi postanete jedna osoba. To je odnos, veza. Deava se u ljubavi
retko, jer kako je nai? To je ipak teko. Samo zaljubljivanje nije siguran kriterijum. Od
hiljadu, devet stotina devedeset devet puta nema uspeha. Ljubav se pokazala neuspelom.
ak i vii odnos se deava sa majstorom. To je vie nego ljubav. To je shraddha poverenje. Ne susree se samo vaa bioenergija i prilagoava, nego sama vaa dua nastupa
zajedno. Zbog toga, kad god neko postane uenik, itav svet misli da je on lud; jer ceo svet ne
moe videti u emu je poenta. Zato ste vi ludi za tim ovekom? A vi to sami takoe ne
moete objasniti, jer se to ne moe objasniti. Moete ak i da ne budete svesni ta se dogodilo,
ali s tim ovekom, iznenada, vi ste u poverenju. Iznenada se neto susretne, postaje jedno. To
je odnos, veza.
Teko je imati taj odnos s kamenom. Jer je ak teko imati taj odnos sa ivim
majstorom, kako moete imati to s kamenom? Ali ako se to dogodi, odmah majstor postaje
Bog. Za sledbenika majstor je uvek Bog. On moe da ne bude Bog za druge, to nije poenta.
Ali za uenika on je Bog, i kroz njega vrata boanskog se otvaraju. Onda vi imate odgovor da je ovaj unutranji odnos klju, ova predanost. Onda moete pokuati to; prepustiti se reci...
Mora da ste itali novelu Sidarta" od Hermana Hesea. On ui mnoge stvari od reke.
Vi ne moete uiti od Bude, upravo posmatrajui reku, tako mnogo promena, udi reke. On je
postao splavar upravo posmatrajui hiljade stanja oko sebe. Ponekad, reka je srena i plee,
ponekad vrlo, vrlo tuna, kao da se uopte ne kree - ponekad vrlo ljuta i buna, protiv itave
egzistencije, a ponekad tako tiha i smirena kao Buda. A Sidarta je jednostavno splavar, prolazi
rekom, ivi pored reke, posmatra reku, ne ini nita drugo. To postaje duboka meditacija i
odnos, a kroz reku i njenu renost" on to postie: on stie do istog sagledavanja kao Heraklit.
Vi moete zagaziti u istu reku i ne moete. Reka je ista i nije ista. Ona je tok, a kroz
reku i kroz odnos sa njom on saznaje celu egzistenciju kao reku - renost ".
To se moe dogoditi sa svim. Osnovno to treba zapamtiti jeste predaja.
Da li je predaja Ishvari - bogu - i predaja guruu isto?
Da! Predaja je uvek ista. Do vas je kome se moete predati. Naite oveka, naite reku
i predajte se. To je rizik, najvei mogui rizik. Zbog toga je tako teko predati se. To je rizik!
Vi se kreete u nepoznatoj teritoriji i dajete toliko snage oveku ili neemu emu se predajete.
Ako se predajete meni vi dajete meni potpuno ovlaenje. Onda moje 'da' jeste vae
'da', onda moje 'ne' jeste vae 'ne'. ak i po danu kada kaem, 'ovo je no', vi kaete: Da, no
je". Vi dajete totalno ovlaenje nekome. Ego se odupire. Um kae: Ovo nije dobro. Imaj
kontrolu nad sobom. Ko zna gde e te ovaj ovek odvesti? Ko zna, on moe rei: Skoi s
vrha brda, i onda e biti mrtav. Ko zna, ovaj ovek moe manipulisati s tobom, kontrolisati,
eksploatisati." Um e izneti sve ove stvari. To je rizik, a um preduzima sve mere sigurnosti.
Um govori: Budi paljiv. Budi malo oprezniji s ovim ovekom." Ako sluate um,
predavanje nije mogue. Um je u pravu! To je rizik! Ali ta god preduzmete, to e biti rizik.
156

uvanje nee mnogo pomoi. Moete se uvati zauvek, i moda neete moi da se odluite,
jer um nikada ne moe odluiti. Um je pometnja. On nikada nije odluan. Morate zaobii um
jednog dana, i morate mu rei: Ti ekaj. Ja idem; ja u skoiti i videti ta se deava."
ta moete da dobijete ili izgubite? Uvek se pitate ta dobijate da se takoe bojite da
gubite, ta tano dajete kada se predajete. Vi nemate nita. Moete dobiti iz toga, ali ne
moete izgubiti jer nemate nita. Moete uvek profitirati iz toga, ali ne postoji mogunost bilo
kakvog gubitka jer nemate ta da izgubite.
Mora da ste uli uvenu maksimu Karla Marksa: Proleteri svih zemalja ujedinite se,
jer nemate ta da izgubite osim svojih lanaca." To moe biti istina, moe i da ne bude istina.
Meutim, za tragae ovo je tana stvar. ta ete izgubiti osim svojih lanaca, svog neznanja,
svoje patnje? Meutim, ljudi takoe postaju jako vezani za svoju patnju - oni prianjaju uz
samu svoju nevolju kao da je blago. Ako elite ukloniti njihovu nevolju, oni stvaraju sve vrste
prepreka.
Posmatrao sam ove prepreke i ove trikove kod hiljada ljudi. ak i ako elite da uzmete
njihovu bedu, oni prianjaju uz nju. Oni pokazuju odreenu stvar, jer nemaju nita drugo, to je
svo blago koje imaju. Ne uzimajte im to jer je uvek bolje imati neto nego nita. To je njihova
logika; uvek je bolje imati neto - barem ovu bedu koja postoji, nego biti potpuno prazan,
nego biti niko.
ak i kada ste jadni, vi ste neko. ak i ako imate pakao u sebi, barem imate neto. Ali
gledajte to, posmatrajte to, i kada se predate zapamtite da nemate nita drugo da date. Majstor
govori o vaoj bedi, nita drugo. On ne uzima va ivot zato to ga nemate. On uzima samo
vau smrt. Ne uzima nita vredno od vas, jer vi to nemate. On uzima samo smee, besmislice
koje ste sakupili kroz mnoge ivote i sedite na gomili besmislica i mislite to je vae
kraljevstvo.
On ne uzima nita. Ako ste spremni da mu date svoju nevolju, postaete sposobni da
primite boansko. Predanost stvara duhovnost, predanost stvara boanstvenost. Predanost je
stvaralaka sila.
Pitanje tree:
Da li je majstor potreban posle satoria?
Da! ak i vie, jer satori je samo letimino sagledavanje, a takvo sagledavanje je
opasno jer ulazite u teritoriju nepoznatog. Pre toga kretali ste se u poznatom svetu. Samo
posle satoria majstor postaje apsolutno potreban, jer sada je neko potreban da vas dri za ruku
i vodi prema onome to nije samo odbljesak realnosti, nego postaje apsolutna realnost. Posle
satoria vi imate ukus, a ukus stvara vie elje. Ukus postaje magnetski privlaan tako da ete
eleti ludaki da jurnete u to. Tada je majstor potreban.
Posle satoria mnoge stvari e se dogoditi. Satori je kao vienje vrha Gourishankar,
(Mont Everesta) iz ravnica. Jednog dana, jednog jasnog sunanog jutra, magle nema, moete
videti stotinama milja udaljen vrg Gourishankar kako se die u nebo. To je satori. Onda pravo
putovanje zapoinje. Sada ceo svet izgleda beskoristan.
To je prekretnica. Sada sve to ste znali postaje nekorisno, sve to ste imali postaje
teret. Sada svet, ivot koji ste iveli do sada. jednostavno iezava kao san, jer se vanije,
(sjajnije, vee) dogodilo. I to je satori, letimino sagledavanje, odbljesak. Ubrzo e magla biti
tu, i vrh nee biti vidljiv. Oblaci e doi i vrh e ieznuti. Sada ete biti u potpuno
nesigurnom stanju svesti.
Prva stvar e biti, da li ta god da ste videli, jeste realno ili samo san, jer gde je to
sada? To je iezlo. To je bio upravo proboj, samo procep i vi ste vraeni natrag - baeni u na
vlastiti svet.
Javie se sumnja, ta god da ste videli, da li je bilo istinito? Da li je to stvarno
postojalo, ili ste sanjali o tome, ili ste zamiljali to? A postoje mogunosti. Mnogi ljudi
zamiljaju, tako da sumnja nije pogrena. Mnogo puta ete zamiljati, i ne moete nainiti
razliku, ta je realno a ta je nerealno. Samo majstor moe rei: Da, ne brinite. To je bilo
realno." Ili majstor moe rei: Odbacite to! To je bilo zamiljeno."
157

Samo onaj ko je upoznao vrh - ne iz planova - samo onaj ko je dosegao vrh, samo onaj
koji je postao vrhunac sam, samo on vam moe rei jer on ima kriterijum, on ima merilo. On
moe rei: Baci to smee! To je samo vaa imaginacija," jer kada tragaoci nastavljaju misliti
o ovim stvarima, um zapoinje da sanja.
Mnogi ljudi dolaze kod mene. Samo jedan procenat od njih ima realnu stvar;
devedeset devet procenata donose nerealne stvari. Teko im je da odlue - ne teko, ve
nemogue - oni ne mogu odluiti. Iznenada oseate oivljavanje energije u osnovi kime, u
kimi; kako ete odluku doneti, da li je to realno ili nerealno? Mnogo ste razmiljali o tome;
takoe ste eleli to. Nesvesno sejete seme da se to treba dogoditi, kundalini treba da se
uzdigne. Onda ste itali Patanjalija, onda ste razgovarali o tome, onda ste sreli ljude koji
kau da je njihova kundalini probuena. Va ego onda se sve pomealo...
Iznenada, jednog dana osetite oivljavanje: to nije nita do kreacija uma - samo da vas
zadovolji: Nemoj brinuti, nemoj biti tako mnogo zabrinut. Gledaj! Tvoja kundalini se
podigla," a samo um zamilja. Onda ko e odluiti? I kako ete odluiti, jer vi ne znate istinu?
Samo istina moe postati kriterijum za odluivanje da li je to istina ili neistina.
Majstor je potreban ak i vie posle prvog satoria. Postoje tri satoria. Prvi satori je
samo letimian, poput svetlucanja. To je nekada mogue ak i kroz droge; to je mogue kroz
mnoge druge stvari - nekada sluajno. Ponekad se penjete na drvo i padnete, a to je takav ok
da se um zaustavlja za jedan momenat, i svetlucanje nastaje, a vi ete osetiti takvu euforiju
kao da ste izbaeni iz svog tela, neto ste saznali.
Za sekundu se vraate natrag, um poinje da funkcionie; to je jednostavno ok. Kroz
elektrini ok je to mogue, kroz ok insulinom to je mogue, kroz droge to je mogue. ak
se ponekad i u bolesti to dogaa. Tako ste slabi da um ne moe funkcionisati; iznenada imate
uvid, letimino sagledavanje. Kroz seks je to mogue. U orgazmu, kada celo telo vibrira, to je
mogue.
Taj prvi uvid ne nastaje nuno kroz religijsko nastojanje. Zbog toga LSD, meskalin, i
marihuana su postali tako vani i privlani. Prvo svetlucanje" je mogue, i vi moete biti
uhvaeni zbog tog prvog sagledavanja" u drogi. To moe postati trajan izlet; onda je to vrlo
opasno jer svetlucanja" nee pomoi. Ona se mogu dogoditi, ali nije nuno da dolazi pomo
od njih. Oni mogu pomoi samo oko majstora, jer e on onda rei, Ne vredi ii samo za
svetlucanjem. Imali ste letimino sagledavanje, sada zaponite putovanje da dostignete vrh."
Budui da nije stvar samo u tome da se stigne do vrha, ve konano ovek treba da postane
vrh.
Ovo su tri stadijuma; prvi je letimian uvid - ovo je mogue kroz mnoge puteve, nije
nuno da budu religijski. ak i ateista moe imati letimian uvid. Droge, hemikalije mogu
vam dati letimino sagledavanje. ak i posle operacije, kada izlazite iz hloroforma, moete
imati letimian uvid.
Mnogi ljudi su postigli prvi satori; to nije mnogo znaajno. Moe se koristiti kao
korak za drugi satori Drugi satori je da se dostigne vrh. To se nikada ne dogaa sluajno. To
se dogaa samo kroz metode, tehnike, kole, jer je to dugo nastojanje da se dostigne drugi
satori.
A kada postoji trei satori, to Patanjali zove samadhi; taj trei znai postati sam vrh.
Jer iz drugog vi takoe silazite dole. Kad dosegnete vrh; to moe biti nepodnoljivo.
Blaenstvo je takoe ponekad nepodnoljivo - ne samo bol, blaenstvo takoe; ovek se vraa
natrag bolu.
Teko je da se ivi na visokom vrhu - vrlo teko! - ovek bi eleo da se vrati natrag.
Dok ne postanete sam vrh, dok iskusilac ne postane iskustvo, to moe da se izgubi. I do treeg
samadhija - majstor je potreban. Samo kada se dostigne konani, najvii samadhi, majstor
nije potreban.
etvrto pitanje:
Dok vas sluam, mnogo puta odreene rei idu vrlo duboko, i postoji iznenadna
jasnoa i razumevanje. Ovo izgleda da se deava samo kada ja sluam rei koje vi izgovarate.
Ali, mir koji se sputa dok vas sluam bez ikakve posebne panje podjednako je blaen, ali
158

onda se gube rei i njihova znaenja. Molim vas, dajte nam uputstvo kako da vas sluamo, jer
je to jedna od vaih najboljih meditacija.
Ne brinite mnogo o reima i znaenju. Ako posveujete mnogo panje reima i
znaenju, to postaje intelektualna stvar. Naravno, nekada ete dospeti do jasnoe. Iznenada
oblak iezava i sunce je tu, ali e to biti samo trenutna stvar i jasnoa nee mnogo pomoi;
sledeeg momenta nestaje. Intelektualna jasnoa nije od velike koristi.
Ako sluate rei i njihovo znaenje moete razumeti mnoge stvari, ali neete razumeti
mene, neete takoe razumeti ni sebe. Mnoge ove stvari nisu vredne. Ne brinite o reima i
znaenjima; sluajte me kao da ne govorim ve pevam, kao da vam ne govorim reima, nego
vam govorim zvukovima, kao da sam pesnik!
Nije potrebno traiti znaenje, ta sam ja mislio. Samo sluajte bez pridavanja ikakve
panje reima i znaenjima; i doi e vam razliit kvalitet jasnoe. Biete blaeni; to je prava
jasnoa. Osetiete sreu, osetiete smirenost, tiinu i spokojstvo. To je pravo znaenje.
Ja nisam ovde da bih vam objasnio odreene stvari, ve da stvorim odreen kvalitet u
vaem biu. Ja ne govorim da bih objasnio; moj govor je kreativan fenomen. Ne pokuavam
neto da vam objasnim - to vi moete uiniti kroz knjige i postoje milioni drugih naina da
razumete ove stvari - ja sam ovde da vas preobrazim.
Sluajte me - jednostavno, nevino, bez ikakve brige oko rei i njihovih znaenja.
Ostavite tu jasnou; ona nije od velike koristi. Kada me jednostavno sluate, transparentno,
intelekt vie ne postoji - od srca do srca, od bia do bia - onda govornik iezava, i slualac
takoe. Onda ja nisam ovde, i vi takoe niste ovde. Odnos, veza postoji; slualac i govornik
su postali jedno. U tom jedinstvu, vi ete biti preobraeni. Da biste dospeli do tog jedinstva
postoji meditacija. Nainite to meditacijom, ne kontemplacijom, ne razmiljanjem. Onda se
prenosi neto vie od rei - neto iznad znaenja. Pravo znaenje, krajnje znaenje se prenosi neto to nije u spisima i ne moe biti.
Moete i sami itati Patanjalija. Uz malo napora vi ete ga razumeti. Ja ne govorim
ovde da biste postali sposobni da razumete Patanjalija; ne, to uopte nije poenta. Patanjali
je samo izgovor, vealica. Ja veam neto na njemu to je izvan spisa.
Ako sluate moje rei, vi ete razumeti Patanjalija, bie jasnoe. Ali ako sluate moj
zvuk, ako ne sluate rei ve mene, onda pravo znaenje e vam biti otkriveno, a to znaenje
nema nita da ini s Patanjalijem. To znaenje se prenosi izvan spisa.

159

Poglavlje 5

MAJSTOR MAJSTORA
Izlaganje 5. januara 1975. u Buddha dvorani.
I, 26:

purveamapi guruh kalenanavacchedat.


On je uitelj i prvim mudracima, budui vremenom neogranien.

I, 27:

tasya vacakah pranavah.


Re koja ga iskazuje je prvobitna vibracija [AUM].

I, 28:

tajjapastadarthabhavanam.
Ponavljati je i realizovati u sebi njen smisao [vodi takoer ka samadhiju].

I, 29:

tatah pratjakcetanadhigamo' pyantaraydbhavaca.


Ovim [ponavljanjem] postie se Uvid u vlastitu unutranjost (pratyakcetana), a
[svakovrsne psihosomatske i intelektualne] smetnje (antaraya) bie takoer otklonjene.
Patanjali govori o fenomenu Boga. Bog nije tvorac. Za Patanjalija, Bog je najvie
cvetanje individualne svesti.
Svako je na putu da postane Bog. Ne samo vi, nego i kamenje, stene, svaka jedinica
egzistencije je na putu da postane Bog. Neki su ve postali; neki postaju; neki e postati.39
Bog nije tvorac, nego kulminacija, vrh, najvie od egzistencije. On nije u poetku; on
je u kraju. A naravno, u izvesnom smislu, on je i na poetku takoe, jer na kraju moe da
cveta samo ono to je uvek bilo od samog poetka kao seme. Bog je potencijalnost, skrivena
mogunost; ovo treba da se zapamti. Dakle Patanjali nema jednog Boga, on ima beskonano
bogova. Cela egzistencija je puna bogova.
Jednom kada ste razumeli Patanjalijevu koncepciju Boga, onda Bog nije da bi se
stvarno oboavao. Vi morate da postanete jedno; to je jedino oboavanje. Ako nastavite da
oboavate Boga, to nee pomoi. Zapravo, to je neozbiljno. Oboavanje, pravo oboavanje
treba da se sastoji od postajanja vas samih Bogom. itav napor treba da bude da se dovede
vaa potencijalnost do take gde se ona rasprsne u jednoj aktuelnosti - gde se seme rasprsne i
ono to je veno skriveno postaje manifestovano. Vi ste nemanifestovan Bog, i svo nastojanje
je u tome kako dovesti nemanifestovano do manifestovanog nivoa - kako ga dovesti do ravni
manifestacije.
Budui da je on izvan ogranienja vremena, on je majstor majstora.
On govori o koncepciji Boga. Kada neko postaje cvet, kada neko postaje lotos
postojanja, mnoge stvari se njemu deavaju i mnoge stvari poinju da se u egzistenciji
deavaju kroz njega. On postaje velika mo, jedna beskonana snaga, i kroz njega na mnogo
naina, drugima se pomae da postanu bogovi na njihov vlastiti nain.
Budui da je on izvan ogranienja vremena, on je majstor majstora.
Postoje tri tipa majstora. Jedan nije tano majstor; pre je uitelj. Uitelj je ovek koji
ui, onaj koji pomae ljudima da znaju o stvarima, bez vlastite realizacije njih. Ponekad
uitelji mogu privui hiljade ljudi. Jedina potrebna stvar je da oni budu dobri uitelji. Oni
39

Zapravo, sve je Boansko i nita osim Boanskog ne postoji, a postajanje Boanskim o emu se ovde govori
zapravo je buenje i prepoznavanje sebe kao Boanskog.
160

moda nisu spoznali sebe, ali mogu govoriti, mogu raspravljati, mogu propovedati, i mnogi
ljudi mogu biti privueni njihovim govorima, besedama, propovedima. Ali govorei
neprekidno o Bogu oni mogu obmanjivati sebe. Ubrzo mogu poeti da oseaju kako oni
znaju.
Kada govorite o nekoj stvari, najvea opasnost je da moete poeti da verujete da
znate. U poetku kada ponete da govorite, da poduavate - poduavanje ima neku privlanost
jer je to vrlo ispunjavajue za ego - kada vas neko slua paljivo, duboko ispod to ispunjava
va ego da vi znate, a on ne zna. Vi ste znalac, a on je neznalica.
To se dogodilo; svetenik, veliki svetenik je pozvan u ludnicu da kae nekoliko rei
stanovnicima te kue. Svetenik nije oekivao mnogo, ali je bio iznenaen. Jedan ludak ga je
sluao toliko paljivo; nikada nije video nekog oveka da ga slua tako paljivo. On se
samonagnuo napred i svaku re primao u svoje srce. ak nije ni treptao. Bio je toliko paljiv kao da je hipnotisan.
Kada je svetenik zavrio propoved, video je istog oveka kako prilazi upravniku i
govori mu neto. Bio je radoznao. im mu se pruila prilika, pitao je upravnika: ta vam je
ovek rekao? Da li je rekao neto o mojoj propovedi?" Upravnik je odgovorio: Da."
Svetenik je pitao: Hoete li mi rei ta je rekao?" Upravnik je bio malo nerad da to uini, ali
je onda rekao: Da, ovek je rekao: Vidite? A ja sam unutra, a on je van!"
Uitelj je tano na istom mestu, u istom amcu, kao to ste vi. On je takoe jedan
stanovnik. On nema nita vie nego vi - samo malo vie informacija. Informacije ne znae
nita. Vi moete sakupiti; obina, osrednja inteligencija je potrebna da skupi informacije.
ovek ne treba da bude genije, ne treba da bude vrlo talentovan. Samo osrednja inteligencija
je dovoljna. Moete skupiti informacije. Moete nastaviti da ih sakupljate; moete postati
uitelj.
Uitelj je onaj ko zna bez saznavanja. On privlai ljude, ako je dobar govornik, dobar
pisac, ako ima linost, ako ima odreenu harizmu oko sebe, magnetske oi, snano telo.
Ubrzo on postaje sve vetiji. Meutim, ljudi oko njega ne mogu postati sledbenici, oni e
ostati uenici. ak i ako se on izdaje za majstora, ne moe vas nainiti sledbenikom. Najvie
vas moe nainiti uenikom. Uenik je onaj koji je u potrazi za vie informacija, a uitelj je
onaj koji je sakupio vie informacija. Ovo je prvi tip majstora - koji uopte nije majstor.
Onda postoji drugi tip majstora - koji je spoznao sebe. ta god kae, on kae kao
Heraklit: Ja sam tragao." Ili kao Buddha on moe rei: Ja sam naao." Heraklit je mnogo
suptilniji. On je govorio ljudima koji nisu mogli razumeti ako bi kazivao kao Buda: Naao
sam". Buddha kae: Ja sam najsavreniji prosvetljeni ovek koji se ikada dogodio." To
izgleda egoistino, ali nije, i on je govorio svojim sledbenicima koji su mogli razumeti da
uopte tu nije bilo ega.
Heraklit je govorio ljudima koji nisu bili disciplinovani - upravo obinim ljudima. Oni
ne bi razumeli. On utivo kae: Ja sam tragao, istraivao," i ostavlja drugu stranu, ono: Ja
sam naao", vaoj imaginaciji. Buddha nikada ne kae; Ja sam tragao." On kae: Naao
sam! A ovo prosvetljenje se nikada nije dogodilo pre. Ono je sasvim apsolutno."
ovek koji je naao jeste majstor. On e prihvatiti sledbenike. Uenici su zabranjeni;
uenici ne mogu otii tamo sami. ak i ako ih nanese tamo put, otii e to je pre mogue jer
im majstor nee pomoi da sakupljaju vie znanja. On e pokuati da vas preobrazi. Dae vam
postojanje, neznanje. Dae vam vie postojanja, a ne vie znanja. Uinie vas usreditenim, a
sredite je negde oko pupka, ne u glavi.
Ko god ivi u glavi jeste ekscentrian, nastran. Ova re je lepa; engleska re eccentric
znai 'izvan centra'. Zaista, lud je onaj ko god ivi u glavi - glava je periferija. Moete iveti u
svojim nogama, ili moete iveti u svojoj glavi; rastojanje od centra je isto. Centar je negde
blizu pupka.
Uitelj vam pomae da budete vie i vie ukorenjeni u glavi; majstor e vas iskoreniti
iz glave i presaditi u centar. To je tano presaivanje, ima tako mnogo bola - nuno je da bude
- patnje, agonije, jer kada se presauje, biljka mora da bude iupana iz zemlje. Tako je uvek
bilo. A onda opet, treba da bude zasaena u novu zemlju. To e potrajati. Stari listovi e
161

otpasti. Cela biljka e proi kroz agoniju, nesigurnost, ne znajui da li e preiveti ili ne. To je
ponovno roenje. S uiteljem nema ponovnog raanja; s majstorom ima ponovnog raanja.
Sokrat je u pravu, on kae: Ja sam akuer" Da, majstor vam pomae da budete
ponovo roeni. Ali to znai da ete morati da umrete; samo onda se moete ponovo roditi.
Dakle majstor nije samo akuer - Sokrat kae samo pola stvari. Majstor je i ubica takoe ubica plus akuer. Prvo e vas ubiti kakvi jeste, i samo onda novo moe nastati od vas. Iz vae
smrti - vaskrsenje.
Uitelj vas nikada ne menja. ta god da vi jeste, ko god vi jeste, on vam jednostavno
daje vie informacija. On vam pridodaje i zadrava kontinuitet. On moe da vas modifikuje,
moe da vas profini. Moete postati kulturniji, vie uglaeni. Ali ostaete isti; osnova e biti
ista.
Sa majstorom deava se diskontinuitet. Vaa prolost postaje kao da nikada nije bila
vaa - kao da je pripadala nekom drugom, kao da je sanjana. Ona nije bila realna; bila je
nona mora. Kontinuitet se prekida. Postoji procep. Staro otpada, a novo dolazi, izmeu ova
dva postoji procep. Procep je problem; taj jaz mora da se pree. U tom procepu mnogi
jednostavno postaju preplaeni, beei brzo se vraaju natrag i prianjaju uz svoju staru
prolost.
Majstor vam pomae da preete taj jaz, ali za uitelja nema niega takvog, nema
problema. Uitelj vam pomae da nauite vie; majstorov prvi posao je da vam pomogne da
zaboravite ono to je naueno, da se oduite; to je razlika.
Neko je pitao Ramanu Maharija: Doao sam iz velike daljine da uim od vas.
Poduite me:" Ramana se nasmejao i rekao: Ako ste doli da uite, onda idite negde drugde
jer mi ovde zaboravljamo naueno. Ovde ne poduavamo. Previe ve znate; to je va
problem. Vie uenja i bie vie problema. Mi uimo kako da zaboravite naueno, kako da se
preuredite, razvijete."
Majstor privlai sledbenike, uitelj - uenike. ta je sledbenik? Sve mora tano da
bude shvaeno; samo ete onda moi da razumete Patanjalija. Ko je sledbenik? Koja je
razlika izmeu uenika i sledbenika? Uenik je u potrazi za znanjem, sledbenik trai
preobraaj, promenu. On je zasien, sit sa samim sobom. Doao je do take da realizuje:
Kakav jesam, ja sam bezvredan - praina, nita drugo. Kakav jesam to je bez vrednosti."
On je doao do postizanja novog roenja, novog postojanja. Spreman je da proe
skroz krst, kroz smrtne muke i ponovno roenje; otuda re sledbenik. Re sledbenik dolazi od
discipline. On je spreman da proe kroz svaku disciplinu. ta god majstor kae, on je spreman
da sledi. On je sledio svoj vlastiti um do sada, za mnogo ivota, i nije stigao nigde. Sluao je
svoj vlastiti um, i dospeo je u sve vee nevolje. Sada je doao do take gde je shvatio; Dosta
je ovoga."
On dolazi i predaje se majstoru. Ovo je disciplina, prvi korak. On kae: Sada u vas
sluati. Sluao sam dovoljno samog sebe; bio sam sledbenik svog vlastitog uma, uenik, i to
ne vodi nikuda. Shvatio sam to. Sada ste vi moj majstor." To znai: Sada ste vi moj um. Sve
to kaete, ja u posluati. Gde god me vodite, ja u poi. Neu sumnjati u vas jer ta sumnja
e dolaziti iz mog uma."
Sledbenik je onaj ko je kroz ivot nauio jednu stvar: da je va um initelj nevolja, va
um je osnovni uzrok vaih nevolja. Va um uvek kae: Neko drugi je uzrok nevolje, ne ja."
Sledbenik je onaj ko je nauio taj trik, to je klopka uma. On uvek kae: Neko drugi je
odgovoran; ja nisam odgovoran." Tako on spasava sebe, titi, ostaje siguran. Sledbenik je onaj
ko je razumeo da je to pogreno da je to trik uma.
Jednom kada osetite celu ovu apsurdnost uma... On vas vodi u elju; elja vas vodi u
frustraciju. On vas vodi u uspeh; svaki uspeh postaje promaaj. On vas vodi prema lepoti, a
svaka lepota se pokazuje runom. On vas vodi dalje i dalje; nikada ne ispunjava nijedno
obeanje. Daje vam obeanja. Ne, ak nijedno obeanje nije ispunjeno. To vam daje sumnju,
sumnja postaje crv u srcu, otrovan. Ne dozvoljava vam da imate poverenje, a bez poverenja
ne postoji rast. Kada razumete celu ovu stvar, samo onda moete postati sledbenik.
Kada doete kod majstora, simbolino polaete svoju glavu pred njegove noge. To je
odbacivanje svoje glave; to je stavljanje svoje glave pred njegova stopala. Tada kaete: Sada
162

u ostati bez glave. ta god mi sada kaete bie moj ivot." To je predanost. Majstor ima
sledbenike koji su spremni da umru i budu ponovo roeni.
Onda postoji trei - majstor majstora. Uitelj uenika je prvi; majstor sledbenika
drugi; i onda trei, majstor majstora. Patanjali kae kada majstor postaje Bog - a da postaje
Bog znai da ovek transcendira vreme; za njega vreme ne postoji, prestaje da postoji; za
njega ne postoji vreme; onaj ko je dospeo do razumevanja bezvremenosti, venosti; koji se
nije samo promenio i postao dobar, ko se nije samo promenio i postao svestan, koji je dospeo
izvan vremena - on postaje majstor majstora. Sada je on Bog.
ta e onda raditi majstor majstora? Ovaj stadijum dolazi samo kada majstor napusti
telo - nikada pre. Jer u telu vi moete biti svesni, u telu vi moete shvatiti da ne postoji vreme.
Inae telo ima bioloki sat. Ono osea glad, a posle izvesnog vremenskog perioda opet glad zasienost i glad, spavanje, bolest, zdravlje. Nou telo mora da ode na spavanje; ujutru mora
da se probudi. Telo ima bioloki sat. Dakle, trei majstor se deava samo kada majstor napusti
telo - kada on ne dolazi ponovo natrag u telo.
Buda ima dva termina. Prvi je nazvan nirvana, kada je Buddha postao prosvetljen ali
je ostao u telu. Ovo je prosvetljenje, nirvana. Onda je posle etrdeset godina napustio telo;
nazvao je to apsolutnom nirvanom - mahaparanirvana. Onda je postao majstor majstora, i
ostao je majstor majstora.40
Svaki majstor, kada trajno napusti telo, kada se nee vie vraati natrag, postaje
majstor majstora. Muhamed, Isus, Mahavira, Buda, Patanjali; oni su ostali uitelji uitelja, i
oni neprekidno vode majstore, ne sledbenike.
Kada neko postane majstor na stazi Patanjalija, odmah postoji kontakt sa
Patanjalijem ija dua lebdi u beskonanom, individualna dua, koju on zove Bog. Kada
osoba sledi Patanjalijevu stazu postaje majstor, prosvetljen, odmah postoji komunikacija sa
izvornim majstorom koji je sada Bog.
Kad god neko sledi Buddhu postaje prosvetljen, odmah uzajamni odnos zapoinje da
postoji. Iznenada on je sjedinjen s Budom - s Budom koji nije vie u telu, koji nije vie u
vremenu i prostoru, ali jo jeste - sa Budom koji je postao jedno sa apsolutnim, ali jo uvek
jeste.
Ovo je vrlo paradoksalno i vrlo je teko razumeti, jer mi ne moemo razumeti nita to
je izvan vremena; itavo nae razumevanje je unutar prostora. Kada neko kae da Buddha
postoji izvan vremena i prostora, za nas to nema smisla.
Kada kaete da Buddha postoji izvan vremena i prostora, to znai da ne postoji nigde
posebno. A kako neko moe postojati bez egzistencije negde posebno? On postoji,
jednostavno postoji. Ne moete pokazati gde; ne moete rei gde je on. U tom smislu on nije
nigde, pa je u tom smislu svuda. Za um koji lei u prostoru, vrlo je teko da razume neto to
je izvan prostora. Meutim, ko god sledi metode Bude i postane majstor, odmah ima kontakt.
Buddha jo nastavlja da vodi ljude koji slede njegovu stazu, Isus jo nastavlja da vodi ljude
koji slede njegov put.
Na Tibetu ima mnogo uitelja, a to nije bilo teko. Tibet je najprosvetljenija zemlja;
ostala je takva do danas. To nee biti u budunosti, zahvaljujui Maou. On je unitio itav
suptilni obrazac koji je Tibet stvorio. Cela zemlja bila je manastir. U drugim zemljama
manastiri postoje; a Tibet je postojao u manastiru.
Pravilo je da iz svake familije jedna osoba mora da preuzme sannyasu, da postane
lama, a to pravilo je tako nainjeno da su najmanje pet stotina majstora uvek dostupna. Kada
se pet stotina majstora sastanu na Kailau u pono - u dvanaest sati - Buddha je opet vidljiv.
40

Smatra se da ove klasifikacije vae samo za posmatrae, ne i za prosvetljenog. On je i za vreme potpunog


prosvetljenja u telu dostigao mahaparanirvanu, jer je i tada potpuno nezavisan od tela kao da ono ne postoji.
Maha znai veliki a ispred rei samadhi oznaava fiziku smrt prosvetljenog. Kada svetac fiziki umre, za
njega se kae da je uao u mahasamadhi. Re para (ispred nirvana) oznaava onostranu ili transcendentalnu
nirvanu koja se nastavlja posle smrti tela prosvetljenog. Stoga mahaparanirvana jednostavno za posmatrae
znai da je telo prosvetljenog umrlo, a ne novo stanje nirvane za prosvetljenog, koje nastupa samo posle smrti.
Ako je prosvetljeni u nirvani, on je potpuno nezavisan od tela, tako da smrt tela za njega ne predstavlja nikakvu
promenu.
163

On je vodio; svaki majstor nastavlja da vodi. Jednom kada ste blizu majstora, ne blizu
uitelja, vi moete imati poverenje. ak i ako ne postignete prosvetljenje u ovom ivotu,
imaete neprekidno suptilno voenje - ak i ako ne shvatite da ste voeni.
Mnogi uenici Gurijeva su dolazili kod mene. Oni su morali doi jer ih je Gurijev
bacao prema meni. Ne postoji niko drugi, Gurijev ih moe baciti ili odgurnuti. To je nesrea.
Ali je tako - sada ne postoji nijedan majstor u Gurijevom sistemu, tako da on ne moe
nainiti kontakt. Mnogi njegovi uenici dolaze pre ili kasnije, i oni nisu svesni jer ne mogu
razumeti ta se dogaa. Oni misle da je to samo sluajno.
Ako majstor postoji na odreenoj stazi u vremenu i prostoru, izvorni majstor moe
nastaviti da alje instrukcije. Na taj nain religije su uvek ostajale ive. Jednom kada se lanac
prekine, religija postaje mrtva. Na primer, religija aina je prekinuta jer nijedan jedini majstor
ne postoji koji bi nastavio da alje nove instrukcije. Jer u svakom dobu stvari se menjaju; um
se menja, tehnike su se promenile, uenja su se promenila, metode moraju biti pronaene,
nove stvari moraju biti dodate, stare stvari moraju biti izbrisane. Svakom dobu je potrebno
mnogo rada.
Ako majstor postoji na odreenoj stazi, onda izvorni majstor koji je sada Bog moe
ostati. Ali ako majstor nije ovde na zemlji, onda je lanac prekinut i religija postaje mrtva. To
se deava mnogo puta.
Na primer, Isus nikada nije nameravao da stvori novu religiju; nikada nije razmiljao o
tome. Bio je Jevrejin, primio je direktna uputstva od jevrejskih majstora koji su postali
bogovi. Ali Jevreji nisu sluali njegova uputstva. Oni bi rekli: Ovo nije zapisano u spisima.
O emu vi priate?" U spisima je ovo zapisano da, ako vas neko pogodi ciglom, vi na njega
bacite kamen; oko za oko, ivot za ivot. A Isus je poeo da govori da volite neprijatelja svog
- i ako vas on udari po jednom obrazu, dajte mu i drugi.
To nije zapisano u jevrejskim spisima, ali je novo uputstvo jer se doba promenilo. To
je nova metoda koju je trebalo sprovoditi, a Isus je primio direktno od bogova - od bogova u
Patanjalijevom smislu; od starih proroka. Ali to nije bili zapisano u spisima. Jevreji su ga
ubili ne znajui ta su uradili. Zato je Isus rekao u poslednjem momentu kada je bio na krstu:
Boe, oprosti im, jer ne znaju ta rade. Oni izvravaju samoubistvo. Oni ubijaju sebe, jer
prekidaju vezu sa svojim vlastitim majstorima."
I to se dogodilo. Ubistvo Isusa je postalo najvea nesrea za Jevreje, i ve dve hiljade
godina oni pate jer nemaju kontakt. Oni ive sa spisima; oni su ljudi koji su najvie
orijentisani na spise u svetu. Talmud, Tora - oni ive sa spisima i kad god je nainjen napor iz
vieg izvora izvan vremena i prostora, oni nisu sluali.
To se dogodilo mnogo puta. Tako je roena nova religija. Nepotrebno - nije postojala
potreba! Ali stari ljudi nisu sluali. Oni bi rekli: Gde je to zapisano?" To nije zapisano. To je
nova instrukcija, novi spis. A vidite, uvek nova religija izgleda snanija od stare. Zato to ima
poslednje instrukcije, moe vie pomoi ljudima.
Jevreji su ostali isti. Hriani su se rairili na pola sveta; sada je polovina sveta
hrianska. aini su ostali u Indiji, vrlo neznatna manjina jer i oni nisu eleli sluati. Oni
nemaju nijednog ivog majstora. Imaju mnogo sadhua, monaha - mnogo, jer oni mogu to
priutiti - oni su bogata zajednica - ali nemaju nijednog ivog majstora. Nikakve instrukcije ne
mogu im biti date kroz vie izvore. Ovo je bilo jedno od najveih otkria teozofije u Indiji - u
ovom dobu, svuda u svetu - da majstori neprekidno nastavljaju da poduavaju. Patanjali kae
da je ovo trea kategorija majstora; majstor majstora. To je ono to kod njega znai re Bog.
Budui da je izvan ogranienja vremena, on je majstor majstora.
ta je vreme i kako ovek odlazi izvan vremena? Pokuajte da razumete. Vreme je
elja, jer za elju potrebno je vreme. Vreme je tvorevina elje. Ako nemate vreme, kako
moete eleti? Ne postoji prostor za kretanje elje. elji je potrebna budunost. Zbog toga se
ljudi koji ive s milionima elja boje smrti. Zato se boje smrti? Jer smrt odmah preseca
vreme. Vie nema vremena, vi imate milione elja, a sada dolazi smrt.
164

Smrt znai sada vie nema budunosti; smrt znai sada vie nema vremena. Sat moe
nastaviti da otkucava, ali vi neete kucati". elji treba vreme da se ispuni - budunost. Vi ne
moete eleti u sadanjosti; ne postoji elja u sadanjosti. Moete li eleti ita u sadanjosti?
Kako ete eleti to? Jer ako elite odmah je budunost ula. Sutra je dolo u sledeem
momentu. Kako sada i ovde moete eleti, u ovom trenutku?
elja je nemogua bez vremena - vreme je takoe nemogue bez elje - oni se
pojavljuju zajedno, dva aspekta istog novia. Kada ovek postane beeljan, on postaje
bezvremen. Budunost se zaustavlja, prolost se zaustavlja. Samo sadanjost je tu. Kada se
elja zaustavi to je slino kao kada sat nastavlja da otkucava a kazaljke su uklonjene. Upravo
zamislite sat koji nastavlja da otkucava, a nema kazaljki, tako da ne moete rei koliko je sati.
ovek bez elje je kao asovnik koji otkucava bez kazaljki. To je stanje Bude. U telu,
on ivi, asovnik nastavlja da otkucava, jer telo ima svoj vlastiti bioloki proces koji se
nastavlja. Ono e biti gladno, ono e traiti hranu. Ono e biti edno i traie da pije. Osetie
pospanost i otii e da spava. Telo e imati potrebe, stoga ono otkucava. Ali unutarnje bie
nema vreme; asovnik je bez kazaljki.
Zbog tela vi ste usidreni u svetu - u svetu vremena. Vae telo ima teinu, a zbog te
teine gravitacija jo deluje na vas. Kada je telo ostavljeno, kada Buddha ostavi telo, onda se
otkucavanje smo zaustavlja. Onda je on ista svest; nema tela, nema gladi, nema drutva;
nema tela, nema ei; nema tela, onda nema potrebe.
Zapamtite ovo - elja i potreba - ove dve rei. elja je od uma; potreba je od tela. elja
i potreba, onda ste vi sat sa kazaljkama. Kada postoji samo potreba, a nema elje; onda ste vi
sat bez kazaljki, a kada se potreba takoe ostavi, otili ste izvan vremena. Ovo je venost;
izvan vremena je venost.
Na primer; ako ne gledam u sat - i ako moram da gledam neprekidno celog dana - ako
ne gledam u sat, ja ne znam koje je vreme. ak i ako sam video pre pet minuta, opet moram
pogledati jer ne znam tano, jer sada - unutra nema vremena - samo telo otkucava.
Svesnost nema vreme. Vreme se stvara kada svest eli neto; odmah se vreme stvara.
U egzistenciji ne postoji vreme. Ako ovek nije na zemlji, vreme e ieznuti odmah. Drvee
otkucava, kamenje otkucava. Sunce e se dii i mesec e zai, i sve e se nastaviti kako jeste,
ali nee biti vremena jer vreme ne dolazi sa sadanjou, ono dolazi seanjem na prolost i
zamiljanjem budunosti.
Buda nema prolost. On je zavrio s tim, on je ne nosi. Buddha nema budunost. On je
zavrio s tim takoe, jer nema elja. Ali potrebe postoje jer telo postoji. Jo nekoliko karmi
vie mora da se ispune; nekoliko dana vie telo e nastaviti da otkucava, samo e se stara
inercija produiti. Morate naviti sat. ak i kad prestanete sa navijanjem, on e nastaviti da
otkucava nekoliko sati, ili nekoliko dana. Stara pokretaka sila e se nastaviti.
Budui da je on izvan ogranienja vremena, on je majstor majstora.
Kada oboje, potreba i elja ieznu, vreme e ieznuti. I zapamtite, iskljuivo nainite
razliku izmeu elje i potrebe; inae moete biti u ozbiljnom neredu. Nikada ne pokuavajte
da ostavite potrebe. Niko ih ne moe ostaviti, dok telo ne bude naputeno. Ne budite u
nedoumici ta je ta. Zapamtite ta je potreba, a ta je elja.
Potreba dolazi od tela, a elja dolazi od uma. Potreba je animalna, elja je ljudska.
Naravno, kada oseate glad potrebna vam je hrana. Prestajete jesti kada potreba prestane; va
stomak odmah kae: Dovoljno", ali um kae: Jo malo. Tako je ukusno:" To je elja. Vae
telo kae: "Ja sam edan," ali telo nikada ne trai koka kolu. Kada deak kae: "edan sam" neka pije. Ne moe piti vodu vie nego to je potrebno. Koka kolu moe popiti vie. To je
fenomen uma.
Koka kola je jedina univerzalna stvar u ovom dobu - ak i u Sovjetskom Savezu. Nita
nije ulo tamo, ali koka kola je ula. ak i gvozdena zavesa ne pravi nikakvu razliku, jer
ljudski um je ljudski um.
Uvek motrite gde potreba prestaje, a elja zapoinje. Uinite to neprekidno svesnim.
Ako moete nainiti razliku, postigli ste neto - klju za egzistenciju. Potreba je lepa, elja je
165

runa. Meutim postoje ljudi koji nastavljaju da ele, oni nastavljaju da reu svoje potrebe.
Oni su neozbiljni, glupi. Ne moete nai vee idiote na svetu, jer oni ine upravo suprotno.
Ima ljudi koji e postiti danima i udeti za nebom. Post je rezanje potrebe, a elja za
nebom je pomaganje elji da vie bude tu. Oni imaju vie vremena nego to je vae, jer
moraju misliti o nebu - imaju neizmerno vreme, nebo je ukljueno u njemu. Vae vreme se
zaustavlja pri smrti. Za vas e oni rei: "Vi ste materijalista." Oni su 'duhovni' jer se njihovo
vreme nastavlja dalje. Ono pokriva nebo - ne samo jedno, sedam - ak i moksha, konano
osloboenje, je unutar granice njihovog vremena. Oni imaju ogromno vreme, a vi ste
materijalisti jer se vae vreme zaustavlja pri smrti.
Zapamtite, lako je odbaciti potrebe, budui da je telo tako neujno vi ga moete
muiti. Telo je tako prilagodljivo da ako ga muite predugo ono postaje prilagoeno vaem
muenju. Ono je nemo i ne moe rei nita, ako postite, za dva, tri dana rei e: Ja sam
gladno, ja sam gladno". Ali va um misli o nebu (o raju), a bez gladi vi ne moe ui u nebo
(raj). U spisima je zapisano: Posti" - stoga ne sluate telo. Takoe je zapisano u spisima: Ne
sluaj telo - telo je neprijatelj."
Telo je nema ivotinja: moete nastavljati da ga muite. Za nekoliko dana ono e
javljati ta mu treba, ako zaponete dug post, barem prvu sedmicu... Petog, estog dana ono
prestaje da se javlja jer ga niko ne slua, onda zapoinje da se prilagoava samo od sebe. Ono
ima skladite za devedeset dana. Svaka zdrava osoba ima rezervoar debljine (masti) za
devedeset dana u sluaju nude - ne za post.
Ponekad se izgubite u umi i ne moete nabaviti hranu. Ponekad nastupi nestaica i ne
moete dobaviti hranu. Telo ima rezervu za devedeset dana. Ono e hraniti sebe; ono jede
sebe. Ono ima sistem sa dve brzine. Obino trai hranu. Ako unosite hranu, onda rezerva
ostaje netaknuta. Ako ne unosite hranu dva, tri dana, ono poinje da trai. Ako mu jo ne
dobavite hranu, jednostavno menja brzinu. Brzina se menja; onda ono zapoinje da jede sebe.
Zato u postu vi gubite jedan kilogram svakog dana. Gde odlazi ta teina? Ova teina
iezava jer jedete svoju vlastitu debljinu, svoje vlastito meso. Vi ste postali kanibal. Post je
kanibalizam. Za devedeset dana biete skelet, sva rezerva je potroena. Onda morate umreti.
Lako je biti nasilan prema telu; ono je tako nemo. Meutim, s umom je to teko jer je
on tako glasan, on nee da slua. Prava stvar je nainiti um poslunim i presei elje. Ne
traite nebo ili raj.
Upravo sam proitao knjigu o novoj religiji u Japanu. A kao to sam znao, Japanci su
tehniki vrlo veti ljudi; stvorili dva raja u Japanu. Samo da bi vam dali mogunost letimino
da ga sagledate, na jednom uzdignutom mestu nainili su mali raj - kako se moe doi tamo...
Vi samo odete tamo i moete ga videti. To lepo mesto su uinili apsolutno istim i takvim ga
odravaju - cvee i cvee, drvee i hlad, lepi mali bungalovi; pruili su vam sjaj raja tako da
poinjete da ga elite.
Raj ne postoji. To je tvorevina uma. Ne postoji pakao. To je takoe tvorevina uma.
Pakao nije nita drugo do odsustvo raja; to je sve. Prvo stvorite, a onda oseate gubitak jer to
nije tu. A ovi ljudi, ovi svetenici, ovi trovai, oni vam uvek pomau da elite. Prvo oni stvore
elju; onda sledi pakao; onda dolaze da vas izbave.
Jednom sam prolazio vrlo primitivnim putem - bilo je leto - i naiao sam na tako
blatnjav deo puta da sam se zaudio kako je postao tako blatnjav. Kie nije bilo. Skoro pola
milje je put bio blatnjav, a ja sam mislio da rupe nisu tako duboke pa sam nastavio da vozim
kola dok se nisam zaglavio. Nije bilo samo blatnjav, imao je i mnogo rupa. Onda sam ekao
da naie neko ko e mi pomoi, neki kamion.
Naiao je farmer sa kamionom. Kada sam zatraio da mi pomogne, rekao je da e to
kotati dvadeset rupija. Rekao sam: U redu platiu ti dvadeset rupija, samo me izvadi
odavde." Kada sam bio van, rekao sam farmeru : Za ovu cenu morao bi raditi dan i no." On
je rekao: Ne, ne nou, jer moram da usmerim vodu iz reke na ovaj put. ta mislite ta je
nainilo ovo blato na putu? Onda mogu takoe malo da odspavam, jer rano ujutru rad
poinje."

166

Ovo su svetenici. Prvo oni stvore blato; puste vodu iz udaljene reke. Onda se vi
zaglavite, a onda vam pomau. Ne postoji raj i nema pakla, nema neba, nema pakla. Vi ste
eksploatisani, i biete eksploatisani dok ne prestanete da elite.
ovek koji ne eli ne moe biti eksploatisan. Onda nijedan svetenik ne moe da ga
eksploatie, onda nikakva crkva ne moe da ga eksploatie. Kada elite vi stvarate mogunost
da budete eksploatisani. Iskorenite svoje elje koliko moete jer su one neprirodne. Nikada ne
secite svoje potrebe jer one su prirodne; ispunite svoje potrebe.
Pogledajte itavu stvar. Potreba nema mnogo; njih uopte nema mnogo. One su tako
jednostavne. ta vama treba? Hrana, voda, sklonite, nekoga da vas voli tako da vi moete
voleti njega. ta je jo potrebno? Ljubav, hrana, sklonite - jednostavne potrebe. Religije su
protiv svih ovih potreba. Protiv ljubavi, one kau praktikujte celibat. Protiv hrane, one kau
praktikujte post. Protiv utoita, oni kau postanite monah, kreite se, postanite lutalica beskunik. One su protiv potreba. Zbog toga one stvaraju pakao. A vi ste sve vie i vie u
patnji, vie i vie u njihovim rukama. Onda traite pomo od njih, a oni su stvorili itavo
stanje.
Nikada ne idite protiv potreba, a uvek se setite da seete elje. elje su beskorisne. ta
je elja? To nije elja za sklonitem. elja je uvek za boljim utoitem. elja je komparativna,
potreba je jednostavna. Vama treba ena da je volite, ovek da ga volite. elji? elji treba
Kleopatra. elja je jednostavno za nemoguim; potreba je za moguim. A ako je mogue
ispunjeno, vi ste spokojni. ak i Buddhi treba to.
elja je besmislena. Odsecite elje i postanite svesni. Onda ete biti izvan vremena.
elje stvaraju vreme; ako odseete elje biete izvan vremena. Telesne potrebe e ostati dok
telo postoji, ali ako elje ieznu, onda je ovo va poslednji, ili uglavnom poslednji ali jedini
ivot. Ubrzo vi ete takoe ieznuti. ovek koji je postigao beeljnost pre ili kasnije e doi
izvan potreba, jer onda telo nije potrebno. Telo je vozilo uma; ako um ne postoji, telo vie nije
potrebno.
On je poznat kao AUM.
A ovaj Bog, savreno cvetanje, poznat je kao Aum. Aum je simbol univerzalnog zvuka.
U sebi ujete misli, rei, ali nikada zvuk vaeg bia. Kada nema elje, nema potrebe, kada je
telo odbaeno, kada um iezne, ta e se dogoditi? Onda se uje prava dua univerzuma. To
je Aum.
Svuda u svetu su ljudi realizovali ovaj Aum. Muslimani, hriani, Jevreji ga nazivaju
amen. Zoroastrianci i parsi Aum nazivaju Ahura Mazda. To a i m - ahura je od a, a mazda je
od m - to je Aum. To su oni nainili boanstvom.
Zvuk je univerzalan. Kada se zaustavite, vi ga ujete. Upravo sada vi govorite mnogo,
askajui sa sobom; stoga to ne moete uti. To je tihi zvuk. On je tako tih da, dok se vi
potpuno ne zaustavite, neete moi to da ujete. Hindus je nazvao svoje bogove simbolinim
imenom - Aum. Patanjali kae, On je poznat kao Aum. Ako elite da naete majstora,
majstora majstora, moraete postati sve vie i vie usklaeni sa zvukom Aum, orijentisani da
ne dopustite ak ni jednu jedinu re, da ne koristite nijednu re vie...
Ponavljajte i meditirajte...
Kad god on kae ponavljajte Aum, on uvek dodaje meditiraj. Treba shvatiti razliku.
Ponavljajte i meditirajte na AUM.
Ponavljanje i meditiranje na AUM donosi iezavanje svih prepreka i buenje nove
svesti.
Ako ponavljate i ne meditirate, to e biti transcendentalna meditacija Maharii Mahe
Jogija - TM. Ako ponavljate i ne meditirate, onda je to hipnotiko sredstvo. Onda se uspavate.
167

To je dobro, jer lepo je uspavati se. To je zdravo; iz toga ete izai mnogo smireniji. Osetiete
vie blagostanja, vie energije, vie zadovoljstva. Ali to nije meditacija.
To je kao sredstvo za smirenje i pilula za duevnu vedrinu zajedno. To vam prua
dobro spavanje, i onda se oseate ujutru vrlo dobro. Vie energije je obezbeeno, ali to nije
meditacija, a to takoe moe biti opasno ako koristite due vreme. Moete postati zavisni od
toga, i to je vie upranjavate, vie ete shvatiti da se dolazi do take kada ste se zaglavili.
Tada kada to ne radite, oseate da vam neto nedostaje. Ako radite to, nita se ne dogaa.
Ovu stvar treba zapamtiti: kad god propustite meditaciju i oseate da vam neto
nedostaje, a ako meditirate redovno i nita novo se ne deava, onda ste se zaglavili. Onda je
potrebno neto odmah uraditi. To je postalo zavisnost kao puenje cigareta. Ako ne puite,
oseate da vam neto nedostaje. Oseate neprekidno da neto treba uraditi; oseate nemir. A
ako puite, nita se ne dobija. To je definicija zavisnosti. Ako se neto dobija, to je u redu; ali
ako se nita ne dobija - to je postalo navika. Ako to ne inite, osetiete se jadno. Ako to radite,
nikakvo blaenstvo ne dolazi iz toga.
Ponavljajte i meditirajte - ponavljajte Aum, Aum, Aum, Aum - i ostanite po strani,
odvojeno od ovog ponavljanja. Aum, Aum, Aum, Aum; zvuk je svuda oko vas i vi ste budni,
svesni, posmatrate, svedoite. To je meditiranje. Stvorite zvuk u sebi i jo ostanite posmatra
na bregu. U dolini, zvuk se kree - Aum, Aum, Aum - a vi stojite iznad i posmatrate, svedoite.
Ako ne posmatrate, uspavaete se. Transcendentalna meditacija je na Zapadu privlana
ljudima jer su izgubili sposobnost da spavaju dobro.
U Indiji niko ne mari za Maharii Mahe Jogija jer su ljudi tako vrsto uspavani, hru.
Njima to ne treba. Ali kada zemlja postane bogata i ljudi ne rade fizike poslove, spavanje je
poremeeno. Onda ili uzimate sredstvo za smirenje ili TM. A TM je, naravno, bolji jer nije
hemijski. Ali je to jo vrlo, vrlo jako hipnotiko sredstvo.
Hipnoza moe biti koriena u odreenim sluajevima, ali ne treba da se uini
navikom, jer na kraju e vas dovesti u uspavano postojanje. Vi ete se kretati kao u hipnozi;
izgledaete kao zombi. Neete biti svesni i budni. A zvuk Aum je takva uspavanka, jer je
univerzalni zvuk. Ako ga ponavljate, kroz njega moete postati potpuno opijeni. Onda dolazi
opasnost, jer cilj nije da se postane opijen. Cilj je da se postane sve vie i vie svestan. Postoje
dve mogunosti da odbacite svoje brige.
Psiholozi dele um na tri sloja: prvi nazivaju svesno, drugi podsvesno, a trei sloj zovu
nesvesno. etvrti jo neznaju - Patanjali ga naziva nadsvesno. Ako postanete vie budni,
kreete se iznad svesnog i dostiete nadsvesno. To je stanje Boga: super-budno, nadsvesno.
Ali ako ponavljate mantru bez meditiranja, vi padate u podsvesno. Ako padate u
podsvesno, to e vam dati dobro spavanje, blagostanje, bogatstvo. Ali ako nastavite, paete u
nesvesno, onda ete postati zombi, a to je vrlo, vrlo loe - to nije dobro.
Mantra se moe koristiti kao hipnoza. Ako ste na operaciji u bolnici to je u redu. Bolje
je nego da uzimate hloroform, dobro je da ste smireni, dobro je da ste hipnotisani; to je manje
zlo. Ako ne spavate dobro, bolje je da radite TM nego da uzimate sredstvo za smirenje. To je
manje opasno, manje tetno. Ali to nije meditacija.
Dakle, Patanjali neprekidno insistira:
Ponavljajte i meditirajte na AUM.
Ponavljajte i stvorite svuda oko vas zvuk Aum, ali ne budite izgubljeni u tome. To je
tako sladak zvuk, vi ete biti izgubljeni. Ostanite budni - ostanite vie i vie budni. to zvuk
ide dublje, postajete vie i vie budni; tako da zvuk oputa va nervni sistem, ali ne vas. Zvuk
oputa vae telo, ali ne vas. Zvuk alje celo vae telo i fiziki sistem u spavanje, ali ne vas.
Onda dupli proces zapoinje; zvuk ostavlja vae telo u odmornom stanju a svesnost
vam pomae da se uzdignete do nadsvesti. Telo se kree prema nesvesnom, postaje zombi,
brzo uspavano, a vi postajete nadsvesno bie. Onda vae telo dosee dno, a vi dostiete vrh.
Vae telo postaje dolina, a vi postajete vrh. Ovo je stvar koju treba realizovati.
Ponavljajte i meditirajte.
168

Ponavljanje i meditiranje na AUM donosi iezavanje svih prepreka i buenje nove


svesti.
Nova svest je etvrta - nadsvest. Ali zapamtite samo ponavljanje nije dobro.
Ponavljanje je samo pomo u meditaciji. Ponavljanje stvara objekat, najpodesniji objekat je
zvuk Aum. A ako moete biti svesni najsuptilnijeg, vaa svet takoe postaje suptilna.
Kada posmatrate grube stvari vaa svesnost se gubi. Kada posmatrate seksualno telo,
vaa svest postaje seksualna. Kada gledate neto - objekat poude - vaa svest postaje pouda.
ta god posmatrate, vi postajete. Posmatra postaje posmatrano; zapamtite ovo.
Krinamurti insistira esto da posmatra postaje posmatrano. ta god posmatrate, vi
postajete. Tako ako posmatrate zvuk Aum, koji je najdublji zvuk, najdublja muzika, zvuk bez
zvuka, zvuk koji je nestvoren - anahat, zvuk koji je upravo priroda egzistencije, ako postanete
svesni toga, vi postajete to - vi postajete univerzalni zvuk. Oboje, subjekat i objekat, susreu
se, stapaju i postaju jedno. To je nadsvesno gde se objekat i subjekat rastvaraju, gde znalca i
znanog nema vie. Samo jedno ostaje; objekat i subjekat su premoeni. Ovo jedinstvo jeste
yoga.
Re yoga dolazi od rei yuj. To znai spojiti se, sjediniti zajedno. To se dogaa kada
su objekat i subjekat upregnuti (yoked) zajedno. Engleska re jaram je takoe od yuj, od istog
korena od koga yoga dolazi. Kada su subjekat i objekat spojeni zajedno, upregnuti zajedno
tako da vie nisu odvojeni, premoeni, jaz iezava. Vi postiete nadsvesnost.
To je ono to Patanjali naziva:
Ponavljanje i meditiranje na AUM donosi iezavanje svih prepreka i buenje nove
svesti.

Poglavlje 6

POETAK NOVE STAZE


Izlaganje 6. januara 1975. u Buddha dvorani.
Pitanje prvo:
Da li vi primate uputstva od nekog majstora majstora?
Ja nisam ni na jednoj drevnoj stazi, stoga nekoliko stvari treba razumeti. Ja nisam kao
Mahavira koji je bio poslednji iz duge serije tirthankara41, dvadeset etvrti - on je bio
dvadeset etvrti. U prolosti dvadeset troje su postati majstori majstora, bogovi, na istoj stazi,
istoj metodi, istom nainu ivota, istoj tehnici.
Prvi je bio Riab a poslednji Mahavira. Riab nije imao nikoga iz prolosti da se
ugleda na njega. Ja nisam kao Mahavira, ve kao Riab. Ja sam poetak tradicije, ne
zavretak. Mnogi e dolaziti na istu stazu. Dakle je ne mogu traiti uputstva ni od koga; to
nije mogue. Tradicija se raa, a zatim umire, upravo kao to se osoba raa i umire. Ja sam
poetak, ne zavretak. Kada je neko u sredini serija ili na zavretku, on dobija instrukcije od
majstora majstora.
41

Tirthankara - znai vodi preko prelaza, gaza preko reke. To je naziv za osnivae ainizma, najstarije religije.
Tih osnivaa je bilo vie, a poslednji je Mahavira, bio je savremenik Buddhe u petom veku pre n.e. Njih dvojica
se nisu sreli iako su se esto vodile kritike rasprave izmeu njihovih uenika. Re inah oznaava pobednika,
osloboenu duu (ivu) koja je pobedila ogranienja materije. Otuda je odlika ainizma strog asketizam,
gladovanje sve do ivice smrti, i potpuno nenasilje prema svim ivim biima koja sadre princip ivota (ivah).
ainizam je stoga religija prakse osloboenja, a ne teizam, oboavanje Boga.
169

Koji je razlog zato ja nisam ni na jednoj stazi? Radio sam s mnogim majstorima, ali
nikada nisam bio sledbenik (uenik). Ja sam bio lutalica, lutajui kroz mnogo ivota, uzdu i
popreko prolazei kroz mnoge tradicije, bivajui sa mnogim grupama, kolama, metodama,
ali nikada ne pripadajui nikome. Bio sam priman s ljubavlju, ali nikada nisam bio deo veinom gost, na nonom boravku. Zbog toga sam nauio tako mnogo. Ne moete nauiti na
jednoj stazi tako mnogo; to je nemogue.
Ako se kreete na stazi, vi znate sve o tome ali nita o neemu drugom. Celo vae bie
je apsorbovano u tome. To nije bio moj put. Ja sam bio kao pela koja leti od jednog cveta do
drugog cveta, sakupljajui mnogo razliitog polena. Zbog toga mogu biti bez ustezanja u
zenu, mogu biti udobno sa Isusom, mogu biti spokojno sa Jevrejima, mogu biti bez ustezanja
sa muslimanima, mogu biti mirno sa Patanjalijem - s razliitim putevima, ponekad
dijametralno suprotnim.
Ali, za mene, skrivena harmonija postoji. Zbog toga ljudi koji slede jednu stazu nisu
sposobni da me razumeju. Oni su jednostavno zbunjeni. Oni znaju posebnu logiku, poseban
obrazac. Ako se stvar uklapa u njihov obrazac, to je u redu. Ako se ne uklapa, to je pogreno.
Oni imaju vrlo ogranien kriterijum. Za mene, kriterijumi ne postoje. Zato to sam bio s tako
mnogo obrazaca, ja mogu biti udobno svuda. Niko nije tu meni i ja nikome nisam stranac.
Ali ovo stvara problem. Ja nisam stranac nikome, ali svako postaje stranac meni - mora da
bude tako.
Ako ne pripadate nekoj odreenoj sekti, onda svako misli kao da ste neprijatelj.
Hindusi e biti protiv mene, hriani e biti protiv mene, Jevreji e biti protiv mene, aini e
biti protiv mene, a ja nisam ni protiv koga. Zato to oni ne mogu nai svoj obrazac u meni,
bie protiv mene.
A ja ne govorim o obrascu, nego o dubljem uzorku koji obuhvata sve obrasce. Postoji
jedan obrazac, drugi obrazac, pa opet drugi obrazac, milioni uzoraka. Ali svi obrasci poivaju
na neemu skrivenom ispod, koje je obrazac obrazaca - skrivena harmonija. Oni ne mogu
izgledati kao to, ali takoe nisu pogreni. Kada ivite s odreenom tradicijom, odreenom
filozofijom, odreenim nainom gledanja na stvari, postajete usklaeni s tim.
Na taj nain ja nisam bio usklaen ni sa kim - bar ne toliko da bih mogao postati deo
njih. U izvesnom smislu to je nesrea, ali u drugom smislu to se pokazalo kao blagoslov.
Mnogi koji su radili sa mnom postigli su osloboenje pre mene. To je bila nesrea za mene. Ja
sam oklevao i oklevao u pozadini, jer nikada nisam delovao potpuno ni sa im, kretao sam se
od jednog do drugog.
Mnogi su uspeli (postigli ostvarenje) koji su zapoeli sa mnom. ak i nekoliko (njih)
koji su poeli posle mene uspeli su pre mene. To je bila nesrea, ali u drugom smislu je to bio
blagoslov jer sam upoznao svaku kuu. Moda ne pripadam nijednoj kui, ali sam kod kue
svuda. Zbog toga nisam dobio (prvobitnog) majstora majstora - nikada nisam bio sledbenik
odreenog majstora. Onda ste vi kola; bivate usmereni. Onda znate jezik. Tako ja nisam bio
usmeravan ni od koga nego pomagan od mnogih. Treba shvatiti razliku; nisam usmeravan, ne
primam nikakve zapovesti: "Uradi ovo ili nemoj uraditi ono," nego sam pomagan od mnogih.
aini moda ne oseaju da im pripadam, ali Mahavira osea, jer svakako on moe
videti obrazac obrazaca. Sledbenici Isusa moda nee moi da me razumeju, ali Isus moe.
Dakle meni pomau mnogi. Zbog toga mi dolaze mnogi ljudi razliitog porekla. U ovo vreme
nigde na zemlji ne moete nai takav skup. Ima Jevreja, hriana, muslimana, hindusa, aina,
budista, iz celog sveta. A vie i vie e ubrzo dolaziti.
To je pomo od mnogih majstora. Oni znaju da ja mogu biti koristan njihovim
sledbenicima; oni e slati mnogo vie - ali ne instrukcije, jer ja nikada nisam primao
instrukcije ni od kog majstora kao sledbenik. Sada takoe nema potrebe za to. Samo pomo, a
to je bolje - oseam veu slobodu. Niko ne moe biti tako slobodan kao to sam ja.
Jer ako primate uputstva od Mahavire, ne moete biti slobodni kao to sam ja. ain
mora da ostane ain. On mora nastaviti da govori protiv budizma. On mora to, jer je to borba
mnogih obrazaca i tradicija. A tradicije mora da se bore ako ele da preive. Radi sledbenika
one moraju biti sklone raspravljanju; moraju rei: "To je pogreno," jer samo onda sledbenik
moe oseati: "Ovo je ispravno." Naspram pogrenog, sledbenik osea da je ispravan.
170

Sa mnom vi ete biti na gubitku. Ako ste upravo ovde sa svojim intelektom, vi ete
biti zbunjeni. Poludeete jer ovog momenta ja kaem neto, a sledeeg momenta to poriem;
jer ovog momenta sam govorio o jednoj tradiciji, a drugog momenta o drugoj. Ponekad ne
govorim ni o jednoj tradiciji; govorim o meni. Onda vi to ne moete nai nigde u nekom
spisu.
Inae meni je pomognuto, a pomo je lepa jer po svoj prilici ja je neu slediti. Ja
nisam prisiljen da je sledim. To zavisi od mene. Pomo je data neuslovljeno. Ako oseam da
elim da je koristim, ja u je koristiti; ako ne oseam potrebu ja je neu koristiti. Nemam
obavezu ni prema kome.
Ali ako postanete jednog dana prosvetljeni, onda je moete primati. Ako nisam u telu,
onda moete primati instrukcije od mene. Ovo se uvek deava prvoj osobi, kada tradicija
zapone. To je poetak, roenje, a vi nikada niste proces raanja. Najlepe je kada se neto
rodi, jer je to najivlje. Ubrzo, kako dete poraste, ono dolazi blie i blie smrti. Tradicija je
najsveija kada se rodi. Ona ima svoju vlastitu neuporedivu, jedinstvenu lepotu.
Ljudi koji su sluali Riaba, prvog ainskog tirthankaru, imali su razliite kvalitete.
Kada su sluali Mahaviru, tradicija je bila hiljadama godina stara. Bila je na ivici umiranja. Sa
Mahavirom, ona je umrla.
Kada se u tradiciji vie ne raaju majstori, ona je mrtva. To znai da tradicija vie ne
raste. aini su je zatvorili. Kod dvadeset etvrtog oni su rekli, "Sada, nema vie majstora,
nema vie tirthankara." Da se bude sa Nanakom bilo je lepo jer neto novo je dolazilo iz
materice - iz materice univerzuma. Ba kao to posmatrate raanje deteta - misterija nepoznato prodire u poznato, bestelesno postaje otelovljeno. To je svee kao kapi rose. Ubrzo
sve e biti prekriveno prainom. Ubrzo, kako vreme prolazi, stvari e postati stare.
Ali vremenom do desetog gurua sikha, desetog majstora, stvari su postale mrtve.
Onda su oni zatvorili lozu, i rekli: "Sada, nema vie majstora, nema vie tirthankara." Zbog
toga su nazvali svoje spise "Guru-granth" - majstorovi spisi. Sada vie nee postojati osobe;
samo mrtvi spisi e biti sada majstor. A kada je spis mrtav to je besplodno, uzaludno - ne
samo nekorisno; to je otrovno. Ne doputajte nita mrtvo u vaem telu. To e stvoriti otrov; to
e unititi ceo va sistem.
Ovde je neto novo roeno, poetak. To je svee, ali je zbog toga to takoe vrlo teko
videti. Kada odete do izvora reke Gang, ona je tamo tako mala - ivahna, svea naravno;
nikada opet nee biti tako svea, jer kada se kree sakuplja mnoge stvari, akumulira, postaje
sve prljavija. U Kashiju je najprljavija, ali je onda zovete "Sveta Ganga" jer je sada tako
iroka. Akumulirala je tako mnogo, sada je ak i slep ovek moe videti. U Gangotriu - na
poetku, na izvoru - treba paljivo da motrite. Samo tada moete videti: inae to je samo
kapanje kapi. Ne moete ak ni verovati da e ovo kapanje kapi postati Gang - neverovatno.
Teko je upravo sada shvatiti ta se deava, jer to je vrlo, vrlo mala struja, ba kao
dete. Ljudi ne primeuju Riaba, prvog ainskog tirthankaru, ali mogu li oni prepoznati
Mahavira - videti ga? aini ne misle mnogo o prvom - Riabu. U stvari, oni iskazuju svo
svoje potovanje Mahaviru. Zapravo u zapadnom umu, Mahavir je tvorac ainizma. Zato to
iskazuju tako mnogo potovanja Mahaviru u Indiji, kako onda drugi mogu misliti da je neko
drugi bio zaetnik? Riab je postao legendaran, zaboravljen; moda je postojao, moda nije
postojao, izgleda da nije istorijski - drevna prolost - i vi ne znate mnogo o njemu. Mahavira
je istorijski, i on je Gang pored Benaresa, Kashia - tako iroka.
Zapamtite da je poetak mali, ali nikada misterija nee biti tako duboka kao na
poetku. Poetak je ivot, a kraj je smrt. Sa Mahavirom, smrt ulazi u ainsku tradiciju. Sa
Riabom, ivot je uao, silazei odozgo s Himalaja na zemlju.
Nikoga nisam imao da mu budem odgovoran, nikoga da od njega dobijem instrukcije,
ali mnogo pomoi je dostupno. Ako uzmete to sve zajedno, to je vie nego to neki majstor
moe poduiti. Kada govorim o Patanjaliju, Patanjali je od pomoi. Mogu govoriti isto kao
da on govori ovde. Ja zapravo ne govorim; ovo nisu komentari. On sam koristi mene kao
vozilo. Kada govorim o Heraklitu, on je ovde, kao pomo. Ovo treba da shvatite, i da imate
veu mo opaanja, tako da moete videti poetak.
171

Da biste se kretali u tradiciji, kada je ona postala velika sila, nije potrebna velika mo
opaanja, ni mnogo senzitivnosti. Da doete kada stvari zapoinju, ujutru, teko je. Ali uvee
mnogi dou jer stvar je postala tako rairena i mona. Ujutru samo nekoliko izabranih doe,
koji imaju senzitivnosti da osete kako se neto veliko raa. Vi to odmah sada ne moete
dokazati. Vreme e dokazati to. Bie potrebne hiljade godina da se dokae ta je roeno, ali vi
ste sreni da budete ovde. Ne propustite priliku, jer ovo je najsveija taka i najtajanstvenija.
Ako moete to da osetite, da dozvolite da to ue duboko u vas, mnoge stvari e postati
mogue u vrlo kratkom vremenskom periodu. To jo ne prilii da bude sa mnom - to nije
prestino da bude sa mnom - to nije dobrog glasa. Zapravo, samo kockari mogu biti sa mnom
koji ne mare i ne brinu ta drugi kau. Ljudi koji su cenjeni ne mogu doi. Posle nekoliko
godina, kada uskoro tradicija postane mrtva, ona postane cenjena. Oni e doi zbog ega.
Vi niste ovde zbog ega, jer sa mnom nema ta da se dobije ni za ego. Vi ete izgubiti.
Sa Riabom, samo ljudi koji su bili okretni, hrabri i odvani, avanturisti, oni su se pokrenuli;
sa Mahavirom, mrtvi biznismeni - ne kockari. Zbog toga su aini postali poslovna zajednica.
itava zajednica je poslovna; ne bave se ni sa im osim biznisom. Biznis je najmanje hrabra
stvar u svetu. Zbog toga biznismeni postaju kukavice. Na prvom mestu oni su bili kukavice;
zbog toga su postali biznismeni.
Farmer je hrabriji jer on ivi s nepoznatim, ne zna ta e se dogoditi, da li e biti kie
ili ne - niko ne zna. Kako moete verovati oblacima? Moete verovati bankama, ali ne moete
verovati oblacima. Ne - niko ne zna ta e se dogoditi; kai se sa nepoznatim. Ali on ivi
mnogo hrabriji ivot - kao ratnik.
Sam Mahavira je bio ratnik; svih dvadeset etiri tirthakara kod aina bili su ratnici.
Koja se onda nesrea dogodila? ta se dogodilo da su svi sledbenici postali biznismeni? Oni
su postali biznismeni s Mahavirom jer su oni doli samo s Mahavirom - kada je tradicija bila
slavna, imala legendarnu prolost, postala je ve mit i bilo je cenjeno da se bude s njom.
Mrtvi ljudi dolaze samo kada neto postane mrtvo; ivi ljudi dolaze samo kada je
neto ivo. Mladi ljudi e dolaziti vie meni. ak i ako mi doe neko star, obavezno je mlai
u srcu. Stari ljudi trae ugled, potovanje. Oni e odlaziti u mrtve crkve i hramove gde niega
nema osim praznine i prolosti. ta je prolost? Praznina. Sve ivo je sada ovde, sve ivo ima
budunost, jer budunost raste iz toga. Onog momenta kada zaponete da gledate u prolost,
ne moe biti rasta.
Da li primate instrukcije od nekog majstora majstora?
Ne. Ali ja primam pomo koja je mnogo lepa. Ja sam bio osamljenik, vagabund bez
kue, prolazio sam, uio, kretao se, ne ostajui nigde. Stoga nemam nikoga na koga bi se
ugledao. Ako sam morao neto otkriti, morao sam to otkriti sam. Mnogo pomoi je dostupno,
ali sam morao to da odradim. Na neki nain to e biti velika pomo jer ne zavisim ni od
kakvog kodeksa, morala. Ja pazim, posmatram sledbenika. Nema nikog kao to je majstor
koji bi mene posmatrao. Ja moram da posmatram sledbenika mnogo dublje da bih naao
putokaz. Moram da sagledam u vama ta e vam pomoi. Zbog toga su moje uenje, moje
metode, razliite kod razliitog sledbenika. Nemam univerzalnu formulu, ne mogu imati;
nema fiksnih pravila na koja moram odgovoriti. Nemam ve nainjenu gotovu disciplinu. To
je pre fenomen rasta. Svaki sledbenik dopunjava to. Kada zaponem da radim s novim
sledbenikom, moram da ga pogledam, istraim. Naem ta e mu pomoi, kako on moe da
raste. I svaki put, sa svakim sledbenikom, raa se novi kod.
Vi ete zaista doi u neprijatnost kada ja odem - jer e biti toliko mnogo pria od
svakog sledbenika, i neete moi da uhvatite nikakav cilj, glavu ili rep toga - jer ja govorim
svakoj individui kao pojedinac. Sistem raste kroz njega, i on raste u mnogim, mnogim
pravcima. To je iroko drvo, mnogo grana, mnogo pod-grana, pruajui se u svim pravcima.
Ja ne primam nikakve instrukcije od majstora. Ja primam instrukcije od vas. Kada
pogledam u vas, u vae nesvesno, u vau dubinu, ja primam instrukcije odatle i izraujem ih
za vas. To je uvek novi odgovor.
172

Drugo pitanje:
Zato majstorima trebaju uputstva od majstora majstora? Nisu li oni dovoljni u sebi
kada su dostigli prosvetljenje? Ili postoje takoe stupnjevi prosvetljenja?
Ne, zapravo nema stupnjeva, ali kada je majstor u telu, i kada majstor napusti telo i
postane bestelesan, postoji razlika - ne ba stupnjevi. To je kao kada stojite pored puta ispod
drveta; moete videti deo puta; izvan tog dela ne moete videti. Onda se popnete na drvo. Vi
ostajete isti; nita se ne dogaa vama ili vaoj svesti. Ali popevi se na drvo moete videti
miljama na ovu i onu stranu.
Onda letite avionom. Nita se vama nije dogodilo; vaa svest ostaje ista. Ali sada
moete videti hiljade milja. U telu vi ste na putu - sa strane pokraj puta - spakovani, okrueni
u telu. Telo je najnia taka u egzistenciji jer ona oznaava preputanje materiji, bivanje s
materijom. Materija je najnia taka, a Bog je najvia taka.
Kada majstor postigne prosvetljenje u telu, telo mora da ispuni svoje karme, prole
samskare, prola uslovljavanja. Svaki raun mora da bude namiren; samo onda telo moe biti
naputeno. To je slino ovome: va avion je prispeo, ali imate mnogo poslova da zavrite. Svi
kreditori su tu, trae da namire raune pre nego to odete. A ima mnogo kredita, jer mnogo
ivota ste obeavali, radili stvari, delovali, ponaali se, ponekad dobro, ponekad loe, ponekad
ste bili grenik, ponekad svetac. Akumulirali ste mnogo. Pre nego to odete, cela egzistencija
od vas zahteva sve da zavrite.
Kada ste postali prosvetljeni, sada znate da niste telo, ali dugujete mnoge stvari telu i
materijalnom svetu. Vreme je potrebno - Buddha je iveo etrdeset godina posle svog
prosvetljenja, Mahavira je takoe iveo oko etrdeset godina - da plate, da plate sve to su
dugovali, da zavre svaki ciklus koji su zapoeli. Nema novih akcija, ali stare stvari koje vise
moraju se zavriti, stare stvari koje vise nad glavom moraju se okonati. Kada su svi rauni
namireni, onda moete poleteti.
Do sada, sa materijom, vi ste se kretali horizontalno - upravo kao volovska kola. Sada
se moete kretati vertikalno. Sada moete ii navie. Pre ovoga, vi ste uvek ili napred ili
nazad; nije bilo vertikalnog kretanja. to se vie uzdiete - a Bog je najvia taka, majstor
majstora - odatle je percepcija potpunija. Vaa svest je ista; nita se nije promenilo; jedan
prosvetljen ovek ima istu svest kao vrhovno stanje svesti, Bog - nema razlike u svesti. Ali
percepcija, polje opaanja, je razliito; sada moe gledati svuda.
Bilo je velikih rasprava u vremenima Bude i Mahavire. Bie korisno razumeti ovo
pitanje. Postojala je rasprava: sledbenici Mahavire su obino govorili da je Mahavira
svemoan, sveznajui, sveprisutan, sarvagya. Na neki nain oni su bili u pravu, jer kada ste
jednom osloboeni od materije i tela vi ste Bog. Meutim na neki nain su greili, jer vi
moete biti osloboeni tela, ali ga jo niste napustili. Identifikacija je prekinuta; vi znate da
niste telo; ali ste jo u njemu.
To je kao da ivite u kui; onda iznenada saznate da ova kua ne pripada vama - kua
je neija i vi ivite u njoj. Ali onda takoe, da biste napustili kuu moraete da nainite
dogovore, moraete da preselite stvari. A za to e trebati vreme. Vi znate da ova kua nije
vaa, vae dranje se promenilo. Sada niste zabrinuti za ovu kuu, ta e se njoj dogoditi. Ako
se sledeeg dana srui i postane razvalina, za vas to nije nita. Ako se sledeeg dana po vaem
odlasku ona zapali, to za vas nije nita; ona pripada nekome drugom. Upravo pre jednog
trenutka bili ste identifikovani sa kuom. Da se zapalila, da se sruila, mnogo biste se brinuli.
Sada je identifikacija prekinuta.
U pravu su Mahavirini sledbenici u jednom smislu, jer kada ste spoznali sebe, vi ste
postali sveznajui. Ali Budini sledbenici su obino govorili da to nije ispravno - Buddha moe
znati ako eli da zna neto, ali on nije sveznajui. Oni su obino govorili da ako Buddha eli,
on moe usredsrediti svoju panju u bilo kom pravcu, a kad god usredsredi svoju panju, bie
sposoban da zna. Sposoban je za sveznanje, ali nije svaznajui. Razlika je suptilna, delikatna,
ali lepa. Jer oni su rekli da ako on zna sve i sve stvari neprekidno, poludee. Ovo telo toliko
ne moe podneti.
173

Oni su takoe u pravu. Buddha u telu moe znati sve ako eli da zna. Njegova svest,
zbog tela, slina je lampi. Vi ulazite u mrak sa lampom. Moete znati sve ako se usredsredite;
svetlo je s vama. Ali lampa je kao baterijska lampa; ona nije plamen. Plamen baklje e dati
svetlo u svim pravcima; a lampa se usredsreuje u odreenom pravcu - gde god elite. Lampa
nema izbor, moete pogledati prema severu, i ona e onda pokazati sever. Moete gledati na
jug, i ona e onda otkriti jug. Ali sve etiri strane se ne otkrivaju zajedno. Ako pokreete
lampu prema jugu, onda je sever zatvoren. To je uzan tok svetla.
Ovo je bilo gledite Budinih sledbenika. Mahavirovi sledbenici su obino govorili da
on nije kao lampa, on ja kao baklja; svi pravci su otkriveni. Ali ja vie volim gledite Budinih
sledbenika. Kada je telo prisutno, vi ste sueni, ogranieni. Telo je ograniavanje. Vi postajete
kao lampa - jer ne moete videti iz ruku, samo moete videti iz oiju. Ako moete videti samo
iz oiju, ne moete videti iz svojih lea jer tamo nemate nikakvih oiju. Morate okrenuti svoju
glavu.
Sa telom sve je fokusirano i sueno. Svest je nefokusirana i tekua, tee u svim
pravcima, ali vozilo, telo, nije u svim pravcima - ono je uvek fokusirano, tako da vaa svet
takoe postaje suena na njega. Ali kada telo vie nije tu, a Buddha je napustio telo, onda
nema problema. Svi pravci se otkrivaju zajedno.
Ovo je stvar koju treba razumeti. Zbog toga ak i prosvetljena osoba moe biti voena,
jer prosvetljena osoba je jo privezana za telo, usidrena u telu, u skuenom telu, a Bog je
neogranien, lebdi u najviem nebu. Odatle on moe videti u svim pravcima. Odatle on moe
videti prolost, budunost, sadanjost. Odatle njegov pogled je vedar. Zbog toga on moe
pomoi.
Va pogled, ak i ako postanete prosvetljeni u telu, je zamagljen. Telo je svuda oko
vas. Status svesti je isti, unutarnja realnost svesti je ista, kvalitet svetlosti je isti. Ali jedno
svetlo je ogranieno na telo i postalo je usko; drugo svetlo uopte ni na ta nije ogranieno samo je lebdee svetlo. U najviim nebima, voenje je mogue.
Zato su majstorima potrebna uputstva od majstora majstora?
To je razlog.
Nisu li oni dovoljni u sebi kada su postigli prosvetljenje, ili su ovo stupnjevi
prosvetljenja takoe?
Oni su dovoljni. Oni su dovoljni da vode sledbenike; oni su dovoljni da pomau
poklonike. Nita nije potrebno. Ali ipak su ogranieni, a onaj ko je neogranien uvek je dobra
pomo. Vi ne moete gledati u svim pravcima; on moe gledati.
Vi se takoe kreete i posmatrate, ali to treba da bude uraeno. To je ono ta ja radim;
nemajui instrukcije odozgo, nikoga da me vodi, moram uvek da budem u pokretu osmatrajui iz tog pravca i onog pravca, gledajui u vas kroz mnogo stanovita tako da
potpuno moete biti sagledani. Moram da gledam kroz, ali se moram kretati oko vas. Samo
letimino sagledavanje nee pomoi jer kratak pogled e biti suen kroz telo. Ja imam baklju i
kreem se svuda okolo vas, posmatrajui sa svakog mogueg stanovita.
Na neki nain je to teko jer moram raditi vie. Ali je na neki nain vrlo lepo jer
moram raditi vie i moram posmatrati sa svakog mogueg stanovita. Saznao sam mnoge
stvari koje gotove instrukcije ne mogu uraditi. A kada majstor majstora, u Patanjalijevoj
ideologiji - Bog - daje instrukcije, on ne daje objanjenja; od daje jednostavno uputstva. On
jednostavno kae: Uradite ovo; ne radite ono."
Oni koji slede ove instrukcije, takoe e eleti gotovo, pripremljeno. Nuno je da bude
tako jer e rei: Uradi ovo." Oni nee imati objanjenje. I vrlo kodirane instrukcije e biti
date. Objanjenja su vrlo teka - a za njih takoe nema potrebe, jer kada su data s vieg
stanovita to je u redu. ovek samo treba da bude posluan.
Majstor je posluan majstoru majstora, a vi morate biti posluni majstoru. Neka
poslunost, pokornost sledi. To je kao vojna hijerarhija; nema mnogo slobode. Nije mnogo
dozvoljeno. Naredba je naredba. Ako traite objanjenje, vi ste neposluni. A to je problem,
174

jedan od najveih problema oveanstva s kojim sada mora da se suoi; sada ovek ne moe
biti posluan kao u prolosti. Vi ne moete jednostavno rei: Ne radi ovo"; objanjenje je
potrebno. A nijedno obino objanjenje nee delovati. Vrlo autentino objanjenje je
potrebno, jer sama priroda uma oveanstva vie nije posluna. Sada je unutra ugraena
buntovnost; dete se sada raa neposluno.
Bilo je potpuno razliito u vreme Bude i Mahavire. Svako je uen da bude individua,
da stoji na svom vlastitom, da veruje u sebe. Poverenje je postalo teko. Poslunost nije
mogua. Ako neko sledi bez pitanja, mislite da je slepi sledbenik. On se kudi. Sada vam moe
pomoi samo majstor koji ima sva objanjenja - vie nego to traite, koji vas moe potpuno
isprazniti. Vi nastavljate da pitate, a on moe nastaviti da vam odgovara. Dolazi momenat
kada ste umorni od pitanja, i kaete, U redu, slediu."
Nikada ranije ovo nije bilo tako. To je bilo jednostavno; kada Mahavira kae: Uradi
ovo," vi uradite to. Ali to nije mogue, jednostavno zato to je ovek tako razliit. Moderan
um je neposluan um, a vi ga ne moete promeniti. Na taj nain evolucija ga je postavila, nita
u tome nije pogreno. Zbog toga su stari majstori otpadali s puta; niko ih nije sluao. Vi idete
kod njih. Oni imaju instrukcije, lepe instrukcije, ali ne daju nikakvo objanjenje. Instrukcije
treba da slede kao logiki zakljuak. Sva objanjenja prvo treba da budu data, a onda majstor
treba da kae: Prema tome, uradi ovo."
To je dugaak proces, ali tako je kako jeste. Nita se ne moe uraditi. U nekom smislu
to je lep rast, jer kada jednostavno imate poverenje, vae poverenje nema u sebi obazrivosti,
nema napetosti u sebi. Vae poverenje nema otrine u sebi. Ono je bezlino, nema tonaliteta u
sebi, nema boje u sebi. To je samo sivo. Ali kada moete sumnjati, moete raspravljati,
moete rasuivati i majstor moe zadovoljiti sve vae razloge, argumente i sumnje, onda se
javlja poverenje koje ima svoju vlastitu lepotu jer je postignuto naspram pozadine sumnje.
Nasuprot svih sumnji to je postignuto, protiv svih izazova to je postignuto. To je bila
borba. To nije bilo jednostavno i jeftino; to je bilo skupo. Kada postignete neto posle duge
borbe, to ima svoju vlastitu vrednost. Ako jednostavno dobijete, naete to kako lei na putu i
odnesete kui, to nema lepotu. Ako bi imalo kohinoora svuda na zemlji, ko bi mario da ih
odnese kui? Ako bi kohinoor bio samo obian belutak koji lei svuda, ko bi onda mario (za
njega)?
U davnim danima, vera je bila slina oblucima svuda po zemlji. Sada ona mora da
bude kohinoor. Sada treba da bude dragoceno postignue. Instrukcije nee pomoi. Majstor
mora da bude tako dubok u svojim objanjenjima da vas iscrpi. Ja vam nikada ne kaem da ne
pitate. Zapravo, upravo je drugaiji sluaj. Ja vam kaem pitajte, a vi ne nalazite pitanja.
Ja u izneti na povrinu sva mogua pitanja iz vaeg nesvesnog, i objasniu ih. Niko
vam ne moe rei da ste slepi sledbenik. Neu vam dati ni jednu jedinu instrukciju bez
potpunog zadovoljenja vaeg zdravog razuma - ne, jer vam to nee pomoi ni na koji nain.
Instrukcije su date od majstora majstora, ali one su samo citirane rei - sutre: Uradi
ovo; nemoj uraditi ono." U novom dobu, to nee pomoi. ovek je tako racionalan, da sada,
ak i ako poduavate iracionalnost morate da prosuujete o tome. To je ono to ja radim: uim
vas apsurdnosti, iracionalnom, uim vas misterioznom - a kroz razum. Va razum tako mnogo
treba da bude iskorien da vi sami postanete svesni da je to besplodno - odbacite to. Toliko
vam se mora govoriti o vaem razumu da budete nahranjeni, snabdeveni s njim; vi ete ga
odbaciti sami, ne kroz poduavanje.
Jer pouka vam moe biti data, ali vi ete prianjati. To nee pomoi. Ja vam neu rei:
Samo verujte meni." Ja kreiram celu situaciju u kojoj vi ne moete initi drugaije, moraete
da imate poverenje. Za to e trebati vreme - malo due - nego za jednostavnu poslunost. Ali
to vredi.
Tree pitanje:
Mi, u naoj nesvesnosti i egoistinom stanju, nismo uvek u dodiru sa majstorom. Ali,
da li je majstor uvek u dodiru s nama?

175

Da, jer majstor je u dodiru sa sva vaa etiri sloja. Va svesni sloj je samo jedan od
etiri sloja. Ali to je mogue samo kada ste se predali i prihvatili njega kao vaeg majstora ne pre toga. Ako ste upravo uenik, koji ui, onda kada ste u dodiru, majstor je u dodiru; kada
niste u dodiru, on takoe nije u dodiru.
Mora da se razume, ovaj fenomen... Vi imate etiri uma; nad um koji je najverovatnije
iz budunosti, od koga nosite samo seme - nita nije isklijalo - samo seme, samo
potencijalnost. Onda svesni um - samo mali fragmenat s kojim vi razumete, razmiljate,
odluujete, prosuujete, sumnjate, verujete - ovaj svesni um je u dodiru sa majstorom kome se
niste predali. Dakle, kad je on u dodiru, majstor je u dodiru. Ako on nije u dodiru, onda
majstor nije u dodiru. Vi ste uenik, a niste uzeli majstora kao majstora. Jo mislite o njemu
kao o uitelju.
Uitelj i uenik postoje u svesnom umu. Nita ne moe biti uinjeno jer vi niste
otvoreni; zatvorena su sva vaa troja vrata. Nadsvest je samo seme; ne moete otvoriti njena
vrata.
Podsvesno je upravo ispod svesnog. To je mogue ako volite. Ako ste ovde sa mnom
samo zbog vaeg miljenja i rasuivanja, vaa svesna vrata su otvorena. Kada ih otvorite, ja
sam prisutan. Ako ih ne otvorite, ja sam spolja; ne mogu ui. Upravo ispod svesnog je
nesvesno. Ako ste u ljubavi sa mnom - ne samo u odnosu uitelja i uenika ve mnogo
prisnije, u fenomenu slinom ljubavi - onda su podsvesna vrata otvorena. Mnogo puta svesna
vrata ete zatvoriti. Vi ete raspravljati protiv mene; biete ponekad negativni; ponekad ete
biti protiv mene. Ali to ne mari. Nesvesna vrata ljubavi su otvorena i ja mogu ostati u dodiru s
vama.
Ali to takoe nisu savrena vrata, jer ponekad vi me moete mrzeti. Ako me mrzite,
zatvorili ste ta vrata takoe. Ljubav postoji, ali nasuprot tome, mrnja takoe postoji - ona je
uvek s ljubavlju. Druga vrata e biti vie otvorena nego prva - jer prva menjaju svoja
raspoloenja tako brzo da vi ne znate... Svakog momenta se to menja. Maloas jednog
momenta je to bilo ovde, sledeeg trenutka nije tu; to je trenutna pojava.
Ljubav je malo dua. Ona takoe menja svoja raspoloenja, ali njena raspoloenja
imaju due periode. Ponekad ete me mrzeti. U trideset dana gotovo e biti osam dana - jednu
sedmicu i etiri dana vi ete me mrzeti. Ali tri sedmice je otvoreno. S razumom, sedmica je
predugaka; ona je venost. S razumom je jedan momenat za, drugi momenat protiv; na taj
nain on se kree. Ako su druga vrata otvorena i vi ste u ljubavi sa mnom, ak i ako su vrata s
razumom zatvorena, ja mogu ostati u kontaktu.
Trea vrata su ispod podsvesti; to je nesvesno. Razum otvara prva vrata - ako se
oseate ubeeni sa mnom. Ljubav otvara druga vrata koja su vea od prvih - ako ste u ljubavi
sa mnom; ne ubeeni, nego u ljubavi - oseajui privlanost, bliskost, harmoniju, naklonost.
Trea vrata otvaraju predanost, ako sam vas ja inicirao, ako ste uskoili u sanyasu, ako
ste skoili i rekli mi: Sada - sada ti budi moj um. Sada preuzmi uzde moje. Sada me vodi a ja
u te slediti." Neete uvek biti sposobni da radite to, ali upravo sam gest da ste se predali
otvara trea vrata.
Trea vrata ostaju otvorena. Vi moete biti protiv mene racionalno. To nije vano; ja
sam u dodiru - jer trea vrata uvek ostaju otvorena. Vi ste se predali. Vrlo je teko zatvoriti
trea vrata - vrlo, vrlo teko. Teko ih je otvoriti, teko ih je zatvoriti. Teko ih je otvoriti, ali
nije toliko teko kao zatvoriti ih. Ali ona takoe moraju biti zatvorena jer ste ih otvorili. To
takoe moe biti zatvoreno. Moete odluiti jednog dana da uzmete svoju predanost natrag.
Ili, moete otii i predati sebe nekome drugom. Ali to se nikada - gotovo nikada - ne dogaa,
jer s ovo troje vrata majstor radi da otvori etvrta vrata.
Stoga je vrlo... gotovo da je nemogue da ete uzeti svoju predanost natrag. Pre nego
to je uzmete, on mora da je otvorio etvrta vrata koja su iznad vas. Vi ih ne moete otvoriti,
ne moete ih zatvoriti. Za vrata koja otvorite, vi postajete majstor da ih takoe zatvorite. Ali
etvrta nema nita da ine s vama. To je nadsvest. Sva ova troje vrata potrebno je otvoriti tako
da majstor moe iskovati, krivotvoriti klju za etvrta vrata, jer vi nemate klju, inae vi sami
ih ne moete otvoriti. Majstor mora da izmisli, krivotvori; to je krivotvorenje jer sam vlasnik
nema klju.
176

Ceo napor majstora je da ima dovoljno vremena od ovih troja vrata da bi proao
etvrta, iskovao klju i otvorio ih. Jednom kada su otvorena, vas vie nema. Ne moete uraditi
nita. Moete izgubiti sva troja vrata - on ima klju za etvrta i uvek je u kontaktu. Onda ak i
kada umrete, to nije vano. Vi idete do samog kraja zemlje, odlazite na mesec, nema nikakve
razlike; on ima klju za etvrta vrata. Zapravo, pravi majstor nikada ne dri klju. On
jednostavno otvara etvrta i baca klju u okean. Dakle, ne postoji mogunost da se ukrade i da
se ita uradi. Nita se ne moe uraditi!
Ja imam iskovan klju od etvrtih vrata od mnogih vas, i bacio sam ga, stoga, ne
uznemiravajte se nepotrebno; to je beskorisno, sada nita ne moe da se uradi. Jednom kada
su etvrta vrata otvorena, onda nema problema. Svi problemi postoje pre toga, jer u samom
zadnjem momentu majstor je spremio klju, jer klju je teak...
Za milione ivota vrata su bila zatvorena; sakupila su sve vrste re. To izgleda kao zid,
ne kao vrata. Teko je nai gde je brava, a svako ima posebnu bravu, tako da ne postoji kalauz
za sve. Nijedan klju nee pomoi jer svako je individualan, kao va otisak palca. Niko nema
nigde taj otisak - ni u prolosti niti u budunosti. Va otisak prsta e jednostavno biti va,
jedinstveni fenomen. Nikada se ne ponavlja.
Vaa unutranja brava je takoe kao va otisak palca - apsolutno individualna; nikakav
kalauz ne moe pomoi. Zbog toga je majstor potreban, jer glavni klju (kalauz) ne moe da
se kupi. Inae, jednom kada se klju naini, svaka vrata bi mogla da se otvore. Ne, svako ima
poseban tip vrata, odvojen tip vrata - svoj vlastiti sistem za zakljuavanje - a vi morate traiti i
nai, i iskovati klju, specijalan klju za sebe.
Jednom kada su otvorena vaa etvrta vrata, onda je majstor u stalnom dodiru s vama.
Moete potpuno da ga zaboravite; to ne ini razliku. Moete da ga ne zaboravite; to ne ini
nikakvu razliku. Ako je majstor napustio telo; to ne ini razliku. Gde god on jeste, gde god ste
vi, vrata su otvorena. A ova vrata postoje izvan vremena i prostora. Zbog toga je to nad-um, to
je nadsvest.
Mi u svojoj nesvesnosti i u svom egoistinom stanju nismo uvek u dodiru sa
majstorom, ali da li je majstor uvek u dodiru s nama?
Da, ali samo kada su etvrta vrata otvorena. Inae, s treim vratima, on je vie ili
manje u kontaktu. S drugim vratima, pola vremena je gotovo u kontaktu. S prvim vratima,
samo je trenutno u kontaktu.
Stoga dozvolite mi da otvorim vaa etvrta vrata - a etvrta vrata se otvaraju u
odreenom trenutku. To je trenutak kada su sva vaa troja vrata otvorena. Ako su samo jedna
vrata zatvorena, etvrta se ne mogu otvoriti. To je matematika zagonetka. A ovaj uslov je
potreban; vaa prva, svesna vrata su otvorena; vaa druga vrata su otvorena - vaa podsvest,
vaa ljubav - vi ste se predali, naini ste korak u inicijaciji, vaa trea, nesvesna vrata su
otvorena.
Kada su svo troje vrata otvorena, kada su u odreenom momentu svo troje vrata
otvorena, etvrta se mogu otvoriti. Dakle, dogaa se da dok ste budni, etvrta vrata je teko
otvoriti. Samo onda dok ste uspavani. Stoga moj pravi rad nije tokom dana. On je tokom noi
kada vrsto uspavani hrete, jer onda ne stvarate nikakvu nevolju. vrsto ste uspavani. Ne
pametujete niti rasuujete protiv. Vi ste zaboravili za rasuivanje.
U dubokom snu vae srce funkcionie dobro. Vie ste ljubazni nego kada ste budni, jer
kada ste budni mnogi strahovi vas okruuju. A zbog straha ljubav nije mogua. Kada ste
vrsto uspavani, strah iezava, ljubav cveta. Ljubav je nono cvee. Mora da ste gledali
nonu kraljicu - cvet koji cveta nou. Ljubav je nona kraljica. Ona cveta nou - zbog vas;
nema drugog razloga. Ona moe cvetati danju, ali onda vi morate promeniti sebe. Ogromna
promena je potrebna, pre nego to ljubav moe da procveta danju. Zbog toga vidite da kada su
ljudi opijeni vie su zaljubljeni, puni ljubavi. Idite u krmu gde su ljudi previe popili; oni su
gotovo uvek puni ljubavi. Pogledajte dvojicu pijanaca koji se kreu ulicom kako vise jedan
drugom o rame; tako odano - kao da su jedno! Uni su uspavani.
177

Kada se ne bojite, ljubav cveta. Strah je otrov. A kada uronite duboko u spavanje, vi
ste ve predani jer spavanje je predanost. Ako ste se predali majstoru, on moe ui u vae
spavanje. Neete moi ak ni da ujete njegove korake. Moe ui mirno i delovati. To je
krivotvorenje, upravo kao kada lopovi uu nou dok spavate. Majstor je lopov. Kada ste
vrsto uspavani i ne znate ta se dogaa, on ulazi u vas i otvara etvrto stanje, (ili etvrta
vrata).
Jednom kada je etvrti um otvoren, onda nema problema. Svaki napor i svaka nevolja
koju moete stvoriti, moete stvoriti samo pre otvaranja etvrtog uma. etvrto je taka bez
povratka. Jednom kada je etvrto otvoreno, majstor moe dvadeset i etiri sata biti s vama nema problema.
Pitanje etvrto:
Kada ovek moe odsei elje bez njihovog potiskivanja?
elje su snovi; one nisu realnost. Vi ih ne moete ispuniti, ne moete ih potisnuti, jer
da bi se ispunila neka stvar ona mora biti realna; da bi se potisnula odreena stvar takoe
treba da bude realna. Realne potrebe mogu biti ispunjene i mogu biti potisnute. elje niti
mogu biti ispunjene niti mogu biti potisnute. Pokuajte da razumete ovo, jer je ovo vrlo
sloeno.
elja je san. Ako razumete ovo, to iezava. Nije potrebno potiskivati to. Zato bi bilo
nuno potiskivati elju? Vi elite da postanete vrlo poznati; to je san, elja, jer telo ne mari da
bude uveno. Zapravo, telo veoma pati kada postanete slavni. Onda nema mira. Onda ste
neprekidno zabrinuti, uznemiravani od drugih, jer ste tako slavni.
Volter je negde zapisao: Kada nisam bio uven, imao sam obiaj da se molim Bogu
svakog dana da me uini poznatim, ovako: Uini me slavnim. Ja sam niko, stoga uini mi da
budem neko. A onda kada sam postao slavan, poeo sam da molim: Dovoljno je, dovoljno;
uini da opet budem niko - jer sam ranije obino iao ulicama Pariza i niko me nije gledao, a
ja sam se oseao tako tunim. Niko nije obraao nikakvu panju na mene - kao da uopte
nisam postojao. Ulazio bih u restorane i izlazio van; niko, ak ni kelneri nisu obraali panju
na mene."
ta je sa kraljevima? Oni ne znaju da je Volter postojao. Onda sam ja postao slavan,"
pisao je on. Onda je bilo teko kretati se ulicom, jer ljudi bi se sakupili. Bilo je teko ii bilo
kuda. Bilo je teko otii u restoran i uzeti hranu na miru. Gomila bi se okupila."
Doao je trenutak kada mu je gotovo bilo nemogue da izae iz kue, jer u to vreme
vladalo je praznoverje u Parizu, u Francuskoj, da ako moete dobaviti komadi platna od vrlo
slavnog oveka i od toga nainite medaljon, to je srea. Gde god da je iao, vraao se go, jer
ljudi bi raskidali njegovu odeu - takoe bi mu povreivali i telo. Kada bi dolazio iz nekog
drugog grada u Pariz ili odlazio iz njega, bila je nuna policija da ga dovede kui.
Stoga je on imao obiaj da moli: Nisam bio u pravu. Uini da jednostavno opet
budem niko, jer ne mogu otii da posmatram reku. Ne mogu izai van da posmatram raanje
sunca, ne mogu se popeti na brdo, ne mogu se kretati. Postao sam zatvorenik."
Oni koji su slavni uvek su zatvorenici. Telu ne treba da bude slavno; telo je tako
apsolutno u redu; njemu ne treba nita slino takvim besmislenim stvarima. Ono trai
jednostavne stvari - hranu; treba mu voda da pije; treba mu sklonite kada je previe toplo, da
se skloni ispod; njegove potrebe su vrlo, vrlo jednostavne. Svet je lud zbog svojih elja, ne
zbog potreba. I ljudi polude. Nastavljaju da reu svoje potrebe, a rastu i uveavaju se njihove
elje. Ima ljudi koji su sveli svoju ishranu na jedan obrok dnevno, ali ne mogu ostaviti svoje
novine, ne mogu prestati da idu u bioskop, ne mogu prestati da pue. Mogu ostaviti hranu potrebe se mogu ostaviti - elje ne mogu. Um je postao despot.
Telo je uvek lepo; zapamtite to. Ovo je jedno od osnovnih pravila koje vam dajem
neuslovljeno, istinito pravilo, apsolutno istinito, kategorino istinito: telo je uvek lepo, um je
ruan. Nije telo to koje treba da se menja. Nema niega da se menja u njemu. To je um. A um
stvara elje. Telo ima potrebe, ali telesne potrebe su stvarne potrebe.
178

Ako elite da ivite, vama treba hrana. Slava nije potrebna za ivot, potovanje nije
nuno da se bude iv. Vama ne treba da budete vrlo velik ovek, ili vrlo veliki slikar - slavan,
poznat celom svetu. Vama ne treba da budete dobitnik Nobelove nagrade, jer Nobelova
nagrada ne ispunjava nijednu potrebu u telu. Ako elite da odbacite potrebe, moraete da ih
suzbijete - jer one su realne. Ako postite moraete da potisnete glad. Onda postoji
potiskivanje, svako potiskivanje je borba unutra, vi elite da ubijete telo, a telo je vae sidro,
va brod koji e vas odvesti do druge obale. Telo dri blago, seme boanskog u vama,
zatieno. Hrana je potrebna za zatitu, voda je potrebna, sklonite je potrebno, udobnost je
potrebna - za telo, jer um ne eli nikakvu udobnost.
Pogledajte moderan nametaj, on uopte nije udoban, ali um kae: Ovo je moderno, a
ta vi radite sedei u staroj stolici? Svet se promenio i moderan nametaj je doao." Moderan
nametaj je zaista udan. Oseate se neudobno u njemu, ne moete sedeti dugo u njemu. Ali je
moderan. Um kae moderno mora biti tu, jer kako moete biti izvan vremena. Budite dorasli
vremenu.
Moderna odea je neudobna, ali je savremena, i um kae da morate pratiti modu. Ljudi
su nainili toliko mnogo runih stvari zbog mode. Telu ne treba nita; ovo su potrebe uma, a
vi ih ne moete ispuniti - nikada, jer su nerealne. Samo nerealno ne moe biti ispunjeno. Kako
moete ispuniti nerealnu potrebu koja zapravo ne postoji? Od kakve je potrebe slava? Samo
meditirajte na tome. Zatvorite svoje oi i pogledajte. Gde je potreba u telu? Kako e vam
pomoi ako ste poznati? Hoete li biti zdraviji ako ste uveni? Hoete li biti tii, smireniji,
ako ste slavni? ta ete iz toga dobiti?
Uvek telo stvara kriterijum. Kad god um kae neto, pitajte telo: ta ti kae?" Ako
telo kae: Besmisleno je", odbacite to. U njemu nema potiskivanja jer je to je jedna nerealna
stvar. Kako moete potisnuti jednu nerealnu stvar? Ujutru ustanete iz kreveta i seate se sna.
Morate li da ga potisnete, ili morate da ga ispunite? A u tom snu ste sanjali da ste postali
vladar celoga sveta. Dakle ta da se radi? Treba li da pokuate? Inae javlja se pitanje: Ako
ne pokuamo, onda je to potiskivanje." Meutim, san je san. Kako moete potisnuti san? San
iezava sam. Treba da budete samo svesni. Morate samo znati da je to san. Kada je san samo
san i spoznat je kao takav, on iezava.
Pokuajte da otkrijete ta je elja, a ta potreba. Potreba je orijentisana na telo, elja
nema orjentaciju na telo. Ona nema korenje. Ona samo lebdi u umu. Gotovo uvek potrebe
vaeg tela dolaze iz vaeg tela, a potrebe vaeg uma dolaze od drugih. Neko kupuje lepa kola.
Neko drugi je kupio lepa kola, jedna strana kola, i sada vaem umu treba poticaj. Kako to
moete dopustiti?
Mula Nasrudin je vozio kola, a ja sam sedeo s njim. Onog momenta kada smo uli u
susedstvo - bio je vrlo topao letnji dan - odmah je zatvorio prozore na kolima. Pitao sam: ta
radi?" On je odgovorio: ta misli? Treba li da dozvolim mojim susedima da saznaju da
nemam klimu u autu?"
Znojio se, ja sam se znojio takoe s njim. Bilo je kao u penici, vrelo, ali kako moete
dopustiti da susedi znaju da nemate kola sa klimom? To je potreba uma. Telo kae: Odbaci
to, jesi li lud?" To je znojenje. On kae: Ne." Sluajte telo; nemojte sluati um. Potrebe uma
su stvorili drugi svuda oko vas; oni su nepromiljeni, tupi, blesavi.
Potrebe tela su lepe, jednostavne. Zadovoljite potrebe tela; nemojte ih suzbijati. Ako
ih suzbijate, postaete sve vie i vie bolesni, oboleli. Nikada se ne brinite o potrebama uma;
jednom kada saznate da je ovo potreba uma... a ima li ikakvih tekoe da se to zna? U emu je
tekoa? Tako je jednostavno saznati da je ovo potreba uma. Jednostavno pitajte telo;
istraujte u telu; naite koren. Postoji li ikakav koren u tome?
Izgledaete luckasto. Svi vai kraljevi i carevi su budalasti. Oni su klovnovi; samo
pogledajte. Odeveni sa hiljadu medalja, izgledaju luckasto. ta oni rade? A za to su patili
dugo. Da postignu to, proli su kroz tako mnogo bede i jo uvek su jadni. Moraju biti jadni.
Um predstavlja vrata za pakao, a vrata nisu nita drugo do elja. Ubijte elju. Neete poiniti
krvoprolie jer elje su beskrvne. Ali ako ubijete potrebe, poiniete krvoprolie. Ubijanjem
potreba postepeno ete umirati. Ubijanjem elje neete umreti. Upravo, naprotiv, postaete
179

slobodniji. Vie slobode e doi iz odbacivanja elja. Ako moete postati ovek potreba, a ne
elja, vi ste ve na stazi i nebo nije daleko.

Poglavlje 7

PREPREKE ZA MEDITACIJU
Izlaganje 7. januara 1975. u dvorani Buda.
I, 30: vyadhistyana samaya pramadalasya viratibhranti darana
labhabhumikatvanavastihitatvani cittavikepdste 'ntarayah.
Humoralni poremeaji (vyadhi), malodunost, sumnjiavost, nehaj, tromost,
nezajaljivost, pomuenost uvianja (bhrantidarana), nemo da se napreduje [na putu
ka konanom cilju], nesposobnost da se [ono dostignuto] odri - [sve to] su [oblici]
duevne neusredsreenosti (cittavikepa). To su te smetnje [o kojima je re u
prethodnom aforizmu].
I, 31:

duhkha daurmana syanga mejayatva vasapravasa vikepa sahabhuvah.


Opta nelagodnost (duhkha), nezadovoljstvo, uznemirenost, neuravnoteenost
udaha i izdaha prate pomenutu neusredsreenost.
I, 32:

tatpratiedharthamekatattvabhyasah.
Da bi otklonio ove [prepreke joginu se preporuuje] praktikovanje
[unutranjeg] objedinjavanja (ekatattvabhyasa).
Patanjali veruje - i ne samo da veruje, on takoe zna - da je zvuk osnovni element
egzistencije. Isto kao to fiziari kau da je elektricitet osnovni elemenat, yogini kau da je
zvuk osnovni elemenat. Oni se slau jedni s drugima na suptilan nain.
Fiziari kau da zvuk nije nita do modifikacija elektriciteta a yogini kau da
elektricitet nije nita drugo do modifikacija zvuka. Onda su i jedni i drugi u pravu. Zvuk i
elektricitet su dve forme jedne pojave, i za mene taj fenomen jo nije poznat i nee ikada biti
poznat. Bilo ta da mi znamo to e biti samo modifikacija toga. To moete nazvati
elektricitetom, moete to zvati zvukom, moete to nazvati vatrom kao Heraklit, moete to
nazvati vodom kao Lao Ce; to zavisi od vas. Ovo su sve modifikacije - oblici bezoblinog. To
bezoblino e uvek ostati nepoznato.
Kako moete znati bezoblino? Znanje je mogue samo kada postoji forma. Kada
neto postane vidljivo, onda to moete znati. Kako moete nevidljivo nainiti objektom
saznanja? Sama priroda nevidljivosti je da on ne moe biti opredmeen. Ne moete ga
oznaiti, ni gde je, ni ta je. Samo neto vidljivo moe postati objekt saznanja.
Dakle, kad god je neto znano, to e biti samo modifikacija nepoznatog. Nepoznato
ostaje nepoznato. To je nesaznatljivo. Dakle, od vas zavisi ta nazivate time, i zavisi od
namene koju ete tome dati. Za yogina elektricitet nije relevantan. On deluje u unutranjoj
laboratoriji bia. Tamo je zvuk mnogo vaniji, jer kroz zvuk on moe promeniti unutra mnoge
pojave i, kroz zvuk, moe takoe promeniti unutranji elektricitet. Yogini to nazivaju pranom
- unutranjom bioenergijom ili bio-elektricitetom. Kroz zvuk to moe odmah biti promenjeno.
Zbog toga, kada sluate klasinu muziku oseate da vas izvesna tiina okruuje;
unutranja energija vaeg tela je promenjena. Sluajte ludog oveka i vi ete osetiti da takoe
postajete ludi; jer je telesni elektricitet ludog oveka u haosu a njegove rei i zvukovi prenose
taj elektricitet. Ako sedite sa prosvetljenim ovekom, odjednom ete osetiti da se unutra u
180

vama sve dogaa u ritmu. Iznenada ete osetiti kako se javlja u vama drugaiji kvalitet
energije.
Zbog toga Patanjali kae da ponavljanje Aum i meditacija na Aum unitava sve
prepreke. ta su prepreke? Sada on opisuje svaku prepreku, i kako se one mogu unititi
ponavljanjem zvuka Aum i meditirajui na njemu; to emo mi morati da prouimo.
Bolest, malaksalost, sumnja, nemar, lenjost, senzualnost, obmana, nemo i
nestabilnost, prepreke su koje remete um.
Uzeemo svaku od njih; na primer bolest. Za Patanjalija bolest (disease) znai disease." To je ne-ritmiki tok vae unutranje bio-energije. Oseate se neudobno. Ako se ova
neudobnost, ova bolest nastavi, pre ili docnije obuzee vae telo. Patanjali se sasvim slae sa
akupunkturom, a u Sovjetskoj Rusiji ovek po imenu Kirlian apsolutno bi se sloio sa
Patanjalijem. Sva tri pravca... Akupunktura nije zainteresovana za prosvetljenje, ali joj je
vano kako telo postaje bolesno, kako dolazi do bolesti. Ona je ustanovila sedam stotina
taaka na telu, gde unutranja bioenergija dodiruje fiziko telo - te dodirne take - njih sedam
stotina svuda su po telu.
Kad god elektricitet ne krui u ovih sedam stotina taaka - ima nekih prekida, nekoliko
taaka vie ne funkcionie, kroz nekoliko taaka elektricitet se vie ne kree, postoje blokade,
elektricitet je preseen, ne krui - onda dolazi do bolesti. Tako akupunktura veruje da bez
ikakvih lekova, bez ikakvog tretmana, ako dozvolite bioenergiji da tee u krugu, bolest
iezava. A za pet hiljada godina... akupunktura je roena kada je Patanjali bio iv.
Kao to sam vam rekao, pre dve hiljade i pet stotina godina nastupio je vrhunac
ljudske svesti. To se dogodilo u vreme Bude: u Kini Lao Ce, uang Ce, Konfuije; u Indiji
Buda, Mahavira i drugi; u Grkoj Heraklit; u Iranu Zaratustra; tada se desilo najvie udo. Sve
religije koje sada vidite u svetu potiu iz tog momenta ljudske svesti. Iz tog vrha Himalaja
reke svih religija su potekle za ove dve hiljade petsto godina.
Upravo, dve hiljade petsto godina pre Bude, desilo se isto udo. Patanjali, Riab zaetnik ainizma - Vede, Upanishade, akupunktura u Kini, yoga u Indiji i tantra; sve se to
dogodilo. Oni su dostigli vrhunac. Nikada taj vrhunac nije ponovo prevazien. Iz te davne
prolosti, pet hiljada godina unatrag, yoga, tantra, akupunktura su potekli kao reke.
Postoji odreena pojava koju Jung zove sinhronicitet". Kada odreeni princip
nastane, ne postaje samo jedna osoba svesna toga - ve mnogi na zemlji, kao da je cela zemlja
spremna to da primi. Pria se da je Ajntajn rekao: Da ja nisam otkrio teoriju relativiteta, za
jednu godinu neko drugi bi je otkrio." Zato? Jer mnogi su ljudi u svetu radili u istom pravcu.
Kada je Darvin otkrio teoriju evolucije da se ovek razvio od majmuna, da postoji
neprekidna borba za preivljavanje jaeg, drugi ovek - Wallace Russell - isto je to otkrio. On
je bio na Filipinima, i bili su takoe prijatelji, ali za mnogo godina nisu znali na emu drugi
radi. Darvin je radio dvadeset godina neprekidno, ali je on bio lenj ovek. Imao je mnoge
fragmente i sve je bilo spremno, ali od toga nije nainio knjigu koju bi predstavio naunom
drutvu tog vremena.
Prijatelji su govorili: Uradi to. Inae neko drugi e to uraditi." Onda je jednog dana
primio pismo sa Filipina u kome je Rasel izloio celu teoriju. On mu je bio prijatelj, ali su
obojica radili odvojeno. Nikada nisu znali da obojica rade na istom istraivanju. Tada se
uplaio, ta da radi! Zato to moe postati pronalaza, a ve dvadeset godina zna princip
istraivanja. Pourio je, na neki nain rukovoen tom situacijom da napie izvetaj, da
predstavi istraivanje naunom drutvu.
Posle tri meseca, svi su postali svesni da je Rasel to takoe otkrio. Rasel je takoe bio
veoma divna osoba. Objavio je da otkrie pripada Darvinu, budui da je dvadeset godina
istraivao, bez obzira da li to prezentirao ili ne... Ipak on je pronalaza.
A to se deava mnogo puta. Iznenada misao postaje vrlo ugledna, kao da misao
pokuava da se ukoreni negde u materici. A obiaj je prirode, da nikada ne preuzima rizik.
Jedan ovek moe da ne uspe, da ne postigne cilj; onda mnogi ljudi moraju pokuati. Priroda
nikada ne preuzima rizik. Drvo e baciti milione semenki. Jedna semenka moe da ne uspe,
181

moda nee pasti na pravo tle, moe biti unitena, ali milioni semenki - ne postoji mogunost
da sve semenke budu unitene.
Kada vodite ljubav, u jednoj ejakulaciji milioni semenki ovek izbaci - jedno od njih
e stii do jajeta ene - ali od miliona. Gotovo u svakoj ejakulaciji ovek ispusti onoliko
semena koliko je upravo sada ljudi na zemlji. Jedan ovek iz jedne ejakulacije moe dovesti
do roenja cele zemlje, populaciju cele zemlje. Priroda ne rizikuje. Ona pokuava na mnogo
naina. Jedan moe da ne uspe, dvoje mogu da ne uspeju, milioni mogu da ne postignu cilj;
ali sa milionima, barem jedan e stici i ostati u ivotu.
Jung je otkrio princip koji se zove sinhronicitet". To je retka stvar. Mi znamo jedan
princip uzroka i posledice; uzrok proizvodi posledicu. Sinhronicitet kae da kad god se neto
dogodi, paralelno s tim mnoge sline stvari se dogode. Ali mi ne znamo zato se to deava, jer
to nije pojava uzroka i posledice. Oni nisu povezani jedan s drugim kao uzrok i posledica.
Kako moete povezati Buddhu i Heraklita? Ako ne po istom principu. Buddha nikada
nije uo o Heraklitu; ne moemo ak ni zamisliti da je Heraklit znao o Budi. Oni su iveli u
odvojenim svetovima. Nije bilo komunikacije. Ali isti tok principa, egzistencija slina reci,
trenutna egzistencija obojicu je dala svetu. Oni nisu prouzrokovali jedno drugo. Oni su
paralelni. Sinhronicitet postoji kao da cela egzistencija u tom momentu eli da proizvede
odreen princip i eli da ga manifestuje, a to nee zavisiti samo od Bude ili samo od
Heraklita; mnogi e to pokuati. Bilo je takoe i drugih koji su otili u zaborav; nisu bili tako
poznati. Buddha i Heraklit postali su najistaknutiji. Oni su bili najmoniji majstori.
U danima Patanjalija, nastao je princip. Moete ga nazvati principom prane bioenergije. U Kini to je uzelo formu akupunkture, u Indiji je uzelo oblik itavog sistema
yoge. Kako se to deava, kada telesna energija ne tee ispravno, da se vi oseate neudobno?
Jer procep postoji u vama, odsustvo, oseate da neto nedostaje. Ovo je zapoinjanje bolesti.
Prvo e se osetiti u umu. Kao to sam vam rekao, osetie se prvo u svesti.
Ne morate biti svesni toga; to e prvo doi u vaim snovima, u vaim snovima
videete bolest, bolesno stanje, neko umire, neto je nepovoljno. None more e se javiti u
vaem nesvesnom, jer nesvesno je najblie telu i najblie prirodi. Iz nesvesnog, to e doi do
podsvesnog; onda ete biti razdraeni. Osetiete da zvezde gree, sve to inite odvija se
pogreno. eleli bi da volite osobu, i pokuavate voleti ali ne moete. eleli biste da
pomognete nekome, ali samo smetate. Sve ide pogreno.
Vi mislite o nekom loem uticaju, od neke zvezde na nebu - ne - neto u podsvesnom,
neto neudobno, i vi postajete iritirani, ljuti, a uzrok je negde u nesvesnom. Vi nalazite uzrok
negde drugde. Onda uzrok dolazi do svesnog. Onda poinjete da oseate da ste bolesni, onda
se to pobudi, prenese i pokrene u telu. To se uvek prenese na telo, i odjednom osetite da ste
bolesni.
U Rusiji je neobian naunik, fotograf Kirlian, otkrio da pre nego to osoba postane
bolesna, est meseci pre, bolest moe da se fotografie. To e biti jedno od najveih otkria u
svetu dvadesetog veka. To e preobraziti itav koncept o oveku, bolesti, medicini, svemu. To
je revolucionaran koncept. On je radio na tome trideset godina i gotovo je sve nauno
dokazao, da kada bolest doe u telo, prvo doe u elektrinu auru oko tela. Procep dolazi do...
Vi ete moda imati tumor u stomaku posle est meseci. Sada odmah ne postoji
osnova. Nijedan naunik ne moe nai nita pogreno u vaem stomaku; sve je u redu, nema
problema. Moete biti paljivo ispitani i vi ste u redu. Ali Kirlian je fotografisao telo na vrlo
osetljivoj fotografskoj ploi; on je razvio najosetljivije foto ploe. Na toj fotografskoj ploi ne
fotografie se samo vae telo, nego i aura svetla koju uvek nosite oko tela. A u toj auri, pored
stomaka postoji upljina u auri - ne tano u fizikom telu, ali neto je poremeeno.
Onda se na osnovu toga moe predvideti da e za oko est meseci nastati tumor. A
posle est meseci kada se tumor pojavi u telu, x-zraci pokazuju istu sliku kao to je on nainio
pre est meseci. Dakle Kirlian kae da se bolest moe predvideti a da se ne bude bolestan - i
da se moe izleiti pre nego to se pojavi u telu, ako je aura tela u veem opticaju, kruenju.
On ne zna kako se to moe izleiti; akupunktura zna, Patanjali zna kako se to moe izleiti.
Za Patanjalija bolest u telu jeste smetnja u auri tela, u prani, u bioenergiji, u
elektricitetu vaeg tela. Zbog toga kroz Aum moe da se izlei. Ponekad sedite usamljeni u
182

hramu. Idite u neki stari hram gde niko ne odlazi, ispod kupole - kupola je kruna samoda bi
odraavala zvuk - dakle sednite ispod nje, pevajte glasno Aum i meditirajte na njemu. Pustite
da se zvuk odbija natrag i pada na vas kao kia, i odjednom ete posle nekoliko minuta osetiti
da vam telo postaje smireno, mirno, utiano; telesna energija se smirila, staloila.
Prva stvar je bolest. Ako ste vi bolesni u svojoj prana energiji, ne moete otii daleko.
Kako moete otii daleko sa boleu koja visi oko vas kao oblak? Ne moete ui u dublja
podruja. Potrebno je odreeno zdravlje. Indijska re za zdravlje vrlo je sadrajna, znaajna;
to je swasthya. Sama re znai biti svoje sopstvo."42 Re zdravlje na sanskritu znai biti sam,
biti usredsreen. Engleska re za zdravlje takoe je lepa. Dolazi od iste rei, istog korena,
odakle dolazi sveto i celina. (Health - holy +whole). Kada ste celoviti onda ste zdravi, a kada
ste potpuni vi ste takoe sveti.
Uvek je dobro doi do korenja rei jer ono budi dugo iskustvo oveanstva. Rei nisu
dole sluajno. Kada osoba osea celo svoje telo energija tee u krugu. Krug je najsavrenija
stvar u svetu. Savreni krug je simbol Boga. Energija ne biva izgubljena, neiskoriena. Ona
stalno krui; nastavlja da se okree kao toak; ona neprekidno odrava sebe.
Kada ste celoviti vi ste zdravi, a kada ste zdravi vi ste takoe sveti, jer ta sveta re
takoe dolazi iz celine. Savreno zdrava osoba je sveta, ali onda e biti problema. Ako odete u
manastire nai ete tamo sve tipove bolesnih ljudi. Zapravo, bolesni ljudi samo tamo idu.
Pitaete ta bi zdrava osoba radila u manastiru. Bolesni ljudi odlaze tamo, nenormalni ljudi
idu tamo. Kod njih je neto pogreno u osnovi. Zbog toga oni bee iz sveta i odlaze tamo.
Patanjalijevo prvo pravilo je da morate biti zdravi, jer ako niste zdravi ne moete
dospeti daleko. Vae bolesti, vaa neudobnost, va prekinuti krug unutranje energije, bie
kamen o vaem vratu. Kada biste hteli da meditirate oseali biste muku ili teinu umesto mira
i spokojstvu. Kada biste eleli da molite, ne moete moliti, eleli bi da se odmarate. Postojao
bi nizak nivo energije. A sa niskom energijom kako moete otii daleko? I da dostignete
Boga? A za Patanjalija Bog je najudaljenija taka; mnogo energije je potrebno. Potrebno je
zdravo telo, zdrav um, zdravo bie. Bolest je bolesno stanje - oboljenje u telesnoj energiji.
Aum e pomoi, a i druge stvari emo takoe razmatrati. Inae ovde Patanjali govori o tome
kako vam Aum, sam zvuk, pomae unutra da postanete celoviti.
Za Patanjalija i za mnoge druge, koji su duboko istraivali ljudsku energiju, jedna
injenica je postala vrlo sigurna - vi morate znati o tome - a to je, to ste vie bolesni, vie ste
senzualni. Kada ste savreno zdravi vi niste senzualni. Obino mislimo upravo suprotno - da
zdrav ovek mora biti senzualan, seksualan, to je tako; on mora da uiva u svetu i u telu. To
nije sluaj. Kada ste bolesni, onda vas spopada vie senzualnosti, vie seksa. Kada ste
savreno zdravi, seks i senzualnost iezava.
ta se to deava? Jer kada ste savreno zdravi vi ste tako sreni sa sobom da vam drugi
ne treba. Kada ste bolesni, tako ste nesreni sa sobom da vam treba drugi. A to je paradoks;
kada ste bolesni treba vam drugi, a drugima ste takoe potrebni vi kada su bolesni. A kada se
dve bolesne osobe sastanu, bolest se ne udvostruava, ona se umnoava.
To je ono to se deava u braku; susretom dve bolesne osobe umnoavaju bolest i
onda cela stvar postaje runa i pakao. Bolesnoj osobi trebaju drugi, a oni su upravo osobe koje
e stvoriti nevolju kada se povee s njima. Zdravoj osobi to ne treba. Inae ako zdrava osoba
voli, to nije potreba, to je deljenje. Cela pojava se menja. Njoj niko ne treba. Ona ima toliko
mnogo da moe deliti.
Jednoj bolesnoj osobi treba seks, zdrava osoba voli, a ljubav je totalno razliita stvar.
A kada se dve zdrave osobe sretnu, zdravlje se umnoava. Onda one mogu postati pomagai
jedna drugoj za najvie. One mogu ii zajedno prema najviem, pomaui jedna drugu.
Meutim potreba iezava. Nema vie potrebe, nema vie zavisnosti.
Kad god imate neudobno oseanje sa sobom, ne pokuavajte da to utopite u seks i
senzualnosti. Bolje pokuajte da postanete zdraviji. Yoga asane e pomoi. Istraivaemo njih
kasnije kada Patanjali bude govorio o njima. Upravo sada, on kae, ako pevate Aum i

42

To be oneself; biti sam u svom vlastitom izvornom biu, iskusiti svoje vlastito Sopstvo.
183

meditirate na tome, bolest e ieznuti. I on je u pravu. Ne samo da e ieznuti prisutna


bolest, nego i bolest koja bi dola u budunosti, takoe e ieznuti.
Ako ovek moe postati savren pojui tako da je pojac potpuno izgubljen - samo ista
svest, plamen svetla svuda okolo, pojui - energija se smiruje u krugu, postaje krug. A onda
imate jedan od najeuforinijih trenutaka u ivotu. Kada se energija smiruje u krugu, postaje
harmonija, nema nesklada, nema konflikta, vi ste postaji jedno. Inae obino, bolest bi takoe
bila nesklad. Ako ste bolesni, vama je potrebno leenje.
Patanjalijev yoga sistem i sistem hindu medicine, ayurveda, razvili su se
istovremeno, zajedno. Ayurveda je totalno razliita od alopatije. Alopatija je suzbijanje
bolesti. Alopatija se razvila uporedo sa hrianstvom; to je uzgredni proizvod. Zato to je
hrianstvo sklono suzbijanju, alopatija je sklona suzbijanju. Ako ste bolesni, alopatija odmah
suzbija bolest. Tada bolest pokuava da se pojavi na nekoj drugoj slaboj taki. Onda s nekog
drugog mesta bukne. Tada je vi suzbijate odatle, da ona odnekud drugde bukne. Na taj nain
sa alopatijom, idete od jedne bolesti do druge, od jedne do druge, to je proces koji se nikada
ne zavrava.
Ayurveda ima totalno razliit koncept. Bolest ne treba da bude suzbijana; ona treba da
bude iskljuena. Katarza je potrebna. Dakle, ayurvedski lek se daje osobi, tako da se bolest
ispolji i bude izbaena; katarza. Dakle ayurvedska medicina vas u poetku moe uiniti vie
bolesnim, i trai due vreme, jer ona nije suzbijanje. Ona ne moe delovati odmah sada; ona
je dug proces. Bolest mora da bude odbaena, a vaa unutranja energija mora biti u harmoniji
tako da zdravlje doe iznutra. Lek e izbaciti bolest van, a sila isceljenja e je zameniti iz
vaeg vlastitog bia.
Oni su razvili ayurvedu i yogu zajedno. Ako radite yoga asane, ako sledite
Patanjalija, nemojte nikada ii kod alopatskog doktora. Ako ne sledite Patanjalija, onda
nema problema. Ali ako sledite yoga sistem i radite mnoge stvari u svom telu, onda nikada ne
ulazite u alopatiju, jer oni su opreni. Onda traite ayurvedskog doktora ili homeopatu ili
naturopatu; (lekara koji lei primenom prirodne medicine) - sve to pomae katarzu.
Inae ako postoji bolest; prvo je napadnite. Ne kreite s njom. S mnogim metodama
vrlo je lako osloboditi se bolesti. Patanjalijeva metoda Aum-a, pojanja i meditiranja vrlo je
blaga. Ali u njegovo vreme, bila je dovoljno jaka, jer ljudi su bili jednostavni, iveli su sa
prirodom. Bolest je bila retka; zdravlje je bilo opte. Sada je sasvim suprotan sluaj; zdravlje
je retko, bolest je uobiajena, a ljudi su vrlo kompleksni, ne ive blisko s prirodom.
U Londonu je sprovedeno ispitivanje. Milion deaka i devojica nisu videli kravu.
Videli su samo sliku krave. Ubrzo, mi smo se prepustili svetu koji je nainio ovek;
betonskim zgradama, asfaltnim putevima, ljudskoj tehnologiji, velikoj maineriji,
automobilima. Priroda je odbaena negde u tamu, a priroda je isceljujua sila. A onda je
ovek postao sve kompleksniji. On ne slua svoju prirodu; on slua zahteve civilizacije,
potrebe drutva. Njegova sloenost je izvan kontakta sa njegovim vlastitim unutranjim
biem.
Onda Patanjalijeve blage metode ne pomau mnogo. Otuda, moje dinamike,
haotine metode - jer vi ste gotovo ludi, pa vam trebaju lude metode koje mogu izneti sve to
je potisnuto u vama i izbaciti to napolje. Meutim zdravlje je nuno. ovek koji odlazi na
dugo putovanje mora pripaziti da bude zdrav. Bolesnom, prikovanom za krevet, teko je da se
kree.
Druga prepreka je mlitavost, iznemoglost koja oznaava da ovek ima istraivanje
vrlo male snage. On eli da traga i istrauje - ali vrlo niskom energijom potrage - bez poleta,
mlako. On eli da oisti uvstva, ali to nije mogue. Takav ovek uvek govori o Bogu,
mokshi, yogi, ovo i ono, ali samo govori. Sa niskim nivoom energije moete govoriti; to je sve
to moete uiniti. Ako elite neto da uinite, nuna je delatnost jake energije.
Jednom se dogodilo da je Mula otiao sa svojim konjem i koijom u neki grad. Bio je
vreo letnji dan; Mula se znojio. Iznenada se na putu konj zaustavio, pogledao natrag u Mulu i
rekao: Sveca mu, ba je pretoplo!" Mula nije mogao da veruje. Mislio je da je poludeo usled
toplote, jer kako konj moe govoriti?
184

Pogledao je okolo da li je neko jo uo, ali nije bilo nikog izuzev njegovog psa koji je
sedeo u koiji. Ne naavi nikoga, da bi se samo oslobodio ideje, pitao je psa: Jesi li uo ta
je on rekao?" Pas je odgovorio: Ma on je ba kao svaki drugi - uvek govori o vremenu i ne
radi nita."
To je mlitav ovek, uvek govori o Bogu, ne radei nita. On uvek govori o velikim
stvarima, a to ini samo da bi sakrio svoju ranjivost. Govori tako da bi mogao zaboraviti da ne
ini nita u vezi s tim. Kroz oblak govora on mugne, pobegne. Govorei stalno o tome, on
misli da ini neto, ali govorenje nije delovanje. Moete nastaviti da govorite o vremenu,
moete nastaviti da govorite o Bogu. Ako ne znate nita, jednostavno traite svoju energiju.
Ovaj tip osobe moe postati ministar, svetenik, pandit. Ovo su ljudi niske energije.
Oni su postali vrlo umeni u govorenju - tako veti da mogu obmanuti, jer uvek govore o
velikim i lepim stvarima. Drugi sluaju i bivaju zavedeni; filozofi - to su mlitavi ljudi.
Patanjali nije filozof. On sam jeste naunik, i on trai od drugih da budu naunici. Mnogo
napora je potrebno.
Kroz pevanje Aum-a i meditiranje na njemu, nizak nivo vae energije e se podii.
Kako se to dogaa? Zato ste uvek na nivou niske energije, oseajui uvek iscrpljenost, umor?
ak i ujutru kada ustanete vi ste umorni. ta vam se deava? Negde u vaem sistemu postoji
curenje; vama istie energija. Vi niste svesni, ali ste kao vedro sa rupama. Svakog dana punite
vedro, ali uvek vidite da je prazno, postaje prazno. Ovo oticanje treba da se zaustavi.
Koliko energije iscuri iz tela? Ovo su ozbiljni problemi za bioenergetiku. Iz tela istie
energija kroz prste ruku, nogu, kroz oi. Energija ne moe istei kroz glavu; ona je okrugla.
Sve to je okruglo pomae telu da se uva i odri. Zbog toga su yoga poloaji - siddhasana,
padmasana - oni ine itavo telo okruglim.
Osoba koja sedi u siddhasani stavlja obe svoje noge zajedno jer telesna energija istie
kroz prste. Kada su obe ruke spojene zajedno na vrhu jedna s drugom, energija se kree iz
jedne ruke u drugu. To postaje krug. Stopala, noge, takoe su poloeni jedno na drugo tako da
se energija kree u vaem telu i ne istie.
Oi su zatvorene, jer one isputaju gotovo osamdeset posto vae bioenergije. Zbog
toga, kada putujete, ako neprekidno gledate iz voza ili kola, oseate se tako umorni. Ako
putujete sa zatvorenim oima, neete se oseati tako umorni. A vi nastavljate da gledate u
nepotrebne stvari, ak itate reklame na zidovima. Previe koristite svoje oi, a kada su oi
umorne itavo telo je umorno. Oi daju znak da je sada dovoljno.
Yogin pokuava da ostane sa zatvorenim oima koliko je vie mogue, s prekrtenim
rukama i nogama. On sedi sa uspravnom kimom. Ako sedite s uspravnom kimom,
gravitacija zemlje ne moe iznuditi mnogo energije iz vas, jer ona dosee samo jednu taku
kime. Zbog toga, kada sedite u kakvom naslonjenom poloaju, nakrivljeno, mislite da se
odmarate. Ali Patanjali kae da vam istie energija, jer je vei deo vaeg tela pod uticajem
gravitacije.
Ovo nee pomoi. Uspravna kima, sa zatvorenim rukama i nogama, sa zatvorenim
oima, ini krug; taj krug je predstavljen pomou shivalinge. Mora da ste videli shivalingu falusni simbol, kao to je poznat na Zapadu. Zapravo, to je unutranji krug bioenergije, kao
pravilno oblikovano jaje.
Kada vaa telesna energija tee pravilno, to postaje kao jaje; oblik je slian jajetu,
tano kao jaje. A to je simbolizovano u shivalingi. Vi postajete iva. Kada energija nadolazi
u vama stalno, ne izlazei napolje, onda mlitavost iezava. Mlitavost nee ieznuti
govorenjem; nee ieznuti itanjem spisa, niti filozofiranjem. Ona e ieznuti samo kada
vaa energija ne istie.
Pokuajte da je ouvate. to vie je ouvate, bolje je. Ali na Zapadu se ui upravo
neto suprotno - da je dobro otpustiti energiju kroz seks, kroz ovo i ono - izbaciti energiju.
Dobro je ako je ne koristite ni na koji drugi nain; inae ete poludeti. Kad god ima previe
energije, bolje je otpustiti je kroz seks. Seks je najjednostavnija metoda da se ona izbaci.
Ali ona moe da se iskoristi, moe biti uinjena kreativnom. Ona vam moe dati
ponovno roenje, uskrsnue. Moete upoznati milione euforinih stadijuma kroz nju; moete
se uzdizati vie i vie kroz nju. Ona predstavlja lestve za dostizanje Boga. Ako je izbacujete
185

svakog dana, nikada neete imati tako izgraenu energiju da biste makar preduzeli prvi korak
prema boanskom. Sauvajte je.
Patanjali je protiv seksa, a to je razlika izmeu Patanjalija i tantre. Tantra koristi
seks kao metodu; Patanjali eli da ga mimoiete. Ima osoba, gotovo pedeset procenata,
kojima e tantra odgovarati; a pedeset posto kojima e yoga odgovarati. ovek mora da
otkrije ta e mu odgovarati. Obe metode se mogu koristiti, i kroz obe ljudi stiu. A nisu ni
pogrene, ni ispravne. To zavisi od vas. Jedna e biti ispravna za vas, a pogrena za drugog,
ali zapamtite, za vas to nije jedna apsolutna kategorina instrukcija, niti naredba.
Neto moe biti ispravno za vas, a pogreno za nekog drugog. A oba sistema su
nastala zajedno, tantra i yoga - blizanaki slini sistemi, tano u isto vreme - to je
sinhronicitet. Kao to ovek i ena trebaju jedno drugo, tantra i yoga trebaju jedno drugo; oni
postaju kompletna stvar. Ako postoji samo yoga, onda je samo pedest posto ljudi moe
postii; pedeset posto ljudi e biti u nevolji. Ako ima samo tantre, onda je pedeset posto ljudi
moe postii; drugih pedeset posto e biti u nevolji. A to dogodilo.
Ponekad ne znajui gde se kreete, ta radite, ako nastavite bez majstora, ne znajui ko
ste i ta e vam odgovarati... Moete biti ena odevena kao mukarac, a mislite da ste
mukarac - onda ete biti u nevolji. Moete biti mukarac odeven kao ena, pa mislite da ste
ena - i vi ete biti u nevolji.
Nevolja uvek nastaje kad god ne shvatate ko ste. Majstor je potreban da vam jasno
ukae na preicu koja je za vas. Dakle zapamtite: kad god neto kaem, da je ovo za vas, ne
irite to drugima, jer je to izriito reeno vama. Ljudi su radoznali. Ako im kaete, oni e
probati. Moda to nije za njih. Moe biti ak tetno. Zapamtite, to nije korisno, to e biti
tetno. Nema izmeu, neto je ili korisno ili tetno.
Malaksalost ili mlitavost najvea je od prepreka, ali ona iezava kroz pojanje Aum-a.
Aum stvara u vama shivalingu, jajoliko oblikovani krug energije. Kada postanete sposobni da
imate veu mo opaanja, to ak moete i videti. Ako sa zatvorenim oima pevate Aum za
nekoliko meseci meditirajui, moete videti unutar sebe, vae telo iezne. Tamo e biti samo
bioenergija, elektrini fenomen, a oblik e biti u formi shivalinge.
Onog momenta kada vam se to dogodi, malaksalost iezava. Sada sve vi jaka,
uzviena energija. Sada moete pomerati planine. Osetitiete da govor nije dovoljan - neto
mora da se uradi. Nivo energije je tako visok, da sada neto moe da se uradi. Ljudi mi dolaze
i pitaju ta da rade, ali ja ih pogledam i vidim da im curi energija; ne mogu uiniti nita. Prva
stvar je da se obustavi ovo isticanje. Samo kada imate energiju, onda pitajte ta moe da se
uradi.
"Sumnja" - sanskrit ima mnogo rei za sumnju, engleski ima samo jednu re. Prema
tome pokuajte da razumete, ja u vam objasniti. Postoji sumnja nasuprot poverenju. U
sanskritu to se naziva shanka - sumnja prema, ili nasuprot poverenju, jedan par. Onda postoji
sumnja zvana sanshaya - Patanjali sada govori o sanhayi - sumnja prema sigurnosti, protiv
odlunosti. Nesiguran ovek, ovek koji nije odluan, on je u sanshayi - u sumnji. Ovo je
protiv poverenja jer poverenje je poverenje u nekoga. Ovo je protiv samo-poverenja; vi ne
verujete sebi. To je razliita stvar.
Dakle ta god da radite, niste sigurni da li elite da radite ili ne elite to da radite, da li
e to biti dobro raditi ili ne - jedna neodlunost. S neodlunim umom, ne moete ii stazom ne stazom Patanjalija. Morate biti odluni. Morate doneti odluku. To je teko jer uvek jedan
deo vas nastavlja da govori ne. Onda kako da donesete odluku? Razmiljajte koliko moete,
dajte tome onoliko vremena koliko moete. Razmislite o svim mogunostima, o svim
alternativama i onda odluite. A jednom kada odluite, onda odbacite svo sumnjanje.
Pre toga, koristite to; uradite sve to moete uraditi sa sumnjom. Razmislite o svim
mogunostima a onda izaberite. Naravno to nee biti totalna odluka; u poetku to nije
mogue. To e biti znaajna odluka, preteni deo vaeg uma e rei 'da'. Jednom kada
odluite, onda nikada ne sumnjajte. Sumnja e podii svoju glavu. Vi jednostavno kaite: Ja
sam odluio - zavreno. To nije totalna odluka; sve sumnje nisu odbaene. Ali ta god je
moglo da se uradi, ja sam uradio. Razmislio sam potpuno, koliko je bilo mogue, i odluio
sam."
186

Jednom kada izaberete onda ne pruajte sumnji opet nikakvu saradnju, jer sumnja
postoji u vama kroz vau saradnju. Nastavljate da joj dajete energiju i stalno poinjete da
mislite o tome. Onda se stvara neodlunost. Neodlunost je vrlo loe stanje stvari - vi ste u
vrlo loem stanju. Ako ne moete nita odluiti, kako moete raditi? Kako moete delovati?
Kako e Aum - zvuk i meditacija - pomoi? Oni pomau, jer kada jednom postanete
tihi, smireni, odluivanje postaje lake. Onda vie niste natrpani, niste haos; mnogi glasovi
govore zajedno, a vi ne znate koji je glas va. Aum, pevanje, meditacija na njemu - glasovi
postaju smireni. Mnogi glasovi - kako moete znati da nisu vai. Vaa majka govori, va otac
govori, vaa braa, vai uitelji, oni nisu vai. Moete ih odbaciti lako jer njima ne treba
nikakva panja.
Kada postanete smireni po pevanju Aum-a, vi ste zatieni, smireni, tihi, sabrani. U toj
sabranosti, moete uvideti koji je stvarni glas koji dolazi od vas, koji je autentian. To je kao
da stojite na pijaci, i mnogi ljudi razgovaraju, mnoge stvari se odvijaju, a vi ne moete
odluiti ta se deava. To je trite akcija, ljudi viu - oni znaju njihov jezik - vi ne moete
razumeti ta se dogaa, da li su poludeli ili ne.
Onda se prenesete u himalajsko utoite. Sedite u peini, jednostavno pevate.
Jednostavno se smirite, sva nervoza iezava, postanete jedinstveni, sabrani. U tom momentu,
odlunost je mogua. I onda odluujete, a ne gledate unatrag. Onda zaboravite - to je reeno
jasno i nedvosmisleno. Sada nema povratka natrag; onda idite napred.
Ponekad e uslediti sumnja, ona laje na vas ba kao pas. Ali ako ne sluate, ne
obraate panju, ubrzo se zaustavlja. Dajte joj priliku, razmislite o svemu to je mogue, a
jednom kada odluite, odbacite je, a aumkar (pevanje Aum-a) e vam pomoi da doete do
odlunosti. Ovde sumnja oznaava neodlunost, nemar. Sanskritska re je pramad. Pramad
znai kao da ovek hoda u snu. Nemar je deo toga; taan prevod e biti: Ne budite zombi; ne
hodajte kao hipnotisani."
Ali ivite u hipnozi, uopte ne znajui to. Celo drutvo pokuava da vas hipnotie za
odreene stvari, a to stvara pramad; to stvara pospanost u vama. ta se deava? Vi niste
svesni, inae iznenadili biste se ta se deava. To je tako obino. Zbog toga ne postajete
svesni. Vueni ste od miliona manipulatora, a njihove metode manipulisanja vama, u vama
stvaraju hipnozu.
Na primer na svakom radiju, na svakom TV ekranu, u svakom filmu, u svakim
novinama, magazinima, oni nastavljaju da oglaavaju odreene stvari - Toaletni sapun Lux".
Vi mislite da to ne utie na vas, ali svakog dana sluate: Lux, toaletni sapun; lux, toaletni
sapun; lux, toaletni sapun." To je pojanje. Tokom noi, na ulici neonska svetla oglaavaju
lux, toaletni sapun." Sada su otkrili da je svetlucanje svetlosti mnogo upeatljivije.
Neprekidno se nastavlja s tim, pali se i gasi; onda to ostavlja jo vei utisak, jer opet morate
itati: Lux, toaletni sapun." Onda se svetlost nastavlja, dolazi ponovo, pa opet morate itati:
Lux, toaletni sapun."
Vi pevate Aum. To sve dublje ulazi u vau podsvest. Mislite da niste uznemireni ni
zabrinuti, mislite da niste obmanuti od ovih ljudi - sve ove lepe nage ene koje stoje pored
toaletnog lux sapuna i govore: Zato sam ja lepa? Zato je moje lice lepo? Zbog toaletnog
sapuna Lux." Vi mislite da niste, ali ste dirnuti time. Iznenada, jednog dana odete u
prodavnicu, odete da kupujete, i traite toaletni sapun. Prodavac pita: Koji sapun?" Onda
iznenada iz vas izbije: Toaletni sapun lux."
Vas su hipnotisali biznismeni, politiki lideri, uitelji, svetenici, jer svako je neto
investirao u vama ako ste hipnotisani. Onda moete biti korieni. Politiari stalno govore:
Ovo je vaa majka zemlja, a ako je majka zemlja u nevolji, idite u rat; postanite muenici."
Kakva besmislica. Cela zemlja je vaa majka. Je li zemlja podeljena na Indiju,
Pakistan, Nemaku, Englesku, ili je jedna? Ali politiari neprekidno kuju va um da je samo
ovaj deo zemlje vaa majka; morate da je spasete. ak i ako izgubite ivot, to je vrlo dobro. I
oni nastavljaju sa oboavanjem zemlje, nacionalizmom, patriotizmom - svim besmislenim
izrazima, jer ako vas neprekidno obasipaju time, vi postajete hipnotisani. Onda moete
rtvovati sebe.
187

Vi rtvujete svoj ivot u hipnotisanom stanju zbog slogana, parola. Zastava, iako
obian komad platna, postaje vana kroz hipnozu. Ovo je naa nacionalna zastava" - milioni
mogu umreti za nju. Ako ima bia na drugim planetama i pogledaju ponekad zemlju, mislie:
Ovi ljudi su jednostavno ludi." Zbog platna - zbog komada krpe - jer su naruili nau
zastavu", a to se ne moe tolerisati...
Religije nastavljaju da propovedaju; vi ste hrianin, hindu, musliman, ovo i ono, i one
ine da oseate da ste hrianin, a onda ste u krstakom ratu: Ubijte druge koji nisu hriani.
To je vaa dunost." Ue vas takvim apsurdnim stvarima, ali vi jo verujete, jer oni
nastavljaju da vam to govore. Adolf Hitler kae u svojoj autobiografiji Moja borba" da ako
neprekidno ponavljate la ona postaje istina. A on zna. Niko ne zna tako dobro kao on jer je to
ponavljao sam i stvorio udo.
Pramad znai stanje hipnoze, manipulisano, pospano kretanje. Onda nemar nuno
dolazi jer vi niste sami. Onda inite sve bez ikakve brige. Kreete se i spotiete; ne idete
nikuda, vi ste ba kao pijanica. Meutim i svi drugi su kao vi, tako da nemate mogunosti da
osetite da ste pijanica.
Budite paljivi. Kako e vam Aum pomoi da budete paljivi? Odbacie hipnozu.
Zapravo, ako vi jednostavno pevate Aum bez meditiranja, to e takoe postati hipnoza; to je
razlika izmeu obinog pevanja mantre i Patanjalijevog naina. Pevajte je i ostanite svesni.
Ako pevate Aum i ostanete svesni, ovaj Aum i njegovo pevanje e postati sila koja
uklanja hipnotisanost. Unitie sve hipnoze koje postoje oko vas, i stvorene su u vama od
strane drutva, manipulacija, politiara. To e biti oduzimanje hipnotisanosti.
Neko je u Americi pitao Vivekanandu: Kakva je razlika izmeu obine hipnoze i
vaeg pojanja Aum-a?" On je rekao: Pevanje Aum-a je uklanjanje hipnotisanosti; to je
kretanje suprotnom brzinom, u rikverc." Proces izgleda da je isti ali je brzina suprotna. Kako
postaje obrnuta? Ako meditirate takoe, onda ubrzo postajete tako smireni i svesni, tako
paljivi, da vas niko ne moe hipnotisati. Sada ste izvan dohvata svetenika i politiara zatvorenika. Sada po prvi put vi ste individua, a onda postajete paljivi. Onda se kreete s
panjom, svaki korak inite paljivo, jer oko vas su milioni zamki.
"Lenjost" - alasya; u vama ima mnogo akumulirane lenjosti. Ona dolazi iz odreenog
razloga - jer vi ne vidite poentu u injenju iega. Ako i radite, nita ne postiete. Ako ne
radite, nita se ne gubi. Onda se lenjost nastanjuje u srcu. Lenjost jednostavno oznaava da ste
izgubili udnju za ivotom.
Deca nisu lenja. Ona kipte s energijom. Morate ih prisiliti da odu na spavanje; morate
ih prinuditi da budu tiha; morate ih prisiliti da sednu na nekoliko minuta kako bi se opustila.
Ona nisu napeta; to je vaa ideja. Deca su puna energije - tako nena bia s toliko mnogo
energije. Odakle ta energija dolazi? Oni jo nisu frustrirani. Ne znaju da se u ovom ivotu, ta
god inili, nita ne postie. Oni su nesvesni, neobaveteni - blaeno nesvesni; zbog toga su s
tako mnogo energije.
Vi ste radili mnoge stvari i nita niste postigli - lenjost se naseljava. To je kao praina
koja se nastanjuje u vama - od svih neuspeha, frustracija, svaki san postaje mrzovoljan, gorak.
To se naseljava. Onda vi postajete lenji. Ujutru mislite: Zato da ustajem? Zbog ega?"
Nema odgovora. Morate ustati jer hleb nekako treba da se zaradi. Imate enu, imate decu i
uhvaeni ste u klopku. Odlazite na neki nain u kancelariju, vraate se nekako natrag. Nema
zadovoljstva. Vuete se, niste sreni radei bilo ta.
Kako e pomoi pojanje Aum-a i meditiranje na njemu? To pomae - sigurno pomae,
jer kada prvi put pevate Aum, posmatrate i meditirate, prvi napor u vaem ivotu izgleda da
donosi ispunjenje. Oseate se tako sreni pojui Aum, oseate se blaeno, to je prvi napor koji
je uspeo.
Sada se budi novi polet. Praina je odbaena. Nova hrabrost, novo poverenje se
postie. Sada mislite da moete uraditi neto, takoe moete postii neto. Nije sve neuspeh.
Moda je spoljanje putovanje neuspeno, ali unutranje putovanje nije neuspeno. ak i prvi
korak donosi tako mnogo cvetova. Sada se javlja nada, poverenje se opet nastanjuje. Vi ste
opet dete - iz unutranjeg sveta... novo roenje. Ponovo se moete smejati, trati, igrati. Opet
ste roeni.
188

To je ono ta hindusi nazivaju drugim roenjem. Ovo je sledee roenje, drugo


roenje. Prvo roenje je bilo u spoljanjem svetu. Ono se pokazalo neuspenim; zbog toga se
oseate tako letargino. Vremenom kada bude u etrdesetoj, ovek poinje da misli o smrti kako da umre, kako da bude dokrajen.
Ako ljudi ne poine samoubistvo, ne znai da su sreni. To je stoga to ne vide
nikakvu nadu ak ni u smrti. ak i smrt izgleda da je beznadena. Nije da ne izvravaju
samoubistvo zato to vole ivot - ne oni su tako frustrirani jer znaju da ak ni smrt nee dati
nita. Stoga zato nepotrebno poiniti samoubistvo? Zato praviti nevolju? Stoga neka idu
dalje stvari kakve jesu.
Senzualnost": Zato se oseate senzualno, seksualno? Oseate se seksualno jer
akumulirate energiju, neiskorienu energiju, a ne znate ta da radite s njom. Dakle, prirodno
ona se akumulira u prvom sreditu seksa. A vi ne znate nijedan drugi centar, ne znate kako
ona moe da tee navie.
To je kao kada dobijete avion, ali ne znate ta je to tako da ga istraujete, a onda
mislite: Ima tokove, dakle mora da je neka vrsta vozila." Onda upregnete konje u njega i
koristite ga kao volovska kola. On se moe iskoristiti. Onda jednog dana, sluajno, otkrijete
da volovi nisu potrebni. On u sebi ima izvestan motor, pa ga moete koristiti kao motorno
vozilo. Onda ga istraujete sve dublje i ozbiljnije. Zatim se zapitate emu ova krila? Posle
toga, jednog dana ga koristite kao to bi trebalo da se koristi - kao avion.
Kada se kreete unutra u sebi, otkrivate mnoge stvari. Ali ako se ne kreete, tada
postoji samo seksualnost. Vi sakupite energiju, ta onda da radite s njom? Ne znate nita o
tome, da moete poleteti navie. Postajete volovska kola; seks je ponaati se kao volovska
kola. Vi skupite energiju. Jedete hranu, pijete vodu, energija se time stvara, energija je tu; ako
je ne koristite, vi ete poludeti. Onda energija krui okolo unutar vas. Ona vas ini ludim.
Treba neto da uradite. Ako neto ne uradite, poludeete; eksplodiraete. Seks je najlaki
sigurnosni ventil - energija se vraa natrag u prirodu.
Ovo je besmisleno jer energija dolazi iz prirode. Vi jedete hranu; ona jede prirodu. Vi
pijete vodu; ona pije prirodu. Vi se sunate; ona jede sunce. Neprekidno vi jedete prirodu, a
onda je izbacujete natrag prirodi. Cela stvar izgleda bez osnove, beskorisna, bez znaenja.
Kakva je korist od toga? Onda postajete letargini, ravnoduni.
Energija mora biti via, na viem stupnju. Morate postati preobraavalac; kroz vas
priroda mora postati nadpriroda; samo onda ima smisao, znaaj. Kroz vas materija mora
postati um; um mora postati nad-um. Kroz vas priroda mora dostii nadprirodu; najnie mora
postati najvie. Samo onda postoji svrha - osea se smisao.
Onda va ivot ima dublje, ozbiljno znaenje. Vi niste bezvredni; niste kao zemlja,
blato. Vi ste Bog. Kada ste preobrazili kroz sebe prirodu do nadprirode, postali ste Bog.
Patanjali je Bog. Vi postajete majstor majstora.
Inae obino senzualnost znai da se energija skupila; a vi morate da je izbacite van.
Ne znate ta da radite s njom. Prvo je skupite; prvo odlazite da traite hranu, ulaui veliki
napor da zaradite hranu. Onda apsorbujete hranu, jer seksualna energija je najfinija energija u
vaem telu, najplemenitija. A onda je izbacite van, i dalje opet kreete se u krugu.
To je nepravilan, neispravan, neist krug, blud. Kada je izbacite van, telu treba
energija. Vi jedete, skupite je, onda je izbacite; kako moete oseati da to ima neki smisao?!
Izgleda da ste u koloteini koja ne vodi nigde. Kako e pomoi Aum? Kako e pomoi
meditiranje na njemu? Jednom kada zaponete da meditirate na Aum-u, drugi centri poinju
da funkcioniu.
Kada energija tee, unutar vas nastaje krug. Onda seksualni centar nije jedini centar
koji funkcionie. itavo vae telo postaje krug. Iz seks centra on raste do drugog, do treeg,
etvrtog, petog; onda iznova dalje do estog, petog, etvrtog, treeg, drugog, prvog. Energija
postaje jedan unutranji krug i prolazi kroz druge centre.
Upravo zato to je energija akumulirana, ona se penje visoko; nivo energije ide visoko,
kao bedem: voda nastavlja da pritie iz reke, a nasip joj ne dozvoljava da izae van. Voda se
uzdie visoko, i drugi centri, druge akre u telu poinju da se otvaraju - jer kada energija tee,
one postaju dinamike sile, generatori. One zapoinju da funkcioniu.
189

To je kao kada vodopad i generator zaponu da funkcioniu; vodopad presahne i


dinamo se ne moe pokrenuti. Kada energija tee navie, vae najvie akre zaponu da rade,
da funkcioniu. Na taj nain Aum pomae. ini vas smirenim, sabranim, jedinstvenim.
Energija se uzdie visoko; senzualnost iezava. Seks postaje beznaajan, detinjast, jo nije
nestao, ali postaje detinjast. Vi se ne oseate senzualno; nemate podsticaj za tim.
Seks je jo tu. Ako niste paljivi, opet e vas epati. Moete popustiti, jer to nije
konano zbivanje. Vi jo niste kristalisani, ali letimian uvid je nastupio, tako da vam
energija moe dati unutranja ekstatina stanja. A seks je najnia ekstaza. Mogue su vie
ekstaze. Kada vie postaje mogue, nie automatski iezava. Ne treba vam da se odriete
toga. Ako se odreknete, onda se vaa energija ne kree visoko. Ako se energija kree visoko,
nije potrebno da se odriete. To jednostavno postaje beskorisno. Jednostavno samo otpada.
Ako ne funkcionie to se pokazuje kao opsena.
Psihoanalitiari kau da, ovakvi kakvi jeste, ako prestanete da sanjate, vi ete poludeti.
Snovi su potrebni jer su vaem stanju uma potrebne obmane. Opsene, varke, iluzije, snovi,
potrebni su jer ste uspavani, a u spavanju, snovi su neminovnost.
U Americi su vreni eksperimenti koji su pokazali da ako vam se ne dozvoli sedam
dana da sanjate, odmah zapoinjete obmanljivo putovanje: s otvorenim oima poinjete da
vidite stvari kojih nema. Poinjete da govorite s osobama kojih nema, poinjete da vidite
vizije. Vi ste ludi. Samo sedam dana bez sanjanja i postajete samoobmanuti. Poinju da se
dogaaju halucinacije. Vai snovi su proiavajui - unutra ugraena katarza, tako svake
noi vi zavaravate sebe. Do jutra ste malo otrenjeni - ali do veeri opet sakupite mnogo
energije. Tokom noi morate sanjati i izbaciti je napolje.
Ovo se deava vozaima, i mnoge nesree se dogaaju zbog ovoga. Nou, nesree se
deavaju oko etiri sata ujutru, jer voza je vozio celu no. Nije sanjao; dakle energija sna se
akumulira. On vozi otvorenih oiju i poinje da vidi varke. Put je prav" kae on. Nema
nikoga nijedan kamion ne dolazi." I s otvorenim oima on ide u kamion. Ili vidi da kamion
dolazi, a da bi ga izbegao on tresne u drvo - a nije bilo kamiona.
Mnoga istraivanja su izvrena zato se toliko nesrea deava oko etiri. Zapravo oko
etiri vi sanjate previe. Od etiri do pet, do est vi previe sanjate. To je stanje sanjanja.
Spavali ste dobro; vie nema potrebe za spavanjem, moete sanjati. Ujutru sanjate, a u to
vreme ako ne sanjate, ako vam nije doputeno da sanjate vi stvarate privienja. Sanjaete sa
otvorenim oima.
Privienje znai sanjanje sa otvorenim oima, inae svako sanja na taj nain. Vidite
enu i mislite ona je sasvim lepa. To moda nee biti sluaj. Vi moda na nju projektujete
obmanu. Moda ste seksualno izgladneli. Onda postoji energija i vi ste zavedeni. Posle dva
dana, tri dana, ena izgleda obino. Vi mislite da ste bili zavedeni, obmanuti. Niko vas ne
obmanjuje; vi sebe... Ali zavedeni ste. Ljubavnici zavode jedno drugo. Oni sanjaju sa
otvorenim oima, a onda su izigrani. Niko se ne vara, samo je to vae stanje.
Patanjali kae, obmana e ieznuti ako s obazrivou pevate Aum. Kako e se to
dogoditi? Zato to obmana oznaava stanje sanjanja, kada ste izgubljeni. Vie niste tu; samo
san je tu. Ako meditirate na Aum i svedok ste, vi ste tu. Vae prisustvo ne moe dopustiti
nikakvom snu da se dogodi. Kad god vi jeste, nema sanjanja. Kad god postoji san, vi niste. Vi
oboje ne moete biti zajedno. Ako ste vi tu, san e ieznuti. Ili ete vi morati da ieznete.
Oboje zajedno ne moete biti. San i svest nikada se ne susreu. Zbog toga obmana iezava
svedoenjem zvuka Aum.
Nemo" je takoe tu prisutna, neprekidno se osea. Vi se sami oseate bespomono;
to je nemo. Oseate da ne moete uiniti nita, bezvredni ste, beskorisni. Moete se
pretvarati da ste neko, ali vaa potencija takoe pokazuje da duboko ispod oseate nitavnost.
Moete se pretvarati da ste vrlo moni, ali vae pretvaranje nije nita do skrivanje. Kad god
uete u okraj, poinjete oseati nemonost i bespomonost. ovek je nemoan jer samo
celina moe biti snana - ne ovek. Deo ne moe biti jak. Samo Bog je jak, ovek je nemoan.
Kada pevate aumkar, Aum, po prvi put oseate da vie niste neko ostrvo. Postajete deo
itavog univerzalnog zvuka. Po prvi put se oseate snanim, ali sada ova snaga ne treba da
190

bude nasilna, ne treba da bude agresivna. Zapravo, moan ovek nikada nije agresivan. Samo
nemoni ljudi postaju agresivni da dokau sebi da su moni.
...nestabilnosti su prepreke koje ometaju um: Vi poinjete jednu stvar i onda stajete s vremena na vreme krenete napred i stanete - ponovo ponete i onda stanete. Nita nije
mogue s ovom nestabilnou. ovek mora da istraje, mora nastaviti da kopa jamu, na istom
mestu neprekidno. Ako ostavite svoj trud, va um je takav da ete posle nekoliko dana morati
opet da zaponete od ABC (od poetka); on ponovo navija (premotava) sebe, on odmotava
(odvija) sebe. Radite neto za nekoliko dana, onda ostavite. Biete baeni natrag u va prvi
dan rada - opet ABC. Tako moete raditi mnogo, ali bez postizanja rezultata. Aum e vam dati
okus.
Zato poinjete i stajete? Ljudi mi dolaze i kau da su meditirali jednu godinu, onda su
prestali. A ja ih pitam: Kako ste se oseali?" Oni kau: Vrlo, vrlo dobro smo se oseali" ali zato ste onda prestali? Niko ne prekida kada se osea istinski vrlo dobro. A oni kau:
Bili smo vrlo sreni a onda smo prestali." To nije mogue. Ako ste sreni, kako moete
prekinuti? Onda su oni rekli: Ne sasvim sreni".
Inae oni su u nevolji. Oni se prave ak i da su sreni. Ako ste sreni u odreenoj
stvari, vi ne prekidate. Zaustavljate se samo kada je to dosadna stvar, gnjavaa,
nezadovoljstvo. Sa Aum-om, Patanjali kae, osetiete prvi ukus upadanja u univerzalno. Taj
ukus e postati vae zadovoljstvo i nestabilnost e nestati. Zbog toga on kae da e pevanjem
Aum-a i njegovim svedoenjem sve prepreke otpasti.
Muka, tuga, beznadenost, nervoza i nepravilno disanje su simptomi poremeenog
uma.
Ovo su simptomi: muka, tuga: Uvek kretanje uznemirenosti, uvek rascep, uvek
nespokojan um, uvek tuan, u oajanju, suptilni drhtaji u telu, jer kada se telesna energija ne
kree u krugu vi imate tanane drhtaje, ustreptalost, strah i nepravilno disanje. Onda vae
disanje ne moe biti ritmiko. Ne moe biti pesma; ne moe biti harmonija. Nepravilno
disanje...
Ovo su simptomi poremeenog uma, a naspram ovoga su simptomi uma koji je
usredsreen. Pojanje Aum-a e uiniti um usredsreenim. Vae disanje e postati ritmiko.
Vai drhtaji u telu e ieznuti; neete biti nervozni. Tuga e biti zamenjena oseanjem sree,
radosti, suptilnim blaenstvom na vaem licu, bez ikakvog razloga. Jednostavno ste sreni;
samo zato to ste ovde, vi ste sreni; jednostavno diui vi ste sreni. Ne traite mnogo, a
umesto jada bie srea.
Da biste uklonili ove, meditirajte ne jednom naelu.
Ovi simptomi rastrojenog uma mogu biti uklonjeni meditiranjem na jednom principu.
Taj jedan princip je pranava - Aum, univerzalni zvuk.

191

Poglavlje 8

OD HAOSA DO HAOSA SA AUM


Izlaganje 8. januara 1975. u Buddha dvorani.
Prvo pitanje:
Put izgleda da je ka miru i svesti. Zato je onda svako i sve oko nas u takvom haosu?
Jer ja jesam haos! Jedino iz haosa je kosmos roen; nema drugog puta. Vi ste kao
stara, vrlo stara, drevna graevina; ne moete biti potpuno obnovljeni. Milionima ivota ste
bili ovde. Prvo morate biti potpuno razvaljeni, i samo onda oporavljeni.
Rekonstrukcija je mogua, ali to nee dugo pomoi. Bie to samo povrinska
dekoracija. Duboko u vaim temeljima vi ete ostati stari, a cela konstrukcija e uvek ostati
klimava. Moe pasti svakog dana. Novi temelji su potrebni - sve novo. Morate biti sasvim
ponovo roeni, inae e to biti prepravka. Moete biti obojeni spolja, ali ne postoji nain da
obojite unutranje. Unutranje e ostati isto - ista stara propala stvar.
Potreban je diskontinuitet. Ne treba vam se dozvoliti da trajete. Procep... Staro
jednostavno umire, a novo izlazi iz njega - iz smrti. Postoji procep izmeu starog i novog;
inae na drugi nain staro bi moglo da traje. Zaista sve prepravke se ine samo da spasu staro,
a ja ne prepravljam. Ako se opirete tome, haos e se za vas nastaviti. Onda to traje due
vreme.
Ako dozvolite to da se dogodi, to se takoe moe desiti i za jedan trenutak. Ako
dozvolite da se to dogodi, staro iezava, a novo nastaje. To novo e biti boansko jer nee
doi iz prolosti, nee doi iz vremena. To e biti bezvremeno - izvan vremena. Nee doi iz
vas; neete biti otac i majka toga. To e doi iznenada iz plavetnila.
Zbog toga Buddha uporno tvrdi da to uvek dolazi iz niega. Vi ste neto; to je patnja.
ta ste vi zapravo? Samo prolost. Nastavljate da akumulirate prolost; zato ste postali kao
razvaline - vrlo drevne razvaline. Samo shvatite poentu i ne pokuavajte da nastavite staro.
Ostavite to.
Otuda, oko mene e uvek biti haos, jer ja neprekidno razvaljujem. Ja sam destruktivan,
jer je to jedini nain da se bude kreativan. Ja sam kao smrt jer samo onda moete biti roeni
kroz mene. To je tano; postoji haos. Neprekidno e trajati jer novi ljudi e dolaziti. Nikada
oko mene neete nai utvrenu odreenu ustanovu. Novi ljudi e dolaziti i ja u ih ruiti,
razvaljivati.
To se moe zaustaviti za vas individualno; ako dopustite meni da vas unitim potpuno,
jer za vas e haos ieznuti. Vi ete postati kosmos, skrivena harmonija; ozbiljan red. Za vas
e haos ieznuti, ali oko mene e se nastaviti jer novi haosi e dolaziti. Ovo mora da bude
tako; uvek je bilo tako. Niste me vi to pitali prvi put. Isto su pitali Budu; isto su pitali Lao Cea; isto e se opet pitati, jer gde god ima majstora, to znai da on koristi smrt kao sredstvo za
uskrsnue. Morate umreti; samo onda se ponovo moete roditi.
Haos je lep jer je to materica, a va takozvani red je ruan jer titi samo izumrlo,
mrtvilo. Smrt je lepa; mrtvilo nije lepo - zapamtite razliku. Smrt je lepa, ponavljam, jer smrt
je ivotna slila. Izumrlo nije lepo, jer mrtvo je ono mesto odakle je ivot ve premeten. To je
samo razvalina. Ne budite mrtav ovek; ne nosite prolost. Odbacite je, i proite kroz smrt.
Isus je pozvao dva ribara da ga slede, i onog momenta kada su izlazili iz grada jedan
ovek je dotrao i pitao ribara: Kuda ide? Tvoj otac je umro. Vrati se natrag." Oni su pitali
Isusa: Dozvoli nam nekoliko dana, onda emo poi i uiniti to je potrebno. Na otac je umro
i pogrebni ritual treba obaviti." Isus je odgovorio: Pustite da mrtvi sahranjuju svoje mrtve. Vi
ne brinite. Sledite mene." ta je Isus time rekao? Rekao je da je ceo grad mrtav - oni e se
pobrinuti: Pusti mrtve da sahranjuju svoje mrtve. Vi sledite mene."
192

Ako ivite u prolosti vi ste mrtva stvar. Vi niste iva sila. Postoji samo jedan nain da
postanete ivi, a to je umreti za prolost, umreti za smrt. To se nee dogoditi jednom za uvek.
Jednom kada saznate tajnu, svakog trenutka morate biti mrtvi za prolost, tako da se praina
ne sakuplja na vama. Onda smrt postaje stalna preorijentacija, neprekidno ponovno raanje.
Uvek imajte na umu: Smrt za prolost. ta god da je prolo, prolo je. Toga nema vie;
to nije nigde. To se samo zadrava u seanju. To je samo u vaem umu. Um je skladite svega
to je mrtvo. Zbog toga um samo koi ivot u njegovom toku. Mrtva tela se sakupljaju oko
toka; ona postaju blokada, konica.
Sve to ja inim ovde jeste da vam pomognem da nauite kako da umrete, jer je to prvi
korak kako da budete ponovno roeni. Smrt je lepa jer nov ivot izlazi iz nje kao kapi rose.
Dakle, haos je iskorien, i vi ete ga oseati oko mene; a to e uvek biti tako, jer negde ja
nekog drugog ruim. Na hiljadu naina - vama poznatim ili nepoznatim - ja vas razvaljujem.
Prodrmam vas iz vae smrti, prodrmam vas iz vae prolosti, pokuavam da vas uinim
svesnijim i ivahnijim.
U drevnim hindu spisima reeno je da je majstor smrt. Oni su znali da majstor mora
biti smrt, jer iz te smrti nastaje preokret, mutacija, transformacija, transcendencija. Smrt je
jedna alhemija; to je najsuptilnija alhemija. Priroda koristi to. Kada neko postane vrlo star,
priroda ga ubija.
Vi se bojite jer se vrsto drite prolosti. Inae bili biste sreni, dobrodoli i zahvalni
prirodi jer uvek priroda ubija staro, prolo i mrtvo; a va ivot se seli u novo telo.
Jedan star ovek postaje mlada beba potpuno oiena od prolosti. Zato vam priroda
pomae da se ne seate prolosti. Priroda koristi naine da vam ne dozvoli da se seate
prolosti, inae biste istog momenta bili stari kada ste roeni. Zato to star ovek umire i raa
se kao mlada beba, dakle, ako bi se ona seala prolosti ve bi bila stara: itava svrha bila bi
izgubljena.
Priroda zatvara prolost za vas, tako da svako roenje izgleda da je novo. Ali vi opet
zapoinjete da akumulirate. Kada je toga previe, priroda e vas opet ubiti. ovek postaje
sposoban da spozna svoje prole ivote samo kada je mrtav za prolost. Onda priroda otvara
vrata. Onda priroda zna da nema potrebe da se skriva od vas. Vi ste stigli do stalne sveine
ivota. Sada znate kako da umrete; priroda ne treba da vas ubija.
Jednom kada znate da niste prolost, vi niste budunost ve ste suta prisutnost bia,
onda cela priroda otvara svoja vrata i misterije. itava vaa prolost - milioni ivota ivljeni
na mnogo, mnogo naina - svi se otkrivaju. Sada to moe biti pokazano jer vi neete biti
optereeni time. Sada nikakva prolost ne moe da vas optereti. Ako ste upoznali alhemiju
kako da postajete neprekidno novi ili mladi, ovo e biti va zadnji ivot, jer onda nema
potrebe da budete ubijeni niti da vam se pomae da budete ponovo roeni. Nema potrebe. Vi
to inite sami svakog trenutka.
Ovo je objanjenje zato Buddha iezava i nikada se ne vraa natrag, zato se
prosvetljena osoba nikada ne raa opet; to je tajna; jer ona sada zna smrt, i koristi je
neprekidno. Svakog trena, kakva god da je prolost, prola je i mrtva, a osoba je osloboena
od nje. Svakog trena ona umire za prolost i ponovo se raa. To postaje tok, tok zadobijanja
novog ivota svakog trena nalik reci. Onda nema potrebe da priroda sakuplja kojeta
sedamdeset godina; smee, besmislice, a onda da ubije ovu razvalinu od oveka, i pomogne
mu da opet bude roen, i da ga stavi u isti krug, jer e on opet skupljati.
Ovo je izopaen krug. Hindus ga je nazvao samsara. Samsara oznaava toak; toak
nastavlja da se okree stalno na istom putu. Prosvetljena osoba je ona koja je stigla na cilj,
iskrcana iz tog obrtanja, kretanja. Ona kae: Vie priroda ne treba da me ubija, jer ja sada
ubijam sebe svakog trena."
A ako ste vi novi, priroda vie za vas ne treba da koristi smrt, ali onda takoe nema ni
potrebe za raanjem, jer neprekidno koristite raanje. Svakog trenutka vi umirete za prolost i
raate se za sadanjost. Zato vi oseate suptilnu sveinu i ivahnost oko Bude, kao da se
upravo okupao. Vi mu se pribliite i oseate miris - miris sveine i krepkosti. Nikada opet ne
moete sresti istog Budu. Svakog trena on je nov.
193

Hindusi su vrlo mudri jer hiljadama godina se susreu s Budama, inama - koji su
pobednici ivota43, prosvetljeni, probueni ljudi, oni su shvatili mnoge istine. Jednu od istina
vi ete videti svuda okolo. Nikada Buddha nije opisan kao star, nikada Mahavira nije opisan
kao star. Nikakva statua ne postoji, nikakva slika Krine, Rame, Bude, Mahavire; niko nije
opisan kao star.
Nije da oni nikada nisu postali stari; oni su postali stari. Buddha je postao star kada je
imao osamdeset godina. On je bio tako star kao to e svako postati kada ima osamdeset, ali
nije prikazan kao star. Razlog je unutranji; jer kad god bi mu se pribliili, nali biste ga
mladog, sveeg i ivahnog. Dakle, starost je bila samo u telu, ne u njemu. A ja moram
razvaliti vas, jer vae telo moe biti mlado, ali vae unutranje bie je vrlo staro i drevno;
ruevina, kao grke ruevine iz Persepolisa i druge.
U sebi imate ruinu bia, postojanja; to mora da bude razvaljeno, a ja za vas moram biti
topionica, penica, vatra, smrt. To je jedini nain kako vam mogu pomoi da zadobijete
kosmos unutar sebe, jedan red. A ja ne elim da vam nametnem neki red jer to nee pomoi.
Svaki red nametnut spolja bie samo podrka za staru drevnu ruinu; to nee pomoi.
Ja verujem u unutranji red. To se deava sa vaom unutarnjom sveu i ponovnim
roenjem. To dolazi iznutra i iri se napolje. Ba kao cvet, on se otvara, i latice se kreu
napolje iz centra prema periferiji. Samo je taj red pravi i lep koji se otvara unutar vas i iri na
sve oko vas. Ako je red sproveden spolja, data vam je disciplina - Uradi ovo, nemoj uraditi
ono" - i vi ste prinueni da budete zatvorenik, to vam nee pomoi jer vas nee promeniti.
Nita vas ne moe promeniti spolja. Postoji samo jedan obrt, a to je onaj koji dolazi
iznutra. Ali pre nego to se taj obrt dogodi, morate biti potpuno uniteni. Samo na vaem
grobu novo e se roditi. Zbog toga postoji haos oko mene: jer ja sam haos. Ja koristim haos
kao metod.
Drugo pitanje:
U vrenju sadhane sa Aum, da li je bolje ponavljati (Aum) kao mantru ili pokuati da
se uje kao unutranji zvuk?
Mantra Aum mora da se radi u tri stadijuma. U prvom, treba da je ponavljate vrlo
glasno. To znai da ona treba da doe iz tela - prvo iz tela jer ono predstavlja glavna vrata.
Dopustite prvo da telo bude proeto s tim.
Dakle, ponavljate je glasno. Idite u hram, u svoju sobu ili negde gde je moete
ponavljati tako glasno kako elite. Koristite celo telo da je ponavljate, kao da vas sluaju
hiljade ljudi bez mikrofona; treba da budete vrlo glasni tako da celo telo drhti, trese se s njom.
A za nekoliko meseci, gotovo tri meseca, ne treba da brinete ni o emu drugom. Prvi stadijum
je vrlo vaan jer on daje temelj. Glasno, kao da je svaka elija tela uzvikuje, peva...
Posle tri meseca, kada osetite svoje telo kao potpuno zasieno, ona je duboko ula dole
u elije tela. A kada je kaete glasno, to ne ine samo usta; od glave do prstiju na nogama,
celo telo je ponavlja. To dolazi ako je za tri meseca ponavljate neprekidno barem jedan sat
dnevno, za tri meseca ete osetiti da to ne ine samo usta, to ini celo telo. To se deava - to
se dogodilo mnogo puta.
Ako to radite zaista iskreno, autentino, i ne obmanjujete sebe, to nije mlaka,
ravnoduna, ve stoprocentna pojava, onda ak i drugi mogu sluati. Mogu poloiti svoje ui
na vaa stopala, i kada uzviknete glasno oni mogu to uti da dolazi iz vaih kostiju jer celo
telo moe apsorbovati zvuk i celo telo moe kreirati zvuk. Oko toga nema problema. Vaa
usta su samo deo tela - specijalizovani deo, to je sve. Ako pokuate, celo vae telo moe
ponoviti to.
Dogodilo se da je jedan hindu sanyasin Svami Ram radio to mnogo godina, pevajui
naglas Ram". Jednom je boravio u himalajskom selu s prijateljem. Prijatelj je bio poznati
sikh pisac Sardar Purnasingh. Usred noi Purnasingh je iznenada uo pojanje Ram, Ram,
43

Jinnah pobednik nad uslovljavanjima prirode, prakrti, po uenju aina, pripadnika najstarije religije.
Asketskim iskuenjima dua (iva) je postigla potpunu nezavisnost i postala pobednik (jinnah) nad prirodom
koja je vezuje u samsaru, ciklus preporaanja.
194

Ram," Nije bio niko drugi - samo Ram, Svami Ram i on sam. Spavali su obojica na svojim
krevetima, a selo je bilo daleko udaljeno - udaljeno gotovo dve, tri milje. Nije bilo nikoga.
Stoga je Purnasingh ustao, obiao oko kolibe; nije bilo nikoga. to se vie udaljavao
od Rama, zvuk je bio sve slabiji i slabiji. Kada se vratio natrag zvuk je opet bio jai. Onda je
priao Ramu koji je vrsto spavao. Onog momenta kada je pristupio blie, zvuk je postao ak
glasniji. Onda je stavio svoje uvo na Ramovo telo. Celo telo je vibriralo sa zvukom "Ram".
To se deava. Celo vae telo postaje proeto. Ovo je prvi korak - tri meseca, est
meseci - ali vi se morate osetiti proetim. Proetost se osea kao kada ste gladni i uzmete
hranu - oseate kada je stomak zadovoljan. Telo mora biti zadovoljeno prvo, ako nastavite, to
se moe dogoditi za tri meseca ili est meseci. Tri meseca je srednja granica; za mali broj ljudi
to se deava ak i pre; za neke to potraje i due.
Ako to prome celo telo, seks e potpuno ieznuti. Celo telo je tako blaeno, postaje
tako mirno s vibriranjem zvuka, da nije potrebno izbacivati energiju, nije potrebno da se
izbacuje, a vi se oseate vrlo, vrlo snano. Ali nemojte da koristite ovu snagu - jer moete je
koristiti, ali sva upotreba e biti zloupotreba - jer to je samo prvi korak.
Energija mora da bude sakupljena tako da moete preduzeti drugi korak. Ako je
koristite Vi je moete koristiti - jer snage e biti tako mnogo da moete raditi mnoge stvari
- moete jednostavno neto rei i to e postati istinito. Na ovom stupnju zabranjeno je da
budete aktivni, i ne treba da govorite nita. Ne treba da kaete nekome u ljutnji: "Idi i umri,"
jer to se moe dogoditi. Va zvuk postaje tako moan da je zasien sa celom energijom vaeg
tela, tako da na ovom stupnju ne treba rei nita negativno - ak ni nesvesno. Nikakvu
negativnu stvar ne treba govoriti.
Moete biti iznenaeni, ali dobro je da vam kaem; mi smo gradili krov u pozadini
ove kue, a on je pao. Pao je zbog mnogih od vas. Vi ste uloili ogroman napor u meditaciji, a
bilo je barem dvadeset osoba koje su mislile da e on pasti. Oni su to pomogli; pomogli su taj
pad. Barem dvadeset osoba je mislilo neprekidno... Kada su bili tamo, gledali bi krov i mislili
da e pasti, jer oblik je bio takav da je njihovim umovima bio neizvestan njegov opstanak.
On je pao. A kada je pao, mislili su: Naravno, bili smo u pravu". To je neispravan
delokrug. Vi ste uzrok, a mislite da ste bili u pravu. A svi ste ulagali veliki napor u meditaciji.
Bilo ta da mislite, moe se dogoditi. Nikada ne mislite negativne misli kada meditirate. To je
mogue jer zadobijate neku snagu. Ali mene ne zanima krov koji je pao. Usled tog pada
mnogi od vas su izgubili izvestan kvalitet snage; a to me vie brine jer nita se ne dogaa bez
vae snage koja je u tome iskoriena.
Oni koji su govorili da e pasti... krov je pao. Oni su mogli da se pogledaju. Za
nekoliko dana ostali su vrlo nemoni, tuni, potiteni. Izgubili su svoju mo. Moda su mislili
da su tuni jer je pao krov - ne. Bili su tuni jer su izgubili izvesnu koliinu snage, a ivot je
energetski fenomen.
Kada ne meditirate, nema mnogo problema. Moete rei ta god elite jer ste nemoni.
Ali kada meditirate, treba da pazite na svaku pojedinu re koju izgovorite, jer svaka vaa
pojedina re moe kreirati neto okolo.
Prvi korak je da promete celo telo, tako da celo telo postane pevajua sila. Kada se
oseate zadovoljni, onda preduzmite drugi korak. I nikada ne koristite ovu mo jer ova snaga
treba da bude akumulirana i da bude koriena za drugi korak.
Drugi korak je da zatvorite svoja usta i pevate re Aum mentalno - prvo telesno, drugo
mentalno. Sada telo uopte ne treba da se koristi. Grlo, jezik, usne, sve je zatvoreno, celo telo
je zakljuano, a pojanje je samo u umu - ali to je mogue glasnije; istom glasnoom kao to
ste koristili telo. Sada pustite da um s tim bude proet. Opet tri meseca, neka um bude proet
time.
Isto vreme e uzeti um kao to je uzelo telo. Ako moete postii proetost u okviru
jednog meseca s telom, postii ete je za jedan mesec takoe u umu. Ako je postignete za
sedam meseci u telu, sedam meseci e trebati i umu, jer um i telo nisu sasvim odvojeni. Oni
su pre telo-um, psihosomatska pojava. Jedan deo je telo, drugi deo je um; telo je vidljivi um,
um je nevidljivo telo.
195

Dozvolite da drugi deo, suptilni deo vae linosti, bude proet; ponavljajte unutra
naglas. Kada je um ispunjen, ak i vea snaga je osloboena u vama. S prvim seks e
ieznuti; s drugim, ljubav e ieznuti - ljubav koju znate, ne ljubav koju Buddha zna, ve
vaa ljubav e ieznuti, vae line elje, naklonosti i strasti.
Zato to je seks telesni deo ljubavi, a ljubav je mentalni deo seksa. Kada ljubav
iezne, onda postoji ak i vea opasnost. Moete biti vrlo, vrlo fatalni za druge. Ako kaete
neto, to e se odmah dogoditi. Zbog toga se za drugo stanje predlae totalna tiina. Kada ste
u drugom stanju, budite potpuno tihi.
Bie tendencije da se koristi snaga, jer ete biti vrlo radoznali oko toga, detinjasti.
Imaete tako mnogo energije da ete eleti da vidite ta moe da se dogodi. Ali ne koristite to
i ne budite detinjasti, jer se mora jo preduzeti trei korak i energija je potrebna. Zbog toga
seks iezava - jer energija mora da bude akumulirana; ljubav iezava - jer suptilna energija
mora da bude akumulirana.
A trei korak je kada se um osea zasien, proet. Vi ete saznati to kada se dogodi;
nije potrebno pitati kako e ovek to oseati. To je upravo kao jedenje; oseate: Sada je
dovoljno". Um e osetiti kada je to dovoljno. Onda zapoinjete trei korak. Trei korak je: ni
telo ne treba da se koristi, niti um. Poto ste zabravili telo, sada moete zakljuati um.
A to je lako. Kada ste vrili pojanje za tri meseca, to je bilo vrlo lako; jednostavno ste
zakljuali telo, sada jednostavno zabravite um. Samo sluajte, i uete samo zvuk koji vam
dolazi iz jezgra vaeg vlastitog srca. Aum e biti tu kao da neko drugi peva; vi ste samo
slualac. To je trei korak, koji e sasvim promeniti vae bie. Sve prepreke e otpasti i sve
tekoe e ieznuti. Dakle, za to e trebati gotovo devet meseci, u proseku, ako uloite svoju
totalnu energiju u to.
U vrenju sadhane sa Aum, da li je bolje ponavljati (Aum) kao mantru ili pokuati da
se uje kao unutranji zvuk?
Upravo sada vi je ne moete uti kao jedan unutranji zvuk. Unutranji zvuk postoji,
ali je on tako tih, tako suptilan, a vi nemate to uho da biste ga uli. Uho mora biti razvijeno.
Telo proeto, um proet, samo ete vi imati to uho - tree uho, da tako kaemo - da moete
uti zvuk koji je uvek tu.
To je kosmiki zvuk; on je unutra i spolja. Usmerite svoje uho na drvo i on postoji,
usmeri svoje uho na stenu i on je tu. Ali prvo treba da bude transcendirano vae telo-um, a vi
da zadobijete vie i vie energije. Da bi se ulo suptilno, trai se ogromna energija.
S prvim seks iezava, s drugim korakom ljubav iezava, a s treim sve to ste znali
iezava, kao da vas vie nema - mrtvi ste, iezli, rastopljeni. To je fenomen smrti, ako je ne
izbegnete i postanete preplaeni - jer sve tendencije u vama su da to izbegnete, poto izgleda
kao ambis, a vi padate u njega, ambis je bez dna... Izgleda da tome nema kraja. Postajete kao
perce koje pada u ambis bez dna - padate, padate i padate - i izgleda da tome nema kraja.
Biete uplaeni. eleete da pobegnete od toga. Ako pobegnete od toga, itav napor je
bio uzaludan gubitak. A beanje e biti to to zapoinjete pevanje mantre Aum; to e biti prva
stvar koju treba uiniti ako ponete da beite, jer ako pevate vi ste natrag u umu. Ako pevate
glasno, vi ste natrag u telu.
Dakle, kada ovek pone sluati ne treba da peva, jer pojanje e biti beanje. Mantra
treba da bude pevana, a onda naputena. Mantra je zavrena samo kada je moete odbaciti.
Ako nastavljate pojanje, lepiete se uz nju kao utoite, a kad god budete uplaeni, vratiete
se opet i pevati je.
Zbog toga mogu da je pevam tako duboko da je telo zasieno, nema potrebe da se
ponovo peva u telu. Um je zasien, nema potrebe da se peva u njemu; buja i preliva se; nema
prostora da se smesti vie pevanja u njega. Tako ne moete pobei, nestati. Samo onda postaje
mogue sluanje bezvunog zvuka.
Drugi prijatelj je postavio tree pitanje:
Ranije ste vi obino govorili o mantri Hu. Zato onda sada naglaavate mantru Aum?
196

Ne naglaavam. Ja vama jednostavno objanjavam Patanjalija. Moje naglaavanje


ostaje za Hu (hoo). A ta god da kaem o Aum-u, isto je primenljivo i na Hu. Ali moje
naglaavanje ostaje na Hu.
Kao to sam vam rekao, Patanjali je iveo pre pet hiljada godina. Ljudi su bili
jednostavni - vrlo jednostavni, bezazleni. Oni su mogli lako da imaju poverenje; nisu imali
mnogo od uma. Nisu bili orijentisani na glavu; bili su orijentisani na srce. Aum je blag, mekan
zvuk - prijatan, nije silovit, nije agresivan. Ako pevate Aum, on ide od grla do srca, nikada
ispod njega. To su bili ljudi srca - Aum je bio dovoljan za njih; slaba, blaga doza,
homeopatska doza je za njih bila dovoljna.
Za vas, on nee biti od velike pomoi, Hu e biti korisniji. Hu je sufi mantra. Ba kao
to je Aum hindu mantra, Hu je sufi mantra. Sufiji su razvili Hu za vrlo agresivnu zemlju i
rasu, strasnu i silovitu - za ljude koji nisu jednostavni, nisu bezazleni - za lukave i pametne, za
borce. Za njih je Hu bio pronaen, izmiljen.
Hu je poslednji deo od (imena) Allah. Ako neprekidno ponavljate "Allah-Allah-AllahAllah", ubrzo, ono preuzima oblik "Allahu-Allahu-Allahu". Onda uskoro se prvi deo odbacuje.
Ono postaje "Lahu,-Lahu-Lahu". Onda ak i "Lah" mora da se odbaci. Ono postaje "Hu-HuHu". Ono je vrlo mono i direktno pogaa va centar seksa. Ne pogaa vae srce; pogaa va
centar seksa.
Za vas e Hu biti od koristi jer sada vae srce gotovo ne funkcionie. Ljubav je iezla;
samo je ostao seks. Va centar seksa funkcionie, ne centar ljubavi, tako Aum nee mnogo
pomoi. Hu e biti dublja pomo jer vaa energija sada nije blizu srca. Vaa energija je pored
seks centra, a seks centar mora da bude pogoen direktno tako da se energija uzdie navie.
Posle izvesnog vremena rada sa Hu, moete osetiti da sada ne oseate veliku potrebu
za tom dozom. Onda se moete okrenuti na Aum. Kada ponete oseati da sada postojite blizu
srca, ne blizu centra seksa, samo onda moete koristiti Aum - ne pre. Inae nema potrebe; Hu
se moe raditi celim putem.
Ali ako osetite sklonost, moete promeniti. Ako osetite da sada nema potrebe - ne
oseate naklonost seksualnom, seks vas ne brine, ne mislite o tome; to nije cerebralna
imaginacija; niste fascinirani s tim; lepa ena prolazi, a vi samo primetite: "Da, ena je
prola," ali nita se u vama ne budi; va centar seksa nije pogoen, nikakva energija se ne
kree u vama - onda moete zapoeti s Aum.
Inae, nije potrebno; moete nastaviti sa Hu. Hu je jaa doza. Kada radite Hu, moete
odmah osetiti da ide u stomak - do centra hara, a onda do centra seksa. Odmah prisiljava
kretanje seksualne energije navie. To pokree centar seksa.
A vi ste vie orijentisani na glavu. Ovo se uvek deava; ljudi, zemlje, civilizacije koje
su orijentisane na glavu postaju seksualni - vie seksualni nego na srce orijentisani ljudi. Na
srce orijentisani ljudi su puni ljubavi. Seks dolazi kao senka ljubavi; on nije vaan sam po
sebi. Na srce orijentisani ljudi ne razmiljaju mnogo jer, zaista, ako posmatrate dvadeset etiri
sata, dvadeset tri sata mislite o seksu.
Na srce orijentisani ljudi uopte ne misle o seksu. Kada se to dogodi, dogodi se. To je
isto kao telesna potreba. I to sledi ljubav kao senka; nikada se ne dogaa direktno. Oni ive u
sredini - srce je sredina izmeu glave i seksualnih centara - vi ivite u glavi i seksu. Kreete se
iz ove dve krajnosti, nikada niste u sredini. Kada je seks ispunjen, selite se u glavu. Kada se
seksualna elja probudi, kreete se prema seksu, ali nikada ne ostajete u sredini. Klatno se
kree desno i levo - nikada se ne zaustavlja u sredini.
Patanjali je razvio ovu metodu pevanja Aum-a za vrlo jednostavne ljude - za
bezazlene seljane koji ive s prirodom. Za vas vi moete probati to; ako to pomae, dobro
je. Ali moje razumevanje o vama je da to nee pomoi vie od jedan posto vas. Devedeset
devet posto e pomoi mantra Hu. Ona vam je blia.
I zapamtite, kada mantra Hu uspe, im dostignete taku sluanja, sluaete aumkar, ne
Hu. Vi ete sluati Aum! Zavrna pojava e biti ista. To je upravo na stazi vi ste razliiti
ljudi. Jae doze su nune, to je sve. Ali na kraju, vi ete iskusiti isti fenomen.
197

Moj naglasak ostaje na Hu, jer moj akcenat ne zavisi od hindusa ili muslimana; moj
naglasak zavisi od vas, od vae potrebe. Ja nisam ni hindu ni musliman. Ja nisam niko, tako
da sam slobodan. Mogu koristiti sve od svuda. Hindu e oseati krivicu koristei Alaha;
muhamedanac e oseati krivicu koristei Aum; ali ja nisam sitniarski zabrinut oko takvih
stvari. Ako Alah pomae to, je lepo; ako aumkar pomae i to je lepo. Donosim i dajem vam
svaku metodu prema vaoj potrebi.
Za mene, sve religije vode do istog; cilj je jedan. Sve religije su kao staze koje vode do
istog vrha. Na vrhu sve postaje jedno. Sada to zavisi od vas - gde ste vi - i koja staza e biti
blia.. Aum e biti vrlo daleko od vas; Hu je vrlo blizu. To je vaa potreba. Moj naglasak
zavisi od vae potrebe. Moj naglasak nije teorijski; nije sektaki. Moj naglasak je apsolutno
lian. Pogledam u vas i odluim.
etvrto pitanje:
Rekli ste da su potrebe da se bave telom; a elje su da se bave umom. Koja od njih je
nas dovela vama?
Pre nego to odgovorim na ovo, jedna stvar se mora razumeti; onda e biti mogue da
dobijete odgovor na ovo pitanje. Vi niste samo telo i um; vi ste neto drugo takoe - dua,
Sopstvo - atman. Telo ima potrebe, atman takoe ima potrebe, upravo izmeu to dvoje je um
koji ima elje. Telo ima potrebe - da se zadovolje glad i e. Sklonite je potrebno, hrana je
potrebna, voda je nuna. Telo ima potrebe, um ima elje. Nita nije potrebno, ali um stvara
lane potrebe.
elja je lana potreba. Ako je negujete, oseate se frustrirano, slabo. Ako je negujete,
nita se ne postie jer na prvom mestu, to nikada nije bila potreba; nikada nije postojala kao
potreba.
Vi moete ispuniti potrebu; a ne moete ispuniti elju. elja je san - san se ne moe
ostvariti; ona nema korenje, ni na zemlji ni na nebu. Ona nema korenje. Um je sanjajui
fenomen. Vi traite slavu, ugled, presti; ak i ako ih postignete neete dostii nita jer slava
nee zadovoljiti nijednu potrebu. To i nije potreba. Vi moete postati uveni. Ako vas cela
zemlja zna, ta - ta onda? ta e vam se desiti? ta moete s tim uiniti? To nije ni hrana ni
pie. Kada vas ceo svet zna, oseate se frustrirano. ta da se radi s tim? To je beskorisno.
Dua opet ima potrebe. Upravo kao to telo ima potrebu za hranom. Naravno hrana je
onda Bog. Setite se da je Isus mnogo puta rekao svojim uenicima: Jedite mene. Ja sam vaa
hrana. Dozvolite mi da budem vae pie." ta on misli? Razliita potreba. Dok ona ne bude
zadovoljena, dok ne budete mogli jesti boga, dok ne postanete Bog jedui njega, apsorbujui
ga - dok on ne tee u vaoj dui kao krv, dok ne postane vaa svest - ostaete nezadovoljni.
Dua ima potrebe; religija ispunjava te potrebe. Telo ima potrebe; nauka ispunjava ove
potrebe. Um ima elje ili pokuava da ih ostvari, ali ih ne moe ostvariti. To je upravo
ogranien prostor gde se telo i dua susreu. Kada su telo i dua razdvojeni, um jednostavno
iezava. On nema svoju vlastitu egzistenciju.
Sada uzmimo ovo pitanje:
Rekli ste da su potrebe povezane s telom a elje s umom? Koja od njih je nas dovela
vama?
Ovde oko mene postoje tri tipa linosti; jedan tip je onaj koji je doao zbog svojih
telesnih potreba. Oni su frustrirani seksom, frustrirani ljubavlju, jadni u telu. Oni su doli,
njima se moe pomoi: njihov problem je otvoren i iskren, a jednom kada potrebe njihovog
tela ieznu, probudie se potrebe njihove due.
Onda postoji druga grupa koja je dola zbog potreba due. Njima se moe pomoi jer
oni imaju stvarne potrebe. Oni nisu doli zbog svojih seksualnih problema, ljubavnih
problema ili telesnih bolova i bolesti. Oni nisu doli radi toga. Oni su doli da trae istinu,
doli su da uu u misteriju ivota; doli da saznaju ta je egzistencija.
Onda postoji tree grupa, koja je vea od ove dve. Ovi ljudi su doli zbog bolesti svog
uma. Njima se ne moe pomoi. Oni e visiti oko mene za dui period, pa ih ja mogu svesti
198

bilo na telesne potrebe ili na potrebe due, ali potrebe njihovog uma se ne mogu ispuniti jer
one ne prvom mestu nisu potrebe.
Ima nekoliko osoba koje su ovde iz egoistinih razloga. Sannyas je za njih korak na
putu ega. One postaju posebne, izuzetne. One nisu uspele u ivotu; nisu mogle postii
politiku mo, one ne mogu dostii svetovnu slavu, ne mogu stei bogatstvo, ni materijalne
stvari. Oseaju da su niko i nita. Sada im ja dajem sannyas, i bez iega sa svoje strane, oni
postaju neko vaan, poseban. Preobukavi se samo u narandasto, misle da nisu obini ljudi oni su nekolicina odabranih, razliitih od svih drugih. Oni e nastaviti u svetu i korie
svakoga, ovako: Vi ste samo svetovna bia, apsolutno nemoralna. Mi smo izbavljeni, mali
broj izabranih."
Ovo su elje uma. Zapamtite da ne budete ovde ni za kakvu elju uma. Inae
jednostavno gubite svoje vreme, one se ne mogu ostvariti. Ja sam ovde da vas izvedem iz
snova, nisam ovde da ispunim vae snove. Ovi ljudi e ovde doneti sve vrste politika, oni su
na putu ega. Donee sve vrste konflikata; stvorie klike, druine. Stvorie minijaturni svet
ovde, i stvorie hijerarhiju: Ja sam vii nego vi, svetiji nego to ste vi."
Ali oni su budale. Na prvom mestu oni ne treba da budu ovde. Izabrali su pogreno
mesto za skakutanja svog ega, jer ja sam ovde da kod njih potpuno ubijem njihov ego, da ga
zdrobim. Zbog toga oko mene oseate mnogo haosa. Zapamtite, vi moete biti na pravom
mestu iz pogrenih razloga. Onda proputate, gubite, jer nije u pitanju mesto, pitanje je zato
ste ovde. Ako ste zbog potreba svog tela, neto moe da se uradi, a kada su potrebe tela
namirene, potrebe vae due e se pojaviti.
Ako ste ovde zbog potreba uma, odbacite te potrebe. One nisu potrebe; one su snovi.
Ukoliko je mogue odbacite ih potpuno. Ne pitajte kako da ih odbacite, jer se nita ne moe
uiniti da bi se odbacile. Upravo samo razumevanje da su one elje uma, dovoljno je; one
otpadaju automatski.
Peto pitanje:
Da li je mogue nai sintezu izmeu joge i tantre? Da li jedna vodi do druge?
Ne, to nije mogue. Nemogue je, kao da pokuavate da naete sintezu izmeu oveka
i ene. ta e onda biti sinteza? Trei pol, impotentna osoba, bie sinteza; a to nee biti ni
ovek ni ena. Bez korena, taj ovek nigde nee biti...
Tantra je apsolutno protivna, dijametralno suprotna jogi. Ne moete nainiti nikakvu
sintezu. Nikada ne inite takve stvari jer ete biti sve vie i vie zbunjeni. Jedno je dovoljno
da vas zbuni, a oboje e biti previe. One vode u razliite pravce. Stiu do istog cilja; stiu do
istog vrha. Sinteza je tamo na vrhu, na vrhuncu, ali u podnoju, gde putovanje zapoinje, one
su apsolutno razliite. Jedna ide na istok, a druga na zapad. One jedna drugoj govore
dovienja; okreu lea jedna drugoj. One su kao mukarac i ena - razliite psihologije, lepe u
razliitosti.
Ako nainite sintezu, to postaje runo. ena mora da bude ena - toliko mnogo ena,
da postane polaritet mukarcu. U njihovoj polarnosti oni su lepi, jer u svom polaritetu privlae
jedno drugo. U njihovom polaritetu oni su komplementarni, ali ne moete ih sintetizovati.
Sinteza e biti upravo siromana, bie samo nemona. U njoj nee biti napetosti.
Na vrhuncu se susreu, a taj susret je orgazam. Gde se ovek i ena sastaju, kada se
njihova tela rastvore, kada nisu dve stvari, kada su jin i jang jedno, to postaje krug energije.
Za momenat, na vrhuncu bioenergije, sretnu se i onda padnu ponovo.
Isto je s tantrom i jogom. Tantra je enska, joga je muka. Tantra je predanost, joga je
volja. Tantra je nenapornost, joga je trud - ogroman napor. Tantra je pasivna, joga je aktivna.
Tantra je kao zemlja, joga je kao nebo. Oni se susreu, ali ne postoji sinteza. Oni se susreu
na vrhu, ali u podnoju gde putovanje zapoinje, gde svi vi stojite, morate izabrati stazu.
Staze se ne mogu sintentizovati. Ljudi koji to pokuaju zbunjuju oveanstvo. Oni
zbunjuju vrlo mnogo i nisu od pomoi; vrlo su tetni. Staze ne mogu biti sintetizovane - samo
cilj. Staza mora biti odvojena jedna od druge - savreno odvojena, razliita u svom vlastitom
prizvuku, bivanju, biu. Kada sledite tantru, vi se kreete kroz seks. To je tantrin put;
199

dozvoljavate prirodi potpunu predanost. To je preputanje, vi se ne borite, to nije staza


ratnika. Vi se ne borite; predajete se gde god vas priroda vodi. Priroda vas vodi u seks, vi se
predajete seksu. Potpuno se kreete u njemu bez krivice, bez ikakvog koncepta greha.
Tantra nema koncept greha, nema krivice. Kreite se u seksu. Samo ostanite budni,
posmatrajui ta se dogaa. Budite budni, paljivo posmatrajui ta se deava okolo. Ali ne
pokuavajte da kontroliete, ne pokuavajte da kontroliete sebe; dopustite proticanje.
Pokreite se u eni, neka se ena pokree u vama. Dopustite im da postanu krug i ostanite
posmatra. Kroz ovo posmatranje i preputane, tantra postie transcendenciju. Seks iezava.
Ovo je jedan nain da se ode izvan prirode, jer odlazak izvan seksa jeste odlazak izvan
prirode.
itava priroda je seksualna. Cvetovi postoje zato to su seksualni. Sva lepota postoji
zbog nekog seksualnog fenomena. Neprekidna igra se odvija. Priroda je seks, a da bi se stiglo
do prvorazrednog seksa treba otii izvan seksa. Meutim, tantra kae da koristite seks kao
postupak. Ne borite se s njim, koristei ga, idite iznad njega. Kreite se kroz seks, proite kroz
to i postignite transcendenciju kroz iskustvo. Budno iskustvo postaje transcendencija.
Joga kae ne gubite energiju; mimoiite seks potpuno. Nije potrebno da ulazite u to:
jednostavno moete to zaobii. Konzervirajte energiju, i ne budite obmanuti, nainjeni ludim
od prirode. Borite se s prirodom, izgradite snagu volje, postanite kontrolisano bie ne lutajui
nigde. itave joga metode postoje da vas uine sposobnim tako da ne bude potrebe da se
preputate prirodi, nije nuno dozvoljavati prirodi da ima svoj vlastiti put. Vi postajete
gospodar i kreete se, na svoj vlastiti nain, protiv prirode. To je put ratnika - nepogreivog
ratnika koji se neprekidno bori, i kroz borbu transcendira.
Ove metode su potpuno razliite. Obe vode do istog cilja; odaberite jednu, ne
pokuavajte da ih sastavljate. Kako moete sintetizovati? Ako idete kroz seks, joga je
odbaena. Kako moete spajati? Ako napustite seks, tantra je naputena. Kako moete
spajati? Ali zapamtite, oboje vode do istog cilja; transcendencija je cilj. To zavisi od vas - od
vaeg tipa. Jeste li ratniki tip, ovek koji se neprekidno bori? Onda je joga va put. Ako niste
tip ratnika, ako ste pasivni - na suptilan nain enstveni, neete eleti da se borite ni sa kim,
zaista nenasilni - onda je tantra put; a zato to oboje vode do istog cilja, nije ih potrebno
spajati.
Spajanje je za mene uvek pogreno. Svi Gandiji su pogreni; ko god spaja grei, jer to
je kao spajanje alopatije sa ajurvedom; to je kao sintetizovanje homeopatije sa alopatijom;
hinduizma i islama. Nije nuno spajati. Svaka staza je u sebi savrena; nita joj se ne treba
dodati; a svaki dodatak moe biti opasan, jer deo koji funkcionie u jednoj maini, moe da
postane barijera u drugoj.
Moete uzeti deo iz auta Impala" koji je dobro radio u njemu, i staviti ga u Forda",
u kome e stvoriti probleme. Deo funkcionie po odreenom obrascu. Deo zavisi od tog
obrasca, od celine. Ne moete ga jednostavno upotrebiti svuda. A ta ove sinteze rade? One
uzimaju jedan deo iz jednog sistema, drugi deo iz drugog sistema; prave bukuri, a ako to
sledite postaete papazjanija. Nije potrebno spajati. Samo pokuajte da otkrijete svoj tip,
osetite svoj tip, i nema potrebe za urbom; posmatrajte i oseajte svoj tip.
Moete li se predati, prepustiti prirodi? Onda se prepustite. Ako oseate da je to
nemogue: Ja se ne mogu predati", onda nemojte biti potiteni jer postoji druga staza za koju
nije nuno predavanje na ovaj nain, koja vam daje svu priliku za borbu. Obe staze vode do
istog vrha, kada ste dostigli Gourishankar. Uskoro, kako prilazite blie i blie vrhu, vidite da
drugi, koji su putovali razliitim stazama, takoe stiu.
Ramakrina je pokuao s jednim od najveih eksperimenata u istoriji oveanstva.
Kada je postao prosvetljen, posle prosvetljenja, probao je mnoge staze. Niko to nije nikada
uradio jer za tim nema potrebe. Postigli ste vrh; zato brinuti da li druge staze vode tamo ili
ne? Meutim, Ramakrina je pruio veliku pomo oveanstvu. Vratio se opet natrag u
podnoje brda" i pokuao drugom stazom - da vidi da li ona vodi do vrha ili ne. Mnoge je
probao i svaki put je stizao do iste take.

200

Ovo je njegovo poreenje - da su u podnoju staze razliite. Kreu se u razliitim


pravcima, ak i izgledaju suprotne, protivrene. Meutim, susreu se na vrhu - spajaju se na
vrhu. Na poetku, razliitost, mnotvo; na kraju jedinstvo, istovetnost.
Ne marite za sintezu. Jednostavno izaberite svoju stazu i drite se nje. Ne budite
zavedeni od drugih koji e vas zvati da doete na njihovu stazu jer ona prednjai. Hindusi su
dostigli, muhamedanci su dostigli, Jevreji su dostigli, hriani su dostigli, a krajnja istina ne
uslovljava da ete je dostii samo ako ste hindu.
Jedina stvar za koju se treba brinuti je da osetite svoj tip i da izaberete. Ja nisam ni
protiv ega; ja sam za sve. ta god da izaberete, mogu vam pomoi na tom putu. Ali nema
sinteza. Nemojte pokuavati da spajate.
esto pitanje:
esto, kada nam govorite, talasi energije nam dolaze otvarajui naa srca i donosei
suze zahvalnosti. Rekli ste da nas ispunjavate kad god smo otvoreni, ali esto se ova pojava
deava mnogim ljudima u isto vreme, kao shaktipat, zato nam ee ne dajete ovo divno
iskustvo?
To zavisi od vas. Nije da vam ja dajem neko iskustvo. To je do vas; vi ga moete
uzeti. To nije davanje jer ja dajem sve vreme. Na vama je da budete otvoreni i to primite. A to
je u redu, to se dogaa mnogo puta mnogim ljudima zajedno. Onda logini um kae da ja
mora da sam neto uinio; inae, zato se tolikim ljudima to deava neprekidno?
Ne, ja ne radim nita. Ali kada se neko otvori, njegovo otvaranje je zarazno. Drugi
odmah poinju da se otvaraju. To je kao kada jedan pone da kalje i drugi poinju da kalju;
to je infekcija. Neko se otvori i iznenada oseate da se neto deava oko vas; vi takoe
postajete otvoreni.
Ja sam dostupan neprekidno. Kad god se otvorite, moete sudelovati s mnom. Kad ste
zatvoreni, ne moete deliti. A to nije zbog mog udela, to zavisi od vas da neto uinite.
Naravno, to se dogaa neprekidno, jer jedan otvara drugog, a onda se to nastavlja. To moe
postati pojava slina poplavi.
U Indoneziji postoji posebna metoda poznata kao latihan. Oni koriste re otvaranje;
ovek koji je otvoren moe otvoriti druge. Majstor po imenu Bapak Sabud, jedan od vrlo
znaajnih ljudi danas na zemlji, majstor je latihan-a. Otvorio je nekoliko ljudi, a onda im je
naloio da idu okolo po zemlji i otvaraju druge.
ta oni ine? Oni imaju vrlo jednostavnu metodu. Vi moete to shvatiti jer radite
mnoge sline metode. ovek koga je otvorio Bapak Sabud kree se sa novopridolim - s
ovekom koga treba otvoriti - sa sledbenikom. Oni ostaju u zatvorenoj sobi. Onaj koji je ve
otvoren podie svoju ruku prema nebu. Otvara sebe, a drugi tu jednostavno stoji. Za nekoliko
minuta drugi poinje da podrhtava. Neto se deava, a kada je otvoren, otvoren ka
beskonanom nebu, beskonanoj energiji s one strane, onda mu se doputa da otvara druge.
Niko ne zna ta oni rade, ak ni akter nikada ne zna ta radi. On jednostavno stoji tamo
a drugi jednostavno stoji u blizini - novokrteni ili iskuenik. A oni ne znaju - oni pitaju
Bapaka Sabuda: ta je ovo?" Oni to rade - to se deava - ali Bapak Sabud nikada ne daje
objanjenje. On nije taj tip oveka. On kae: Jednostavno radite to. Ne brinite se zato se to
deava. To se deava."
Isto se dogaa ovde. ovek se otvara. Iznenada, energija se kree okolo: on kreira
atmosferu, ivotnu sredinu. Vi ste pored njega; iznenada oseate jak talas, suze poinju da
liju, vae srce je puno. Vi otvarate; pomaete drugog... To postaje lanana reakcija. Ceo svet
moe biti otvoren; a jednom kada ste otvoreni, vi znate tu vetinu. Onda jednostavno stavite
svoj um u odreenu situaciju, na odreeni put vae bie; to je ono ta ja nazivam molitvom.
Za mene, molitva nije verbalna komunikacija sa boanskim. Jer kako vi jezikom
moete komunicirati sa boanskim? Boansko nema jezik i sve to kaete nee biti shvaeno.
Vi ne moete biti shvaeni uz pomo jezika, nego pomou vaeg unutranjeg bia ili bivanja.
Bie ili postojanje je jedini jezik.
201

Probajte malu metodu molitve. Tokom noi, kada odlazite u krevet, kleknite pored
kreveta. Ugasite svetlo, podignite svoje ruke, zatvorite oi i samo oseajte kao da ste ispod
vodopada - vodopada energije s neba. U poetku, to je jedna zamisao. U poetku to mora da
bude mata. Tokom dva, tri dana poinjete da oseate da je to stvarna pojava - vi ste ispod
vodopada - vae telo zapoinje da se trese, kao list na jakom vetru. A to padanje je tako jako i
ogromno da ga ne moete obuhvatiti - ono vas ispunjava od pore do pore, od nonih prstiju do
glave. Postali ste prazna posuda i ono vas ispunjava.
Kada osetite da vam nailazi drhtanje, saraujte s njim. Pomaite to drhtanje da raste
sve vie, jer to se vie tresete, vie je mogunosti za beskonanu energiju da se spusti u vas,
jer vaa vlastita energija postaje dinamika. Kada ste dinamiki, moete susresti dinamiku
silu; kada ste statiki, ne moete susresti dinamiku silu.
Kada drhtite, energija se stvara u vama. Energija privlai vie energije. Postanite
posuda - prazna, ispunjena, prepunjena. Kada oseate kako je to previe, nepodnoljivo,
punjenje je preveliko i vie ga ne moete podneti, kleknite na zemlju, poljubite zemlju i
ostanite tihi tamo kao da izlivate energiju u zemlju.
Uzmite od neba; dajte natrag zemlji. Postajete medijum izmeu neba i zemlje.
Poklonite se duboko; postanite opet prazni. Kada osetite da ste prazni, osetiete smirenost,
tiinu, sabranost. Onda uzdignite svoje ruke opet. Oseajte energiju. Spustite se dole,
poljubite zemlju; vratite energiju natrag zemlji.
Energija je nebo, energija je zemlja. Postoje dva tipa energije. Nebo se uvek naziva
mukim jer daje, a zemlja se uvek naziva enskom jer prima, ona je kao materica. Stoga
uzmite od neba i dajte zemlji. To treba uraditi sedam puta - ne manje - jer svaki put energija
e prodreti u jednu akru vaeg tela, a ima sedam akri.
Svaki put energija e ui dublje u vas; ona e pokrenuti dublju sr u vama. Mora se
uiniti sedam puta. Manje ne treba raditi, jer ako uradite manje neete moi da spavate.
Energija e biti unutra, i vi ete se oseati nemirno. Uradite to sedam puta. to vie puta
uradite, manje e biti tete, ali ne manje - uradite sedam puta ili vie.
A kada se osetite sasvim ispranjeno, idite da spavate. Cela vaa no e postati
dogaaj. U spavanju vi ete postati sve tii i tii. Snovi e se zaustaviti. Osetiete ujutru kako
se novo bie budi - uskrsava. Vie niste onaj stari. Prolost je odbaena; vi ste svei i mladi.
Radite to svake noi. Za tri meseca mnoge stvari e postati mogue. Biete otvoreni, a
onda moete otvarati druge. Posle tri meseca ovog fenomena otvaranja, moete jednostavno
stajati pored nekog i otvoriti sebe, i odmah ete osetiti da se drugi trese, drhti. ak i ako vas
on ne zna, ak i ako ga ne poznajete, moete otvoriti nekoga. Ali ne radite to jer drugi e biti
jednostavno preplaeni. On e misliti da se dogaa neto neprirodno.
Jednom otvoreni, vi moete otvarati druge. To je jedno duhovno stanje, jedno
oseanje; to je lepa infekcija; infekcija savrenog zdravlja, ne od neke bolesti - infekcija
celovitosti, infekcija svetosti, infekcija od duhovnog, svetog.

202

Poglavlje 9

NEGOVANJE ISPRAVNOG GLEDITA


Izlaganje ujutro 4. januara 1975. u Buddha dvorani.
I, 33: maitrikarunamuditopekanam sukha duhkha punya apunya viayanam bhavanata
citta prasadanam.
Duevna proienost (cittaprasadana) javlja se uspostavljanjem (bhavana)
[odnosa] simpatije za ono to je u dobru (sukha), sauea za ono to je u patnji
(duhkha), radovanja za ono to je valjano (punya) i ravnodunosti za ono to takvo nije
(apunya).
I, 34:

pracchardanavidharanabhyam va pranasya.
[Pomenuta proienost javlja se] takoer [kao posledica kontrolisanog]
otputanja i zadravanja daha.
I, 35:

viayavati va pravrttirutpanna manasah sthitinibandhani.


Ono dostignue (pravrtti) uma (manas) u kome se [kroz istotu senzacije] dogaa
poistoveenost sa predmetom [senzacije] (viayavati) privodi [duu] miru.
I, 36:

visoka va jyotimati.
- ili [se pomenuta duevna vedrina i proienost javlja u ostvarenosti stanja]
ispunjenog blaenom rastereenou i rasvetljenou (jyotimati).
I, 37:

vitaragaviayam va cittam.
- ili, pak [u poistoveenosti] sa domenima eljom-nepomuenih (vitaraga) s-

vesti.
Um postaje smiren uz pomo kultivisanja stanovita prijateljstva prema srenom,
sauee prema jadnom, radosti prema estitom i nezainteresovanosti prema zlu.
Mnoge stvari treba da se shvate pre nego to budete mogli da razumete ovu sutru.
Prvo, prirodno dranje; kad god ugledate nekog srenog, oseate ljubomoru - ne sreu, nikada
sreu. Oseate bedu, jad. To je prirodno dranje, gledite koje ste ve dobili. A Patanjali
kae da um postaje smiren negovanjem prijateljskog dranja prema srenom - vrlo teko. Da
bi se bio prijateljski sa nekim ko je srean jedno je od najteih stvari u ivotu.
Obino mislite da je to vrlo lako. Nije! Ba je suprotan sluaj. Oseate ljubomoru,
oseate jad. Moete pokazivati sreu, ali to je samo fasada, ou, maska. A kako moete biti
sreni? Kako moete biti smireni, tihi, ako imate takvo dranje?
Poto je itav ivot proslavljanje, milioni srea se deavaju po univerzumu, ali ako
imate dranje ljubomornosti, biete jadni, stalno ete biti u paklu. Biete u paklu jer svuda
ovde preko je nebo (blaenstvo). Stvoriete pakao za sebe - privatni pakao - lini pakao - jer
itava egzistencija je slavljenje.
Ako je neko srean, ta prvo dolazi u va um? Kao da je ta srea vama oduzeta, kao da
je on pobedio a vi ste pobeeni, kao da vas je on obmanuo... Srea nije nadmetanje, stoga ne
budite zabrinuti. Ako je neko srean, to ne znai da vi ne moete biti sreni, da je on uzeo
sreu - sada kako vi moete biti sreni. Srea nije neto to negde postoji, to mogu iscrpeti
sreni ljudi.
Zato oseate ljubomoru? Ako je neko bogat, moda je vama teko da budete bogati,
jer bogatstvo postoji u kvantitetu. Ako je neko snaan na materijalni nain, moe vam biti
teko da budete moni jer snaga je nadmetanje. Ali srea nije nadmetanje. Srea postoji u
203

beskonanoj koliini. Nikada niko nije mogao da je iscrpi; uopte ne postoji nadmetanje. Ako
je neko srean, zato vi oseate ljubomoru? S ljubomorom u vas ulazi pakao.
Patanjali kae, kada je neko srean, oseajte sreu, oseajte prijateljstvo. Onda vi
takoe otvarate vrata prema srei. Na suptilan nain, ako se moete oseati prijateljski s
nekim ko je srean, odmah zapoinjete da delite njegovu sreu; postala je takoe vaa odmah! Srea nije neka stvar; ona nije materijalna. Ona nije neto uz ta neko moe da se
vee. Vi to moete podeliti. Kada cvet cveta, moete ga podeliti; kada ptica peva, moete to
podeliti; kada je neko srean to moete podeliti. A lepota je da to ne zavisi od njegovog
deljenja. To zavisi od vaeg uestvovanja.
Ako bi to zavisilo od njegovog deljenja, da li on deli ili ne, onda bi to bila totalno
razliita stvar. On moda ne eli da deli. Ali to uopte nije pitanje, to ne zavisi od njegovog
deljenja. Kada se sunce podigne ujutru vi moete biti sreni, a sunce nita ne moe uiniti u
vezi s tim. Ono vas ne moe spreiti da budete sreni. Neko je srean; vi moete biti
prijateljski. To je totalno vae vlastito dranje, on vas ne moe spreiti da delite tu sreu. im
otvorite vrata, njegova srea tee prema vama.
Ovo je tajna kreiranja neba oko vas, a samo s nebom moete biti smireni. Kako
moete biti smireni u ognjenom paklu? Niko to ne stvara; vi to stvarate. Osnovna stvar koju
treba razumeti je da kad god postoji patnja, pakao, vi ste uzrok toga. Nikada ne prebacujte
odgovornost na drugoga, jer to prebacivanje odgovornosti je beanje od osnovne istine.
Ako ste jadni, samo vi - apsolutno samo vi - ste odgovorni. Pogledajte unutra i naite
uzrok toga. A niko ne eli da bude jadan. Ako moete nai uzrok u sebi, moete ga izbaciti
van. Niko ne stoji na vaem putu da vas sprei. Ne postoji ni jedna jedina prepreka da budete
sreni.
Stoga, bivajui prijateljski prema srenim ljudima, vi postajete usklaeni sa sreom.
Oni cvetaju; vi postajete prijateljski. Oni moda nisu prijateljski; ali to se vas ne tie. Oni vas
moda ak ne znaju - to nije vano. Inae, kad god ima cvetanja, kad god ima blaenstva, kad
god se neko rascvetava, kad god neko plee, srean je i smeje se, kad god ima slavljenja,
postanite prijatelji, uestvujte u tome. To zapoinje da tee u vama, niko to ne moe spreiti.
A kada je srea okolo vas, vi se oseate smireno.
Um postaje smiren negovanjem stanovita prijateljstva prema srenom...
Sa srenim, vi oseate ljubomoru - u suptilnom nadmetanju. Sa srenim ljudima, vi se
oseate inferiorni. Vi uvek birate ljude oko sebe koji su nesreni. Postajete prijateljski prema
nesrenim ljudima, jer se oseate superiorno. Uvek traite nekoga ko je ispod vas. Uvek se
bojite vieg; uvek traite nie, a to vie traite nie, nie padate. Onda su jo nii ljudi
potrebni.
Traite drutvo onih koji su vii nego to ste vi - vii u mudrosti, vii u srei, vii u
smirenosti, hladnokrvnosti, sabranosti; uvek traite drutvo viih jer je to nain kako moete
postati vii, kako da transcendirate doline i dosegnete vrhove. Oni postaju lestve. Uvek traite
drutvo vieg, lepog, srenog - vi ete postati lepi, postaete sreniji.
A jednom kada se upozna tajna, jednom kada znate kako ovek postaje sreniji, kako
sa sreom drugih vi stvarate situaciju za sebe da budete takoe sreni, onda nema prepreke;
onda moete otii onoliko daleko koliko elite. Moete postati Bog gde nikakva nesrea ne
postoji.
Ko je Bog? Bog je onaj ko je nauio tajnu da bude srean sa celim univerzumom, sa
svakim cvetom, sa svakom rekom i sa svakom stenom i svakom zvezdom, koji je postao
jedno sa ovim neprestanim venim slavljenjem, koji slavi, ko ne mari ija je ovo proslava.
Gde god je proslava, on uestvuje. Ova umetnost uestvovanja u srei jedan je od temelja ako
elite da budete sreni. To mora da se sledi.
Upravo suprotno ste radili; ako je neko srean smesta ste se sablaznili. Kako je to
mogue? Kako vi niste postali sreni, a on je srean? Za vas je to nepravda. Ceo ovaj svet vas
obmanjuje, i Bog ne postoji. Ako Boga ima, kako onda vi niste sreni, a drugi su sreni? A
204

oni ljudi koji su sreni, iskoriavaju druge. Oni su lukavi, podmukli, oni ive od vae krvi.
Oni sisaju sreu od drugih.
Niko ne isisava niiju sreu. Srea je takva pojava da nema potrebe da se isisava. To je
samo unutranje cvetanje; ne dolazi spolja. Samo bivajui sa srenim ljudima vi stvarate
situaciju u kojoj va unutranji cvet poinje da cveta:
Um postaje smiren negovanjem stanovita prijateljstva...
Vi stvarate stav neprijateljstva. Moete oseati prijateljstvo prema tunoj osobi, a
mislite da ste vrlo estiti. Moete se oseati prijateljski prema nekome ko je potiten, u nevolji
i misliti da je to neto religiozno, da inite neto moralno, ali ne znate ta inite.
Kad god oseate prijateljstvo prema nekome ko je tuan, potiten, jadan, stvarate sebi
nevolju. To Patanjalijevo stanovite izgleda vrlo nereligiozno. To nije tako, jer kada biste
razumeli itavo njegovo gledite, znali biste ta on misli. On je vrlo nauan. On nije
sentimentalna osoba, a sentimentalnost vam nee pomoi.
ovek treba da bude vrlo, vrlo jasan:
...sauee prema jadnom...
Ne prijateljstvo - sauee. Sauee je razliit kvalitet; prijateljstvo je razliit.
Prijateljstvo znai da vi stvarate situaciju u kojoj biste eleli da budete isti kao to je druga
osoba, eleete da budete isti kao va prijatelj. Sauee znai da je neko pao iz tog stanja. Vi
biste eleli njemu da pomognete, ali ne biste eleli da budete kao on. eleli biste da mu
pruite ruku; eleli biste da ga uzdignete, ohrabrite. eleli biste da mu pomognete na svaki
nain; ali ne biste eleli da budete kao on, jer to onda nije pomo.
Neko zapomae i plae, a vi sedite sa strane i poinjete da zapomaete i plaete; da li
mu pomaete? Na koji nain? Neko je jadan i vi postajete alosni; da li mu pomaete? Moete
udvostruiti njegovu bedu. Samo je on bio jadan; sada su dve osobe jadne. Ali u pokazivanju
sauea prema jadnom vi se opet poigravate lukavstvom. Duboko dole, kada pokazujete
simpatiju prema jadnom - a zapamtite simpatija nije sauee; simpatija je prijateljstvo. Kada
pokazujete simpatiju i prijateljstvo prema potitenoj, tunoj, jadnoj osobi, duboko dole
oseate sreu. Uvek postoji podzemna struja sree. To mora biti tako, jer je to jednostavna
aritmetika; kada je neko srean vi se oseate jadno, onda kako je mogue kada je neko
nesrean da se oseate nesreni? Ako je neko srean vi se oseate jadno; a onda, ako je neko
nesrean, duboko dole vi se oseate vrlo srenim.
Ali vi to ne pokazujete. Ili zapravo, ako ste primetili da pokazujete to - ak i u vaoj
simpatiji postoji suptilan tok sree. Vi se oseate dobro, oseate se zaista razveseljeni, da vi
niste taj koji je nesrean, a u poloaju ste da pokazujete simpatiju - vi ste vii, superiorniji.
Ljudi se uvek dobro oseaju kada pokazuju simpatiju prema drugima; oni su uvek
ohrabreni, uveseljeni. Duboko dole ljudi oseaju da nisu toliko jadni, hvala Bogu. Kada neko
umre, odmah se u vama pojavi jedna podzemna struja da ste jo ivi, hvala Bogu. I moete
pokazati simpatiju i ona nita ne kota. Pokazivanje simpatije ne kota nita, ali sauee je
drugaija stvar. Sauee znai da vi elite da pomognete drugoj osobi; eleli biste uiniti sve
to se moe uiniti; eleli biste da joj pomognete da izae is svoje bede. Niste sreni s tim, ali
niste takoe ni u alosti.
A upravo izmeu to dvoje stoji sauee; Buddha je u saueu. On se nee oseati
jadno s vama jer nikome to nee pomoi, a nee oseati ni sreu jer nema mesta za oseanje
sree. Kako moete oseati sreu kada je neko bedan? Ali on takoe ne moe oseati nesreu,
jer to nee pomoi. On e oseati sauee. Sauee samo postoji izmeu ovo dvoje.
Sauee oznaava da bi on eleo da vam pomogne da izaete iz toga. On je za vas, sauee
znai, samo da je protiv vae nevolje; on voli vas, ali ne vau bedu. eleo bi da vas uzdigne iz
toga, ali ne s vama i vau patnju.
Kada ste saoseajni vi poinjete voleti bedu, ne oveka koji pati. Ako je ovek
iznenada obodren, uveseljen i kae: "Ne brinite," vi ete biti okirani, jer vam nikada nije dao
priliku da budete saoseajni i pokaete mu kako ste vi vie, superiornije i sreno bie.
205

Ne budite jadni s nekim ko je bedan. Pomognite mu da izae iz toga. Nikada ne inite


jadnim jedan objekat ljubavi; ne iskazujte nikakvu privrenost patnji, jer ako iskaete
naklonost i uinite je jednim objektom ljubavi, otvarate vrata za to. Pre ili kasnije vi ete
postati jadni. Ostanite ravnoduni, hladni. Sauee znai ostati ravnoduan. Pruite svoju
ruku, ostanite udaljeni, pomognite, ne oseajte se srenim, jer oboje su isto. Kada se oseate
bedno na povrini s neijom patnjom, duboko dole protie struja sree. Oboje treba odbaciti.
Sauee e vam doneti smirenost uma.
Mnogi ljudi mi dolaze; oni su drutveni reformatori, revolucionari, politiari i kau:
"Kako moete nauiti ljude meditaciji i tiini kada ima tako mnogo bede u svetu?" Oni mi
kau: "Vi ste sebini." Oni bi eleli od mene da nauim ljude da budu jadni s drugima koji su
jadni. Oni ne znaju ta govore ali se oseaju vrlo dobro - radei drutveni posao, vrei
drutvenu slubu, oni se oseaju vrlo dobro. A ako iznenada svest postane nebo, i Bog kae,
"Sada e sve biti u redu," vi ete nai drutvene reformatore i revolucionare u apsolutnoj bedi,
jer oni nee imati nita da rade.
Khalil Gibran je napisao malu alegoriju. U gradu, u velikom gradu postojao je pas koji
je bio propovednik i misionar, i on je propovedao drugim psima: "Prestanite da lajete.
Gubimo oko devedeset devet posto svoje energije u nepotrebnom lajanju. Zbog toga se ne
razvijamo. Prestanite nepotrebno da lajete."
Ali psima je teko da prestanu lajati. To je jedan unutra ugraeni proces. Oni se zaista
oseaju sreni samo kada laju. To je katarza. Oseaju se tiho samo kada su lajali. Dakle, oni
su sluali vou - revolucionara, utopistu, koji je razmiljao o carstvu boijem, carstvu pasa,
negde u dolazeoj budunosti, gde e svaki pas postati reformisan i postati religiozan - nema
lajanja, nema borbe, sve je tiho... taj misionar mora da je bio pacifista.
Ali psi su psi. Sluate njega i onda e rei: "Vi ste veliki ovek, i ta god vi kaete to
je istina. Ali mi smo bespomoi, siroti psi. Ne razumemo takve velike stvari." Dakle svi su psi
osetili kvalitet jer nisu mogli da se zaustave. Oni su poverovali u poruku voe, a on je bio u
pravu; racionalno, oni nisu mogli to da slede. Ali ta da ine s telima? Tela su iracionalna.
Kad god ima promene - sannyasin naie - oni e lajati; policajac naie, potar... jer oni su
protiv uniformi.
To je gotovo nemogue za njih, oni su se utvrdili u tome: "Taj pas je veliko bie, i mi
ga ne moemo slediti. On je kao avatar - neto s druge obale. Dakle, mi emo ga oboavati,
ali kako ga moemo slediti? A voa je bio uvek istinit u svojim reima; nikada nije lajao. Ali
jednog dana sve je propalo. Jedne noi, mrane noi, psi su odluili: "Ovaj veliki voa uvek
pokuava da nas preobrati, a mi ga nikada ne sluamo. Barem jednom godinje, na roendan
lidera, treba potpuno da postimo, bez lajanja - u apsolutnoj tiini - bez obzira koliko je teko.
Barem jednom godinje moemo to uraditi," odluili su oni.
Te noi nijedan pas nije lajao. Lider je iao od jednog ugla do drugog, od ove ulice do
one, da posmatra, jer kad god bi psi zalajali on bi propovedao. Poeo je da se osea vrlo jadno
jer niko nije lajao; itave noi je bilo sasvim tiho kao da nije postojao nijedan pas... Obiao je
mnoga mesta, posmatrao, i do ponoi bilo mu je tako nepodnoljivo da je zaao u mraan
ugao i zalajao!
Onog momenta kada su drugi psi uli da je jedan pas zalajao, rekli su: "Sada nema
problema." Nisu znali da je lider to uinio. Mislili su da je jedan od njih prekrio zavet. Sada
im nije bilo mogue da se uzdre; ceo grad je zalajao. Voa je izaao i poeo da propoveda!
To e biti stanje vae drutvene revolucije - ovnovi predvodnici, reformatori,
gandijevci, marksisti i drugi - svih vrsta. Oni e biti u takvoj tekoi ako se svet zaista
promeni. Ako svet zaista ispuni utopiju iz njihovih umova i mate, oni e poiniti
samoubistvo ili e poludeti. Ili e zapoeti da propovedaju ba suprotno, kontradiktorno;
upravo suprotno od onoga ta propovedaju sada.
Oni mi dolaze i kau: "Kako moete govoriti ljudima da budu smireni kada je svet u
takvoj bedi?" Oni prvo misle da beda treba da bude uklonjena, onda hoe li ljudi biti smireni?
Ne, ako su ljudi smireni, jad se moe ukloniti, jer samo smirenost moe ukloniti bedu. Beda je
jedno stanovite. To je manje stvar materijalnih uslova, a vie unutranjeg uma, unutranje
206

svesnosti. ak i siromaan ovek moe biti srean, a jednom kada je srean, mnoge stvari
zapoinju da padaju na put.
Ubrzo on moda nee biti siromaan ovek, jer kako moete biti siromani kada ste
sreni? Kada ste sreni, itav svet uestvuje s vama. Kada ste nesreni, sve ide pogreno.
Kreirate svuda oko sebe situaciju koja pomae vaoj nesrei da bude tu. Ovo je dinamika
uma. To je sistem samoodbrane. Vi se oseate bedno, onda se vie jada privlai prema vama.
Kada jo vie jada privuete onda kaete: "Kako sada da budem smiren? Suvie je patnje
ovde" Tako privlaite jo vie patnje na sebe. Onda kaete: "Sada je to nemogue. A oni koji
kau da su sreni mora da govore lai; ove Bude, Krine mora da govore lai. Ovi Patanjaliji
mora da su laovi, jer kako je to mogue, tako je mnogo patnje?"
Onda ste vi u samoodbrambenom sistemu. Vi privlaite, a ne samo da privlaite sebi;
kada je neka osoba jadna, pomae takoe drugima da budu jadni, jer su takoe budale kao vi.
Videvi vas u patnji, oni saoseaju. Kada saoseaju, postaju povredljivi. Dakle, to je slino
ovome; jedna bolesna osoba zarazi celo drutvo.
Mula Nasrudinov doktor mu je poslao raun. Bio je preveliki. Njegovo dete je bilo
bolesno; Nasrudinov mali sin je bio bolestan. Telefonirao je doktoru i rekao: "Ovo je previe."
Doktor je odgovorio: "Ali morao sam dolaziti devet puta da vidim vaeg sina, tako da to mora
biti zaraunato." Nasrudin je rekao: Nemojte zaboraviti da je moj sin zarazio celo selo, pa ste
vi zaradili mnogo. Zapravo vi treba meni da platite neto."
Kada je osoba jadna, ona zarazi. Beda je zarazna ba kao to je i srea zarazna. A ako
ste ranjivi prema bedi - kao to jeste, jer uvek tragate nesvesno - va um trai patnju, jer sa
bedom vi oseate simpatiju; sa sreom oseate ljubomoru.
Mula Nasrudinova ena mi je jednom rekla: "Ako idete u Nju Delhi - zima dolazi donesite mi zavidan kaput." Nisam je mogao slediti ta misli, pa sam joj rekao: "Ne znam
puno o kaputima, ali nikada nisam o tome uo. ta je 'zavidan' kaput?" Rekla je: "Nikad niste
uli?". Poela je da se smeje pa je rekla: "Zavidan kaput je onaj kaput, koji kada obuete,
susedi vam zavide!"
Dok vam drugi ne zavide, vi se ne oseate ivi. Dok drugi nisu u bedi, vi ne oseate
sreu. Ali kako moete oseati sreu kada su drugi nesreni; kako se moete oseati zaista
ivi kada su drugi mrtvi? Mi postojimo zajedno. Ponekad moete biti uzrok bede mnogih
ljudi. Onda zaraujete karmu. Vi ih moda niste direktno pogodili, moda niste bili nasilni
prema njima. Suptilan je zakon. Vi ne treba da budete ubica, ali ako jednostavno zarazite
ljude vaom bedom, vi uestvujete u tome; vi kreirate bedu. Vi ste odgovorni za to, i moraete
da platite za to. Mehanizam je vrlo suptilan!
Upravo pre dva-tri dana se dogodilo da je sannyasin je napao Lakmi. Moda niste
zapazili da ste vi odgovorni za to, jer mnogi od vas oseali ste otpor prema Lakmi. Taj
sannyasin je samo rtva, upravo najslabija veza meu vama. On je izrazio va otpor, to je sve,
a on je bio najslabiji; on je postao rtva, i zato biste oseali da je on odgovoran? To nije
istina. Vi ste uestvovali. Suptilan je zakon!
Kako ste uestvovali? Duboko dole, kad god neko nadgleda - a Lakmi ovde okolo
nadgleda stvari... Ima mnogo situacija u kojima ete oseati protivljenje, u kojima e vam ona
morati rei ne, u kojima ete se osetiti povreeni - to se ne moe izbei - u kojima oseate da
vam nije ukazana dovoljna panja, u kojima oseate da ste tretirani kao da niste niko. Va ego
osea da je povreen i vi oseate protivljenje.
Ako mnogi ljudi oseaju protivljenje prema osobi, onda najslabiji meu njima e
postati rtva; on e uraditi neto. On je bio najlui meu vama, to je u tano. Ali nije samo on
odgovoran. Ako ste ikada oseali neprijateljstvo prema Lakmi, to je delimino i vi ste nauili
karmu, a dok ne postanete tako suptilno svesni ne moete postati prosvetljeni. Stvari su vrlo
komplikovane.
Sada su na Zapadu takoe otkrili psihoanalitiari da je cela porodica odgovorna ako
jedna osoba poludi - cela porodica! Oni sada misle da se celom porodicom treba baviti, ne
jednom osobom, jer kada osoba poludi to samo pokazuje da cela porodica ima unutranje
napetosti. Ona je najslabija od svih njih, tako da odmah pokazuje celu stvar, ona postaje izraz
207

cele porodice, a ako se bavite samo njom to nee pomoi. U bolnici osoba moe biti u redu;
vrativi se kui opet e pasti jer cela porodica ima unutranje napetosti, a ona je najslabija.
Deca pate previe zbog roditelja. Oni se meusobno bore ili tuku; uvek stvaraju nemir
i napetost u kui. itava kua postoji ne kao mirna zajednica, nego kao unutranji rat ili
konflikt. Dete je vie ranjivo; ono poinje da se ponaa na ekscentrian nain - sada imate
izgovor da ste napeti i zabrinuti zbog deteta. Onda otac i majka, oboje mogu biti zabrinuti
zbog deteta, odvee ga kod psihoanalitiara i doktora, i mogu zaboraviti svoj vlastiti konflikt.
Ovo dete postaje vezivna sila, ako je ono bolesno, onda mu oni moraju posvetiti vie
panje. Sada oni imaju izgovor i zato su zabrinuti, napeti i u patnji - jer dete je bolesno - a
oni ne znaju da je upravo obrnut sluaj... dete je bolesno zato to su oni zabrinuti, napeti i u
konfliktu. Dete je nevino, neno; ono se odmah moe povrediti, ono jo nema zatitu oko
sebe. A ako dete zaista ozdravi, roditelji e biti u veoj tekoi - jer onda nema izgovora.
Ovo je zajedniko, vi ivite ovde kao porodica. Nuno je da postoje mnoge napetosti,
budite toga svesni. Budite oprezni s ovim napetostima, jer vae napetosti mogu stvoriti silu.
One se mogu akumulirati i iznenada onaj ko je slab, ranjiv, jednostavan, moe postati utoite
akumulirane sile, onda on reaguje na takav nain. Onda moete baciti odgovornost na njega.
Ali to nije istina, ako ste ikada osetili ikakvo neprijateljstvo, vi ste deo toga. Isto je istinito u
veem svetu takoe.
Kada je Goda ubio Gandija, ja nikada nisam rekao da je on odgovoran. On je bio
najslabija karika; to je istina. Ceo hindu um bio odgovoran, duboke struje hindu antagonizma
protiv Gandija. Akumuliralo se oseanje da je on za muslimane. Ovo je jedna stvarna pojava;
neprijateljstvo postaje akumulirano. Isto kao oblak, ono se koleba, krui, a onda negde slabo
srce, vrlo nezatien ovek, postaje rtva. Oblak se nakupi i u njemu onda nastupa eksplozija.
Svako je tako osloboen; Goda je odgovoran - ubijajui Gandija - tako da moete ubiti Godu i
bie sve zavreno. Onda se cela zemlja kree na isti nain, a hindu um ostaje isti; bez
promene. Suptilan je zakon!
Uvek otkrijte dinamiku uma. Samo onda ete biti preobraeni; na drugi nain ne.
Um postaje smiren negovanjem prijateljskog dranja prema srenom, saoseanja
prema jadnom, radosti prema estitom...
Gledajte! Patanjali gradi korake - lepo i vrlo suptilno, ali sasvim nauno.
...radosti prema estitom i ravnodunosti prema zlom...
Kada oseate da je neko estit ovek, radostan, obino dranje je da on mora da
obmanjuje. Kako iko moe biti vie estit nego vi? Otuda ima tako mnogo kriticizma.
Kad god ima nekoga ko je estit, vi odmah zapoinjete da kritikujete, poinjete da
traite greke u njemu. Na ovaj ili onaj nain morate da ga dovuete dole. On ne moe biti
estit. Ne moete verovati u to. Patanjali kae 'radost', jer ako kritikujete estitog oveka, u
dubini dole vi kritikujete vrlinu. Ako kritikujete estitog oveka, dolazite do take da
poverujete da vrlina nije moguna u ovom svetu. Onda ete se oseati oputeno. Onda se lako
moete kretati na svojim zlim putevima jer: "Niko nije estit; svako je ba kao ja - ak i gori
nego ja." Zbog toga ima tako mnogo osuda - kriticizma, neodobravanja.
Ako neko kae: "Ova osoba je vrlo lepa," vi odmah nalazite neto da kritikujete. Ne
moete tolerisati - jer ako je neko estit, a vi niste, va ego je razbijen, i onda poinjete
oseati: "Ja moram promeniti sebe," to je preteak napor. Jednostavnije je da se osuuje;
jednostavnije je kritikovati, rei: "Ne! Dokaite! ta kaete? Prvo, dokaite kako je on estit!"
Teko je dokazati vrlinu; vrlo lako je ne dokazati ita. Vrlo je teko dokazati!
Jedan od najveih ruskih pripovedaa je Turgenjev. On je napisao priu. Pria kae da
je u jednom malom selu ovek mislio da je glup, i bio je. Ceo grad mu se smejao. Bio je kao
budala, i svako je u gradu uivao u njegovoj ludosti. Meutim, on je bio umoran od svoje
ludosti, pa je pitao mudrog oveka: "ta da radim?"
Mudar ovek je rekao: "Nita! Jednostavno, kad god neko hvali nekoga ti kudi. Kad
neko kae da je taj i taj ovek svetac, odmah kai: Ne, ja znam da je grenik! Kada neko
kae: Ova knjiga je vrlo vana, odmah kai: itao sam je i izuavao. Ne brini da li si je
itao ili ne; jednostavno kai: To je smee. Ako neko kae: Ova slika je jedno od najveih
208

umetnikih dela, jednostavno kai: Inae ta je ona? - samo platno i boje. Dete to moe da
naini! Kritikuj, kai ne, trai dokaze, a posle sedam dana doi kod mene."
Tokom sedam dana grad je poeo da osea da je taj ovek genije: Nikada nismo znali
o ovim talentima, on je genije za sve. Pokaete mu sliku a on vam pokazuje njene greke.
Pokaete mu vanu knjigu, a on pokazuje u njoj greke. On je tako veliki kritiki um!
Analitiar! Genije!"
Sedmog dana on je doao kod mudrog oveka i rekao: Sada nema potrebe da uzimam
bilo kakav savet od tebe. Ti si budala!" itav grad je imao obiaj da veruje tom mudracu, i svi
su rekli: Na genije je rekao da je on budala, mora da jeste."
Ljudi uvek lake veruju u negativno, jer vrlo je teko da se opovrgne 'ne' - kako
moete dokazati? Kako moete dokazati da je Isus sin Boiji? Kako ete dokazati? Dve
hiljade godina je hrianska teologija dokazivala bez dokaza. A za sekundu je dokazano da je
on grenik, vagabund, i ubili su ga - za nekoliko sekundi! Neko je rekao: "Ja sam video ovog
oveka kako izlazi iz prostitutkine kue" - i gotovo! Niko ne mari da li je taj ovek koji je
rekao: "Video sam ga!", pouzdan ili ne - nikoga to nije briga. U negativno se uvek lako
verovalo, jer to takoe pomae va ego. U pozitivno se nije verovalo.
Vi moete rei 'ne', kad god postoji vrlina. Ali ne moete nauditi estitom oveku,
povreujete sebe. Vi ste samodestruktivni. Zapravo sprovodite samoubistvo lagano trujui
sebe. Kada kaete: "Ovaj ovek nije estit," ta vi zapravo kreirate? Kreirate osnovu na kojoj
ete poeti da verujete da je vrlina nemogua; a kada je vrlina nemogua, nije potrebno ni
pokuati. Onda padate dole. Onda se smetate gde jeste. Rast postaje nemogu. Vi biste eleli
da se namirite, utvrdite, onda se utvrdite u patnji jer ste jadni.
Vi ste sve utvrdili potpuno. Ovo utvrivanje treba da se prekine; treba da budete
neutvreni. Gde god da ste, treba da budete iupani i presaeni na viu ravan, a to je mogue
samo ako ste radosni prema estitom.
...radosti prema estitom i ravnodunosti prema zlom...
Nemojte ak ni da osuujete zlo.
Iskuenje postoji: vi biste eleli da osudite ak i vrlinu. Patanjali kae nemojte
osuivati zlo. Zato? On zna unutranju dinamiku uma: ako previe osuujete zlo, posveujete
previe panje zlu, i ubrzo postajete usklaeni s njim. Ako kaete: Ovo je pogreno, ono je
pogreno," posveujete preveliku panju pogrenom. Postaete naviknuti na zlo. Ako
posveujete preveliku panju bilo emu, postajete opinjeni time. A ta god da osuujete vi
ete se obavezati, jer e to postati jedna privlanost, duboka privlanost prema dole. Inae,
zato biste brinuli? Oni su grenici, ali ko ste vi da brinete za njih?
Isus je rekao: Ne sudite..." To je ono ta Patanjali ovde podrazumeva pod izrazom
ravnodunosti; ne sudite na ovaj ili onaj nain, budite ravnoduni. Ne kaite da ili ne; ne
osuujte, nemojte procenjivati. Jednostavno ostavite to boanskom; to nije nimalo va posao.
ovek je lopov; to je njegov posao. Njegov i Boji. Neka oni to srede sami; ne ulazite u to.
Ko trai od vas da se uputate u to? Isus kae: Ne sudite..." Patanjali kae: Budite
ravnoduni."
Jedan od najveih hipnotizera u svetu, Emil Kue, otkrio je zakon - zakon hipnoze.
Nazvao ga je zakonom obrnutog ili suprotnog efekta. Ako ste previe protiv neega, postaete
rtva. Pogledajte osobu koja je tek obuena da vozi bicikl na putu. Put je irok ezdeset stopa,
a postoje i miljokazi pokraj puta. ak i ako ste iskusni biciklista i od kamena nainite metu:
Ja u otii i tresnuti u kamen," nekada moete promaiti. Ali nikada novo naueni - nikada!
On nikada ne promauje ugaoni kamen. Na dobrom putu, njegov toak se kree prema
kamenu, a ezdeset stopa je irok put! ak i sa zavezanim oima moete se kretati na njemu ak i ako nikoga nema na putu, on je sasvim tih, niko se ne kree...
ta se deava poetniku? Zakon deluje. Emil Kue ga naziva zakonom suprotnog
efekta. U poetku, zato to je poetnik koji ui, on se boji, pa tako gleda okolo, gde je taka
koje se plai - gde moe pogreiti? itav put je u redu, ali ovaj kamen, ovaj crveni kamen
pored ugla, to je opasnost: Mogu tresnuti u njega." Dakle sada je stvorena jedna naklonost,
209

afinitet. Sada je njegova panja usmerena prema kamenu; zaboravlja se ceo put. A on je
poetnik koji ui! Njegove ruke drhte, gleda u kamen i ubrzo osea da se bicikla pokree.
Odjednom oseti da bicikl...
Bicikl mora da sledi vau panju; bicikl nema svoju vlastitu volju. On vas sledi gde
god da vi idete, a vi sledite vae oi, a oi slede suptilnu hipnozu, izvesnu paljivost. Vi
gledate u kamen, ruke se kreu tim putem. Vi postaje sve vie i vie uplaeni. to ste vie
uplaeni, vie ste uhvaeni, jer sada kamen izgleda da je jedna zla sila, kao da vas kamen
privlai. itav put se zaboravlja, bicikl se zaboravlja, poetnik koji ui je zaboravljen. Samo
kamen postoji; vi ste hipnotisani. Vi ete ii i tresnuti u kamen. Kada ste ispunili svoj um,
sledei put ete se plaiti jo vie. Dakle, gde se to moe prekinuti?
Kada kaete da je neto pogreno, idite u manastir - monasi osuuju seks. Seks je
postao miljokaz. Dvadeset etiri sata oni misle o tome; pokuavanje da se izbegne jeste
razmiljanje o tome. to vie pokuavate da izbegnete to, vie ste hipnotisani. Zbog toga je u
starim spisima reeno da kad god svetac meditira, lepe devojke s neba dolaze i pokuavaju da
ometaju njegov um. Zato bi lepe devojke bile zainteresovane? Neko sedi ispod drveta sa
zatvorenim oima, zato bi lepe devojke bile zainteresovane za njega?
Niko ne dolazi ni od kuda, ali on je toliko protiv seksa da je to postalo hipnoza. On je
tako mnogo hipnotisan da sada snovi postaju realni. Otvara svoje oi i vidi lepe nage devojke
kako stoje tamo. Vama treba pornografski asopis da vidite nagu enu. Ako odete u manastir,
nee vam trebati pornografski asopis; vi sami stvarate svoju pornografiju oko sebe. A onda
onaj koji tako meditira, postaje vie uplaen; zatvara oi, stee svoju pesnicu. Odmah se
unutra ena uspravlja.
Ne moete nai tako lepe ene na ovoj zemlji jer one su tvorevine sna - sporedni
proizvod hipnoze - a to se vie plaite, vie njih je tu. One e trljati njegovo telo, dodirivati
njegovu glavu, lepie se uz njega i grlie ga. On je potpuno lud, ali to se deava. Takoe se to
deava i vama. Opasnost moe da se razlikuje, ali to je ono to se dogaa. Protiv ega da ste
vi, s tim ete duboko dole biti spojeni.
Nikada nemojte biti protiv neega. Da se bude protiv zla znai pasti kao rtva. Onda
padate u ruke zla. Ravnodunost; ako sledite ravnodunost, to znai da to nije vaa briga.
Neko krade; to je njegova karma. On e je spoznati i morae da pati. To uopte nije va
posao; ne razmiljajte o tome, ne poklanjajte nikakvu panju tome. Postoji bludnica; ona
prodaje svoje telo - to je njen posao. Vi nemate neodobravanje u sebi, inae bili biste
privueni prema njoj.
To se deavalo - to je vrlo stara pria - da su svetac i bludnica iveli zajedno. Bili su
susedi, a onda su umrli. Svetac je bio vrlo poznat. Smrt je dola i poela da vodi sveca u
pakao. Umro je tog istog zlokobnog dana kada i bludnica.
Onda je svetac bio iznenaen, jer ona je odneena na put prema nebu. Stoga je pitao:
"ta je ovo? Izgleda da je dolo do nesporazuma. Ja sam onaj koji treba da ide prema nebu, a
ona je bludnica!"
Smrt je rekla: "Znamo, ali sada ako elite moemo vam objasniti; nije dolo do
nesporazuma. Date su naredbe - da bludnica mora da se odvede na nebo, a mudrac baci u
pakao." Svetac je pitao: "Ali zato?" ak i bludnica nije mogla da veruje. Ona je rekla: "Neto
mora da je pogreno. Zar ja moram biti odvedena na nebo? A on je svetac - veliki svetac. Mi
smo ga oboavali. Odvedite njega na nebo!"
Smrt je rekla: "Ne, to nije mogue jer je on bio svetac samo na povrini a mislio je
neprekidno o tebi; sanjao je o tebi milion puta. Na usnama mu je bilo ime Boga; u srcu tvoj
lik."
U isto vreme, s druge strane, tano je da je bludnica prodavala svoje telo, ali uvek je
mislila da bi elela da ima ivot kao ovaj svetac koji je iveo u hramu: "Kako je on ist!"
Sanjala je o svecu, istoti, svetosti, vrlini koja joj je nedostajala. A kada bi muterije otile,
ona bi se molila Bogu: "Sledei put nemoj me uiniti opet bludnicom. Uini me vernikom;
naini me meditantom. elela bih da sluim u hramu."
Mnogo puta je razmiljala da ode u hram, ali mislei da je previe u grehu, odluila je
da nije dobro da ulazi u hram: "To mesto je tako sveto a ja sam takva grenica." Mnogo puta
210

je elela da dotakne mudraeva stopala, ali je mislila da to nee biti dobro: "Nisam dovoljno
vredna da dodirnem njegova stopala." Odluila je da kada mudrac umre, sakupi prainu sa
staze kojim je prolazio, i da je oboava.
Nije pitanje ta ste vi spolja. Ono to je vaa unutranja hipnoza odluie budui tok
vaeg ivota. Budite ravnoduni prema zlu. Ravnodunost ne oznaava apatiju - zapamtite.
Postoji suptilna razlika. Ravnodunost ne oznaava apatiju. To ne znai da zatvorite svoje oi,
jer ak i kada ste ih zatvorili vi ste zauzeli stanovite, dranje. To ne znai da ne brinete, jer
tamo takoe postoji suptilno neodobravanje, osuivanje. Ravnodunost jednostavno znai kao
da to ne postoji, kao da to nije tu. Ravnodunost ne oznaava nikakvo stanovite. Vi prolazite
kao da se to ne dogaa.
Re upeksha, koju Patanjali koristi, jeste vrlo lepa. Nije ni apatija ni protivljenje, niti
bekstvo. To je jednostavno ravnodunost bez ikakvog naelnog stava - zapamtite, bez ikakvog
stanovita, jer vi moete biti indiferentni sa nekim naelnim stavom. Moete misliti da to nije
vredno - nije vredno mene da mislim o tome. Ne, onda imate izvestan naelan stav, a suptilno
neodobravanje je skriveno u tome. Ravnodunost jednostavno znai: "Ko ste vi da odluujete,
da sudite?" Mislite o sebi: "Ko ste vi? Kako moete rei ta je zlo a ta je dobro? Ko zna?"
Zato to je ivot takva kompleksnost zlo postaje dobro, dobro postaje zlo - oni se
menjaju. Poznati su grenici koji su dosegli najvie, i sveci koji su bacani u pakao. Stoga, ko
zna? A ko ste vi? Ko vas pita? Vi se brinite o sebi. ak i ako moete initi to, dovoljno ste
uradili. Budite vie obazrivi i svesni, onda vam ravnodunost dolazi bez ikakvog naelnog
stava.
To se dogodilo. Vivekananda, pre nego to je otiao u Ameriku postao je uvena
svetska figura, boravio je u Maharadinoj palati u Daipuru. Maharada je bio prijatelj
Vivekanande i Ramakrine. Kao to se maharadama svia, kada je Vivekananda doao u
palatu da tu boravi nainio je veliku sveanost od toga, pozvao je prostitutke da igraju i
pevaju na prijemu... kao to se maharadama svia; oni imaju svoje vlastite poglede. On je
sasvim zaboravio da primanje sannyasina s pevanjem i plesom prostitutki ne dolikuje. Ali nije
mogao znati sve to. Znao je da kad nekoga prima mora da se pije i plee.
A Vivekananda je jo bio nezreo; jo nije bio savreni sannyasin, onda postoji
ravnodunost - ali on jo nije bio ravnoduan. Nije dovoljno duboko uao ak ni u
Patanjalija. Bio je mlad ovek i vrlo sklon uzdravanju kojim je suzbijao svoj seks i sve.
Kada je video prostitutke, jednostavno se zakljuao u svojoj sobi i nije izlazio iz nje.
Maharada je doao i zatraio oprotaj. Rekao je: "Nismo znali. Nikada nismo primali
sannyasina. Uvek smo primali kraljeve, otuda znamo takve naine primanja. Dakle, ao nam
je, ali sada je ovo postalo jako uvredljivo, jer ovo je najvea prostitutka u zemlji - i vrlo je
skupa. Mi smo je platili, a sada rei joj da ode, bila bi velika uvreda za nju; ako vi ne doete
ona e se oseati vrlo povreena. Stoga izaite van."
Ali Vivekananda se plaio da izae van; zbog toga kaem da je bio jo nezreo, jo
neosposobljen sannyasin. Jo ne postoji ravnodunost - ve osuda: "Bludnica!" Bio je vrlo
ljut, pa je rekao: "Ne." Onda je prostitutka poela da peva bez njega, a pevala je pesmu o
svecu. Pesma je bila vrlo lepa. Pesma je kazivala: "Ja znam da te nisam vredna, ali si mogao
biti malo samilosniji. Ja sam blato, ubre na putu; to ja znam. Ali ti ne treba da bude
neprijateljski prema meni. Ja nisam niko - neznalica, grenik. Ali ti si svetac - zato se plai
mene?"
Kae se da je Vivekananda sluao iz svoje sobe. Prostitutka je plakala i pevala, i on je
osetio - osetio je celu situaciju i ta je uradio. To je nezrelo, detinjasto. Zato se boji? Strah
postoji samo ako ste privueni. Bojaete se ene ako ste privueni od nje. Ako vas ne privlai,
strah iezava. ta je strah? Ravnodunost dolazi bez ikakvog otpora.
Otvorio je vrata; nije mogao obuzdati sebe, pobedila ga je prostitutka. Ona je postala
pobednik; morao je da izae van. Izaao je, seo i napisao u dnevniku: "Novo otkrovenje sam
dobio od boanskog. Plaio sam se... mora da je bilo neke poude u meni. Zbog toga sam se
plaio. Inae ena me je potpuno pobedila, i nikada nisam video tako istu duu. Suze su bile
tako nevine a pevanje i igranje tako sveto da bih ja bio neprimeen. A sedei pored nje, po
prvi put sam postao svestan da nije pitanje ko je tu spolja; pitanje je ta je."
211

Te noi je napisao u svom dnevniku: "Sada bih uvek mogao spavati s tom enom u
krevetu i ne bi bilo straha." On je transcendirao. Ta prostitutka mu je pomogla da
transcendira. Ovo je udo. Ramakrina nije mogao da pomogne, a prostitutka mu je pomogla.
Dakle, niko ne zna odakle e pomo doi. Niko ne zna ta je zlo, a ta je dobro. Ko moe
odluiti? Um je nemoan i bespomoan. Stoga ne uzimajte nikakvo stanovite; to je znaenje
da se bude ravnoduan.
Um takoe postaje smiren naizmeninim izdisanjem i zadravanjem daha.
Patanjali takoe daje druge alternative. Ako moete uraditi ovo - bivajui sreni sa
srenim ljudima, prijateljski; saoseajui s jadnim, radosni s estitim, ravnoduni sa zlim
ljudima - ako to moete uraditi, onda ulazite iz transformacije uma prema nad-umu. Ako ne
moete uiniti - jer je to teko, nije lako - onda postoje druga dva puta. Ne oseajte se
potiteni.
Patanjali kae:
Um takoe postaje smiren naizmeninim izdisanjem i zadravanjem daha.
Onda uite kroz fiziologiju. Prvo je ulazak kroz um, drugo je ulaenje kroz fiziologiju.
Disanje i miljenje su duboko povezani, kao da su dva pola jedne stvari. Vi takoe
ponekad postajete svesni, ako ste malo paljivi; kad god se um promeni, disanje se promeni.
Na primer, vi ste ljuti; odmah se disanje menja, ritam se gubi. Disanje ima razliit kvalitet.
Ono nije ritmiko.
Kada imate strast, poudu, kada seks nadvlada, disanje se menja; ono postaje
grozniavo, ludo. Kada ste smireni, ne radei ba nita, samo se oseate vrlo oputeno, disanje
ima razliit ritam. Dakle, ili promenite um i disanje e se promeniti, ili moete uiniti
obrnuto: promenite disanje i um e se promeniti. Promenite ritam disanja, i um e se odmah
promeniti.
Kada se oseate sreni, smireni, ljubomorni, zapamtite ritam disanja. Sledei put kada
nastupi ljutnja, nemojte dozvoliti disanju da se promeni; zadrite ritam disanja kao da ste
sreni. Onda nije mogua ljutnja, jer disanje stvara situaciju za to. Sile disanja iz unutranjih
lezda u telu oslobaaju hemikalije u krvi.
Zbog toga postajete crveni kada ste ljuti; odreene hemikalije su ule u vau krv i
postali ste grozniavi. Vaa temperatura raste. Telo je spremno da se bori ili preduzme borbu:
telo je u krizi, u vanrednom stanju. Kroz ritam disanja ova promena nastaje.
Ne menjajte disanje. Upravo ga zadrite kao da ste smireni, samo disanje mora da
sledi obrazac smirenosti - i osetiete da je nemogue da postanete ljuti. Samo pokuajte da
budete smireni u disanju, i osetiete da seks iezava.
Ovde on predlae metodu:
Um takoe postaje smiren naizmeninim izdisanjem i zadravanjem daha.
Moete uraditi dve stvari; kad god osetite da um nije smiren - da je napet, zabrinut,
brbljajui, uznemiren, konstantno sanjiv - uradite jednu stvar: prvo duboko izdahnite. Uvek
zaponite sa izdisanjem. Izdahnite duboko, onoliko koliko moete, izbacite sav vazduh van.
Sa izbacivanjem vazduha to raspoloenje e biti izbaeno van, jer disanje je sve.
A kada izdahnite koliko je mogue, uvucite stomak unutra i zadrite za nekoliko
sekundi - ne udiite. Tada pustite telo da samo udahne. Udahnite duboko - onoliko koliko
moete. Opet stanite za nekoliko sekundi sa punim pluima. Ali vazduh mora kompletno biti
izbaen napolje. Izdahnite potpuno i udahnite potpuno; u istom ritmu. Ako ste zadrali vazduh
tri sekunde, onda i bez vazduha treba da budete tri sekunde. Zadrite udahnuti dah unutra,
zadrite izdahnuti dah. Odmah ete osetiti promenu koja nastupa u vaem telu. Raspoloenje
je nestalo. Nova klima je ula u vas.
ta se deava? Zato je to tako? Iz mnogo razloga, od kojih je jedan taj da kada
zaponete stvarati ovo disanje, va um je potpuno odvraen. Vi ne moete biti ljuti, jer je
zapoela nova stvar, um ne moe imati dve stvari zajedno. Va um je sada ispunjen
izdisanjem, udisanjem, zaustavljanjem, stvaranjem ritma. Vi ste potpuno apsorbovani u tome,
saradnja sa ljutnjom je prekinuta; to je jedna stvar.
212

Ovo izdisanje i udisanje isti celo telo. Kada izdahnete i zadrite (bez daha) za tri
sekunde, ili pet sekundi - onoliko koliko elite, onoliko koliko moete - ta se iznutra deava?
Celo telo izbacuje u krv sve to je otrovno. Vazduh je izvan, a telo zadobija prazninu. U toj
praznini svi otrovi se izbacuju napolje. Oni dolaze do srca, akumuliraju se tamo - otrovni
gasovi, azot, ugljen dioksid, svi se zajedno tamo sakupljaju.
Ne dajte im priliku da se sakupljaju zajedno. Nastavite da udiete i izdiete. Nema
praznine, nema pauze. U toj pauzi, rascep se stvara, neka praznina. U toj praznini, sve tee i
ispunjava je. Dakle, uzmete duboki udah, a onda zaustavite (dah). Svi ovi otrovni gasovi s
disanjem postaju pomeani; onda opet izdahnete i izbacite ih van. Opet pauza. Pustite da se
otrovi sakupe. To je nain izbacivanja stvari napolje.
Um i disanje su veoma povezani - moraju biti, jer disanje je ivot. ovek moe
postojati bez uma, ali ne moe postojati bez disanja. Disanje je dublje nego um. Va mozak
moe biti kompletno operisan; biete ivi ako moete disati. Ako se disanje nastavi, vi ete
biti ivi. Mozak moe biti sasvim izvaen napolje. Vi ete vegetirati, ali ete biti ivi. Neete
moi da otvorite oi i govorite, da inite ita, ali na krevetu moete biti ivi, vegetirajui za
mnogo godina. Ali um ne moe opstati; ako se disanje zaustavi, um iezava.
Vi ste otkrili ovu osnovnu stvar - da je disanje dublje od miljenja. Ako promenite
disanje moete promeniti miljenje. Jednom kada znate klju, da disanje ima klju, moete
kreirati svaku klimu koju elite; to zavisi od vas. Nain disanja zavisi od vas. Vi samo radite
jednu stvar; za sedam dana, samo nainite zabeleke o razliitim tipovima disanja koji se
deavaju s razliitim raspoloenjima. Vi ste ljuti; uzmite belenicu i evidentirajte disanje - za
koliko udiete i za koliko izdiete. Brojei do pet vi udiete, brojei do tri izdiete - zabeleite
to.
Ponekad se oseate vrlo, vrlo lepo - zapiite to, onda koja je proporcija udisanja i
izdisanja, koja je duina, ima li ikakve pauze - zabeleite to. Za sedam dana nainite svoj
dnevnik da biste osetili svoje vlastito disanje, kako je povezano s vaim raspoloenjima. Onda
ga moete probati. Kad god elite odbaciti raspoloenje, samo koristite suprotan obrazac. Ili,
naravno, ako elite da donesete odreeno raspoloenje, samo koristite odreeni obrazac.
Glumci svesno ili nesvesno dolaze do toga jer ponekad moraju biti ljuti a da nisu ljuti.
ta e oni stoga uiniti? Morae da kreiraju obrazac disanja. Moda nee biti svesni, ali e
zapoeti da diu kao da su ljuti, ubrzo krv jurne unutra i otrovi su osloboeni. Iako bez ljutnje
njihove oi su crvene, oni su u suptilnom stanju ljutnje bez da su ljuti. Oni moraju iskazivati
ili voditi ljubav a da nisu u ljubavi, moraju pokazivati ljubav a da nisu zaljubljeni. Kako to
rade? Oni znaju odreenu tajnu joge.
Zbog toga ja uvek kaem da jogin moe postati najsavreniji glumac. On to i jeste!
Njegova predstava je iroka, to je sve. On deluje, glumi - ne glumi na podijumu pozorita, ve
na pozornici sveta. On je samo glumac, nije pravi inilac. Razlika je to uzima uee u
velikoj drami, a moe ostati svedok toga i moe ostati udaljen i izdvojen.
Kada meditacija proizvodi izuzetne ulne percepcije, um stie poverenje a ovo pomae
istrajnosti.
Ako odradite svoj obrazac disanja, i otkrijete tajne kljueve kako da promenite klimu
uma, kako da promenite raspoloenja... I ako delujete s oba pola, to e biti bolje. Pokuajte da
budete prijateljski prema srenom, ravnoduni prema zlom, i takoe da menjate i
preobraavate obrazac svog disanja. Onda e biti neobian oseaj opaanja.
Ako ste uzeli LSD, marihuanu, hai onda se deava neobian oseaj percepcije. Vi
gledate obine stvari, a one postaju neobine, retke. Haksli (Aldous Nuxley) se sea da kada
je prvi put uzeo LSD sedeo je pred jednom obinom stolicom, a kada je bio sve dublje i
dublje sa drogom, kada je bio u tome ukljuen, stolica je odmah poela da menja boju. Postala
je blistava; jedna obina stolica - on nije nikada posveivao njoj nikakvu panju - postala je
tako lepa, iz nje su izlazile mnoge boje, kao da je bila nainjena od dijamanata. Takvi lepi
oblici i nijanse da nije mogao poverovati svojim oima ta se deava. Docnije se priseao da
se to moda dogodilo Van Gogu, poto je on gotovo sasvim isto naslikao stolicu.
213

Pesniku nije potrebno da koristi LSD. On ima jedan unutra ugraen sistem ubacivanja
LSD u telo. To je razlika izmeu pesnika i obinog oveka. Zbog toga oni kau da se pesnik
raa, a ne stvara se; jer on ima izuzetnu telesnu strukturu. Hemikalije u njegovom telu imaju
razliit kvantitet i kvalitet za njih. Zbog toga gde vi ne vidite nita on vidi uda. Vi vidite
obino drvo, a on vidi neto neverovatno. Vi vidite obine oblake; a pesnik, ako je zaista
pesnik, nikada ne vidi nita obino; sve je izuzetno lepo.
Isto se dogaa joginu; jer kada promenite svoje disanje i dranje, vaa telesna hemija
menja svoj obrazac, prolazite kroz hemijsku transformaciju, a onda vae oko postaje jasno,
nova mo opaanja se deava. Isto staro drvo postaje apsolutno novo. Nikada niste upoznali
senku njegovog zelenila; postala je sjajna. itav svet svuda oko vas uzeo je nov oblik. Sada je
to raj - nije obina stara kvarna zemlja.
Ljudi oko vas vie nisu isti. Vaa obina ena postaje najlepa ena. Sve se menja s
jasnoom vae percepcije. Kada se vae oi promene, sve se menja. Patanjali kae:
Kada meditacija proizvodi izuzetne ulne percepcije, um stie poverenje a ovo pomae
istrajnosti.
Onda postajete sigurni da ste na pravom putu. Svet postaje sve lepi i lepi, a runoa
iezava. Sve postaje sve vie i vie harmonija; nesloga iezava. Svet postaje sve vie i vie
dom, oseate se sve vie i vie lagodno u njemu. On je prijateljski. To je ljubavni dogaaj
izmeu vas i univerzuma. Stiete sve vie poverenja, i vie istrajnosti ima u vaem pregnuu.
Takoe meditirajte na unutranju svetlost koja je uzviena, izvan svakog bola.
Ovo se moe uraditi samo kada ste zadobili odreen kvalitet moi opaanja. Onda
moete zatvoriti oi i nai plamen - lep plamen pokraj srca, plavu svetlost. Ali odmah sada je
ne moete videti. Ona je tu, uvek je bila tu. Kada umrete, odlazi napolje iz vaeg tela. Ali ne
moete je videti jer kada ste bili ivi niste mogli da je vidite.
A drugi takoe to nee moi da vide, da neto izlazi van; ali je Kirlian iz Sovjetske
Rusije nainio fotografije sa vrlo osetljivim filmovima. Kada osoba umire neto se okolo
deava. Neka telesna energija, neka stvar slina svetlosti, naputa, odlazi i iezava u
kosmosu. Ta svetlost je uvek tu; to je sredite vaeg bia. Ona je pored srca - sa plavim
plamenom.
Kada imate istu percepciju, moete videti lep svet, svet svuda oko vas - kada su vae
oi jasne. Zatvorite ih i premestite se blie srcu; pokuajte da naete ta je tamo. Prvo ete
osetiti tamu. To je upravo kao da ste toplog sunanog dana uli spolja u sobu, i osetite da je
sve tamno. Ali saekajte, da oi budu usklaene s tamom, i ubrzo ete poeti da vidite stvari u
kui. Vi ste bili napolju milionima ivota. Kada po prvi put uete unutra, niega nema izuzev
tame, praznine. Ali priekajte, potrajae nekoliko dana - ak i nekoliko meseci, ali samo
priekajte, zatvorite oi i gledajte dole u srce. Iznenada, jednog dana to se dogodi; vidite
svetlost, plamen. Onda se usredsredite na plamen.
Nita nije blaenije od toga. Nita nije razigranije, raspevanije, muzikalnije,
harmoninije od te prave unutarnje svetlost u vaem srcu. A to se vie usredsreujete, vie
postajete smireni, tihi, hladnokrvni, sabrani. Onda za vas nema tame. Kada je vae srce
ispunjeno svetlou, itav univerzum je ispunjen svetlou.
Takoe meditirajte na unutranju svetlost koja je uzviena, izvan svakog bola.
Takoe, meditirajte na onome ko je postigao beeljnost.
Taj alat, sve alternative, daje vam Patanjali. Vitarga, onaj ko je otiao izvan svih
elja - takoe meditirajte na njemu. Mahavira, Buda, Patanjali - vai oboavani - Zaratustra,
Muhamed, Hrist ili bilo ko, prema kome oseate naklonost i ljubav... Meditirajte na onome ko
je otiao izvan elja. Meditirajte na vaem uitelju, na vaem guruu, koji je otiao izvan elja.
Kako e to pomoi? To pomae jer kada meditirate na nekome ko je otiao s one strane elja,
214

on u vama postaje magnetska sila. Dozvoljavate mu da ue u vas; on vas izvlai iz vas samih.
Ovo postaje vaa dostupnost, raspoloivost za njega.
Ako meditirate na nekome ko je otiao izvan elja, postaete pre ili kasnije kao on, jer
meditacija vas ini slinim samom objektu meditacije. Ako meditirate na novcu, postaete isti
kao novac. Idite i pogledajte u tvrdicu; on vie nema duu. On ima samo bankovni bilans;
nema nita unutra. Ako sluate uete samo primedbe, rupiji; tamo neete nai nikakvo srce.
emu god posvetite svoju panju, postajete slini tome. Dakle budite svesni. Ne posveujte
panju neemu to ne biste eleli da postanete, jer je to poetak. Seme se sadi s panjom, i
ubrzo e ono postati drvo.
Vi sadite seme pakla, a kada ono postane drvo kaete: "Zato sam tako bedan?" Uvek
posveujete panju pogrenom; uvek gledate u ono to je negativno. Uvek poklanjate panju
mani; onda postajete manjkavi.
Ne poklanjajte panju mani, nedostatku. Posvetite panju lepom. Zato brojati trnje.
Zato ne gledati cvet? Zato ceniti trnje? Zato ceniti noi? Zato ne ceniti dane? Ako brojite i
cenite noi, onda ima dve noi a samo jedan dan izmeu njih. Ako brojite dane, onda su dva
dana a samo jedna no izmeu. A to ini veliku razliku. Gledajte u svetlu stranu ako elite da
postanete svetlost; gledajte u mrak ako elite da postanete tama.
Patanjali kae:
Takoe, meditirajte na onome ko je postigao beeljnost.
Traite majstora, predajte se majstoru. Budite predusretljivi prema njemu. Sluajte,
posmatrajte, jedite i pijte njega. Pustite ga da ue u vas; dozvolite svom srcu da bude
ispunjeno s njim. Ubrzo ete biti na putovanju, jer objekat panje na kraju postaje cilj vaeg
ivota. A ljubaznost, paljivost je tajna uzajamnog odnosa. Kroz paljivost vi postajete
objekat svoje panje.
Krinamurti nastavlja da govori: Posmatra postaje posmatrano." On je u pravu: ta
god posmatrate, vi ete postati. Stoga budite budni, uvajte se, ne posmatrajte neto to ne
biste eleli da postanete, jer to je va cilj; vi sejete seme.
ivite pokraj vitarge - pored oveka koji je izvan elja. ivite pored oveka koji nema
nita da ostvaruje ovde, koji je ostvaren. Sama njegova ostvarenost e vas preplaviti, i on e
postati katalizator.
On nee raditi nita, jer ovek koji je iznad elja ne moe raditi nita. ak vam ne
moe ni pomoi jer pomo je takoe elja. Mnogo pomoi dolazi kroz njega, ali vam on ne
pomae. On postaje katalizator ne inei nita, ako mu dopustite; on se sputa u vae srce i
samo njegovo prisustvo vas kristalie.

215

Poglavlje 10

ALFA JE OMEGA
Izlaganje 10. januara 1975. u Buddha dvorani.
Prvo pitanje:
Da li pozitivne misli donose sreu, kao, na primer, elja za prosvetljenjem?
To je preveliko traenje od pozitivnih misli jer prosvetljenje je izvan dualnosti; ono
nije ni negativno niti pozitivno. Kada se oba polariteta napuste, ono se deava. S pozitivnim
mislima mnoge stvari su mogue - ne prosvetljenje.
Moete biti sreni, ali ne blaeni. Srea dolazi i odlazi; suprotno uvek postoji s njom.
Kada ste sreni, upravo pored sree nesrea eka svoje vlastito vreme. Po pravilu eka na red.
Kada ste ljubazni ili puni ljubavi, to je pozitivno; mrnja eka svoje vlastito vreme.
Pozitivno ne moe otii izvan dualnosti. To je dobro sve dotle dok ide, ali previe je
traiti prosvetljenje od toga. Nikada ne oekujte to. Negativno mora da bude ostavljeno da bi
se dostiglo pozitivno. Pozitivno mora takoe da bude ostavljeno da bi postiglo ono izvan.
Prvo ostavite negativno, onda odbacite pozitivno; tada nita ne preostaje. To nepostojanje je
prosvetljenje; onda vie ne postoji um.
Um je ili pozitivan ili negativan; srean ili nesrean; ljubazan ili gnusan; ljut ili
saoseajan; dan i no; roenje i smrt - sve pripada umu. Ali vi ne pripadate umu. Vi ste izvan
njega - okrueni ste umom, ali izvan njega.
Prosvetljenje ne nastaje od uma. Ono nastaje od vas. Realizacija da "ja nisam um"
jeste prosvetljenje. Ako ostajete negativni, ostajete u delu doline uma. Ako ste pozitivni vi
dostiete deo vrha uma. Ali nijedno ne transcendira mentalnu ravan vaeg bia, sam um;
odbacite oboje.
Teko je ostaviti pozitivno. Lako je odbaciti negativno jer negativno vam daje patnju.
To je pakao; vi to moete ostaviti. Ali pogledajte u nesreu; niste ak ni nju ostavili. Prianjate
uz negativno takoe. vrsto se drite uz bedu kao da je blago. Lepite se uz nesreu samo zato
jer je postala stara navika, a vama treba neto da se priveete. Ne nalazei nita, vi se drite
vaeg pakla. Ali zapamtite, da se ostavi negativno lako je, ma koliko da izgleda teko. U
poreenju s pozitivnim to je vrlo lako, jer je to patnja.
Da se ostavi pozitivno znai da se odbaci srea; da se odbaci pozitivno znai da se
odbaci sve to izgleda kao cvee, sve to je lepo. Negativno je runo, pozitivno je lepo.
Negativno je smrt, pozitivno je ivot. Ali ako moete ostaviti negativno... dakle nainite prvi
korak. Prvo osetite patnju, koliko patnje vam je dalo negativno. Samo posmatrajte kako patnja
nastaje iz toga; posmatrajte samo i oseajte. Samo oseanje da negativno stvara patnju postae
odbacivanje.
Ali um ima vrlo lukav trik. Kad god patite, uvek kae da je neko drugi odgovoran.
Budite oprezni, jer ako ste rtva ovog trika onda negativno se nikada ne moe odbaciti. Na taj
nain negativno sebe skriva. Vi ste ljuti. Um kae neko vas je uvredio i zbog toga ste ljuti - to
nije ispravno. Neko vas je moda uvredio, ali to je samo jedan izgovor. Vi ve oekujete da
budete ljuti. Ljutnja se akumulirala u vama, inae neko bi bio uvreen - ne bi bilo ljutnje.
Uvreda moe da postane vidljivi uzrok toga, ali to stvarno nije uzrok. Vi kljuate
unutra. Zapravo, osoba koja vas grdi pomae vam. Pomae vam da iznesete svoj nemir van i
da se okona s tim. Vi ste u tako looj formi da vam ak i uvreda pomae. Neprijatelj vam
pomae jer pomae da iznesete sve negativnosti van. Barem ste rastereeni za sada.
Um uvek ima ovaj trik da skrene vau svest prema drugom. im neto ide pogreno vi
zapoinjete da traite ko je to uradio. U tom traenju ne uspevate, a stvarni krivac se skriva u
pozadini.
Nainite to apsolutnim zakonom da kad god je neto pogreno, odmah zatvorite oi i
potraite pravog krivca. A moi ete to da vidite jer je to istina. To je realnost. Istina je da vi
216

akumulirate ljutnju; zbog toga postajete srditi. Istina je da vi akumulirate mrnju; zbog toga
oseate neprijateljstvo. Drugi nije pravi uzrok. Na sanskritu oni imaju dva izraza. Jedan izraz
je karan - pravi uzrok, a drugi izraz je nimitta - nestvarni uzrok. A nimitta, nestvarni uzrok
koji izgleda kao uzrok, ali nije uzrok, obmanjuje vas. Obmanjivao vas je za mnogo, mnogo
ivota.
Odmah zatvorite oi i idite gde god oseate da se neto jadno deava, jer to je pravi
momenat da uhvatite krivca na samom delu. Inae neete moi da ga uhvatite. Kada ljutnja
iezne, vi ete zatvoriti svoje oi. Niega neete nai tamo. U uarenoj, plahovitoj situaciji,
ne propustite glavnu stvar. Nainite to meditacijom.
Ako ponete oseati da nije potrebna nikakva metoda za odbacivanje negativnog...
Negativno je tako gadno, to je takva bolest - neverovatno je kako to nosite. Odbacivanje nije
nita; noenje je zapanjujue. To je zbunilo sve Bude - kako nosite i zato nosite sve svoje
bolesti tako ljubazno? Tako ste paljivi s njima; titite sve to je pogreno. Zatiene, putaju
sve dublje i dublje korenje u vama.
Shvativi jednom da je to moja vlastita negativnost koja stvara problem, to otpada
samo od sebe. A onda ima lepote, kada negativan um otpadne sam od sebe. Ako pokuavate
da ga odbacite, on e prianjati; jer sam napor da se to odbaci pokazuje da vae razumevanje
nije sazrelo. Svako odricanje je nezrelost; niste zreli za to. Zbog toga je potreban napor da se
to odbaci. Ja nosim smee; treba li mi ikakav napor da ga odbacim, izuzev razumevanja da je
to smee? Ako mi treba neki napor da to odbacim, to znai da dodajem mom razumevanju
napor. Samo razumevanje nije dovoljno - zbog toga je potreban napor.
Svi oni koji su znali kau da je napor potreban jer vi nemate razumevanje. To moe
biti neko intelektualno znanje, ali zaista niste osetili situaciju, inae jednostavno biste je
odbacili. Ako zmija gmie stazom, vi jednostavno skoite. Nema napora u skoku. Vi ne
odluujete da skoite; ne stvarate u sebi logian zakljuak: "Evo zmije, a kad god ima zmije
postoji opasnost; stoga moram skoiti." Vi ne stvarate logian zakljuak korak po korak. ak i
Aristotel bi skoio. Kasnije on moe nainiti logian zakljuak, ali ba sada, kada je tu zmija,
zmija ne mari za vau logiku, a itava situacija je tako opasna... samo razumevanje te situacije
dovoljno je opasno.
Da se odbaci negativno nije potreban napor - samo razumevanje. Onda se javlja pravi
problem; kako odbaciti pozitivno - jer je tako lepo. A za vas koji niste upoznali onostrano,
transcendenciju, to je najvia srea - tako ste sreni. Pogledajte par u ljubavi; pogledajte u
njihove oi, nain na koji hodaju s rukom u ruci; oni su sreni. Recite im da odbace taj
pozitivan um, i oni e pomisliti: "jeste li ludi?" Oni su to ekali i sada se to dogodilo. A onda
doe Buddha i kae: "Ostavite to."
Kada neko uspeva da postie sve vie i vie na lestvici uspeha, recite mu da odbaci to.
U njegovim oima to je jedina njegova svrha. ak i ako pomisli da ostavi to, zna da e pasti u
nevolju.
Jer gde ete se kretati od pozitivnog - znate samo dve mogunosti: pozitivnu ili
negativnu. Ako odbacite pozitivno, kreete se prema negativnom. Zbog toga negativno mora
biti ostavljeno prvo, tako da nema niega da se kree prema negativnom. Inae, ako odbacite
pozitivno, odmah negativno ulazi. Ako niste sreni, onda kakvi ete biti - nesreni? Ako niste
smireni, kakvi ete biti - brbljivi? Stoga, odbacite negativno prvo, tako je alternativa
zatvorena - ne moete se kretati tim putem. Inae energija ima uobiajeni tok kretanja od
pozitivnog prema negativnom, od negativnog prema pozitivnom. Ako postoji negativno, onda
postoji svaka mogunost da onog momenta kada odbacite pozitivno vi postanete negativni.
Kada niste sreni, biete nesreni. Vi ne znate da takoe postoji i trea mogunost.
Trea mogunost se samo otvara kada je negativno ostavljeno, a onda odbaeno i pozitivno.
Za momenat e biti zastoj. Energija se ne moe kretati nigde, ne znajui gde da se kree.
Negativna vrata su zatvorena, pozitivna su zatvorena. Vi ete biti za momenat... a taj
momenat e izgledati kao venost. Izgledae vrlo, vrlo dug - bez kraja.
Za momenat vi ete biti ba u sredini, ne znajui ta da radite, gde da idete. Ovaj
momenat e izgledati kao ludilo. Niste ni pozitivni niti negativni, onda gde ste? Kakav je va
identitet? Va identitet, reputacija i forma odbacuju se s pozitivnim i negativnim. Iznenada
217

niste niko koga moete prepoznati - samo energija, fenomen. I ne moete rei kako se oseate.
Nema oseanja. Ako to moete tolerisati, podneti ovaj momenat, to je najvee rtvovanje,
najvea tapascharya, a itava joga vas priprema za taj momenat. Inae tendencija e biti da
odete negde, ali nemojte ostati u ovom vakumu. Budite pozitivni, budite negativni, ali ne
ostajte o ovom vakumu. Vi ste nita, kao da iezavate. Ambis se otvorio, a vi padate u njega.
U tom momentu potreban je majstor koji e rei: "ekaj! Ne plai se, ja sam ovde." To
je samo la, ali vam je potrebna. Nikoga nema. ak ni majstor ne moe biti tu jer majstor
nestaje kada se va um okona. Sada ste apsolutno sami, ali da se bude sam tako je strano,
tako slino smrti, da je potreban neko ko e vam uliti hrabrost. Jer je to pitanje samo jednog
momenta i la pomae.
A ja u vam rei, sve Bude su bili laovi upravo zbog saoseanja prema vama. Majstor
kae: "Ja sam ovde. Ne brini; idi napred." Vi zadobijate poverenje, nainite skok. U pitanju je
samo momenat, i sve zavisi od toga. itava egzistencija zavisi od toga; taka ukrtanja, taka
kljuanja. Ako nainite korak, zauvek ste izgubljeni za um. Nee biti pozitivnog, nema opet
negativnog.
Moete biti zaplaeni. Moete se vratiti natrag i ui u negativno ili u pozitivno koje je
prijatno, udobno, blisko. Vi ste ulazili u nepoznato; to je problem. Prvo problem je kako
odbaciti negativno - nuno je zrelo razumevanje - a koje je najlake, a vi niste uinili ak ni
to.
Onda je problem kako ostaviti pozitivno koje je tako lepo i prua vam takvu sreu. Ali
ako odbacite negativno, ako postanete toliko zreli, imaete drugo razumevanje, drugi
preobraaj, u kome se moe uvideti da ako ne odbacite pozitivno, negativno e se vratiti
natrag.
Pozitivno onda gubi svu svoju pozitivnost. Bilo je pozitivno samo u poreenju s
negativnim. Jednom kada se negativno odbaci, ak i pozitivno postaje negativno jer sada
moete videti da je sva srea trenutna. A kada se taj trenutak izgubi, gde ete biti? Negativno
e ui opet.
Pre nego to negativno ue, odbacite ga. Pakao uvek dolazi kroz nebo ili raj. Nebo je
samo kapija; pakao je stvarnost iza nje. Kroz nebo i obeanje raja vi ulazite u pakao. Pakao je
stvarno mesto; nebo je samo kapija. Pre ili kasnije - kako moete zauvek ostati na kapiji?
Morate ui. Gde ete otii od pozitivnog?
Jednom kada se negativno ostavi, moete videti da je pozitivno samo drugi aspekt
negativnog - nije zaista suprotan, nije protivan, ve zavera. Oni su oboje u zaveri; oni su
zajedno. Kada doe do ovog razumevanja, pozitivno postaje negativno, vi to moete odbaciti.
Zapravo, nije dobro da se kae da vi to moete ostaviti. To se takoe odbacuje. To je
takoe postalo negativno. Onda vi znate da u ovom ivotu nema niega slinog srei. Srea je
trik nesree, da bi takoe ula unutra. To je isto kao odnos jajeta i kokoke. ta je koka? To
je put jajeta da se vrati natrag. A ta je jaje? To je put kokoke da se vrati natrag.
Pozitivno i negativno nisu prave suprotnosti. Oni su kao kokoka i jaje, majka i dete.
Oni pomau jedno drugo i dolaze jedno od drugog. Ali ovo razumevanje je mogue samo
kada se negativno odbaci. Onda odbacujete pozitivno takoe. Tada moete ostati u tom
prolaznom momentu, koji je najvei trenutak u egzistenciji. Nikada neete oseati da je drugi
trenutak tako dug - kao da prolaze godine, jer vakuum... Vi gubite svaku vezu, itava prolost
i budunost iznenada se prazne, ne znajui gde ste, ni ta se dogaa.
Ovo je trenutak ludosti. Ako pokuate da se vratite iz ovog trenutka, ostaete uvek
ludi. Mnogi ljudi polude kroz meditaciju. Od tog momenta oni padaju natrag, a sada ne
postoji nita u ta bi se nazad palo jer negativno i pozitivno su odbaeni. Oni vie ne postoje;
kua vie nije tu. Jednom kada ostavite kuu ona iezava. To zavisi od vas; to nije odvojen
entitet.
Um nije odvojen entitet. On zavisi od vas. Jednom kada ga ostavite, vie nije tu. Ne
moete se vratiti natrag, pasti nazad na to. To je stanje ludosti. Niste postigli transcendentno, a
vratili ste se natrag i traite um - on vie nije tu; kua je iezla.
Da se bude u tom stanju jeste vrlo, vrlo bolno. Prava patnja se po prvi put deava.
Otuda, majstor - potreba za majstorem, koji vam nee dozvoliti da se vratite natrag, ko e vas
218

prisiliti da idete napred, jer jednom kada se okrenete natrag, ko e vas prinuditi da idete
napred, jer kada se jednom okrenete natrag bie potreban veliki napor da se opet vratite na to
mesto. Moda ete propustiti to za mnogo ivota jer sada nema uma da bi to ak razumeo.
U sufizmu to stanje se naziva stanje masti - stanje ludog oveka, boanskog ludaka. To
stanje je zaista teko razumeti jer ovek jeste i nije - oboje. On se i smeje i plae, izgubio je
svaku orijentaciju. Ne zna ta je plakanje, a ta je smejanje. Imali li u tome ikakve
kontradikcije? On udara sebe i uiva, slavi udarajui sebe. On ne zna ta radi, da li je to tetno
ili nije. Postaje potpuno zavisan, postaje kao malo dete; o njemu se mora starati.
Ako neko ue u meditaciju bez majstora, rezultat moe da bude takav. S majstorem,
majstor e biti barijera. On e stajati iza vas i nee vam dopustiti da idete natrag. On e postati
stena. I ne nalazei nain da idete natrag, moraete da skoite. Niko ne moe to preduzeti za
vas. Niko u tom momentu ne moe biti s vama. Ali jednom kada nainite taj skok morate
transcendirati sve dualnosti. Negativno, pozitivno, oboje nestaju - a to je prosvetljenje.
Ja govorim o pozitivnom tako da moete odbaciti negativno. Jednom kada ostavite
negativno vi ste uhvaeni u klopku. Onda pozitivno mora da bude odbaeno. Svaki korak
dovodi do drugog, na takav nain da, ako nainite prvi korak, drugi e nuno doi. To je
lanac. Zapravo, samo prvi treba preduzeti. Onda sve drugo sledi. Prvi je poslednji, ako
razumete. Poetak je kraj, alfa je omega.
Drugo pitanje:
Molimo vas opiite razvojni jaz izmeu oveka sa duhovnim iskustvom koji je ve
dostigao odreen stepen vie svesti, ak i odreene psihike vetine i sposobnosti, i potpuno
razvijenog bia - ivog Buddhe.
Ovo je razlika: ovek koji je postao apsolutno pozitivan jeste ovek duhovnog
postignua. Osoba koja je postala apsolutno negativna... Kada ja kaem apsolutno negativna,
mislim devedeset devet posto negativna, jer apsolutna negativnost nije mogua. Nije mogua
ni apsolutna pozitivnost. Drugo je potrebno. Kvantitet moe da se promeni; stepeni se
razlikuju.
ovek koji je devedeset devet posto negativan, a jedan posto pozitivan jeste najnii
ovek, koga hriani nazivaju grenikom - pozitivnim jedan posto! To je potrebno samo da
pomogne njegovih devedeset devet posto negativnosti. Ali u svemu negativnom, ta god da vi
kaete, samo 'ne' je odgovor. ta god da trai egzistencija, odgovor je samo 'ne'. Ateista koji
niemu ne moe rei 'da', koji je postao nesposoban da kae 'da', koji ne moe verovati - taj
ovek pati u paklu. Zato to on kae svemu 'ne', on postaje 'ne', zevajue 'ne'; ljutnja, nasilje,
uguivanje i ugnjetavanje, alost, sve skupa - on postaje personifikovani pakao.
Teko je nai takvog oveka, jer teko je biti takav ovek. Da se ivi u devedeset devet
posto pakla vrlo je teko. Meutim, govorim vam ovo, samo da bih vam objasnio. Ovo je
matematika mogunost. ovek to moe postati ako pokua. Takvog oveka neete nigde
nai. ak ni Hitler nije tako destruktivan. itava energija postaje destruktivna - ne samo za
druge, ve takoe i za sebe. itavo dranje je samoubilako. Kada osoba poini samoubistvo,
ta kae? Kae 'ne' celom ivotu kroz svoju smrt. Ona kae 'ne' Bogu, ovako: "Ti me ne
moe stvoriti. Ja u unititi sebe."
Sartr, jedan od najveih mislilaca ovog veka, kae da je samoubistvo jedina sloboda sloboda od Boga. Zato osloboenje od Boga? Jer ne postoji sloboda. Nemate nikakvu
slobodu da stvarate sebe. Gde god da ste, vi nalazite da ste ve stvoreni. Roenje vi ne moete
preuzeti; to nije vaa sloboda. Sartr kae da ako smrt sami moete odrediti, u tome je vaa
sloboda. Time definitivno moete rei jednu stvar Bogu: "ja sam slobodan". Takav ovek koji
uvek ivi pored ambisa samoubistva jeste zadnji, najvei grenik.
U egzistencijalizmu koji propoveda Sartr, ove rei su postale vrlo znaajne - muka,
dosada, alost. One su morale postati znaajne, jer ovaj ovek e iveti u muci, dosadi. Jedan
posto pozitivnog je potrebno. On e rei 'da' dosadi, samoubistvu, muci, samo tek toliko da
ima potrebu da kae 'da'. Ovo je moderan ovek koji se pribliava sve blie i blie poslednjoj
obali. Na drugom vrhu stoji duhovni ovek. Ovo je grenik, pali ovek. Na drugom vrhu 219

devedeset devet procenata pozitivnom, jedan posto negativnom - je duhovni ovek. On kae
'da' svemu. On ima samo jedno 'ne' a to je protiv samog 'ne', to je sve. Inae on je 'da'. Ali zato
to totalno 'da' ne moe postojati, on ima potrebu i da kae 'ne'.
Ovaj ovek postie mnoge stvari jer pozitivan um vam moe dati milione stvari; ovaj
ovek e biti srean, smi