You are on page 1of 54

7HFKQLFDO*XLGH

0L&203

7*
&+$37(5

&+$37(5

$33/,&$7,216127(6

7*
&+$37(5

7HFKQLFDO*XLGH
0L&203

3$*(%/$1&+(

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

&217(176$33/,&$7,216127(6


,1752'8&7,21



3URWHFWLRQRI$V\QFKURQRXV V\QFKURQRXVPRWRUV



,QWURGXFWLRQRIWKH3UHOD\



3URWHFWLRQ)HDWXUHV



1RQ3URWHFWLRQ)HDWXUHV



$33/,&$7,212),1',9,'8$/3527(&7,21)81&7,216



7KHUPDORYHUORDGSURWHFWLRQ



,QWURGXFWLRQ



7KHUPDO5HSOLFD



6HWWLQJVJXLGHOLQHV



7KHUPDO6WDWH0RGLILFDWLRQ





7KHUPDO3UREH,QIOXHQFH





6SHFLILFDSSOLFDWLRQV





5HVLVWLYHWHPSHUDWXUHGHWHFWRUV





57'7KHUPDO3URWHFWLRQ)HDWXUHV





57'7KHUPDO3URWHFWLRQ6HWWLQJV





6KRUWFLUFXLWSURWHFWLRQ





6HWWLQJ*XLGHOLQHV





6HWWLQJ([DPSOH





(DUWKIDXOWSURWHFWLRQ





6ROLGO\(DUWKHG6\VWHP





,QVXODWHG6\VWHP





5HVLVWDQFH(DUWKHG6\VWHPV





3HWHUVHQ&RLO(DUWKHG6\VWHPV





:DWWPHWULF&KDUDFWHULVWLF





5HVLGXDORYHUYROWDJH QHXWUDOGLVSODFHPHQW SURWHFWLRQ





6HWWLQJ*XLGHOLQHV





1HJDWLYHVHTXHQFHSURWHFWLRQ





/RVVRIRQHSKDVHZKLOHVWDUWLQJ UXQQLQJ





5HYHUVHSKDVHGHWHFWLRQ



7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203



6WDUWVWDOOSURWHFWLRQ





([FHVVLYHVWDUWWLPH/RFNHGURWRUSURWHFWLRQVWDOOWLPH!VWDUWWLPH





6WDOO3URWHFWLRQ





([FHVVLYHVWDUWWLPH/RFNHGURWRUSURWHFWLRQVWDOOWLPHVWDUWWLPH





1XPEHURIVWDUWVOLPLWDWLRQ





/RZYROWDJHSURWHFWLRQ UHDFFHOHUDWLRQ





8QGHUYROWDJHSURWHFWLRQ



 3ULQFLSOH



 6HWWLQJ*XLGHOLQHV







/RVVRIORDGSURWHFWLRQ

 3ULQFLSOH



 6HWWLQJ*XLGHOLQHV







6\QFKURQRXVPRWRUSURWHFWLRQ

 2XWRIVWHS3URWHFWLRQ



 /RVVRIVXSSO\





27+(53527(&7,21&216,'(5$7,216





$33/,&$7,212)1213527(&7,21)81&7,216





&,5&8,7%5($.(5&21',7,21021,725,1*





&LUFXLW%UHDNHU&RQGLWLRQ0RQLWRULQJ)HDWXUHV





6HWWLQJJXLGHOLQHV





&,5&8,7%5($.(5&21752/





&7975(48,5(0(176



7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

),*85(6
)LJXUH([DPSOHRIVHWWLQJV 
)LJXUH7KHUPDOFXUYHPRGLILFDWLRQ 
)LJXUH2YHUFXUUHQWHOHPHQW 
)LJXUH&RUHEDODQFHG&7ZLWKFDEOH 
)LJXUH)XVHFKDUDFWHULVWLF  
)LJXUH&XUUHQWGLVWULEXWLRQLQDQ,QVXODWHGV\VWHPZLWK&3KDVHIDXOW  
)LJXUH3KDVRUGLDJUDPVIRU,QVXODWHGV\VWHPZLWK&3KDVH)DXOW  
)LJXUH'LUHFWLRQDOWULSSLQJFKDUDFWHULVWLF  
)LJXUH&XUUHQWGLVWULEXWLRQLQ3HWHUVHQ&RLOHDUWKHGV\VWHP  
)LJXUH&XUUHQWYHFWRUVIRU$SKDVHIDXOW  
)LJXUH'LVWULEXWLRQRIFXUUHQWVGXULQJD&SKDVHWRHDUWKIDXOW 
)LJXUH7KHRUHWLFDOFDVHQRUHVLVWDQFHSUHVHQWLQ;/RU;&  
)LJXUH=HUR6HTXHQFH1HWZRUNVKRZLQJUHVLGXDOFXUUHQWV  
)LJXUH3UDFWLFDOFDVHUHVLVWDQFHSUHVHQWLQ;/DQG;F  
)LJXUH5HVLVWLYHFRPSRQHQWVRIVSLOOFXUUHQW  
)LJXUHD5HVLGXDO9ROWDJH 
)LJXUHE5HVLGXDO9ROWDJH 
)LJXUH(TXLYDOHQWFLUFXLWV  
)LJXUH5HPRWHFRQWURORIFLUFXLWEUHDNHU  

7*
&+$37(5
3DJHRI



,1752'8&7,21



3URWHFWLRQRI$V\QFKURQRXV V\QFKURQRXVPRWRUV

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

%RWKDV\QFKURQRXV LQGXFWLRQ DQGV\QFKURQRXVPRWRUVSHUIRUPDYLWDOUROHLQPDQ\


LQGXVWULDOSURFHVVHVWKURXJKRXWWKHZRUOGDYDVWPDMRULW\RIZKLFKZRXOGEHXQDEOH
WR IXQFWLRQ ZLWKRXW VXFK D GHYLFH &OHDUO\ ORVV RI D PRWRU WKURXJK GDPDJH LQFXUV
PXFKPRUHWKDQDSRVVLEOHHOHFWULFDOUHZLQGEXWDOVRDVWRSLQDQHOHFWULFDOSURFHVV
UHVXOWLQJ LQ H[SHQVLYH SODQW GRZQ WLPH 7KLV SUREOHP PD\ EH H[DFHUEDWHG E\ WKH
GDPDJHGPDFKLQHEHLQJSRVLWLRQHGLQDQLQDFFHVVLEOHSRVLWLRQVXFKDVDQDZNZDUG
FRUQHURIDIDFWRU\RUE\DVSDUHQRWEHLQJUHDGLO\DYDLODEOH7KHUHIRUHSULRUZDUQLQJ
RIDSUREOHPLVYLWDOO\LPSRUWDQWWRUHGXFHWKHLPSDFWRQDSURFHVVUHVXOWLQJIURPD
IDXOWHGPRWRU
&RPSUHKHQVLYHSURWHFWLRQUHOD\VVXFKDVWKH3FDQWKHUHIRUHEHXVHGWRSURWHFW
D PRWRU IURP FDWDVWURSKLF IDLOXUH RU SRVVLEO\ JLYH WKH RSHUDWRU SULRU ZDUQLQJ RI D
SUREOHPZKLFKPD\LQWXUQUHGXFHSODQWGRZQWLPH+RZHYHULWLVDOVRQHFHVVDU\WR
FRQVLGHU WKDW DQ\ SURWHFWLYH GHYLFH WKRXJK UHOLDEOH LQ RSHUDWLRQ XQGHU DEQRUPDO
FRQGLWLRQV PXVW QRW DIIHFW WKH FRQWLQXRXV RSHUDWLRQ RI WKH PRWRU XQGHU QRUPDO
RSHUDWLQJFRQGLWLRQV
8QIRUWXQDWHO\ PRWRU FKDUDFWHULVWLFV YDU\ JUHDWO\ GHSHQGLQJ XSRQ WKHLU SUHFLVH
DSSOLFDWLRQ (DFK DSSOLFDWLRQ WKHUHIRUH UHTXLUHV FDUHIXO FRQVLGHUDWLRQ UHJDUGLQJ WKH
VSHFLILFDWLRQ DQG VHWWLQJ RI WKH PRWRU SURWHFWLRQ )RU H[DPSOH VWDUWLQJ DQG VWDOOLQJ
FXUUHQWV DQG WLPHV PXVW EH NQRZQ ZKHQ DSSO\LQJ RYHUORDG SURWHFWLRQ DQG
IXUWKHUPRUH WKH WKHUPDO ZLWKVWDQG RI WKH PDFKLQH XQGHU EDODQFHG DQG XQEDODQFHG
ORDGLQJPXVWEHGHILQHG
7KHFRQGLWLRQVZKLFKPRWRUSURWHFWLRQPD\EHUHTXLUHGWRGHWHFWFDQEHGLYLGHGLQWR
WZR EURDG FDWHJRULHV LPSRVHG H[WHUQDO FRQGLWLRQV DQG LQWHUQDO IDXOWV 7KH IRUPHU
FDWHJRU\ LQFOXGHV XQEDODQFHG VXSSO\ YROWDJHV XQGHUYROWDJHV VLQJOH SKDVLQJ DQG
UHYHUVHSKDVHVHTXHQFHVWDUWLQJDQGLQWKHFDVHRIV\QFKURQRXVPDFKLQHVRQO\ORVV
RI V\QFKURQLVP 7KH ODWWHU FDWHJRU\ LQFOXGHV EHDULQJ IDLOXUHV LQWHUQDO VKXQW IDXOWV
ZKLFKDUHFRPPRQO\HDUWKIDXOWV DQGRYHUORDGV


,QWURGXFWLRQRIWKH3UHOD\
0L&20UHOD\VDUHDQHZUDQJHRISURGXFWVIURP$/67207 '3URWHFWLRQ &RQWURO
8VLQJ WKH ODWHVW QXPHULFDO WHFKQRORJ\ 0L&20 UHOD\V LQFOXGH GHYLFHV GHVLJQHG IRU
WKH DSSOLFDWLRQ WR D ZLGH UDQJH RI SRZHU V\VWHP SODQW VXFK DV PRWRUV JHQHUDWRUV
IHHGHUVRYHUKHDGOLQHVDQGFDEOHV
7KHVH UHOD\V DUH GHVLJQHG DURXQG D FRPPRQ KDUGZDUH DQG VRIWZDUH SODWIRUP LQ
RUGHUWRDFKLHYHDKLJKGHJUHHRIFRPPRQDOLW\EHWZHHQSURGXFWV2QHVXFKSURGXFW
LQWKHUDQJHLVWKH0RWRU3URWHFWLRQ5HOD\7KLVUHOD\KDVEHHQGHVLJQHGWRFDWHUIRU
WKH SURWHFWLRQ RI ERWK DV\QFKURQRXV DQG V\QFKURQRXV PRWRUV ZKLFK PD\ UHTXLUH
H[WHQVLYHSURWHFWLRQ
7KHUHOD\DOVRLQFOXGHVDFRPSUHKHQVLYHUDQJHRIQRQSURWHFWLRQIHDWXUHVWRDLGZLWK
SRZHU V\VWHP GLDJQRVLV DQG IDXOW DQDO\VLV $OO WKHVH IHDWXUHV FDQ EH DFFHVVHG
UHPRWHO\IURPRQHRIWKHUHOD\VUHPRWHVHULDOFRPPXQLFDWLRQVRSWLRQV

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203



7*
&+$37(5
3DJHRI

3URWHFWLRQ)HDWXUHV
7KH 3 UHOD\ FRQWDLQV D ZLGH YDULHW\ RI SURWHFWLRQ IXQFWLRQV 7KHVH
SURWHFWLRQSURWHFWLRQUHODWHGIHDWXUHVDUHVXPPDULVHGEHORZ

7KHUPDO2YHUORDG3URWHFWLRQ$WKHUPDOUHSOLFDPHWKRGLVXVHGWRPRQLWRUWKH
WKHUPDOVWDWHRIWKHPRWRUDQGSURYLGHDWULSDQGDODUP

6HQVLWLYH'LUHFWLRQDO(DUWKIDXOW3URWHFWLRQ7KLV6'()HOHPHQWLVHTXLSSHGZLWK
WZRLQGHSHQGHQWVWDJHVZKLFKDUHVHOHFWDEOHWREHHLWKHUGLUHFWLRQDORUQRQ
GLUHFWLRQDO7KHILUVWVWDJHPD\EHVHOHFWHGDVHLWKHU,'07RU'7DQGWKHVHFRQG
VWDJHLV'7RQO\

5HVLGXDO2YHUYROWDJH3URWHFWLRQ3URYLGHVDPHWKRGRIHDUWKIDXOWGHWHFWLRQDQG
KDVWZRVWDJHVVWDJHPD\EHVHOHFWHGDVHLWKHU,'07RU'7DQGVWDJHLV'7
RQO\

3HWHUVRQ&RLO(DUWK)DXOW3URWHFWLRQ7LPHGHOD\HG:DWWPHWULFEDFNXSSURWHFWLRQ
IRUHDUWKIDXOWVRQDUFVXSSUHVVLRQFRLOHDUWKHGV\VWHPV

6KRUW&LUFXLW3URWHFWLRQ2YHUFXUUHQWHOHPHQWZLWKGHILQLWHWLPHFKDUDFWHULVWLFIRU
SURWHFWLRQDJDLQVWSKDVHSKDVHDQGSKDVHHDUWKIDXOWV

([FHVVLYH6WDUW/RFNHG5RWRU3URWHFWVWKHPRWRUDJDLQVWVWDOOLQJGXULQJVWDUWLQJ

6WDOO3URWHFWLRQ3URWHFWLRQVWKHPRWRUDJDLQVWVWDOOLQJGXULQJUXQQLQJ

6WDUWV/LPLWDWLRQ7KHDOORZDEOHQXPEHURIKRWDQGFROGVWDUWVZLWKLQDVHWSHULRG
FDQEHVHOHFWHG

1HJDWLYH6HTXHQFH8QEDODQFH6LQJOH3KDVLQJ,QYHUVHWLPHFKDUDFWHULVWLFZLWK
ERWKDODUPDQGWULSFXUUHQWWKUHVKROG

5HYHUVH3KDVH6HTXHQFH'HWHFWLRQ8VHGWRFRQILUPWKHFRUUHFWVXSSO\SKDVH
URWDWLRQ0D\EHLQWHUORFNHGZLWKWKHFLUFXLWEUHDNHUFORVHFLUFXLW

/RZ)RUZDUG3RZHU8VHGWRGHWHFWORVVRIORDG

8QGHUYROWDJH3URWHFWLRQ7KLVLVHTXLSSHGZLWKWZRLQGHSHQGHQWVWDJHVDQG
SURYLGHVERWKWULSDQGDODUP6WDJHPD\EHVHOHFWHGDVHLWKHU,'07RU'7DQG
VWDJHLV'7RQO\

/RZ9ROWDJH3URWHFWLRQ$OORZVWKHPRWRUWRUHDFFHOHUDWHIROORZLQJDUHGXFWLRQLQ
V\VWHPYROWDJH

2YHUYROWDJH3URWHFWLRQ7KLVLVHTXLSSHGZLWKWZRLQGHSHQGHQWGHILQLWHWLPH
VWDJHV

8QGHUIUHTXHQF\7KLVLVHTXLSSHGZLWKWZRLQGHSHQGHQWVWDJHVDQGSURYLGHVERWK
WULSDQGDODUP

2XW2I6WHS3RZHU)DFWRU3URWHFWLRQ8VHGWRSURYLGHRXWRIVWHSSURWHFWLRQRQ
V\QFKURQRXVPRWRUV

5HVLVWLYH7HPSHUDWXUH'HYLFHV57'LQSXWVDUHSURYLGHGIRUWHPSHUDWXUH
PRQLWRULQJ

3URJUDPPDEOH6FKHPH/RJLF$OORZVXVHUGHILQHGSURWHFWLRQDQGFRQWUROORJLFWR
VXLWSDUWLFXODUFXVWRPHUDSSOLFDWLRQV

7*
&+$37(5
3DJHRI



7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

1RQ3URWHFWLRQ)HDWXUHV
%HORZLVDVXPPDU\RIWKH3UHOD\QRQSURWHFWLRQIHDWXUHV

/RFDO5HPRWH0HDVXUHPHQWV9DULRXVPHDVXUHPHQWYDOXHVIRUGLVSOD\RQWKH
UHOD\RUDFFHVVHGIURPWKHVHULDOFRPPXQLFDWLRQV

)DXOW(YHQW'LVWXUEDQFH5HFRUGV$YDLODEOHIURPWKHVHULDOFRPPXQLFDWLRQVRU
RQWKHUHOD\GLVSOD\ IDXOWDQGHYHQWUHFRUGVRQO\ 

5HDO7LPH&ORFN7LPH6\QFKURQLVDWLRQ7LPHV\QFKURQLVDWLRQSRVVLEOHIURP
UHOD\,5,*%LQSXW

7ZR6HWWLQJ*URXSV,QGHSHQGHQWVHWWLQJJURXSVWRFDWHUIRUDOWHUQDWLYHPRWRU
SDUDPHWHUV

5HPRWH6HULDO&RPPXQLFDWLRQV7RDOORZUHPRWHDFFHVVWRWKHUHOD\7KH
IROORZLQJFRPPXQLFDWLRQVSURWRFROVDUHVXSSRUWHG&RXULHU02'%86:RUOG),3
DQG,(&

&RQWLQXRXV6HOI0RQLWRULQJ3RZHURQGLDJQRVWLFVDQGVHOIFKHFNLQJURXWLQHVWR
SURYLGHPD[LPXPUHOD\UHOLDELOLW\DQGDYDLODELOLW\

&LUFXLW%UHDNHU6WDWH0RQLWRULQJ3URYLGHVLQGLFDWLRQRIGLVFUHSDQF\EHWZHHQ
FLUFXLWEUHDNHUDX[LOLDU\FRQWDFWV

&LUFXLW%UHDNHU&RQWURO&RQWURORIWKHFLUFXLWEUHDNHUFDQEHDFKLHYHGHLWKHU
ORFDOO\YLDWKHXVHULQWHUIDFHRUUHPRWHO\YLDVHULDOFRPPXQLFDWLRQV

&LUFXLW%UHDNHU&RQGLWLRQ0RQLWRULQJ3URYLGHVUHFRUGVDODUPRXWSXWVUHJDUGLQJ
WKHQXPEHURI&%RSHUDWLRQVVXPRIWKHLQWHUUXSWHGFXUUHQWDQGWKHEUHDNHU
RSHUDWLQJWLPH

&RPPLVVLRQLQJ7HVW)DFLOLWLHV

8VHUVHOHFWDEOHODWFKHGRXWSXWUHOD\V

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203



7*
&+$37(5
3DJHRI

$33/,&$7,212),1',9,'8$/3527(&7,21)81&7,216
7KHIROORZLQJVHFWLRQVGHWDLOWKHLQGLYLGXDO SURWHFWLRQ IXQFWLRQV LQ DGGLWLRQ WR ZKHUH
DQGKRZWKH\PD\EHDSSOLHG(DFKVHFWLRQDOVRJLYHVDQH[WUDFWIURPWKHUHVSHFWLYH
PHQXFROXPQVWRGHPRQVWUDWHKRZWKHVHWWLQJVDUHDFWXDOO\DSSOLHGWRWKHUHOD\
7KH3UHOD\VHDFK LQFOXGH D FROXPQ LQ WKH PHQX FDOOHG WKH &21),*85$7,21
FROXPQ
7KH DLP RI WKH &21),*85$7,21 FROXPQ LV WR DOORZ JHQHUDO FRQILJXUDWLRQ RI WKH
UHOD\IURPDVLQJOHSRLQWLQWKHPHQX$Q\RIWKHIXQFWLRQVWKDWDUHGLVDEOHGRUPDGH
LQYLVLEOH IURP WKLV FROXPQ GR QRW WKHQ DSSHDU ZLWKLQ WKH PDLQ UHOD\ PHQX $
FRPSOHWH GHVFULSWLRQ RI WKLV FROXPQ LV JLYHQ LQ WKH 8VHU *XLGH SDUW RI WKLV
7HFKQLFDO*XLGH



7KHUPDORYHUORDGSURWHFWLRQ



,QWURGXFWLRQ
2YHUORDGVFDQUHVXOWLQVWDWRUWHPSHUDWXUHULVHVZKLFKH[FHHGWKHWKHUPDOOLPLWRIWKH
ZLQGLQJLQVXODWLRQ(PSLULFDOUHVXOWVVXJJHVWWKDWWKHOLIHRILQVXODWLRQLVDSSUR[LPDWHO\
KDOYHGIRUHDFK&ULVHLQWHPSHUDWXUHDERYHWKHUDWHGYDOXH+RZHYHUWKHOLIHRI
LQVXODWLRQLVQRWZKROO\GHSHQGHQWXSRQWKHULVHLQWHPSHUDWXUHEXW RQ WKH WLPH WKH
LQVXODWLRQLVPDLQWDLQHGDWWKLVHOHYDWHGWHPSHUDWXUH'XHWRWKHUHODWLYHO\ODUJHKHDW
VWRUDJH FDSDFLW\ RI DQ LQGXFWLRQ PRWRU LQIUHTXHQW RYHUORDGV RI VKRUW GXUDWLRQ PD\
QRWGDPDJHWKHPDFKLQH+RZHYHUVXVWDLQHGRYHUORDGVRIDIHZSHUFHQWPD\UHVXOW
LQSUHPDWXUHDJHLQJDQGIDLOXUHRILQVXODWLRQ
7KH SK\VLFDO DQG HOHFWULFDO FRPSOH[LW\ RI PRWRU FRQVWUXFWLRQ WKHLU GLYHUVH
DSSOLFDWLRQV YDULHW\ RI SRVVLEOH DEQRUPDO RSHUDWLQJ FRQGLWLRQV DQG WKH GLIIHUHQW
PRGHV RI IDLOXUH WKDW PD\ RFFXU UHVXOW LQ D FRPSOH[ WKHUPDO UHODWLRQVKLS ,W LV QRW
WKHUHIRUH SRVVLEOH WR FUHDWH DQ DFFXUDWH PDWKHPDWLFDO PRGHO RI WKH WUXH WKHUPDO
FKDUDFWHULVWLFVRIWKHPDFKLQH
+RZHYHU LI D PRWRU LV FRQVLGHUHG WR EH DQ KRPRJHQHRXV ERG\ GHYHORSLQJ KHDW
LQWHUQDOO\DWDFRQVWDQWUDWHDQGGLVVLSDWLQJKHDWDWDUDWHGLUHFWO\SURSRUWLRQDOWRLWV
WHPSHUDWXUHULVHLWFDQEHVKRZQWKDWWKHWHPSHUDWXUHDWDQ\LQVWDQWLVJLYHQE\
7 7

 H
W

PD[

:KHUH
7  )LQDOVWHDG\VWDWHWHPSHUDWXUH
 +HDWLQJWLPHFRQVWDQW
PD[

7KLVDVVXPHVDWKHUPDOHTXLOLEULXPLQWKHIRUP
+HDWGHYHORSHG +HDWVWRUHG+HDWGLVVLSDWHG
7HPSHUDWXUHULVHLVSURSRUWLRQDOWRWKHFXUUHQWVTXDUHG
7 .,  H


W

:KHUH
,  7KDWFXUUHQWZKLFKZKHQOHIWWRIORZFRQWLQXRXVO\ZRXOGSURGXFHDWHPSHUDWXUH
7 LQWKHPRWRU
5

PD[

)RUDQRYHUORDGFXUUHQW,WKHWHPSHUDWXUHLVJLYHQE\
7 .,  H


W

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

)RUDPRWRUQRWWRH[FHHGWKHUDWHGWHPSHUDWXUHWKHQWKHWLPHWIRUZKLFKWKHPRWRU
FDQZLWKVWDQGWKHFXUUHQW,FDQEHVKRZQWREHJLYHQE\
W ORJ >^ , , `@


$Q RYHUORDG SURWHFWLRQ HOHPHQW VKRXOG WKHUHIRUH VDWLVI\ WKH DERYH UHODWLRQVKLS 7KH
YDOXHRI, PD\EHWKHIXOOORDGPRWRUFXUUHQWRUDSHUFHQWDJHRILWGHSHQGLQJRQWKH
PRWRUGHVLJQ
5

$VSUHYLRXVO\VWDWHGLWLVDQRYHUVLPSOLILFDWLRQWRUHJDUGDPRWRUDVDQKRPRJHQHRXV
ERG\7KHWHPSHUDWXUHULVH RI GLIIHUHQW SDUWV RU HYHQ RI YDULRXV SRLQWV LQ WKH VDPH
SDUWPD\EHYHU\XQHYHQ+RZHYHULWLVUHDVRQDEOHWRFRQVLGHUWKDWWKHFXUUHQWWLPH
UHODWLRQVKLSIROORZVDQLQYHUVHIDVKLRQ$PRUHDFFXUDWHUHSUHVHQWDWLRQRIWKHWKHUPDO
VWDWH RI WKH PRWRU FDQ EH REWDLQHG WKURXJK WKH XVH RI WHPSHUDWXUH PRQLWRULQJ
GHYLFHV 57'V ZKLFKWDUJHWWKHVHVSHFLILFDUHDV


7KHUPDO5HSOLFD
7KH3UHOD\PRGHOVWKHWLPHFXUUHQWWKHUPDOFKDUDFWHULVWLFRIDPRWRUE\LQWHUQDOO\
JHQHUDWLQJDWKHUPDOUHSOLFDRIWKHPDFKLQH7KHWKHUPDORYHUORDGSURWHFWLRQFDQEH
VHOHFWLYHO\ HQDEOHG RU GLVDEOHG 7KH SRVLWLYH DQG QHJDWLYH VHTXHQFH FRPSRQHQWV RI
WKHORDGFXUUHQWDUHPHDVXUHGLQGHSHQGHQWO\DQGDUHFRPELQHGWRJHWKHUWRIRUPDQ
HTXLYDOHQWFXUUHQW, ZKLFKLVVXSSOLHGWRWKLVUHSOLFDFLUFXLW7KHKHDWLQJHIIHFWLQWKH
WKHUPDOUHSOLFDLVSURGXFHGE\, DQGWKHUHIRUHWDNHVLQWRDFFRXQWWKHKHDWLQJHIIHFW
GXHWRERWKSRVLWLYHDQGQHJDWLYHVHTXHQFHFRPSRQHQWVRIFXUUHQW
HT

HT

7KHHTXLYDOHQWFXUUHQWIRURSHUDWLRQRIWKHRYHUORDGSURWHFWLRQLVLQDFFRUGDQFHZLWK
WKHIROORZLQJH[SUHVVLRQ
,   , .,


HT

:KHUH
,  3RVLWLYHVHTXHQFHFXUUHQW
,  1HJDWLYHVHTXHQFHFXUUHQW
. $XVHUVHWWDEOHFRQVWDQWSURSRUWLRQDOWRWKHWKHUPDOFDSDFLW\RIWKHPRWRU



$V SUHYLRXVO\ GHVFULEHG WKH WHPSHUDWXUH RI D PRWRU ZLOO ULVH H[SRQHQWLDOO\ ZLWK
LQFUHDVLQJFXUUHQW6LPLODUO\ZKHQFXUUHQWGHFUHDVHVWKHWHPSHUDWXUHDOVRGHFUHDVHV
LQ D VLPLODU PDQQHU 7KHUHIRUH LQ RUGHU WR DFKLHYH FORVH VXVWDLQHG RYHUORDG
SURWHFWLRQWKH3UHOD\LQFRUSRUDWHVDZLGHUDQJHRIWKHUPDOWLPHFRQVWDQWV7KHVH
DOORZ WKH UHOD\ UHSOLFD WR FORVHO\ PDWFK WKH SURWHFWHG PRWRU GXULQJ KHDWLQJ DQG
FRROLQJ
)XUWKHUPRUHWKHWKHUPDOZLWKVWDQGFDSDELOLW\RI WKH PRWRU LV DIIHFWHGE\ KHDWLQJ LQ
WKHZLQGLQJSULRUWRWKHIDXOW7KHWKHUPDOUHSOLFDLVGHVLJQHGWRWDNHLQWRDFFRXQWWKH
H[WUHPHVRI]HURSUHIDXOWFXUUHQWNQRZQDVWKHFROGFRQGLWLRQDQGIXOOUDWHGSUH
IDXOWFXUUHQWNQRZQDVWKHKRWFRQGLWLRQ:LWKQRSUHIDXOWFXUUHQWWKHUHOD\ZLOOEH
RSHUDWLQJ RQ WKH FROG FXUYH :KHQ D PRWRU LV RU KDV EHHQ UXQQLQJ DW IXOO ORDG
SULRU WR D IDXOW WKH ZLQGLQJV ZLOO DOUHDG\ EH GLVVLSDWLQJ KHDW DQG WKH KRW FXUYH LV
DSSOLFDEOH 7KHUHIRUH GXULQJ QRUPDO RSHUDWLRQ WKH UHOD\ ZLOO EH RSHUDWLQJ ZLWKLQ
WKHVHWZROLPLWVXQOHVVSURJUDPPHGWRGRRWKHUZLVH

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

7RSURWHFWWKHPRWRUGXULQJDOORSHUDWLQJFRQGLWLRQVWKUHHLQGHSHQGHQWO\DGMXVWDEOH
WLPHFRQVWDQWVDUHHPSOR\HGLQWKHRYHUORDGFXUYH
, 
7
7
7U
WK

7KHUPDOFXUUHQWVHWWLQJ
2YHUORDGWLPHFRQVWDQWDSSOLHGZKHQWKHFXUUHQWLVEHWZHHQ,  , 
2YHUORDGWLPHFRQVWDQWDSSOLHGIRUFXUUHQWVDERYH, 
&RROLQJWLPHFRQVWDQWDSSOLHGZKHQWKHPRWRULVVWRSSHG
WK

WK

WK

7KHIROORZLQJHTXDWLRQLVXVHGWRFDOFXODWHWKHWULSWLPHIRUDJLYHQFXUUHQW1RWHWKDW
WKHUHOD\ZLOOWULSDWDYDOXHFRUUHVSRQGLQJWRRILWVWKHUPDOVWDWH
W 7ORJ  N $  N 




ZKHUH
7 7LI, ,  ,
7 7LI, !,
7 7ULI,   &%RSHQ
N , ,
$  LQLWLDOVWDWHRIWKHPDFKLQH
6HWWLQJVJXLGHOLQHV
WK

HT

HT

WK

WK

HT

HT

WK



 7KHUPDO6HWWLQJ,WK
7KH ,  VHWWLQJ FKRVHQ ZLOO GHSHQG RQ WKH W\SH RI PRWRU EHLQJ SURWHFWHG 0RVW
PDFKLQHV DUH WHUPHG &05 FRQWLQXRXV PD[LPXP UDWLQJ  PRWRUV 7KHVH PRWRUV DUH
GHVLJQHG WR FDUU\ WKH QDPH SODWH YDOXH RU IXOO ORDG FXUUHQW FRQWLQXRXVO\ $ &05
PRWRUPD\EHUXQDWVRPHYDOXHOHVVWKDQLWV&05DQGVHWWRWULSDWLWV&05
WK

$OWHUQDWLYHO\LIWKHPDFKLQHLVQRWD&05PRWRUWKHQWKH,WK VHWWLQJZLOOQHHGWRWDNH
LQWRDFFRXQWWKHDPRXQWRIRYHUORDGZKLFKFDQEHWROHUDWHGZLWKRXWWKHUPDOGDPDJH
UHVXOWLQJ $ W\SLFDO DOORZDEOH RYHUORDG PD\ EH LQ WKH UHJLRQ RI  RI UDWHG
WHPSHUDWXUH ,W LV LPSRUWDQW WR UHDOLVH WKDW WKH WHPSHUDWXUH EXLOG XS ZLWKLQ WKH
PDFKLQHLVDSSUR[LPDWHO\HTXDOWRWKHFXUUHQWVTXDUHGWKHUHIRUHDWHPSHUDWXUH
RYHUORDGLVHTXLYDOHQWWRDFXUUHQWRYHUORDG


6HWWLQJH[DPSOH
7KHIROORZLQJPRWRUSDUDPHWHUVZLOOEHXVHGWRKHOSLOOXVWUDWHKRZWRGHWHUPLQHWKH
3VHWWLQJV
9ROWDJH

N9

)XOOORDGFXUUHQW

$

6WDUWLQJFXUUHQW



6WDUWLQJWLPH

V

+HDWLQJWLPHFRQVWDQW

PLQ

&RROLQJWLPHFRQVWDQW

PLQ

+RWORFNHGURWRUZLWKVWDQGWLPH

V

&ROGORFNHGURWRUZLWKVWDQGWLPH

V

&75DWLR



975DWLR

N99

6WDUWLQJ

'2/

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

)RUWKLVDSSOLFDWLRQZHKDYHDVVXPHGWKDWWKHPDFKLQHLVD&05PRWRUDQGWKHUHIRUH
WKH,WKVHWWLQJLVFDOFXODWHGDVIROORZV
,WK ,

&05

[ &7UDWLR

ZKHUH
,
&RQWLQXRXV0RWRU5DWLQJ
&05

7KHUHIRUH,WK [

1
,Q
300

7KHUHIRUHVHW,WK ,Q
 .&RHIILFLHQW
7KHFRQVWDQW.LVXVHGWRLQFUHDVHWKHLQIOXHQFHRIQHJDWLYHVHTXHQFHFXUUHQWRQWKH
WKHUPDO UHSOLFD 7KLV IDFWRU VKRXOG EH VHW HTXDO WR WKH UDWLR RI QHJDWLYH SKDVH
VHTXHQFH URWRU UHVLVWDQFH WR SRVLWLYH VHTXHQFH UHVLVWDQFH DW UDWHG VSHHG :KHQ DQ
H[DFW VHWWLQJ FDQQRW EH FDOFXODWHG D GHIDXOW VHWWLQJ RI  VKRXOG EH XVHG 7KLV LV D
W\SLFDOVHWWLQJDQGZLOOVXIILFHIRUWKHPDMRULW\RIDSSOLFDWLRQV
7KHUHIRUHVHW. 
 7KHUPDO7LPH&RQVWDQWV
7KH UHOD\ KHDWLQJ DQG FRROLQJ WLPH FRQVWDQWV DUH VHW LQ DFFRUGDQFH ZLWK WKH VWDWRU
WKHUPDO KHDWLQJ DQG FRROLQJ WLPH FRQVWDQWV 7KH UHOD\ KHDWLQJ WLPH FRQVWDQW 7
VKRXOG EH VHW HTXDO WR RU DV FORVH DV SRVVLEOH WR WKH VWDWRU KHDWLQJ WKHUPDO WLPH
FRQVWDQWZKLFKLVREWDLQDEOHIURPWKHPRWRUPDQXIDFWXUHU,WLVJRRGSUDFWLFHWRVHW
7 VOLJKWO\ OHVV WKDQ WKH VWDWRU KHDWLQJ WKHUPDO WLPH FRQVWDQW WR DOORZ IRU UHOD\
WROHUDQFHV +RZHYHU WKLV LV QRW DOZD\V QHFHVVDU\ VLQFH WKH VWDWRU WKHUPDO WLPH
FRQVWDQWVSURYLGHGE\WKHPRWRUPDQXIDFWXUHUDUHXVXDOO\FRQVHUYDWLYH
7LVDXWRPDWLFDOO\DSSOLHGDERYH,WKDQGLVXVHGWRPRGLI\WKHUHOD\WKHUPDOFXUYH
GXULQJ VWDUWLQJ IRU FHUWDLQ DSSOLFDWLRQV IRU H[DPSOH ZKHUH VWDUGHOWD VWDUWHUV DUH
EHLQJXWLOLVHG'XULQJQRUPDOUXQQLQJZLWKWKHPRWRUFRQQHFWHGLQGHOWDWKHFXUUHQW
LQ WKH PRWRU ZLQGLQJ LV RQO\  RI WKDW PRQLWRUHG E\ WKH UHOD\ +RZHYHU GXULQJ
VWDUWLQJZLWKWKHPRWRUFRQQHFWHGLQVWDUWKHFXUUHQWPRQLWRUHGE\WKHUHOD\LVHTXDO
WR WKH FXUUHQW LQ WKH PRWRU ZLQGLQJ )RU WKLV UHDVRQ 7  FDQ EH XVHG WR UHGXFH WKH
RSHUDWLQJ WLPH RI WKH UHOD\ GXULQJ VWDUWLQJ  )RU DSSOLFDWLRQV ZKHUH GLUHFW RQ OLQH
'2/  VWDUWLQJ LV XWLOLVHG 7 VKRXOG EH VHW HTXDO WR 7 UHVXOWLQJ LQ RQH FRQWLQXRXV
WKHUPDOFXUYH
,W LV LPSRUWDQW WR SORW WKH FKRVHQ WKHUPDO FKDUDFWHULVWLFV RQ D WLPHFXUUHQW JUDSK WR
HQVXUHWKDWWKHFROGFXUYHGRHVQRWLQWHUVHFWWKHVWDUWLQJFKDUDFWHULVWLF
,QFHUWDLQDSSOLFDWLRQVWKHWKHUPDOWLPHFRQVWDQWVPD\QRWEHDYDLODEOH+RZHYHUD
JUDSKLFDOUHSUHVHQWDWLRQRIWKHVHYDOXHVPD\EHJLYHQ,QVXFKDSSOLFDWLRQVDVWDWRU
KHDWLQJ WLPH FRQVWDQW PXVW EH FKRVHQ VXFK WKDW ZKHQ SORWWHG RQ D WLPHFXUUHQW
JUDSKLWFORVHO\PDWFKHVWKHFROGZLWKVWDQGFXUYHRIWKHPRWRU
)RUDSSOLFDWLRQVZKHUHQHLWKHUWKHWKHUPDOWLPHFRQVWDQWVQRUWKHWKHUPDOZLWKVWDQG
FXUYH DUH DYDLODEOH VHWWLQJV 7 DQG 7 VKRXOG EH FKRVHQ VXFK WKDW WKH UHVXOWLQJ
WKHUPDOFXUYHOLHVDERYHWKHPRWRUVWDUWLQJFKDUDFWHULVWLFEXWOHVVWKDQWKHPRWRUVWDOO
ZLWKVWDQG WLPH ,Q WKLV FDVH WKH WKHUPDO RYHUORDG SURWHFWLRQ LV DOVR SURYLGLQJ VRPH
GHJUHHRIVWDOOSURWHFWLRQ

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

7U LV WKH FRROLQJ WLPH FRQVWDQW 7KLV VHWWLQJ LV LPSRUWDQW IRU F\FOLF RSHUDWLRQ RI WKH
PRWRUVLQFHSUHFLVHLQIRUPDWLRQRIWKHWKHUPDOVWDWHRIWKHPRWRULVUHTXLUHGGXULQJ
KHDWLQJ DQG FRROLQJ ,W LV VHW DV D PXOWLSOH RI 7 DQG VKRXOG EH VHW WR WKH QHDUHVW
YDOXHDERYHWKHPRWRUFRROLQJWLPHFRQVWDQW
6HWWLQJ([DPSOH
)RU WKLV SDUWLFXODU DSSOLFDWLRQ WKH VWDWRU WKHUPDO WLPH FRQVWDQWV RI WKH PRWRU DUH
NQRZQWKHUHIRUHWKHUHTXLUHGWLPHFRQVWDQWVHWWLQJVDUHDVIROORZV
7KHUHIRUHVHW

7 PLQXWHV
7 7VLQFHPDFKLQHLV'2/VWDUWLQJ
7UWR[7 PLQV

7KHVHVHWWLQJVDUHVKRZQJUDSKLFDOO\LQILJXUH

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

7KHUPDORYHUORDG
WKHUPDOVWDWXV
7H

7H



PLQ

10

&ROGVWDOO

6WDUWLQJ

+RWVWDOO

FKDUDFWHULVWLF
/RFNHGURWRU

/RFNHGURWRU
6KRUWFLUFXLW

0,01

/RDGFXUUHQW,WK

)LJXUH([DPSOHRIVHWWLQJV

10

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203



7*
&+$37(5
3DJHRI

7KHUPDO6WDWH0RGLILFDWLRQ
,ID&05LQGXFWLRQPRWRULVIXOO\ORDGHGWKLVLVHTXLYDOHQWWRDWHPSHUDWXUHRI
DVIDUDVWKHWKHUPDOUHSOLFDLVFRQFHUQHG7KH PRWRU SURWHFWLRQ UHOD\ ZLOO WKHUHIRUH
QRUPDOO\ EH VHW WR WULS ZKHQ WKH WHPSHUDWXUH UHDFKHV  +RZHYHU D VWDWRU
WHPSHUDWXUH RI  GRHV QRW QHFHVVDULO\ FRUUHVSRQG WR D URWRU WHPSHUDWXUH RI
WKHURWRUWHPSHUDWXUHFRXOGEHDVORZDVRIWKHSHUPLWWHGOHYHO7KHPDLQ
UHDVRQIRUWKLVLVWKDWWKHURWRUZLQGLQJLVDEOHWRGLVVLSDWHWKHKHDWPRUHHIILFLHQWO\
WKDQWKHVWDWRUZLQGLQJSDUWLFXODUO\ZLWKIDQGULYHQDLUIORZPDFKLQHV
'XULQJ VWDUWLQJ WKH VOLS ZLOO EH ORZ DQG ERWK WKH VWDWRU DQG URWRU FXUUHQWV ZLOO EH
KLJK WKHUHE\ FUHDWLQJ KHDW LQ ERWK ZLQGLQJV +RZHYHU D PRWRU ZLOO XVXDOO\ EH
GHVLJQHGWRDOORZRQHVWDUWZKHQLWKDVSUHYLRXVO\EHHQUXQDWDVWDWRUWHPSHUDWXUH
QRWH[FHHGLQJLWVUDWLQJ
)URPFROGWKHPRWRUWKHUPDOUHSOLFDFKDUDFWHULVWLFZLOOEHRQLWVFROGFXUYHZLWKWKH
KLJKHVW WULSSLQJ WLPHV $V WKH PDFKLQH LV UXQ RYHU D SHULRG RI WLPH WKH SURMHFWHG
WKHUPDOWULSWLPHVZLOOUHGXFHHYHQWXDOO\UHDFKLQJWKHLUPLQLPXPZKHQRSHUDWLQJRQ
WKH KRW FXUYH 8QIRUWXQDWHO\ DQ\ UDSLG LQFUHDVH LQ FXUUHQW IRU H[DPSOH D VWDUWLQJ
FRQGLWLRQPD\UHVXOWLQDQXQQHFHVVDU\WULS7KLVLVVKRZQLQILJXUH

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

7KHUPDORYHUORDGFKDUDFWHULVWLFFXUYHV
WKHUPDOFXUYHPRGLILFDWLRQ

10 000

1 000

&ROGFXUYH
7KHUPDOVWDWXV 
7H 7H

operating time

100


F
H
V

+RWFXUYH
7KHUPDOVWDWXV 
7H 7H

6WDUWLQJFKDUDFWHULVWLF

10

+RWFXUYH
7KHUPDOVWDWXV 
7H 7H

0
0,1

,IXOOORDG1
Load Current / Ith

)LJXUH7KHUPDOFXUYHPRGLILFDWLRQ

,WK

,VWDUW

10

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

,QWKHSDVWPRWRUPDQXIDFWXUHUVDQGHQGXVHUVKDYHEHHQDZDUHRIWKHOLPLWDWLRQRI
WKHVWDWRUWKHUPDOPRGHODQGWKHSRVVLEOHVROXWLRQKDVEHHQWRRYHUVL]HWKHPDFKLQH
&OHDUO\WKLVLVH[SHQVLYH
7KH3UHOD\LQFRUSRUDWHVDIHDWXUHZKHUHE\WKHWKHUPDOFXUYHPD\EHPRGLILHGWR
RYHUFRPH WKLV SUREOHP 3UHYLRXVO\ LW KDV EHHQ VHHQ WKDW WKH UHOD\ KDV D GXDO WLPH
FRQVWDQW 7DQG7 FKDUDFWHULVWLFIRUDSSOLFDWLRQVVXFKDVVWDUGHOWDVWDUWLQJ,QWKLV
H[DPSOH7ZDVVHWWRDORZHUYDOXHWKDQ7+RZHYHUWRHQDEOHDKRWUHVWDUWIRUD
'2/ PDFKLQH LW PD\ EH QHFHVVDU\ WR VHW 7 WR D KLJKHU YDOXH WKDQ 7 LQ RUGHU WR
DYRLGWKHVWDUWLQJFKDUDFWHULVWLF7KLVLVVKRZQLQILJXUH
2QH SUREOHP KHUH LV WKDW FXPXODWLYH VWDUWV ZLOO KHDW WKH URWRU DQG VWDWRU WR
GDQJHURXVO\KLJKOHYHOVDQGWKHWKHUPDOSURWHFWLRQZLOOQRWUHVSRQG)RUWXQDWHO\WKH
PRWRU PDQXIDFWXUHU LV DEOH WR JLYH LQIRUPDWLRQ RQ WKH QXPEHU RI KRW VWDUWV WKDW D
PRWRU FDQ ZLWKVWDQG DQG LQGHSHQGHQW H[FHVVLYH VWDUW SURWHFWLRQ FDQ EH XVHG WR
SUHYHQWGDPDJH 6HHWKH8VHU*XLGHSDUWRIWKLV7HFKQLFDO*XLGH 


7KHUPDO3UREH,QIOXHQFH
0RWRUVDUHGHVLJQHGWRRSHUDWHZLWKLQDVSHFLILFDPELHQWWHPSHUDWXUH,IWKHPDFKLQH
LV RSHUDWHG LQ D KLJKHU DPELHQW WHPSHUDWXUH WKDQ VSHFLILHG WKH ZLQGLQJV PD\
RYHUKHDWUHVXOWLQJLQLQVXODWLRQGHWHULRUDWLRQHYHQLILWLVRSHUDWLQJZLWKLQUDWHGORDG
7KHUHIRUH LI WKH PDFKLQH LV RSHUDWHG LQ DQ HQYLURQPHQW ZKHUH WKH DPELHQW
WHPSHUDWXUHPD\IOXFWXDWHLWLVLPSRUWDQWWRFRPSHQVDWHWKHWKHUPDORYHUORDGFXUYH
LQ RUGHU WR PDLQWDLQ FORVH WKHUPDO RYHUORDG SURWHFWLRQ 6WUDWHJLFDOO\ SODFHG
WHPSHUDWXUH VHQVRUV FDQ EH XVHG WR SURYLGH LQIRUPDWLRQ RQ DPELHQW FRQGLWLRQV
ZKLFK LQ WXUQ FDQ WKHQ EH XVHG WR LQIOXHQFH WKH WKHUPDO UHSOLFD 0RWRUV ZKLFK DUH
SDUWLFXODUO\ DW ULVN DUH WKRVH RSHUDWHG LQ GLUHFW VXQOLJKW ERLOHU KRXVHV WURSLFDO
HQYLURQPHQWVDQGPRWRUVZKLFKDUHUHOLDQWXSRQIRUFHGFRROLQJ
7KH SRZHUGHOLYHUHG E\ D PRWRU YDULHV ZLWK WKH DPELHQW WHPSHUDWXUH WKH IROORZLQJ
WDEOH VKRZV YDULDWLRQV LQ SRZHU GHOLYHUHG DV WKH WHPSHUDWXUH FKDQJHV IRU D W\SLFDO
PRWRU
$PELHQW7HPSHUDWXUH&



3RZHU GHOLYHUHG DV D  RI 


QRPLQDOSRZHU

















$V WKH QRPLQDO SRZHU YDULHV OLQHDUO\ ZLWK QRPLQDO FXUUHQW ZLWK D FRQVWDQW YROWDJH
WKHDERYHWDEOHLVDSSOLFDEOHWRQRPLQDOFXUUHQW
7KH WKHUPDO VHWWLQJ LV DOVR GLUHFWO\ SURSRUWLRQDO WR QRPLQDO FXUUHQW +HQFH WR
FRPSHQVDWH IRU WKH DPELHQW WHPSHUDWXUH YDULDWLRQ WKH WKHUPDO VHWWLQJ LV FRUUHFWHG
GHSHQGHQWXSRQWKHDPELHQWWHPSHUDWXUHIRUWKHIROORZLQJFRQGLWLRQV

GXULQJWKHFDOFXODWLRQRIWKHUPDOVWDWH

GXULQJWKHGHWHFWLRQRIWKHUPDODODUP

GXULQJWKHGHWHFWLRQRIWKHUPDORYHUORDG

GXULQJWKHGHWHFWLRQRIWKHUPDOORFNRXW

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

$FRUUHFWLRQFRHIILFLHQWLVFDOFXODWHGGHSHQGLQJXSRQWKHWHPSHUDWXUHDVVKRZQLQWKH
WDEOHEHORZDQGLVPXOWLSOLHGWRWKHWKHUPDOWKUHVKROGV
$PELHQW7HPSHUDWXUH&













0XOWLSOLFDWLRQ&RHIILFLHQW











7KH3DFFHSWVLQSXWVIURPXSWR57'CV UHVLVWDQFHWHPSHUDWXUHGHWHFWRUV 7ZR


RI WKHVH 57'CV RQH PDLQ DQG RQH EDFNXS  FDQ EH XVHG WR PHDVXUH WKH
H[WHUQDODPELHQWWHPSHUDWXUHDQGLQIOXHQFHVWKHWKHUPDOFXUYH


6SHFLILFDSSOLFDWLRQV

 ,QKLELWLRQRIWKHWKHUPDOWULSGXULQJVWDUWLQJ
,WPD\EHQHFHVVDU\WRGLVDEOHWKHWKHUPDORYHUORDGFXUYHZKHQVWDUWLQJPRWRUVZKLFK
KDYH H[WUHPH VWDUWLQJ FRQGLWLRQV VXFK DV YHU\ ORQJ VWDUW WLPHV RU YHU\ KLJK VWDUW
FXUUHQWYDOXHV:LWKWKLVIHDWXUHHQDEOHGLIWKHFDOFXODWHGWKHUPDOVWDWHUHDFKHV
EHIRUHWKHHQGRIWKHVWDUWLQJSHULRGWKLVYDOXHLVUHWDLQHGDWIRUWKHUHPDLQLQJ
VWDUWLQJSHULRG$WWKHHQGRIWKHVWDUWLQJSHULRGWKHLQKLELWLVUHPRYHG1RWHWKDWWKLV
IXQFWLRQGRHVQRWDIIHFWWKHRSHUDWLRQRIWKH7KHUPDO$ODUPIHDWXUH
 (PHUJHQF\5HVWDUW
:KHUHDPRWRUIRUPVSDUWRIDQHVVHQWLDOSURFHVVLWLVVRPHWLPHVGHVLUDEOHIRULWWR
FRQWLQXH RSHUDWLRQ HYHQ XQGHU VHYHUH RYHUORDG FRQGLWLRQV 7KLV XVXDOO\ PHDQV WKH
PRWRUEHLQJVXEMHFWHGWRWHPSHUDWXUHVLQH[FHVVRILWVGHVLJQOLPLWV(YHQWKRXJKWKLV
PD\ GHFUHDVH WKH OLIH RI WKH PRWRU RU HYHQ XQGHU H[WUHPH FLUFXPVWDQFHV EXUQ WKH
PRWRURXWWKLVPD\EHMXVWLILHGIRUWKHDSSOLFDWLRQ
 7KHUPDO$ODUP
7KHWKHUPDODODUPWKUHVKROGLVH[SUHVVHGDVDSHUFHQWDJHRIWKHWKHUPDOVWDWHRIWKH
PDFKLQH DQG LV XVHG WR JLYH DQ DODUP ZKHQ WKH WKHUPDO VWDWH UHDFKHV D
SUHGHWHUPLQHG YDOXH 7KHUH LV QR GHILQLWLYH VHWWLQJ IRU WKH WKHUPDO DODUP WKUHVKROG
VLQFHLWLVDSSOLFDWLRQGHSHQGHQW$W\SLFDOVHWWLQJZRXOGEH
 /RFNRXW7KUHVKROG
7KLVIDFLOLW\FDQEHXVHGWRLQKLELWDKRWUHVWDUWXQWLOWKHPRWRUKDVFRROHGWRWKHVWDUW
LQKLELWWKUHVKROG7KLVVHWWLQJLVH[SUHVVHGDVDSHUFHQWDJHRIWKHWKHUPDOVWDWHRIWKH
PRWRU$FRQWDFWLVGHVLJQHGWRRSHQZKHQWKHWKHUPDOVWDWHRIWKHPDFKLQHUHDFKHV
WKLV VHWWLQJ DQG FORVH DJDLQ ZKHQ WKH WKHUPDO VWDWH GURSV EHORZ WKLV VHWWLQJ 7KLV
FRQWDFW ZRXOG WKHUHIRUH EH ZLUHG LQWR WKH VWDUWLQJ FLUFXLWU\ LQ RUGHU WR SURYLGH WKH
LQKLELW
7KHUHLVQRGHILQLWLYHVHWWLQJIRUWKHORFNRXWWKUHVKROGVLQFHLWLVEDVHGRQWKHPRWRUV
FDSDELOLW\WRZLWKVWDQGDKRWUHVWDUW,WLVW\SLFDOO\VHWWRWKHPLQLPXPYDOXHRI,WK

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203



7*
&+$37(5
3DJHRI

5HVLVWLYHWHPSHUDWXUHGHWHFWRUV
3URORQJHGRYHUORDGLQJRIPRWRUVRUJHQHUDWRUVPD\FDXVHWKHLUZLQGLQJVWRRYHUKHDW
UHVXOWLQJLQSUHPDWXUHDJHLQJRIWKHLQVXODWLRQRULQH[WUHPHFDVHVLQVXODWLRQIDLOXUH
:RUQRUXQOXEULFDWHGEHDULQJVFDQDOVRJHQHUDWHORFDOLVHGKHDWLQJZLWKLQWKHEHDULQJ
KRXVLQJ  7R SURWHFW DJDLQVW DQ\ JHQHUDO RU ORFDOLVHG RYHUKHDWLQJ WKH 3 UHOD\V
KDYHWKHDELOLW\WRDFFHSWLQSXWVIURPUHVLVWLYHWHPSHUDWXUHVHQVLQJGHYLFHV 57'V 
6XFKSUREHVDUHVWUDWHJLFDOO\SODFHGLQDUHDVRIWKHPDFKLQHZKLFKDUHVXVFHSWLEOHWR
RYHUKHDWLQJRUKHDWGDPDJH
:KHUHSRZHUWUDQVIRUPHUVDUHORFDWHGFORVHWRWKHSURWHFWHGPDFKLQHFHUWDLQ57'
SUREHV FRXOG EH DVVLJQHG WR SURYLGH RYHUWHPSHUDWXUH SURWHFWLRQ IRU WKH
WUDQVIRUPHU V  7KLV ZRXOG SURWHFW DJDLQVW ZLQGLQJ KRW VSRW RYHUKHDWLQJ RU
RYHUWHPSHUDWXUHLQWKHEXONRIWKHLQVXODWLQJRLO



57'7KHUPDO3URWHFWLRQ)HDWXUHV
7\SLFDOO\DQ57'SUREHFDQPHDVXUHWHPSHUDWXUH ZLWKLQ WKH UDQJH WR  &
7KH WHPSHUDWXUH DW HDFK SUREH ORFDWLRQ FDQ EH GHWHUPLQHG E\ WKH UHOD\ DQG LV
DYDLODEOHIRU
R

7HPSHUDWXUHPRQLWRULQJGLVSOD\HGORFDOO\RUUHPRWHO\YLDWKHUHOD\
FRPPXQLFDWLRQV

$ODUPLQJVKRXOGDWHPSHUDWXUHWKUHVKROGEHH[FHHGHGIRUORQJHUWKDQDVHWWLPH
GHOD\

7ULSSLQJVKRXOGDWHPSHUDWXUHWKUHVKROGEHH[FHHGHGIRUORQJHUWKDQDVHWWLPH
GHOD\

6KRXOG WKH PHDVXUHG UHVLVWDQFH EH RXWVLGH RI WKH SHUPLWWHG UDQJH DQ 57' IDLOXUH
DODUPZLOOEHUDLVHGLQGLFDWLQJDQRSHQRUVKRUWFLUFXLW57'LQSXW
1RWH WKDW GLUHFW WHPSHUDWXUH PHDVXUHPHQW FDQ SURYLGH PRUH UHOLDEOH WKHUPDO
SURWHFWLRQ WKDQ GHYLFHV ZKLFK XVH D WKHUPDO UHSOLFD HQHUJLVHG IURP SKDVH FXUUHQW
7KHODWWHULVVXVFHSWLEOHWRLQDFFXUDFLHVLQWLPHFRQVWDQWVXVHGE\WKHUHSOLFDPRGHO
DQGDOVRLQDFFXUDFLHVGXHWRWKHYDULDWLRQLQDPELHQWWHPSHUDWXUH

7*
&+$37(5
3DJHRI



7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

57'7KHUPDO3URWHFWLRQ6HWWLQJV
7\SLFDORSHUDWLQJWHPSHUDWXUHVIRUSURWHFWHGSODQWDUHJLYHQ$FWXDOILJXUHVPXVWEH
REWDLQHGIURPWKHHTXLSPHQWPDQXIDFWXUHUV
3DUDPHWHU

7\SLFDO6HUYLFH
7HPSHUDWXUHDW)XOO
/RDG

%HDULQJWHPSHUDWXUHRI
PRWRUVRUJHQHUDWRUV

3RVVLEO\ &
GHSHQGLQJRQWKHW\SHRI
EHDULQJ

 &

7RSRLOWHPSHUDWXUHRI
WUDQVIRUPHUV

 &  &DERYH


DPELHQW 

$WHPSHUDWXUHJUDGLHQWIURP
ZLQGLQJWHPSHUDWXUHLV
XVXDOO\DVVXPHGVXFKWKDW
WRSRLO57'VFDQSURYLGH
ZLQGLQJSURWHFWLRQ

:LQGLQJKRWVSRW
WHPSHUDWXUH

 &IRUQRUPDODJHLQJ
RILQVXODWLRQ

&\FOLFRYHUORDGLQJPLJKWJLYH
 &GXULQJHPHUJHQFLHV

6KRUW7HUP2YHUORDGLQJ

7KH3UHOD\KDVDQDODUPWKUHVKROGVHWWLQJZLWKDWLPHGHOD\IRUHDFK57'LQSXW
(DFKLQSXWDOVR KDV D WULS HOHPHQW ZLWK D WHPSHUDWXUH WKUHVKROG DQG D WLPH GHOD\
7KHWLPHGHOD\VPD\EHVHWWRVLILQVWDQWDQHRXVSURWHFWLRQLVUHTXLUHG
7HPSHUDWXUHVHWWLQJVPD\EHVHWLQGHJUHHV&HOVLXVZLWKLQWKHUDQJH &
R



6KRUWFLUFXLWSURWHFWLRQ
%HFDXVH RI WKH UHODWLYHO\ ODUJH DPRXQW RI LQVXODWLRQ EHWZHHQ SKDVH ZLQGLQJV IDXOWV
EHWZHHQ SKDVHV VHOGRP RFFXU $V WKH VWDWRU ZLQGLQJV DUH FRPSOHWHO\ HQFORVHG LQ
HDUWKHGPHWDOPRVWIDXOWVZLOOLQYROYHHDUWKZKLFKZRXOGWKHQRSHUDWHWKHHDUWKIDXOW
SURWHFWLRQ +RZHYHU D IDVW RSHUDWLQJ RYHUFXUUHQW HOHPHQW LV RIWHQ HPSOR\HG WR
SURWHFW DJDLQVW SKDVH IDXOWV RFFXUULQJ DW WKH PRWRU WHUPLQDOV VXFK DV WHUPLQDO
IODVKRYHUV
7KHVKRUWFLUFXLWSURWHFWLRQLQFOXGHGZLWKLQWKH3UHOD\VFRQVLVWVRIDQDGMXVWDEOH
FXUUHQWWKUHVKROGDQGDGHILQLWHWLPHVHWWLQJ
,QRUGHUWRDYRLGWULSSLQJGXULQJVWDUWXSDVDUHVXOWRIDV\PPHWULF&7VDWXUDWLRQWKLV
HOHPHQW DV D PLQLPXP RSHUDWLQJ WLPH RI PV IRU FXUUHQWV LQ WKH UDQJH ,! WR
,!

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

7KHGHILQLWHWLPHFKDUDFWHULVWLFLVVKRZQEHORZ
Time T
100ms

40ms

I>

1.2I>

Current I

)LJXUH2YHUFXUUHQWHOHPHQW


6HWWLQJ*XLGHOLQHV
,QRUGHUWRSUHYHQWRSHUDWLRQGXULQJVWDUWLQJWKHLQVWDQWDQHRXVHOHPHQWLVXVXDOO\VHW
WRWLPHVWKHPD[LPXPVWDUWLQJFXUUHQW
7KHWLPHUVHWWLQJLVYHU\PXFKV\VWHPGHSHQGHQWEXWPD\W\SLFDOO\EHVHWWRDYDOXH
LQWKHUHJLRQRIPV
1RWHWKDWLIWKHPRWRULVFRQWUROOHGE\DIXVHGFRQWDFWRUWKHQWKLVIHDWXUHZLOOQHHGWR
EHFRRUGLQDWHGZLWKWKHIXVH7KLVLVWRSUHYHQWWKHFRQWDFWRUDWWHPSWLQJWRLQWHUUXSW
FXUUHQWLQH[FHVVRILWVEUHDNLQJFDSDFLW\



6HWWLQJ([DPSOH
8WLOLVLQJWKHSUHYLRXVO\VSHFLILHGPRWRUSDUDPHWHUVVHW
,!&XUUHQW6HW  [[  ,Q
,!7LPH'HOD\ PV
7KHVHVHWWLQJVDUHLOOXVWUDWHGJUDSKLFDOO\RQILJXUH



(DUWKIDXOWSURWHFWLRQ
2QHRIWKHPRVWFRPPRQIDXOWVWRRFFXURQDPRWRULVDVWDWRUZLQGLQJIDXOW7KLVLV
XVXDOO\ WKH UHVXOW RI SURORQJHG RU F\FOLF RYHUKHDWLQJ ZKLFK FDXVHV WKH LQVXODWLRQ WR
GHWHULRUDWH6LQFHWKHZLQGLQJVDUHVXUURXQGHGE\DQHDUWKHGPHWDOFDVHVWDWRUIDXOWV
XVXDOO\ PDQLIHVW WKHPVHOYHV DV HDUWKIDXOWV 7KH W\SH RI HDUWKIDXOW SURWHFWLRQ DQG &7
DUUDQJHPHQW DGRSWHG ZLOO GHSHQG RQ WKH DPRXQW RI HDUWK IDXOW FXUUHQW DYDLODEOH
GXULQJ D IDXOW 7KH PDJQLWXGH RI FXUUHQW LV GHSHQGHQW XSRQ WKH V\VWHP HDUWKLQJ
DUUDQJHPHQWV
7KH 3 HDUWK IDXOW HOHPHQW LV HTXLSSHG ZLWK WZR LQGHSHQGHQW VWDJHV ZKLFK DUH
VHOHFWDEOH DV HLWKHU IRUZDUG UHYHUVH RU QRQGLUHFWLRQDO 7KH ILUVW VWDJH PD\ EH
VHOHFWHGDVHLWKHU,'07RU'7DQGWKHVHFRQGVWDJHLV'7RQO\

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

7KH LQYHUVH WLPH GHOD\HG FKDUDFWHULVWLFV OLVWHG DERYH FRPSO\ ZLWK WKH IROORZLQJ
IRUPXOD

W 7[^>. ,,V  @/`

ZKHUH
W
.
,
,V

/
7

RSHUDWLRQWLPH
FRQVWDQW
PHDVXUHGFXUUHQW
FXUUHQWWKUHVKROGVHWWLQJ
FRQVWDQW
$16,,(((FRQVWDQW ]HURIRU,(&FXUYHV
7LPHPXOWLSOLHU6HWWLQJRU7LPH'LDO6HWWLQJ

&XUYHGHVFULSWLRQ

6WDQGDUG

.FRQVWDQW

FRQVWDQW

/FRQVWDQW

6WDQGDUG,QYHUVH

,(&





9HU\,QYHUVH

,(&



([WUHPHO\,QYHUVH

,(&



/RQJ7LPH,QYHUVH

8.



0RGHUDWHO\,QYHUVH

,(((







9HU\,QYHUVH

,(((





([WUHPHO\,QYHUVH

,(((





,QYHUVH

86&





6KRUW7LPH,QYHUVH

86&







1RWHWKDWWKH,(((DQG86FXUYHVDUHVHWGLIIHUHQWO\WRWKH,(&8.FXUYHVZLWKUHJDUG
WRWKHWLPHVHWWLQJ$PXOWLSOLHUVHWWLQJ 706 LVXVHGWRDGMXVW WKH RSHUDWLQJWLPH RI
WKH,(&FXUYHVZKHUHDVDWLPHGLDOVHWWLQJLVHPSOR\HGIRUWKH,(((86FXUYHV%RWK
WKH706DQG7LPH'LDOVHWWLQJVDFWDVPXOWLSOLHUVRQWKHEDVLF706
1RWHDOOWKHFXUYHVDUHJLYHQLQ$SSHQGL[
7KH HOHPHQW RSHUDWHV IURP UHVLGXDO FXUUHQW REWDLQHG IURP HLWKHU WKH UHVLGXDO
FRQQHFWLRQRIWKHWKUHHSKDVH &7CV RU IURP DQ LQGHSHQGHQW FRUH EDODQFH &7 7KH
FRUHEDODQFH&7LVQRUPDOO\RIWKHULQJW\SHWKURXJKWKHFHQWUHRIZKLFK LV SDVVHG
WKHWKUHHSKDVHFDEOHWRWKHPRWRU7KHDGYDQWDJHLQXVLQJWKLV&7DUUDQJHPHQWOLHV
LQ WKH IDFW WKDW RQO\ RQH &7 FRUH LV XVHG LQ SODFH RI WKH FRQYHQWLRQDO WKUHH SKDVH
&7CV ZKRVH WKUHH VHFRQGDU\ ZLQGLQJV DUH UHVLGXDOO\ FRQQHFWHG ,Q WKLV ZD\ WKH &7
PDJQHWLVLQJFXUUHQWDWUHOD\RSHUDWLRQLVUHGXFHGE\DSSUR[LPDWHO\WKUHHWRRQHDQ
LPSRUWDQWFRQVLGHUDWLRQLQWKHGHWHFWLRQRI ORZ OHYHO HDUWKIDXOWV ZKHUH ORZ HIIHFWLYH
VHWWLQJV DUH UHTXLUHG )XUWKHUPRUH WKH SULPDU\ FXUUHQW UDWLQJ GRHV QRW QHHG WR EH
UHODWHG WR PRWRU IXOO ORDG FXUUHQW DV QR VHFRQGDU\ FXUUHQW IORZV XQGHU QRUPDO
EDODQFHG FRQGLWLRQV 7KLV DOORZV WKH &7 UDWLR WR EH FKRVHQ VXFK DV WR RSWLPLVH WKH
HIIHFWLYHSULPDU\SLFNXSFXUUHQW
&RUHEDODQFHWUDQVIRUPHUVDUHQRUPDOO\PRXQWHGRYHUDFDEOHDWDSRLQWFORVHWRWKH
FDEOHJODQG3K\VLFDOO\VSOLWFRUHVWKDWLVVOLSRYHUW\SHVDUHQRUPDOO\DYDLODEOHIRU
DSSOLFDWLRQV LQ ZKLFK WKH FDEOH LV DOUHDG\ LQ SRVLWLRQ DV RQ H[LVWLQJ LQVWDOODWLRQV
)LJXUHLOOXVWUDWHVWKHFRUUHFWPHWKRGRIHDUWKLQJWKHFDEOHVKHDWKZKHQXVLQJDFRUH
EDODQFH&7

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

&DEOHJODQG
&DEOHER[

&DEOHJODQGVKHDWK
HDUWKFRQQHFWLRQ

6()

6()

1RRSHUDWLRQ

2SHUDWLRQ
6()

)LJXUH&RUHEDODQFHG&7ZLWKFDEOH
:KHUH GLUHFWLRQDO HDUWKIDXOW SURWHFWLRQ LV UHTXLUHG WKH HOHPHQW VKRXOG EH SRODULVHG
IURPUHVLGXDOYROWDJH 9R 7KLVLVGHULYHGIURPHLWKHUWKHWKUHHSKDVH97LQSXWVWR
WKHUHOD\RUWKH UHVLGXDOYROWDJHLQSXW7KHPRGHRIFRQQHFWLRQFDQ EH VHOHFWHG YLD
WKH+0,
'LIIHUHQW97UDWLRVHWWLQJVIRUWKHWZRPRGHVRIFRQQHFWLRQDUHDYDLODEOH

7*
&+$37(5
3DJHRI



7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

6ROLGO\(DUWKHG6\VWHP

 3ULQFLSOH
2Q VROLGO\ HDUWKHG V\VWHPV IRU HDUWK IDXOW VHWWLQJV ! RI WKH PRWRU FRQWLQXRXV
UDWHGFXUUHQWLWLVDFFHSWDEOHWRXVHWKHFRQYHQWLRQDOUHVLGXDO&7FRQQHFWLRQIRUWKH
GHWHFWLRQRIHDUWKIDXOWV%HORZWKLVYDOXHWKHXVHRIDFRUHEDODQFH&7PD\EHPRUH
DSSOLFDEOH
&DUHPXVWEHWDNHQWRHQVXUHWKDWWKHUHOD\GRHVQRW RSHUDWH IURP WKH VSLOO FXUUHQW
UHVXOWLQJ IURP DV\PPHWULF &7 VDWXUDWLRQ GXULQJ VWDUWLQJ 7R DFKLHYH VWDELOLW\ XQGHU
WKHVHFRQGLWLRQVLWLVXVXDOWRLQVHUWDVWDELOLVLQJUHVLVWRULQVHULHVZLWKWKHUHOD\7KH
UHTXLUHGYDOXHRIUHVLVWRULVFDOFXODWHGDVIROORZV

R stab =

I st
(R ct + N.R 1 + R r )
Io

ZKHUH
,R HDUWKIDXOWVHWWLQJLQDPSV
,VW PRWRUVWDUWLQJFXUUHQWUHIHUUHGWR&7VHFRQGDU\
5FW GFUHVLVWDQFHRI&7VHFRQGDU\
1 IRUZLUH&7FRQQHFWLRQ VWDUSRLQWDW&76
IRUZLUH&7FRQQHFWLRQ ERWKVWDUSRLQWVIRUPHGDWUHOD\SDQHO 
5 UHVLVWDQFHRIVLQJOHOHDGIURPUHOD\WR&7
5  5HOD\UHVLVWDQFHLQRKPV
U

 7\SLFDOVHWWLQJV
7\SLFDOO\ WKH HDUWK IDXOW HOHPHQW VKRXOG EH VHW QRQGLUHFWLRQDO ZLWK D VHWWLQJ RI
DSSUR[LPDWHO\RIWKHPRWRUFRQWLQXRXVUDWHGFXUUHQW
:KHUH D VWDELOLVLQJ UHVLVWRU LV XVHG WKH HDUWKIDXOW HOHPHQW VKRXOG EH VHW
LQVWDQWDQHRXV ,I RQH LV QRW XVHG VWDELOLW\ GXULQJ DV\PPHWULF &7 VDWXUDWLRQ FDQ EH
DFKLHYHG E\ WLPH GHOD\LQJ WKH HDUWKIDXOW HOHPHQW 7KH DFWXDO WLPHU VHWWLQJ LV YHU\
PXFKV\VWHPGHSHQGHQW

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

,I WKH PRWRU LV VXSSOLHG E\ D IXVHG FRQWDFWRU LW LV LPSRUWDQW WRJUDGH WKH HDUWKIDXOW
SURWHFWLRQ WR HQVXUH WKDW WKH FRQWDFWRU GRHV QRW DWWHPSW WR LQWHUUXSW IDXOW FXUUHQW LQ
H[FHVVRILWVEUHDNLQJFDSDFLW\7KHILJXUHJLYHVDQH[DPSOH
Time

Fuse

Earthfault relay

Contactor
breaking
capacity

Current

)LJXUH)XVHFKDUDFWHULVWLF


,QVXODWHG6\VWHP

 3ULQFLSOH
7KH DGYDQWDJHJDLQHG E\ UXQQLQJ D SRZHU V\VWHP ZKLFK LV LQVXODWHG IURP HDUWK LV
WKHIDFWWKDWGXULQJ D VLQJOH SKDVH WR HDUWK IDXOW FRQGLWLRQ QR HDUWK IDXOW FXUUHQW LV
DOORZHG WR IORZ &RQVHTXHQWO\ LW LV SRVVLEOH WR PDLQWDLQ SRZHU IORZ RQ WKH V\VWHP
HYHQ ZKHQ DQ HDUWK IDXOW FRQGLWLRQ LV SUHVHQW +RZHYHU WKLV DGYDQWDJH LV RIIVHW E\
WKHIDFWWKDWWKHUHVXOWDQWVWHDG\VWDWHDQGWUDQVLHQWRYHUYROWDJHVRQWKHVRXQGSKDVHV
FDQEHYHU\KLJK
&OHDUO\ RSHUDWLRQDO DGYDQWDJHV PD\ EH JDLQHG E\ WKH XVH RI LQVXODWHG V\VWHPV
+RZHYHU LW LV VWLOO YLWDO WKDW GHWHFWLRQ RI WKH IDXOW LV DFKLHYHG 7KLV LV REYLRXVO\ QRW
SRVVLEOHE\PHDQVRIVWDQGDUGFXUUHQWRSHUDWHGHDUWKIDXOWSURWHFWLRQ2QHSRVVLELOLW\
IRUIDXOWGHWHFWLRQ LV E\ PHDQV RI D UHVLGXDO RYHUYROWDJH GHYLFH 7KLV IXQFWLRQDOLW\ LV
LQFOXGHG ZLWKLQ WKH 3 UHOD\ DQG LV GHWDLOHG LQ VHFWLRQ   +RZHYHU IXOO\
GLVFULPLQDWLYH HDUWK IDXOW SURWHFWLRQ RQ WKLV W\SH RI V\VWHP PD\ EH DFKLHYHG E\ WKH
DSSOLFDWLRQ RI D VHQVLWLYH HDUWK IDXOW HOHPHQW 7KLV W\SH RI UHOD\ LV VHW WR GHWHFW WKH
UHVXOWDQW LPEDODQFH LQ WKH V\VWHP FKDUJLQJ FXUUHQWV WKDW RFFXUV XQGHU HDUWK IDXOW
FRQGLWLRQV,WLVWKHUHIRUHHVVHQWLDOWKDWDFRUHEDODQFH&7LVXVHGIRUWKLVDSSOLFDWLRQ

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

&RQVLGHU)LJXUH
Ia1
Ib1

IR1
-jXc1

IH1
Ia2
Ib2

IR2

IH3
-jXc2

IH2
Ia3
Ib3
IH1+ IH2+ IH3

IR3
-jXc3

IR3 = IH1+ IH2 + IH3 - IH3 :IR3 = IH1+ IH2

IH3

IH1+ IH2

)LJXUH&XUUHQWGLVWULEXWLRQLQDQ,QVXODWHGV\VWHPZLWK&3KDVHIDXOW
)URP ILJXUH  LW FDQ EH VHHQ WKDW WKH UHOD\V RQ WKH KHDOWK\ PRWRU IHHGHUV VHH WKH
XQEDODQFH LQ WKH FKDUJLQJ FXUUHQWV IRU WKHLU RZQ IHHGHU 7KH UHOD\ RQ WKH IDXOWHG
IHHGHUKRZHYHUVHHVWKHFKDUJLQJFXUUHQWIURPWKHUHVWRIWKHV\VWHP ,+DQG,+LQ
WKLVFDVH ZLWKLWVRZQIHHGHUVFKDUJLQJFXUUHQW ,+ EHFRPLQJFDQFHOOHGRXW7KLVLV
IXUWKHULOOXVWUDWHGE\WKHSKDVRUGLDJUDPVVKRZQLQ)LJXUH

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

Vaf
IR1

Restrain
Vapf
Ib1

Operate

Ia1

Vbf
Vcpf
Vbpf

Vres
(= -3Vo)

An RCA setting of +90 shifts


the MTA to here

IR3= -(IH1+ IH2)

)LJXUH3KDVRUGLDJUDPVIRU,QVXODWHGV\VWHPZLWK&3KDVH)DXOW
5HIHUULQJWRWKHSKDVRUGLDJUDPLWFDQEHVHHQWKDWWKH&SKDVHWRHDUWKIDXOWFDXVHV
WKHYROWDJHVRQ WKH KHDOWK\ SKDVHV WR ULVH E\ D IDFWRU RI  7KH$ SKDVH FKDUJLQJ
FXUUHQWV ,D  LV WKHQ VKRZQ WR EH OHDGLQJ WKH UHVXOWDQW $ SKDVH YROWDJH E\ 
/LNHZLVHWKH%SKDVHFKDUJLQJFXUUHQWOHDGVWKHUHVXOWDQW9EE\
7KHXQEDODQFHFXUUHQWGHWHFWHGE\DFRUHEDODQFHFXUUHQWWUDQVIRUPHURQWKHKHDOWK\
PRWRU IHHGHUV FDQ EH VHHQ WR EH D VLPSOH YHFWRU DGGLWLRQ RI ,D DQG ,E JLYLQJ D
UHVLGXDOFXUUHQWZKLFKOLHVDWH[DFWO\ODJJLQJWKHUHVLGXDOYROWDJH 9R $VWKH
KHDOWK\SKDVHYROWDJHVKDYHULVHQE\DIDFWRURIWKHFKDUJLQJFXUUHQWVRQ WKHVH
SKDVHV ZLOO DOVR EH  WLPHV ODUJHU WKDQ WKHLU VWHDG\ VWDWH YDOXHV 7KHUHIRUH WKH
PDJQLWXGHRIUHVLGXDOFXUUHQW,5LVHTXDOWR[WKHVWHDG\VWDWHSHUSKDVHFKDUJLQJ
FXUUHQW
7KH SKDVRU GLDJUDPV LQGLFDWH WKDW WKH UHVLGXDO FXUUHQWV RQ WKH KHDOWK\ DQG IDXOWHG
PRWRUIHHGHUV,5DQG,5UHVSHFWLYHO\DUHLQDQWLSKDVH$GLUHFWLRQDOHOHPHQWFRXOG
WKHUHIRUHEHXVHGWRSURYLGHGLVFULPLQDWLYHHDUWKIDXOWSURWHFWLRQ
,IWKHSRODULVLQJYROWDJHRIWKLVHOHPHQW9UHV HTXDOWR9R LVVKLIWHGWKURXJK
WKHUHVLGXDOFXUUHQWVHHQE\WKHUHOD\RQWKHIDXOWHGIHHGHUZLOOOLHZLWKLQWKHRSHUDWH
UHJLRQRIWKHGLUHFWLRQDOFKDUDFWHULVWLFDQGWKHFXUUHQWRQWKHKHDOWK\IHHGHUVZLOOIDOO
ZLWKLQWKHUHVWUDLQUHJLRQ
,WVKRXOGEHQRWHGWKDWWKHDFWXDOUHVLGXDOYROWDJHXVHGDVDUHIHUHQFHVLJQDOIRUWKH
GLUHFWLRQDOHDUWKIDXOWSURWHFWLRQLQWKH3UHOD\LVLQWHUQDOO\SKDVHVKLIWHGE\
DQGLVWKHUHIRUHVKRZQDV9RLQWKHYHFWRUGLDJUDPV
$V SUHYLRXVO\ VWDWHG WKH UHTXLUHG FKDUDFWHULVWLF DQJOH VHWWLQJ IRU WKH VHQVLWLYH HDUWK
IDXOWHOHPHQWZKHQDSSOLHGWRLQVXODWHGV\VWHPVLV,WVKRXOGEHQRWHGWKRXJK
WKDWWKLVUHFRPPHQGHGVHWWLQJFRUUHVSRQGVWRWKHUHOD\EHLQJFRQQHFWHGVXFKWKDWLWV
GLUHFWLRQRIFXUUHQWIORZIRURSHUDWLRQLVIURPWKHPRWRUIHHGHULQWRWKHEXVEDU7KH
FRUUHFWUHOD\FRQQHFWLRQVWRJLYHDGHILQHGGLUHFWLRQIRURSHUDWLRQDUHVKRZQRQWKH
UHOD\FRQQHFWLRQGLDJUDPLQ$SSHQGL[

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

7KH 3 UHOD\ LQWHUQDOO\ GHULYHV WKH UHVLGXDO SRODULVLQJ YROWDJH IRU WKH GLUHFWLRQDO
HDUWKIDXOWHOHPHQW&RQVHTXHQWO\HLWKHUDOLPERUWKUHHVLQJOHSKDVH97VVKRXOG
EH DSSOLHG WR GULYH WKH UHOD\ QRW D 97 RI WKH WKUHHOLPE GHVLJQ 7KH IRUPHU W\SHV
DOORZWKHSDVVDJHRIUHVLGXDOIOX[WKURXJKWKH97DQGFRQVHTXHQWO\SHUPLWWKHUHOD\
WRGHULYHWKHUHTXLUHGUHVLGXDOYROWDJH$WKUHHOLPE97SURYLGHVQRSDWKIRUWKHIORZ
RIUHVLGXDOIOX[DQGLVWKHUHIRUHXQVXLWDEOH$OWHUQDWLYHO\WKHUHOD\FDQEHGULYHQE\D
SKDVHWRSKDVHFRQQHFWHG97ZLWKDEURNHQGHOWDZLQGLQJFRQQHFWHGWRWKHUHVLGXDO
YROWDJHLQSXW
1RWHWKDWGLVFULPLQDWLRQFDQEHSURYLGHGZLWKRXWWKHQHHGIRUGLUHFWLRQDOFRQWURO7KLV
FDQRQO\EHDFKLHYHGLILWLVSRVVLEOHWRVHWWKHUHOD\LQH[FHVVRIWKHFKDUJLQJFXUUHQW
RIWKHSURWHFWHGIHHGHUDQGEHORZWKHFKDUJLQJFXUUHQWIRUWKHUHVWRIWKHV\VWHP
 6HWWLQJ*XLGHOLQHV
$V KDV EHHQ SUHYLRXVO\ VKRZQ WKH UHVLGXDO FXUUHQW GHWHFWHG E\ WKH UHOD\ RQ WKH
IDXOWHGIHHGHULVHTXDOWRWKHVXPRIWKHFKDUJLQJFXUUHQWVIORZLQJIURPWKHUHVWRIWKH
V\VWHP )XUWKHU DV VWDWHG HDUOLHU WKH DGGLWLRQ RI WKH WZR KHDOWK\ SKDVH FKDUJLQJ
FXUUHQWV RQ HDFK IHHGHU JLYHV D WRWDO FKDUJLQJ FXUUHQW ZKLFK KDV D PDJQLWXGH RI
WKUHH WLPHV WKH SHU SKDVH YDOXH 7KHUHIRUH WKH WRWDO XQEDODQFH FXUUHQW GHWHFWHG E\
WKH UHOD\ LV HTXDO WR WKUHH WLPHV WKH SHU SKDVH FKDUJLQJ FXUUHQW RI WKH UHVW RI WKH
V\VWHP$W\SLFDOUHOD\VHWWLQJPD\WKHUHIRUHEHLQWKHRUGHURIRIWKLVYDOXHLH
HTXDOWRWKHSHUSKDVHFKDUJLQJFXUUHQWRIWKHUHPDLQLQJV\VWHP3UDFWLFDOO\WKRXJK
WKH UHTXLUHG VHWWLQJ PD\ ZHOO EH GHWHUPLQHG RQ VLWH ZKHUH V\VWHP IDXOWV FDQ EH
DSSOLHGDQGVXLWDEOHVHWWLQJVFDQEHDGRSWHGEDVHGXSRQSUDFWLFDOO\REWDLQHGUHVXOWV
7KHXVHRIWKH3UHOD\VFRPSUHKHQVLYHPHDVXUHPHQWDQGIDXOWUHFRUGLQJIDFLOLWLHV
PD\SURYHYHU\XVHIXOLQWKLVUHVSHFW
7KHWLPHUVHWWLQJRIWKLVHOHPHQWLVQRWFULWLFDOVLQFHIRUWKHILUVWIDXOWRQO\FDSDFLWLYH
FXUUHQW H[LVWV RQ WKH V\VWHP +RZHYHU IRU VXEVHTXHQW IDXOWV IDVW WULSSLQJ ZLOO EH
UHTXLUHG ,I WKH PRWRU LV RSHUDWHG YLD D IXVHG FRQWDFWRU LW LV LPSRUWDQW WR GHOD\ WKH
SURWHFWLRQ VXIILFLHQWO\ LQ RUGHU WR HQVXUH WKDW WKH FRQWDFWRU GRHV QRW DWWHPSW WR
LQWHUUXSWIDXOWFXUUHQWLQH[FHVVRILWVEUHDNLQJFDSDFLW\


5HVLVWDQFH(DUWKHG6\VWHPV
(DUWKLQJ WKH V\VWHP E\ PHDQV RI D UHVLVWRU UHGXFHV ERWK WKH IDXOW FXUUHQW DQG
WUDQVLHQW RYHUYROWDJHV ,Q DGGLWLRQ WR WKLV UHVLVWDQFH HDUWKLQJ FDQ VRPHWLPHV EH
DGYDQWDJHRXV LQ KD]DUGRXV HQYLURQPHQWV VXFK DV PLQHV HWF VLQFH WKH HDUWKLQJ
UHVLVWDQFHHIIHFWLYHO\UHGXFHVWRXFKDQGVWHSSRWHQWLDOVGXULQJHDUWKIDXOWV

 6HWWLQJ*XLGHOLQHV
2Q D UHVLVWDQFH HDUWKHG V\VWHP LW LV FRPPRQ SUDFWLFH WR OLPLW WKH IDXOW FXUUHQW WR
DSSUR[LPDWHO\IXOOORDGFXUUHQW
)RUVXFKDQDSSOLFDWLRQWKHUHOD\PD\EHVHWQRQGLUHFWLRQDOZLWKDFXUUHQWVHQVLWLYLW\
RI OHVV WKDQ  RI WKH PLQLPXP HDUWK IDXOW OHYHO EXW JUHDWHU WKDQ WKUHH WLPHV WKH
VWHDG\VWDWHFKDUJLQJFXUUHQWRIWKHPRWRUIHHGHU ,WLVDSSDUHQWIURP)LJXUHWKDW
WKH KHDOWK\ IHHGHU UHJDUGOHVV RI WKH PHWKRG RI HDUWKLQJ ZLOO VHH WKLV YDOXH RI
FKDUJLQJFXUUHQW 
6LPLODU JXLGHOLQHV WR WKRVH JLYHQ IRU VROLGO\ HDUWKHG V\VWHPV VHFWLRQ   DUH
DSSOLFDEOHZLWKUHJDUGWRWKHUHTXLUHGWLPHGHOD\VHWWLQJ

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

1RWHWKDWLIWKHDERYHVHWWLQJJXLGHOLQHVIRUDSSO\LQJDQRQGLUHFWLRQDOUHOD\FDQQRW
EH DFKLHYHG GXH WR WKH FXUUHQW PDJQLWXGHV WKHQ D VHQVLWLYH GLUHFWLRQDO HDUWK IDXOW
HOHPHQW ZLOO EH UHTXLUHG 7KLV HOLPLQDWHV WKH QHHG WR VHW WKH UHOD\ LQ H[FHVV RI WKH
FKDUJLQJFXUUHQWIRUWKHSURWHFWHGIHHGHU
 +LJK5HVLVWDQFH(DUWKLQJ
)RUFHUWDLQDSSOLFDWLRQVWKHIDXOWFXUUHQWPD\EHVHYHUHO\OLPLWHGE\WKHXVHRIYHU\
KLJKUHVLVWDQFHHDUWKLQJ,WLVXVXDOLQWKLVFDVHWRFKRRVHDYDOXHRIUHVLVWRUZKLFKZLOO
OLPLWWKHUHVLVWLYHIDXOWFXUUHQWWRDVLPLODUPDJQLWXGHDVWKHV\VWHPFKDUJLQJFXUUHQW
7KHUHIRUH FKDUJLQJ FXUUHQW ZLOO KDYH D PDUNHG LQIOXHQFH RQ WKH DQJOH RI WKH IDXOW
FXUUHQWZLWKUHVSHFWWRWKHSRODULVLQJYROWDJH 9R 
,Q WKLV DSSOLFDWLRQ VHQVLWLYH GLUHFWLRQDO HDUWKIDXOW SURWHFWLRQ RSHUDWHG IURP D FRUH
EDODQFH &7 ZLOO EH UHTXLUHG7KH UHOD\ FKDUDFWHULVWLF DQJOH VHWWLQJ VKRXOG WKHUHIRUH
EHVHWWR UHIHUWRILJXUH ,WVKRXOGEHQRWHGWKRXJKWKDWWKLVUHFRPPHQGHG
VHWWLQJ FRUUHVSRQGV WR WKH UHOD\ EHLQJ FRQQHFWHG VXFK WKDW LWV GLUHFWLRQ RI FXUUHQW
IORZIRURSHUDWLRQLVIURPWKHPRWRUIHHGHULQWRWKHEXVEDU
7KH FXUUHQW VHQVLWLYLW\ RI WKH UHOD\ VKRXOG EH DSSUR[LPDWHO\  RI  WLPHV WKH
FKDUJLQJFXUUHQWIRUWKHUHVWRIWKHV\VWHP [VWHDG\VWDWHYDOXH 7KHFRUUHFWUHOD\
FRQQHFWLRQV WR JLYH D GHILQHG GLUHFWLRQ IRU RSHUDWLRQ DUH VKRZQ RQ WKH UHOD\
FRQQHFWLRQGLDJUDPLQ$SSHQGL[
7KHWLPHUVHWWLQJRIWKLVHOHPHQWLVQRWFULWLFDOVLQFHIRUWKHILUVWIDXOWPLQLPDOGDPDJH
ZLOOUHVXOW+RZHYHUIRUVXEVHTXHQWIDXOWVIDVWWULSSLQJZLOOEHUHTXLUHG
1RWH WKDW VLPLODU FRPPHQWV DSSO\ ZLWK UHVSHFW WR WKRVH JLYHQ LQ VHFWLRQ 
UHJDUGLQJ WKH 97 UHTXLUHPHQWV IRU WKH 3 UHOD\ ZKHQ GLUHFWLRQDOLVLQJ HDUWK IDXOW
HOHPHQWV 5&$ UHOD\FKDUDFWHULVWLFDQJOH 
,1FDSDFLWLYH

,1

5&$

,1UHVLVWLYH

7ULSSLQJ]RQH

)LJXUH'LUHFWLRQDOWULSSLQJFKDUDFWHULVWLF

91S

7*
&+$37(5
3DJHRI



7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

3HWHUVHQ&RLO(DUWKHG6\VWHPV

 3ULQFLSOH
3RZHU V\VWHPV DUH XVXDOO\ HDUWKHG LQ RUGHU WR OLPLW WUDQVLHQW RYHUYROWDJHV GXULQJ
DUFLQJ IDXOWV DQG DOVR WR DVVLVW ZLWK GHWHFWLRQ DQG FOHDUDQFH RI HDUWK IDXOWV
,PSHGDQFHHDUWKLQJKDVWKHDGYDQWDJHRIOLPLWLQJGDPDJHLQFXUUHGE\SODQWGXULQJ
HDUWKIDXOWFRQGLWLRQVDQGDOVROLPLWVWKHULVNRIH[SORVLYHIDLOXUHRIVZLWFKJHDUZKLFK
LV D GDQJHU WR SHUVRQQHO ,Q DGGLWLRQ LW OLPLWV WRXFK DQG VWHS SRWHQWLDOV DW D
VXEVWDWLRQRULQWKHYLFLQLW\RIDQHDUWKIDXOW
,I D KLJK LPSHGDQFH GHYLFH LV XVHG IRU HDUWKLQJ WKH V\VWHP RU WKH V\VWHP LV
XQHDUWKHGWKHHDUWKIDXOWFXUUHQW ZLOO EH UHGXFHG EXW WKH VWHDG\ VWDWH DQG WUDQVLHQW
RYHUYROWDJHVRQWKHVRXQGSKDVHVFDQEHYHU\KLJK&RQVHTXHQWO\LWLVJHQHUDOO\WKH
FDVHWKDWKLJKLPSHGDQFHHDUWKLQJZLOORQO\EHXVHGLQORZPHGLXPYROWDJHQHWZRUNV
LQZKLFKLWGRHVQRWSURYHWRRFRVWO\WRSURYLGHWKHQHFHVVDU\LQVXODWLRQDJDLQVWVXFK
RYHUYROWDJHV +LJKHU V\VWHP YROWDJHV ZRXOG QRUPDOO\ EH VROLGO\ HDUWKHG RU HDUWKHG
YLDDORZLPSHGDQFH
$ VSHFLDO FDVH RI KLJK LPSHGDQFH HDUWKLQJ YLD D UHDFWRU RFFXUV ZKHQ WKH LQGXFWLYH
HDUWKLQJUHDFWDQFHLVPDGHHTXDOWRWKHWRWDOV\VWHPFDSDFLWLYHUHDFWDQFHWRHDUWKDW
V\VWHP IUHTXHQF\ 7KLV SUDFWLFH LV ZLGHO\ UHIHUUHG WR DV 3HWHUVHQ RU UHVRQDQW  &RLO
(DUWKLQJ :LWK D FRUUHFWO\ WXQHG V\VWHP WKH VWHDG\ VWDWH HDUWKIDXOW FXUUHQW ZLOO EH
]HURVRWKDWHDUWKIDXOWVEHFRPHVHOIH[WLQJXLVKLQJ6XFKDV\VWHPFDQLIGHVLJQHGWR
GRVREHUXQZLWKRQHSKDVHHDUWKHGIRUDORQJSHULRGXQWLOWKHFDXVHRIWKHIDXOWLV
LGHQWLILHGDQGUHFWLILHG:LWKWKHHIIHFWLYHQHVVRIWKLVPHWKRGEHLQJGHSHQGHQWXSRQ
WKH FRUUHFW WXQLQJ RI WKH FRLO UHDFWDQFH WR WKH V\VWHP FDSDFLWLYH UHDFWDQFH DQ
H[SDQVLRQ RI WKH V\VWHP DW DQ\ WLPH ZRXOG FOHDUO\ QHFHVVLWDWH DQ DGMXVWPHQW RI WKH
FRLOUHDFWDQFH
3HWHUVHQFRLOHDUWKHGV\VWHPVDUHFRPPRQO\IRXQGLQDUHDVZKHUHWKHSRZHUV\VWHP
FRQVLVWVPDLQO\RIUXUDORYHUKHDGOLQHVDQGFDQEHSDUWLFXODUO\EHQHILFLDOLQORFDWLRQV
ZKLFKDUHVXEMHFWWRDKLJKLQFLGHQFHRIWUDQVLHQWIDXOWV7UDQVLHQWHDUWKIDXOWVFDXVHG
E\OLJKWQLQJVWULNHVIRUH[DPSOHFDQEHH[WLQJXLVKHGE\WKH3HWHUVHQ&RLOZLWKRXWWKH
QHHGIRUOLQHRXWDJHV
)LJXUHVKRZVDVRXUFHRIJHQHUDWLRQHDUWKHGWKURXJKD3HWHUVHQ&RLOZLWKDQHDUWK
IDXOW DSSOLHG RQ WKH $ 3KDVH 8QGHU WKLV VLWXDWLRQ LW FDQ EH VHHQ WKDW WKH $ SKDVH
VKXQWFDSDFLWDQFHEHFRPHVVKRUWFLUFXLWHGE\WKHIDXOW&RQVHTXHQWO\WKHFDOFXODWLRQV
VKRZWKDWLIWKHUHDFWDQFHRIWKHHDUWKLQJFRLOLVVHWFRUUHFWO\WKHUHVXOWLQJHDUWKIDXOW
FXUUHQWZLOOEH]HUR

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

,E
,F

,I ,E,F9DQ
9DE
M;F

M;/

,/ 

9DE
M;F

,E  ,F 
9DF
M;F

LI 9DQ ,E,F


M;/

M;/

M;F

,I

M;F

M;F

)LJXUH&XUUHQWGLVWULEXWLRQLQ3HWHUVHQ&RLOHDUWKHGV\VWHP
-IC

A
IL

-IB

)LJXUH&XUUHQWYHFWRUVIRU$SKDVHIDXOW
3ULRUWRDFWXDOO\DSSO\LQJSURWHFWLYHUHOD\VWRSURYLGHHDUWKIDXOWSURWHFWLRQRQV\VWHPV
ZKLFKDUHHDUWKHGYLDD3HWHUVHQ&RLOLWLVLPSHUDWLYHWRJDLQDQXQGHUVWDQGLQJRIWKH
FXUUHQW GLVWULEXWLRQV WKDW RFFXU XQGHU IDXOW FRQGLWLRQV RQ VXFK V\VWHPV :LWK WKLV
NQRZOHGJH LW LV WKHQ SRVVLEOH WR GHFLGH RQ WKH W\SH RI UHOD\ WKDW PD\ EH DSSOLHG
HQVXULQJWKDWLWLVERWKVHWDQGFRQQHFWHGFRUUHFWO\
)LJXUHVKRZVDUDGLDOGLVWULEXWLRQV\VWHPKDYLQJDVRXUFHZKLFKLVHDUWKHGYLD D
3HWHUVHQ&RLO7KUHHRXWJRLQJIHHGHUVDUHSUHVHQWWKHORZHURIZKLFKKDVDSKDVHWR
HDUWKIDXOWDSSOLHGRQWKH&SKDVH

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

Ia1
Ib1

IR1
-jXc1

IH1
Ia2

IL

Ib2

jXL

IR2
-jXc2

IH2
Ia3
Ib3
Ic3=IF

IR3
-jXc3

IL = IF + IH1+ IH2 + IH3


IF
IL

IH3

IH1+ IH2

)LJXUH'LVWULEXWLRQRIFXUUHQWVGXULQJD&SKDVHWRHDUWKIDXOW
)LJXUHV DEDQGF VKRZYHFWRUGLDJUDPVIRUWKHSUHYLRXVV\VWHPDVVXPLQJWKDWLW
LVIXOO\FRPSHQVDWHG LHFRLOUHDFWDQFHIXOO\WXQHGWRV\VWHPFDSDFLWDQFH LQDGGLWLRQ
WR DVVXPLQJ D WKHRUHWLFDO VLWXDWLRQ ZKHUH QR UHVLVWDQFH LV SUHVHQW HLWKHU LQ WKH
HDUWKLQJFRLORULQWKHIHHGHUFDEOHV

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

IH3
IL

IH2

3Vo

IH1

a) Capacitive & Inductive Currents

Ib1
Ia1

N
C

IL

-IH1

IR1= IH1

-IH2

Ib1

c) Faulted Line

b) Unfaulted Line

IR3

IR3= IF + IH3
= IL - IH1- IH2

Ia1

Vres = -3Vo

Vres = -3Vo

)LJXUH7KHRUHWLFDOFDVHQRUHVLVWDQFHSUHVHQWLQ;/RU;&
5HIHUULQJ WR WKH YHFWRU GLDJUDP LOOXVWUDWHG LQ ILJXUH D LW FDQ EH VHHQ WKDW WKH &
SKDVHWRHDUWKIDXOWFDXVHVWKHYROWDJHVRQWKHKHDOWK\SKDVHVWRULVHE\DIDFWRURI
7KH$SKDVHFKDUJLQJFXUUHQWV ,D,DDQG,D DUHWKHQVKRZQWREHOHDGLQJ
WKHUHVXOWDQW$SKDVHYROWDJHE\DQGOLNHZLVHIRUWKH%SKDVHFKDUJLQJFXUUHQWV
ZLWKUHVSHFWWRWKHUHVXOWDQW9E
7KHXQEDODQFHFXUUHQWGHWHFWHGE\DFRUHEDODQFHFXUUHQWWUDQVIRUPHURQWKHKHDOWK\
IHHGHUVFDQEHVHHQWREHDVLPSOHYHFWRUDGGLWLRQRI,DDQG,EJLYLQJDUHVLGXDO
FXUUHQWZKLFKOLHVDWH[DFWO\ODJJLQJWKHUHVLGXDOYROWDJH ILJXUHE &OHDUO\DV
WKH KHDOWK\ SKDVH YROWDJHV KDYH ULVHQ E\ D IDFWRU RI  WKH FKDUJLQJ FXUUHQWV RQ
WKHVHSKDVHVZLOODOVREHWLPHVODUJHUWKDQWKHLUVWHDG\VWDWHYDOXHV7KHUHIRUHWKH
PDJQLWXGHRIUHVLGXDOFXUUHQW,5LVHTXDOWR[WKHVWHDG\VWDWHSHUSKDVHFKDUJLQJ
FXUUHQW

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

1RWH
7KHDFWXDOUHVLGXDOYROWDJHXVHGDVDUHIHUHQFHVLJQDOIRUGLUHFWLRQDOHDUWKIDXOWUHOD\V
LVSKDVHVKLIWHGE\DQGLVWKHUHIRUHVKRZQDV9RLQWKHYHFWRUGLDJUDPV7KLV
SKDVHVKLIWLVDXWRPDWLFDOO\LQWURGXFHGZLWKLQWKHUHOD\V
2QWKHIDXOWHGIHHGHUWKHUHVLGXDOFXUUHQWLVWKHDGGLWLRQRIWKHFKDUJLQJFXUUHQWRQ
WKH KHDOWK\ SKDVHV ,+  SOXV WKH IDXOW FXUUHQW ,)   7KH QHW XQEDODQFH LV WKHUHIRUH
HTXDOWR,/,+,+DVVKRZQLQ)LJXUHF
7KLV VLWXDWLRQ PD\ EH PRUH UHDGLO\ REVHUYHG E\ FRQVLGHULQJ WKH ]HUR VHTXHQFH
QHWZRUNIRUWKLVIDXOWFRQGLWLRQ7KLVLVGHSLFWHGLQ)LJXUHEHORZ
I0F
IR0F

Faulted Feeder
IR0H

Healthy Feeders

IR0H

IL

IH3
3XL

-V0

IH2

IH1

Xco

Key:IR0F = Residual Current on Faulted Feeder


IR0H = Residual Current on Healthy Feeder
It can therefore be seen that:I0F = IL - IH1 - IH2 - IH3
IR0F = IH3 + I0F
So: IR0F = IL - IH1 - IH2
)LJXUH=HUR6HTXHQFH1HWZRUNVKRZLQJUHVLGXDOFXUUHQWV

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

,Q FRPSDULQJ WKH UHVLGXDO FXUUHQWV RFFXUULQJ RQ WKH KHDOWK\ DQG RQ WKH IDXOWHG
IHHGHUV )LJXUHVE F LWFDQEHVHHQWKDWWKHFXUUHQWVZRXOGEHVLPLODULQERWK
PDJQLWXGHDQGSKDVHKHQFHLWZRXOGQRWEHSRVVLEOHWR DSSO\ D UHOD\ ZKLFK FRXOG
SURYLGHGLVFULPLQDWLRQ
+RZHYHUDVSUHYLRXVO\VWDWHGWKHVFHQDULRRIQRUHVLVWDQFHEHLQJSUHVHQWLQWKHFRLO
RU IHHGHU FDEOHV LV SXUHO\ WKHRUHWLFDO )XUWKHU FRQVLGHUDWLRQ WKHUHIRUH QHHGV WR EH
JLYHQWRDSUDFWLFDODSSOLFDWLRQLQZKLFKWKHUHVLVWLYHFRPSRQHQWLVQRORQJHULJQRUHG
FRQVLGHUILJXUH
Resistive component in Feeder

Resistive component in Earthing Coil

(IH1+ IH2+ IH3)


IL

3Vo

a) Capacitive & Inductive Currents


with Resistive components
N
C

Restrain

IL

Operate
IR1= IH1

b) Unfaulted Line

Zero Torque Line for 0o RCA

c) Faulted Line
-IH1 -IH2

IR3
Vres = -3Vo

IR3= IF + IH3
= IL - IH1- IH2

Restrain
Zero Torque Line for 0o RCA
Vres = -3Vo

)LJXUH3UDFWLFDOFDVHUHVLVWDQFHSUHVHQWLQ;/DQG;F
)LJXUHDDJDLQVKRZVWKHUHODWLRQVKLSEHWZHHQWKHFDSDFLWLYHFXUUHQWVFRLOFXUUHQW
DQGUHVLGXDOYROWDJH,WFDQQRZEHVHHQWKDWGXHWRWKHSUHVHQFHRIUHVLVWDQFHLQWKH
IHHGHUVWKHKHDOWK\SKDVHFKDUJLQJFXUUHQWVDUHQRZOHDGLQJWKHLUUHVSHFWLYHSKDVH
YROWDJHVE\OHVVWKDQ,QDVLPLODUPDQQHUWKHUHVLVWDQFHSUHVHQWLQWKHHDUWKLQJ
FRLOKDVWKHHIIHFWRI VKLIWLQJ WKH FXUUHQW ,/ WR DQ DQJOH OHVV WKDQ  ODJJLQJ 7KH
UHVXOWRIWKHVHVOLJKWVKLIWVLQDQJOHVFDQEHVHHQLQILJXUHVEDQGF
7KHUHVLGXDOFXUUHQWQRZDSSHDUVDWDQDQJOHLQH[FHVVRIIURPWKHSRODULVLQJ
YROWDJH IRU WKH XQIDXOWHG IHHGHU DQG OHVV WKDQ  RQ WKH IDXOWHG IHHGHU +HQFH D
GLUHFWLRQDO UHOD\ KDYLQJ D FKDUDFWHULVWLF DQJOH VHWWLQJ RI  ZLWK UHVSHFW WR WKH
SRODULVLQJVLJQDORI9R FRXOGEHDSSOLHGWRSURYLGHGLVFULPLQDWLRQLHWKHKHDOWK\
IHHGHUUHVLGXDOFXUUHQWZRXOGDSSHDU ZLWKLQ WKH UHVWUDLQ VHFWLRQ RI WKH FKDUDFWHULVWLF
EXWWKHUHVLGXDOFXUUHQWRQWKHIDXOWHGIHHGHUZRXOGOLHZLWKLQWKHRSHUDWHUHJLRQ

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

,QSUDFWLFDOV\VWHPVLWPD\EHIRXQGWKDWDYDOXHRIUHVLVWDQFHLVSXUSRVHO\LQVHUWHGLQ
SDUDOOHO ZLWK WKH HDUWKLQJ FRLO 7KLV VHUYHV WZR SXUSRVHV RQH LV WR DFWXDOO\ LQFUHDVH
WKHOHYHORIHDUWKIDXOWFXUUHQWWRDPRUHSUDFWLFDOO\GHWHFWDEOHOHYHODQGWKHVHFRQGLV
WR LQFUHDVH WKH DQJXODU GLIIHUHQFH EHWZHHQ WKH UHVLGXDO VLJQDOV DJDLQ WR DLG LQ WKH
DSSOLFDWLRQRIGLVFULPLQDWLQJSURWHFWLRQ
 2SHUDWLRQRIVHQVLWLYHHDUWKIDXOWHOHPHQW
,W KDV EHHQ VKRZQ WKDW WKH DQJXODU GLIIHUHQFH EHWZHHQ WKH UHVLGXDO FXUUHQWV RQ WKH
KHDOWK\DQGIDXOWHGIHHGHUVDOORZVWKHDSSOLFDWLRQ RI DGLUHFWLRQDO UHOD\ ZKRVH ]HUR
WRUTXH OLQH SDVVHV EHWZHHQ WKH WZR FXUUHQWV 7ZR SRVVLELOLWLHV H[LVW IRU WKH W\SH RI
SURWHFWLRQHOHPHQWWKDWPD\FRQVHTXHQWO\EHDSSOLHGIRUHDUWKIDXOWGHWHFWLRQ

$VXLWDEO\VHQVLWLYHGLUHFWLRQDOHDUWKIDXOWUHOD\KDYLQJDUHOD\FKDUDFWHULVWLFDQJOH
VHWWLQJ 5&$ RI]HURGHJUHHVZLWKWKHSRVVLELOLW\RIILQHDGMXVWPHQWDERXWWKLV
WKUHVKROG

$VHQVLWLYHGLUHFWLRQDO]HURVHTXHQFHZDWWPHWULFUHOD\KDYLQJVLPLODUUHTXLUHPHQWV
WRDERYHZLWKUHVSHFWWRWKHUHTXLUHG5&$VHWWLQJV

%RWKVWDJHVDQGRIWKHVHQVLWLYHHDUWKIDXOWHOHPHQWRIWKH3UHOD\DUHVHWWDEOH
GRZQWRRIUDWHGFXUUHQWDQGZRXOGWKHUHIRUHIXOILOOWKHUHTXLUHPHQWVRIWKHILUVW
PHWKRG OLVWHG DERYH DQG FRXOG WKHUHIRUH EH DSSOLHG VXFFHVVIXOO\ +RZHYHU PDQ\
XWLOLWLHV SDUWLFXODUO\LQFHQWUDO(XURSH KDYHVWDQGDUGLVHGRQWKHZDWWPHWULFPHWKRGRI
HDUWKIDXOWGHWHFWLRQZKLFKLVGHVFULEHGLQWKHIROORZLQJVHFWLRQ
=HUR VHTXHQFH SRZHU PHDVXUHPHQW DV D GHULYDWLYH RI 9R DQG ,R RIIHUV LPSURYHG
UHOD\ VHFXULW\ DJDLQVW IDOVH RSHUDWLRQ ZLWK DQ\ VSXULRXV FRUH EDODQFH &7 RXWSXW IRU
QRQHDUWKIDXOWFRQGLWLRQV7KLVLVDOVRWKHFDVHIRUDVHQVLWLYHGLUHFWLRQDOHDUWKIDXOW
UHOD\KDYLQJDQDGMXVWDEOH9RSRODULVLQJWKUHVKROG


:DWWPHWULF&KDUDFWHULVWLF

 3ULQFLSOH
7KH SUHYLRXV DQDO\VLV KDV VKRZQ WKDW D VPDOO DQJXODU GLIIHUHQFH H[LVWV EHWZHHQ WKH
VSLOO FXUUHQW RQ WKH KHDOWK\ DQG IDXOWHG IHHGHUV ,W FDQ EH VHHQ WKDW WKLV DQJXODU
GLIIHUHQFH JLYHV ULVH WR DFWLYH FRPSRQHQWV RI FXUUHQW ZKLFK DUH LQ DQWLSKDVH WR RQH
DQRWKHU7KLVLVVKRZQLQ)LJXUHEHORZ
Vres = -3Vo
Active component of residual current:
Faulted Feeder

Operate
IR3 -I H1 -I H2
IL

I R1
Acttive component of residual current:
Healthy Feeder

Zero Torque Line for 0 o RCA

)LJXUH5HVLVWLYHFRPSRQHQWVRIVSLOOFXUUHQW

Restrain

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

&RQVHTXHQWO\WKHDFWLYHFRPSRQHQWVRI]HURVHTXHQFHSRZHUZLOODOVROLHLQVLPLODU
SODQHVDQGVRDUHOD\FDSDEOHRIGHWHFWLQJDFWLYHSRZHUZRXOGEHDEOHWRPDNHD
GLVFULPLQDWRU\GHFLVLRQLHLIWKHZDWWPHWULFFRPSRQHQWRI]HURVHTXHQFHSRZHUZDV
GHWHFWHG LQ WKH IRUZDUG GLUHFWLRQ WKHQ WKLV ZRXOG EH LQGLFDWLYH RI D IDXOW RQ WKDW
IHHGHULISRZHUZDVGHWHFWHGLQWKHUHYHUVHGLUHFWLRQWKHQWKHIDXOWPXVWEHSUHVHQW
RQDQDGMDFHQWIHHGHURUDWWKHVRXUFH
)RURSHUDWLRQRIWKHGLUHFWLRQDOHDUWKIDXOWHOHPHQWZLWKLQWKH3UHOD\VDOOWKUHHRI
WKH VHWWDEOH WKUHVKROGV RQ WKH UHOD\ PXVW EH H[FHHGHG  QDPHO\ WKH FXUUHQW
3!&XUUHQW 6HW  WKH YROWDJH 3!9ROWDJH 6HW  DQG WKH SRZHU 3!&RHI . 6HW  ,W
VKRXOGEHQRWHGWKRXJKWKDWWKHGLUHFWLRQDOGHFLVLRQZLWKLQWKHUHOD\VLVEDVHGSXUHO\
RQ FXUUHQW UDWKHU WKDQ SRZHU 7KH &RHI . WKUHVKROG LV VLPSO\ SUHVHQW DV DQ
DGGLWLRQDOOHYHOWKDWPXVWEHH[FHHGHGEHIRUHDWULSLVLQLWLDWHG
$VFDQEHVHHQIURPWKHIROORZLQJIRUPXODWKHZDWWPHWULFSRZHULVFDOFXODWHGXVLQJ
UHVLGXDOUDWKHUWKDQ]HURVHTXHQFHTXDQWLWLHV5HVLGXDOTXDQWLWLHVDUHWKUHHWLPHVWKHLU
UHVSHFWLYH ]HUR VHTXHQFH YDOXHV DQG VR WKH FRPSOHWH IRUPXOD IRU RSHUDWLRQ LV DV
VKRZQEHORZ
7KHZDWWPHWULFHOHPHQWVHWWLQJFRUUHVSRQGVWR
9UHV[,UHV[&RV F [9R[,R[&RV F
:KHUH
 $QJOHEHWZHHQWKH3RODULVLQJ9ROWDJH 9UHV DQGWKH5HVLGXDO&XUUHQW
F 5HOD\&KDUDFWHULVWLF$QJOH 5&$ 6HWWLQJ ,6()!&KDU$QJOH
9UHV 5HVLGXDO9ROWDJH
,UHV 5HVLGXDO&XUUHQW
9R =HUR6HTXHQFH9ROWDJH
,R =HUR6HTXHQFH&XUUHQW
 $SSOLFDWLRQFRQVLGHUDWLRQV
5HTXLUHGUHOD\FXUUHQWDQGYROWDJHFRQQHFWLRQV
5HIHUULQJWRWKHUHOHYDQWDSSOLFDWLRQGLDJUDPIRUWKH3UHOD\LWVKRXOGEHDSSOLHG
VXFKWKDWLWVGLUHFWLRQIRUIRUZDUGRSHUDWLRQLVORRNLQJGRZQLQWRWKHSURWHFWHGIHHGHU
DZD\IURPWKHEXVEDU ZLWKD5&$VHWWLQJ
$VLOOXVWUDWHGLQWKHUHOD\DSSOLFDWLRQGLDJUDPLWLVXVXDOIRUWKHHDUWKIDXOWHOHPHQWWR
EH GULYHQ IURP D FRUH EDODQFH FXUUHQW WUDQVIRUPHU &%&7  7KLV HOLPLQDWHV WKH
SRVVLELOLW\ RI VSLOO FXUUHQW WKDW PD\ DULVH IURP VOLJKW PLVPDWFKHV EHWZHHQ UHVLGXDOO\
FRQQHFWHG OLQH &7V ,W DOVR HQDEOHV D PXFK ORZHU &7 UDWLR WR EH DSSOLHG WKHUHE\
DOORZLQJWKHUHTXLUHGSURWHFWLRQVHQVLWLYLW\WREHPRUHHDVLO\DFKLHYHG

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

&DOFXODWLRQRIUHTXLUHGUHOD\VHWWLQJV
$V KDV EHHQ SUHYLRXVO\ VKRZQ IRU D IXOO\ FRPSHQVDWHG V\VWHP WKH UHVLGXDO FXUUHQW
GHWHFWHGE\WKHUHOD\RQWKHIDXOWHGIHHGHULVHTXDOWRWKHFRLOFXUUHQWPLQXVWKHVXP
RIWKHFKDUJLQJFXUUHQWVIORZLQJIURPWKHUHVWRIWKHV\VWHP)XUWKHUDVVWDWHGLQWKH
SUHYLRXV VHFWLRQ WKH DGGLWLRQ RI WKH WZR KHDOWK\ SKDVH FKDUJLQJ FXUUHQWV RQ HDFK
IHHGHUJLYHVDWRWDOFKDUJLQJFXUUHQWZKLFKKDVDPDJQLWXGHRIWKUHHWLPHVWKHVWHDG\
VWDWHSHUSKDVHYDOXH7KHUHIRUHIRUDIXOO\FRPSHQVDWHGV\VWHPWKHWRWDOXQEDODQFH
FXUUHQWGHWHFWHGE\WKHUHOD\LVHTXDOWRWKUHHWLPHVWKHSHUSKDVHFKDUJLQJFXUUHQWRI
WKHIDXOWHGFLUFXLW$W\SLFDOUHOD\VHWWLQJPD\WKHUHIRUHEHLQWKHRUGHURIRIWKLV
YDOXH LH HTXDO WR WKH SHU SKDVH FKDUJLQJ FXUUHQW RI WKH IDXOWHG FLUFXLW 3UDFWLFDOO\
WKRXJKWKHUHTXLUHGVHWWLQJPD\ZHOOEHGHWHUPLQHGRQVLWHZKHUHV\VWHPIDXOWVFDQ
EH DSSOLHG DQG VXLWDEOH VHWWLQJV FDQ EH DGRSWHG EDVHG XSRQ SUDFWLFDOO\ REWDLQHG
UHVXOWV
$OVR LW VKRXOG EH QRWHG WKDW LQ PRVW VLWXDWLRQV WKH V\VWHP ZLOO QRW EH IXOO\
FRPSHQVDWHG DQG FRQVHTXHQWO\ D VPDOO OHYHO RI VWHDG\ VWDWH IDXOW FXUUHQW ZLOO EH
DOORZHGWRIORZ7KHUHVLGXDOFXUUHQWVHHQE\WKHUHOD\RQWKHIDXOWHGIHHGHUPD\WKXV
EH D ODUJHU YDOXH ZKLFK IXUWKHU HPSKDVLVHV WKH IDFW WKDW UHOD\ VHWWLQJV VKRXOG EH
EDVHGXSRQSUDFWLFDOFXUUHQWOHYHOVZKHUHYHUSRVVLEOH
7KH DERYH DOVR KROGV WUXH UHJDUGLQJ WKH UHTXLUHG 5HOD\ &KDUDFWHULVWLF $QJOH 5&$
VHWWLQJ$VKDVEHHQVKRZQHDUOLHUDQRPLQDO5&$VHWWLQJRILVUHTXLUHG+RZHYHU
ILQHWXQLQJRIWKLVVHWWLQJZLOOUHTXLUHWREHFDUULHGRXWRQVLWHLQRUGHUWRREWDLQWKH
RSWLPXPVHWWLQJLQDFFRUGDQFHZLWKWKHOHYHOVRIFRLODQGIHHGHUUHVLVWDQFHVSUHVHQW
7KHORDGLQJDQGSHUIRUPDQFHRIWKH&7ZLOODOVRKDYH DQ HIIHFW LQ WKLV UHJDUG 7KH
HIIHFW RI &7 PDJQHWLVLQJ FXUUHQW ZLOO EH WR FUHDWH SKDVH OHDG RI FXUUHQW :KLOVW WKLV
ZRXOG DVVLVW ZLWK RSHUDWLRQ RI IDXOWHG IHHGHU UHOD\V LW ZRXOG UHGXFH WKH VWDELOLW\
PDUJLQRIKHDOWK\IHHGHUUHOD\V$FRPSURPLVHFDQWKHUHIRUHEHUHDFKHGWKURXJKILQH
DGMXVWPHQWRIWKH5&$7KLVLVDGMXVWDEOHLQVWHSVRQWKH3UHOD\V


5HVLGXDORYHUYROWDJH QHXWUDOGLVSODFHPHQW SURWHFWLRQ


2QDKHDOWK\WKUHHSKDVHSRZHUV\VWHPWKHDGGLWLRQRIHDFKRIWKHWKUHHSKDVHWR
HDUWKYROWDJHVLVQRPLQDOO\]HURDVLWLVVLPSO\WKHYHFWRUDGGLWLRQRIWKUHHEDODQFHG
YHFWRUVDWWRRQHDQRWKHU+RZHYHUZKHQDQHDUWKIDXOWRFFXUVRQWKHSULPDU\
V\VWHP WKLV EDODQFH LV XSVHW DQG D UHVLGXDO YROWDJH LV SURGXFHG 7KLV FRXOG EH
PHDVXUHGIRUH[DPSOHDWWKHVHFRQGDU\WHUPLQDOVRIDYROWDJHWUDQVIRUPHUKDYLQJD
EURNHQ GHOWD VHFRQGDU\ FRQQHFWLRQ 1RWH WKDW WKLV FRQGLWLRQ FDXVHV D ULVH LQ WKH
QHXWUDO YROWDJH ZLWK UHVSHFW WR HDUWK ZKLFK LV FRPPRQO\ UHIHUUHG WR DV QHXWUDO
YROWDJHGLVSODFHPHQWRU19'
7KHUHIRUHLWFDQEHVHHQWKDWWKHGHWHFWLRQRIDUHVLGXDORYHUYROWDJHFRQGLWLRQLVDQ
DOWHUQDWLYHPHDQVRIHDUWKIDXOWGHWHFWLRQZKLFKGRHVQRWUHTXLUHDQ\PHDVXUHPHQWRI
FXUUHQW 7KLV PD\ EH SDUWLFXODUO\ DGYDQWDJHRXV LQ KLJK LPSHGDQFH HDUWKHG 
LQVXODWHGV\VWHPVZKHUHWKHSURYLVLRQRIFRUHEDODQFH&7VRQHDFKIHHGHUPD\EH
HLWKHULPSUDFWLFDORUXQHFRQRPLF
,WPXVWEHQRWHGWKDWZKHUHUHVLGXDORYHUYROWDJHSURWHFWLRQLVDSSOLHGVXFKDYROWDJH
ZLOO EH JHQHUDWHG IRU D IDXOW RFFXUULQJ DQ\ZKHUH RQ WKDW VHFWLRQ RI WKH V\VWHP DQG
KHQFH WKH DSSOLHG SURWHFWLRQ PXVW EH GLVFULPLQDWLYH 7KH 19' HOHPHQW ZLWKLQ WKH
3UHOD\LVRIWZRVWDJHGHVLJQHDFKVWDJHKDYLQJVHSDUDWHYROWDJHDQGWLPHGHOD\
VHWWLQJV6WDJHPD\EHVHWWRRSHUDWHRQHLWKHUDQ,'07RU'7FKDUDFWHULVWLFZKLOVW
VWDJHPD\EHVHWWR'7RQO\

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

7KH ,'07 FKDUDFWHULVWLF DYDLODEOH RQ WKH ILUVW VWDJH LV GHILQHG E\ WKH IROORZLQJ
IRUPXOD
W 706 0
:KHUH
706 7LPH0XOWLSOLHU6HWWLQJ
W 2SHUDWLQJ7LPHLQ6HFRQGV
0 'HULYHG5HVLGXDO9ROWDJH5HOD\6HWWLQJ9ROWDJH
7ZR VWDJHV DUH LQFOXGHG IRU WKLV 19' SURWHFWLRQ WR DFFRXQW IRU DSSOLFDWLRQV ZKLFK
UHTXLUHERWKDODUPDQGWULSVWDJHV,QVXFKDSSOLFDWLRQVDQDODUPLVXVXDOO\UHTXLUHG
WREHJHQHUDWHGVRRQDIWHUWKHFRQGLWLRQ LV GHWHFWHGZKLFK VLPSO\ VHUYHV WR LQGLFDWH
WKH SUHVHQFH RI DQ HDUWK IDXOW RQ WKH V\VWHP ,W LV FRPPRQ IRU WKH V\VWHP WR KDYH
EHHQGHVLJQHGWRZLWKVWDQGWKHDVVRFLDWHGKHDOWK\SKDVHRYHUYROWDJHVIRUDQXPEHU
RI KRXUV IROORZLQJ IDXOW LQFHSWLRQ 7KLV WKHUHIRUH JLYHV WLPH IRU V\VWHP RSHUDWRUV WR
ORFDWHDQGKRSHIXOO\UHPRYHWKHIDXOWFRQGLWLRQ
7KLVHOHPHQWVKRXOGEHGULYHQIURPUHVLGXDOYROWDJH 9R 7KLVFDQEHGHULYHGIURP
HLWKHUWKHWKUHHSKDVH97LQSXWVWRWKHUHOD\RUWKHUHVLGXDOYROWDJHLQSXW7KHPRGH
RIFRQQHFWLRQFDQEHVHOHFWHGYLDWKH+0,
'LIIHUHQW97UDWLRVHWWLQJVIRUWKHWZRPRGHVRIFRQQHFWLRQDUHDYDLODEOH
6

(

=6

)

=/

$*

9$

9$
9%

9&

9$
9%
9&

V %

9&

95(6
9$

9%

9&

95(6

9&

5HVLGXDOYROWDJHDW5 UHOD\SRLQW LVGHSHQGDQWXSRQ


95(6

=6
=6  =6  =/  =/

)LJXUHD5HVLGXDO9ROWDJH

9%

9%

9&
=6 =/ UDWLR
[(

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

6

(

5

=6

1

)

=/

$*

=(
*

9$*
6
*)
9&*

9%*

6 9
5 $*
*)

9%*

9$*

9$*

9&*

95(6

9&*
9%*

9&*

9&*

9%*

95(6

95(6

95(6

6
5 *)

9%*

9%*
9&*

=6  =(
[(

=6  =6  =/  =/  =(

)LJXUHE5HVLGXDO9ROWDJH


6HWWLQJ*XLGHOLQHV
7KHYROWDJHVHWWLQJDSSOLHGWRWKHHOHPHQWVLVFOHDUO\GHSHQGHQWXSRQWKHPDJQLWXGH
RIUHVLGXDOYROWDJHWKDWLVH[SHFWHGWRRFFXUGXULQJWKHHDUWKIDXOWFRQGLWLRQ7KLVLQ
WXUQ LV GHSHQGHQW XSRQ WKH PHWKRG RI V\VWHP HDUWKLQJ HPSOR\HG DQG LV WKHUHIRUH
DSSOLFDWLRQ GHSHQGHQW )LJXUH  LOOXVWUDWHV WKH IRUPXOD XVHG LQ FDOFXODWLQJ WKH
H[SHFWHGUHVLGXDOYROWDJHRFFXULQJIRUDQHDUWKIDXOWRQDUHVLVWDQFHHDUWKHGV\VWHP
1RWHWKDW,'07FKDUDFWHULVWLFVDUHVHOHFWDEOHRQWKHILUVWVWDJHRI19'LQRUGHUWKDW
HOHPHQWV ORFDWHG DW YDULRXV SRLQWV RQ WKH V\VWHP PD\ EH WLPH JUDGHG ZLWK RQH
DQRWKHU

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203



7*
&+$37(5
3DJHRI

1HJDWLYHVHTXHQFHSURWHFWLRQ
1HJDWLYH SKDVH VHTXHQFH FXUUHQW LV JHQHUDWHG IURP DQ XQEDODQFHG YROWDJH
FRQGLWLRQVXFKDVXQEDODQFHGORDGLQJORVVRIRQHSKDVHRUVLQJOHSKDVHIDXOWV
&RQVLGHU WKH HTXLYDOHQW FLUFXLWV IRU SRVLWLYH DQG QHJDWLYH SKDVH VHTXHQFH FXUUHQWV
VKRZQLQILJXUHWKHPDJQHWLVLQJLPSHGDQFHEHLQJQHJOHFWHG

R1+R2

j(X1+X2)

[(1-s)/s].R2

Positive Phase Sequence Equivalent Circuit

R1+R2

j(X1+X2)

[(s-1)/(2-s)].R2

Negative Phase Sequence Equivalent Circuit

)LJXUH(TXLYDOHQWFLUFXLWV
:LWKSRVLWLYHSKDVHVHTXHQFHYROWDJHVDSSOLHGWRWKHPRWRUDURWDWLQJILHOGLVVHWXS
EHWZHHQWKHVWDWRUDQGURWRU7KHUHVXOWLQJHIIHFWLVWKDWWKHGLUHFWLRQRIURWDWLRQRIWKH
URWRULVHTXDOWRWKDWRIWKHDSSOLHGILHOG:LWKQHJDWLYHSKDVHVHTXHQFHYROWDJHVWKH
ILHOGZLOOURWDWHLQWKHRSSRVLWHGLUHFWLRQFXWWLQJDURWDWLQJURWRUFRQGXFWRUDWDOPRVW
WZLFHWKHV\VWHPIUHTXHQF\7KHDFWXDOIUHTXHQF\RIQHJDWLYHSKDVHVHTXHQFHYROWDJH
DQGFXUUHQWLQWKHURWRUFLUFXLWLVHTXDOWR V I

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

)URPWKHHTXLYDOHQWFLUFXLWV
0RWRUSRVLWLYHVHTXHQFHLPSHGDQFHDWDJLYHQVOLSVE\WKHIRUPXOD
> 5 5 V  ; ; @

 

7KDWPHDQV> 5 5  ; ; @ ZKHQV DWVWDQGVWLOO

 

0RWRUQHJDWLYHVHTXHQFHLPSHGDQFHDWDJLYHQVOLSVE\WKHIRUPXOD
> 5 5 V  ; ; @

 

7KDWPHDQV> 5 5   ; ; @ ZKHQVDWQRUPDOUXQQLQJVSHHG

 

:KHUH
336 SRVLWLYHSKDVHVHXTHQFH
136 QHJDWLYHSKDVHVHTXHQFH
3366WDWRU5HVLVWDQFH
5 
3365RWRU5HVLVWDQFH5HIHUUHGWR6WDWRU
5 
3365RWRU5HDFWDQFH
;
3365RWRU5HDFWDQFH5HIHUUHGWR6WDWRU
; 
1366WDWRU5HVLVWDQFH
5
1365RWRU5HVLVWDQFH5HIHUUHGWR6WDWRU
5
1365RWRU5HDFWDQFH
;
1365RWRU5HDFWDQFH5HIHUUHGWR6WDWRU
; 
V
6OLS
7KHYDOXHRIUHVLVWDQFHLVJHQHUDOO\PXFKOHVVWKDQWKHOHDNDJHUHDFWDQFH7KHUHIRUH
QHJOHFWLQJ WKH UHVLVWDQFH WHUP WKH PRWRU QHJDWLYH SKDVH VHTXHQFH LPSHGDQFH DW
QRUPDO UXQQLQJ VSHHG FDQ EH DSSUR[LPDWHG WR WKH SRVLWLYH SKDVH VHTXHQFH
LPSHGDQFHDWVWDQGVWLOO











$WQRUPDOUXQQLQJVSHHG

positive sequence impedance


starting current

negative sequence impedance normal load current


)RU H[DPSOH LI D PRWRU KDV D VWDUWLQJ FXUUHQW RI VL[ WLPHV WKH IXOO ORDG YDOXH WKH
QHJDWLYHVHTXHQFHLPSHGDQFHZRXOGEHDERXWWKHSRVLWLYHVHTXHQFHLPSHGDQFH
&RQVHTXHQWO\ WKH SUHVHQFH RI  QHJDWLYH VHTXHQFH YROWDJH LQ WKH VXSSO\ ZRXOG
UHVXOWLQDSSUR[LPDWHO\RIQHJDWLYHVHTXHQFHFXUUHQW
7KHDFUHVLVWDQFHRIWKHURWRUFRQGXFWRUWRWKHLQGXFHGQHJDWLYHVHTXHQFHFXUUHQWLV
JUHDWHUGXHWRWKHKLJKHUIUHTXHQF\> V I@FDXVLQJVNLQHIIHFW7KHKHDWLQJHIIHFWRI
QHJDWLYH VHTXHQFH FXUUHQW LV WKHUHIRUH JUHDWHU DQG LQFUHDVHV WKH PRWRU ORVVHV
,WLVWKHUHIRUHHVVHQWLDOWRGHWHFWDQ\QHJDWLYHVHTXHQFHFXUUHQWSUHVHQWRQWKHV\VWHP
DQGDFWDFFRUGLQJO\EHIRUHGDQJHURXVWHPSHUDWXUHVRFFXULQWKHPRWRU
7KH 3 UHOD\ LQFOXGHV D QXPEHU RI PHWKRGV IRU WKH GHWHFWLRQ RI QHJDWLYH SKDVH
VHTXHQFHFXUUHQWVGHSHQGLQJXSRQWKHFDXVHRIWKHXQEDODQFH7KHVHPHWKRGVDUH
DGGUHVVHGLQGHWDLOEHORZ

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203



7*
&+$37(5
3DJHRI

/RVVRIRQHSKDVHZKLOHVWDUWLQJ UXQQLQJ

 3ULQFLSOH
,I D PRWRU LV VWDUWHG ZLWK RQH SKDVH RSHQ LW ZLOO UHPDLQ VWDWLRQDU\ DQG LW FDQ EH
VKRZQ WR GUDZ D FXUUHQW HTXDO WR  WLPHV WKH QRUPDO VWDUWLQJ FXUUHQW 8QGHU
WKHVHFLUFXPVWDQFHVWKHQHJDWLYHSKDVHVHTXHQFHFRPSRQHQWSUHVHQWLQWKHFXUUHQW
LVHTXDOWRKDOIWKHQRUPDOVWDUWLQJFXUUHQWYDOXH7KLVLVDQH[WUHPHFRQGLWLRQDVWKLV
DPRXQW RI QHJDWLYH SKDVH VHTXHQFH FXUUHQW ZLOO UDSLGO\ RYHUKHDW WKH PRWRU DQG
XQOHVVFRUUHFWLYHDFWLRQLVWDNHQWKHPRWRUZLOOEHVHULRXVO\GDPDJHG
/RVVRIRQHSKDVHRIWKHVXSSO\WRDPRWRUGXULQJQRUPDOUXQQLQJFRQGLWLRQVUHVXOWV
LQWKHIROORZLQJFRQGLWLRQV

+HDWLQJLQFUHDVHVFRQVLGHUDEO\GXHWRKLJKURWRUORVVHVFDXVHGE\WKHYH
VHTXHQFHFXUUHQWQRZSUHVHQW

2XWSXWRIWKHPRWRULVUHGXFHGDQGGHSHQGLQJRQWKHORDGDQLQGXFWLRQPRWRU
PD\VWDOORUDV\QFKURQRXVPRWRUPD\SXOORXWRIV\QFKURQLVP

WKHPRWRUFXUUHQWZLOOLQFUHDVH

2QH FRPPRQ IDFWRU LQ WKH DIRUHPHQWLRQHG FRQGLWLRQV LV WKH SUHVHQFH RI QHJDWLYH
SKDVH VHTXHQFH FXUUHQW 7KH 3 UHOD\ WKHUHIRUH LQFRUSRUDWHV D QHJDWLYH SKDVH
VHTXHQFHFXUUHQWHOHPHQWWRGHWHFWVXFKH[WUHPHRSHUDWLQJFRQGLWLRQV7KLVQHJDWLYH
SKDVH VHTXHQFH FXUUHQW HOHPHQW RSHUDWLQJ WLPH FKDUDFWHULVWLF LV RI DQ LQYHUVH WLPH
QDWXUHDQGLVJRYHUQHGE\WKHIROORZLQJIRUPXOD
W 706  ,,Q 
IRU,,Q
W 706 
IRU,,Q!
7KHHOHPHQWPD\EHVHOHFWLYHO\HQDEOHGRUGLVDEOHG
,QDGGLWLRQWRWKLVDQLQGHSHQGHQWGHILQLWHWLPHDODUPVWDJHLVSURYLGHG
 6HWWLQJ*XLGHOLQHV
7KLV HOHPHQW VKRXOG EH VHW LQ H[FHVV RI WKH DQWLFLSDWHG QHJDWLYH SKDVH VHTXHQFH
FXUUHQW UHVXOWLQJ IURP DV\PPHWULF &7 VDWXUDWLRQ GXULQJ VWDUWLQJ EXW OHVV WKDQ WKH
QHJDWLYHSKDVHVHTXHQFHFXUUHQWUHVXOWLQJIURPORVVRIRQHSKDVHGXULQJVWDUWLQJ
$ W\SLFDO VHWWLQJ IRU WKH QHJDWLYH VHTXHQFH RYHUFXUUHQW HOHPHQW LV  RI WKH
DQWLFLSDWHG QHJDWLYH VHTXHQFH FXUUHQW UHVXOWLQJ IURP ORVV RI RQH SKDVH GXULQJ
VWDUWLQJ)RUDPRWRUZLWKDVWDUWLQJFXUUHQWWRORDGFXUUHQWUDWLRRIWR
7KHUHIRUHVHW
,!&XUUHQW6HW QRUPDOVWDUWLQJFXUUHQWRUIXOOORDGFXUUHQW
7KHVHWWLQJIRUWKHDODUPWLPHGHOD\LVDSSOLFDWLRQGHSHQGHQW

7*
&+$37(5
3DJHRI



7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

5HYHUVHSKDVHGHWHFWLRQ

 3ULQFLSOH
,QFRUUHFWSKDVHURWDWLRQRIWKHLQFRPLQJVXSSO\WRWKHPRWRUZLOOUHVXOWLQWKHPRWRU
URWDWLQJLQWKHRSSRVLWHGLUHFWLRQ)RUFHUWDLQGLUHFWLRQDOO\VHQVLWLYHDSSOLFDWLRQVVXFK
DV OLIWV DQG FRQYH\RU EHOWV WKLV LV D SRWHQWLDOO\ GDQJHURXV FRQGLWLRQ DQG PXVW EH
GHWHFWHGUDSLGO\
$OWKRXJKWKHDERYHFRQGLWLRQGRHVQRWUHVXOWLQWKHIORZRIQHJDWLYHSKDVHVHTXHQFH
FXUUHQWLQWKHPRWRUQHJDWLYHSKDVHVHTXHQFHFXUUHQWZLOOEHSUHVHQWHGWRWKH
PHDVXULQJFLUFXLWU\RIWKHUHOD\
,I WKH PDFKLQH LV DOORZHG WR URWDWH LQ WKH RSSRVLWH GLUHFWLRQ WKH WKHUPDO SURWHFWLRQ
DQG QHJDWLYH SKDVH VHTXHQFH RYHUFXUUHQW HOHPHQW ZLOO GHWHFW WKH FRQGLWLRQ DQG WULS
WKH FLUFXLW EUHDNHU LQ WKHLU UHVSHFWLYH WLPH GHOD\V +RZHYHU DV VWDWHG DERYH LW LV
VRPHWLPHVXQGHVLUDEOHWRDOORZWKHPRWRUWRURWDWHDWDOO
)RU VXFK DSSOLFDWLRQV WKH 3 UHOD\ LQFOXGHV D UHYHUVH SKDVH VHTXHQFH GHWHFWRU
7KLV HOHPHQW PRQLWRUV WKH LQSXW YROWDJH URWDWLRQ DQG PDJQLWXGH 7KH SRVLWLYH
VHTXHQFH YROWDJH VKRXOG EH JUHDWHU WKDQ WKH QHJDWLYH VHTXHQFH YROWDJH DQG WKH
SKDVHYROWDJHV9$9%DQG9&VKRXOGEHJUHDWHUWKDQWKHXVHUVHWWDEOHWKUHVKROG,I
WKH DIRUHPHQWLRQHG FRQGLWLRQV DUH QRW VDWLVILHG WKHQ DQ DODUP LV UDLVHG 7KLV DODUP
FRQWDFWFDQEHLQWHUORFNHGZLWKWKHPRWRUFRQWDFWRURUFLUFXLWEUHDNHUWRSUHYHQWWKH
PRWRUIURPEHLQJHQHUJLVHGXQWLOFRUUHFWSKDVHURWDWLRQDQGVXIILFLHQWYROWDJHH[LVWRQ
WKHV\VWHP
7KLVIHDWXUHUHTXLUHVDDFLUFXLWEUHDNHUDX[LOLDU\FRQWDFWPDSSHGWRDQRSWRLQSXW
WRJHWWKHLQIRUPDWLRQ&%FORVHG&%RSHQ
 6HWWLQJ*XLGHOLQHV
7KH XQGHUYROWDJH LQWHUORFN LV SURYLGHG WR SUHYHQW WKH PRWRU DWWHPSWLQJ WR VWDUW RQ
UHGXFHG YROWDJH 7KH VHWWLQJ LV V\VWHP GHSHQGHQW EXW PD\ W\SLFDOO\ EH VHW WR  
RI9Q


6WDUWVWDOOSURWHFWLRQ
:KHQDPRWRULVVWDUWHGLWZLOOGUDZDYDOXHRIFXUUHQWLQH[FHVVRIIXOOORDGUDWLQJIRU
D VHW SHULRG RI WLPH QDPHO\ WKH VWDUWLQJ WLPH ,W LV QRUPDO SUDFWLFH WR DVVXPH D
FRQVWDQWVWDUWLQJFXUUHQWIRUWKHZKROHRIWKHVWDUWLQJWLPH
7KHVWDUWLQJFXUUHQWZLOOYDU\GHSHQGLQJXSRQWKHW\SHDQGPHWKRGRIVWDUWLQJXWLOLVHG
,IWKHPRWRULVVWDUWHGGLUHFWRQOLQH '2/ WKHFXUUHQWFRXOGHDVLO\UHDFKWLPHVIXOO
ORDGFXUUHQW+RZHYHUZKHQVWDUGHOWDVWDUWLQJLVXWLOLVHGWKHVWDUWLQJFXUUHQWZLOOEH
OHVVWKDQZKHQ'2/VWDUWLQJ
6KRXOGDPRWRUVWDOOZKLOVWUXQQLQJRUEHXQDEOHWRVWDUWGXHWRH[FHVVLYHORDGLQJLW
ZLOOGUDZDFXUUHQWHTXLYDOHQWWRWKHORFNHGURWRUFXUUHQW'XHWRWKHIDFWWKDWWKHOHYHO
RI VWDUWLQJ FXUUHQW ZLOO EH HTXDO WR WKH OHYHO RI ORFNHG URWRU FXUUHQW LW LV FOHDUO\ QRW
SRVVLEOHWRGLVWLQJXLVKEHWZHHQSKDVHVWDOOLQJDQG KHDOWK\ VWDUWLQJ E\ PRQLWRULQJ
FXUUHQWDORQH

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

,QWKHPDMRULW\RIFDVHVWKHVWDUWLQJWLPHRIDQRUPDOLQGXFWLRQPRWRULVOHVVWKDQWKH
PD[LPXPVWDOOZLWKVWDQGWLPH8QGHUWKLVFRQGLWLRQLWLVSRVVLEOHWRGLVFULPLQDWHRQD
WLPHEDVLVEHWZHHQWKHWZRFRQGLWLRQVDQGWKXVSURYLGHSURWHFWLRQDJDLQVWVWDOOLQJ
+RZHYHUZKHUHPRWRUVDUHXVHGWRGULYHKLJKLQHUWLDORDGVWKHVWDOOZLWKVWDQGWLPH
PD\ EH OHVV WKDQ WKH VWDUWLQJ WLPH ,Q VXFK FDVHV LW LV QRW SRVVLEOH WR GLVFULPLQDWH
EHWZHHQVWDUWDQGVWDOOFRQGLWLRQVE\WLPHDORQH
7KH 3 UHOD\ SURYLGHV H[WHQVLYH VWDUW DQG VWDOO SURWHFWLRQ LQ RUGHU WKDW DOO RI WKH
DIRUHPHQWLRQHGFRQGLWLRQVPD\EHDFFRXQWHGIRU7KHPHWKRGVXVHGWRDFKLHYHWKLV
DUHGLVFXVVHGLQPRUHGHWDLOEHORZ


([FHVVLYHVWDUWWLPH/RFNHGURWRUSURWHFWLRQVWDOOWLPH!VWDUWWLPH
$ PRWRU PD\ IDLO WR DFFHOHUDWH IRU D QXPEHU RI UHDVRQV )RU H[DPSOH ORVV RI RQH
VXSSO\SKDVHPHFKDQLFDOIDLOXUHLQVXIILFLHQWVXSSO\YROWDJHHWF$VVWDWHGSUHYLRXVO\
IDLOXUHRIDPDFKLQHWRDFFHOHUDWHZLOOUHVXOWLQH[FHVVLYHFXUUHQWEHLQJGUDZQE\WKH
PRWRU 7KLV FXUUHQW ZLOO JHQHUDWH H[WUHPHO\ KLJK WHPSHUDWXUHV ZLWKLQ WKH PDFKLQH
&RXSOHGZLWKWKHIDFWWKDWWKHPRWRULVZLWKRXWWKHDGGHGFRROLQJQRUPDOO\SURYLGHG
E\URWDWLRQLUUHSDUDEOHGDPDJHZLOOUHVXOWYHU\TXLFNO\
:KHUHWKHVWDOOZLWKVWDQGWLPHLVOHVVWKDQWKHVWDUWLQJWLPHLWLVSRVVLEOHWRXWLOLVHD
UHOD\ RSWRLQSXW LQ FRQMXQFWLRQ ZLWK PHDVXUHPHQW RI WKH SKDVH FXUUHQW WR GHWHFW D
VDIHVWDUW
7ZR PHWKRGV DUH DYDLODEOH IRU GHWHFWLQJ D VWDUW DQG WKH\ DUH PHQX VHOHFWDEOH 6HH
WKH8VHU*XLGHSDUWRIWKLV7HFKQLFDO*XLGHIRUGHWDLOHGLQIRUPDWLRQ

 6HWWLQJ*XLGHOLQHV
7KH VWDUWLQJ FXUUHQW WKUHVKROG VKRXOG EH VHW JUHDWHU WKDQ IXOO ORDG FXUUHQW EXW OHVV
WKDQPRWRUVWDUWLQJFXUUHQW,WVFRUUHVSRQGLQJWLPHU3URORQJHGVWDUWWLPHVKRXOGEH
VHWRUVHFRQGVDERYHWKHPRWRUVWDUWLQJWLPHDQGOHVVWKDQWKHFROGVWDOOZLWKVWDQG
WLPH
6HWWLQJH[DPSOH
8WLOLVLQJWKHSUHYLRXVO\VSHFLILHGPRWRUSDUDPHWHUV
6WDUWLQJFXUUHQW
[,WK $
3URORQJHGVWDUWWLPH
VHFRQGV
7KHVHVHWWLQJVDUHLOOXVWUDWHGJUDSKLFDOO\LQILJXUH



6WDOO3URWHFWLRQ

 3ULQFLSOH
$Q LQGXFWLRQ PRWRU PD\ VWDOO IRU D QXPEHU RI UHDVRQV VXFK DV RYHUORDGLQJ
XQGHUYROWDJH HWF :KHQ D PDFKLQH VWDOOV LW ZLOO UXQ GRZQ ZKLOVW GUDZLQJ D FXUUHQW
HTXDOWRWKHORFNHGURWRUFXUUHQW
:KHUH WKH VWDOO ZLWKVWDQG WLPH LV JUHDWHU WKDQ WKH VWDUWLQJ WLPH D VWDOO FRQGLWLRQ
GXULQJ UXQQLQJ LV VLPSO\ GHWHFWHG E\ WKH OLQH FXUUHQW H[FHHGLQJ WKH SURJUDPPHG
WKUHVKROG,IWKHFXUUHQWIDLOVWRIDOOEDFNEHORZWKLVWKUHVKROGEHIRUHWKHSURJUDPPHG
WLPHGHOD\KDVHODSVHGDWULSFDQEHLQLWLDWHG
,W VKRXOG EH QRWHG WKDW WKLV IXQFWLRQ LV GLVDEOHG ZKHQ WKH UHOD\ GHWHFWV D VWDUW
FRQGLWLRQ

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

 6HWWLQJ*XLGHOLQHV
7KHVWDOOFXUUHQWWKUHVKROGVKRXOGEHVHWJUHDWHUWKDQIXOOORDGFXUUHQWEXWOHVVWKDQ
PRWRUVWDOOFXUUHQW ZKLFKLVXVXDOO\HTXDOWRVWDUWLQJFXUUHQW ,WVFRUUHVSRQGLQJWLPHU
VKRXOGEHVHWOHVVWKDQWKHPRWRUKRWVWDOOZLWKVWDQGWLPH
6HWWLQJH[DPSOH
8WLOLVLQJWKHSUHYLRXVO\VSHFLILHGPRWRUSDUDPHWHUV
[,WK $

6WDOO6HWWLQJ
6WDOO7LPH

VHFRQGV

7KHVHVHWWLQJVDUHLOOXVWUDWHGJUDSKLFDOO\LQILJXUH


([FHVVLYHVWDUWWLPH/RFNHGURWRUSURWHFWLRQVWDOOWLPHVWDUWWLPH
$VWKHURWRUUHVLVWDQFHRI DQ LQGXFWLRQ PRWRU LV SURSRUWLRQDO WR VOLS LW ZLOO GHFUHDVH
GXULQJDFFHOHUDWLRQ:KHQWKHPRWRULVVWDWLRQDU\WKHURWDWLQJILHOGLQWKHDLUJDSVHW
XS E\ FXUUHQWV IORZLQJ LQ WKH VWDWRU ZLQGLQJ ZLOO FXW WKH URWRU 7KLV ILHOG ZLOO EH
WUDYHOOLQJ DW V\QFKURQRXV VSHHG UHODWLYH WR WKH URWRU DQG ZLOO LQGXFH D YROWDJH DW
V\VWHP IUHTXHQF\ WKXV JHQHUDWLQJ FLUFXODWLQJ FXUUHQWV LQ WKH URWRU EDUV $W WKLV
IUHTXHQF\WKHUHDFWDQFHRIWKHURWRUZLOOFDXVHWKHFXUUHQWWRIORZLQWKHRXWHUVHFWLRQ
RI WKH URWRU FRQGXFWRUV FRPPRQO\ NQRZQ DV WKH VNLQ HIIHFW 6LQFH WKH FXUUHQW LV
RFFXS\LQJ D VPDOOHU VHFWLRQ RI WKH URWRU WKH DSSDUHQW LPSHGDQFH SUHVHQWHG WR LW LV
LQFUHDVHG WKHUHIRUH WKH , 5 KHDWLQJ LV JUHDWO\ LQFUHDVHG $V WKH PRWRU DFFHOHUDWHV
GXULQJVWDUWLQJWKHVOLSEHJLQVWRGHFUHDVHDQGWKHFXUUHQWLVDEOHWRRFFXS\PRUHRI
WKH URWRU FRQGXFWRU 7KH DSSDUHQW LPSHGDQFH WKHUHIRUH UHGXFHV DORQJ ZLWK WKH
KHDWLQJHIIHFW7KHPRWRULVWKHUHIRUHDEOHWRWROHUDWHVWDUWLQJFXUUHQWIRUWKHVWDUWLQJ
WLPHEXWQRWORFNHGURWRUFXUUHQW


7KHDERYHGHVFULSWLRQH[SODLQVZK\IRUFHUWDLQDSSOLFDWLRQVVXFKDVPRWRUVGULYLQJ
KLJK LQHUWLD ORDGV WKH VWDOO ZLWKVWDQG WLPH PD\ EH VDIHO\ H[FHHGHG GXULQJ VWDUWLQJ
ZLWKRXW UHVXOWLQJ LQ DQ RYHUWHPSHUDWXUH FRQGLWLRQ ZLWKLQ WKH PRWRU &RQVHTXHQWO\
VLQFHWKHVWDOOZLWKVWDQGWLPHLVOHVVWKDQWKHVWDUWWLPHLWLVQRWSRVVLEOHWRXVHWLPH
DORQHWRGLVWLQJXLVKEHWZHHQDVWDUWDQGDVWDOOFRQGLWLRQ
7KH3UHOD\RYHUFRPHVWKLVSUREOHPE\XWLOLVLQJDFRQWDFWIURPD VSHHG VHQVLQJ
GHYLFHZLUHGLQWRDVSHFLILHGRSWRLQSXWRQWKHUHOD\
 6HWWLQJ*XLGHOLQHV
7KH 6WDUWLQJ FXUUHQW WKUHVKROG VKRXOG EH VHW JUHDWHU WKDQ IXOO ORDG FXUUHQW EXW OHVV
WKDQPRWRUORFNHGURWRUFXUUHQW XVXDOO\ HTXDOWRVWDUWLQJFXUUHQW ,WVFRUUHVSRQGLQJ
WLPHUVKRXOGEHVHWOHVVWKDQWKHPRWRUFROGVWDOOZLWKVWDQGWLPH


1XPEHURIVWDUWVOLPLWDWLRQ
5HSHDWHG VWDUWLQJ RU LQWHUPLWWHQW RSHUDWLRQ RI D PRWRU PD\ JHQHUDWH GDQJHURXVO\
KLJK WHPSHUDWXUHV ZLWKLQ WKH PRWRU XQOHVV VXIILFLHQW WLPH LV DOORZHG IRU FRROLQJ
EHWZHHQVWDUWV
7KH 3 UHOD\ LQFRUSRUDWHV D QXPEHU RI VWDUWV OLPLWDWLRQ IDFLOLW\ 7KLV OLPLWDWLRQ LV
IXOO\ SURJUDPPDEOH DQG LV DSSOLFDEOH WR ERWK KRW DQG FROG VWDUW FRQGLWLRQV $ KRW
VWDUWLVGHILQHGE\DWKHUPDOVWDWHJUHDWHUWKDQDQGDFROGVWDUWLVGHILQHGDVD
WKHUPDOVWDWHORZHUWKDQ

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

5HVWDUWLQJWKHPRWRUIURPDKRWWKHUPDOVWDWH
)RUFHUWDLQDSSOLFDWLRQVLWLVQRWGHVLUDEOHWRDOORZWKHPRWRUWLPHWRFRROGRZQWRD
VSHFLILHGWKHUPDOVWDWHEHIRUHDUHVWDUWLVSHUPLWWHG7KH3 UHOD\ LQFRUSRUDWHV D
QXPEHURIIHDWXUHVZKLFKDOORZDVXEVHTXHQWVWDUWIURPDKRWWKHUPDOVWDWHWKHVHDUH
GLVFXVVHGLQWKHVHFWLRQRQWKHUPDORYHUORDGSURWHFWLRQ


/RZYROWDJHSURWHFWLRQ UHDFFHOHUDWLRQ
)ROORZLQJDWUDQVLHQWGLSLQWKHVXSSO\YROWDJHDPRWRUZLOODWWHPSWWRUHDFFHOHUDWH
8QGHU WKHVH FLUFXPVWDQFHV LW ZLOO GUDZ D OHYHO RI FXUUHQW H[FHHGLQJ WKH UHOD\ VWDOO
SURWHFWLRQ WKUHVKROG ,  &RQVHTXHQWO\ IRU VXFFHVVIXO UHDFFHOHUDWLRQ WKH 3 UHOD\
FDQEHFRQILJXUHGWRWHPSRUDULO\LQKLELWWKHVWDOOSURWHFWLRQ
6O

,IDORZYROWDJHFRQGLWLRQH[LVWVRQWKH V\VWHP IRU D WLPH LQ H[FHVV RI PV XSRQ


UHFRYHU\ RI WKH YROWDJH WKH UHOD\ ZLOO LQKLELW VWDOO SURWHFWLRQ 5HDFFHOHUDWLRQ ZLOO EH
UHFRJQLVHG LI FXUUHQW DERYH WKH VHW WKUHVKROG LV GHWHFWHG ZLWKLQ  VHFRQGV RI WKH
YROWDJHUHFRYHU\'XULQJWKLVSHULRGWKHH[FHVVLYHVWDUWSURWHFWLRQLVHQDEOHG7KLVZLOO
SURYLGHSURWHFWLRQLQWKHHYHQWRIXQVXFFHVVIXOUHDFFHOHUDWLRQ)RUH[DPSOHDGLSLQ
WKHEXVEDUYROWDJHVXSSO\LQJVHYHUDOPRWRUVZRXOGUHVXOWLQHDFKRIWKHPDWWHPSWLQJ
UHDFFHOHUDWLRQ 6XEVHTXHQWO\ D ODUJH FXUUHQW ZLOO EH GUDZQ IURP WKH VXSSO\ WKXV
IXUWKHUUHGXFLQJWKHVXSSO\YROWDJHUHVXOWLQJLQSRWHQWLDOVWDOOLQJRIDOOPDFKLQHV7KLV
ZRXOG QRW RFFXU GXULQJ QRUPDO VWDUWLQJ DV D VWDJJHUHG DSSURDFK LV QRUPDOO\
DGRSWHG
7KLVIXQFWLRQLVGLVDEOHGGXULQJWKHVWDUWLQJSHULRG
6HWWLQJ*XLGHOLQHV
7KHORZYROWDJHWKUHVKROGLVYHU\PXFK V\VWHPGHSHQGHQWKRZHYHUDW\SLFDOVHWWLQJ
PD\EH9Q


8QGHUYROWDJHSURWHFWLRQ

 3ULQFLSOH
8QGHUYROWDJH FRQGLWLRQV PD\ RFFXU RQ D SRZHU V\VWHP DV D UHVXOW RI LQFUHDVHG
ORDGLQJ IDXOW FRQGLWLRQV RU LQFRUUHFW UHJXODWLRQ 7UDQVLHQW YROWDJH GLSV PD\ DOORZ
VXFFHVVIXO PRWRU UHDFFHOHUDWLRQ +RZHYHU VXVWDLQHG XQGHUYROWDJH FRQGLWLRQV ZLOO
UHVXOWLQPRWRUVWDOOLQJ7LPHGHOD\HGXQGHUYROWDJHSURWHFWLRQLVWKHUHIRUHFRPPRQO\
DSSOLHG
7KH XQGHUYROWDJH SURWHFWLRQ LQFOXGHG ZLWKLQ WKH 3 UHOD\V FRQVLVWV RI WZR
LQGHSHQGHQWSKDVHWRSKDVHPHDVXULQJVWDJHV
7ZR VWDJHV DUH LQFOXGHG WR SURYLGH ERWK DODUP DQG WULS VWDJHV ZKHUH UHTXLUHG
$OWHUQDWLYHO\GLIIHUHQWWLPHVHWWLQJVPD\EHUHTXLUHGGHSHQGLQJXSRQWKHVHYHULW\RI
WKHYROWDJHGLSLHPRWRUORDGVZLOOEHDEOHWRZLWKVWDQGDVPDOOYROWDJHGHSUHVVLRQ
IRUDORQJHUWLPHWKDQLIDPDMRUYROWDJHH[FXUVLRQZHUHWRRFFXU&RQVHTXHQWO\WZR
VWDJHV FRXOG EH XVHG RQH ZLWK D KLJKHU VHWWLQJ DQG D ORQJHU WLPH GHOD\ DQG YLFH
YHUVDIRUWKHVHFRQGVWDJH

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

7KHLQYHUVHFKDUDFWHULVWLFLVJLYHQE\WKHIROORZLQJIRUPXOD
W 706 0
ZKHUH
706 7LPH0XOWLSOLHU6HWWLQJ
W
RSHUDWLQJWLPHLQVHFRQGV
0
$SSOLHGLQSXWYROWDJH5HOD\VHWWLQJYROWDJH
 6HWWLQJ*XLGHOLQHV
7KH YROWDJH WKUHVKROG VHWWLQJ IRU WKH XQGHUYROWDJH SURWHFWLRQ VKRXOG EH VHW DW VRPH
YDOXH EHORZ WKH YROWDJH H[FXUVLRQV ZKLFK PD\ EH H[SHFWHG XQGHU QRUPDO V\VWHP
RSHUDWLQJFRQGLWLRQV&OHDUO\WKLVWKUHVKROGLVGHSHQGHQWXSRQWKHV\VWHPLQTXHVWLRQ
EXWW\SLFDOKHDOWK\V\VWHPYROWDJHH[FXUVLRQVPD\EHLQWKHRUGHURIRIQRPLQDO
YDOXH
6LPLODU FRPPHQWV DSSO\ ZLWK UHJDUG WR D WLPH VHWWLQJ IRU WKLV HOHPHQW LH WKH
UHTXLUHG WLPH GHOD\ LV GHSHQGHQW XSRQ WKH WLPH IRU ZKLFK WKH PRWRU LV DEOH WR
ZLWKVWDQG GHSUHVVHG YROWDJH $ W\SLFDO WLPH VHWWLQJ PD\ EH LQ WKH RUGHU RI 
VHFRQGV
7KLVIHDWXUHPXVWEHLQWHUORFNHGZLWKWKHPRWRUFRQWUROJHDULQRUGHUWRHQVXUHWKDWLW
LVGLVDEOHGZKHQWKHPRWRULVVWRSSHG$QRSWRLQSXWLVSURYLGHGIRUWKLVIXQFWLRQ


/RVVRIORDGSURWHFWLRQ

 3ULQFLSOH
,Q RUGHU WR GHWHFW ORVV RI PRWRU ORDG WKH 3 UHOD\ LQFOXGHV D ORZ IRUZDUG SRZHU
HOHPHQW ,W FDQ EH XVHG IRU H[DPSOH WR SURWHFW HOHFWULF SXPSV DJDLQVW EHFRPLQJ
XQSULPHGRUWRVWRSDPRWRULQWKHHYHQWRIDIDLOXUHLQWKHPHFKDQLFDOWUDQVPLVVLRQ
1RWH WKDW D ORZ IRUZDUG SRZHU FRQGLWLRQ FDQ RQO\ EH HVWDEOLVKHG ZKHQ WKH FLUFXLW
EUHDNHULVFORVHGDQGWKHDFWLYHSRZHUFDOFXODWHGLVDERYH]HUR
:KHUHUDWHGSRZHUFDQQRWEHUHDFKHGGXULQJVWDUWLQJ IRUH[DPSOHZKHUHWKHPRWRU
LVVWDUWHGZLWKQRFRQQHFWHGORDG LWZLOOEHQHFHVVDU\WRLQKLELWWKLVIXQFWLRQIRUDVHW
WLPH
 6HWWLQJ*XLGHOLQHV
7KHVHWWLQJRIWKLVHOHPHQWLVYHU\PXFKV\VWHPGHSHQGHQW+RZHYHULW ZLOO W\SLFDOO\
EHVHWWREHORZPLQLPXPORDG
5HIHUULQJWRWKHSUHYLRXVH[DPSOHGHWDLOVWKHPRWRUUDWHGSRZHUZLOOEH
3 [[ 09$
$VVXPLQJWKDWPLQLPXPORDGLQJPD\EHWKHPLQLPXPSRZHUWKUHVKROGPD\EH
VHWWRRIWKLVYDOXHLHN:
33RZHU6HW N:
7KHWLPHGHOD\3'URSRIIWLPHVKRXOGEHVHWLQH[FHVVRIWKHWLPHEHWZHHQPRWRU
VWDUWLQJDQGWKHORDGEHLQJHVWDEOLVKHG
7KHWLPHGHOD\RQSLFNXS37LPH'HOD\LVDSSOLFDWLRQGHSHQGHQW

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203



7*
&+$37(5
3DJHRI

6\QFKURQRXVPRWRUSURWHFWLRQ
,QWKHPDMRULW\RIDSSOLFDWLRQVDV\QFKURQRXVPRWRUZRXOGEHVWDUWHGDVDQLQGXFWLRQ
PRWRU ,I WKLV LV FDVH WKH DIRUHPHQWLRQHG SURWHFWLRQ HOHPHQWV DSSO\ HTXDOO\ WR ERWK
LQGXFWLRQ DQG V\QFKURQRXV PRWRUV +RZHYHU IRU WKH FRPSOHWH SURWHFWLRQ RI
V\QFKURQRXV PRWRUV DGGLWLRQDO SURWHFWLYH IHDWXUHV ZLOO EH UHTXLUHG 7KHVH IHDWXUHV
DUHGLVFXVVHGLQWKHIROORZLQJVHFWLRQV

 2XWRIVWHS3URWHFWLRQ
$ V\QFKURQRXV PRWRU PD\ GHFHOHUDWH DQG IDOO RXW RI VWHS ZKHQ LW LV VXEMHFWHG WR D
PHFKDQLFDO RYHUORDG H[FHHGLQJ LWV PD[LPXP DYDLODEOH RXWSXW ,W PD\ DOVR ORVH
V\QFKURQLVPIURPDIDOOLQWKHILHOGFXUUHQWRUVXSSO\YROWDJH$QRXWRIVWHSFRQGLWLRQ
ZLOO VXEMHFW WKH PRWRU WR XQGHVLUDEOH RYHUFXUUHQW DQG SXOVDWLQJ WRUTXH OHDGLQJ WR
HYHQWXDOVWDOOLQJ
:KHQ ORVV RI V\QFKURQLVP LV GHWHFWHG WKH PRWRU PXVW EH GLVFRQQHFWHG IURP WKH
VXSSO\
8SRQORVVRIV\QFKURQLVPDKHDY\FXUUHQWDWDYHU\ORZSRZHUIDFWRULVGUDZQIURP
WKHVXSSO\7KH3LVDEOHWRPRQLWRUWKLVFKDQJHLQSRZHUIDFWRUZKHQWKHPRWRU
SROH VOLSV WKXV DOORZLQJ DSSURSULDWH DFWLRQ WR EH WDNHQ ,I WKH SRZHU IDFWRU SDVVHV
XQGHUDGHILQHGWKUHVKROGIRUDGHILQHGWLPHDWULSLVJHQHUDWHG
6HWWLQJ*XLGHOLQHV
7KHDELOLW\RIDPRWRUWRUXQDWDORZSRZHUIDFWRUZLOOEHGHVLJQGHSHQGHQW
)RUDXQLW\SRZHUIDFWRUPDFKLQHWKHIROORZLQJVHWWLQJVZLOOEHW\SLFDO
-

SRZHUIDFWRU 

WLPHGHOD\ PV

GURSRIIWLPHGHOD\ RUVHFRQGVDERYHWKHVWDUWWLPHRIWKHPDFKLQH

+RZHYHUVRPHPDFKLQHVDUHGHVLJQHGWRRSHUDWHDWSRZHUIDFWRUVDVORZDVLQ
WKLVFDVHWKHVHWWLQJZLOOKDYHWREHDGMXVWHGDFFRUGLQJO\
 /RVVRIVXSSO\
2QORVVRIVXSSO\DV\QFKURQRXVPRWRUVKRXOGEHGLVFRQQHFWHGLI WKH VXSSO\ FRXOG
EH UHVWRUHG DXWRPDWLFDOO\ RU ZLWKRXW WKH PDFKLQH RSHUDWRUV NQRZOHGJH 7KLV LV WR
DYRLG WKH SRVVLELOLW\ RI WKH VXSSO\ EHLQJ UHVWRUHG RXW RI SKDVH ZLWK WKH PRWRU
JHQHUDWHGHPI
 8QGHUIUHTXHQF\
,I WKH PRWRU LV ORDGHG LW ZLOO GHFHOHUDWH IDLUO\ TXLFNO\ RQ ORVV RI VXSSO\ DQG WKH
IUHTXHQF\RIWKHWHUPLQDOYROWDJHZLOOIDOO7KH3UHOD\LVDEOHWRGHWHFWWKHIDOOLQ
IUHTXHQF\ DQG WDNH DSSURSULDWH DFWLRQ 7KLV XQGHUIUHTXHQF\ HOHPHQW LV D WZR VWDJH
GHYLFHZKLFKFDQEHXVHGIRUERWKDODUPDQGWULSSXUSRVHV

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

6HWWLQJ*XLGHOLQHV
7KLVVHWWLQJLVYHU\PXFKV\VWHPGHSHQGHQWVLQFHLWPD\EHSRVVLEOHIRUWKHIUHTXHQF\
RIWKHVXSSO\WRGHYLDWHGXULQJQRUPDOFRQGLWLRQV
6PDOOVRXUFHIUHTXHQF\FKDQJHVPD\DULVHIROORZLQJSRZHUWUDQVPLVVLRQGLVWXUEDQFHV
RULPPHGLDWHO\IROORZLQJDVXGGHQLQFUHDVHLQV\VWHPORDGLQJ6LJQLILFDQWIUHTXHQF\
YDULDWLRQVDUHUHODWLYHO\UDUHIRUODUJHLQWHUFRQQHFWHGSRZHUV\VWHPV,QVRPHUHJLRQV
RI WKH ZRUOG VLJQLILFDQW GURSV LQ V\VWHP IUHTXHQF\ KDYH EHHQ H[SHULHQFHG GXH WR
XQDYRLGDEOHGHILFLWRIJHQHUDWLRQGXULQJSHDNORDGSHULRGV
6R DV QRW WR WULS WKH PRWRU XQQHFHVVDULO\ LW LV WKHUHIRUH LPSRUWDQW WR GHWHUPLQH WKH
PLQLPXPV\VWHPIUHTXHQF\DQGVHWWKHXQGHUIUHTXHQF\HOHPHQWEHORZWKLVYDOXH
 2YHUYROWDJH
,I WKH VXSSO\ EXVEDUV KDYH QR RWKHU ORDG FRQQHFWHG DQG WKH PRWRU LV QRW ORDGHG
XSRQORVVRIVXSSO\WKHPRWRUWHUPLQDOYROWDJHFRXOGULVHLQVWDQWDQHRXVO\WR
GXHWRWKHRSHQFLUFXLWUHJXODWLRQRIWKHPDFKLQH
7KH3UHOD\KDVDQRYHUYROWDJHIHDWXUHZKLFKFDQEHXVHGWRGHWHFWWKLVFRQGLWLRQ
,W FRQVLVWV RI WZR LQGHSHQGHQW GHILQLWH WLPH PHDVXULQJ HOHPHQWV ZKLFK PHDVXUH
SKDVHSKDVHYROWDJH
6HWWLQJ*XLGHOLQHV
7KHVHWWLQJLVYHU\PXFKV\VWHPGHSHQGHQW+RZHYHULWZRXOGW\SLFDOO\EHVHWWR
DERYHUDWHGYROWDJH7KHUHIRUHIRUD997WKHUHOD\VHWWLQJZRXOGEH[
97KHWLPHUZRXOGEHPRWRUGHVLJQDQGDSSOLFDWLRQGHSHQGHQW

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203



7*
&+$37(5
3DJHRI

27+(53527(&7,21&216,'(5$7,216
7KHVH VHFWLRQV DUH LQWHQGHG WR FRYHU VSHFLDO DSSOLFDWLRQV RU ZKHUH VHYHUDO UHOD\
IXQFWLRQVFDQEHFRPELQHGWRSURYLGHRWKHUIRUPVRISURWHFWLRQ)RUH[DPSOHWKHXVH
RIWKHRYHUFXUUHQWHOHPHQWVLQEORFNLQJVFKHPHVWRSURYLGHEXVEDUSURWHFWLRQGHDG
PDFKLQHDQGSROHVOLSSLQJSURWHFWLRQIRUJHQHUDWRUVHWF
7KHSURJUDPPDEOHVFKHPHORJLFFDQDOVREHLQFOXGHGDVRQHRIWKHVHVHFWLRQV



$33/,&$7,212)1213527(&7,21)81&7,216



&,5&8,7%5($.(5&21',7,21021,725,1*
3HULRGLFPDLQWHQDQFHRIFLUFXLWEUHDNHUVLVQHFHVVDU\WRHQVXUHWKDWWKHWULSFLUFXLWDQG
PHFKDQLVPRSHUDWHFRUUHFWO\DQGDOVR WKDW WKH LQWHUUXSWLQJ FDSDELOLW\ KDV QRW EHHQ
FRPSURPLVHG GXH WR SUHYLRXV IDXOW LQWHUUXSWLRQV  *HQHUDOO\ VXFK PDLQWHQDQFH LV
EDVHGRQDIL[HGWLPHLQWHUYDORUDIL[HGQXPEHURIIDXOWFXUUHQWLQWHUUXSWLRQV7KHVH
PHWKRGV RI PRQLWRULQJ FLUFXLW EUHDNHU FRQGLWLRQ JLYH D URXJK JXLGH RQO\ DQG FDQ
OHDGWRH[FHVVLYHPDLQWHQDQFH
7KH UHOD\V UHFRUG YDULRXV VWDWLVWLFV UHODWHG WR HDFK FLUFXLW EUHDNHU WULS RSHUDWLRQ
DOORZLQJ D PRUH DFFXUDWH DVVHVVPHQW RI WKH FLUFXLW EUHDNHU FRQGLWLRQ WR EH
GHWHUPLQHG7KHVHPRQWLRULQJIHDWXUHVDUHGLVFXVVHGLQWKHIROORZLQJVHFWLRQ



&LUFXLW%UHDNHU&RQGLWLRQ0RQLWRULQJ)HDWXUHV
)RUHDFKFLUFXLWEUHDNHUWULSRSHUDWLRQWKHUHOD\UHFRUGVVWDWLVWLFV
7KHFLUFXLWEUHDNHUFRQGLWLRQPRQLWRULQJFRXQWHUVZLOOEHXSGDWHGHYHU\WLPHWKHUHOD\
LVVXHV D WULS FRPPDQG ,Q FDVHV ZKHUH WKH EUHDNHU LV WULSSHG E\ DQ H[WHUQDO
SURWHFWLRQ GHYLFH LW LV DOVR SRVVLEOH WR XSGDWH WKH &% FRQGLWLRQ PRQLWRULQJ 7KLV LV
DFKLHYHGE\DOORFDWLQJRQHRIWKHUHOD\VRSWRLVRODWHGLQSXWV YLDWKHSURJUDPPDEOH
VFKHPHORJLF WRDFFHSWDWULJJHUIURPDQH[WHUQDOGHYLFH7KHVLJQDOWKDWLVPDSSHG
WRWKHRSWRLVFDOOHG([WHUQDO7ULS
1RWH WKDW ZKHQ LQ &RPPLVVLRQLQJ WHVW PRGH WKH &% FRQGLWLRQ PRQLWRULQJ FRXQWHUV
ZLOOQRWEHXSGDWHG



6HWWLQJJXLGHOLQHV

 6HWWLQJWKH,AWKUHVKROG
:KHUH RYHUKHDG OLQHV DUH SURQH WR IUHTXHQW IDXOWV DQG DUH SURWHFWHG E\ RLO FLUFXLW
EUHDNHUV 2&%V RLOFKDQJHVDFFRXQWIRUDODUJHSURSRUWLRQRIWKHOLIHF\FOHFRVWRI
WKH VZLWFKJHDU  *HQHUDOO\ RLO FKDQJHV DUH SHUIRUPHG DW D IL[HG LQWHUYDO RI FLUFXLW
EUHDNHUIDXOWRSHUDWLRQV+RZHYHUWKLVPD\UHVXOWLQSUHPDWXUHPDLQWHQDQFHZKHUH
IDXOWFXUUHQWVWHQGWREHORZDQGKHQFHRLOGHJUDGDWLRQLVVORZHUWKDQH[SHFWHG7KH
 ,A FRXQWHU PRQLWRUV WKH FXPXODWLYH VHYHULW\ RI WKH GXW\ SODFHG RQ WKH LQWHUUXSWHU
DOORZLQJDPRUHDFFXUDWHDVVHVVPHQWRIWKHFLUFXLWEUHDNHUFRQGLWLRQWREHPDGH

7*
&+$37(5
3DJHRI

7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

)RU2&%VWKHGLHOHFWULFZLWKVWDQGRIWKHRLOJHQHUDOO\GHFUHDVHVDVDIXQFWLRQRI
, W7KLVLVZKHUH,LVWKHIDXOWFXUUHQWEURNHQDQGWLVWKHDUFLQJWLPH ZLWKLQ WKH
LQWHUUXSWHUWDQN QRWWKHLQWHUUXSWLQJWLPH $VWKHDUFLQJWLPHFDQQRWEHGHWHUPLQHG
DFFXUDWHO\WKHUHOD\ZRXOGQRUPDOO\EHVHWWRPRQLWRUWKHVXPRIWKHEURNHQFXUUHQW
VTXDUHGE\VHWWLQJ


%URNHQ,A 
)RU RWKHU W\SHV RI FLUFXLW EUHDNHU HVSHFLDOO\ WKRVH RSHUDWLQJ RQ KLJKHU YROWDJH
V\VWHPV SUDFWLFDO HYLGHQFH VXJJHVWV WKDW WKH YDOXH RI %URNHQ ,A   PD\ EH
LQDSSURSULDWH ,Q VXFK DSSOLFDWLRQV %URNHQ ,A PD\ EH VHW ORZHU W\SLFDOO\  RU
 $Q DODUP LQ WKLV LQVWDQFH PD\ EH LQGLFDWLYH RI WKH QHHG IRU JDVYDFXXP
LQWHUUXSWHU+9SUHVVXUHWHVWLQJIRUH[DPSOH
7KHVHWWLQJUDQJHIRU%URNHQ,ALVYDULDEOHEHWZHHQDQGLQVWHSV,WLV
LPSHUDWLYH WKDW DQ\ PDLQWHQDQFH SURJUDPPH PXVW EH IXOO\ FRPSOLDQW ZLWK WKH
VZLWFKJHDUPDQXIDFWXUHUVLQVWUXFWLRQV
 6HWWLQJWKHQXPEHURIRSHUDWLRQVWKUHVKROG
(YHU\ RSHUDWLRQ RI D FLUFXLW EUHDNHU UHVXOWV LQ VRPH GHJUHH RI ZHDU IRU LWV
FRPSRQHQWV  7KXV URXWLQH PDLQWHQDQFH VXFK DV RLOLQJ RI PHFKDQLVPV PD\ EH
EDVHGXSRQWKHQXPEHURIRSHUDWLRQV6XLWDEOHVHWWLQJRIWKHPDLQWHQDQFHWKUHVKROG
ZLOODOORZDQDODUPWREHUDLVHGLQGLFDWLQJZKHQSUHYHQWDWLYHPDLQWHQDQFHLVGXH
&HUWDLQ FLUFXLW EUHDNHUV VXFK DV RLO FLUFXLW EUHDNHUV 2&%V  FDQ RQO\ SHUIRUP D
FHUWDLQQXPEHURIIDXOWLQWHUUXSWLRQVEHIRUHUHTXLULQJPDLQWHQDQFHDWWHQWLRQ7KLVLV
EHFDXVHHDFKIDXOWLQWHUUXSWLRQFDXVHVFDUERQLVLQJRIWKHRLOGHJUDGLQJLWVGLHOHFWULF
SURSHUWLHV  7KH PDLQWHQDQFH DODUP WKUHVKROG &% 2SV 0DLQW  PD\ EH VHW WR
LQGLFDWH WKH UHTXLUHPHQW IRU RLO VDPSOLQJ IRU GLHOHFWULF WHVWLQJ RU IRU PRUH
FRPSUHKHQVLYHPDLQWHQDQFH
 6HWWLQJWKHRSHUDWLQJWLPHWKUHVKROG
6ORZ &% RSHUDWLRQ LV DOVR LQGLFDWLYH RI WKH QHHG IRU PHFKDQLVP PDLQWHQDQFH
7KHUHIRUH DQ DODUP WKUHVKROG &% 7LPH $ODUP  LV SURYLGHG DQG LV VHWWDEOH LQ WKH
UDQJHRIWRPV7KLVWLPHLVVHWLQUHODWLRQWRWKHVSHFLILHGLQWHUUXSWLQJWLPHRI
WKHFLUFXLWEUHDNHU


&,5&8,7%5($.(5&21752/
7KHUHOD\LQFOXGHVWKHIROORZLQJRSWLRQVIRUFRQWURORIDVLQJOHFLUFXLWEUHDNHU

ORFDOWULSSLQJDQGFORVLQJYLDWKHUHOD\PHQX

ORFDOWULSSLQJDQGFORVLQJYLDUHOD\RSWRLVRODWHGLQSXWV

UHPRWHWULSSLQJDQGFORVLQJXVLQJWKHUHOD\FRPPXQLFDWLRQV

,WLVUHFRPPHQGHGWKDWVHSDUDWHUHOD\RXWSXWFRQWDFWVDUHDOORFDWHGIRUUHPRWHFLUFXLW
EUHDNHU FRQWURO DQG SURWHFWLRQ WULSSLQJ  7KLV HQDEOHV WKH FRQWURO RXWSXWV WR EH
VHOHFWHGYLDDORFDOUHPRWHVHOHFWRUVZLWFKDVVKRZQLQ)LJXUH:KHUHWKLVIHDWXUH
LVQRWUHTXLUHGWKHVDPHRXWSXWFRQWDFW V FDQEHXVHGIRUERWKSURWHFWLRQDQGUHPRWH
WULSSLQJ

7HFKQLFDO*XLGH
$SSOLFDWLRQV1RWHV
0L&203

7*
&+$37(5
3DJHRI

YH

3URWHFWLRQ
WULS
7ULS
5HPRWHFRQWURO



WULS

&ORVH

5HPRWHFRQWURO
FORVH

/RFDO
5HPRWH

7ULS

&ORVH

YH

)LJXUH5HPRWHFRQWURORIFLUFXLWEUHDNHU
$ PDQXDO WULS ZLOO EH SHUPLWWHG SURYLGHG WKDW WKH FLUFXLW EUHDNHU LV LQLWLDOO\ FORVHG
/LNHZLVHDFORVHFRPPDQGFDQRQO\EHLVVXHGLIWKH&%LVLQLWLDOO\RSHQ7RFRQILUP
WKHVH VWDWHV LW ZLOO EH QHFHVVDU\ WR XVH WKH EUHDNHU $ DQGRU % FRQWDFWV WKH
GLIIHUHQWVHOHFWLRQRSWLRQVDUHJLYHQIURPWKH&%6WDWXV,QSXWFHOODERYH ,IQR&%
DX[LOLDU\ FRQWDFWV DUH DYDLODEOH WKHQ WKLV FHOO VKRXOG EH VHW WR 1RQH 8QGHU WKHVH
FLUFXPVWDQFHVQR&%FRQWURO PDQXDORUDXWR ZLOOEHSRVVLEOH
2QFH D &% &ORVH FRPPDQG LV LQLWLDWHG WKH RXWSXW FRQWDFW FDQ EH VHW WR RSHUDWH
IROORZLQJDXVHUGHILQHGWLPHGHOD\ 0DQ &ORVH 'HOD\ 7KLV ZRXOG JLYH SHUVRQQHO
WLPHWRPRYHDZD\IURPWKHFLUFXLWEUHDNHUIROORZLQJWKHFORVHFRPPDQG7KLVWLPH
GHOD\ZLOODSSO\WRDOOPDQXDO&%&ORVHFRPPDQGV
7KHOHQJWKRIWKHWULSRUFORVHFRQWUROSXOVHFDQEHVHWYLDWKH7ULS3XOVH7LPHDQG
&ORVH 3XOVH 7LPH VHWWLQJV UHVSHFWLYHO\ 7KHVH VKRXOG EH VHW ORQJ HQRXJK WR HQVXUH
WKHEUHDNHUKDVFRPSOHWHGLWVRSHQRUFORVHF\FOHEHIRUHWKHSXOVHKDVHODSVHG
1RWH WKDW WKH PDQXDO FORVH FRPPDQGV IRU HDFK XVHU LQWHUIDFH DUH IRXQG LQ WKH
6\VWHP'DWDFROXPQRIWKHPHQX
,I DQ DWWHPSW WR FORVH WKH EUHDNHU LV EHLQJ PDGH DQG D SURWHFWLRQ WULS VLJQDO LV
JHQHUDWHGWKHSURWHFWLRQWULSFRPPDQGRYHUULGHVWKHFORVHFRPPDQG
,IWKH&%IDLOVWRUHVSRQGWRWKHFRQWUROFRPPDQG LQGLFDWHGE\QRFKDQJHLQWKHVWDWH
RI &% 6WDWXV LQSXWV  D &% )DLOHG WR 7ULS RU  &% )DLOHG WR &ORVH DODUP ZLOO EH
JHQHUDWHGDIWHU WKH UHOHYDQW WULS RU FORVH SXOVHV KDYH H[SLUHG 7KHVH DODUPV FDQ EH
YLHZHGRQWKHUHOD\/&'GLVSOD\UHPRWHO\YLDWKHUHOD\FRPPXQLFDWLRQV RU FDQ EH
DVVLJQHGWRRSHUDWHRXWSXWFRQWDFWVIRUDQQXQFLDWLRQXVLQJWKHUHOD\VSURJUDPPDEOH
VFKHPHORJLF 36/ 

7*
&+$37(5
3DJHRI



7HFKQLFDO*XLGH
$SSOLFDWLRQVQRWHV
0L&203

&7975(48,5(0(176
7KH FXUUHQW WUDQVIRUPHU UHTXLUHPHQWV DUH EDVHG RQ D PD[LPXP SURVSHFWLYH IDXOW
FXUUHQWRIWLPHVWKHUHOD\UDWHGFXUUHQW ,Q DQGWKHUHOD\KDYLQJDQLQVWDQWDQHRXV
VHWWLQJ RI  WLPHV UDWHG FXUUHQW ,Q  7KH FXUUHQW WUDQVIRUPHU UHTXLUHPHQWV DUH
GHVLJQHGWRSURYLGHRSHUDWLRQVRIDOOSURWHFWLRQHOHPHQWV
:KHUHWKHFULWHULDIRUDVSHFLILFDSSOLFDWLRQDUHLQH[FHVVRIWKRVHGHWDLOHGDERYHRU
WKHDFWXDOOHDGUHVLVWDQFHH[FHHGVWKHOLPLWLQJYDOXHTXRWHGWKH&7UHTXLUHPHQWVPD\
QHHGWREHLQFUHDVHGDFFRUGLQJWRWKHIRUPXODHLQWKHIROORZLQJVHFWLRQV
1RPLQDO
UDWLQJ

1RPLQDO
RXWSXW

$FFXUDF\
FODVV

$FFXUDF\
/LPLWLQJOHDG
OLPLWHGIDFWRU
UHVLVWDQFH

$

9$

3



2KPV

$

9$

3



2KPV