You are on page 1of 23

BAB I

PENDAHULUAN

Katarak berasal dari bahasa Yunani (Katarrhakies), Inggris (Cataract), dan
Latin (Cataracta) yang berarti air terjun.Dalam bahasa Indonesia disebut bular
dimana penglihatan seperti tertutup air terjun akibat lensa yang keruh.Katarak
ialah setiap kekeruhan pada lensa yang dapat terjadi akibat hidrasi (penambahan
cairan lensa) lensa, denaturasi protein lensa atau akibat kedua-duanya (Ilyas,
2005).
Katarak kerap disebut-sebut sebagai penyebab kebutaan nomor satu di
Indonesia.Bahkan,mengacu pada data World Health Organization, sebagaimana
dipublikasikan dalam situs www.who.int,katarak menyumbang sekitar
48% kasus kebutaan di dunia (Widyaningtyas, 2009).
Menurut WHO dinegara berkembang 1-3% penduduk mengalami
kebutaaan dan 50% penyebabnya adalah katarak. Sedangakan untuk negara maju
sekitar 1,2% penyebab kebutaan adalah katarak.Menurut survei Depkes RI tahun
1982 pada 8
Propinsi, prevalensi kebutaan bilateral adalah 1,2% dari seluruh penduduk,
sedangkan prevalensi kebutaan unilateral adalah 2,1%dari seluruh penduduk
(Ilham, 2009).

1

BAB II
TINJAUANPUSTAKA

A. Definisi
Katarak termasuk golongan kebutaan yang tidak dapat dicegah tetapi dapat
disembuhkan. Definisi katarak menurut WHO adalah kekeruhan yang terjadi pada
lensa mata, yang menghalangi sinar masuk kedalam mata.Katarak terjadi karena
faktor usia,namun juga dapat terjadi pada anak-anak yang lahir dengan kondisi
tersebut. Katarak juga dapat terjadi setelah trauma, inflamasi atau penyakit
lainnya.
Katarak senilis adalah semua kekeruhan lensa yang terdapat pada usia
lanjut, yaitu usia diatas 50 tahun(Ilyas, 2005).
B. Anatomi Lensa
Lensa berbentuk bikonveks dan transparan.Lensa menyumbang kekuatan
refraksi sebanyak 15-20 dioptri dalam penglihatan.Kutub anterior dan posterior
lensa dihubungkan oleh garis khayal yang disebut axis,sedangkan equator
merupakan garis khayal yang mengelilingi lensa.Lensa merupakan struktur yang
tidak memiliki pembuluh darah dan tidak memiliki pembuluh limfe.Didalam
mata,lensa terfiksir pada serat zonula yang berasal dari badan silier.Serat zonula
tersebut menempel dan

2

Nukleus dan Korteks Sel-sel berubah menjadi serat.Kapsul ini mengandung isi lensa serta mempertahankan bentuk lensa pada saat akomodasi. korteks danepitel lensa.Serat Zonula Lensa terfiksir oleh serat zonula yang berasal dari lamina basal pars plana dan pars plikata badan silier. 1. Sel-sel tersebut juga dapat membentuk ATP untuk memenuhi kebutuhan energi lensa. 2. Sel-sel epitel ini dapat melakukan aktivitas seperti yang dilakukan sel-sel lainnya.RNA.Serat-serat 3 . Serat-serat zonula ini menyatu dengan lensa pada bagian anterior dan posterior kapsul lensa. 3.protein dan lipid.Epitel Lensa Tepat dibelakang kapsul anterior lensa terdapat satu lapis sel-sel epitel. seperti sintesis DNA.menyatu dengan lensa pada bagian anterior dan posterior dari kapsul lensa.Kapsul Kapsul lensa merupakan membran dasar yang elastis dan transparan tersusun dari kolagen tipe IV yang berasal dari sel-sel epitel lensa. Bagian paling tebal kapsul berada di bagian anterior dan posterior zona preequator dan bagian paling tipis berada di bagian tengah kutub posterior. Sel-sel epitel yang baru terbentuk akan menuju equator lalu berdiferensiasi menjadi serat lensa.lalu serat baruakan terbentuk danakan menekan serat-serat lama untuk berkumpul dibagian tengah lensa. 4.Kapsul ini merupakan membran dasar yang melindungi nukleus.

Konsentrasi sodium didalam lensa adalah sekitar 20µM dan potasium sekitar 120µM.Konsentrasi sodium diluar lensa lebih tinggi yaitu sekitar 150µM dan potasium sekitar 5µM. 4 .paling tua yang terbentuk merupakan lensa fetus yang diproduksi pada fase embrionik dan masih menetap hingga sekarang.Namun hanya sisi anterior lensa saja yang terkena aqueoushumor.Serat-serat yang baru akan membentuk korteks dari lensa. 1.sel-sel yang berada ditengah lensa membangun jalur komunikasi terhadap lingkungan luar lensa dengan membangun low-resistance gap junction antarsel. Untuk mempertahankan kejernihannya.dan jumlah ini tidak banyak berubah seiring bertambahnya usia. Fisiologi Lensa Lensa tidak memiliki pembuluh darah maupun sistem saraf.Na .Sekitar 5% dari air didalam lensa berada diruangan ekstrasel.Keseimbangan Elektrolit dan Air Dalam Lensa Lensa normal mengandung 65% air.lensa harus menggunakan aqueous humor sebagai penyedia nutrisi dan sebagai tempat pembuangan produknya. Keseimbangan elektrolit antara lingkungan dalam dan luar lensa sangat tergantung dari permeabilitas membran sel lensa dan aktivitas pompa + sodium. C.Oleh karena itu.

pembentukan protein highmolecular-weight dan aktivasi protease destruktif.Hilangnya keseimbangan kalsium ini dapat menyebabkan depresi metabolisme glukosa. Saat ototsilier berkontraksi. 2.dan terjadi akomodasi. Glukosa memasuki lensa secara difusi terfasilitasi.Saat otot silier relaksasi.Akomodasi terjadi akibat perubahan lensa oleh aksi badan silier terhadap serat-serat zonula.Ketika otot silier berkontraksi.ketebalan axial lensa meningkat. serat zonular menegang. K -ATPase dapat mengakibatkan hilangnya keseimbangan elektrolit dan meningkatnya air didalam lensa. lensa lebih pipih dan kekuatan dioptri menurun. 5 .sedangkan diluar lensa adalah sekitar 2µM.serat zonular relaksasi mengakibatkan lensa menjadi lebih cembung.Konsentrasi kalsium didalam sel yang normal adalah 30µM.tidak langsung seperti sistem transport aktif.+ + + K -ATPase.AkomodasiLensa Mekanisme yang dilakukan mata untuk merubah fokus dari benda jauh ke benda dekat disebut akomodasi. Transpor membran dan permeabilitas sangat penting untuk kebutuhan nutrisi lensa. Inhibisi Na .Asam aminoaktif masuk ke dalam lensa melalui pompa sodium yang berada disel epitel.Perbedaan konsentrasi kalsium ini diatur sepenuhnya oleh pompa kalsium Ca 2+ -ATPase. Keseimbangan kalsium juga sangat penting bagi lensa.kekuatan dioptri meningkat.Setelah umur 30tahun.kekakuan yang terjadi dinukleus lensa secara klinis mengurangi daya akomodasi.

Obat-obat akomodasi. . · Freeradical dengan molekul normal mengakibatkan degenerasi. sedangkan parasimpatomimetik obat-obat parasimpatolitik (pilokarpin) memicu (atropine) memblok akomodasi.Teori mutasi spontan. Akomodasi Kontraksi Menurun Lebih cembung Meningkat Meningkat Otot silier Ketegangan serat zonular Bentuk lensa Tebal axial lensa Dioptri lensa Tanpa Akomodasi Relaksasi Meningkat Lebih pipih Menurun Menurun Terjadinya akomodasi dipersarafi oleh saraf simpatik cabang nervus III (okulomotorius).Imunologis. Obat-obatan yang menyebabkan relaksasi otot silier disebut cycloplegik.Teori putaran biologik (“A biologic clock”).Tabel 1.Perubahan yang terjadi pada saat akomodasi. . dengan bertambah usia akan bertambah cacat imunologik yang mengakibatkan kerusakan sel. 6 .Terori ”A freeradical” · Freeradical terbentuk bila terjadi reaksi intermediate reaktif kuat. . .Jaringan embrio manusia dapat membelah diri 50kali→ mati. Etiologi danPatofisiologi Penyebab terjadinya katarak senilis hingga saat ini belum diketahui secara pasti. D. Terdapat beberapa teori konsep penuaan menurut Ilyas (2005) sebagai berikut: .

Bengakak danfakuolisasi mitokondriayangnyata 3.Terlihat bahangranular 2.Menebal dan kurangelastis (1/4 dibandinganak) .metionin.Bentuk lamel kapsul berkurangatau kabur . . Perubahan lensapadausialanjutmenurutIlyas (2005): 1. sinar ultraviolet lama kelamaan merubah protein nukleus(histidin.sistein dantirosin)lensa.Sel epitel (germinatif)pada ekuator bertambah besardan berat .Kapsul .Lebih iregular .Serat lensa: . triptofan.Padakorteks jelas kerusakan serat sel . Ahlibiokimiamengatakanterjadipengikatanbersilangasamnukleatdanmolekul protein sehingga mengganggu fungsi.Epitel → makin tipis .Teori “A Cross-link”.Brown sclerotic nucleus. 7 histidindantriptofandibanding .· Freeradicaldapat dinetralisasi oleh antioksidan dan vitaminE.sedang warna cokletproteinlensanukleusmengandung normal.Mulai presbiopia .

2005). Klasifikasi Katarak Senil Katarak senilis secara klinik dikenal dalam empat stadium yaitu insipien.Padakataraksubkapsularposterior.kekeruhanmulaiterlihatanterior 8 . Kekeruhanlensadengannukleusyangmengerasakibatusialanjutbiasanya mulai terjadi padausialebih dari 60 tahun.KatarakInsipien Pada katarak stadium insipien terjadi kekeruhan mulai dari tepi ekuator menujukorteksanteriordanposterior (katarakkortikal)..Korteks tidak berwarnakarena: · Kadarasam askorbat tinggi dan menghalangi fotooksidasi.Perbedaan stadium katarak senilis (Ilyas. E. · Sinartidak banyak mengubah protein padaseratmuda.Vakuolmulaiterlihatdi dalamkorteks. intumesen. imatur. maturdan hipermatur (Ilyas. Kekeruhan Cairan lensa Iris Bilik mata Depan Sudut bilik Mata Iris shadow Test Penyulit Insipien Ringan Normal Normal Imatur Sebagian Bertambah Terdorong Matur Seluruh Normal Normal Hipermatur Masif Berkurang Tremulans Normal Dangkal Normal Dalam Normal Sempit Normal Terbuka Negatif Positif Negatif Pseudopos - Glaukoma - Uveitis + Glaukoma 1. Tabel 2. 2005).

Masuknyaairkedalamcelahlensamengakibatkanlensamenjadibengkak danbesaryang akanmendorong irissehinggabilikmatamenjadidangkaldibanding dengankeadaannormal.Bentukinikadang-kadang menetap untukwaktu yanglama. 2.celahterbentukantaraseratlensadankorteksberisijaringan degeneratif (bendaMorgagni) padakatarak isnipien(Ilyas.Padakatarakimatur akan dapatbertambah volumelensaakibatmeningkatnyatekananosmotikbahanlensayangdegeneratif. Pada pemeriksaan slitlamp terlihat vakuol pada lensa disertai peregangan jarak lamel serat lensa. Kekeruhaninidapatmenimbulkan polipia oleh karenaindeksrefraksiyang tidaksamapadasemuabagianlensa. Pada keadaaninidapatterjadihidrasikorteks hinggalensaakanmencembungdandayabiasnyaakanbertambah.KatarakImatur Pada kataraksenilisstadiumimatursebagianlensakeruhataukatarakyang belummengenaiseluruh lapis lensa. Katarakintumesenbiasanyaterjadi padakatarakyang berjalancepatdan mengakibatkanmipopialentikular. 9 . 2005). Pada katarakintumesenterjadikekeruhanlensadisertaipembengkakanlensa akibat lensayangdegeneratif menyerap air.KatarakIntumesen.subkapsularposterior. 3.yang memberikan miopisasi.Pencembunganlensa iniakandapatmemberikanpenyulit glaukoma.

berwarna pemeriksaanterlihatbilikmata dalamdanlipatan kuningdan kering. 2005). 4.dapat lensayangberdegenerasikelurdari kapsullensasehinggalensamenjadimengecil. 10 .Akanterjadikekeruhanseluruh bilalamaakanmengakibatkankalsifikasilensa. 5.Katarak Matur Pada kataraksenilisstadiummaturkekeruhantelahmengenai seluruhmasa lensa. normal. 2005). Kekeruhan ini bisa terjadi akibat deposisi ion Ca yang menyeluruh.Kadang-kadang pengkerutanberjalan terussehingga hubungandengan zonula Zinnmenjadikendor.KatarakHipermatur Pada katarakstadiumhipermatur menjadikerasataulembekdanmencair.Padakeadaanlensamencembungakandapatmenimbulkanhambatanpupil. 2005).makakorteksakanmemperlihatkan bentuksebagaisekantong susudisertaidengannukleusyang terbenamdidalam korteks lensa karena lebih berat. Keadaan ini disebut sebagai katarak Morgagni (Ilyas.Bilikmatadepanakan berukurankedalaman normal kembali.Masa terjadiprosesdegenerasilanjut.Pada kapsullensa. sehinggaujibayangan iris negatif(Ilyas. Bila katarakimaturatauintumesentidakdikeluarkanmaka sehinggalensakembalipadaukuranyang lensayang cairanlensa akankeluar. tidakterdapat bayanganiris padalensayang keruh. Bilaproseskatarakberjalanlanjutdisertaidengankapsulyang tebal makakorteks yang berdegenerasidancairtidakdapatkeluar.sehingga terjadi glaukoma sekunder (Ilyas.

Korteks yang mengalami degenerasi dengan nukleus yang terletak di inferiornya (kiri). yaitu nukleus lensa yang terbenam dalam korteks lensa yang mengalami degenerasi. degenerasi total dan absorbsi korteks dengan nukleus di inferior (kanan) Gambar 2.Katarak Morgagni Katarak morgagni merupakan stadium akhir katarak yang biasanya berkembang dalam 20 tahun. Waktu terjadinya onset awal katarak biasanya dapat diperkirakan 20 tahun sebelum adanya temuan ini. Gambar 1. Nukleus kecoklatan yang terletak di inferior korteks yang mengalami degenerasi (katarak morgagni) 11 .

12 . Gambaran histologi menunjukan posisi dari nukleus dan kantung kapsul yang menyusut.Gambar 3.

bilik mata depan dalam. Pada pemeriksaan fisik dapat ditemui korteks lensa yang mengalami degenerasi. GejalaumumgangguankatarakmenurutGOI (2009) dan Medicastore (2009)meliputi: 1. 13 . 5.Lensamataberubah menjadi buram seperti kacasusu.Penglihatan tidak jelas. 4. morgagni dibuat Pemeriksaanlaboratorium berdasarkan preoperasi anamnesis dilakukan dan untuk mendeteksi adanya penyakit-penyakityang menyertai(contoh: diabetes melitus. hipertensi. 2. tidak jarang katarak morgagni disertai dengan komplikasi berupa glaukoma dan uveitis. 2009).Memerlukan pencahayaanyangbaik untuk dapatmembaca. G. seperti terdapat kabut menghalangi objek.Dapat terjadi penglihatangandapadasatu mata. Manifestasi Klinis Gejalakatarakmorgagni yaitu penurunan tajam penglihatan yang sangat progresif.F. Diagnosis Diagnosis pemeriksaan katarak fisik. biasanya penderita merasa nyeri pada mata.Pekaterhadap sinar ataucahaya.cardiac anomalies). sudut bilik mata terbuka dan nukleus lensa yang berada di inferior. 3. cairan lensa berkurang. militusdapatmenyebabkanperdarahan Penyakitsepertidiabetes perioperatif sehingga perludideteksisecaradinisehingga bisadikontrolsebelum operasi(Ocampo.

al.didapatkankorteks yang telah mengalami degenerasi dan nucleus lensa terdapat di inferior. 14 . Penatalaksanaan Pengobatanpada katarak dapatdibedah katarakadalahpembedahan. Anestesi lokal diinfiltrasikandisekitarbolamatadankelopakmataataudiberikansecaratopikal.. pasien dapatdirawatswbagaikasusperawatan sehari dan tidak memerlukan perawatanrumah sakit.Pembedahan Katarak(James et. terbuka.Lalu.konjungtiva. 1.2006) Operasi katarak terdiri dari pengangkatan sebagian besar lensa dan penggantianlensa denganimplanplastik.Pada COA lensa pasienkatarak. H.Pada pasienkataraksebaiknya dilakukanpemeriksaanvisusuntukmengetahui kemampuanmelihatpasien. Saatinipembedahansemakinbanyak dilakukan dengan anestesi lokal daripada anestesi umum. Jika keadaan sosialmemungkinkan.padapemeriksaanshadowtestdidapatkan pseudopos. Tajam penglihatan dikaitkan dengan tugas sehari-hari penderita.Dapat terlihatdalam dan sudut ditemukan bilik Iris mata tremulans. Pada dankornea pemeriksaanslitlampbiasanyadijumpaikeadaanpalpebra. dalamkeadaannormal.Untukmenentukankapan ditentukan oleh keadaan tajampenglihatan.

diikutiolehekstraksikatarak ekstrakapsular (extra-capsularcataract extraction. Pilihanlensa jugadipengaruhiolehrefraksimatakontralateral dan apakahterdapatterdapatkatarak padamatatersebutyang membutuhkanoperasi.Sekarang metodeinimerupakanmetodepilihandi negarabarat. Jangan biarkan pasien mengalami perbedaanrefraktif padakeduamata.Biasanya tidakdibutuhkanpenjahitan. .Insisiluaspadaperiferkorneaatauskleraanterior.Operasi ini dapat dilakukan dengan: . ECCE).Likuifikasi lensa menggunakan probe ultrasonografi yang dimasukkan melalui insisiyang lebihkecildikorneaatauskleraanterior(fakoemulsifikasi). Kekuatanimplanlensaintraokularyang dihitung akandigunakan sebelumnyadenganmengukurpanjang kelengkungankornea umumnyadihitung dalamoperasi maatasecaraultrasonikdan (makajugakekuatanoptik)secara optik. 15 .Insisi harus dijahit.Kekuatanlensa sehinggapasientidakakanmembutuhkankacamatauntuk penglihatanjauh.

Rehabilitasivisualdanperesepankacamata baru dapatdilakukanlebihcepat denganmetode fakoemulsifikasi.Pembedahankatarak(Harvard HealthPublications. Saatinidigunakanlensa intraokular multifokal.Karena pasienmembutuhkan kacamata pasientidakdapatberakomodasimaka untukpekerjaanjarakdekatmeskitidakdibutuhkan kacamata untukjarakjauh.Gambar4. 16 . 2007).lensa intraokularyangdapat berakomodasi sedangdalam tahap pengembangan.ketikabekasinsisitelah sembuh. Kacamatabarudapatdiresepkansetelahbeberapaminggu. Pascaoperasipasien diberikantetesmata steroiddanantibiotikjangka pendek.

b.Hilangnyavitreous.Komplikasiinfektifekstraksikatarakyang seriusnamunjarang terjadi(<0.Komplikasi PembedahanKatarak(James et. c.Jahitanyanglonggarharusdiangkat untukmencegahinfeksinamunmungkindiperlukanjahitan kembalijika penyembuhan lokasiinsisitidaksempurna.penurunan tajam penglihatan.Endoftalmitis. 17 . Pupilmengalami distorsi. al.Irisdapatmengalamiprotusmelaluiinsisibedahpadaperiodepaska operasi dini.pasiendatangdenganmatamerahyangterasanyeri. d.3%). denganpasiendudukdidepanslitlamp..Inidilakukan sebelummelakukan pengukuran kacamata baru namun setelah luka insisi sembuh dan tetes mata steroiddihentikan. 2006) a. Kelengkungankorneayangberlebihdapatterjadipada garis jahitan bila jahitan terlaluerat.Prolapsiris. Mungkin diperlukan pengangkatan jahitan kornea untukmengurangiastigmatisma kornea.2.Selainitu. pengumpulan sel darah putih dibilik mata depan (hipopion). Pengangkatanjahitan biasanya menyelesaikan masalahinidanbisadilakukandenganmudahdiklinik dengananastesilokal.penempatanluka memungkinkan koreksi astigmatismayangtelah adasebelumnya.Fakoemulsifikasitanpa jahitan melalui insisiyang kecilmenghindarkankomplikasiini.Astigmatisma pascaoperasi. Jika kapsulposterior mengalamikerusakanselamaoperasi makagelvitreousnyadapatmasukkedalambilikmatadepanyang merupakan resiko terjadinyaglaukoma atau traksi pada retina.

Ablasio retina.Dapatsembuhseiring berjalannyawaktu.Penelitianyang ditujukanpadapengurangankomplikasiinimenunjukkan bahwa bahan yang digunakan untuk membuat lensa.Makulamenjadiedemasetelah pembedahan. I. Teknik-teknik modern dalam ekstraksi katarak dihubungkan denganrendahnyatingkatkomplikasiini. g. Komplikasi Apabila dibiarkan katarak akan menimbulkan gangguan penglihatan dan komplikasi seperti glaukoma.e. f.Dapatdibuatsatulubang kecilpadakapsuldenganlaser (neodymium yttrum(ndYAG) laser) sebagaiprosedur klinisrawatjalan. dan tumpang tindihlensaintraokulardengansebagiankecilcincinkapsulanterior pentingdalam mencegahopasifikasi kapsul posterior. 2009).kejernihankapsulposterior berkurangpada beberapa bulan setelahpembedahanketika selepitelresidu Penglihatanmenjadikabur danmungkin bermigrasimelaluipermukaannya. didapatkanrasasilau. namun dapat menyebabkan penurunan tajam penglihatanyangberat. 18 .Edemamakularsistoid. uveitis dan kerusakan retina(GOI.Terdapat risikokeciledema makular sistoidatau terlepasnyaretina setelahkapsulotomi YAG.terutamabila disertaidenganhilangnyavitreous.Tingkatkomplikasiinibertambahbila terdapat kehilangan vitreous. bentuk tepi lensa.Padasekitar20%pasien.Opasifikasikapsulposterior.

2010). 19 . Sedangkan katarak morgagni dapat dicegah dengan diagnosis dini pada katarak. namundapatdilakukan pencegahan terhadap hal-hal yang langsung memperberatsepertimengontrolpenyakitmetabolik.CdanE) secara teori bermanfaat(Wikipedia. sehingga katarak senilis tidak berkembang sampai stadium katarak morgagni dan menimbulkan komplikasi.J. K. Namun bila sudah mencapai stadium menjadi katarak morgagni dan telah terjadi komplikasi berupa glaukoma dan uveitis dengan prognosis yang lebih buruk.mencegahpaparan terhatapsinarultravioletdenganmenggunakankacamatagelapdan sebagainya. Prognosis Apabilapadaprosespematangankatarakdilakukanpenangananyang sehinggatidakmenimbulkankomplikasiserta tepat dilakukantindakanpembedahanpada saatyangtepat makaprognosis padakatarak senilis umumnyabaik.Pemberian intake antioksidan(sepertiasamvitaminA. Pencegahan Kataraksenilistidakdapatdicegahkarena penyebabterjadinyakataraksenilis ialah oleh karena faktorusia.

Tajam penglihatan dikaitkan dengan tugas sehari-hari penderita.yaitu stadium insipien. Penyebabterjadinya kataraksenilisialahkarena prosesdegeneratif.BAB III KESIMPUL AN Kataraksenilisadalahsemuakekeruhanlensayang terdapatpadausialanjut.peka terhadapsinar atau cahaya. Keadaan ini terjadi pada katarak stadium hipermatur. trauma sertapaparan sinar ultraviolet. Pengobatanpada katarakadalahpembedahan.Untukmenentukankapan katarak dapatdibedah ditentukan oleh keadaan tajampenglihatan. dapat terjadi penglihatan ganda pada satu mata memerlukan pencahayaanyang baikuntukdapatmembaca. yaitu terjadinya degenarasi korteks dengan nukleus lensa yang terletak di inferior. Diagnosis dini pada katarak sangat penting untuk selanjutnya dilakukan intervensi bedah guna mencegah berkembangnya katarak menjadi katarak morgagni. imatur.Gejalaumumgangguan katarak meliputi penglihatantidakjelassepertiterdapatkabutmenghalangiobjek. Selainitu kataraksenilisjuga dapatdisebabkanolehberbagaifaktorsepertiadanyapenyakit metabolisme. yaitu usiadiatas 50 tahun. dan dapat menimbulkan berbagai komplikasi antara lain glaukoma dan uveitis.lensamataberubahmenjadiburam seperti kacasusu. Kataraksenilissecaraklinisdikenaldalamempatstadium. matur dan hipermatur. Apabila dibiarkankatarakakanmenimbulkangangguanpenglihatandan 20 .

komplikasi seperti glaukoma. 21 makaprognosispadakatarak .mencegahpaparan halyang langsung terhatapsinarultravioletdenganmenggunakankacamatagelapdan sebagainya. Katarak senilis tidak dapat dicegah karena penyebab katarak senilis ialah disebabkan oleh faktor usia. namun dapat dilakukan pencegahan terhadap hal- memperberatsepertimengontrolpenyakitmetabolik. Apabilapadaprosespematangankatarakdilakukan danpenangananyang tepat dilakukantindakanpembedahanpada diagnosis dini sehinggatidakmenimbulkankomplikasiserta saatyangtepat senilis umumnyabaik. uveitis dan kerusakan retina.Pemberianintake antioksidan(sepertiasamvitaminA.CdanE) secara teori bermanfaat.

Diaksesdari http://en. Harvard Health Publications..B.PengertiandanDefinisiKatarak. th James.info. 2005.html.wikipedia.org/wiki/Cataract. 2007.A.Erlangga Medical Series: Jakarta.DAFTARPUSTAK A AmericanAcademyofOphtalmology.LensandCataract. Epidemiologi Katarak. IlmuPenyakitMata.C.9 ed. (2009).com/doc/2028 3414/EPIDEMIOLOGI-KATARAK.LectureNotesOftalmologi.scribd.Chew. 22 .Diaksesdari http://info. Harvard Medical School. Diakses dari http://medicastore.aolhealth. Cataract SurgeryCataract:EyeCare. diakses dari http://www.Bron. Ilyas.1997-1998. Ilham. Katarak.2010.com/id/info/PengertiandanDefinisiKatarak. tanggal 31Januari 2010. GlobalOnlineInformation. tanggal 31 Januari 2010. 3. Medicastore.FKUI: Jakarta. S.Diaksesdari http://www. 2006.2006.com/penyakit/65/ Katarak. tanggal 31 Januari 2010.Cataract.SanFransisco: AAO Anonim.tanggal 31 Januari 2010.com/eye-care/learnabout-it/cataract/cataract-surgery..2009. Ed. tanggal 9 Januari 2010.g-excess.

Ocampo. V.medscape.V. Diakses dari http://emedicine. Senile: Differential Diagnoses and Workup. (2009). tanggal tanggal 31 januari 2010. 23 . Cataract.com/article/1210914- overview.D.