You are on page 1of 4

12/9/2015

TipsIptek:InilahTipsCerdasMerawatKomputerTanpaTeknisi

December9,2015

Home

KitFormalin

BreakingNews

AboutUs

KitBoraks

ETGroupBiz

KampoengTestKit

KitMethailYellow

AVIMedica

ETOthers

Search...

MakeMoneyFromYourSite

MakeMoneyFromYourSite

Joinover100,000PublishersThatAre
MakingThousandsofDollars!
www.BidVertiser.com

Joinover100,000PublishersThatAre
MakingThousandsofDollars!
www.BidVertiser.com

KitRhodamineB

Harga Jauh Lebih Murah UMi Rome Kalahkan iPhone6S 2015/11/23

ProdukLain

KitLain

EasyTestProducts

TestKitShopProducts

undefinedComments

akang4biz

02:34

Homehandphonemurahhargamurahkaryaipteklaptopmurahlayananterpercayaprodukberkualitasprodukindonesiatips
androidtipsiptektipskomputertipsperawatanTipsIptek:InilahTipsCerdasMerawatKomputerTanpaTeknisi

Tips Iptek: Inilah Tips Cerdas Merawat Komputer Tanpa Teknisi


CaraMerawatKomputermerupakansalahsatukatakunciyangseringAndaketikkandimesinpencarian
sepertiGoogle,BingdanmaupunYahoo.Sayayakindenganmengetikkankatatersebut,Andapastitidak
ingin komputer kesayangan Anda tibatiba mati seketika dan tidak bisa digunakan. Ya itu merupakan
sesuatuyangwajar,Sayapunmelakukanhalyangsama.PastinyaAndainginagarkomputeryangAnda
gunakantetapterawatbaikdarisegiHardwaremaupunSoftwarenya.
Untukmerawatkomputer(PC)ataulaptop,sebenarnyasangatlahmudah.Andabisamelakukannyasendiri
dirumah maupun ditempat Anda bekerja, Anda hanya membutuhkan sedikit tambahan informasi agar
AndabisabenarbenarmengertiCaraMerawatKomputerAgarTetapAwetdigunakan.Sebenarnyabanyak
sekali cara merawat komputer/laptop Anda agar tetap bisa Anda gunakan walaupun tergolong komputer
lama,sepertiMerawatKomputerAndadariVirusdanMerawatKomputerSecaraHardwaredanSoftware.

InfoTechnologiLain,CekDisini

BeliGmailU/
Domain
Anda
AlamatEmailBisnis
Khusus.MulaiUji
CobaGratis30Hari.

Baik tanpa panjang lebar, mari Kita bahas Tips Cerdas Merawat
KomputerTanpaTeknisiberikutini:
TIPSIBackupKomputerSecaraBerkala
Backup Komputer sengaja Saya tempatkan pada posisi pertama karena ini merupakan hal yang sangat
pentingdaripoinpoinyanglainyangakanKitabahas.MelakukanBackupsecaraberkalasangatbaikuntuk
Anda lakukan, ini berguna untuk menghindari halhal yang tidak diinginkan seperti file terhapus, hardisk
rusak maupun kejadiankejadian lain yang menyebabkan file/berkas Anda tidak bisa diakses. Anda dapat
melakukanBackupdatamenggunakanmediapenyimpananlainsepertiExternalHardisk,Flasdiskmaupun

Popular

Recent

Comments

Archive

FloppyDisk.JadiketikaFileAndatidakbisadiaksesatauhardiskAndamengalamikerusakan,makaAnda
masihmemilikiBackupfiletersebutdimediapenyimpananyanglain.
TIPSIIOperasikanKomputerSesuaiProsedur
Ya tidak bisa dipungkiri lagi, mengoperasikan komputer dengan cara yang baik dan benar, akan

Laptopbarumurahdibawah1jutaVIACPU7
inchMiniNetbookLaptopNotebookWIFI
WindowsCE6.02GBHD(LaptopChina)
MINILAPTOPSOnyVAIO10inchNetbook
MURAHTerlaris

memberikan dampak baik bagi kesehatan komputer Anda. Mengoperasikan komputer sesuai dengan
prosedurmerupakanlangkahcerdasyangbisaAndalakukanagarkomputerAndatetapawetdanmampu
untuk digunakan dalam jangka panjang. Jika Anda masih merasa bingung dengan Cara Mengoperasikan
Komputer,silahkanbacaupdatesebelumnyayangmembahastentanghaltersebut.
JikaAndasudahmengetahuiCaraMengoperasikanKomputeryangBaikdanBenar,sekarangAndahanya
tinggal mengembangkan pengetahuan Anda agar kegiatan Anda dengan komputer seharihari tidak
membuat Anda merasa jenuh. Anda juga perlu tau mengenai Ergonomi Komputer agar Anda bisa lebih
nyamandalammengoperasikankomputerdantentunyatidakmengganggukesehatanAnda.
TIPSIIITutupProgramYangTidakDigunakan
Menjalankanaplikasisecarabersamaan(multitasking),akanmemperlambatkinerjadarisebuahkomputer,

ProdukHandphoneMurah:Vivistar3.6Inch
QuadBandDualSIMSliderPhone(WIFI,TV,
QWERTY)
VidioKameraDigitalHebatHargaMurah
PROTAXDIGITALVIDEOCAMERAWIDEANGLE
2.4inDC500T12MP
12InchLCDTouchScreenMonitorfor
Computers,TV+DVDPlayer
ProdukHandphoneMurah:GunslingerChinaCell
PhonewithKeyboardandSwivelTouchscreen

hal ini dikarenakan pemakaian memory dari komputer yang semakin besar yang mengakibatkan kinerja
sistem mulai menurun. Untuk mengantisipasi hal tersebut, sebaiknya Anda tutup aplikasi yang tidak
digunakan agar kinerja sistem komputer bisa lebih stabil dan secara otomatis memperpanjang umur
perangkatkomputerAnda.
TIPSIVUninstall/HapusProgramYangTidakPerlu

http://itoptech.blogspot.co.id/2014/09/inilahtipscerdasmerawatkomputer.html

ProdukHandphoneMurah:PowerFour2.8Inch
TouchscreenQuadbandCellPhonewithFour
SIMCardSlots
LaptopMurahLaptopwithWIFIWinCE6.0

1/4

12/9/2015

TipsIptek:InilahTipsCerdasMerawatKomputerTanpaTeknisi
(10.1inch)hanya1.599.000,

Terlalu banyak menginstall aplikasi pada sebuah komputer akan menyebabkan Kinerja sistem komputer
tidak berjalan stabil dan komputer akan terasa berat saat menjalankan aplikasi, hal ini dikarenakan
resourceatautempatyangdipakaiolehaplikasiyangAndainstallakanmemakantempatyangbanyakdan

ProdukHandphoneMurah:ThriftyWatchPhone
Black(QuadBand,Bluetooth,Touchscreen)

berlebihandaninitidakbaikdansangattidakdirekomendasikan.ApalagijikakomputeryangAndagunakan
memilikispesifikasiyangstandart/paspasan.
Agarkomputerdapatberjalandenganstabil,Andabisamenghapusprogramyangtidakdiperlukansaatini,

OurPartnerLINKS
EASYTEST(BukaLapak)

karena programprogram tersebut dapat memperlambat kinerja dari sebuah komputer. Jika Anda

EASYTEST(TOKOPEDIA)

memerlukanprogramtersebutdikemudianhari,silahkanAndainstallkembali.

TESTKITSHOP(WP)
EASYTESTPAGES

TIPSVBersihkanPerangkatKomputerdariDebu

BATIKONLINESHOP
ALATTERAPIKESEHATAN

JikaAndasudahpernahMerakitKomputerSendiri,pastinyaAndasudahmengetahuikomponenkomponen

MITRAABADITERAPI

yang terdapat dalam komputer Anda. Komponenkomponen komputer tersebut akan berjalan dengan

HIFABUSANA

optimaljikakondisinyaterawat.AndabisamembayangkanjikaCPUAndatidakpernahdibersihkanselama
beberapabulan,pastiAndaakanmelihatdebudebuyangmenempeldanmulaimenebalpadaperangkat
komputer Anda, ini dapat mengganggu kinerja dari komponen komputer tersebut. Sebagai contoh CPU

OTHERSHOTINFO

Cooler misalnya, jika Anda tidak lakukan pembersihan secara rutin, maka debu dan kotoran akan
menempelpadabagianatauselaselakipasyangdapatmemperlambatperputarankipas,danbisaberakibat
fatal.AndabisabayangkanjikapendinginpadaCPUAndatibatibamati,pastikomputerAndaakancepat
panasdantidakmenutupkemungkinanjikakomputerAndatibatibamati.
Agar hal tersebut tidak terjadi, sangat baik sekali jika Anda rajin membersihkan kotoran atau debu yang
menempel pada perangkat komputer Anda, dan jika Anda melakukannya secara berkala, maka dijamin
komputerAndaakanselalunyamanuntukdigunakandanperangkatkomputerAndaakanjauhlebihawet.

BeliGmailU/
Domain
Anda

TIPSVIVentilasiYangCukupUntukPerangkatKomputer
JikaAndamenggunakankomputerdiruanganyangtertutup,sebaiknyaAndapastikansuhuudaradidalam
ruangan tersebut tetap dingin. Suhu ruangan sangat berpengaruh terhadap komponenkomponen
komputer, jika suhu ruangan komputer Anda tidak stabil/panas, maka komponenkomponen komputer
Andajugaakancepatpanas,hal

AlamatEmailBisnis
Khusus.MulaiUji
CobaGratis30Hari.

BeliGmailU/DomainAnda
AlamatEmailBisnisKhusus.MulaiUjiCoba
Gratis30Hari.

inidikarenakankipaspendinginyangterdapatdalamcasingkomputertidakdapatmenyeimbangkansuhu
dalamkomputertersebut.
Untukmenghindarihaltersebut,sebaiknyaAndamembuatventilasiyangcukupagarsuhudalamruangan
tetapterjaga,sehinggakomponenkomponenkomputerAndatidakcepatpanas(overheating).Andajuga
dapatmemberikankipaspendingintambahanpadacasingCPUAnda.
TIPSVIILakukanDefragmentSecaraBerkala
Disk Defragment adalah sebuah program untuk membantu merpaihkan penempatan data di dalam
harddisk,setelahrapihefeknyaadalahkecepatandalammencaridatalebihefisienkarenatidakberpencar
lagi.DefragmentmerupakantoolbawaanSistemOperasiWindows.
Fungsi Defragment adalah untuk menata dan mengurutkan filefile harddisk berdasarkan jenis file/data
sedemikian rupa sehingga akan mempermudah proses read/write. Dengan demikian, beban kerja akan
lebihringanyangakhirnyadapatmemperpanjangumurharddisk.
CaramelakukanDefragmentadalah:
KlikmenuStart>Program>Accesories>SystemTool>DiskDefragmenter.Saatmenjalankanfungsiini
sebaiknyatutupsemuaaplikasi,agarprosespenataandapatberjalansecaraoptimal.
TIPSVIIIBersihkanReycycleBinSecaraRutin
RecycleBinatauTrashdalamduniakomputermerupakantempatpenyimpanansementarauntukfileyang

http://itoptech.blogspot.co.id/2014/09/inilahtipscerdasmerawatkomputer.html

2/4

12/9/2015

TipsIptek:InilahTipsCerdasMerawatKomputerTanpaTeknisi

telah dihapus dari file manager oleh user. Namun belum secara permanen dihapus dari physical media
sehinggamemungkinkanfiletersebutdikembalikanpadalokasisemula,jikaterjadikesalahanpenghapusan
data.
Sebenarnyafile/folderyangkitahapustidaklangsunghilangdariharddiskkarenaakanditampungdahulu
diRecycleBin,meskipunadabeberapajenispengaturanyangbisakitagunakanantaralainmemberikan
peringatansaatmenghapus,hapuslalusimpanditempatsementaraatauhapuspermanen.Pengaturan
untukjenishapuslaludisimpanditempatpenampunganinibertujuanagarsuatusaatapabila
Anda masih membutuhkannya dapat mengembalikan lagi. Recycle Bin yang sudah banyak juga akan
menyita ruang harddisk yang dapat menyebabkan pembacaan harddisk menjadi lambat. Cara
mengosongkan Recycle Bin adalah: Jalankan Windows Explorer >> klik Recycle Bin >> klik File >> klik
EmptyRecyleBin.
TIPSIXAktifkanFirewallKomputer
Firewalladalahsuatusistemperangkatlunakyangmengizinkanlalulintasjaringanyangdianggapaman
untuk bisa melaluinya dan mencegah lalu lintas jaringan yang dianggap tidak aman. Umumnya, sebuah
tembokapi diterapkan dalam sebuah mesin terdedikasi, yang berjalan pada pintu gerbang (gateway)
antarajaringanlokaldenganjaringanInternet.
Firewall digunakan untuk membatasi atau mengontrol akses terhadap siapa saja yang memiliki akses
terhadapjaringanpribadidaripihakluar.Saatini,istilahFirewallmenjadiistilahlazimyangmerujukpada
sistem yang mengatur komunikasi antar dua macam jaringan yang berbeda. Mengingat saat ini banyak
perusahaanyangmemilikiakseskeInternetdanjugatentusajajaringanberbadanhukumdidalamnya,
maka perlindungan terhadap perangkat digital perusahaan tersebut dari serangan para peretas, pemata
mata,ataupunpencuridatalainnya,menjadikenyataan.
Sebenarnya pada sistem operasi Windows sendiri sudah ada fasilitas Firewall ini hanya saja jarang
difungsikan.jikaAndainginmengaktifkannya,makasilahkanikutilangkahlangkahberikut:
1. KlikStartlalupilihControlPanel
2. KalosudahmasukdiControlPanel,lalupilihWindowsFirewall
3. DimenusebelahkirilagipilihtulisanTurnWindowsFirewallonoroff
4. SilahkanAndagantion(untukmengaktifkanFirewall)atauoff(untukmenonaktifkanFirewall),lalu
klikOK.

TIPSXInstallAntiVirusdanLakukanUpdateBerkala
MenginstallAntiVirusmerupakansalahsatulangkahcerdasuntukmerawatdanmenjagakomputeragar
tidak cepat rusak. Fungsi Anti Virus sendiri adalah sebagai proteksi dan perlindungan dari serangan virus
komputer.
Banyak sekali Software Anti virus Gratis maupun berbayar yang Anda dapat gunakan untuk melindungi
komputerkesayanganAnda,sepertiAvast,Kaspersky,Avira,AVG,Smadav(Lokal)danmasihbanyaklagi
yanglainnya.NamunyangpastijanganlupauntukmelakukanupdatedatabaseAntiVirussecaraberkala
agarAntiVirussenantiasamendeteksiadanyaseranganVirusvirusbaru.
END
Dengan mengikuti beberapa tips diatas, maka Anda sudah bisa merawat dan menjaga komputer sendiri
tanpa harus repotrepot memanggil teknisi komputer untuk melakukan perawatan komputer Anda.
Semoga beberapa tips cerdas diatas dapat membantu rekanrekan dalam Merawat Komputer Agar Tetap
Awet.(Sumber:webberbagi.blogspot.com)
=================================================
Untukinformasidanpemesanansilahkanemailkeeasy4test@yahoo.com/easy4test@
gmail.comatauhubungi085310135381,085779721597,atau081806201522.InfoProduk
LengkapLainlihatdi:WebsiteEasyTest,atauBlogTokoOnlineTestKit.
Tag:karyaiptek,produkindonesia,produkberkualitas,hargamurah,layananterpercaya,laptopmurah,
handphonemurah,beritaiptek,tipsiptek,peluangbisnis,androidmurah
handphonemurah
produkindonesia
SHARE:

Next

hargamurah
tipsandroid

karyaiptek
tipsiptek

laptopmurah

tipskomputer

Tips Iptek: Inilah 5 Cara Mengatasi Ponsel Android yang Lemot

layananterpercaya

produkberkualitas

tipsperawatan

Previous

Tips Iptek: Inilah 5 Cara Merawat Baterai Android

RELATED POSTS

http://itoptech.blogspot.co.id/2014/09/inilahtipscerdasmerawatkomputer.html

3/4

12/9/2015

TipsIptek:InilahTipsCerdasMerawatKomputerTanpaTeknisi

DownloadGRATISPortableAppKatagori
UTILITIES
HalamanPusatDownloadGratis(Free
Download)

TheAlexaTop25SitesonTheWeb
ThisinformationtakefromAlexa.Com
HargaJauhLebihMurahUMiRome
KalahkaniPhone6S

Sebenarnyadiduniainiterdapatbegitu
BEIJINGSebuahsmartphonebuatansalah
Banyakaplikasigratisdengankemampuan
satuprodusenasalChinasedangramai
dankualitasyangluarbiasayangbahkan
dibicarakan.Pasalnya,smartphoneyang
dapatbersaingataubahkanma...
bernamaUMiinimempunyaispe...
XiaomiAkanLuncurkanSmartwatch
denganHargaTerjangkau

DownloadGRATISPortableAppKatagori
OFFICE

BEIJINGXiaomidalamwaktudekat
DownloadSoftwareSecaraAmandanLegal,
kembaliakanmeluncurkanproduk
ServerLokaldanBebasdariVirus.The
smartwatchdansmartphonepada24
PortableAppDirectoryandPortableApp
Novembermendatang.MemangselamainiXiaomibe... Marketplacelistfreeopen...
DownloadGRATISPortableAppKatagori
SECURITY
DownloadSoftwareSecaraAmandanLegal,
ServerLokaldanBebasdariVirus.The
PortableAppDirectoryandPortableApp
Marketplacelistfreeopen...

9bestChromebooks2015/2016
Chromebooksareinexpensivelaptopswith
adifference:theyrunGoogle'sChromeOS
insteadofWindowsorOSX.Herewereview
thebestChromebooksyo...

EASYTESTKITWEBSUPPORTDAPATANDAKUNJUNGIDILINKBERIKUT:BAHASAINDONESIA:EasyTestSupport,
PenawaranJual,KatalogProduk,ENGLISHLANGUAGE:EasyTestSupport,SellingOffers,ProductsCatalog
FEEDTESTKITSHOP(GunakanLinkini).WEBSUPPORTRESMICV.ETGROUP:CV.ETGROUPBusiness,Test
KitShop,danEasyTestKitInfo
THANKSSOMUCHFOR:GoogleSearchEngine,GMail,Blogger.Com,Yahoo,YahooMail,Wordpress,Blog
Detik,IndoNetwork,Twitter,Facebook,etc.

MakeMoneyFromYourSite

MakeMoneyFromYourSite

Joinover100,000PublishersThatAre
MakingThousandsofDollars!
www.BidVertiser.com

Joinover100,000PublishersThatAre
MakingThousandsofDollars!
www.BidVertiser.com

Copyright2012iTopTechAllRightReserved
BloggerDesignedbyIVYthemes|MKRSite

http://itoptech.blogspot.co.id/2014/09/inilahtipscerdasmerawatkomputer.html

ToggleFooter

PostsRSSCommentsRSS

4/4