You are on page 1of 397

03_ WCDMA RAN RRM HSDPA

D511004772

Draft
2
Confidential

Metadata on the cover page and rendition header and footer are automatically generated from the ShareNetIMS application. For the actual document metadata please see the first page of the actual document.

03_ WCDMA RAN RRM HSDPA

NSN Document
Number
Version
Number
Confidentiality
Document
Type
Document
Owner
Document
Created By
Document
Creation Date
Version
Created By
Document
Modify Date
Reviewers
Date Reviewed
Approver
Actual
approval date
Lifecycle
Status

D511004772
2
Confidential

Viitanen, Irma Hannele


Viitanen, Irma Hannele
02/26/2014 09:21 AM
Viitanen, Irma Hannele
04/14/2014 03:00 PM

Draft

Enterprise:Topics:Product Information Center:PIC


Documentation:Product_Categories:Radio Network:Radio Network Solutions:WCDMA
RAN:zz Archived 2014-04-14> WCDMA RAN, Rel. RU40, Operating Documentation, Issue
04, Documentation Change Delivery 3:PDF
Document ID 511004772
Document
https://sharenetOverview URL ims.inside.nokiasiemensnetworks.com/livelink/livelink/overview/D511004772
Document
Location

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARAN,Rel.RU40,
OperatingDocumentation,
Issue04Documentation
ChangeDelivery3
WCDMARANRRMHSDPA
DN0638161
Issue06H
ApprovalDate2014-01-23

R: 1/396

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Theinformationinthisdocumentissubjecttochangewithoutnoticeanddescribesonlytheproduct
defined in the introduction of this documentation. This documentation is intended for the use of
NokiaSolutionsandNetworkscustomersonlyforthepurposesoftheagreementunderwhichthe
documentissubmitted,andnopartofitmaybeused,reproduced,modifiedortransmittedinany
formormeanswithoutthepriorwrittenpermissionofNokiaSolutionsandNetworks.Thedocumentationhasbeenpreparedtobeusedbyprofessionalandproperlytrainedpersonnel,andthecustomerassumesfullresponsibilitywhenusingit.NokiaSolutionsandNetworkswelcomescustomer
commentsaspartoftheprocessofcontinuousdevelopmentandimprovementofthedocumentation.
The information or statements given in this documentation concerning the suitability, capacity, or
performanceofthementionedhardwareorsoftwareproductsaregiven"asis"andallliabilityarisinginconnectionwithsuchhardwareorsoftwareproductsshallbedefinedconclusivelyandfinally
in a separate agreement between Nokia Solutions and Networks and the customer. However,
NokiaSolutionsandNetworkshasmadeallreasonableeffortstoensurethattheinstructionscontained in the document are adequate and free of material errors and omissions. Nokia Solutions
and Networks will, if deemed necessary by Nokia Solutions and Networks, explain issues which
maynotbecoveredbythedocument.
NokiaSolutionsandNetworkswillcorrecterrorsinthisdocumentationassoonaspossible.INNO
EVENT WILL Nokia Solutions and Networks BE LIABLE FOR ERRORS IN THIS DOCUMENTATION OR FOR ANY DAMAGES, INCLUDING BUT NOT LIMITED TO SPECIAL, DIRECT, INDIRECT,INCIDENTALORCONSEQUENTIALORANYLOSSES,SUCHASBUTNOTLIMITEDTO
LOSSOFPROFIT,REVENUE,BUSINESSINTERRUPTION,BUSINESSOPPORTUNITYORDATA,THATMAYARISEFROMTHEUSEOFTHISDOCUMENTORTHEINFORMATIONINIT.
Thisdocumentationandtheproductitdescribesareconsideredprotectedbycopyrightsandother
intellectualpropertyrightsaccordingtotheapplicablelaws.
NSN is a trademark of Nokia Solutions and Networks. Nokia is a registered trademark of Nokia
Corporation.Otherproductnamesmentionedinthisdocumentmaybetrademarksoftheirrespectiveowners,andtheyarementionedforidentificationpurposesonly.
CopyrightNokiaSolutionsandNetworks2014.Allrightsreserved

ImportantNoticeonProductSafety
Thisproductmaypresentsafetyrisksduetolaser,electricity,heat,andothersourcesof
danger.
Only trained and qualified personnel may install, operate, maintain or otherwise handle
this product and only after having carefully read the safety information applicable to this
product.
ThesafetyinformationisprovidedintheSafetyInformationsectionintheLegal,Safety
andEnvironmentalInformationpartofthisdocumentordocumentationset.

NokiaSolutionsandNetworksiscontinuallystrivingtoreducetheadverseenvironmentaleffectsof
itsproductsandservices.Wewouldliketoencourageyouasourcustomersanduserstojoinusin
working towards a cleaner, safer environment. Please recycle product packaging and follow the
recommendationsforpoweruseandproperdisposalofourproductsandtheircomponents.
IfyoushouldhavequestionsregardingourEnvironmentalPolicyoranyoftheenvironmentalservicesweoffer,pleasecontactusatNokiaSolutionsandNetworksforanyadditionalinformation.

DN0638161

R: 2/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

TableofContents
Thisdocumenthas396pages

Summaryofchanges................................................................... 15

1.2.1
1.2.2
1.2.3
1.2.4
1.2.5
1.2.6

DescriptionofWCDMARANradioresourcemanagementof
HSDPA......................................................................................... 17
IntroductiontoradioresourcemanagementofHSDPA............... 17
Featuresandfunctionsrelatedtoradioresourcemanagementof
HSDPA......................................................................................... 17
HSDPAresourceallocation.......................................................... 18
HSDPAmobility............................................................................ 20
MultiRABcombinationswithHSDPA...........................................25
HSDPAuserexperience...............................................................25
Qualityofservicemanagement....................................................31
CommonIubinterface..................................................................31

RABcombinationsforHSDPA..................................................... 33

3
3.1
3.2
3.3
3.3.1
3.3.2
3.3.3

SupportedbitratesforHSDPA.....................................................36
SupportedHSDPApeakrates......................................................36
SupportedguaranteedbitrateswithHSDPA............................... 37
HS-DSCHMAC-dflowpeakdatarate......................................... 37
FlexibleRLC(MAC-ehsconfigured)............................................ 38
FixedRLC(MAC-hsconfigured).................................................. 40
CSvoice.......................................................................................41

4
4.1
4.2
4.3
4.4
4.5
4.5.1

HSDPAqualityofservice(QoS)management.............................42
BasicprinciplesandQoSprioritizationdecision.......................... 43
PSNRTRABreconfiguration....................................................... 45
NominalbitratesforHSDPAnon-real-time(NRT)services.........47
CelllevelmeasurementsusedbyRTservices............................ 48
ApplicationAwareRAN................................................................ 48
Inter-operabilitywithotherfeatures..............................................50

MaximumnumberofHSDPAusers..............................................53

6
6.1
6.2
6.3
6.3.1
6.3.2
6.3.3
6.3.4
6.3.5
6.4

Cell-specificresourcehandling.................................................... 55
CodeallocationofHS-SCCHphysicalchannels..........................56
HSDPAcodemultiplexing............................................................ 57
HSDPAdynamicresourceallocation............................................57
Dynamicpowerallocation............................................................ 58
DynamicNRTDCHscheduling.................................................... 61
Overloadcontrol...........................................................................66
PrioritizationbetweenHSDPAandNRTDCHpowerresources.. 69
DynamicallocationofHS-PDSCHcodes.....................................74
FractionalDedicatedPhysicalChannel(F-DPCH)...................... 84

1.1
1.2

Issue:06H

DN0638161

R: 3/396

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

6.5
6.5.1
6.5.2
6.5.3

HSDPAstaticresourceallocation.................................................88
CodeallocationforHS-PDSCHphysicalchannels...................... 88
AllocationoftheHSDPApower....................................................89
SelectingthepriorityofHSDPAandoverloadcontrol.................. 89

7
7.1
7.1.1
7.2

UE-specificresourcehandling..................................................... 94
Channeltypeselection.................................................................94
SelectionbetweenDCHandHS-DSCH.......................................95
FractionalDedicatedPhysicalChannel(F-DPCH)andSRBson
HSPA............................................................................................97
DirectNRTresourceallocation.................................................. 107
Dual-cellHSDPAallocation........................................................ 109
Admissiondecision..................................................................... 111
PSNRTservices........................................................................ 115
PSRTservices...........................................................................115
CSservices................................................................................ 120
Actionsincaseofunsuccessfulresourcereservation............... 121
Pre-emption,RT-over-RTandRT-over-NRT..............................125
Pre-emption................................................................................126
RT-over-RTandRT-over-NRT................................................... 126
Pre-emption,RT-over-RTandRT-over-NRTfortransport
resources................................................................................... 129
CIDsrunoutcongestion.............................................................131
Pre-emption,RT-over-RT,andRT-over-NRTforBTScongestion....
132

7.3
7.4
7.5
7.5.1
7.5.2
7.5.3
7.6
7.7
7.7.1
7.7.2
7.7.3
7.7.3.1
7.7.4

8
8.1
8.2

Channeltypeswitching.............................................................. 133
DirectDCHtoHS-DSCHswitch.................................................134
DirectHS-DSCHtoDCHswitch.................................................139

9
9.1
9.2
9.3
9.3.1
9.3.2
9.3.3
9.4
9.4.1
9.4.2
9.4.3
9.4.4
9.5
9.5.1
9.5.2
9.6
9.6.1

HSDPAmobilityhandling........................................................... 142
Measurementreporting.............................................................. 142
ServingHS-DSCHCellChange.................................................147
HSPAoverIur.............................................................................159
SoftHandoverOverIur.............................................................. 170
Failurecases..............................................................................171
Inter-operabilitywithotherfeaturesandfunctionalities.............. 173
ExtensionofHSPAoverIur........................................................180
MobilityhandlingwithextensionofHSPAoverIur..................... 180
Channeltypeselectionduringanchoring................................... 181
Channeltypeswitchduringanchoring....................................... 182
Inter-operabilitywithotherfeaturesandfunctionalities.............. 182
HSPAInter-RNCCellChange....................................................184
Servingcellselection................................................................. 188
Iur-interfacedisabled..................................................................193
HSDPAhandovers..................................................................... 194
HSDPAinter-frequencyhandover.............................................. 194

DN0638161

R: 4/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

9.6.2
9.6.3
9.7
9.8
9.9
9.9.1
9.9.2

Inter-systemhandover............................................................... 196
Serviceandload-basedhandover............................................. 196
Measurementcontrolandhandoverpathparameters............... 196
MobilityhandlingduringPSNRTRABreconfiguration.............. 201
InterCircleRoamingforHSDPA................................................ 201
ICRcapabilityindication.............................................................202
Inter-operabilitywithotherfeatures............................................202

10
10.1
10.2
10.3
10.4
10.5
10.6

RABinactivityhandlingforPSservices..................................... 204
MonitoringtheutilizationandthroughputofHS-DSCH..............204
ReleaseofDLHS-DSCHMAC-dflowandULDCH/E-DCH....208
ExtendedinactivitytimeinCell_DCHstatewithCPC................209
Preventiveoverloadcontrol........................................................212
Inactiveusersselectionalgorithm.............................................. 215
HS-DSCHinactivitycontroloftheidentifiedLegacyFast
dormancysmartphone............................................................... 216

11

ULDCHreturnchannel..............................................................218

12

12.1.4
12.1.5
12.1.6
12.1.7
12.1.8
12.2

HSDPAphysicalchannel,transportchannel,radiobearer,and
RLCconfiguration...................................................................... 224
RLCconfiguration...................................................................... 238
RetransmissionparametersofAMRLC.....................................239
TransmissionandreceivingwindowsoftheAMRLCentities....248
AMRLCwindowsizeandretransmissionparametersforSRBson
HSPA..........................................................................................250
DeliveryoftheRLCSDUstothehigherlayers.......................... 251
UMRLCconfiguration................................................................252
Jitterbuffermanagement........................................................... 253
AMRcodecsetsinCSvoiceoverHSPA................................... 253
SelectionoftheRLCPDUsize.................................................. 254
HS-DSCHMAC-dflowparametersoftheCSvoiceRAB.......... 257

13
13.1
13.2

PowerSavingModeforBTS......................................................260
ConfiguringandreconfiguringHSPA05inacell........................ 261
PWSMlicenseandBTSfeatureswitchinHSPA05reconfiguration
................................................................................................... 264
RequirementstoHSPA05reconfiguration..................................264
HSPA05reconfigurationinPWSMcell/layershutdown............. 265
HSPA5-HSPA0reconfiguration................................................ 266
HSPA0-HSPA5reconfiguration................................................ 266
HSPA05reconfigurationinPWSMcell/layeractivation..............266
HSPA5-HSPA0reconfiguration................................................ 267
HSPA5configurationtosetupcells............................................ 267
OtherHSPA05reconfigurationissues........................................268
CTSfromDCHtoHSPAincellswithconfiguredHSPA.............268
RNCReset................................................................................. 268
BTSReset..................................................................................268

12.1
12.1.1
12.1.2
12.1.3

13.3
13.4
13.4.1
13.4.2
13.5
13.5.1
13.5.2
13.6
13.6.1
13.6.2
13.6.3

Issue:06H

DN0638161

R: 5/396

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

13.6.4

HSPA05reconfigurationstatistics.............................................. 268

14
14.1
14.2
14.3
14.4

MIMO(MultipleInputMultipleOutput)....................................... 269
MIMOsupportedforNRTPSdata............................................. 269
MIMOactivationanddeactivationfortheHS-DSCHMAC-dflow....
270
MIMOutilizationofS-CPICH......................................................272
Featuredependencies............................................................... 272

15
15.1
15.2
15.3
15.4
15.4.1
15.4.2
15.4.3
15.4.4
15.5

Dual-CellHSDPA....................................................................... 274
DCHSDPAsupportedforNRTPSdata.....................................275
ConfigurationoftheDCHSDPAinthecellsetupphase............275
RNCreceivescapabilityinformationfromBTS.......................... 277
SimultaneoususagewithMIMO................................................ 278
Selectionofthesecondarycell.................................................. 279
ActivationinconnectionwiththeHS-DSCHMAC-dflowsetup. 280
Activationintheprimaryandsecondarycell..............................281
SupportoftheRABcombinations.............................................. 281
ULloadbasedACforHSPA+features...................................... 282

16
16.1
16.1.1
16.1.2
16.1.3
16.1.4

HighSpeedCell_FACH..............................................................285
HS-FACHfunctionality............................................................... 286
SetupofHS-FACHconfigurationtothecell............................... 286
UEcapabilityoftheHS-FACH................................................... 287
HS-DSCHCommonSystemInformation................................... 288
PriorityqueueinformationfortheCommonMACFlowcarrying
BCCH,CCCH,andDCCHdata................................................. 288
PriorityqueueinformationfortheCommonMACFlowcarrying
DTCHdata................................................................................. 289
ThemaximumnumberofdedicatedH-RNTIsforHS-FACHusers..
289
CommonMAC-ehsreorderingattributesforCCCHandSRB1. 290
BroadcastsofHS-FACHHS-SCCHcodes................................ 290
RLCconfiguration...................................................................... 290
RetransmissionparametersfortheAMRLCwhentheUEisin
Cell_FACHstate.........................................................................290
TransmissionandreceivingwindowsoftheAMRLCentities....292
AMRLCwindowsizeandretransmissionparametersforSRBson
HSPA..........................................................................................292
DeliveryoftheRLCSDUstothehigherlayers.......................... 292
Channeltypeselectionforpacketdatatransferindownlinkin
Cell_FACHstate.........................................................................293
Measurementmanagement....................................................... 295
ActivitymeasurementoftheHS-FACHuserwithPSRB(s)in
downlink..................................................................................... 295
HS-RACHfunctionality...............................................................296
SymboloffsetsandF-DPCHcodesforHS-RACH..................... 296
F-DPCHslotformat,TPCDLstepsize,andTPCcommanderror
ratetargetforHS-RACH............................................................ 297

16.1.5
16.1.6
16.1.7
16.1.8
16.1.9
16.1.9.1
16.1.9.2
16.1.9.3
16.1.9.4
16.1.10
16.1.11
16.1.11.1
16.2
16.2.1
16.2.2

DN0638161

R: 6/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

16.3
16.3.1
16.3.2
16.3.3
16.3.4

UEDRXinCELL_FACH............................................................ 297
BTS/CellcapabilityoftheUEDRXsupport............................... 298
ResourceStatusIndicationprocedure....................................... 298
ConfigurationofUEDRXintheBTS......................................... 299
UEDRX-specificparametermodification...................................299

17

17.4.1
17.4.2
17.4.3
17.4.4
17.4.5
17.4.6

ManagementdataforradioresourcemanagementofHSDPAfor
WCDMA..................................................................................... 301
AlarmsforradioresourcemanagementofHSDPA....................301
HSDPAresourceallocationalarms............................................ 301
HSDPAmobilityalarms.............................................................. 302
MultiRABcombinationswithHSDPAalarms.............................303
Userexperiencealarms............................................................. 303
Qualityofservicemanagementalarms......................................304
CountersforradioresourcemanagementofHSDPA................ 304
HSDPAresourceallocationcounters......................................... 304
HSDPAmobilitycounters........................................................... 321
MultiRABcombinationswithHSDPAcounters..........................327
HSDPAuserexperiencecounters..............................................328
Qualityofservicemanagementcounters...................................340
Keyperformanceindicatorsforradioresourcemanagementof
HSDPA....................................................................................... 349
HSDPAresourceallocationKPIs............................................... 349
HSDPAmobilityKPIs................................................................. 352
MultiRABcombinationswithHSDPAKPIs................................ 353
HSDPAuserexperienceKPIs.................................................... 354
QualityofservicemanagementKPIs......................................... 355
Managementparametersforradioresourcemanagementof
HSDPA....................................................................................... 357
BasicHSDPAparameters.......................................................... 357
HSDPAresourceallocationparameters.....................................360
HSDPAmobilityparameters.......................................................368
MultiRABcombinationswithHSDPAparameters..................... 375
HSDPAuserexperienceparameters......................................... 377
Qualityofservicemanagementparameters.............................. 385

18
18.1
18.2
18.3
18.4

ManagementdataofFlexiDirect............................................... 396
Alarms........................................................................................ 396
Counters.....................................................................................396
Keyperformanceindicators....................................................... 396
Parameters.................................................................................396

17.1
17.1.1
17.1.2
17.1.3
17.1.4
17.1.5
17.2
17.2.1
17.2.2
17.2.3
17.2.4
17.2.5
17.3
17.3.1
17.3.2
17.3.3
17.3.4
17.3.5
17.4

Issue:06H

DN0638161

R: 7/396

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

ListofFigures

Figure1

LTEInterworking.................................................................................22

Figure2

HS-DSCHMAC-dflowpeakdatarate................................................37

Figure3

PeakRateatRLCPDUpayloadlevel................................................ 38

Figure4

maximumRLCPDUpayload..............................................................38

Figure5

MAC-ehsHeaderSize........................................................................38

Figure6

RLCHeaderSize................................................................................38

Figure7

NumberofMAC-ehsreorderingSDUs............................................... 39

Figure8

PeakrateatRLCPDUpayloadlevel................................................. 40

Figure9

ThepeakrateoftheHS-DSCHMAC-dflowestablishedfortheCS
voice................................................................................................... 41

Figure10

HS-SCCHallocationlogic...................................................................56

Figure11

DLpowerallocation............................................................................ 59

Figure12

PtxTargetTot........................................................................................60

Figure13

PtxTargetTotcondition........................................................................ 60

Figure14

DynamicNRTDCHscheduling.......................................................... 62

Figure15

IdealvalueofthePtxTargetPS........................................................... 63

Figure16

TargetvalueofthePtxTargetPSwithHS-RACHsetup..................... 63

Figure17

DecreaseofthePtxTargetPS............................................................. 65

Figure18

IncreaseofthePtxTargetPS...............................................................66

Figure19

ConditionstotriggeroverloadactionstargetedtoNRTservices....... 67

Figure20

ConditionstotriggeroverloadactionstargetedtoPSstreaming
services.............................................................................................. 67

Figure21

SumoftheweightvaluesofeachUE.................................................71

Figure22

SumoftheweightvaluesofeachUEusedfordynamicpower
allocationalgorithms...........................................................................72

Figure23

ValueforWeightDCH............................................................................72

Figure24

Codetreeallocation...........................................................................74

Figure25

HS-PDSCHcodeupgrade.................................................................78

Figure26

HS-PDSCHcodedowngrade............................................................ 79

Figure27

NumberofHS-PDSCHcodesincodeupgraderetry(NB/RSxxx)......83

Figure28

FramestructureforF-DPCH.............................................................. 84

Figure29

Codetreeallocation............................................................................89

Figure30

FunctionalitywhenHSDPApriorityisone.......................................... 91

Figure31

Condition1......................................................................................... 91

Figure32

FunctionalitywhenHSDPApriorityistwo...........................................92

Figure33

Condition2......................................................................................... 93

Figure34

Channeltypeselectionschemeofpacketscheduler......................... 94

Figure35

RRC:RRCCONNECTIONREQUESTreceived..............................101

Figure36

RRC:RRCConnectionSetup,SRBmappingtoHSPA....................102

DN0638161

R: 8/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Issue:06H

Figure37

RRC:RRCConnectionSetup,SRBmappingtoDCH..................... 102

Figure38

CPICHEcNovaluecalculation......................................................... 104

Figure39

Voicecallprioritizationduringhightrafficload.................................. 114

Figure40

ResourcechecksforPSstreaming.................................................. 116

Figure41

EstimatedpowerfornewHSDPAstreaminguser............................ 116

Figure42

AverageHS-DSCHSINRifCPICHEc/N0isavailable...................... 117

Figure43

AverageHS-DSCHSINRifCPICHEc/N0isavailable(conditionfor
(alpha)=0)....................................................................................... 118

Figure44

AverageHS-DSCHSINRifCPICHEc/N0isnotavailable................ 118

Figure45

CPICHEcNocalculationwhenCPICHEcNoandPtx_average
measurementsarenotavailable.......................................................119

Figure46

Calculationoftheunused(free)power............................................. 119

Figure47

PowerneededbynewCSvoiceservice.......................................... 120

Figure48

HSDPAconversationalusers........................................................... 121

Figure49

TheservingHS-DSCHcellchangeinactiveset.............................. 148

Figure50

Inter-BTSservingHS-DSCHcellchangecombinedwithservingHSDSCHBTSrelocation.......................................................................149

Figure51

AlgorithmforselectingtheinitialservingHS-DSCHcell.................. 150

Figure52

Conditionforselectingthecandidatecells....................................... 151

Figure53

PossiblecandidatecellsforSRBsonHS-DSCHallocation............. 152

Figure54

ThecandidatestoallocateSRBsonHS-DSCH............................... 152

Figure55

TheconditiontoinitiateservingHS-DSCHcellchange................... 153

Figure56

ServingHS-DSCHcellchangealgorithm......................................... 154

Figure57

SituationpriortoHSPAinter-RNCcellchange.................................185

Figure58

SituationaftersuccessfulHSPAinter-RNCcellchange................... 186

Figure59

HSPAinter-RNCcellchange............................................................ 188

Figure60

Conditionforselectingthecandidatecells....................................... 189

Figure61

Comparisontothebestcell.............................................................. 190

Figure62

Comparisontotheexistingservingcell............................................ 190

Figure63

HSDPAmonitoringscenario............................................................. 205

Figure64

SettingoftimertoextendthetimeofinactiveuserinCell_DCHstate...
210

Figure65

RelationshipoftheextendedtimeinCell_DCHstatetimerand
inactivityindications.......................................................................... 211

Figure66

PreventiveoverloadcontrolformaximumnumberofHSDPAMAC-d
flows................................................................................................. 212

Figure67

PreventiveoverloadcontrolformaximumnumberofHSDPAusers......
212

Figure68

AverageInactivityOccasionPeriod.................................................. 216

Figure69

InactiveusersmovedfromCell_DCHstate......................................216

Figure70

PSdataupto384kbit/sinuplinkandHSDPAindownlink.............. 218

Figure71

HSDPAULDCHwithinitialbitrate64kbit/s.................................... 222

DN0638161

R: 9/396

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

10

Figure72

HSDPADynamicResourceAllocationfeatureisdisabled............... 232

Figure73

HSDPADynamicResourceAllocationfeatureisenabled................ 232

Figure74

DiscardTimer................................................................................... 235

Figure75

ExpectedAMRLCstatusreportingperiodforHS-DSCH.................242

Figure76

ValueofAMRLCPoll_PDUforHS-DSCH....................................... 242

Figure77

ValueofTimer_discardRLCtimer....................................................247

Figure78

NUMDcalculating............................................................................... 253

Figure79

SIRHS-DSCHcalculationbasedonCPICHEc/N0measurement........ 256

Figure80

SIRHS-DSCHcalculationbasedonTransmittedCodePower
measurement....................................................................................257

Figure81

SizeoftheMAC-ehsPDU................................................................ 258

Figure82

ValueGBRMACehsoftheMAC-hs guaranteed bit rate is (bit/s).........259

Figure83

HSPAincellshutdownandactivation.............................................. 260

Figure84

DCHSDPAwithtwopossiblesecondarycellcandidates.................279

Figure85

DCHSDPAwithtwopossiblenon-MIMOsecondarycellcandidates.....
280

Figure86

ULloadbasedHSDPAuseramountofthecellformula................... 283

Figure87

UEwithprimaryHS-DSCHallocationinacell................................ 283

Figure88

TheULloadbasedACfortheHSDPA+condition........................... 284

Figure89

Logical/transport/physicalchannelmappingintheDLwithHSDPA
usageinCell_FACHstate................................................................ 285

Figure90

HSDPAusageinCell_FACHstatewithULRACHvs.HSDPAusagein
Cell_DCHstatewithdedicatedchannels......................................... 286

Figure91

SetupofHS-FACH........................................................................... 287

Figure92

DownlinkchanneltypeselectionbetweenCell_FACHandCell_DCH
statesonMAC.................................................................................. 293

Figure93

DRXcycles....................................................................................... 298

DN0638161

R: 10/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

ListofTables

Issue:06H

Table1

DefaultvaluesoftheQoSPriorityMappingparameters................43

Table2

Exampleofasetofapplications.........................................................49

Table3

ConfigurationoftheinitialSPI............................................................ 50

Table4

Priorityvaluepertrafficclass..............................................................71

Table5

HS-PDSCHcodeset.......................................................................... 76

Table6

F-DPCHfields.....................................................................................85

Table7

TPCBitPattern...................................................................................85

Table8

Intra-frequencymeasurements,whichareusedforUEhavingalsothe
HS-DSCHallocated..........................................................................142

Table9

ReportingeventswhichareusedwhenHSDPAassociatedDPCHisin
SHO..................................................................................................143

Table10

TriggersforreleasingtheHS-DSCHMAC-dflow.............................143

Table11

Intra-frequencymeasurementcontrol(FMCS)parameters..............197

Table12

Inter-frequencymeasurementcontrol(FMCI)parameters............... 199

Table13

Inter-systemmeasurementcontrol(FMCG)parameters..................199

Table14

Intra-frequencycellre-selectionandhandoverpathcontrol
parameters(HOPS)..........................................................................200

Table15

HS-DSCHrelatedparameterssignaledfromtheRNCtotheBTSin
NBAP(reference1).......................................................................... 224

Table16

HS-DSCHrelatedparameterssignaledfromtheRNCtotheUEin
RRC(reference2)............................................................................ 232

Table17

StatusreportingandretransmissiontriggersfortheAM-RLCwithHSDSCH............................................................................................... 239

Table18

HSPA0-5swappingexample........................................................... 260

Table19

RAN821:HSDPAResourceAllocationalarms................................. 301

Table20

RAN955:PowerSavingModealarms.............................................. 303

Table21

RAN1906:Dual-CellHSDPA42Mbpsalarms................................. 303

Table22

RAN821:HSDPAResourceAllocationcounters.............................. 304

Table23

RAN763:BasicHSDPAwithQPSKand5Codescounters..............311

Table24

RAN235:HSDPAChannelSwitchingcounters................................ 315

Table25

RAN1013:16kbit/sReturnChannelDCHDataRateSupportfor
HSDPAcounters...............................................................................315

Table26

RAN312:HSDPADynamicResourceAllocationcounters............... 316

Table27

RAN852:HSDPA15Codescounters...............................................319

Table28

RAN1643:HSDPA64QAMcounters............................................... 320

Table29

RAN2954:Voicecallprioritisationduringhightrafficloadcounters. 320

Table30

RAN2879:MassEventHandlercounters.........................................320

Table31

RAN828:HSDPAServingCellChangecounters............................. 321

Table32

RAN829:HSDPASoft/softerHandoverforAssociatedDPCHcounters
..........................................................................................................322

Table33

RAN1515:HSPAInter-RNCCellChangecounters..........................323

DN0638161

R: 11/396

11

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

12

Table34

RAN1276:HSDPAInter-frequencyHandovercounters................... 324

Table35

RAN1596:HSPACapabilityBasedHandovercounters................... 326

Table36

RAN827:HSDPAwithSimultaneousAMRVoiceCallcounters....... 327

Table37

RAN285:HSPAMultiNRTRABscounters.......................................327

Table38

RAN839:HSDPA16UsersperCellcounters.................................. 328

Table39

RAN1033:HSDPA48UsersperCellcounters................................ 329

Table40

RAN1464:HSDPA64UsersperCellcounters................................ 329

Table41

RAN1249:HSDPA10MbpsperUserandRAN1258:HSDPA14Mbps
perUsercounters............................................................................. 330

Table42

RAN955:PowerSavingModeforBTScounters..............................330

Table43

RAN1201:FractionalDPCHcounters.............................................. 332

Table44

RAN1638:FlexibleRLC(DL)counters.............................................332

Table45

RAN1642:MIMOcounters............................................................... 333

Table46

RAN1644:ContinuousPacketConnectivitycounters...................... 333

Table47

RAN1686:HSPA72userspercellcounters.................................... 334

Table48

RAN1689:CSvoiceoverHSPAcounters........................................ 335

Table49

RAN1906:Dual-CellHSDPA42Mbpscounters.............................. 338

Table50

RAN1762:DirectResourceAllocationforHSPAcounters............... 339

Table51

RAN1912:MIMO42Mbpscounters.................................................339

Table52

RAN1907:DC-HSDPAwithMIMO84Mbpscounters......................339

Table53

RAN2124:HSPA128UsersperCellcounters................................. 340

Table54

RAN1262:QoSAwareHSPASchedulingcounters..........................341

Table55

RAN1004:StreamingQoSforHSPAcounters................................. 342

Table56

RAN930:PSRABReconfigurationcounters....................................348

Table57

RAN821:HSDPAResourceAllocationKPIs.................................... 349

Table58

RAN763:BasicHSDPAwithQPSKand5CodesKPIs....................349

Table59

RAN235:HSDPAChannelSwitchingKPIs...................................... 350

Table60

RAN312:HSDPADynamicResourceAllocationKPIs..................... 351

Table61

RAN852:HSDPA15CodesKPIs..................................................... 351

Table62

RAN1305:HSDPA14.4MbpsperCellKPIs.................................... 351

Table63

RAN1643:HSDPA64QAMKPIs..................................................... 352

Table64

RAN828:HSDPAServingCellChangeKPIs................................... 352

Table65

RAN1515:HSPAInter-RNCCellChangeKPIs................................ 353

Table66

RAN827:HSDPAwithSimultaneousAMRVoiceCallKPIs............. 353

Table67

RAN285:HSPAMultiNRTRABsKPIs.............................................353

Table68

RAN1249:HSDPA10MbpsperUserKPIs......................................354

Table69

RAN1470:HSUPA2msTTIKPIs..................................................... 354

Table70

RAN1642:MIMOKPIs......................................................................354

Table71

RAN1689:CSVoiceoverHSPAKPIs.............................................. 354

Table72

RAN1004:StreamingQoSforHSPAKPIs....................................... 355

DN0638161

R: 12/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Issue:06H

Table73

RAN930:PSRABReconfigurationKPIs.......................................... 356

Table74

BasicHSDPAparameters................................................................ 357

Table75

RAN821:HSDPAResourceAllocationparameters..........................360

Table76

RAN763:BasicHSDPAwithQPSKand5Codesparameters......... 361

Table77

RAN235:HSDPAChannelSwitchingparameters............................ 361

Table78

RAN233:HSDPAAssociatedUplinkDPCHSchedulingparameters.....
362

Table79

RAN1013:16kbit/sReturnChannelDCHDataRateSupportfor
HSDPAparameters.......................................................................... 363

Table80

RAN312:HSDPADynamicResourceAllocationparameters...........363

Table81

RAN852:HSDPA15Codesparameters.......................................... 365

Table82

RAN853:HSDPACodeMultiplexingparameters............................. 366

Table83

RAN1643:HSDPA64QAMparameters........................................... 366

Table84

RAN2879:MassEventHandlerparameters.................................... 367

Table85

RAN2954VoiceCallPrioritizationDuringHighTrafficLoad
parameters....................................................................................... 367

Table86

RAN230:HSDPAMobilityHandlingwithDCHSwitchingparameters....
368

Table87

RAN828:HSDPAServingCellChangeparameters.........................368

Table88

RAN829:HSDPASoft/softerHandoverforAssociatedDPCH
parameters....................................................................................... 369

Table89

RAN1515:HSPAInter-RNCCellChangeparameters..................... 370

Table90

RAN1276:HSDPAInter-frequencyHandoverparameters............... 370

Table91

RAN1596:HSPACapabilityBasedHandoverparameters...............371

Table92

RAN1231:HSPAoverIurparameters.............................................. 373

Table93

RAN2270:ExtensionofHSPAoverIurrelatedparameters............. 373

Table94

RAN2172:Multi-BandLoadBalancingparameters..........................374

Table95

RAN2596:InterCircleRoamingforHSDPAparameters..................375

Table96

RAN827:HSDPAwithSimultaneousAMRVoiceCallparameters.. 375

Table97

RAN285:HSPAMultiNRTRABsparameters.................................. 376

Table98

RAN1033:HSDPA48UsersperCellparameters............................ 377

Table99

RAN1464:HSDPA64UsersperCellparameters............................ 377

Table100

RAN1249:HSDPA10MbpsperUserparameters........................... 377

Table101

RAN1258:HSDPA14MbpsperUserparameters........................... 377

Table102

RAN1201:FractionalDPCHparameters..........................................377

Table103

RAN1686:HSPA72UsersperCellparameters.............................. 379

Table104

RAN2124:HSPA128UsersperCellparameters............................ 379

Table105

RAN955:PowerSavingModeforBTSparameters......................... 379

Table106

RAN1642MIMOparameters............................................................ 379

Table107

RAN1906Dual-CellHSDPA42Mbpsparameters........................... 380

Table108

RAN1912:MIMO42Mbpsparameters............................................ 380

DN0638161

R: 13/396

13

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

14

Table109

RAN1907:DCHSDPAwithMIMO84Mbpsparameters................. 380

Table110

RAN2067:LTEInterworkingparameters.......................................... 380

Table111

RAN1644:ContinuousPacketConnectivityparameters.................. 381

Table112

RAN1470:HSUPA2msTTIparameters.......................................... 381

Table113

RAN1762:DirectResourceAllocationparameters.......................... 382

Table114

RAN1637:HighSpeedCELL_FACHDLparameters.......................383

Table115

RAN1913:HighSpeedCELL_FACHparameters............................ 384

Table116

RAN2136:FastDormancyparameters............................................ 384

Table117

RAN2451:FastDormancyProfilingparameters.............................. 384

Table118

RAN1908:UEDRXinCELL_FACHparameters..............................384

Table119

RAN2494:FastCELL_PCHswitchingparameters.......................... 385

Table120

RAN930:PSRABReconfigurationparameters............................... 385

Table121

RAN1004:StreamingQoSforHSPAparameters............................ 386

Table122

RAN1262:QoSAwareHSPASchedulingparameters..................... 392

Table123

RAN1689:CSVoiceoverHSPA.......................................................393

Table124

CelllevelparametersforbetterULLoadcontrol.............................. 394

Table125

RAN2509:ApplicationAwareRANparameters............................... 394

DN0638161

R: 14/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Summaryofchanges

Summaryofchanges
Changesbetweendocumentissuesarecumulative.Therefore,thelatestdocument
issuecontainsallchangesmadetopreviousissues.

Changesbetweenissues06G(2013-01-10,RU40)and06H(2014-0123,RU40)
ULloadbasedACforHSPA+features

TheULloadbasedACuseramountcalculationvariableshavebeenupdated.

Changesbetweenissues06F(2013-11-15,RU40)and06G(2014-0110,RU40)
Dual-CellHSDPA

TheinformationontheULloadbasedACforHSPA+featureswasaddedintheUL
loadbasedACforHSPA+featureschapter.

DescriptionofWCDMARANradioresourcemanagementofHSDPA

TheinformationintheFastDormancyProfilingsectionhasbeenupdated.

CountersforradioresourcemanagementofHSDPA

ThecounterwasaddedtotheRAN2879: Mass Event Handler counters table.

UE-specificresourcehandling

InformationregardingtheMEHhasbeenaddedtothechapter.

RABinactivityhandlingforPSservices

Informationregardingtheextendedinactivitytimesforsmartphoneswasupdatedin
theHS-DSCHinactivitycontroloftheidentifiedLegacyFastdormancysmartphone.

Informationregardingtheextendedinactivitytimesforsmartphoneswasupdatedin
theExtendedinactivitytimeinCell_DCHstatewithCPC.

Changesbetweenissues06E(2013-10-18,06E)and06F(2013-11-15,
06F)
RABinactivityhandlingforPSservices(10)

InformationonettingoftimertoextendthetimeofinactiveuserwhenHS-RACHis
usedwasremovedfromtheExtendedinactivitytimeinCell_DCHstatewithCPC
chapter.

HighSpeedCell_FACH(16)

InformationontheInitialpower,MaximumpowerandMinimumpowerparameters
andrelatedNBAPmessagehasbeenaddedtoF-DPCHslotformat,TPCDLstep
size,andTPCcommanderrorratetargetforHS-RACHchapter.

ManagementparametersforradioresourcemanagementofHSDPA(17.4)

Issue:06H

DN0638161

R: 15/396

15

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Summaryofchanges

WCDMARANRRMHSDPA

TheparameterInactHSRACHisremovedfromthe
#unique_12/unique_12_Connect_42_CIHBGEFF.

Changesbetweenissues06D(2013-09-10,06D)and06E(2013-10-18,
06E)
MaximumnumberofHSDPAusers(5)

TheBTScapacitylimits,regardingtheLocalCellGroupinformationhasbeen
updated

HSDPAmobilityhandling(9)

InformationintheFastercompletionofconsecutiveASUandSCCprocedures
sectionhasbeenupdated

RABinactivityhandlingforPSservices(10)

InformationontheLCGandBTS-specificuseramountcheckinthePreventive
overloadcontrolbecauseofthemaximumHSDPAusernumberssection,inthe
Preventiveoverloadcontrolchapterhasbeenupdated

ManagementparametersforradioresourcemanagementofHSDPA(17.4)

IPA-RNC,mcRNC,FlexiDirectRNCandBTSparameterdescriptionsinPDFformat
havebeenremovedfromWCDMAOperatingDocumentation.Fromthisissueon,the
parameterdescriptions,includingchangesinparameters,aredeliveredinExcel
formatinaseparateparameterdocumentsetinNOLSProductInformationCenter.

ManagementdataofFlexiDirect(18)

16

IPA-RNC,mcRNC,FlexiDirectRNCandBTSparameterdescriptionsinPDFformat
havebeenremovedfromWCDMAOperatingDocumentation.Fromthisissueon,the
parameterdescriptions,includingchangesinparameters,aredeliveredinExcel
formatinaseparateparameterdocumentsetinNOLSProductInformationCenter.

DN0638161

R: 16/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

DescriptionofWCDMARANradioresource
managementofHSDPA

1 DescriptionofWCDMARANradioresource
managementofHSDPA

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
HSDPA(high-speeddownlinkpacketaccess)isawidebandcodedivisionmultiple
access(WCDMA)keyfeature,whichprovideshighdataratetransmissioninaCDMA
downlinktosupportmultimediaservices.HSDPAbringsahigh-speeddatadeliveryto3G
terminals,ensuringthatusersrequiringeffectivemultimediacapabilitiesbenefitfrom
dataratespreviouslyunavailablebecauseoflimitationsintheradioaccessnetwork
(RAN).
HSDPAbringsbenefitsforboththeoperatorsandtheend-users.Inpractice,itmeans
higherdataratesfortheend-users,alargercapacityintheradionetwork,andthe
opportunityfortheoperatortodeliverservicesexistingonesandnewonesatalower
costofbit.

1.1 Introductiontoradioresourcemanagementof
HSDPA
TheWCDMARANRRMHSDPAfunctionalareadescriptionathanddescribesthe
prevailingRRM-relatedHSDPAimplementationoftheNSNRN6.0radionetwork
controllerandFlexiDirectRNCrelease4.0.

Thedistinctionbetweenfeaturesregardingspecificproduct,suchasRNCor
FlexiDirectRNC,isstatedalwaysbeforehand.

1.2 Featuresandfunctionsrelatedtoradioresource
managementofHSDPA

NotethatlicenseinformationisrelevantonlytotheIPA-RNCsolution.
ThissectioncontainsallfeaturesandfunctionsthataffectRRMofHSDPAandprovides
shortintroductionstothem.Thefeaturesandfunctionsarecategorizedaccordingtothe
relatedsub-functionsofRRMofHSDPA,inthefollowingway:

Issue:06H

HSDPAresourceallocation

HSDPAmobility

MultiRABcombinationswithHSDPA

HSDPAuserexperience

DN0638161

R: 17/396

17

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

DescriptionofWCDMARANradioresource
managementofHSDPA

WCDMARANRRMHSDPA

Qualityofservicemanagement

CommonIubinterface

1.2.1 HSDPAresourceallocation
ThefollowingfeaturesarepartoftheHSDPAbasicfunctionality:

ForIPA-RNCsolutiononly:HSDPAResourceAllocation(thestaticallocationof
powerandcoderesourcesintheRNC)
NotethattheBTSappliesthedynamicpowerallocationregardlessofaresource
allocationmethodintheRNC.

HSDPAAssociatedUplinkDPCHScheduling

HSDPAPhysicalChannel,TransportChannelandRadioBearerConfiguration

HSDPAChannelSwitching

BasicHSDPAwithQPSKand5Codes

HSDPA16QAMSupport

FlexibleRLC

DirectswitchbetweenHS-DSCHandDCHchanneltypes

HSDPADynamicResourceAllocation
ForIPA-RNCsolutiontheHSDPADynamicResourceAllocationfeaturereplacesfeature
HSDPAResourceAllocation,whileforFlexiDirectRNCitisstandardfeature.HSDPA
DynamicResourceAllocationcontainsthefollowingnewandimprovedfunctionalities:

DynamicNRTDCHscheduling(RNC)

Dynamicpowerallocation(BTS)

DynamicallocationofHS-PDSCHcodes

HSDPA15Codes
HSDPA15CodesoptionalfeatureisafurtherevolutionoftheBasicHSDPAwithQPSK
and5CodesandHSDPA16QAMSupportfeaturesallowinghigherpeakdataratesand
anincreasedaveragecellthroughput.WiththeHSDPA 14.4 Mbps per Cellfeature,peak
cellthroughputsofupto14.4Mbit/scanbeachieved.

HSDPACodeMultiplexing
HSDPACodeMultiplexingoptionalfeatureenablesasimultaneoustransmissionofa
maximumoffourHSDPAuserswithinasinglecellduringasingleTransmissionTime
Interval(TTI).

16kbit/sReturnChannelDCHDataRateSupportforHSDPA
16kbit/sReturnChannelDCHDataRateSupportforHSDPAoptionalfeatureallows
usingtheuplinkDCHdatarateof16kbit/sforHSDPAULDCHreturnchannel.

18

DN0638161

R: 18/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

DescriptionofWCDMARANradioresource
managementofHSDPA

HSPATransportfallback
FortheIPA-RNCsolutiontheHSPAtransportfallbackfeatureprovidesaprotection
solutionoverIubinthescenariothattheHSPAtrafficiscarriedovertheIPtransport.The
operatorcanselecttheinteractiveorbackgroundHSDPAtrafficclassandtheprotected
orunprotectedHSDPAstreaming.Ifthetrafficclassisprotected,thetrafficcanbe
carriedovertheAMRtransportincaseofanIP-transportfailure.Ifthetrafficclassisnot
protected,theIPtransportisanonlyoption.

MassEventHandler
TheRAN2879: Mass Event Handlerfeatureimprovestheaccesstothenetworksduring
masseventsorsuddentrafficburstsanddecreasestheULloadcausedbythe
sequentialservicerequests.Thefeatureintroducesanautomaticcontrolofthetraffic
loadonhighloadednetworkstopreventthecellcollapsesandtoimprovethe
performanceofthehighloadcellsbydecreasingtheULinterference.
RAN2879: Mass Event Handler includesthefollowingsub-features:
1. IncreasedTVMpendingtime

Formoreinformation,seeWCDMA RAN Packet Scheduler.

2. TemporarymaximumbitrateforULDCH

TemporarymaximumbitrateissetfortheminimumbitrateforULDCHduring
thehighloadstatetoreducetheULinterference.

Thisfunctionalsoreducesunnecessaryre-attemptsandbitrateupgraderequests
duringhighload.

3. TemporarymaximumnumberofHSUPAusers

Formoreinformation,seeWCDMA RAN RRM HSUPA.

4. IncreasedCQIfeedbackcycle

WhenthenumberofHSDPA/HSPAusersinthecellexceedsapre-defined
threshold,theIncreasedCQIfeedbackcyclefunctionisusedtodecreaseUL
interferencecausedbythecontinuousCQIreportingofHSDPA/HSPAusers.

5. LoadbasedE-DCH2msTTIprevention

Formoreinformation,seeWCDMA RAN RRM HSUPA.

6. ULloadbasedACforHSPA+features

HSPA+featuresMIMOandDC-HSDPAusageincelllevelarerestricted,when
theULloadbasedACthresholdisexceededorthemasseventloadstateis
triggeredinthecell.

RAN2879: Mass Event HandleriscontrolledbythelicencesandMassEventHandler


WCELparameter.

Issue:06H

DN0638161

R: 19/396

19

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

DescriptionofWCDMARANradioresource
managementofHSDPA

WCDMARANRRMHSDPA

VoiceCallPriorizationDuringHighTrafficLoad
TheRAN2954 Voice Call Priorization During High Traffic Loadfeatureutilizesprioritized
DLpowerACwhereAMRCSDCHspeechcallisadmitted.Thisoccursif(Ptx_nc +
Ptx_nc) < (PtxTarget + PtxOffset)andiftherearesimultaneousHSDPA
usersinthecell.Ptx,ncreferstotheestimatednon-controllabletxpower. PtxTarget
andPtxOffsetareRNW-parameters.Formoreinformation,seeWCDMA RAN RRM
Admission Control.
TheRNCalsostartslimitingnewHSDPAallocationsiftheestimatednon-controllabletx
powerisequalorhigherthanapredefinedthreshold:
Ptx,nc(PtxTargetVCPPtxOffset)
PtxTargetandVCPPtxOffsetareRNW-parameters.
ThefeaturedecreasesblockingofCSAMRusersbylimitingDLnon-controllabletx
powercausedbysignalinglinksofHSDPAusers.
PrioritisationisalsoapplicableforsuchRRCconnectionrequest,whichisrejected
becauseoftheDLpowerandindicatesanestablishmentcause:

Originating Conversational Call

Terminating Conversational Call

Terminating cause unknown

1.2.2 HSDPAmobility
TheHSDPAMobilityHandlingwithDCHswitchingandHSDPACellReselectionarepart
ofHSDPAbasicfunctionality.

HSDPAServingCellChange
HSDPA Serving Cell ChangeandHSDPA Soft/Softer Handover for Associated DPCH
optionalfeaturesreplacefeaturesHSDPAMobilityHandlingwithDCHswitchingand
HSDPACellReselectionallowinganimprovedmobilityforHSDPAusers.

HSPAInter-RNCCellChange
HSPA Inter-RNC Cell Changeisanoptionalfeaturethatimprovestheend-user
performancebymaintainingthehigh-data-rateHSDPAserviceduringtheintra-frequency
inter-RNCmobility.HSPAInter-RNCcellchangefeatureisalsovalidforFlexiDirectRNC
performingthesamecellchange,thusbetweenFlexiDirectAdapters.

HSDPAInter-frequencyHandover
HSDPA Inter-frequency Handoverisanoptionalfeaturethattheoperatorcanactivate
anddeactivatewiththeBTSlevelBTSSupportForHSPACMRNPparameter.Basedon
inter-frequencyhandover(IFHO)triggers,theRNCordersthecompressedmodeon
HSDPAsothatinter-frequencymeasurementscanbeperformedonHSDPAwithout

20

DN0638161

R: 20/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

DescriptionofWCDMARANradioresource
managementofHSDPA

channeltypeswitchingtoDCH.Thus,ahighHSDPAthroughputcanbeexperienced
duringthecompressedmodeandthetotalhandoverexecutiontimeisreducedupto1.5
s.

HSPACapabilityBasedHandover
TheHSPA Capability Based Handoverfeatureprovidesamechanismtoperiodically
handoverallHSPA-capableUEsfromnonHSDPA/HSUPAWCDMAcellstoneighboring
cellsprovidingtheHSPAsupport.ThetargetcellcanbeeitheraWCDMAcellservedby
anRNCoranFlexiDirectcellservedbytheFlexiDirectsystem.HSPA-capableUEsin
HSDPA/HSUPAWCDMAcellsarehandedovertoFlexiDirectcellsbyaneventtriggeredmechanism.Fordetails,seeWCDMA RAN RRM Handover Controlfunctional
areadescription.

HSPAoverIur
TheRAN1231: HSPA over Iurfeatureimprovestheend-userperformanceby
maintainingthecontinuoushighdatarateHSPAserviceduringtheinter-RNCmobility.
Capacitygainisachievedinthebordercellswhentheservingcellchangeisperformed,
andHSPA,insteadofDCH,canbeutilized.WhentheUE'sintra-frequency
measurementsindicatethatthestrongestcellintheactivesetisundertheDRNC/Drift
FlexiDirectRNC/DriftFlexiDirectRNC,HSDPA,andHSUPAservingcellchangeover
Iurisperformed.Aftertheservingcellchange,HSDPA(HS-DSCHMAC-dflow)and
HSUPA(E-DCHMAC-dflow)dataistransmittedovertheIur-interface.HSPAoverIur
featureenablesthefollowingfunctions:

SRNC/ServingFlexiDirectRNCsetsuptheHS-DSCHandE-DCHradiolinkover
Iur.

SRNC/ServingFlexiDirectRNCperformstheservingcellchange(SCC)from
SRNC/ServingFlexiDirectRNCcelltoDRNC/DriftFlexiDirectRNCcell.

SRNC/ServingFlexiDirectRNCperformstheservingcellchange(SCC)from
DRNC/DriftFlexiDirectRNCcelltoDRNC/DriftFlexiDirectRNCcellinsideoneRNC
andbetweentwodifferentRNCs.

SRNC/ServingFlexiDirectRNCperformstheservingcellchange(SCC)from
DRNC/DriftFlexiDirectRNCcelltoSRNC/ServingFlexiDirectRNCcell.

DRNC/DriftFlexiDirectRNCacceptstheradiolinkoverIur-interfacecontainingHSDSCHandE-DCHMAC-dflowinformation.

BesidestheE-DCH,theULDCHissupportedasareturnchannelfortheHS-DSCHover
Iur-interface.WhenthelastactivesetcellintheSRNC/ServingFlexiDirectRNCis
deleted,theUE not involvedSRNSrelocationistriggeredwhiletheHSPAserviceisin
use.AlsotheUE involvedSRNSrelocationissupportediftheIur-interfaceiscongested,
disabled,ornotexisting.

LTEInterworking
Feature RAN2067: LTE Interworkingenablescellreselectionfrom3GtoLTEand
providessupportforPSISHOfromLTEto3G.LTEinterworkingisanoptionalfeaturein
theRNCandiscontrolledbycapacitylicense(numberofcells)inRNCproductwhilein
FlexiDirectRNCtherearenolicenseissues.

Issue:06H

DN0638161

R: 21/396

21

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

DescriptionofWCDMARANradioresource
managementofHSDPA

WCDMARANRRMHSDPA

InLTErolloutphasethecoverageistypicallylimited,andUEseasilyrunoutoftheLTE
coverage,especiallyinanidlemode.ThisfeatureenablestheLTEcellreselectionwhen
theUEisinanidlemode,Cell_PCH,orURA_PCHstateinWCDMAlayer.Theoperator
setsprioritiesforeachLTEfrequencyfortheLTE-capableUEs.TheUEcanthen,
dependingontheoperatorspreference,selecttocamponLTEoncethecoverageis
available.Intheidle,URA_PCH,andCell_PCHstates,theUEcampedinWCDMA
periodicallymeasuresallhigherpriorityRATs.AlsolowerpriorityRATsaremeasured
whenWCDMAqualitycriteriafallbelowathreshold.Withthisfeaturetheoperatorcan
definetheabsolutepriorityforeachLTEfrequency.LTElayerprioritiescanbethesame
ordifferentbetweenthedifferentLTElayers,andtheUEcomparestheseprioritiestothe
WCDMAown-cellabsolutepriority(servingcellabsolutepriority)thatisprovided.Ifthe
LTEabsolutepriorityishigherthantheWCDMAown-cellabsolutepriority,UEprefers
LTElayerovertheservingWCDMAlayer.
TheLTEsystemsupportsinter-RAThandovertoUTRANbecauseofqualityand
coverageforPScalls.Hence,asapartofLTEinterworkingfunctionality,UTRANmust
handletheincomingPSISHOfromLTE.UponreceivingtheRelocationRequestfrom
PSCN,thetargetRNCallocatestheresourcesforincomingRABsanduponsuccessful
resourceallocationsendstheRelocationRequestAcknowledgetotheCoreNetwork.
Figure 1

LTEInterworking

LTE
Cellreselectiontohigher
priorityLTElayerwhen
coverageavailable
Cellreselectionto
lowerpriorityRAT
duetocoverage

WCDMA layerL1

LTElayerpriority:high
Owncell priority:medium

IntheFlexiDirectsystemthebeforementionedfeatureisseparatelydescribedas
RAN2176:LTEPSHandoverfeaturethatoffersseamlesshandovertoWCDMAwhen
leavingtheLTEcoverage.
LTEtoWCDMAPShandoverfunctionalityallowsforservicecontinuityofdataservices
withminimalinterruptiontimewhenchangingfromaLTEcelltoaWCDMAcell.LTEis
controllingwhenthehandoveristriggeredandwhatarethepossibleWCDMAtargets.
Multi-RABhandoverfromLTEtoWCDMAissupported.
ForFlexiDirectRNCsolution:Inter-AdapterServingCellChangecombinedRoleSwitch
isastandardfeatureinADA4.0.WhenUEinCELL_DCHRRCStateisallocatedwith
HSDPAorHSPAresources,themobilitybetweentwoadaptersispossibleintwoways:

22

withoutusingIur(nouseofIurSHO)

usingIur(SHOoverIurandthenServingCellChangewithcombinedRelocation)

DN0638161

R: 22/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

DescriptionofWCDMARANradioresource
managementofHSDPA

IftheSource-FlexiDirectRNChasactivelinksoverIurwithRNCorwhenthereisnoIur
betweentheadapters,theSource-FlexiDirectRNCinitiatestheHandovertoTarget-Flexi
DirectRNC(orTarget-RNC)asperHSPAInter-RNCCellChange(RAN1515,HSCECH)
feature.
Thepurposeofroleswitchprocedureistoenableinter-FlexiDirectRNCrelocation,and
alsoretainingthe(originalsource)sourceFlexiDirectRNCradiolinkevenafterthe
relocation.ThismeansthattheoriginalsourceFlexiDirectRNCbecomesDrift,and
originalDriftFlexiDirectRNCbecomesthenewServingFlexiDirectRNC(Adapter).
Thisissynchronizedonapre-calculatedCFN.Thisisadeviationfromthe3GPP
specificationforrelocationandneedsspecialRNSAPextensions.TheUEactiveset
beforeandaftertheroleswitchdoesnotchange.FormoreinformationseesectionInter
AdapterServingCellChangecombinedRoleSwitch.

ExtensionofHSPAoverIur
RAN2270: Extension of HSPA over IurfeatureisanextensionoftheRAN1231: HSPA
over Iurfeature.Thisfeature:

extendsRAN1231: HSPA over IursupportformcRNCandFlexiDirectRNCproducts

supportCSAMRonDCH+1PSNRTonHS(D)PAmulti-rabcombinationoverIur

supportanchoringforsinglePSNRTRABwithorwithoutCSAMRonDCHwhenall
theactivesetcellsoftheUEareinDRNC

ThefeatureiscontrolledbythesamelicenseasRAN1515: HSPA Inter-RNC Cell


Changefeature.

InterCircleRoamingforHSDPA
TheRAN2596: Inter Circle Roaming for HSDPAfeatureallowsa3Goperatortoshare
HSDPAnetworkcapacitywithotheroperatorswhodonothave3Gcoverageinthisarea.
ThedifferencebetweenICRandnormalnationalroamingisthatICRallowscapacity
sharingaccordingtocertainweights.RAN2596: Inter Circle Roaming for HSDPAisan
optionalfeatureandiscontrolledbyanexisting Inter Circle RoamingRNC-levellicense
key.ThelicensekeyisthesameonethatcontrolstheRAN2412: Inter Circle Roaming
feature.TheRAN2596: Inter Circle Roaming for HSDPAfeatureisenabledbythe
existingBTS-levelICREnabledparameter.
NotethatthisfeatureissupportedonlyfortheIPA-RNC.

FastHSPAMobility
TheRAN2746 Fast HSPA Mobilityfeatureimprovesenduserexperience,especiallyfor
fastmovingusers,suchaspassengersinbullettrains.ThisfeatureensuresthatHSPA
userisservedbythebestcellwhichguaranteesthebestthroughputalsoinfast
changingradioenvironment.
FromtheRRMpointofview,theRAN2746 Fast HSPA Mobilityfeatureincludesthe
followingfunctionalities:
1. PrioritizationofSCCandASUoverpoweroffsetupdate.

Issue:06H

DN0638161

R: 23/396

23

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

DescriptionofWCDMARANradioresource
managementofHSDPA

WCDMARANRRMHSDPA

HS-DPCCHpoweroffsetsareupdatedwhenUEmovesbetweentheSHOandnonSHOstate.LegacysolutionusesPhysical Channel Reconfigurationprocedure,and


executestheupdaterightafteractivesetupdateifthestatechangesfromSHOto
non-SHOorviceversa.NewsolutionintroducedbythisfeaturedelaystheHSDPCCHpoweroffsetupdatebyapredefinedwaittime.
SCC(orASU)canbetriggeredrightafterthepreviousASUiscompletedwithout
waitingforcompletionofthepoweroffsetupdateprocedure.Poweroffsetupdate
procedurecanbecombinedwithSCC(orotherRBreconfiguration)ifRB
reconfigurationprocedureistriggeredduringthepredefinedwaittime.
2. Poweroffsetupdatemessagesizeoptimization.
ThefollowingunnecessaryinformationelementsinRRC:PHYSICALCHANNEL
RECONFIGURATIONmessageusedforHS-DPCCHpoweroffsetupdateare
removedresultinginthereducedmessagesize:

dl-InformationPerRLlist

dl-CommonInformation.

3. FastercompletionofconsecutiveASUandSCCprocedures.
TheRNCcantriggerbothASUandSCCprocedurebasedontheevent1Aand1C
reportedbytheUEintheRRC:MEASUREMENTREPORT.TheRNCexecutesSCC
rightafterASUiscompletediftheSCCconditionistriggered.Nonewmeasurement
reportisneededtotriggertheSCC.

SRVCCfromLTEandCSFBwithHO
TheRAN2435: SRVCC from LTE and CSFB with HOfeaturesupportstwocasesto
movetheUEfromtheLTEsystemtoWCDMA:

SRVCCwhenVoIPissupportedinLTE

CSFBwhenVoIPisnotsupportedinLTE

LTEtoWCDMASingleRadioVoiceCallContinuity(SRVCC)functionalityenablesvoice
service(VoIP)continuitytotheCSdomainwhenchangingfromanLTEcelltoaWCDMA
cell.Allnon-voiceserviceswillbehandedovertothePSdomain.Incaseofanexisting
voicecallintheLTE,thisfunctionalityappearsforUTRANasanincominginter-RAT
relocationrequestfromLTEtoWCDMAintheCSdomainorinCS+PSdomains.MultiRABhandover(CS+PSRABs)fromLTEtoWCDMAissupportedwithSRVCC.
CSFallback(CSFB)isinitiatedintheLTElayerwhen:

UEisinconnectedmode.

CScallneedstobeestablished.

UEhasPSconnection.

VoIPisnotsupportedthere.

TheRNCseesCSFBasPSISHOfromLTE.AftertheUEchangesitsRATfromEUTRANtoUTRAN,theUEcaninitiateaCSservice.CSFallbackallowsLTE
deploymentasadataonlynetwork.

24

DN0638161

R: 24/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

DescriptionofWCDMARANradioresource
managementofHSDPA

IftheUEisintheidlemodeintheLTEwheninitiatingaCSvoicecall,theLTEmay
performredirectiontoWCDMAwithRRCConnectionReleasemessagesenttotheUE.
Then,CSvoicecallisanewcallstartingfromtheidlemodeinWCDMA,butCSFB
operationisnotindicatedtotheRNC.

1.2.3 MultiRABcombinationswithHSDPA
NRTRABonHSDPA(HSDPAwithAdditionalRABinitiationfeature)ispartofthe
HSDPAbasicfunctionality.

HSDPAwithSimultaneousAMRVoiceCall
HSDPA with Simultaneous AMR Voice Calloptionalfeatureallowsasimultaneoususeof
AMRspeechCSRABandHSDPA.Thefunctionalityprovidedbythatfeatureisfurther
enhancedwiththeEnhancementtoHSDPAwithSimultaneousAMRVoiceCallgeneric
feature,whichadds128and384kbit/sULDCHbitratesupportfortheHSDPAreturn
channelwithasimultaneousAMRcall.

HSDPAMultiNRTRABs
HSDPA Multi NRT RABsoptionalfeatureenablesthesimultaneousallocationofupto
threeNRTPSRABsontheHS-DSCH.Thefeatureiscontrolledbythelicenseandthe
WCEL-HspaMultiNrtRabSupportparameter.

1.2.4 HSDPAuserexperience
HSDPA16usersperCell
HSDPA 16 Users per CellfeatureispartoftheHSDPAbasicfunctionality.

HSDPA48UsersperCell
HSDPA 48 Users per Celloptionalfeaturemakesitpossibletohave48simultaneous
HSDPAusersinonecell.

HSDPA64UsersperCell
HSDPA 64 Users per Celloptionalfeaturemakesitpossibletohave64simultaneous
HSDPAusersinonecell.

HSDPA10MbpsperUserandHSDPA14MbpsperUser
HSDPA 10 Mbps per UserandHSDPA 14 Mbps per Useroptionalfeaturesenablepeak
ratesof10Mbit/sand14Mbit/s,respectively,forindividualHSDPAusers.

HSPA72userpercell
HSPA 72 users per cellenablessupportforupto72simultaneousHSPAusers(HSDPA
andHSUPA)percell.Thefeatureiscontrolledbyalicense.Thelicensecontrolisinthe
RNCsolutiononly.Thelicensetypeistheon/offlicense.

Issue:06H

DN0638161

R: 25/396

25

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

DescriptionofWCDMARANradioresource
managementofHSDPA

WCDMARANRRMHSDPA

FractionalDPCH
TheFractional DPCHsharestheDLdedicatedcodechannelcarryingL1signaling(TPC
bits)ofHSDPAusers.DLL1signalingofupto10HSDPAusersaretime-multiplexedon
thesameSF256DLcodechannel,andL1controloverheadisreduced.Bysharingthe
SF256channelwithF-DPCH,thenumberofHS-PDSCHcodes(andDPCHcodes)can
beincreased.FractionalDPCHisonlyusedforRel-7andsubsequentUEs.Thenetwork
supportsonlyRel-7versionofF-DPCH.F-DPCHisonlysupportedwiththesignaling
radiobearers(SRBs)onHSPA.InthiscaseHSUPAuseseither2ms(itrequiresfeature
RAN1470: HSUPA 2ms TTI)or10msTTI.SwitchingbetweenthemappingofSRBson
DCHandHSPAissupported.ComparedtoRel-6,Rel-7improvesF-DPCHgainsinsoft
handoverbyallowingmoreSHOuserstobemultiplexedtothesameSF256code
channel.TheHSDPAaveragecellthroughputisincreasedthankstotheimproved
spreadingcodeefficiencyandreducedL1controloverheadincaseofahighnumberof
HSDPAusers.

HSUPA2msTTI
The HSUPA 2 ms TTIfeatureenablestheuseofshorterTTI(2msvs.10ms)onE-DCH.
TheshorterTTIimprovestheaveragelatencyinradiointerfaceby12msforthefirst
transmission.FasterretransmissionsalsoreducethevarianceoftheRTT.The
immediatedataprocessinginIubandRNCuserplanealsoshortenstheround-triptime.
ThusthelowerlatencyimprovesanapplicationlevelperformanceandtheHSPAenduserexperience.ULSRBsarealwaysmappedonHSUPAwhenthe2msTTIis
assignedtotheUE.Thenon-scheduledtransmission(NST)isalwaysusedforSRBson
HSUPAifE-TTIis2ms.InDL,SRBscanbemappedonDCHorHS-DSCH(requires
RAN1201,F-DPCH).HSUPA2msTTIisusedfortheUE,thatE-DCHphysicallayer
categoryis2,4,6,or7.MappingtheSRBstoHSUPAwith2msE-TTIenablesthe
spreadingcodeallocationof2xSF2+2xSF4intheuplink,whichisneededif5.8Mbit/s
bitrate(RAN981: HSUPA 5.8 Mbps)isusedintheULdirection.

HSDPA64QAM
TheHSDPA 64QAMfeatureincreasestheHSDPApeakrateupto21.1Mbit/s.The
64QAMmodulationisintroducedbythe3GPPrel-7.HSDPAterminalcategories13,14,
17,18,19,and20supportthe64QAMmodulation.Practicalthroughputislimitedby
radiointerfacecondition(suchassignalstrengthandinterference).Thefeatureis
controlledbyalicense.ThelicensecontrolisintheRNC.Thelicensetypeistheon/off
license.IftheRNCallowstheuseofHSDPA64QAM,theBTSdecideswhetherthe
featureisusedornot.

Continuouspacketconnectivity
3GPPRel-7introducescontinuous packet connectivity (CPC).Discontinuousuplink
DPCCHtransmission,discontinuousdownlinkreceptionoperations,MACDTXandCQI
reportingreductionarethesupportedpartsofthecontinuouspacketconnectivityfeature.
CPCisanoptionalfeatureforRel-7UEs.TheCPCcapabilityissignaledbytheUEto
theRNCinRRCconnectionsetup.CPCisusedonlyincaseofHSPAconfiguration,for
exampletheHSUPAintheULandtheHSDPAandF-DPCHintheDL.TheSRBsare
alsoalwaysonHSPA.NoDCHsintheUL/DLareallowedwithCPC.CPCisactivated
perUE.CPCmakestheCell_DCHstatemoreaffordablefromtheairinterfacecapacity
andUEbatteryconsumptionpointsofviewforthelowactivity/non-continuous

26

DN0638161

R: 26/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

DescriptionofWCDMARANradioresource
managementofHSDPA

transmission.AbetteruserexperiencecanbeofferedtoCPC-capableUEsbykeeping
themlongerintheCell_DCHstate.Thestatetransitionisnotneededfortemporary
inactiveuserswithinteractiveandbackgroundRAB(s).
ThereisapossibilitytouseCPCsimultaneouslywithRAN2124:HSPA128usersper
cellfeature.TheusageofCPCsimultaneouslywithHSPA128userspercellfeatureis
controlledbytheCPC for 128 HSPA Users LKRNClicensekey.Thelicensekeyison/off
license.ThelicenseisusedinparallelwiththelegacyCPClicense.

FlexibleRLC
ThemainpurposeofthefeatureFlexible RLCistoenableachievinghigherHSDPApeak
ratesprovidedby64QAMmodulationscheme.Themeansforthisisreducingthe
overheadintheRLClayerinthedownlinkdirectionbyallowingtheusageofflexibleRLC
PDUsize.ThefeatureisapplicableonlyforRBsusingAMRLCwhicharemappedon
theHS-DSCHtransportchannel.TheuplinkchannelmustbeE-DCH.Thefeatureisnot
underlicensecontrolanditbelongstotheRNCBSW.TheRNCmanagementparameter
FRLCEnabledenables/disablestheuseofthefeatureFlexibleRLCinthenetwork
element.AlsoMAC-ehscanonlybeusediftheF-RLCisenabledwiththe
FRLCEnabledparameter.

CSVoiceoverHSPA
CS Voice over HSPAusesHSPAtransportchannelstocarrytheCSvoicetraffic.
MappingtheCSvoicetoHSPAtakesplaceintheRNCandisnotvisibletothecore
network.ThustheR99orR4CScorenetworkcanbeusedinaregularmanner.CS
voiceoverHSPAisanoptionalfeature,anditsuseiscontrolledatacelllevelbythe
operator.ToactivatetheCSvoiceoverHSPAfeaturewiththeHSPAQoSEnabledRNP
parameter.

PowerSavingModeforBTS
TheHSPA05reconfigurationduringcellshutdownandcellactivationproceduresin
powersavingmode(PWSM)ismadeintherestrictedenvironment.TheHSPA05
reconfigurationisdefinedinWCDMA RAN RRM Admission Control.Thepurposeof
HSPA05reconfigurationistoswaptheHSPAservicesfromHSPAlayercellstoDCH
cellsbyreconfiguringcellswithoutlockingcellsandlosingcalls.

MIMO2x2
MIMO 2x2increasesasingle-userpeakdatarate,overallcellcapacity,andtheaverage
cellthroughput.MIMO2x2assumesadouble-transmitantennaarray(D-TxAA)atthe
BTS,andtworeceiveantennasattheUEwiththesingleordualstreamDLtransmission.
Inthiscase,theoperationoftwoparalleldatastreamsdoublestheHSDPApeakdata
rate,sothetheoreticalmaximumdataratewith16QAMis28Mbpsin3GPPRel-7.
HSDPAterminalcategories15,16,17,and18supporting2x2MIMOwith16QAMare
introduced.Terminalcategories19and20fromRel-8aresupportedwith16QAMonly.
TheUEsignalsMIMOcapabilitytotheRNCduringtheRRCconnectionsetup
procedure.TheRNCconfigurestheMIMOmodetoaMIMOcapableUEwiththeRRC
signaling.IftheMIMOcapableUEisnotconfiguredinMIMOmode,itoperatesasa
regularnon-MIMOUE.

Issue:06H

DN0638161

R: 27/396

27

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

DescriptionofWCDMARANradioresource
managementofHSDPA

WCDMARANRRMHSDPA

Dual-CellHSDPA
In3GPPRel-8,theDual-Cell HSDPAfeatureusestwoadjacentWCDMAcarriersto
transmitdataforasingleUE.Togetherwith64QAM,thepeakbitrateis42Mbit/s.DualCellHSDPAisonlysupportedwiththeNRTservices.IftheRTservicesareneeded,
dynamicswitchingbetweenDual-CellHSDPAandSingle-CellHSDPAmodeis
performed.Dual-CellHSDPArequirestheHSUPA,HSDPA15codes,HSDPA14Mbps
peruser,andFlexibleRLCfeatures.Dual-CellHSDPAissupportedwithSRBsonHSPA,
SRBsonHSUPA,orSRBsonDCH3.4kbit/s.IfboththeUEandnetworksupportthe
enhanced(Rel-7)F-DPCH,thenSRBsonHSPAwithenhancedF-DPCHisused.MIMO
andDual-CellHSDPAcanbeenabledinthesamecellandusedsimultaneouslyforone
UE.Indual-carriermode,themobilityproceduresarebasedonthecarrierfrequencyof
theprimaryservingHS-DSCHcell.Dual-CellHSDPAprovides:

doublepeakrateforsingleuser

higheraveragethroughputthankstostatisticalmultiplexing

bettercoveragethankstofrequencyselectivity

Dual-CellHSDPAwithIurinvolvedissupportedonlywhenSRBsareonDCH/DCHand
theservingcellisinSRNC/ServingFlexiDirectRNC.

DirectResourceAllocationforHSPA
WiththeRAN1762: Direct Resource Allocation for HSPA feature,theHS(D)PAtransport
channelsaredirectlyallocatedintheRABsetupphaseinCell_DCHandCell_FACH
state.Usingthisfeature,theoperatorcanselectthedirectresourceallocationforthe
newenteringPSRABsofinteractiveandbackgroundtrafficclasses.Theoperatorcan
alsodefinewhetherthedirectresourceallocationisappliedinCell_FACHstate.

MIMO42Mbps
TheRAN1912: MIMO 42 MbpsfeatureincreasestheMIMOpeakrateto42Mbit/s.This
isachievedbyapplyingthe64QAMmodulationscheme.HSDPARel-8terminal
categories19and20supportMIMOwith64QAMmodulation.Simultaneoususageof
MIMOandHSDPA64QAMiscontrolledbytheWCEL-MIMOWith64QAMUsage
parameterintheRNC.

DC-HSDPAwithMIMO84Mbps
TheRAN1907: DC-HSDPA with MIMO 84 Mbpsfeaturescombinesthefollowing
features:

RAN1906: Dual Cell HSDPA 42 Mbps

RAN1642: MIMO 28 Mbps

RAN1643: HSDPA 64QAM

Combinationsofthosethreefeatureshelpachieve84Mbit/speakdatarateindownlink
(DL).Whenpossible,MIMOisconfiguredtouseintheUEforbothprimaryand
secondarycell.ThereisapossibilitytouseMIMOonlyinprimarycell.Thathappens
whenMIMOusageinsecondarycellisnotpossible.HSDPARel-9terminalcategories
from25to28supportsimultaneoususageoftheDC-HSDPAandMIMO.

28

DN0638161

R: 28/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

DescriptionofWCDMARANradioresource
managementofHSDPA

ThemaximumachievabledataratewhenMIMOisconfiguredonlyintheprimarycell:

63Mbit/s(Primary42Mbit/s+Secondary21Mbit/s)when64QAMmodulationis
used

42Mbit/s(Primary28Mbit/s+Secondary14Mbit/s)without64QAMmodulation

SimultaneoususageoftheDC-HSDPAandMIMOiscontrolledbytheWCELDCellAndMIMOUsageparameterintheRNC.

HSPA128UsersperCell
TheRAN2124: HSPA 128 Users per Cell featureincreasesthenumberofuserspercell
intheCELL_DCHstateto128.ForUL,asopposedtooldcapacityfeatures,onlyserving
usersarecountedandcheckedwiththisfeature.ThemaximumnumberofHS-DSCH
MAC-dflowsis1024peronecell.Thefeatureisunderalicensekey.Thefeatureis
activatedwiththeHSPA128UsersPerCellWCELparameter.
TheusageofCPCsimultaneouslywithHSPA128userspercellfeatureiscontrolledby
theCPC for 128 HSPA Users LKRNClicensekey.

HighSpeedCell_FACHDL
TheRAN1637: High Speed Cell_FACH DLfeatureenablestheHSDPAusagein
Cell_FACHstate.Thelogicalchannels(CCCH/DCCH/DTCH)mappedinprevious
releasestotheFACHtransportchannelcanbemappedtoHS-DSCHtoimprovethe
performance.Thenewlogicalchanneltotransportchannelmappingschemeisapplied
intheMAClayer.Nonewtransportorphysicalchannelsareintroduced.
High Speed Cell_FACH DLisanoptionalfeatureanditsuseiscontrolledatcelllevelby
theoperator.Activationandconfigurationofthefeatureiscontrolledwiththenewcell
levelHSFACHEnabledradionetworkplanningparameter.Modificationofthisparameter
requiresobjectlocking.

FastDormancyProfiling
TheRAN2451: Fast Dormancy ProfilingfeatureidentifiesLegacyFastDormancy(LFD)
smartphones,Rel5iPhoneandFastdormancyUE(supporting3GPPRel8fast
dormancyUE),causingunnecessarysignalingload.IdentifiedLFDsmartphonesare
movedtoCell_PCH/URA_PCHstatewithshorterinactivitytimerstoavoidsignaling
connectionrelease.Also,highertrafficvolumemeasurement(TVM)thresholdsfor
commonchannelsareconfiguredtoidentifiedtheLegacyFastDormancy(LFD)
smartphones,Rel5iPhone,FastdormancyUEs,toavoidstatetransitiontoCell_DCH
stateforakeep-alivemessageonly.
FromRRMpointofview,theRAN2451: Fast Dormancy ProfilingfeatureaffectsTVM
thresholdsandCell_DCHstateinactivityhandling.TheRRMconfiguresspecificTVM
thresholdsforLFDsmartphones,Rel5iPhoneandFastdomancyUEandapplies
specificCell_DCHstateinactivityhandlingincaseofidentifiedsmartphones.
TheRAN2451: Fast Dormancy ProfilingfeatureiscontrolledbytheRNClicensekey
Fast Dormancy Profiling.Theoperatorcanactivateanddeactivatethefeaturewiththe
RNC-LFDProfEnabledtelecomcategoryparameter.

Issue:06H

DN0638161

R: 29/396

29

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

DescriptionofWCDMARANradioresource
managementofHSDPA

WCDMARANRRMHSDPA

HighSpeedCell_FACH
WiththeRAN1913: High Speed Cell_FACHfeature,theHSPAusageisenabledinthe
Cell_FACHstate.Thelogicalchannels(CCCH/DCCH/DTCH)mappedinprevious
releasestotheRACHtransportchannelcanbemappedtoE-DCHforimprovingtheUL
performance.WithHighSpeedCell_FACH,moreuserscanbesupportedinthe
Cell_FACHstate,andsmoothdatatransmissioncanbeprovidedforusersnotrequiring
largedatavolumes.
Thisfeatureusesthe3GPPenhancedCell_FACHstatefordownlink(Rel7)anduplink
(Rel8).InthedownlinkdirectionthelogicalchannelsmappedtoFACHtransportchannel
inpreviousreleasescanbemappedtoHS-DSCHtransportchannel,whileintheuplink
directionthelogicalchannelsmappedtoRACHtransportchannelinpreviousreleases
canbemappedtoE-DCHtransportchannel.
TheRAN1913: High Speed Cell_FACHfeatureiscontrolledwiththesamelicensekeyas
RAN1637: High Speed Cell_FACH DLfeature.ThelicencenameisHigh Speed
Cell_FACH.TheoperatorcanactivateanddeactivatethefeaturewiththeWCELHSRACHEnabledparameter.
TheradionetworkplanningparameterHSRACHEnabledcanbesettoONonlyif:

High Speed Cell_FACHlicencestateisON.

HSUPAisenabledinthecellwiththeHSUPAEnabledRNPparameter.

TheuseofFlexibleRLCinULdirectionisenabledintheRNCwiththeRNP
FlexULRLCEnabledparameter.

RAN1637: High Speed Cell_FACH DLfeatureisenabledinthecellwiththeRNP


HSFACHEnabledparameter.

UEDRXinCELL_FACH
TheRAN1908: UE DRX in CELL_FACHfeatureenablesdiscontinuousreception(UE
DRX)forHighSpeedCell_FACHforRel8ornewerUEs.
TheUEDRXinCELL_FACHsupportsdiscontinuousreceptioninthehighspeed
CELL_FACHstateandthusallowstheUEbatterysaving(especiallyforapplications
requiringkeep-alivetypeoftraffic).LowbatteryconsumptionenableslongerCell_FACH
times,resultinginbetteruserexperiencebecauseoffastresponsetime.Theadvantage
ofthismethodisalsothattheUEstatetransitionfromRXtoDRXcanbecheckedbythe
BTS,andisnotdependentontheRNCinactivitytimers.
IftheUEDRXisnotconfiguredintheCell_FACHstate,theUEdecodesallthedownlink
HS-SCCHframesinCell_FACHstate.
FeatureRAN1908: UE DRX in CELL_FACHrequirestheRAN1913: High Speed
Cell_FACHfeature.
TheRAN1908: UE DRX in CELL_FACHfeatureiscontrolledwiththesamelicensekey
astheRAN1913:HighSpeedCell_FACHfeature.
EnablingoftheRAN1908: UE DRX in CELL_FACHfeatureiscontrolledwithnew
HSFACHDRXEnabledcelllevelradionetworkplanningparameter.

30

DN0638161

R: 30/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

DescriptionofWCDMARANradioresource
managementofHSDPA

1.2.5 Qualityofservicemanagement
QoSAwareHSPAScheduling
QoS Aware HSPA Schedulingoptionalfeatureallowsdifferentiatingbetweenvarious
kindsofservicesandsubscriberssupportingdifferenttariffclassificationmodelsforNRT
trafficclasses.Inotherwords,premiumservicesandsubscriberscanbeprioritizedover
thelow-tariffbroadbandHSDPAdatatraffic.

StreamingQoSforHSPA
Streaming QoS for HSPAoptionalfeaturesupportsstreamingQoStrafficclassRABson
theHS-DSCH.Thepacket-switched(PS)corenetworkistheoriginofthesetypesof
RABs.TheRANsupportsstreamingRABsandthencreatesthecorrespondingradio
bearers(RBs).Whenusingthisfeature,streamingtrafficclassRBscanbemappedon
DCH/HS-DSCHandE-DCH/HS-DSCH.

PSNRTRABReconfiguration
Thecorrespondingoptionalfeature,PS NRT RAB Reconfiguration,providesthe
reconfigurationofpacket-switchednon-real-timeradioaccessbearers.Thefeature
complementstheHSPAqualityofservice(QoS)management.IfRABservice
characteristicsrequiremodification,boththeSGSNandUEcanrequesttheRAB
reconfigurationprocedure.Neitherthenarrowbandadaptivemulti-rate(N-AMR)northe
widebandAMR(W-AMR)RABmodificationprocedureisaffectedbythisfeature.The
RNClevelparameterNodeBRABReconfigSupportdefinestheBTSssupportforthis
feature.

ApplicationAwareRAN
TheRAN2509: Application Aware RANfeatureintroducesdynamicserviceorapplication
prioritizationforHSDPAscheduling.Thisfeaturealsointroducesdynamicdemotionof
ULbulktrafficbytheBTSinasingleRABcase.
TheRAN2509: Application Aware RANfeatureiscontrolledbytheApplication Aware
RANlicense.TheRAN2509: Application Aware RANfeaturecanbeenabledordisabled
inthecellbyWCEL-AppAwareRANEnabledparameter.

1.2.6 CommonIubinterface
TheRNCcommunicateswithdifferentBTStypestheWCDMABTSandthe
NB/RSxxxwhileFlexiDirectRNConlywithWCDMABTS.Thelattertyperequires
modificationofthecommunicationovertheIubinterface.Theseadaptationsare
availablewiththefollowingfunctions:

Issue:06H

RemovalofWCDMABTSSpecificOptimizationsforNB/RSxxxadaptstheRNCto
theNB/RSxxxwithregardtoWCDMABTS-specificoptimizations.TheNB/RSxxxis
notabletoprovideitsHSDPA-specificcapabilityindicationsthroughtheprivate
messagemechanism,specifiedinthe3GPPNBAPprotocolextensionandusedby
theWCDMABTS.TheRNChastocopewithoutthiscapabilityinformationwhen
communicatingthroughNBAPwiththeNB/RSxxx.

DN0638161

R: 31/396

31

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

DescriptionofWCDMARANradioresource
managementofHSDPA

32

WCDMARANRRMHSDPA

WhencommunicatingwiththeWCDMABTS,theRNCusestheprivateNBAPRadio
ResourceIndicationmethod.Thismethodprovidesparticularreportfilteringand
reportcombiningfunctions,allowingforshortreportingperiods,forexample.
CommonMeasurements-FilteringandEventBasedTriggeringenablestheRNCto
supportthe3GPPcommonmeasurementsusedbytheNB/RSxxx.Thus,both
periodicandevent-E-basedmeasurementsareapplicable.Furthermore,the
increasedreportingperiodoftheNB/RSxxx(800msandlonger)isfacilitated.

HSPADownlinkCommonChannelPowerControlcomplementsbothHSDPAand
HSUPAdownlinkcommonchannelpowercontrolsthathavebeenintroducedin
RAS06release.ItintroducesfunctionsfortheNB/RSxxx.Thefunctionalityforthe
WBTSremainsunchanged.

DN0638161

R: 32/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

RABcombinationsforHSDPA

2 RABcombinationsforHSDPA

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
Anumberofmulti-RABcombinationsarecurrentlysupportedwiththeHS-DSCH
transportchannel,withtherestrictionthatthefollowingfeaturesareoptional:

SupportforAMRspeechCSRAB(HSDPA with simultaneous AMR Voice call,


activatedbyenablingtheAMRWithHSDSCHparameter)

Multiple(morethanone)NRTRABs(HSPA Multi NRT RAB)

HSPAstreaming(Streaming QoS for HSPA)

SupportforCSvoice(CS Voice over HSPA)

HSPA Multi NRT RABsfeatureenablesallocationofuptothreesimultaneousNRTPS


RABsonHS-DSCHandE-DCH,withorwithoutAMR.IftheStreaming QoS for HSPAis
additionallyactivated,onestreamingRABcanalsobecombinedwithNRTRABsonHSDSCHandE-DCH.TheRABsaremultiplexedanddemultiplexedintheMAC-hsand
MAC-eentitiesintheBTSandintheUE,respectively.IncaseHSUPAisnotsupported,
RABscanbemappedtoDCHinULdirection.TheRABsmayfurthermorebeprioritized
inthemultiplexingbasedontheirschedulingpriorityindicator(SPI)valueswhichare
derivedfromtheRABQoSparametersreceivedfromthecorenetwork.
WhileusingtheHS-DSCHonthedownlink(DL),twocaseshavetobedistinguishedfor
theuplinktransportchannelinuseDCHorE-DCH.
UL:DCHandDL:HS-DSCHcase:

13interactive/background(UL:16/64/128/384kbit/s,DL:HS-DSCH)PSRAB(s)

Streaming(UL:16/64/128kbit/s,DL:HS-DSCH)PSRAB

Streaming(UL:16/64/128kbit/s,DL:HS-DSCH)PSRABand13
interactive/background(UL:16/64/128kbit/s,DL:HS-DSCH)PSRAB(s)

AMRspeechCSRABand13interactive/background(UL:16/64/128/384kbit/s,
DL:HS-DSCH)PSRAB(s)

AMRspeechCSRABandstreaming(UL:16/64/128kbit/s,DL:HS-DSCH)PSRAB

AMRspeechCSRABandstreaming(UL:16/64/128kbit/s,DL:HS-DSCH)PSRAB
and13interactive/background(UL:16/64/128kbit/sifthereissimultaneous
streamingserviceor16/64/128/384kbit/sifthereisnosimultaneousstreaming
service,DL:HS-DSCH)PSRAB(s)

PresentedbitratelimitationsareinuseonlyifthereexistanactivePSstreamingRAB
(PSstreamingserviceisnotmappedonDCH0/0).IfPSstreamingserviceisinactive
(mappedtoDCH0/0),thenbitratescanbechosenlikePSRTRABdoesnotexist.

Issue:06H

DN0638161

R: 33/396

33

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

RABcombinationsforHSDPA

WCDMARANRRMHSDPA

UL:E-DCHandDL:HS-DSCHcase:

13interactive/background(UL:E-DCH,DL:HS-DSCH)PSRAB(s)

Streaming(UL:E-DCH,DL:HS-DSCH)PSRAB

Streaming(UL:E-DCH,DL:HS-DSCHPSRABand13interactive/background
(UL:E-DCH,DL:HS-DSCH)PSRAB(s)

AMRspeech(UL:DCH,DL:DCH)CSRABand13interactive/background(UL:EDCH,DL:HS-DSCH)PSRAB(s)

AMRspeech(UL:DCH,DL:DCH)CSRABandstreaming(UL:E-DCH,DL:HS-DSCH)
PSRAB

AMRspeech(UL:DCH,DL:DCH)CSRABandstreaming(UL:E-DCH,DL:HS-DSCH)
PSRABand13interactive/background(UL:E-DCH,DL:HS-DSCH)PSRAB(s)

ThefollowingfullHSPARABcombinationswhereSRBsandallRBsaremappedtoEDCH/HS-DSCHtransportchannelsaresupported:

1...3interactive/background(UL:E-DCH,DL:HS-DSCH)PSRAB(s)

streaming(UL:E-DCH,DL:HS-DSCH)PSRAB

streaming+1...3interactive/background(UL:E-DCH,DL:HS-DSCH)PSRAB(s)

AMRSpeechCSRAB(UL:E-DCH,DL:HS-DSCH)CSRAB(s)

AMRSpeech(UL:E-DCH,DL:HS-DSCH)CSRABandPSstreamingPSRAB(UL:
E-DCH,DL:HS-DSCH)PSRAB

AMRSpeech(UL:E-DCH,DL:HS-DSCH)CSRABand1...3Interactive/Background
PSRABs

AMRSpeech(UL:E-DCH,DL:HS-DSCH)CSRABandPSStreaming(UL:E-DCH,
DL:HS-DSCH)PSRABand1...3Interactive/Background(UL:E-DCH,DL:HSDSCH)PSRABs

ThefollowingRABcombinationsaresupportedoverIurinthefollowingcases:

HSPAoverIurisactivated:

1Interactive/Background(UL:DCH/E-DCH,DL:HS-DSCH)PSRAB

ExtendedHSPAoverIurisactivated:

1Interactive/Background(UL:DCH/E-DCH,DL:HS-DSCH)PSRAB

AMRspeechCSRAB(UL:DCH,DL:DCH)+1Interactive/Background
(UL:DCH/E-DCH,DL:HS-DSCH)PSRAB

IfSRBsorSpeechCSRABcannotbemappedtoE-DCH/HS-DSCHtransportchannels,
thenSRBsandSpeechCSRABismappedtoDCHtransportchannelbutPSRABscan
beusedinHS-DSCH(withDCHorE-DCHinUL).PSstreamingandmultipleNRTRABs
(2/3)areseparateoptionalfeatures.

34

DN0638161

R: 34/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

RABcombinationsforHSDPA

IfthemultiRABconfigurationusedbytheUEisnotsupportedwiththepresenttransport
channels,thenachanneltypeswitchismadetowardstransportchannelconfiguration
wheretheneededRABcombinationissupported.
IftheAMRvoiceCSRABismappedtoHS-DSCH,thenonlyfullHSPAconfigurationcan
beusedandsotherecannotbeULsmappedtoDCHfortheUEinquestion.IftheRAB
combinationwithSRBsonHSPAisnotsupportedanymore,becausenewRABisbeing
established,thenDCHchanneltypeisconfiguredtoDLSRBs.Formoreinformationon
ULSRBs,seeWCDMA RAN RRM HSUPA.
MIMOissupportedforNRT(InteractiveandBackground)PSservices.Themaximum
numberofthreesimultaneousNRTPSRABsissupported.Formoreinformation,see
MIMOsupportedforNRTPSdata.
DCHSDPAissupportedforNRT(InteractiveandBackground)PSservices.The
maximumnumberofthreeinteractiveorbackgroundRABs,allmappedtoHSPA.For
moreinformation,seeDCHSDPAsupportedforNRTPSdata.

Issue:06H

DN0638161

R: 35/396

35

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

SupportedbitratesforHSDPA

WCDMARANRRMHSDPA

3 SupportedbitratesforHSDPA

g
g

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
NotethatlicenseinformationisrelevantonlytotheIPA-RNCsolution.

3.1 SupportedHSDPApeakrates
ThemaximumuserbitrateoftheHS-DSCHMAC-dflowusedintheresource
reservationfortheHS-DSCHMAC-dflowisthesmallestofthefollowingvalues(HSDSCHMAC-dflowpeakratealsomeansapeakrateofoneRAB):

ThemaximumbitratebasedonUEcapability

ThevalueoftheMaxBitRateNRTMACdflowmanagementparameter.The
parameterdoesnotlimitthemaximuminstantaneousbitrateontheairinterface.
ThevalueoftheparameteriscomparedtotheuserbitrateoftheHS-DSCHMAC-d
flowexcludingMAC-hsheader,RLCheaderandpadding.

ThemaximumbitrateinRABparameters.Thisconditionischeckedonlyifthe
HSDPAPeakRateLimitRABMaxmanagementparameterissettovalue1(Limitation
isactive).

ThemaximumuserbitrateallowedbythesystemfortheHS-DSCHMAC-dflow
dependsontheactivelicensesinthefollowingway:

36

IfthereisnolicenseforHSDPA 15 Codesfeature,thenthemaximumuserbitrateis
3.36Mbit/s(correspondsto3.6Mbit/sairinterfacebitrate)

IfthereislicenseforHSDPA 15 Codesfeature,thenthemaximumuserbitrateis
6.72Mbit/s(correspondsto7.2Mbit/sairinterfacebitrate)

IfthereislicenseforHSDPA 15 Codesfeaturewithmaximumnumberofcodes15
andHSDPA 10 Mbps per Userfeature,thenthemaximumuserbitrateis9.60Mbit/s
(correspondsto10Mbit/sairinterfacebitrate).Tousethisfeature,themaximum
MAC-dpeakratemustbesettoavaluenotrestrictingthebitratetooearlywiththe
MaxBitRateNRTMACDFlowmanagementparameter.

IfthereislicenseforHSDPA 15 Codesfeaturewithmaximumnumberofcodes15
andHSDPA 14 Mbps per Userfeature,thenthemaximumuserbitrateis13.44
Mbit/s(correspondsto14Mbit/sairinterfacebitrate).Tousethisfeature,the
maximumMAC-dpeakratemustbesettoavaluenotrestrictingthebitratetooearly
withtheMaxBitRateNRTMACDFlowmanagementparameter.

IfthereislicenseforHSDPA 15 Codesfeaturewithmaximumnumberofcodes15
andHSDPA 64QAMfeature,thenthemaximumuserbitrateis20.96Mbit/s
(correspondsto21.1Mbit/sairinterfacebitrate).

IfthereislicenseforHSDPA 16QAMfeatureandMIMOfeature,thenthemaximum
userbitrateis28Mbit/s.

DN0638161

R: 36/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

SupportedbitratesforHSDPA

IfthereislicenseforHSDPA 64QAMfeatureandDual-Cell HSDPA 42Mbpsfeature


orMIMO 42 Mbpsfeature,thenthemaximumuserbitrateis42Mbit/s.

IfthereislicenseforDual-Cell HSDPA,MIMO,andHSDPA 64QAMfeature,thenthe


maximumuserbitrateis84Mbit/s.

Ineithercase,ithastobenoticedthattheactualpeakrateoftheHSDPAuseralso
dependsontheuser'sradioconditionsandtheoverallloadofthecell.
ThemaximumvalueofthemanagementparameterMaxBitRateNRTMACdflowfollows
themaximumvalueallowedbythesystem.

3.2 SupportedguaranteedbitrateswithHSDPA
UE-specificpacketschedulerlimitstheDLguaranteedbitrateincaseofHS-DSCHto
2000kbit/s.ThismeansthatforstreamingonHS-DSCHthebiggestsupportedGBRis
2000kbit/s.RequestsforbiggerGBRarerejectedwhenRABisbeingallocatedwiththe
causecodeRequestedGuaranteedBitRateforDLnotAvailable(35).
WhentheRNCreceivestheguaranteedbitrate(GBR)value0forUL,DL,orbothUL
andDL,thevalueisnormalizedto8kbit/s.ThenewvalueisusedasGBRforall
purposes.ThisvalueisalsousedintheSRNC/ServingFlexiDirectRNCandthe
DRNC/DriftFlexiDirectRNC.However,incaseofinactivePSRABs,theDCH0/0isstill
used.

3.3 HS-DSCHMAC-dflowpeakdatarate
PeakdatarateoftheHS-DSCHMAC-dflow,whichisprovidedbytheL3totheL2,is
utilizedintheRNCinternalresourcereservation(DSP)andalsointheselectionofthe
fixeddownlinkRLCPDUsizeforHS-DSCH.HS-DSCHMAC-dflowpeakrateforNRT
andstreamingservicesiscalculatedasfollows:
Figure 2

HS-DSCHMAC-dflowpeakdatarate

where:
Rmax_RABistheRABattributeMaximumbitratereceivedinRANAP.IftheExtended
Maximum Bit RateIEispresentinRANAPmessage,theRNCconsidersitandignores
theMaximum Bit RateIE.ThisischeckedonlyifcheckingisactivatedwiththeRNP
HSDPAPeakRateLimitRABMax parameter.Ifcheckingisnotactivated,theRAB
attributedoesnotaffecttheselectedpeakrate.
MaxBitRateNRTMACDFlowisamanagementparameterforsettingthemaximumbit
rateofMAC-dflow.

Issue:06H

DN0638161

R: 37/396

37

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

SupportedbitratesforHSDPA

WCDMARANRRMHSDPA

System_Maxisamaximumpeakrateallowedbythesystem,limitedbytheactive
licenses.
PeakrateatRLCPDUpayloadleveliscalculatedforflexibleRLC(MAC-ehsconfigured)
andfixedRLC(MAC-hsconfigured)casesasdescribedinthefollowingsubchapters.

3.3.1 FlexibleRLC(MAC-ehsconfigured)
Figure 3

PeakRateatRLCPDUpayloadlevel

andiscomputedasfollows:
Figure 4

maximumRLCPDUpayload

where:
MaxTBsize=maximumMAC-ehsPDUtransportblocksize,
TTI=HS-DSCHtransmissioninterval(2ms),
inter TTI interval=minimumintervalbetweenconsecutivedatatransmissionforthe
sameUE.
Assumingthat:
1. MAC-ehsreorderingSDUscontainedintheMAC-ehsPDUaretargetedtothesame
priorityqueueintheWCDMABTS
and
2. eachMAC-ehsreorderingSDUcontainsRLCPDUheaderwhichinturnisassumed
tohavesizeof16bits
theMACehsHeaderSizeandRLCheaderSizecanbecomputedasfollows:
Figure 5

MAC-ehsHeaderSize

Figure 6

RLCHeaderSize

where:
sizeof(TSN + SI)=8bits,
sizeof(LCHID + L + F)=16bits,
N=numberofMAC-ehsreorderingSDUsfittingintotheMAC-ehsPDUcomputedas
follows:

38

DN0638161

R: 38/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

SupportedbitratesforHSDPA

Figure 7

NumberofMAC-ehsreorderingSDUs

where:
[]denotesroundinguptothenearestinteger,
MaxRLCPDUsizeisdefinedbytheRLCinternalmanagementparameterwhosedefault
valueis5568bits.
64QAMconfiguredinuse
ThemaximumsupportedbitrateofMAC-dflowinRLCPDUpayloadlevelis20964
kbit/s.ThemaximumMAC-ehsPDUtransportblocksize(MaxTBsize)of42192bitsis
used.
MIMOconfiguredinuse
1. Peak rate at RLC payload level perMIMOstreamiscalculatedsothattheMaximum
MAC-ehs PDU transport block size(MaxTBsize)receivesavalueaccordingtothe
UEphysicallayercategoryasfollows:

Category15:23370bits

Category16:27952bits

Category17:23370bits(16QAM)

Category18:27952bits(16QAM)

Category19:27952bits(16QAM)

Category19:35280bits(64QAM)

Category20:27952bits(16QAM)

Category20:42192bits(64QAM)

ThefinalvalueforthePeak rate at RLC payload level,whichrepresentsacombined


valuefor2MIMOstreams,isobtainedbymultiplyingthealgorithmvalueby2.
2. TheSystem_MaxvaluecorrespondswiththehighestpossiblevalueforthePeak
rate at RLC payload level.System_Maxobtainsthefollowingvalue:

27752kbit/sifMIMOwithout64QAMisactivated.

41928kbit/sifMIMOwith64QAMisactivated.

ThefinalvalueofthePeak rate at RLC payload levelandSystem_Maxisusedwhenthe


HS-DSCHMAC-dflowpeakrateiscalculatedfortheMIMOUE,andMIMOisactivated.
DCHSDPAconfiguredinuse
1. HS-DSCHMAC-dflowiscalculatedperMIMOstream:

Issue:06H

WhenMIMOisnotactivated,theusedcategoriesarefrom21to24.

WhenMIMOisactivated,theusedcategoriesarefrom25to28.

DN0638161

R: 39/396

39

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

SupportedbitratesforHSDPA

WCDMARANRRMHSDPA

2. ThePeak rate at RLC payload level percelliscalculatedsothattheMaximum MACehs PDU transport block size(MaxTBsize)receivesavalueaccordingtotheUE
physicallayercategoryasfollows:

Category21:23370bits(DCHSDPAwith16QAM)

Category22:27952bits(DCHSDPAwith16QAM)

Category23:35280bits(DCHSDPAwith64QAM)

Category24:42192bits(DCHSDPAwith64QAM)

Category25:23370bits(DCHSDPAwithMIMOand16QAM)

Category26:27952bits(DCHSDPAwithMIMOand16QAM)

Category27:35280bits(DCHSDPAwithMIMOand64QAM)

Category28:42192bits(DCHSDPAwithMIMOand64QAM)

3. AcombinedvaluefortwoMIMOstreamspereachcellisobtainedbymultiplyingthe
algorithmvalueby2.
4. ThefinalvalueforthePeak rate at RLC payload levelisobtainedbysummingupthe
valueoftheprimarycellandthesecondarycell.
5. TheSystem_MaxvaluecorrespondswiththehighestpossiblevalueforthePeak
rate at RLC payload level.System_Maxobtainsthefollowingvalue:

27752kbit/sifDCHSDPAisactivated(withoutMIMOandwithout64QAM).

41928kbit/sifDCHSDPAand64QAMareactivated(withoutMIMO)

41928kbit/sifDCHSDPA(without64QAM)withMIMOisactivated(MIMOis
onlyintheprimarycell).

55504kbit/sifDCHSDPAandMIMO(MIMOintheprimaryandsecondarycell)
areactivated(without64QAM)

62892kbit/sifDCHSDPAand64QAMwithMIMOareactivated(MIMOisonlyin
theprimarycell).

83856kbit/sifDCHSDPA,MIMO,and64QAMareactivated(MIMOisinboth
theprimaryandsecondarycell).

ThefinalvalueofthePeak rate at RLC payload levelandSystem_Maxisusedwhenthe


HS-DSCHMAC-dflowpeakrateiscalculatedfortheDCHSDPAUEandDCHSDPAis
activated.
InFlexiDirectsolutiontheSystem_Maxvaluedependsonthefeaturethathasthe
highestavailablepeakrate.Thecorrespondingbitrateis84Mbit/s.

3.3.2 FixedRLC(MAC-hsconfigured)
Figure 8

PeakrateatRLCPDUpayloadlevel

TheequationPeak rate at RLC PDU payload levelincludesthefollowingparameters:

40

DN0638161

R: 40/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

SupportedbitratesforHSDPA

Nmax_TBequalstoMaximum number of bits of an HS-DSCH transport block received


within an HS-DSCH TTIdefinedbyHS-DSCHphysicallayercategory(UE
capability)

NMAC-hs_headeristhenumberofbitsinMAC-hsheader,equalsto21

NRLC_PDUisthenumberofbitsinRLCPDU,equalsto656(or336)

NRLC_PUisthenumberofbitsinRLCpayload,equalsto640(or320)

TTIistheHS-DSCHTTI,equalsto2ms

qequalstoMinimum inter-TTI intervaldefinedbyHS-DSCHphysicallayercategory


(UEcapability)

3.3.3 CSvoice
ThepeakrateoftheHS-DSCHMAC-dflowestablishedfortheCSvoicebearerisset
equaltothemaximumRLCuserbitratevalue.ConsideringthattheNUMDistheMAC-d
PDUsizeofthemaximumAMRmodeofthecodecset,itsvalueisdefinedasdescribed
inUMRLCconfiguration.Thepeakrateisobtainedfromtheequation:
Figure 9

ThepeakrateoftheHS-DSCHMAC-dflowestablishedfortheCSvoice

WhereNUMistheheadersizeofUMDPDUthatequals8bits.
TTIAMRistheframeperiodoftheAMRthatequals0.02s.

Issue:06H

DN0638161

R: 41/396

41

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAqualityofservice(QoS)management

WCDMARANRRMHSDPA

4 HSDPAqualityofservice(QoS)management

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
HSDPAQoSmanagementfunctionalityallowstoprioritizedifferentQoStrafficclass
RABsontheHS-DSCH.TheoptionalQoS Aware HSPA Schedulingfeatureisappliedif
thefollowingconditionsarefulfilled:

HSDPA Dynamic Resource Allocationoptionalfeatureisusedinthecell


(HSDPADynamicResourceAllocationparameterissettoEnabled)

QoS Aware HSPA Schedulingoptionalfeatureactivatedoncelllevelviathe


HSPAQoSEnabledRNPparameter

WhenevertheoptionalQoS Aware HSPA Schedulingfeature(HSPAQoSEnabledRNP


parametersettoEnabled)isused,prioritizingRABsofinteractiveandbackgroundQoS
trafficclassesmappedtoHSDPAtransportchannelsisbasedonthefollowing
parametersreceivedfromthecorenetwork:

Signalingindication

Trafficclass(TC)

Traffichandlingpriority(THP)

Allocationretentionpriority(ARP)

Thelatterthreeparameters(TC,THP,andARP)aremappedaccordingtooperatordefinedrulestotherespectiveprioritizationvalueusedintheRNC.Themappingis
realizedviatheQoSPriorityMappingRNPparameter.WhenevertheHS-DSCHis
affected,therelevantvalueisthensenttotheBTSasschedulingpriorityindicator(SPI)
value.
Additionally,theStreaming QoS for HSPAoptionalfeaturedefineswhetherornot
streamingRABsmaybemappedtotheHS-DSCHandhandledbyHSDPAQoS
management.QoSsupportforPSstreamingRBsmappedtotheHS-DSCHisonly
appliediftheHSPAQoSEnabledRNPparametersettovalue2andtheprerequisitesfor
QoS Aware HSPA Schedulingarefulfilled.
NotethatiftheStreaming QoS for HSPAoptionalfeatureisnotactivatedwithinthecell,
RABswithstreamingQoStrafficclasscannotbemappedtotheHS-DSCHbutcanbe
usedonDCH.
CSvoiceoverHSPAcanbeactivatedwiththeHSPAQoSEnabledparameter.IftheCS
voiceoverHSPAfeatureisnotactivatedtothecell,thenCSvoiceRABsarenotmapped
toHStransportchannel(DCHisused).TheRNPparameterFDPCHSetupECisusedto
indicate,ifpre-emptioncapableCSvoiceRAB,canbemappedtoHSPAchannelsor
not.

42

DN0638161

R: 42/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAqualityofservice(QoS)management

4.1 BasicprinciplesandQoSprioritizationdecision
Basedonthebefore-mentionedRNPparameters'valuesdefinedbytheoperatorandthe
valuesoftheparametersreceivedviaRANAPandRNSAP(TC,THP,ARP),QoS
prioritizationofRABsishandledwiththeQoSPriorityMappingRNPparameter.
WheneverthereceivedTHPorARPvaluesarenotsmallerthanorequaltothree(3),
value3isusedforthemappingwiththerestrictionthatamaximumof16different
prioritiescanbeused.
ThebasicprinciplesappliedforQoS-basedprioritizingofQoSclassesarethefollowing:

PriorityforconversationalservicesmustbelowerthanprioritysetforSRBs,but
higherthanprioritysetforPSstreamingservices.

PrioritydefinedbytheRNPparameterQoSPriorityMappingisusedfortheCS
voiceservicesmappedonlyforHSPAtransportchannels.

PriorityforSRBswithHSUPA/HSDPA(E-DCH/HS-DSCH)transportchannelare
alwaysdefinedbytheRNPparameterQoSPriorityMapping.

PrioritiesforDCHstreaming,interactive,andbackgroundservicesarealwaysread
fromtheQoSPriorityMappingparameters

Priorityofnon-real-time(NRT)RABsmappedtotheHS-DSCHdependsonwhether
ornotQoSprioritizationforNRTservicesisactivatedinthecell:

IfQoSprioritizationforNRTservicesisactivated(HSPAQoSEnabled),theactual
priorityfortheseRABsisreadfromthestructuredQoSPriorityMapping
parameters,definedonRNClevel.

Otherwise,ifQoSprioritizationforNRTservicesisnotactivated,theactual
priorityfortheseRABsisalwaysequaltozero(0).

PriorityofstreamingRABsmappedtoHS-DSCHisreadalwaysfromthe
QoSPriorityMappingparameter.

PriorityofinteractivesignalingRABshastobelargerthanthepriorityusedforany
otherNRTservice.

ThefollowingtableprovidesthedefaultvaluesoftheQoSPriorityMapping
parameters,whichallowtodefinedifferentprioritiesdependingontheQoSclassandthe
RAB'sprioritytype.
Table 1

QoSClass

PriorityType

PriorityValue

SRB

15

CSvoice

14

Streaming

Issue:06H

DefaultvaluesoftheQoSPriorityMappingparameters

ARP1

13

DN0638161

R: 43/396

43

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAqualityofservice(QoS)management

Table 1

WCDMARANRRMHSDPA

DefaultvaluesoftheQoSPriorityMappingparameters(Cont.)

QoSClass

PriorityType

PriorityValue

ARP2

13

ARP3

13

Signaling

12

THP1ARP1

11

THP1ARP2

11

THP1ARP3

11

THP2ARP1

THP2ARP2

THP2ARP3

THP3ARP1

THP3ARP2

THP3ARP3

ARP1

ARP2

ARP3

Interactive

Background

WheneverthemappingofQoSprioritieshasbeenchanged,thesechangesbecome
effectiveforonlythoseRABstowhichDCHorHS-DSCHallocationorreconfigurationis
appliedafterward.AsregardsHS-DSCHs,theassignedpriorityisthendirectlyusedas
SPIvaluewhich,inturn,issenttotheBTS.AnSPIvalueequaltozero(0)istransmitted
whenevertheoptionalQoS Aware HSPA Schedulingfeatureisdeactivated
(HSPAQoSEnabledRNPparametersettoDisabled).Dedicatedchannels(DCHs)have
avalueintherangebetweenzero(0)and15,indicatingthelowestandhighestpriority
values,respectively.
TheSPIvalueforSRBswithHSUPA/HSDPA(E-DCH/HS-DSCH)transportchannelis
readfromQoSPriorityMapping-->PriForSRBsOnHSPARNPparameteralthough
theQoSAwareHSPASchedulingfeatureisnotactive.

44

DN0638161

R: 44/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAqualityofservice(QoS)management

HowthevariousRABparameters(TC,THP,ARP)receivedviaRANAPorRNSAPare
handledduringbranchadditionorrelocation,dependsontheactualscenario:

BranchadditionoverIurinterface
WhenabranchisaddedtothedriftRNC(DRNC/DriftFlexiDirectRNC),theTC,
ARPandframehandlingpriority(FHP)parametersarereceivedviatheIurinterface.
AdmissioncontrolthendefinestheTHP,basedonthereceivedFHPvalue,see
Definition of the NBAP/RNSAP frame handling priorities in SRNCinWCDMA RAN
RRM Admission Control.IfthesourceRNC(SRNC/ServingFlexiDirectRNC);from
adifferentmanufacturerthanNSN)thensendsanFHPvaluewhichishigheror
lowerthantheonedefinedbyadmissioncontrolforPSinteractiveservices,

THPisadjustedtothenearestTHPvalueinthemappingtable.

FHPisnotchangedandremainsasithasbeenreceived.TheRNCthensends
theFHPvaluetotheBTSviaNBAPmessage.

TheRNCusesthemappedTHPvalueaswellasthereceivedTCandARPvaluesto
definetheQoSpriority.Thispriorityisonlyforwardedtotransportnetworklayerwhen
thebranchissetup.Inthisway,thetransportpriorityisasexactasitcanbewiththe
informationavailable.
FHPisnotusedincaseofHS-DSCHandE-DCHMAC-dflowoverIur-interface.
THPisdeterminedbytheDRNC/DriftFlexiDirectRNCwithoutFHPinformation.

UEnotinvolvedrelocation
Inthisscenario,thetargetRNCdefinestheQoSpriorityfromRABparameters(TC,
ARP,THP)receivedinRANAP:RelocationRequestmessage.Whilethecell-specific
packetschedulerbecomesimmediatelyawareofthedefinedQoSpriorityandRAB
parameters,eitherofthemwillonlybeupdatedonthetransportlayereither

WhenthenextchanneltypeswitchbacktoHSPAchannelconfigurationoccurs,
forexample,or

Afterinactivityresourcesareagainneededfordatatransmission.

UEinvolvedrelocation
Intheeventofahardhandover(UEinvolvedrelocation),thetargetRNCdefinesthe
QoSpriorityfromRABparameters(TC,ARP,THP)receivedinRANAP:Relocation
Requestmessage.Inthisway,boththeQoSpriorityandtheRABparametersare
knownwhenradiochannelsareallocatedandsetuponthetransportnetworklayer.
TheARPoftheCSservicedoesnotaffecttheschedulingbecausetheCSservices
shouldbehandledequally.TheARPparametersareonlyusedintheadmission
phaseofthepre-emptionfunctionality.

4.2 PSNRTRABreconfiguration
RABreconfigurationcanberequestedbytheSGSNorbytheUE.TowardtheRAN,the
modificationistriggeredbythecorenetwork,signaledthroughaRANAP:RAB
AssignmentRequestmessage.TheRABidentifier(ID)containedinthismessage
uniquelyidentifiestheRABtobemodified,whereseveralRABIDscanbetransmitted
withinoneRANAP:RABAssignmentRequestmessage.
ForinteractiveandbackgroundtrafficclassRABs,thefollowingRABparameterscan
thusbechanged:

Issue:06H

DN0638161

R: 45/396

45

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAqualityofservice(QoS)management

WCDMARANRRMHSDPA

Trafficclass(TC),frominteractivetobackgroundandvice-versa

Maximumbitrate(MBR)foruplink(UL)anddownlink(DL)

Traffichandlingpriority(THP)ofaninteractiveRAB

Allocationandretentionpriority(ARP)

Ifmodificationofanyparameterotherthantheabove-mentionedRABparametersis
requested,theRNCrespondsviaaRANAP:RABAssignmentResponsemessagewith
causecodesettoInvalid RAB Parameters Combination.
DependingontheUE'scurrentstate,thetypeofrequest(downgradeorupgradeofQoS
parameters),andwhethertheUEisusingDCHorHSPAservice,theRNCindividually
handlestheparticularPSNRTRABreconfigurationrequest.
WhenaparticularUEisinCELL_DCHstate,usingHSPAservice,andmodificationof
QoSparametersisrequested,thenewRABparametersaretakenintouseimmediately.
TheRNCthusmatchestheRAB'sQoSparameterstoaQoSprioritymappingasisdone
fortheQoSPriorityMappingmanagementparameter,seetableTable1:Default
valuesoftheQoSPriorityMappingparameters.
BeforeRABmodificationisactuallystarted,however,theRNCcheckswhetherornotPS
NRTRABreconfigurationissupportedintheBTS,verifyingthe
NodeBRABReconfigSupportparameter.ThischeckisonlynecessaryincaseofHSPA
connectionsbecausetheBTSisresponsibleforHSPAscheduling.Dependingonthe
configuration,theBTSswiththefollowingroleshavetosupportPSNRTRAB
reconfiguration:

DCH/HS-DSCHconfiguration:theRNConlyhastocheckthecapabilityofthe
servingBTS,controllingtheservingcell.

E-DCH/HS-DSCHconfiguration:theRNChastocheckthecapabilityofallBTSs
whichareinvolvedintheE-DCHactiveset.

Ineithercase,ifthequeriedBTSsdonotsupportRABmodification,theupdateofthe
RABparametersisstopped.Otherwise,RNCprioritizestheNRTRBsaccordingtotheir
QoSpriorityvaluesanddefinestheschedulingpriorityindicator(SPI)forHSPA
connections.TheSPIisbasedontheQoSpriorityvalueandthevalueofthe
HSPAQoSEnabledparameter.
Thefollowingcasesthushavetobedistinguished:

RAB'snewmaximumbitrate(MBR)issmallerthanexistingbitrateforHSDPAassociatedULDCH
TheHSDPA-associatedULDCHisdowngradedtoaratethatisbothstillsuitable
andequaltoorlowerthanthenewmaximumbitrateoftheRAB.

Ifnoneofthebitratesareallowedalthoughthereisnocongestionsituation,
channeltypeswitch(CTS)toDCHwithULandDLratesgreaterthan0kbit/s
(DCH>0/>0)isperformed.

Otherwise,ifULbitratescannotbeassignedduetocongestion,theRNCchecks
thesourceofcongestion.

IfcongestionoccurredontheRNC'stransportnetworklayer,channeltypeswitch
(CTS)toDCH>0/>0isperformed.

46

DN0638161

R: 46/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAqualityofservice(QoS)management

Ifcongestionoccurredduetoanyotherreason,CTStoDCH0/0isdone.CTSto
DCH0/0isonlyperformedwhenallotherRABsassignedtotheUEarealsoonDCH
>0/>0.IfatleastoneexistingRABisonDCH0/0,however,theUEwillbeswitched
fromCELL_DCHtoCELL_FACHstate.

QoSparameterchangeincaseofDCH/HS-DSCHconfiguration
Ifthetrafficclass(TC)and/orthetraffichandlingpriority(THP)changeduring
DCH/HS-DSCHconfiguration,anewframehandlingpriority(FHP)aswellasthe
updatedULDCHloadfactorwillbecalculated.Duringthenextschedulingperiod
(radiolinkreconfiguration),theBTSwillalsobeinformedaboutthechangedFHP.

Whetherornotparticularservices,identifiedbytrafficclassandtraffichandlingpriority,
canuseHS-DSCHandE-DCHisdefinedbytheHSDSCHQoSclasses and
EDCHQOSClasses managementparameters,respectively.Asaconsequence,CTSto
DCH/HS-DSCHisperformedifaUEusesHSUPAbutHSUPAisnotsupportedwiththe
modifiedRABparametervalues.Inasimilarway,CTStoDCH>0/>0isexecutedwhena
UEmakesuseofHSDPAorHSUPAbutHSDPAisnolongerallowedafterRAB
reconfiguration,whenthechangedvaluesbecomeeffective.
Formoreinformation,seesectionPS NRT RAB reconfigurationinWCDMA RAN RRM
Admission ControlandsectionPS NRT RAB reconfigurationinWCDMA RAN RRM
Packet Scheduler.

4.3 NominalbitratesforHSDPAnon-real-time(NRT)
services
Thenominalbitrate(NBR)isdefinedasthebitratewhichissetintheRNCforNRTHSDSCHsandsenttotheBTSasguaranteedbitrate(GBR).TheprinciplesofNBRthus
arethefollowing:

NBRscanonlybeusedforNRTtrafficclasses.

NBRsareappliedinonlythosecellsforwhichstreaminginHSDPAtransport
channelsisactivated(HSPAQoSEnabledRNPparametersettoEnabled).
Otherwise,anNBRvalueequaltozero(0)willbeapplied.

ForeachQoSpriorityvalueusedfortherespectiveNRTtrafficclasses,NBRscanbe
definedeitherforbothuplink(UL)anddownlink(DL)directionsorforonlyone
direction.

PrioritieswhichhavebeenassignedNBRshavetoformacontinuousblockwithin
theQoSPriorityMappingparameter,startingwiththehighestpriorityusedfor
NRTservices.Afterthisblock,trafficclassesintheQoSPriorityMapping
parameterhavetobeorderedasfollows:
1. Prioritiesusedbystreamingservices
TheirNBRalwaysequalstozero(0);theirpriorityvalue,however,islargerthan
theonesusedforNRTusershavingdefinedQoS.
2. PrioritiesusedbyNRTusershavingdefinedQoS
TheNBRoftheseusersisspecifiedforatleastonedirection(ULorDLorboth).
3. Prioritiesusedbybesteffort(BE)users,i.e.NRTuserswithoutQoS.
TheirNBRalwaysequalstozero(0).

Issue:06H

DN0638161

R: 47/396

47

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAqualityofservice(QoS)management

WCDMARANRRMHSDPA

IntheRNC,NBRsaremanagedandstoredusingthestructuredHSPANBRValuesRNP
parameter,whichisdefinedonRNClevel.TheHSPANBRValuesparameterallowsto
specifyNBRsforULandDLdirectionsforthoseHS-DSCHswithpriorityvalues
(QoSPriorityMappingparameter)intherangebetweenzero(0)andtwelve(12).
WheneverthedefinedNBRvaluesaremodified,thechangeswillbecomeeffectiveonly
fornewRABs,whilethemappingforexistingRABsremainsunchanged.
WheneveraRAB'smaximumbitrateissmallerthantheNBRdefinedforthisQoSclass
andprioritytype,thismaximumbitratewillbeusedastheRAB'sNBRvalueandonly
theresourcesrequiredforthisbitratearereserved.Otherwise,resourceswouldbe
wasted.
Nominalbitrates(NBRs)forDCHSDPAusersaresetsimilarlyasthosefortheSC
HSDPAusers.

4.4 CelllevelmeasurementsusedbyRTservices
IfHSPARTservicesareactivatedinaparticularcellbysettingtheHSPAQoSEnabled
parameterappropriately,twomeasurementsareinitiated:HS-DSCHprovidedbitrate
measurement(PtxHSProBR)andHS-DSCHrequiredpowermeasurement
(PtxHSRePo).
Foreachschedulingpriorityindicator(SPI),theWBTSmeasuresboththeprovidedbit
rateandthepowerrequiredbytheHS-DSCHandreportsthemeasuredvaluestothe
RNCviatheNBAP:RadioResourceMeasurementReportmessage.Forthepurposeof
higher-layerfiltering,theRNCinformstheWBTSaboutthefiltercoefficienttobeused,
usingtheNBAP:RadioResourceMeasurementInitiationmessage'sMeasurement Filter
Coefficientinformationelement(IE).ThevaluespecifiedinthisIEiscontrolledwiththe
PtxMeasFilterCoeffparameter.
TheRNCfurthermoresendstheNBAP:Radio Resource Measurement Initiation
messagetotheWBTStocontrolthereportingperiodofthecell-levelmeasurements
usedbyRTservices,indicatedbytheRRIndPeriodparameter.TheWBTScan
howeverfilterthemeasuredvaluesobtainedinthePtxHSProBRandPtxHSRePo
measurementswithdefinedlimits.Themaximumnumberofconsecutivefiltered
measurementreportsissettoafixedvalueofnine(9)periods.Ifnonewmeasurement
resultisreceivedfromtheWBTS,theRNCusestheresultpreviouslyreceived.
TheRNCdoesneitheraveragenorestimatetheHS-DSCHprovidedbitrateandHSDSCHrequiredpowerforthefollowingreasons:asmeasurementperiodscanbequite
long,averaginghastorelyonestimatedvalues.Estimation,inturn,ishowevernot
possibleintheRNCbecauseHSPAschedulingisperformedbytheBTSratherthanthe
RNC.

4.5 ApplicationAwareRAN
TheRAN2509: Application Aware RANfeatureintroducesdynamicserviceorapplication
prioritizationforHSDPAscheduling.Prioritizationcanbeperformedbetweenbearers
carryingmultipleservices.ThefeaturehasenablingparametersforIubandIur

48

DN0638161

R: 48/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAqualityofservice(QoS)management

interfaces.WhentheoperatorenablestheIurinterfaceusage,allBTSsunderNSN
DRNCareconsideredforsupportofthisfeature.Thisfeaturealsointroducesdynamic
demotionofULbulktrafficbytheBTSinasingleRABcase.
CorenetworkbasedDeepPacketInspection(DPI)providesapplicationdetectionby
markinginner(user)IPpacketwithDSCPcodepoints.InitialSchedulingPriority
Indication(SPI)oftheradiobearerisdemotedorpromotedintheRNCPDCPlayer
accordingtoDPImarking(alsoknownasDSCPmarking).Thefastreactiontimeis
enabledbytransferringpriorityinformationfromtheRNCtotheBTSschedulerviauser
planebymeansoftheCommonChannelPriorityIndication(CmCH-PI)intheFrame
Protocol.
Anexampleofasetofapplicationsthattheoperatormightbeinterestedto
promote/demoteisintroducedinthefollowingtable.
Table 2

Exampleofasetofapplications

Application
GroupID

ApplicationGroupscontent

SPIchange

Precedence
value

Comment

WEBbrowsing(http)

promotion

Fastplayout
buffer

VideooverTCP
VideooverUDP(RTP,RTSP)
2

InternetAudio/Video(VoIP)

promotion

Bidirectionalinteractive

FTPdownload

demote

Nottimecritical

P2P

demote

Longlastingsessions

othertraffic(UDP,TCP)

initial

Unclassifiedtraffic

AsetofapplicationsrequiringthesametreatmentatRANcanbegroupedbythe
operatorintoApplicationGroups.Hence,oneApplicationGroupmaycontainIPpackets
markedwithdifferentDSCPfieldcodes.ItisassumedthatoneApplicationGroupmight
notcontainmorethanfiveuniqueapplicationsrequiringsimilartreatment.Precedence
valuedictateswhatSPIshouldbechosenwhenpacketsbelongingtomultiple
applicationgroupsaredetectedbytheRNC.Thelowestvalueofprecedencemeansthe
highestpriorityduringruleevaluation.
TheoperatorcanconfigurethepromotionoftheinitialSPI,demotionoftheinitialSPI,or
nottochangetheinitialSPIactionsforacertaintypeofdata.Table3:Configurationof
theinitialSPIdescribeshowthepromote/demote/donothingactionscouldbeconfigured
sothatthepromotionwouldalwaysaffectlatencysensitivedata,andthedemotewould
onlyaffectnon-latencysensitivedata.Notethatdependingonhowtheoperatorhas

Issue:06H

DN0638161

R: 49/396

49

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAqualityofservice(QoS)management

WCDMARANRRMHSDPA

mappedtheapplicationsintoApplicationGroups,someoflatencysensitivedatamight
bemappedtodemoteortotheinitialSPIcategory.ThosearetheblankfieldsinTable3:
ConfigurationoftheinitialSPI.
Table 3

ConfigurationoftheinitialSPI

Non-Latencysensitiveda- InitialSPIdata
ta

Latencysensitivedata

Non-Latencysensitiveda- demote
ta

initial

promote

InitialSPIdata

initial

promote

Latencysensitivedata

promote

4.5.1 Inter-operabilitywithotherfeatures
QosAwareScheduling
IftheRAN1262: QoS Aware Schedulingfeatureisenabled,theinitialSPIforNRTHSPA
RABisdefinedbasedontheTC/THP/ARPcombinationviatheRNPSQosPriorityMappingparameter.InitialSPIiscommunicatedtotheBTSviatheL3
proceduresandtotheRNConthePDCPlayer.TheRAN2509: Application Aware RAN
featuredeterminesthedynamicSPIbasedontheapplicationtypeandinitialSPIvalue.
ThenewSPIisthencommunicatedtotheBTSusingCmCH-PIfieldinFrameProtocol.
ForRT-over-NRTandNRT-over-NRT,thecandidateselectionproceduresinRNCare
basedontheonQosPriorityMappingparametervalue.
WhentheRAN1262: QoS Aware SchedulingfeatureisdisabledandRAN2509:
Application Aware RANisenabled,theoperatorcanconfiguretheinitialSPIwiththe
parameter(RNHSPA-InitialSPINRT).InitialSPIiscommunicatedtotheBTS/UEvia
L3proceduresandtotheRNConthePDCPlayer.Then,thePDCPlayerdeterminesthe
targetSPIbasedontheapplicationtypeandtheInitialSPI.ThenewdynamicSPIis
communicatedtotheBTSusingcm-CHPIfieldviatheRNCFrameProtocol.ForRTover-NRTandNRT-over-NRT,thecandidateselectionproceduresinRNCarebasedon
theonQosPriorityMappingparametervalue.
Whenbothfeaturesareenabledsimultaneouslyinthecell,theinitialSPIforNRTHSPA
RABisdefinedaccordingtoRAN1262: QoS Aware Schedulingprinciples,thatisbased
ontheTC/THP/ARPcombinationviaRNPS-QosPriorityMappingparameter.
RNHSPA-InitialSPINRTvalueisnotused.

StreamingQosforHSPA
IftheRAN1004: Streaming Qos for HSPAfeatureisenabled,theNBRisapplicablefor
HSPAPSNRTRABs.TheNBRvaluesaredefinedperSPIandarecommunicatedtothe
BTSduringtheHSPAresourceallocationphaseviaGBRIE.WhentheSPIis
dynamicallymodifiedbytheRNCPDCPlayer,thenewNBRvaluecorrespondingtothe
newSPIisnotcommunicatedtotheBTS.TheBTScontinuesusingtheoldNBRvalue.
Also,theRNC(viaO&MconsistencychecksforRNHSPAAARConfigTable-TargetSPIforSPIxxparameters)ensuresthattheSPI

50

DN0638161

R: 50/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAqualityofservice(QoS)management

promotion/demotionforNBRusersisperformedwithintheSPIrangedefinedforNBR
users.FornonNBRusers,theSPIpromotion/demotionisperformedwithintheSPI
rangedefinedfornonNBRusers.

HSPAoverIur
IftheRAN1231: HSPA over Iurfeatureisenabled,thentheHS-DSCHandtheE-DCH
Mac-dflowscanbesetupoverIur.TheRAN2509: Application Aware RANfeaturecan
beactivated/deactivatedoverIurtowardsacorrespondingDRNCviaIURAppAwareRANEnabledparameter.IftheRAN2509: Application Aware RANfeatureis
activatedoverIur,thenSRNCcommunicatesthedynamicSPIvaluesusingCmCH-PI
fieldoverIurintheHS-DSCHFPframe.However,therearedifferentscenarioswhere
othervendorsRNCisinvolvedandthebehavioroftheothervendorsRNCisnot
known:

NSN-NSN
HS-DSCHFPframeonIurcarriesCmCH-PIiftheRAN2509: Application Aware RAN
featureisenabledontheSRNCandsupportedbythecorrespondingDRNC.The
NSNBTShandlesIurandIubMAC-dflowsinthesameway.Thereisnoadditional
requirementattheBTStohandleIurflowswithupdatedCmCH-PI.

NSN-other
TheNSNSRNCdoesnotknowiftheDRNCisNSNDRNCorothervendorsDRNC.
Hence,anIurlevelparameterisintroducedtoindicateifthecorrespondingDRNC
supportsdynamicSPImodification.Thefeatureisappliedtowardstheothervendors
DRNConlyiftheIurlevelfeatureactivationparameterindicatesthesame.

Other-NSN
TheNSNDRNCdoesnotknowiftheSRNCisNSNSRNCorothervendorsSRNC.
TheNSNDRNCtransparentlyforwardsthedynamicCmCH-PIvaluereceivedinthe
HS-DSCHFPframetotheBTS.

IftheNSNRNCistheDRNC,itmightnotchangetheCmCH-PIvalueintheFP,because
itdoesnotcheckthecontent,butonlyperformsFPrelaying.IftheDRNCandBTSare
fromanothervendor,itcannotbeensuredthattheBTSusesthedynamicSPIinsteadof
theSPIexchangedduringRABestablishment.Hence,formulti-vendorcase,thefeature
hasanundefinedoperation.

ExtensionofHSPAoverIur
IftheRAN2270: Extension of HSPA over Iurfeatureisenabled,thentheHS-DSCHand
theE-DCHMAC-dflowscanbesetupoverIurduringtheanchoringprocess,thatis,
whenalltheactivesetcellsareundertheDRNC.Intheanchoringprocessthe
RAN2509: Application Aware RANfeaturefollowsthesameprinciplesasdefinedin
HSPAoverIursection.

Dual-cellHSDPAandDualBandHSDPA
TheRAN2509: Application Aware RANfeaturemustbeenabledinbothcellsofDCHSDPAorDB-HSDPAcellpair(viaWCEL-AppAwareRANEnabledparameter)ifithas
tobeactivatedtogetherwithDual-cellHSDPAorDualBandHSDPA.Thischeckis
performedbytheRRMandtheresultiscommunicatedtotheL3.

Issue:06H

DN0638161

R: 51/396

51

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAqualityofservice(QoS)management

WCDMARANRRMHSDPA

IftheRAN2509: Application Aware RAN(AAR)featurewithSC-HSDPAiscurrently


activeintheUEandthereisaneedtoswitchtoDC-HSDPAorDB-HSDPA,thenthe
RRMchecksifAARcanbeactivetogetherwithDC-HSDPAorDB-HSDPA.TheRRM
informsL3todeactivateRAN2509: Application Aware RANfeatureforthecorresponding
UEbeforeswitchingtoDC-HSDPAorDB-HSDPAwhentheWCELAppAwareRANEnabledparameterisnotsettoEnabledforbothprimaryandthe
secondaryservingcell.
WhenthereisaneedtoswitchfromDC-HSDPAorDB-HSDPAwithoutAARtoSCHSDPA,theRRMchecksiftheAARfeaturecanbeenabledinthenewservingcell.If
possible,theRRMrequeststheAARfeatureactivationalongwithswitchtoSC-HSDPA
fromL3.

52

DN0638161

R: 52/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

MaximumnumberofHSDPAusers

5 MaximumnumberofHSDPAusers

g
g

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
NotethatlicenseinformationisrelevantonlytotheIPA-RNCsolution.
ThemaximumnumberofHSDPAusersaredefinedinRNCwiththefollowing
parameters:

MaximumallowednumberofHS-DSCHMAC-dflowsinthecell,whichisdefinedby
theMaxNumberHSDSCHMACdFlowsRNWparameter.
EachHS-DSCHMAC-dflowofeverysingleHSDPAuseriscountedwhenthetotal
numberofHS-DSCHMAC-dflowsinthecelliscalculated.HS-DSCHMAC-dflowof
thecertainSCHSDPAuseriscountedonlyinitsactualcell.Ifthevalueofthe
MaxNumberHSDSCHMACdFlowsparameterischanged,thenewvalueis
immediatelytakenintouse.ExistingHS-DSCHMAC-dflowsarenotreleasedifthe
newvalueislowerthantheprevailingnumberofHS-DSCHMAC-dflows.Thesetup
ofanewHS-DSCHMAC-dflowisallowedonlyifthemaximumnumberofHS-DSCH
MAC-dflowsisnotexceededanymore.

MaximumallowednumberofHSDPAusersinthecell,whichisdefinedbythe
MaxNumberHSDPAUsersRNWparameter.
AnHSDPAuserthusisauserhavingoneormoreHS-DSCHMAC-dflows
established.CertainSCHSDPAuseriscountedonlyinitsactualcell.TheRNCdoes
notexceedthismaximumnumber.Instead,admissionofadditionalHSDPAusersis
inhibitedinthecellifthemaximumnumberistobeexceeded.Ifthevalueofthe
MaxNumberHSDPAUsersparameterischanged,thenewvaluebecomes
immediatelyeffective.ExistingHSDPAusersarenotreleasedifthenewvalueis
lowerthantheprevailingnumberofHSDPAusers.NewHSDPAusersarehowever
onlyadmittedifthemaximumnumberofHSDPAusersisnotexceededanymore.

IfthemaximumnumberofHS-DSCHallocationsisreached,thenewHS-DSCH
allocationsarenotalloweduntilthenumberoftheHS_DSCHallocationsisbelowthe
maximum.Pre-emption,RT-over-RT,and/orRT-over-NRTactionsarepossibleandthe
existingHS-DSCHallocationscanbereleasedtoallownewHS-DSCHallocation.
WhenbasicHSDPAsupportisenabled(HSDPAenabledparameter),theRNClimitsthe
maximumnumberofHSDPApercelltoavalueof16users.
ThemaximumnumberofHSDPAuserspercellcanbefurtherincreasedwhenavalid
licenseforoneofthefollowingoptionalfeaturesisavailableandtherespectivefeatureis
activated:

Issue:06H

HSDPA 48 Users per Cell(HSDPA48UsersEnabledparameter)

HSDPA 64 Users per Cell(HSDPA64UsersEnabledparameter)

HSPA 72 Users per Cell(HSPA72UsersPerCellparameter)

HSPA 128Users per Cell(HSPA128UsersPerCellparameter)

DN0638161

R: 53/396

53

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

MaximumnumberofHSDPAusers

WCDMARANRRMHSDPA

TheRNClimitsthenumberofHSDPAusers,basedoninformationprovidedbytheBTS
(theBTScapabilitylimits):

maximumHSDPAusernumberpercell

maximumHS-DSCHMAC-dflownumberpercell

maximumHSDPAusernumberperMAC-hs/ehsscheduler

maximumHS-DSCHMAC-dflownumberperMAC-hs/ehsscheduler

maximumHSDPAuseramountperLCG

maximumHSDPAuseramountperBTS

TheLCGandBTS-specificHSDPAuseramountcheckfunctionalitycanbedeactivated
bythePRFILE:002:2107 RU40_MAINT_11parameter.TheLCGandBTS-specific
checkisactivebydefault(theparametervalueis0).Todisablethefunctionality,setthe
parameterto1.

NotethattheLCGandBTSspecificuseramountchecksarenotdone,when
theBTSreturnedvalue0formaximumHSDPAuseramountfortheLCGorfor
theBTS.
HSDPApreventionfunctionoftheRAN2954: Voice call prioritization during high traffic
loadmightlimittheHS-DSCHallocations.Formoredetails,seeHSDPAprevention
becauseofVoicecallprioritizationduringhightrafficloadchapter.
IubandBTSbasebanddimensioningrequiresthatalsothe16 kbit/s Return Channel
DCH Data Rate SupportfeatureisinuseforHSDPA.

DCHSDPA
HS-DSCHMAC-dflowofthecertainDCHSDPAuseriscountedonlyintheprimarycell
andisnotcountedinthesecondarycell.
Inadditiontothecell-specificuserlimitation,scheduler-specificpacketschedulerlimits
themaximumnumberofSCHSDPAandDCHSDPAusersintheMAC-hs/ehs-specific
BTSscheduler.CertainSCHSDPAandcertainDCHSDPAusersarecountedonceper
scheduler.TheMaxNumbHSDPAUsersSRNWparameterisusedfordefiningthe
maximumallowednumberofSCHSDPAandDCHSDPAusersinthescheduler.
Inadditiontothecell-specificHS-DSCHMAC-dflowlimitation,scheduler-specificpacket
schedulerlimitsthemaximumnumberofHS-DSCHMAC-dflowsofSCHSDPAandDC
HSDPAusersintheMAC-hs/ehs-specificBTSscheduler.HS-DSCHMAC-dflowofthe
certainSCHSDPAandDCHSDPAuseriscountedonceperscheduler.The
MaxNumbHSDSCHMACdFSRNWparameterisusedfordefiningthemaximumallowed
numberofHS-DSCHMAC-dflowsofSCHSDPAandDCHSDPAusersinthescheduler.
TheMaxNumbHSDPAUsersSandMaxNumbHSDSCHMACdFSRNWparametersare
definedpercell.Becausetheschedulerconsistsofseveralcells,thelowestparameter
valuesofthecellsformingtheschedulerareused.
CheckingsrelatedtotheMaxNumbHSDPAUsersSandMaxNumbHSDSCHMACdFSRNW
parametersaredoneonlywhentheDCHSDPAisenabledinatleastonecellpairinthe
MAC-hs/ehs-specificBTSscheduler.

54

DN0638161

R: 54/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

6 Cell-specificresourcehandling

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
ThisfunctioncontrolstheallocationofHS-PDSCH/HS-SCCHcodesandallocationof
downlinkpowerresourceswhenHSDPAisusedinthecell.
TheRNCappliestwomethodstohandletheHS-PDSCHcodesandpowerresourcesfor
HSDPA:

HSDPA Dynamic Resource Allocation(optionalfeature)(seeHSDPAdynamic


resourceallocation)

HSDPA Resource Allocation(basicfeature)(seeHSDPAstaticresourceallocation)

TheFlexiDirectRNCsupportsHSDPADynamicResourceAllocationonly.

TheHSDPAdynamicresourceallocationisactivatedwiththe
HSDPADynamicResourceAllocationparameter.CelllockingforHSDPAcellsis
neededtoactivatethechangedvalueofthemanagementparameter.
BasedontheHSDPADynamicResourceAllocationmanagementparameterand
capabilityoftheBTS,theRNCdecideswhethertoapplystaticordynamicresource
allocationalgorithmfordownlinkpowerresourcesandHS-PDSCHcodes.Inthecaseof
dynamicresourceallocation,theRNCdoesnotallocateHSDPApower(BTSbased
powerallocation)butonlydefinestheupperlimitforHSDPApowerandcanallocateup
to15HS-PDSCHcodesdependingontheprevailingloadinthecellandthemaximum
numberofHS-PDSCHcodes.Inthecaseofstaticresourceallocation,theRNC
allocates5HS-PDSCHcodes.IftheWBTSdoesnotsenditscapabilityinformation,the
RNCappliesstaticresourceallocation.

Basicprincipleofpowerallocation
ThebasicprincipleisthattheBTSdynamicallycontrolstheamountofDLpowerusedfor
HSDPA.AllthepoweravailableafterDCHtraffic,HSUPAcontrolchannelsandcommon
channelscanbeusedforHSDPA.Consequently,thepowerresourcesofthecellcanbe
utilizedefficientlyforHSDPA.Theoperatorcanhoweverdefinetheupperlimitfor
HSDPApowerbyusingtheWCEL-parameterPtxMaxHSDPA(MaximumallowedHSDPA
power).ThismaximumamountofDLpowerusedforHSDPAissignaledduringthe
NBAP:PhysicalSharedChannelReconfigurationprocedure,whentheRNCsendsthe
HS-PDSCH, HS-SCCH, E-AGCH, E-RGCH and E-HICH Total PowerIEoftheNBAP:
PHYSICALSHAREDCHANNELRECONFIGURATIONREQUESTmessage(TS
25.433)totheBTS.TheNBAP:PhysicalSharedChannelReconfigurationprocedureis
executedaftersuccessfulsetupofcellsinwhichHSDPAissupportedandenabled
(HSDPAenabledparameter).

Issue:06H

DN0638161

R: 55/396

55

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

6.1 CodeallocationofHS-SCCHphysicalchannels
TheRNCallocates04HS-SCCH(SF=128)codestothecell.Morethan1(to4)code
canbeusedifHSDPAcodemultiplexingfeatureisinuse.Allocationprinciplesare
describedinthefollowingpicture:
Figure 10

HS-SCCHallocationlogic

HSDPAenabledandMaxNbrOfHSSCCHCodesarecelllevelRNPparameters.
TheWCDMABTS(WBTS)informstheRNCaboutitsHSDPAcapabilityanditssupport
forcodemultiplexingviatherespectiveinformationelements(IEs)oftheNBAP:
CapabilityIndicationmessage.TheNB/RSxxx,however,doesnotindicateitscapability
viathismessage.
ForinformationonhowtheRNCandtheBTShandlestheHS-SCCHcodes,see
chapterDynamicallocationofHS-PDSCHcodes.

56

DN0638161

R: 56/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

Cell-specificPSreservesHS-SCCHcodesfromthespreadingcodetreeaccordingtothe
MaxNbrOfHSSCCHCodesRNW-parameterifHSDPAisenabledinthecell.Cell-specific
PSdoesnotchecktheBTScapabilitywhenitmakesthispre-reservationfromcodetree.
TheBTScapabilityischeckedbeforeHS-SCCHcodesaresignaledtotheBTSwiththe
PhysicalSharedChannelReconfigurationprocedure.

6.2 HSDPAcodemultiplexing

NotethatlicenseinformationisrelevantonlytotheIPA-RNCsolution.
TheHSDPA Code Multiplexingoptionalfeatureallowssimultaneouslyserving(a
maximumof)fourHSDPAuserswithinoneparticularcellduringasingletransmission
timeinterval(TTI).EachmultiplexedHSDPAuserneedsaseparate(own)HS-SCCH
code(seeCodeallocationofHS-SCCHphysicalchannels).
HSDPA Code MultiplexingisactivatedintheRNCbysettingthe
MaxNbrOfHSSCCHCodescell-levelRNPparametertoavaluelargerthan1.Notethat
changingthisparameterrequirescelllocking.
HSDPAcodemultiplexingrequiresHSDPA15Codesfeature(licenseforeither10or15
HS-PDSCHcodes)intheRNC.ActualcodemultiplexingandHS-PDSCHcode
allocationisperformedbytheBTS.

6.3 HSDPAdynamicresourceallocation

NotethatlicenseinformationisrelevantonlytotheIPA-RNCsolution.
TheRNCappliesHSDPAdynamicresourceallocationifthe
HSDPADynamicResourceAllocationmanagementparameterissettoEnabledand
theRNCreceivescapabilityindicationfromtheWBTS(NodeB)withregardtodynamic
resourceallocation.AsregardstheNB/RSxxx,theRNCassumesthatthisBTStype
supportsHSDPAdynamicresourceallocation.Thisfeaturecontrolsdynamicallythe
allocationofHS-PDSCHcodesanddownlinkpowerresourcesthatcanbeusedfor
HSDPAandRel99channels.Itcomprisesthefollowingfunctionalities:

DynamicNRTDCHscheduling(RNC)

Dynamicpowerallocation(BTS)

DynamicallocationofHS-PDSCHcodes

TheRNCschedulesNRTDCHbitrates.EventhoughtheRNCdoesnotdirectlyguide
theBTSinHSDPApowerallocation,theRNCaffectsthisimplicitlybydecisionofNRT
DCHbitrates.ThehigherbitratestheRNCallocatestoNRTDCHs,thelesspowerthe
BTScanuseforHSDPA,andviceversa.

Issue:06H

DN0638161

R: 57/396

57

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

ToavoidsituationswhereunfairdistributionofpoweriscreatedbetweenHSDPAand
NRTDCHusers,theRNCtakesintoaccountboththecurrentnumberofNRTDCH
usersandHSDPAuserswhenallocatingNRTDCHbitrates.Theoperatorisableto
defineandadjustwhethertheRNCfavorsHSDPAusersorNRTDCHusers,intermsof
availableDLtransmissionpower.UserswithhigherTrafficClass(TC)orTrafficHandling
Priority(THP)orAllocationandRetentionPriority(ARP)canbeconsideredmore
importantwhendecidingthedivisionbetweenpowerforNRTDCHandHSDPAtraffic
types.PowerisaimedtobespentinrelationP1:P2,whereP1representsthetargetDL
transmissionpowerperuseravailableforNRTDCHandP2correspondinglythetarget
DLtransmissionpowerperuseravailableforHSDPA.
DynamicallocationofHS-PDSCHcodesrequirestheoptionalfeature:HSDPA 15
Codes.TheRNCdynamicallyadjuststheHS-PDSCHcodesfrom5tomaximumnumber
accordingtotheinstantaneoustrafficmixinthecell(DCHload).Operatorcandefinethe
setofallowedHS-PDSCHcodes.
HSDPA 15 CodesfeatureincreasesthemaximumnumberofHS-PDSCHcodesupto10
or15andsupportsallocationofanynumberofHS-PDSCHcodesfrom5to10or5to
15.Peaktotalcellthroughputincreasesupto7.2Mbpsor10.8Mbps.Themaximum
valuesdependontheexistingcapacitylicensesoftheHSDPA 15 Codesfeature.HSDPA
15 CodesfeaturerequiresHSDPA Dynamic Resource Allocationfeature.
Dynamicadjustmentofthecellresourcesgivesgainincellthroughputasallthe
availablepowercanbeutilizedeffectivelyatalltimes.Typically,asignificantpower
controlheadroomneedstobeleftforfastpowercontrolofRel'99channels(DCH).
DynamicHSDPApowerallocationtakesadvantageoftheDCHpowercontrolheadroom.
OperatorcontrolonresourcedivisionbetweenNRTDCHandHSDPAallowsflexible
supportofdifferentpricingstrategiesforDCHandHSDPA.
HSDPA 15 Codesfeatureallowshigherpeakdataratesaswellaslargercapacity.The
averagecellthroughputincreasessignificantlybothinmacroandmicrocellenvironment
comparedtohavingonly5HS-PDSCHcodes.Thethroughputgainissignificantlyhigher
ifthewholefrequencyisdedicatedtoHSDPA,becausethecellthroughputbecomes
codelimitedwhenthereareonly5HS-PDSCHcodesavailableforHSDPA,andDCH
trafficisnottheretousetheremainingcodes.

6.3.1 Dynamicpowerallocation
TheamountofDLtransmissionpowerusedforHSDPAisdynamicallycontrolledbythe
BTSanddefinedasthepoweravailableafterDCHtraffic,HSUPAcontrolchannelsand
commonchannelshavebeensetup.Asaconsequence,theRNCdoesnotallocateHSSCCHorHS-PDSCHdownlinktransmissionpowertoHSDPAusers.Themaximum
amountofHSDPAdownlinktransmissionpowermayhoweverbespecifiedbythe
operator.Formoredetails,refertoBasicprincipleofpowerallocation.
Whenallocatingdownlinktransmissionpowerofacell,aprioritizationisapplied,thus
beingabletocontroltheloadusedbystreamingservicesandCSvoice.Thepoweris
allocatedinthefollowingorder:

58

DN0638161

R: 58/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

1. Circuit-switched(CS)dedicatedchannels(DCHs),CSHSDPAsandcommon
channels(non-controllableload)
ThesechannelsusealltheneededfreepoweruptoPtxTargetorPtxTargetTot.
2. Packet-switched(PS)streamingonDCHandHSDPA(semi-controllableload)
Theyusealltherequiredfreepowerleftafterthenon-controllableloadhasbeen
allocated.However,thetotalamountofpowerusedbyconversationalDCHsand
streamingDCHshastobelessthanPtxTarget.
3. InteractiveandbackgroundDCHs(controllableload)
IfatleastoneMAC-dflowisavailableinthecell,interactiveandbackgroundDCHs
useallavailablepoweruptothedynamicPtxTargetPS.Otherwise,theymakeuseof
thefreepoweruptoPtxTarget.
4. InteractiveandbackgroundonHSDPA(controllableload)
Thesechannelsusealltheremainingpower.
TheprincipleoftheBTSbaseddynamicpowerallocationalgorithmisillustratedinthe
followingfigure:
Figure 11

DLpowerallocation

PtxTargetTotisdynamictargetpowerfornon-controllableloadofthecell.
PtxTargetTotMaxandPtxTargetTotMinarethemaximumandminimumvaluefor
thedynamictarget(RNPparameters). PtxTargetisstatictargetpowerfornoncontrollableDLDCHpower(RNPparameter).PtxHSDPA_streamispowerusedbyHSDPA

Issue:06H

DN0638161

R: 59/396

59

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

streaming.PtxNCHSDPAispowerusedbyHSDPAconversationalservices.PtxCDCHis
powerusedbyDCHPSservices.PtxNCDCHispowerusedbyDCHservicesassociated
withnon-controllableload.
PtxTargetTotisusedasapowertargetfornon-controllableloadwhenthereareservices
associatedasnon-controllableloadmappedtoHSDPA(forexampleinconversational
services).Iftherearenosuchservices,thenPtxTargetisused.
PtxTargetTotiscalculatedinthefollowingway:
Figure 12

PtxTargetTot

PtxNCDCHiscalculatedbysubtractingthepowerusedbytheDCHNRTservicesfrom
thePtxnonHSPA.PtxNonHSPAcanbeeithertheaveragedestimatedortheaveraged
measuredpowerquantity.Theselectionbetweenthemisperformedasdescribedinthe
WCDMA RAN RRM Admission Control.
PtxTargetTotmustalsoalwaysfulfillthefollowingcondition:
Figure 13

PtxTargetTotcondition

Iftheconditionisnotfulfilled,thenthevaluesettingthelimitisusedasPtxTargetTot.
PtxTargetTotMinand/orPtxTargetTotMaxcanbegivenaspecialvaluewhich
indicatestheuseofPtxTargetparametervalue.Theuseofthespecialvaluefor
PtxTargetTotMaxmeansinpracticethatthedynamicDLtargetpowerfunctionalityis
disabled.
PtxTargetTotiscalculatedeverytimewhenservicebelongingtonon-controllableload
isbeingadmitted.
TheoperatorcanaffecttoPtxTargetTotbysettingtheminimumandthemaximumvalue
foritbyRNPparametersPtxTargetTotMinandPtxTargetTotMax.These
parametershavethefollowingcharacteristics:

60

PtxTargetTotMin<=PtxTargetTotMax

PtxTarget<=PtxTargetTotMin

PtxTargetTotMax<=PMax

DN0638161

R: 60/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

PtxTargetisconfiguredasinpreviousreleases.Valuesoftheseparameterscanbe
changedonline,butthenewvalueshaveeffectonlytonewserviceswhenACisbeing
madeforthem.
HSDPAnon-controllableload(PtxNCHSDPA)iscalculatedsamewayas
PtxHSDPA_stream(withHS-DSCHrequiredpowermeasurement),butonlythepowerof
SPIsthatareusedbyservicesbelongingtonon-controllableload(excludingSRBs)are
takenintoaccount.Alsotheservice-specificactivityfactoristakenintoaccountthatisfor
voiceservicescalculatedasdescribedinWCDMA RAN RRM HSUPA(ortakenfromthe
RNPparameterRRMULDCHActivityFactorCSAMR,ifcalculatedvalueisnot
available).CalculationismadeeverytimeameasurementisreadforanSPIvalueused
fornon-controllableloadandthelatestcalculatedvalueisusedinothercalculations
(PtxNCHSDPAisnotaveraged).

6.3.2 DynamicNRTDCHscheduling
TheRNCaffectstheHSDPApowerallocationindirectlybyschedulingNRTDCHbit
rates.ThehigherbitratestheRNC/FlexiDirectRNCallocatestotheNRTDCHs,the
lesspowertheBTScanuseforHSDPA,andviceversa.BTSbaseddynamicpower
allocationisrealizedintheRNCbydynamicadjustmentofthetargetthresholdforNRT
DCHpacketscheduling(namedPtxTargetPS).
TheRNCappliesdynamicNRTDCHschedulingifthe
HSDPADynamicResourceAllocationmanagementparameterissettoEnabledand
RNCreceivescapabilityindicationfromtheBTSwithregardstodynamicresource
allocation.
WhenthereisatleastoneHS-DSCHMAC-dflowallocatedinthecell,PtxTargetPSis
usedforpacketscheduling.PtxTargetPSisadjustedbetweenPtxTargetPSMinand
PtxTargetPSMax,whicharemanagementparameters.PtxTargetPSMaxmustbe
lowerthanorequaltotheexistingschedulingtargetPtxTarget.IfPtxTargetPSMaxand
PtxTargetPSMinaresettothesamevalue,theRNCdoesnotadjustPtxTargetPS.
PtxTargetPSAdjustPeriodmanagementparameterdefinestheadjustmentperiod
forthePtxTargetPSintermsofRadioResourceIndication(RRI)reportingperiods.
ThevalueofthePtxTargetPSMaxistakenasaninitialvalueforthePtxTargetPS.The
initialvalueistakenintousewhenthefirstHS-DSCHMAC-dflowforPSserviceisset
upinthecell.TheinitialvalueisalsousedwhenthelastNRTdownlinkDCHisreleased
inthecelloratleastbeforethefirstNRTdownlinkDCHisscheduledinthecell.Usage
ofthePtxTargetPSendswhenthelastHS-DSCHMAC-dflowforPSserviceisdeletedin
thecell.
PtxTargetremainsasatargetfornon-controllableloadevenifthereisoneormoreHSDSCHMAC-dflowssetupinthecell.IfthereareconversationalservicesmappedtoHSDSCH,thentargetfornon-controllableloadisPtxTargetTot.PtxTargetPSisadjusted
basedonthelastreceivedPtxTotal(TransmittedCarrierPower)andPtxNonHSPA
(TransmittedcarrierpowerofallcodesnotusedforHS-PDSCH,HS-SCCH,E-AGCH,ERGCHorE-HICHtransmission)measurementreports.

Issue:06H

DN0638161

R: 61/396

61

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

Figure 14

WCDMARANRRMHSDPA

DynamicNRTDCHscheduling

AdjustingPtxTargetPS
PtxTargetPS(targetthresholdforNRTDCHpacketscheduling)isadjustedonlywhen
thereareNRTDCHusers-inadditiontotheHS-DSCHMAC-dflow(s)-inthecell.
AdjustmentofthePtxTargetPSisdoneinfixedsteps,definedbythemanagement
parametersPtxTargetPSStepUPandPtxTargetPSStepDown.
WhentheHS-RACHhasbeensetupinthecell,adynamicallyadjustedtargetthreshold
PtxTargetPSisusedforDCHpacketschedulingandhandovercontrolpurposesinstead
ofPtxTarget.
PtxTargetPSisadjustedbetweenPtxTargetPSMinandPtxTargetPSMaxHSRACH
whentheHS-RACHhasbeensetupinthecell.
IfthePtxTargetPSMaxHSRACHRNPplanningparametervalueissettoequalwiththe
specialvalue(32767),thenPtxTargetPSMaxHSRACHparametervalueisreplacedwith
avaluesetbyPtxTargetPSMaxRNPparameter.
WhentheHS-RACHhasbeensetupinthecell,theinitialvalueofthePtxTargetPSis
equaltothevalueofthePtxTargetPSMaxHSRACHparameter.Thefollowingscenarios
areconsidered:

InitialvalueisputtousewhentheHS-RACHhasbeensetupinthecell.

InitialvalueisputtousealsowhenthelastNRTDLDCHisreleasedinthecell.

IfPtxTargetPSMaxHSRACHandPtxTargetPSMinaresettoanequalvalue,the
RNCdoesnotadjustthePtxTargetPS,butitisusedasthetargetvalueintheDL
NRTDCHresourceallocation.

PtxTargetPSisusedalwayswhentheHS-RACHhasbeensetupinthecell
(althoughthereisnoHS-DSCHuseronCELL_FACH(HS-RACHuser)and
CELL_DCH(HSDPAuser)states).

ThefirststepistochecktheneedforadjustmentofthePtxTargetPS.Adjustmentis
executedonlyifpowercongestionforDLtransportchanneltype(HS-DSCH/NRTDCH)
isdetectedbytheRNC.ThedefinitionofthepowercongestionforDLtransportchannel
typeinthiscontextisdefinedasfollows:

62

DN0638161

R: 62/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

PowercongestionforDLHS-DSCHtransportchanneltypeisdetectedwhenthe
followingconditioniseffective:

PtxTotal PtxHighHSDPAPwr
PtxHighHSDPAPwrisamanagementparameter.

Inpractice,theconditionmeansthatifalltheDLtransmissionpowerupto
PtxHighHSDPAPwrlevelisusedbytheBTS,theRNCconsiderscongestionfor
HSDPA,becausethereisnomorefreeDLtransmissionpowerresourcesavailable
forHSDPAintheBTS.

PowercongestionforDLDCHtransportchanneltypeisdetectedwhenthefollowing
conditioniseffective:

PtxNonHSPA (PtxTargetPS Offset)


Fixedvalue1dBusedforOffset.

Inpractice,theconditionmeansthatifalltheDLtransmissionpoweruptotarget
thresholdforNRTDCHpacketscheduling(deductedwiththefixed1dBoffset)is
used,RNCconsiderscongestionforNRTDCH,becausethereisnomorefreeDL
transmissionpowerresourcesavailableforNRTDCHscheduling.
Thesecondstepistocalculatetarget(ideal)valueforthePtxTargetPS,whichis
calculatedforeachadjustmentperioddefinedbythemanagementparameter
PtxTargetPSAdjustPeriod.TheconditionswhetherornottoadjustPtxTargetPSare
checkedeveryschedulingperiod,thatiswhentheadjustmentperiodhasexpiredsince
thelastmodificationofPtxTargetPS.Thevalueoftheschedulingperiodisdefinedwith
theSchedulingPeriodpacketschedulerparameter.
Thetarget(ideal)valueforthePtxTargetPSTargetiscalculatedasfollows(inalinear
fashion):
Figure 15

IdealvalueofthePtxTargetPS

WhentheHS-RACHhasbeensetupinthecell,thetargetvaluePtxTargetPSTargetis
calculatedasfollows(inalinearfashion):
Figure 16

TargetvalueofthePtxTargetPSwithHS-RACHsetup

Intheformula:

Issue:06H

PMaxisthecellmaximumtransmissionpower

DN0638161

R: 63/396

63

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

Ptx_ncisthetotalnon-controllabletransmittedDCHpower(PtxnonHSPAPtxNRT)
PtxNRTisthepowerusedbyDCHNRTusers

PtxHSDPA_streamingisthepowerusedbyallHSDPAstreamingusersofthecell

PtxTargetPSMaxisthemaximumallowedvalueforPtxTargetPSdefinedbythe
managementparameterPtxTargetPSMax

PtxTargetPSMinistheminimumallowedvalueforPtxTargetPSdefinedbythe
managementparameterPtxTargetPSMin

PtxNC_HSDPAisanon-controllableHSDPApower

WeightRatioistheratioofWeightDCHandWeightHSDPA,thatis,WeightDCH/
(WeightHSDPA+WeightDCH).WeightHSDPAistheweightoftheHS-DSCHradio
accessbearers(HS-DSCHMAC-dflows)andWeightDCHistheweightoftheNRT
DCHradioaccessbearers.SeePrioritizationbetweenHSDPAandNRTDCHpower
resourcesformoredetailsaboutdeterminationoftheweightvalues.

PtxTargetPSMaxHSRACHisdefinedbyPtxTargetPSMaxHSRACHRNPparameter.
ItdefinesthemaximumallowedvalueforPtxTargetPSwhentheHS-RACHis
configuredinthecell.

NotethatPtxTargetPSmayalsobeadjustedbecauseofRT-over-NRTactions.
Thefollowingexamplerepresentsthecalculationoftheidealvalueofthetarget
thresholdforNRTDCHpacketscheduling:

Example:Calculationofidealtargetthreshold
Letusassumethefollowingconditionsandvaluesforthemanagementparameters:

PMax(cellmaximumtransmissionpower)=20W(43dBm)

PtxTargetPSMax=13W(41,1dBm)

PtxTargetPSMin=4W(36,0dBm)

Ptx_nc(totalprevailingnon-controllableDLloadinthecellcalculatedbytheRNC)=
5W(37,0dBm)

Then,therearethreepacketswitched(NRT)usershavingresourcesallocatedinthe
cell.Theweightsforeachservicearedefinedbythecorrespondingmanagement
parameters:

1NRTDCHuser(InteractiveTHP1,WeightDCHTHP1=0.9)

1HSDPAuser(InteractiveTHP1,WeightHSPATHP1=1.0)

1HSDPAuser(Background,WeightHSPABG=0.25)

Thus,thevalueoftheWeightRatiocanbecalculatedasfollows:

WeightRatio=0.9/(0.9+1.0+0.25)0.42

Therefore,weobtain:

64

DN0638161

R: 64/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

IdealvalueofthetargetthresholdforNRTDCHpacketscheduling=
MAX{MIN{5W+[(20W-5W)x0.42],13W}4W}=11.3W

AftercalculationoftheidealvalueofthetargetthresholdforNRTDCHpacket
scheduling,RNCcanexecutethefollowingcomparisons:

IfPtxTotalPtxHighHSDPAPwrandifthecurrentPtxTargetPS>11.3W,RNC
decreasesPtxTargetPS(seesectionDecreaseofthePtxTargetPSformoredetails).

IfPtxTotalPtxHighHSDPAPwrandifthecurrentPtxTargetPS>11.3W,RNC
decreasesPtxTargetPS(seeDecreaseofthePtxTargetPSformoredetails).

IfPtxNonHSPA(PtxTargetPS1dB)andifthecurrentPtxTargetPS<11.3W,the
RNCincreasesPtxTargetPS(seesectionIncreaseofthePtxTargetPSformore
details).

IfPtxNonHSPA(PtxTargetPS1dB)andifthecurrentPtxTargetPS<11.3W,the
RNCincreasesPtxTargetPS(seeIncreaseofthePtxTargetPSformoredetails).

DecreaseofthePtxTargetPS
TheRNCdecreasesPtxTargetPSifthePtxTotalmeasurementexceedsorequalsthe
thresholddefinedbythePtxHighHSDPAPwrmanagementparameterandPtxTargetPS
ishigherthanthecalculatedidealvalueofthetargetthresholdforNRTDCHpacket
scheduling(PtxTargetPSTargetinthefigure).
Figure 17

DecreaseofthePtxTargetPS

TheamountofdecreaseisdeterminedbythePtxTargetPSStepDownmanagement
parameter.TheRNCdoesnotdecreasePtxTargetPSlowerthanthecalculatedideal
valueofthetargetthresholdforNRTDCHpacketscheduling.ThePtxTargetPSMin

Issue:06H

DN0638161

R: 65/396

65

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

managementparameterdeterminesanabsoluteminimumvalueforPtxTargetPS.If
PtxTargetPSislowerthanthecalculatedidealvalue,theRNCdoesnotdecrease
PtxTargetPS.

IncreaseofthePtxTargetPS
TheRNCincreasesPtxTargetPSifthePtxNonHSPAmeasurementexceedsorequals
thePtxTargetPSthresholddeductedwiththe1dBmarginandPtxTargetPSislowerthan
thecalculatedidealvalueofthetargetthresholdforNRTDCHpacketscheduling
(PtxTargetPSTargetinthefigure)
Figure 18

IncreaseofthePtxTargetPS

TheamountofincreaseisdeterminedbythePtxTargetPSStepUpmanagement
parameter.TheRNCdoesnotincreasePtxTargetPShigherthanthecalculatedideal
valueofthetargetthresholdforNRTDCHpacketscheduling.WhentheHS-RACHhas
beensetupinthecell,theRNCdoesnotincreasethePtxtargetPSabovethe
PtxTargetPSMaxHSRACHorthePtxTargetPSTarget.ThePtxTargetPSMaxmanagement
parameterdeterminesanabsolutemaximumvalueforPtxTargetPS.IfPtxTargetPSis
higherthanthecalculatedidealvalue,theRNCdoesnotincreasePtxTargetPS.

6.3.3 Overloadcontrol
TheRNCcandirectlycontroltheamountofpowerallocatedforDCHs,thusimplicitly
controllingtheHSDPAdownlinktransmissionpowerandbeingthebasisforoverload
controltriggeredbytheRNC.Apartfrompreventiveloadcontrol,whichmeansthatnew
CSspeechRABsarenotadmittedwhentheamountofpowerrequiredbythenoncontrollableloadreachestargetpower,theRNCtakesmeasuresagainstoverload
scenarios.Thesemeasuresarebasedonthepriorityorderdefinedinthe

66

DN0638161

R: 66/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

QoSPriorityMappingparameter.Inotherwords,overloadactionsaredonefirstfor
NRTservicesandthenPSRTserviceswillbehandled.Thefollowingpossibilitiesexist
forthedifferentservicetypes:

BitrateofNRTservicecanbedowngradedand/orresourcesofRBcanbereleased
(RBmappedtoDCH0/0).

ForPSRTservices,theusedbitratescannotbedowngraded.Therefore,releasing
ofRBresources(mappingtoDCH0/0)istheonlywaytosolvetheoverload
situation.

WhenthereisatleastoneMAC-dflowallocatedinthecell,thetargetfornoncontrollableloadisPtxTargetTot,andtargetforDCHpacketschedulingisPtxTargetPS.
WhenthereareNRTDCH(s),overloadcontrolactionsindownlinkarestartedforNRT
DCH(s)ifatleastoneconditioninFigure19:Conditionstotriggeroverloadactions
targetedtoNRTservicesistrue.
WhentherearenoNRTDCH(s)buttherearePSstreamingDCH(s)allocatedinthecell,
overloadactionsinthedownlinkarestartedforPSstreamingDCH(s)ifatleastone
conditioninFigure20:ConditionstotriggeroverloadactionstargetedtoPSstreaming
servicesistrue.
IftherearenoPSDCH(s)allocatedinthecell,overloadcontrolactionsarenottriggered
basedonPtxNonHSPAmeasurementandtargetthresholds.
Figure 19

ConditionstotriggeroverloadactionstargetedtoNRTservices

Figure 20

ConditionstotriggeroverloadactionstargetedtoPSstreamingservices

where:

Issue:06H

Ptx_target_PSisdynamicallyadjustedPtxTargetPSthreshold.

Ptx_targetisstaticPtxTargetthreshold.

PtxOffsetisdefinedbythePtxOffsetmanagementparameter

Ptx_non_HSPAisproducedasasimplemeanvalueofthesamplevaluesPtx_non_HSPA.
AveragingwindowsizeofthePtx_non_HSPAisdefinedbythemanagementparameter
WinLCHSDPA.

Pmaxismaximumtransmissionpowerofthecelldefinedbytheminimumvalueofthe
twoparametersPtxCellMaxandMaxDLPowerCapability.

DN0638161

R: 67/396

67

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

PHSDPA_streamingisthepowerusedbyHSDPAstreamingusers

Ptx_NC_HSDPAispowerusedbyHSDPAconversationalservices

Ptx_target_totisdynamictargetpowerfornon-controllableloadofthecell

TheLoadControlPeriodPSparameterdetermineshowoftenloadcontrolactionscan
beperformedinthecell.
OverloadcontrolactionsbecauseoftheDLtransmissionpoweraretargetedfirsttoNRT
DCH(s)whenthereareexistingHS-DSCHMAC-dflowsallocatedinthecell.Selectionof
thetargetNRTDCH(s)foroverloadactionsandthedowngradingorreleaseprocedure
followsthePacket scheduling principlespresentedinWCDMA RAN RRM Packet
Scheduler,onlywiththedifferencethatthetargetpowerlevelisdefinedbythe
dynamicallyadjustedPtxTargetPS,notPtxTarget.Overloadcontrolactionsbecauseof
theDLtransmissionpowerarenottargetedtoHS-DSCHMAC-dflows.
WhentheoverloadactionstargetedagainstNRTDCH(s)havenotbeensufficient,the
followingmeasuresareappliedforPSstreamingDCHs,newstreamingDCHservices
willnotbeadmittedtothecell.Additionally,existinguserswithstreamingservicesare
releasedormovedtocommonchannels.Inthiscontext,releasingausersmeanstomap
itsradiobearer(RB)toDCH0/0orswitchtheUEintoCELL_FACHstate.Releasingor
movingexistingstreamingusersisdoneinthefollowingway,dependingontheactual
overloadcondition

If(Ptx_non_HSPA<Pmax-PHSDPA_streaming-Ptx_NC_HSDPA)triggersoverload:

Poweristriedtobedecreasedsothatstreamingservicedoesnottrigger
overloadanymore.

Theprincipleisthatthepowerlevelischeckedinpriorityorder(definedby
QoSPriorityMappingparameter)startingfromthelowestpriority(priorityby
priority)

WithinsameprioritytheDCHusershavehigherprioritythanHSDPAusers
(becausepowerusedbyindividualstreamingHSDPAuserisnotknown)andso
thecheckingcontainstwostepsineachprioritylevel:
1. HSDPAuserswiththelowestpriorityarechecked

itischeckedthatdoestheoverloadexistifpowerneededbythelowest
priorityHSDPAusersisignored(subtractedfromusedtotalpower)

ifoverloaddoesnotexistanymore,thennothingisdone(theBTS
handlestheoverloadinHSPAside)

ifoverloadstillexist,thenstep2isdone

2. DCHuserswiththelowestpriorityarechecked

68

itischeckedthatdoestheoverloadexistifpowerneededbythelowest
priorityDCHuserswouldbereleased

DN0638161

R: 68/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

ifoverloadwouldnotexistanymore,thenneededamountofDCHusers
arereleased

ifoverloadstillexist,thenstep1isdone,butthepriorityisthenexthigher
priority(powerusedbyhandledprioritiesistakenintoaccountin
calculations)

If(Ptx_non_HSPA<Ptx_target+PtxOffset)triggersoverload:

neededamountofDCHusersarereleased(poweristriedtobegetunder
PtxTarget)

priorityofuserstellsinwhatorderreleasingisdone(QoSPriorityMapping
parameter)

incaseofsamepriorityreleasingisdoneinfreeorder

If(Ptx_non_HSPA+Ptx_NC_HSDPA<Ptx_target_tot+Ptx_offset)triggersoverload:

neededamountofDCHusersarereleased(poweristriedtobegetunder
PtxTargetTot)

priorityofuserstellsinwhatorderreleasingisdone(QoSPriorityMapping
parameter)

incaseofsamepriorityreleasingisdoneinfreeorder

'IfconditionPtx_non_HSPA>=Ptx_target+PtxOffsetwhentherearenoNRTDCHservices
inthecelltriggersoverload,thenonlyPSstreamingDCHsareusedastargetsfor
overloadactions,becausereleasingofPSstreamingonHSDPAdoesnothelp.Ifseveral
conditionsshowsoverloadsimultaneously,thenitishandledinorderPtx_non_HSPA+
Ptx_NC_HSDPA>=Ptx_target_tot+Ptx_offset,Ptx_non_HSPA>=Ptx_target+PtxOffsetand
Ptx_non_HSPA>=Ptx_Cell_Max-PHSDPA_streaming-Ptx_NC_HSDPA(forthoseconditionsthat
showsoverload)sothatonlyoneconditionishandledinoneoverloadcontrolperiod.
Ineithercase,themaximumpowertobereleasedisdefinedbythe
DeltaPtxMaxDownRNPparameter.
Toreleaseinactiveusersbeforetheoverload,thepreventiveoverloadcontrolisused.
ThepreventiveoverloadcontrolisdescribedinPreventiveoverloadcontrolchapter.

6.3.4 PrioritizationbetweenHSDPAandNRTDCHpower
resources
TheRNCfollowstheprioritizationofthetraffictypeswhenadjustingdynamictarget
thresholdforNRTDCHpacketscheduling(PtxTargetPS).RTalwayshasahigher
prioritytoNRTDCHandHSDPA(HS-DSCHMAC-dflow)traffictypes.
CelllevelpriorityforbothHSDPAandNRTDCHtraffictypeisdeterminedbythecell
levelweightvalues(WeightHSDPA,WeightDCH),whicharedynamicallyadjustedbythe
RNC.Celllevelweightvalueisobtainedbysummingtheweightvalueofeachuserup.

Issue:06H

DN0638161

R: 69/396

69

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

Weightvalueofanindividualuserdependsonthetrafficclass,traffichandlingpriority
(THP)ofitsNRTPSradioaccessbearers,andtheallocationandretentionpriority(ARP)
oftheuser.Anindividualuser'sweightthusisdefinedbythehighestweightoftheuser's
NRTPSradioaccessbearers.TheContinuousPacketConnectivityinactiveusers
weightiszero.
Prioritiesareapplicableindownlinkonly(HSDPAULDCHreturnchannelutilizespriority
basedschedulingandotherDCHrelatedfeatures),unlesstheHSUPAisconfiguredin
thecell.InthelattercasetheHSDPA-specificprioritiesareinheritedforthedynamicUL
interferencesharingbetweenHSPAandDCHusersinthewayspecifiedinWCDMA
RAN RRM HSUPA.Theusers'allocationandretentionpriority(ARP)valuesareonly
takenintoaccountintheweightcalculationsiftheoptionalQoS aware HSPA scheduling
featureisactivatedinthecell(HSPAQoSEnabledparametersettoEnabled).
Dynamicprioritizationisbasedonthenumberofusersandalsotrafficclassesandtraffic
handlingprioritiesofNRTPSradioaccessbearersofeachuserweightedwiththe
structuredparametersWeightHSPA(WeightHSPATHP1,WeightHSPATHP2,
WeightHSPATHP3,WeightHSPABG)andWeightDCH(WeightDCHTHP1,
WeightDCHTHP2,WeightDCHTHP3,WeightDCHBG)forHSDPAusersandNRTDCH
users,respectively.HSDPAusermeansaUEwhichhasHS-DSCHallocated,andNRT
DCHusermeansaUEwhichhasNRTDCHallocated.Furthermore,theallocationand
retentionprioritiesofeachuserareconsidered,weightedwiththeARPWeight
parameter(WeightForARP1,WeightForARP2,WeightForARP3).
Aparticulartrafficclasscanbeexcludedindeterminationoftheweightvaluesbysetting
thetraffic-class-specificweightvalueto0withWeightHSPAandWeightDCH
parameters.Ifeverytraffic-class-specificweightvalueissetto0,celllevelweightvalue
obtainsvalue1forWeightHSPAandWeightDCH.AparticularARPcanalsobe
excludedbysettingthecorrespondingvalueintheARPWeightparameterto0.
Thetraffic-class-specificweightisdeterminedforeachUEwhichhaseitherdedicated
transportchannel(DCH)orhighspeeddownlinksharedchannel(HS-DSCH)allocated
forNRTPSRAB.Incaseofmulti-RAB,aweightiscalculatedforeach
interactive/backgroundradioaccessbearer.Thehighestweightofall
interactive/backgroundRABsisselectedandroundedtotheclosestinteger.The
selectedandroundedvalueisusedasaweightforthisparticularUE.Whethertheuser
isincludedintheHSDPAtraffictypeorNRTDCHtraffictypedependsonitsallocated
transportchannel(DCHorHS-DSCH)indownlink.
HSPAuserswhichL2hasindicatedinactive(bothdirection)areleftoutfromcalculation
(HSDPAandHSUPAweightiszero).
TheweightvalueoftheUE(radioaccessbearer)comprisesofthefollowingtrafficclass
andtraffichandlingpriorityspecificvalues.Thevaluesinthetableareexamples:

70

DN0638161

R: 70/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 4

Cell-specificresourcehandling

Priorityvaluepertrafficclass

TrafficClass

WeightHSDPA

WeightDCH

HSDPAweight
value(0100)

DCHweightvalue
(0100)

InteractiveTHP1

100

90

InteractiveTHP2

75

65

InteractiveTHP3

50

40

25

15

See1).
Background

1)InteractiveclassTHP3includesalsolowerorderofprioritiesandnopriorityvalueif
receivedfromRANAP.
TheoperatorcandefineARP-specificweightsusedtocalculatetheUE-specificweights
bymeansoftheRNClevelARPWeightRNPparameter.Modifyingtheparameter's
valuestakeseffectwhenthecell-levelweightsarecalculatedthenexttime.Ifthe
optionalQoS aware HSPA Schedulingfeatureisnotactivatedinthecell
(HSPAQosEnabledparametersettoDisabled),afixedweightof1isusedforallARP
values.Furthermore,thefollowingapplies:

IfsomeARP-specificweightsaresetto0,UEswiththeseARPsdonotaffecttocell
levelweight.

IfhoweverallweightsforARPsequalto0,thecelllevelweightsforHSDPAand
DCHare1.

ThecelllevelweightiscalculatedbysummingtheweightvaluesofeachUEupas
follows:
Figure 21

SumoftheweightvaluesofeachUE

whereHSDPA_userirepresentstheweightvalueofHSDPAuseri,whohasHS-DSCH
allocatedinthecellandnrepresentsthetotalnumberofHSDPAusers.
ARPuserrepresentsweightvalueoftheARPoftheuseri.Theweightvaluesofnusers
aresummedupinordertoobtainthevalueforWeightHSDPA.

Issue:06H

DN0638161

R: 71/396

71

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

TheSCHSDPAuser,DCHSDPAuserinprimarycell,andDCHSDPAuserinsecondary
cellcanequallytriggerdynamicpowerallocationalgorithm.
Thecelllevelweight,whichisusedfordynamicpowerallocationalgorithms,is
calculatedbysummingupweightvaluesofeachSCandDCHSDPAUEasfollows:
Figure 22

SumoftheweightvaluesofeachUEusedfordynamicpowerallocation
algorithms

whereHSPA_userirepresentsweightvalueofHSDPAuseri(incaseofmultiNRTRAB
thehighestweightofNRTRBsisselectedastheweightoftheUE),whichhasSCorDC
HS-DSCHallocatedinthecell,andnrepresentsthetotalnumberofSCandDCHSDPA
users.
ARP_userirepresentsweightvalueoftheARPoftheuseri.
Factorpirepresentsscaleofthecell,whosevalueishardcodedas1forSCHSDPA
usersandforDCHSDPAusersinbothprimaryandsecondarycell.Algorithmis
calculatedsimilarlyforbothprimaryandsecondarycellDCHSDPAusers.Weightvalues
ofnusersaresummedupinordertoobtainthevalueforWeightHSDPA.
Figure 23

ValueforWeightDCH

whereDCH_userjrepresentstheweightvalueofNRTDCHuserj,whohasNRTDCH
allocatedinthecell,andmrepresentsthetotalnumberofNRTDCHusers.
ARPuserrepresentsweightvalueoftheARPoftheuserj.Theweightvaluesofmusers
aresummedupinordertoobtainthevalueforWeightDCH.
Theweightofanindividualuserisdefinedasthelargestvalueofallweightparameters
oftheuser'sNRTPSradioaccessbearers.Thisisillustratedbythefollowingtwo
examples(Example 1andExample 2).

Example1:
Letusassumethereisauser(User1)havingHSDPAresourcesallocatedinthecell:

User1with1AMRspeechCSRAB+1PSRABestablished(InteractiveTHP2HSDSCHallocated)

Then,weassumethevalueoftheweightparameterissetasfollows:

72

WeightHSPATHP2=90

DN0638161

R: 72/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

Therefore,weobtain:

WeightvalueoftheUser1=90

Example2:
Letusassumethereisauser(User2)havingNRTDCHresourcesallocatedinthecell:

User2with2PSRABsestablished(InteractiveTHP1NRTDCHallocated+
BackgroundNRTDCHallocated

Then,weassumethevaluesoftheweightparametersaresetasfollows:

WeightDCHTHP1=100,WeightDCHBG=50

Sincethelargestvalueoftheweightparametersdefinestheuser'sweightvalue,we
obtain:

WeightvalueoftheUser2=WeightDCHTHP1=100

Celllevelweightisobtainedbysummingtheweightvalueofeachuserup.Thisis
depictedbythefollowingexample(Example 3).

Example3:
Letusassumetherearefivepacketswitchedusers(User1,User2,User3,User4,
User5)inthecell.HSDPAresourcesareallocatedtotheUser1andUser3.NRTDCH
resourcesareallocatedtotheUser2,User4andUser5.Theweightvaluesforeach
usersareasfollows:

User1:WeightvalueoftheHSDPAuser=90(seeExample 1)

User2:WeightvalueoftheDCHuser=100(seeExample 2)

User3:WeightvalueoftheHSDPAuser=100

User4:WeightvalueoftheDCHuser=80

User5:WeightvalueoftheDCHuser=60

Therefore,weobtaincelllevelweightvaluesforHSDPAandNRTDCHtraffictypesas
follows:

WeightHSDPA=User1+User3=190

WeightDCH=User2+User4+User5=240,

Thus,thevalueoftheWeightRatiousedinthecalculationoftheidealvalueofthetarget
thresholdforNRTDCHpacketscheduling:

Issue:06H

WeightRatio=240/(240+190)0.56

DN0638161

R: 73/396

73

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

6.3.5 DynamicallocationofHS-PDSCHcodes
TheRNCassignsthenumberofHS-PDSCHcodestotheBTSwiththeNBAP:
PHYSICALSHAREDCHANNELRECONFIGURATIONREQUESTmessage(Number Of
HS-PDSCH CodesIEandStart Code NumberIE).
Principlesofcodeallocationarepresentedinthefollowinglist:

Thecodeblocks(thesetofcodes)allocatedtotheHS-PDSCHchannelarelocated
inacluster,thatis,thecodesareadjacenttoeachother.

TheDPCHcodeallocationalgorithmremainsunchanged.

Thisallocationmethodsavesthefree,unusedchannelizationcodesinthecenterof
thecodetree,whichalsodecreasesfragmentationofthechannelizationcodetree.

Figure 24

Codetreeallocation

OnlytheprimaryscramblingcodeisusedforHS-PDSCHcodeallocation.Thespreading
factorsofthechannelsarefixed(SF=16).
TheHS-SCCH1codeisalwaysallocatedintheleft-mostSF16branchofthecodetree.
Withthisitispossibletoallocatemaximumof15SF16codestoHS-PDSCHinthecase
oflessHSDPAusersinthecell.Thepositionofremainingthreecodes(HS-SCCH2,HSSCCH3andHS-SCCH4)isalsofixedinthesecondSF16branchfromleftsideofthe
tree.Themainobjectiveistokeeptheallocatednon-HS-PDSCHcodesascompactas
possibleintheleftportionofthecodetree,leavingasmuchSF16codesaspossiblefor
HS-PDSCH.ThefollowingcaseshavetobehandledinRNCduringDLcodeallocation.
Case1:WhentheparameterMaxNbrOfHSSCCHCodesissetto1byoperatorandwhen
codesforalltheDLcontrolchannels(E-AGCH,E-RGCH/E-HICH,HS-SCCH,etc)and
codesforDCHuserscanbeaccommodatedinleftmostSF16branch(firstfromleft)
itself,theremaining15SF16codesareallocatedforHS-PDSCH.RNCsends15HS-

74

DN0638161

R: 74/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

PDSCHcodesthroughNBAP:PHYSICALSHAREDCHANNELRECONFIGURATION
messagetotheBTSandtheBTSmakesuseofall15codesforHS-PDSCHitself.Inthis
case,theRNCsendsoneSF128codeforHS-SCCHintheaforesaidNBAPmessage.
Case2:TheparameterMaxNbrOfHSSCCHCodesissettoavaluegreaterthanone.
OnlyHS-SCCHcodesareallocatedinsecondSF16branch(fromleft)andnocodesare
allocatedforotherDLcontrolchannels(or)DCHusersinsecondSF16branchandinthe
nextrightSF16branches.Inthiscase,theRNCsends15SF16codes(forexamplefrom
secondto16th)totheBTSasHS-PDSCHcodes.But,theBTStakesadecisionof
whethertouse15(or14)codesforHS-PDSCH,whichisbasedonthenoofHS-SCCH
channels.IfmorethanoneHS-SCCHisrequired,theBTSuses14SF16codes(SF16
branchesfromthirdto16th)forHS-PDSCH.Incase,ifonlyoneHS-SCCHisenough,
theBTSusesall15SF16codes(SF16branchesfromsecondto16th)forHS-PDSCH.
RNCsendstwotofour(basedonthevalueofMaxNbrOfHSSCCHCodes)SF128codes
forHS-SCCHinthiscase.
15HS-PDSCHcodesincreasesthethroughputoftheUEandthisispossibleonlywhen
asingleHSDPAuserisscheduledinasingle2msTTI(forexampleonlyoneHS-SCCH
=>nocodemultiplexing).
Case3:theRNCallocatescodesforcontrolchannelsotherthanHS-SCCH(thatisERGCH/E-HICH,F-DPCH,etc)and/orDCHusersintheSF16branchotherthanleftmost
(first)branch.Inthiscase,theRNCsendstheremainingSF16codes(lessthan15)to
theBTSandtheBTSusesonlythemforHS-PDSCH.
RNCsendsonetofour(basedonthevalueofMaxNbrOfHSSCCHCodes)SF128codes
forHS-SCCHinthiscase.InanutshelltheRNCconsidersthecodesofHS-SCCH2,
HS-SCCH3andHS-SCCH4asunoccupiedwhenHS-PDSCHcodesareallocated.

DynamicHS-PDSCHcodeallocation
DynamicallocationofHS-PDSCHcodesisappliedifHSDPADynamicResource
Allocationfeatureisenabled(HSDPADynamicResourceAllocationmanagement
parameter)andifHSDPA15Codes(HSDPA15Codes)featureisenabled.Whilethe
RNCautomaticallyassumesthattheNB/RSxxxiscapableofsupporting10(15)code,
thisdoesnotapplyfortheWCDMABTS(WBTS).Still,theWBTSmustofcoursealsobe
capableof10(15)codesinordertodynamicallyadjustHS-PDSCHcodes.IftheWBTS
isnotcapableordoesnotsenditscapabilitytotheRNC,fixedallocationoffiveHSPDSCHcodesisappliedinthecellsetupphase.
RNCallocatesHS-PDSCHcodesfromthesetofcodesdefinedbythe
HSPDSCHCodeSetmanagementparameter.
TheminimumallowednumberofHS-PDSCHcodesisthelowestvalueintheHSPDSCHcodeset.CorrespondinglythemaximumallowednumberofHS-PDSCHcodes
isthehighestvalueintheHS-PDSCHcodeset.TheRNCallocatesonlythenumberof
HS-PDSCHcodes,whichisdefinedbythesetofHS-PDSCHcodes.Ifthereisonlyone
valuedefinedintheHS-PDSCHcodeset,theRNCappliesstaticcodeallocationforthat
particularnumberofHS-PDSCHcodes.WhenevertheWCDMABTS(WBTS)indicates

Issue:06H

DN0638161

R: 75/396

75

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

thatitisonlycapableofsupportingasmallernumberofHS-PDSCHcodesthancurrently
allocated,theRNCdowngradesthenumberofHS-PDSCHcodes.Afterward,this
numberwillbethehighestpossiblevaluefromtheHS-PDSCHcodesetwhichislower
thanorequaltotheWBTScapability.
Table 5

HS-PDSCHcodeset

Numberof
HS-PDSCH
codes(full
set)

HSDPA15
Codes

HSDPA10
Codes

Staticcode
allocation

10

11

12

13

14

15

Backgroundinformationaboutdefaultvalues(Static code allocation)andrecommended


values(HSDPA 15 CodesandHSDPA 10 Codes)intheHS-PDSCHcodeset:
TherecommendedvaluesintheHS-PDSCHcodesetinclude5,8,10,12,14,15codes.
Minimumvalue5codescorrespondswiththestaticcodeallocationanditisalsothe
maximumcapabilityofUEcategories1-6and11-12.
8codesisatypicalfigureforcodemultiplexingoftwousers(4+4).
10codesisthemaximumnumberforHSDPA15Codesfeature,ifthereislicenseonly
for10codes,anditisalsothemaximumcapabilityofUEcategories7-8.
12codesisatypicalfigureforcodemultiplexingofthreeusers(4+4+4).

76

DN0638161

R: 76/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

15codesisanabsolutemaximumnumberofHS-PDSCHcodesanditisalsothemaximumcapabilityofUEcategories9-10butinpracticeitcanbeachievedonlyinanempty
cellandthus14codesisalsoincluded.

TheinitialallocationofHS-PDSCHcodes(SF=16)isexecutedinthecellsetupphase.
TheminimumnumberofHS-PDSCHcodesisallocatedinitially.Theminimumnumberof
HS-PDSCHcodesisdefinedbythelowestnumberofHS-PDSCHcodestakenfromthe
HS-PDSCHcodeset.
TheRNCattemptstoupgradeHS-PDSCHcodes1)inconjunctionoftheHS-DSCH
MAC-dflowsetupand2)periodically.RNCdowngradesHS-PDSCHcodes1)
periodicallyand2)inthecaseofDPCHcodecongestion.RNCupdatestheHS-PDSCH
codestotheBTSwiththeNBAP:PhysicalSharedChannelReconfigurationprocedure.
TheRNCappliesthetimerHSPDSCHAdjustPeriod,whichcanbeadjustedbythe
operator,forperiodicalHS-PDSCHcodeadjustment:

WhenthefirstHS-DSCHMAC-dflowissetupinthecell,theRNCstartsthetimer

TimerisusedforcheckingtheneedforupgradeanddowngradeofHS-PDSCH
codesperiodically

TheRNCstopsthetimerwhentheminimumallowednumberofHS-PDSCHcodesis
allocatedandthereis(are)notanyHS-DSCHMAC-dflow(s)setupinthecell

RNCresetsthetimerinconjunctionwiththeHS-PDSCHcodeupgradeand
downgrade.

HS-PDSCHcodeupgradeintheHS-DSCHMAC-dflowsetup
TheRNCimmediatelyattemptstoupgradeHS-PDSCHcodesinconjunctionofthesetup
ofthefirstHS-DSCHMAC-dflowproviding:

ThenumberofcurrentlyallocatedHS-PDSCHcodesislowerthanthemaximum
allowednumberofHS-PDSCHcodes.

CapabilityindicatedbytheWCDMABTS(WBTS)doesnotlimittheupgrade.
NotethattheRNCdoesnotusetheMaximumnumberofHS-PDSCHcodesorthe
SupportofdynamicresourceallocationcapabilityindicationwhentheNB/RSxxxis
affected.Instead,theRNCassumesthattheNB/RSxxxiscapableofsupportingboth
15HS-PDSCHcodesandHSDPAdynamicresourceallocation.

FreeSF=16codes,whichareadjacenttothecurrentlyallocatedHS-PDSCHcodes,
canbefoundinordertotakethenexthighervaluefromHS-PDSCHcodesetinto
use.

FreeSF=16codescanbefoundsothatafterupgradenumberoffreeSF=128codes
isgreaterthanorequaltothevaluedefinedbytheHSPDSCHMarginSF128
managementparameter.

ThepurposeoftheHSPDSCHMarginSF128managementparameteristoreservefree
coderesourcesforDPCHcodes.Theamountoffreecodesisdefinedintermsof
numberofspreadingcodeshavingspreadingfactor128(SF=128).Operatorcanuse
parameter,forexample,forreservingfreecodesforAMRspeechcalls.

Issue:06H

DN0638161

R: 77/396

77

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

Iftheconditionsareeffective,thatis,upgradeoftheHS-PDSCHcodescanbeexecuted
inconjunctionofthefirstHS-DSCHMAC-dflowsetup,thehighestallowedvaluefrom
theHS-PDSCHcodesetfulfillingtheconditionsistakenintouse.

HS-PDSCHcodeupgradeperiodically
TheRNCperiodicallyattemptstoupgradeHS-PDSCHcodeswhenthetimerforthe
periodicaladjustmentoftheHS-PDSCHcodes(HSPDSCHAdjustPeriod)expires.In
ordertoupgradeHS-PDSCHcodes,thesameconditionsaspresentedaboveforHSDSCHMAC-dflowsetup,mustbefulfilled.
Iftheconditionsfortheperiodicalupgradeareeffective,thenextgreatervaluefromthe
HS-PDSCHcodesetistakenintouse.
Figure 25

HS-PDSCHcodeupgrade

Inthefigure,CodeNrepresentsthevaluefromtheHS-PDSCHcodeset,whichindicates
thenumberofcurrentlyallocatedHS-PDSCHcodesandCodeN+1representsthenext
highervaluefromtheHS-PDSCHcodeset,whichindicatesthenumberofHS-PDSCH
codesafterupgrade.

78

DN0638161

R: 78/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

HS-PDSCHcodedowngradeperiodically
TheRNCperiodicallydowngradesHS-PDSCHcodesunderthefollowingconditions:

TimerforperiodicaladjustmentoftheHS-PDSCHcodes(HSPDSCHAdjustPeriod)
expires

ThenumberofcurrentlyallocatedHS-PDSCHcodesishigherthantheminimum
allowednumberofHS-PDSCHcodes

ThenumberofcurrentlyavailableSF=128codesislowerthan
HSPDSCHMarginSF128,orthereis(are)notanyHS-DSCHMAC-dflow(s)setupin
thecell.

Iftheconditionsdeterminedaboveareeffective,thenextlowervaluefromtheHSPDSCHcodesetistakenintouse.
Figure 26

HS-PDSCHcodedowngrade

CodeNrepresentsthevaluefromtheHS-PDSCHcodeset,whichindicatesthenumber
ofcurrentlyallocatedHS-PDSCHcodesandcodeN-1representsthenextlowervalue
fromtheHS-PDSCHcodeset,whichindicatesthenumberofHS-PDSCHcodesafter
downgrade.

Issue:06H

DN0638161

R: 79/396

79

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

DPCHcodecongestion
TheRNCdowngradesHS-PDSCHcode(s)becauseoftheDPCHcodecongestion.RNC
doesnotdowngradeHS-PDSCHcodeslowerthantheminimumallowednumberofHSPDSCHcodesdefinedbythelowestnumberintheHS-PDSCHcodeset.
IfRTrequestiscongestedbecauseofthelackofDPCHcode(s),HS-PDSCHcodesare
downgradedinordertoadmitRTrequest.
IfNRTDCHschedulingiscongestedbecauseofthelackofDPCHcode(s),HS-PDSCH
codesaredowngradedinordertoadmitNRTDCHrequestaccordingtothefollowing
principles.

IfthereisoneormoreHS-DSCHMAC-dflowssetupinthecell,downgradeofHSPDSCHcodesisallowedifnumberofthecurrentlyallocatedHS-PDSCHcodesis
greaterthanDPCHOverHSPDSCHThreshold(managementparameterdefinesan
offsetfromthemaximumallowednumberofHS-PDSCHcodes).

Ifthereis(are)noHS-DSCHMAC-dflow(s)setupinthecell,HS-PDSCHcodescan
bedowngradedwithouttakingDPCHOverHSPDSCHThresholdintoaccount.

Otherwise,HS-PDSCHcodesarenotallowedtodowngradebecauseoftheNRT
DPCHcodecongestion.

TheamountofHS-PDSCHcodestobedowngradeddependsontheneed,thatisthe
lowestpossiblenumberofHS-PDSCHcodesisreleasedinordertoadmitRTrequestor
scheduleNRTDCH.ThenumberofHS-PDSCHcodesafterdowngradeisthehighest
possiblefromtheHS-PDSCHcodeset.

Codetreeoptimization
Codechangeproceduretriestore-arrangetheDPCHcodesinordertomakeroomfor
HS-PDSCHcodeupgradeAfterupgradeoftheHS-PDSCHcodestriggeringconditionof
thecodetreeoptimizationprocedureischecked.Codetreeoptimizationisnotperformed
onHSDPA-relatedcodes,i.e.HS-SCCHandHS-PDSCHcodesarenotre-allocated
becauseofthecodetreeoptimization.Formoreinformationoncodetreeoptimization
procedure,seeWCDMA RAN RRM Admission Control.
Also,ifthereareDPCHcodesinthesharedcodearea(areainthecodetreebetween
theminimumandmaximumallowednumberofHS-PDSCHcodes),thefollowing
conditionsandrulesarecheckedeachtimeaDPCHcodeisreleased:

80

CodeTreeOptimisationmanagementparameterisenabledinthecell.

NumberofcurrentlyallocatedHS-PDSCHcodesislowerthanthemaximumallowed
numberofHS-PDSCHcodes.

AllDPCHcodescanbeaccommodatedinotherthanHS-PDSCHcodeupgrade
area,thatis,.upgradeoftheHS-PDSCHcodesispossible

Afterrearrangement,thenumberofcurrentlyallocatedHS-PDSCHcodesaddedwith
thenumberoffreeSF=16codes,whichareadjacenttothecurrentlyallocatedHSPDSCHcodes,mustbeequaltoorhigherthanthenexthighervalueintheHSPDSCHcodeset,sothatalsothenumberoffreeSF=128codesisgreaterthanor
equaltothevaluedefinedbytheHSPDSCHMarginSF128managementparameter.

DN0638161

R: 80/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

Inotherwords,RTandNRTDCHspreadingcodes,excludingstandaloneSRB,HSSCCH,HS-PDSCHandHSUPAcommoncontrolchannelcodes,arereallocatedso
thatthecodeareaforthenextperiodicalHS-PDSCHcodeupgradebecomesfree.
Iftheconditionsarevalid,thecodechangeprocedurecanbestartedbytheRNC.
TheRRMperformscodechangeprocedureofdownlinkspreadingcodetreewhenFDPCHexists.ThisrequirementisvalidwhenHSDPAdynamiccodeallocation
functionalityisenabledinthecell.
RNPparameterFDPCHCodeChangeEnableddefineswhethercodechangeprocedure
isperformedforF-DPCHcodeandhowmanyF-DPCHslotformatscaninmaximumbe
occupiedwhenprocedureisallowedtostart.IfcodechangeprocedureforF-DPCHis
allowed,F-DPCHishandledsimilarlyasnormalRTDPCHincodechangeprocedure.
CodechangeprocedureisappliedalsoconnectionsutilizingSRBonlywithF-DPCH,
becausenowF-DPCHcodeallocationdoesnotchangeinRBallocationthatisF-DPCH
allocationisnotnecessarilyshorttermallocation.
StartingconditionsofcodechangeprocedureischeckedwhenDPCHorF-DPCHis
released.ConditionsaresimilarascurrentlybutnowalsoF-DPCHreleaseiscounted.
PrimarilyUEsfromF-DPCHcodetobereleasedaremovedtoexistingF-DPCHsand
secondarilynewF-DPCHissetup.Codechangeprocedureisperformedonlyifit
releasesrequiredresources.CodechangeprocedureisnotperformedifanyoftheFDPCHslotformatsintheF-DPCHinquestionbelongstotheUEwhichSRNCisnotthis
RNC.CodechangeprocedureofoneorseveralF-DPCHcodescanbeperformedper
codechangetriggering.UptotenUEscansimultaneouslyutilizecertainF-DPCHcode
andthusde-fragmentationthatiscodechangeprocedureofthiscodeaffectsto
maximumtenUEs.IfallF-DPCHslotformatsoccupiedinF-DPCHcodetobereleased
fitstoexistingF-DPCHcode/codeswhichis/arelocatedinbetterpositionforexamplein
lefthandsideofF-DPCHcodetobereleasedincodetree,newF-DPCHcodeisnot
setupbutallF-DPCHslotformatsarechangedtothis/theseexistingF-DPCHcode(s).FDPCHslotformatisreconfiguredinordertomatchwithexistingsynchronizationin
existingnewF-DPCHcode.ChangeisdoneinF-DPCHslotformatorder1,2,3,...9,0.
IfallF-DPCHslotformatsoccupiedinF-DPCHcodetobereleasedaremovedtosame
newF-DPCH,codechangeprocedureisperformedsothatfirstnewF-DPCHcodeinthe
betterpositioninthecodetreeissetupforfirstUEwhichutilizesoldF-DPCHcodeand
afterthatrestoftheUEswhichareusingthisoldF-DPCHcodearechangedtousenew
F-DPCHcode.ChangingisdoneinF-DPCHslotformatorder1,2,3,...9,0.F-DPCH
slotformatofeachUEremainthesameinthenewF-DPCHcodeasitwasinoldFDPCHcode.IfallF-DPCHslotformatsoccupiedinF-DPCHcodetobereleaseddonot
fittoexistingF-DPCHcode/codes,thosewhichfitaremovedtoexistingF-DPCHcodes
andforrestnewF-DPCHcodeinbetterpositionissetup.NewuserallocationstoFDPCHcodewhichistobereleasedincodechangeprocedurearenotallowed.OldFDPCHcodeisreleasedafterlastUEismovedtoanotherF-DPCHcode.Ifthecode
changeprocedurefailsforoneoftheDPCHorF-DPCHcodesorfortheF-DPCHslot
format,thecodechangeprocedureisstopped.

HS-DSCHoperationalstatechange
TheRNCreactsuponchangesoftheHS-DSCH'sresourceoperationalstate,provided
thatHSDPAisenabledinthecellbytheHSDPAenabledparameter.Statechangedare
indicatebytheBTStowardtheRNC,seeActivating the HSDPAfeature.

Issue:06H

DN0638161

R: 81/396

81

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

IftheBTSchangestheHS-DSCH'sresourceoperationalstatefromEnabledtoDisabled
becauseoftherecoveryactions,forexample,thefollowingprocedureisapplied:
1. TheRNCstartsatimerwhichrunsfor10seconds.
2. Uponexpiryofthattimer,
a) TheRNCreleasesallHS-PDSCHcodesfromthespreadingcodetreedownto
theminimumnumberofHS-PDSCHcodesinthecell,definedbythelowest
valueoftheHSPDSCHCodeSetparameter.
b) TheRNCfurthermorestartstoreleaseallexistingHS-DSCHMAC-dflowsinthe
cellifnotyetdoneuponchangeoftheHS-DSCH'sresourceoperationalstate.

ThisprocedureensuresthatHS-PDSCHcodesarenotkeptreservedintheRNCwhen
theHSDPAserviceisunavailableintheBTS.TheRNCdoesfurthermorenotallocate
anynewHS-DSCHMAC-dflowsinthecellaslongastheHS-DSCH'sresource
operationalstateremainsDisabled.
Otherwise,whenthecellisHSDPA-capableandtheHS-DSCH'soperationalstate
changesfromDisabledtoEnabled,theRNC
1. UpdatestheallocatedHS-PDSCHchannelizationcodesbysendinganNBAP:
PhysicalSharedChannelReconfigurationRequestmessagetotheBTS.TheRNC
setstheminimumnumberofHS-PDSCHcodes,definedbythelowestvalueofthe
HSPDSCHCodeSetparameter.
2. ContinuesallocatingHSDPAresourcesandHS-DSCHMAC-dflowsinthecell(if
necessary)assoonastheHS-PDSCHcodeswillhavesuccessfullybeenupdatedin
theBTS.

HandlingofHS-PDSCHcodeallocationfailuresintheWBTS
TheNBAP:PhysicalSharedChannelReconfigurationproceduremayfailintheeventof
HS-PDSCHcodeupgradeordowngrade.SuchscenariosmayoccurwhentheWBTS
sendsafailuremessageorwhentheRNCdoesnotreceiveanyresponsefromthe
WBTS.
WhenHS-PDSCHcodeupgradefails,theRNCreleasestheupgradedchannelization
codesandkeepsthesameamountofcodesreservedasbeforetheupgradeattempt.In
otherwords,thecodeareaisfreedforDPCHuse.
Furthermore,intheeventoffailedHS-PDSCHcodeupgrades-andintheeventoffailed
HS-PDSCHcodedowngrades,aswell-theRNCretriestoallocatethenewamountof
HS-PDSCHchannelizationcodesforthesamecellifthefollowingprerequisitesare
fulfilled:

TheconditionsforHS-PDSCHcodeupgradeordowngrade,respectively,arestill
valid.

Atleastoneminutehaselapsedafterthelastattempttoupgradeordowngrade,
respectively.

Afterthreeconsecutivefailedupgradeordowngradeattempts,analarmwillberaised.

82

DN0638161

R: 82/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

However,ifHS-PDSCHcodedowngradeisrequiredbecauseofDPCHcodecongestion
andtheNBAP:PhysicalSharedChannelReconfigurationprocedurethenfails,failure
handlingwillbedoneasdescribedinWCDMA RAN RRM Packet Schedulerand
WCDMA RAN RRM Admission Control.

HandlingofHS-PDSCHcodeallocationfailuresintheNB/RSxxx

SupportofNB/RSxxxisnotavailableforFlexiDirectRNCsolution
TheNB/RSxxxmayrejectNBAP:PHYSICALSHAREDCHANNEL
RECONFIGURATIONREQUESTmessages,leadingtoabortionoftheNBAP:Physical
SharedChannelReconfigurationprocedures,inseveralscenarios:

PeriodicHS-PDSCHcodeupgrade
Inthiscase,theRNCsetsthepenaltytimerforHS-PDSCHcodeupgradebyadding
30stothevalueoftheHSPDSCHAdjustPeriodparameterandstartsit.Aslongas
thetimerisrunning,nofurtherHS-PDSCHcodeupgradesaretriedintheparticular
cell.HS-PDSCHcodedowngradesarehowevernotaffectedbythetimer.Assoonas
HS-PDSCHcodedowngradehassuccessfullybeenfinished,thetimerwillbe
stopped.AstoppedorexpiredtimerthendoesnotautomaticallytriggerHS-PDSCH
codeupgradeattempts.Instead,thenextcodeupgradeisonlyretriedwhentheneed
foritarisesaftertimerstoporexpiry.
IftheHS-PDSCHcodeupgradefailsagaininthatparticularcellafterexpiryofthe
penaltytimerforHS-PDSCHcodeupgrade,nofurtherretriesaremadeinthiscell
unlessoneofthefollowingwillhavebeenoccurredinanycellofthebasestation:

SuccessfulHS-PDSCHcodedowngrade

HSDPAdisabled

HS-PDSCHcodeupgradetogetherwiththesetupofthefirstHS-DSCHMAC-dflow
inthecell
Here,theRNCdoesnotsetthepenaltytimerforHS-PDSCHcodeupgradebut
startsanotherattemptforHS-PDSCHcodeupgrade.TheactualnumberofHSPDSCHcodesintheretryisdefinedbyroundingthefollowingequationuptothe
closestinteger:
Figure 27

NumberofHS-PDSCHcodesincodeupgraderetry(NB/RSxxx)

with
NHS-PDSCH,retry
NumberofHS-PDSCHcodesforthenextattempt
NHS-PDSCH,current
NumberofcurrentlyallocatedHS-PDSCHcodes
NHS-PDSCH,failed
NumberofHS-PDSCHcodesinthefailedattempt

Issue:06H

DN0638161

R: 83/396

83

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

Iftheroundedvalue(NHS-PDSCH,retry)cannotbefoundfromtheHS-PDSCHcodeset,
theclosesthighervalueisusedfortheHS-PDSCHcodeupgraderetry.Thecodeset
itselfisdefinedbytheHSPDSCHCodeSetparameter.However,ifanappropriate
numberofHS-PDSCHcodes,whichishigherthanNHS-PDSCH,retrybutlowerthan
NHS-PDSCH,failed,cannotbeselected,noretryismade.
Iftheretryfailsaswell,thecurrentlyallocatednumberofHS-PDSCHcodes(NHSPDSCH,current)iskeptwhensettingupthefirstHS-DSCHMAC-dflowinthecell.

HS-PDSCHcodedowngrade
Inthiscase,theRNCsetsthepenaltytimerforHS-PDSCHcodedowngradeby
adding30stothevalueoftheHSPDSCHAdjustPeriodparameterandstartsit.As
longasthetimerisrunning,nofurtherHS-PDSCHcodedowngradewillbeinitiated,
nordoesanyHS-PDSCHcodeupgrade.
ExpiryofthetimerdoesnotautomaticallytriggerHS-PDSCHcodedowngrade
attempts.Instead,thenextcodedowngradeisonlyretriedwhentheneedforit
arisesaftertimerexpiry.

6.4 FractionalDedicatedPhysicalChannel(F-DPCH)
ThischapteriseffectiveforFractionalDPCHandSRBsonHSPAfeatures(RAN1201,
FDPCH).
TheF-DPCHcarriescontrolinformationgeneratedatlayer1(TPCcommands).Itisa
specialcaseofdownlinkDPCCH.Thefollowingfigureshowstheframestructureofthe
F-DPCH.Eachframeoflength10msissplitinto15slots,eachoflengthTslot=2560
chips,correspondingtoonepower-controlperiod.
Figure 28

FramestructureforF-DPCH

TheexactnumberofbitsoftheOFFperiodsandoftheF-DPCHfields(NTPC)is
describedinthefollowingtable.EachslotformatcorrespondstoadifferentsetofOFF
periodswithintheF-DPCHslot.

84

DN0638161

R: 84/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

Table 6

F-DPCHfields

Slot
Format
#i

Channel
BitRate
(kbps)

Channel
Symbol
Rate
(ksps)

SF

Bits/
Slot

NOFF1
Bits/Slot

NTPC
Bits/Slot

NOFF2
Bits/Slot

1.5

256

20

16

1.5

256

20

14

1.5

256

20

12

1.5

256

20

10

1.5

256

20

10

1.5

256

20

12

1.5

256

20

14

1.5

256

20

16

1.5

256

20

18

1.5

256

20

18

TherelationshipbetweentheTPCsymbolandthetransmitterpowercontrolcommandis
presentedinthefollowingtable.
Table 7

TPCBitPattern

TPCBitPattern

Transmitter
power
control
command

NTPC=2

NTPC=4

NTPC=8

11

1111

11111111

00

0000

00000000

1
0

F-DPCHisusedonlyforRel-7andlaterUEs.NetworkdoesnotsupportRel-6versionof
F-DPCH.

Issue:06H

DN0638161

R: 85/396

85

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

RRMmanagesdownlinkspreadingcodeallocationforF-DPCHand
F-DPCHslotformatallocation
RRMmanages:

AllocationofdownlinkspreadingcodeforF-DPCHfromdownlinkspreadingcode
tree.ThisisdonesimilarlyasinDPCHallocation.Formoreinformation,see
WCDMA RAN RRM Admission Control

AllocationofF-DPCHslotformat.

SpreadingfactorofF-DPCHcodeis256.Thereisupto10F-DPCHslotformats
availableineachF-DPCHcode.TheF-DPCHcodeisallocatedandreleasedaccording
tofollowingrules:

DownlinkspreadingcodeforF-DPCHisallocatedfromfirstfreepositionstartingfrom
lefthandsideinthecodetree.ThisisdonesimilarlyasinDPCHallocation.

FirstdownlinkspreadingcodeforF-DPCHisallocatedwhenfirstUEstartstoutilize
F-DPCH.CapacityofoneF-DPCH(Rel-7version)ismaximum10UEs,forexample,
following9F-DPCHUEsareallocatedtothissameF-DPCHcode.Notethatthe
rulesforallocatingF-DPCHslotformatmightcausethatnotall10F-DPCHslot
formatscanbeused.Probabilityforthatishoweververysmall.

NewF-DPCHcodeisreservedwhennumberofUEsincreasesovermaximumtotal
capacityofexistingF-DPCHs.

NewUEwhichisstartingtoutilizeF-DPCHisalwaysallocatedtofreeF-DPCHslot
formatpositionifsuchexistinexistingF-DPCHcode.SearchingisstartedfromFDPCHcodelocatedinmostlefthandsideincodetree.

TheF-DPCHcodeisreleasedwhenlastUEusingthiscertaincodehasstoppedthe
useofF-DPCH.

ThereisnoupperlimitfornumberofF-DPCHcodes.

RRMdefinesradiolinkpowerlimitswhenF-DPCHisused
TheRRMproducesminimum,maximumandinitialpowerforF-DPCHbasedonpower
ofCPICHandRNPparametersasfollows:

InitialDLTransmissionPower=PtxPrimaryCPICH-PtxFDPCHMax+
PtxOffsetFDPCHSHO(dBnotation)

MaximumDLPower=PtxPrimaryCPICH-PtxFDPCHMax+
PtxOffsetFDPCHSHO

MinimumDLPower=PtxPrimaryCPICH-PtxFDPCHMin+
PtxOffsetFDPCHSHO

InitialDLTransmissionPowerisequaltoMaximumDLPower.
PtxPrimaryCPICHisRNPparameterwhichdefinesconstantpowerforprimaryCPICH.
PtxFDPCHMaxisRNPparameterwhichdefinesmaximumpowerforTPCbitsofFDPCH.

86

DN0638161

R: 86/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

PtxFDPCHMinisRNPparameterwhichdefinesminimumpowerforTPCbitsofFDPCH.
PtxOffsetFDPCHSHOisRNPparameterwhichdefinespoweroffsettoF-DPCHpower
forE-DCHsofthandovercase.
IfRRCconnectionenterstoE-DCHsofthandoverstate(thatis,non-servingE-DCHRLS
exists),valueoftheRNPparameterPtxOffsetFDPCHSHOisaddedtosignaledvalue.
Otherwise,forexample,whenRRCconnectionisnotinE-DCHsofthandover,noadding
isdone,thatis,thevalueofPtxOffsetFDPCHSHOinequationsis0.Signaledvaluesof
allradiolinksarereconfiguredwhenE-DCHsofthandoverstatuschanges.Information
elementsaredefinedperradiolink.NBAPinformationelementsInitialDLTransmission
Power,MaximumDLPowerandMinimumDLPoweraresignaledtoBTSinradiolink
setupwhileinradiolinkreconfigurationonlyMaximumDLPowerandMinimumDL
Poweraresignaled.InformationelementsarethesamewhichareusedforDPCH.
SignaledvaluesareupdatedwhenDPCHisreconfiguredasF-DPCHandviceversa.
WhenF-DPCHisactivated,theRNCdoesnotincludetheDLPowerBalancing
InformationIEintoNBAPmessages.However,downlinkpowerbalancingisstillusedin
casethatthereisnoF-DPCH(thatis,withaCSAMRonDCHcall).

QualitytargetfortheF-DPCH
TheRRMsignalsRRCinformationelementTPCcommanderrorratetarget(DownlinkFDPCHinfocommonforallRL)totheUE.
ValuefortheinformationelementisreadfromtheTPCCommandERTargetRNP
parameter.
ValueoftheparameterisreadwhenF-DPCHissetuporwhenHSPAservingcell
changeisperformed.ValueoftheHSPAservingcellisused.
SignaledvalueisnotupdatedifvalueoftheparameterismodifiedduringF-DPCH
allocation.

TPCcombinationindex
TheRRMsignalsRRCinformationelementTPC combination indextotheUEwhenFDPCHisused.InsofterhandovertheRNCsetsthesameTPC combination index
informationelementvalueforradiolinksunderthesameLCGwithinoneBTS.
Otherwise,forexample,whenradiolinksarenotunderthesameBTS,different
informationelementvaluesaresignaled.Differentinformationelementvaluesarealso
signaledwhentheradiolinksareunderdifferentLCGswithinoneBTS.
TheRRMsignalsRRCinformationelementDPCmodetotheUEwhenF-DPCHisused
similarlyaswithDPCH.

RRMsignalsF-DPCHrelatedinformationtotheBTS
TheRRMsignalsfollowingNBAPinformationelementstotheBTSwhenF-DPCHis
used:

Issue:06H

PO2.Signaledvalueisfixedas0dB.InformationisnotusedbytheBTS.

DN0638161

R: 87/396

87

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

FDDTPCDLStepSize.SignaledvalueisreadfromexistingRNCconfiguration
parameterDownLinkInnerLoopPCStepSizesimilarlyaswithDPCHorwhenCPC
isusedfromRNCconfigurationparameterDLInLoopPCStepSizeCPC.RRMreads
parameterwhenradiolinkissetup.Signaledvalueisnotupdatedifvalueofthe
parameterischanged.OnlyservingcellintheBTSutilizesthisinformationelement
butitissignaledtoallradiolinksbecauseitismandatoryinformationelementin
NBAPprotocols.

LimitedPowerIncrease.Signaledinformationisfixedas'Notused'.

InnerLoopDLPCStatus.Signaledvalueis'Active'forcellsofservingBTSand
'Inactive'forothercells.SignaledvalueisupdatedwhenservingBTSchanges.

RadionetworkplanningparameterDedicatedMeasReportPeriod(AMRandSRB)
definesthereportingintervalthatBTSutilizesforsendingdedicatedmeasurement
reportstotheRNCwhenF-DPCHisallocated.Filteringofthesendingofthe
measurementresultsisperformedinthesamewaythanwithAMRandSRBservicesin
theDPCH.Measurementissetupincellsetupphase.TheRRMdoesnotactivate
Transmitted Code Power (PtxAverage)measurementwithspecialperiodicitywhenFDPCHisallocatedinRRCconnectionsetupphase.TheRRMreleasesadditional
Transmitted Code Power(PtxAverage)measurementwithspecialperiodicityifsuch
existswhenF-DPCHisallocated.TheRRMactivatesadditionalTransmitted Code
Power(PtxAverage)measurementwithspecialperiodicityifneededbasedonexisting
requirementswhenF-DPCHisreleased.Dynamiclinkoptimizationisnotperformed
whenF-DPCHisallocated.

6.5 HSDPAstaticresourceallocation
HSDPAstaticresourceallocationisappliedifHSDPAdynamicresourceallocationisnot
enabledoriftheWCDMABTS(WBTS)doesnotsupportHSDPA Dynamic Resource
Allocation(HSDDRES).ThisfeatureconsistsofstaticallocationofHS-PDSCHcodes
andstaticallocationofpowerresourcesforHSDPAintheRNC.TheBTSapplies
dynamicpowerallocationregardlessoftheresourceallocationmethodintheRNC.

HSDPAstaticresourceallocationisnotsupportedbyFlexiDirectRNC.

6.5.1 CodeallocationforHS-PDSCHphysicalchannels
TheRNCallocatesoneHS-SCCHcode(SF=128)andfiveHS-PDSCHcodes(SF=16,
codenumbers#11-#15)percellinthecell-setupphaseforcells,whichareHSDPAcapableandwhichhaveHSDPAenabled.

88

DN0638161

R: 88/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Figure 29

Cell-specificresourcehandling

Codetreeallocation

OnlytheprimaryscramblingcodeisusedforHS-SCCHandHS-PDSCHcodeallocation.
Thespreadingfactorsofthechannelsarefixed(SF=16).
CodetreeoptimizationisnotperformedonHSDPA-relatedcodes.
AllocationoffiveHS-PDSCHcodesisfixedanddoesnotrequireanyconfiguration
actionsbyoperators.

6.5.2 AllocationoftheHSDPApower
ThePtxMaxHSDPAparameterdefinesthemaximumamountofHSDPApower(HSPDSCHandHS-SCCHtotalpower).HSDPApowerandnumberofHS-PDSCHcodes
aresignaledtotheBTSthroughNBAP:PhysicalSharedChannelReconfiguration
procedure.ThisprocedureisexecutedaftercellsetupincellsthatsupportHSDPAand
haveHSDPAenabled(parameterHSDPAenabled).Formoredetails,refertoBasic
principleofpowerallocation.
NoticethattheHSDPApowercanbeusedforR99channelswhentherearenoHSDSCHMAC-dflowsinthecell.

6.5.3 SelectingthepriorityofHSDPAandoverloadcontrol
TheselectedpriorityofHSDPAdeterminesifNRTDCH(s)orHS-DSCHMAC-dflowsare
primarilytargetedforoverloadactionsinoverloadsituations.Thepriorityalsodetermines
theusedcriteriononwhichthefirstHS-DSCHMAC-dflowcanbeallocatedinthecell.
ThesecriteriaareexplainedinUsecase1:HSDPAhashigherprioritythanDCHsand
Usecase2:DCHshavehigherprioritythanHSDPA.Theusecasesassumethatthe
BTSappliesdynamicpowerallocationforHSDPA,seeBasicprincipleofpower
allocation.

Issue:06H

DN0638161

R: 89/396

89

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

TheoperatorcanconfigurethepriorityofHSDPAwiththeHSDPAPriorityparameter.

Overloaddetectionandactions
Ingeneral,wheneveratleastoneMAC-dflowisallocatedinthecell,implyingthat
HSDPApowerisused,loadcontrolsupervisesthetargetfornon-controllableload
(PtxTarget)andthetargetforDCHpacketscheduling(PtxTargetHSDPA).Overload
controlactionsarethenstartediftheaveragedestimatedtransmittednon-HSPAcarrier
power(PtxnonHSPA)maintainedbythecellexceedsthePtxTargetHSDPAbythe
configurableoffsetPtxOffsetHSDPA.Inoneloadcontrolperiod,definedbythe
LoadControlPeriodPSparameter,overloadcontrolactionsaretargetedeitheragainst
NRTDCHsoragainstMAC-dflows,butnotagainstboth.Uponaccomplishingaload
controlaction,theaveragingwindowofPtx_non_HSPA,definedbytheWinLCHSDPA
managementparameter,isemptied.
WhenoverloadcontrolhasfirstreleasedallHS-DSCHMAC-dflowsinthecell,possible
furtheroverloadactionstargetedagainstthePSNRTDCHsarenotinitiatedinashorter
periodthan

CellservedbyWCDMABTS(WBTS):maximumvalueof{LoadControlPeriodPS;
2*RRIndPeriod;WinLCHSDPA}

CellservedbyNB/RSxxx:maximumvalueof{LoadControlPeriodPS;
2*PtxTotalReportPeriod;WinLCHSDPA}

Thisperiodisdefinedinmilliseconds[ms]andtheparametervaluescanbemodifiedby
theoperator.ThetypeofBTSwhichservesthecellisindicatedintheNBAPCommMode
parameter.
Thesameperiodisusedfortheguardtimewhenoverloadcontrolhasfirstreleasedall
PSNRTDCHsandthenstartspossiblefurtheroverloadactions,targetedagainstHSDSCHMAC-dflows.

Usecase1:HSDPAhashigherprioritythanDCHs
AllocatingHSDPApowerwhenHSDPApriorityisone.

90

DN0638161

R: 90/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Figure 30

Cell-specificresourcehandling

FunctionalitywhenHSDPApriorityisone

TimeinstantA:
TheRNCisallowedtoallocateHS-DSCHMAC-dflowwhentheaveragedtotalnoncontrollabletransmittedpower(PtxNC)maintainedbytheloadcontrolfunctionalityinthe
celliseitherequaltoorbelowtheconfigurablePtxTargetHSDPAthreshold:
Figure 31

Condition1

ThisconditionismetatthetimeinstantAandwhenHS-DSCHisselected,HSDPA
transmissionpoweristakeninuse.WhenHSDPApowerisinuse,thetargetforPtxNC
isPtxTarget,thesameaswithoutHSDPA.ThetargetforNRTDCHpacketschedulingis
PtxTargetHSDPA.

TheoperatorcanconfigurethePtxTargetHSDPAthresholdwiththePtxTargetHSDPA
parameter.

TheoperatorcanconfigurethemaximumHSDPAtransmissionpowerwiththe
PtxMaxHSDPAparameter.

TimeinstantB:
TheRNCmeasuresandaveragesthetotaltransmittedpowerofallthecodesthatare
notusedforHS-PDSCH,HS-SCCH,E-AGCH,E-RGCHorE-HICHtransmission
(PtxNonHSPA)inthecellinordertodetectoverloadsituations.Overloadcontrolactions
arestartedwhentheaveragedPtxNonHSPAexceedsthePtxTargetHSDPAby
configurableoffsetPtxOffsetHSDPA.

Issue:06H

Theoperatorcanconfiguretheoffsetfortransmittednon-HSPApowerwiththe
PtxOffsetHSDPAparameter.

DN0638161

R: 91/396

91

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Cell-specificresourcehandling

WCDMARANRRMHSDPA

Theoperatorcanconfiguretheaveragingwindowsizeofthetransmittednon-HSDPA
powermeasurementwiththeWinLCHSDPAparameter.TheRNCdoesnotinitiate
overloadactionsasdescribedabovebeforethewindowisfullofsamples.

ThisconditionismetattimeinstantB.
TheRNCprimarilytargetsNRTDCHsforoverloadactions(downgradingorrelease).
Afterloadcontrolactionshavebeenaccomplished,theaveragingwindowofthe
transmittednon-HSDPApowermeasurement(definedbyWinLCHSDPA),isemptied.
TimeinstantC:
Overloadisdetected,buttherearenomoreNRTDCH(s)inthecell,sotheoverload
actionsaretargetedagainsttheHS-DSCHMAC-dflows.OverloadactionsforHS-DSCH
MAC-dflowsthenareonlystartedwhenaguardtimerhasexpired.Thedurationofthis
periodisdefinedinOverloaddetection.
AstheRNCusesthistriggeringmechanismofoverloadcontrolactionsforNRTradio
bearersonlywhenthereisatleastoneHS-DSCHMAC-dflowinthecell,thesetriggers
nolongertriggeroverloadactionsaftertimeinstantC.OverloadactionsforNRTDCH(s)
areperformedfollowingthefunctionalitywithoutHSDPA.

Usecase2:DCHshavehigherprioritythanHSDPA
AllocatingtheHSDPApowerwhenHSDPApriorityistwo.
Figure 32

FunctionalitywhenHSDPApriorityistwo

TimeinstantA:
TheRNCisallowedtoallocateHS-DSCHMAC-dflowwhen

92

Case(a),theaveragedestimatedtransmittednon-HSPAcarrierpower
(PtxnonHSPA)maintainedbythecell

DN0638161

R: 92/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Cell-specificresourcehandling

Case(b),thetotaltransmittedcarrierpower(PtxTotal)maintainedbytheloadcontrol
functionalityinthecell

iseitherequaltoorbelowtheconfigurabletargetoftransmittednon-HSPApower
(PtxTargetHSDPA).Theaveragedestimatedtransmittednon-HSPAcarrierpowerisused
whenatleastoneHS-DSCHMAC-dflowisallocatedinthecell.Otherwise,ifnosuch
MAC-dflowexists,thetotaltransmittedcarrierpowerisusedbecauseitisequaltothe
estimatedtransmittednon-HSPAcarrierpowerforthiscase.
Figure 33

Condition2

ThisconditionismetattimeinstantAandwhenHS-DSCHisselected.HSDPA
transmissionpoweristakeninuse.WhenHSDPApowerisinuse,thetargetforPtxNC
isPtxTarget,thesameaswithoutHSDPA.ThetargetforNRTDCHpacketschedulingis
PtxTargetHSDPA.
TimeinstantB:
Atthistimeinstant,overloadisdetectedsimilarlyasinUsecase1.AlltheHS-DSCH
MAC-dflowsarereleased.
AstheRNCusesthistriggeringmechanismofoverloadcontrolactionsforNRTradio
bearersonlywhenthereisatleastoneHS-DSCHMAC-dflowinthecell,thesetriggers
nolongertriggeroverloadactionsafterTimeinstantB.
TimeinstantC:
Overloadisdetected,buttherearenomoreHS-DSCHMAC-dflow(s)inthecell,sothe
overloadactionsaretargetedagainsttheNRTDCH(s).Thereleaseordowngradeofthe
NRTDCH(s)isnotalloweddirectlyafterthelastHS-DSCHMAC-dflowwasreleased
becauseofoverloadinthecell.Instead,theoverloadcontrolfunctionwaitsaperiodin
time,asdefinedinOverloaddetectionandactions.

Issue:06H

DN0638161

R: 93/396

93

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

7 UE-specificresourcehandling

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
TheprincipleisthatRNCandBTSresourcesforRTRABsarereservedalreadyinRAB
setupphase.IncaseofPSNRTservicesresourcesarereservedinRABsetupphase
directlytoexistingHS-DSCH/E-DCHonlyiftheUEhasfullHSPAconfiguration.Inother
casesresourcesforNRTservicesarereservedafteratrafficvolumemeasurement
reportforthenewserviceisreceived.Formoreinformation,seeDirectNRTresource
allocationchapter.

7.1 Channeltypeselection
TheHSDPAchanneltypeselectionfeaturedeterminestheoptimaldownlinktransport
channelfortheuser(FACH,DCHorHS-DSCH).
Figure 34

Channeltypeselectionschemeofpacketscheduler

TheUE-specificpacketscheduler(PS)performsthechannelselection.Themaininput
forchannelselectionisthetrafficvolumemeasurement,whichtheMAClayerofthe
RNCortheUEperformsforeachNRTRB.
TheresultofthetrafficvolumemeasurementishandledinthePSasacapacity
allocationrequest(forexample,asarequestforaDCHorHS-DSCH).Fordetailson
trafficvolumemeasurementsandrelatedparameters,seeUplink traffic volume
measurement reportsinWCDMA RAN RRM Packet Scheduler.
ToactivateCSvoiceoverHSPAinavirtualcelloranyothercell,theFlexibleRLCneeds
tobeenabled.FlexibleRLC(useofMAC-ehs)isenabledintheRNCwiththeRNClevel
FRLCEnabledRNPparameter.

94

DN0638161

R: 94/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

ThechanneltypeselectionisperformedforPSNRTRABtobeestablishedimmediately
withoutwaitingforthenextschedulingmoment.Thereisnoprioritybasedscheduling
appliedfortheDirectResourceAllocation(DRA).IftheHSPAchannels(HS-DSCHand
E-DCH),orHSDPAchannel(UL-DCHandHS-DSCH)areselectedforthePSNRTRAB,
theMAC-dflowsareestablishedimmediatelywithoutqueuing.TheUL-DCHisnot
queuedwhentherearependingcapacityrequests.Inthiscase,theDRAisaborted,
DCH0/0isallocated,andTrafficVolumeMeasurement(TVM)isstartedasperexisting
principles.

7.1.1 SelectionbetweenDCHandHS-DSCH

NotethatlicenseinformationisrelevantonlytotheIPA-RNCsolution.
HS-DSCHisselectedifallofthefollowingconditionsaremet:
1. TrafficclassandtraffichandlingpriorityareallowedonHS-DSCH.
Theoperatorcanconfigurewhichtrafficclassesandtraffichandlingprioritiesare
allowedwithHSDPAwiththeHSDSCHQoSclassesparameter.The
FDPCHAndSRBOnHSPATCmanagementparametercanalsorestricttheuseofSRBs
onHSPAconfigurationforthecertaintrafficclass.
Asalltransportchannel-typecombinationsarenotallowed,aswitchtoDCHmay,
thus,becomenecessaryforexistingRABsifoneRABisnotallowedtousetheHSDSCH.AnewRTRABcan,however,alsotriggeraDCHtoHS-DSCHchanneltype
switch(seeDirectDCHtoHS-DSCHswitch).NoticethatCSvoicecanbealso
switchedtoDCH,becausetheuseofHSDPAforCSvoicemeansfullHSPA
configuration.
2. UEcapabilitysupportsHS-DSCH,asdefinedbythefollowingUEradioaccess
capabilityparameters:

Issue:06H

Support of HS-PDSCH,indicatingwhetherornottheUEsupportsHS-PDSCH
UEinformsinRRCInformationElementMulti cell supportwhetheritsupportDCHSDPA.InformationisreceivedinRRCCONNECTIONREQUESTmessage.

HS-DSCH physical layer category,providingtheUEcapabilityintermsof


maximumnumberofreceivedHS-DSCHcodes,minimuminter-TTIinterval,
maximumnumberofbitsofanHS-DSCHtransportblockreceivedwithinanHSDSCHTTI,andtotalnumberofsoftchannelbits.TheRNCreceivesthevalue
fromtheUE(REL-5HS-DSCHphysicallayercategory,REL-7HS-DSCH
physicallayercategoryextension,REL-8HS-DSCHphysicallayercategory
extension2,REL-9HS-DSCHphysicallayercategoryextension3).The
informationisreceivedinRRCCONNECTIONSETUPCOMPLETEmessage.
TheRNCstoresthereceivedRRCInformationElementsMulti cell support,HSDSCH physical layer category,HS-DSCH physical layer category extension,HSDSCH physical layer category extension 2, HS-DSCH physical layer category
extension 3andusesthemduringthelifetimeoftheRRCconnection.

DL capability with simultaneous HS-DSCH configuration,definingthe


modificationofreceptioncapabilitiesinthedownlinkdirectionintermsofDPCH
whenanHS-DSCHisconfiguredsimultaneously

DN0638161

R: 95/396

95

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

supportofCSvoiceoverHSPA,indicatingwhetherornotUEsupportsCSvoice
mappedtoHSPA(InformationonCSvoiceoverHSPAsupportissentbytheUE
duringRRCconnectionsetupprocedureinRRC:RRCCONNECTIONSETUP
COMPLETEandRRC:RRCCONNECTIONREQUESTmessages.)

NotethattheinformationrelatedtoHS-DSCH physical layer categoryisnotusedto


defineSRBRLCPDUsizeandmaximumbitrateofSRBs/MAC-dflowofHSDPA.
3. ThecellsupportsHSDPA.
ThesupportofHSDPAinaparticularcellisenabledordisabledwiththe
HSDPAenabledmanagingparameter.
AcellisconsideredtosupportHSDPAifitsHSDPA Capabilityinformationelement
(IE)issettoHSDPA CapableandtheResourceOperationalStateIEintheHSDSCHResourcesInformationIEisnotsettoDisabled.TheRNCstoresthe
informationabouteachcell'sHSDPAcapabilityandupdatestheinformationupon
receiptofNBAP:AuditResponseandNBAP:ResourceStatusIndicationmessages.
4. HS-DSCHisenabledinthecell.
AHS-DSCHisconsideredenabledwhenitsResourceOperationalStateIEinthe
HS-DSCHResourcesInformationIEisnotsettoDisabled.
5. Multi-RABcombinationoftheUEissupportedwithHS-DSCH.
WiththerestrictionthatthesupportforAMRspeechCSRAB(HSDPA with
simultaneous AMR Voice call),CSvoiceoverHSPA(CS voice over HSPA),multiple
(morethanone)NRTRABs(HSPA Multi NRT RAB),andHSPAstreaming
(Streaming QoS for HSPA)areoptionalfeatures,anumberormulti-RAB
combinationsaresupported.Fordetails,seeRABcombinationsforHSDPA.
6. ThenumberofsimultaneousHS-DSCHMAC-dflowsorHSDPAusersisbelowthe
maximumnumberofHS-DSCHallocations
ThemaximumnumberofsimultaneousHS-DSCHMAC-dflowsandHSDPAusersis
definedbytheMaxNumberHSDSCHMACdFlowsandMaxNumberHSDPAUsers
WCELparameters,respectively,anddependsontheactivelicenses,seeMaximum
numberofHSDPAusers.
7. TheUEisnotperforminginter-frequencyorinter-systemmeasurements.
8. TheHsdschGuardTimerandHsdschGuardTimerLowThroughputguardtimers
arenotrunning.
9. ThereisnoHSDPAschedulercongestioninBTS.Formoreinformation,seeHSDPA
preventionincaseofBTSHSDPAscheduler(MAC-hs/ehsentity)congestion.
10. Theactivesetsizeisequaltoone.Thisconditionisonlycheckedifthe
HSDPAMobilityparametervalueisDisabled.
11. TheUEdoesnothaveDCHsscheduledwithbitrateshigherthanzero.
12. TheHS-DSCHphysicallayercategoryissupported.
13. HSDPADynamicResourceAllocationisdisabled:

IfthereisnoexistingHS-DSCHMAC-dflowinthecell,dependingonthe
HSDPApriorityparameter,Figure31:Condition1orFigure33:Condition2
hastobevalidbeforeHS-DSCHcanbeselected.

IfHSDPADynamicResourceAllocationisenabled,admissiondecisionismade
withouttakingdownlinkpowerandHSDPApriorityparameterintoaccount.

14. IncaseofaPSstreamingandCSvoiceRB,resourcechecksforHS-DSCHhaveto
bepassedaswelltogettheHS-DSCH,seeAdmissiondecision.

96

DN0638161

R: 96/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

15. HSDPApreventionfunctionoftheRAN2954: Voice call prioritization during high


traffic loadfeaturedoesnotpreventfromHS-DSCHallocation.Formoredetails,see
HSDPApreventionbecauseofVoicecallprioritizationduringhightrafficloadchapter.
Ifanyoftheconditionsisnotmet,DCHpacketschedulingisinitiated,whichmayalso
meanusingDCH0/0kbit/s.
IncaseofCSserviceallthefollowingconditionsmustalso(inadditiontogeneral
conditions)befulfilled:

mappingofpriorityservicetoHS-DSCHisallowedbytheoperator(withtheRNP
parameterFDPCHSetupEC),iftheCSRABispre-emptioncapable.

CSvoiceoverHSPAissupportedbytheUE

MAC-ehsissupportedbytheBTS

fullHSPAconfigurationispossible(F-DPCH)

allcellsintheactivesetmustsupportCSvoiceoverHSPA

FlexibleRLCisenabled(MAC-ehs)

ChanneltypeselectionincaseoftheRRCconnectionreestablishmentforCSvoiceoverHSPA
IncaseoftheRRCconnectionre-establishment,usuallyallchanneltypeselection
checks(includingqualitychecks)mustbepassedbeforetheHSPAcanbeusedforthe
UEwithCSvoiceoverHSPA.IfHSPAcannotbeused,thentheDCHisselected
(meaningchanneltypeswitchduringRRCconnectionre-establishment).
IftheUEdoesnotacceptDCHconfiguration(whenchanneltypewasattemptedtobe
switched),thepossibleRRCconnectionre-establishmentattemptismadewiththe
HSPAconfiguration(ifalltheotherthanqualitychecksarepassed).Resourcesarestill
checkedinAdmissionControlinanormalway(likeinRABsetup)andRT-over-(N)RT
andpre-emptioncanbeusedtogetmissingresources.IfitisnotpossibletouseHSPA
oritisnotpossibletodotheretry,thentheUEisdropped.

7.2 FractionalDedicatedPhysicalChannel(F-DPCH)
andSRBsonHSPA

NotethatlicenseinformationisrelevantonlytotheIPA-RNCsolution.

ConfigurationneededforF-DPCH
UsageofF-DPCHiscontrolledwithcell-specificradionetworkplanningparameter
FDPCHEnabled.RRMisallowedtoallocateF-DPCHfortheUEonlyif:

Issue:06H

LicenseCPCexistsanditsstateisON.

F-DPCHisenabledintheallactivesetcellsusingparameterFDPCHEnabled.

DN0638161

R: 97/396

97

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

BTShasindicatedfortheallactivesetcellsthatitsupportsRel-6F-DPCHusing
NBAP:F-DPCHCapabilityinformationelement.

BTShasindicatedfortheallactivesetcellsthatitsupportsRel-7F-DPCHusing
NBAP:F-DPCHSlotFormatCapabilityinformationelement.

ThischeckisperformedbytheUE-specificadmissioncontrolintheSRNC.Checkis
doneeverytimewhenF-DPCHisallocatedforcertainUEandwhenactivesetupdates.
ThischeckremainseffectiveforthisUEaslongasitutilizesF-DPCHdespiteofpossible
changesinlicenseorparameters.Forexample,ifstateinformationofthelicenseCPC
changesfromONtoOFForCONFIGwhenF-DPCHallocationalreadyexistsinthe
certainUE,F-DPCHisnotreleasedimmediatelybutbasedonnextnormalrelease.

ConditionsforallocatingF-DPCHinUE
F-DPCHisallocatedalwayswhenitispossible,notonlyifCPCorCSvoiceoverHSPA
requireit.F-DPCHitselfprovidescapacitygainbecauseoflessL1overheadandlatency
gainbecauseSRBshavewiderbandwidthonHSPA.RRMallocatesF-DPCHfortheUE
onlyif:

Rel-7F-DPCHisenabledintheallthecellsofcurrentDCHactiveset.

E-DCHactivesetisequaltoDCHactiveset.

ThereisnoradiolinkoverIurintheactiveset.

F-DPCHisallowedforusedservice.AllowedservicesaredefinedwithRNC
configurationparameterFDPCHAndSRBOnHSPATC.Thisischeckedinradiobearer
setupandreconfigurationphases.

UEinformsinRRCIE:SupportforEnhancedF-DPCHthatitsupportsRel-7FDPCH.

AnyserviceswhichrequireDCHdonotexist(AMRonDCH).

HS-DSCHisallocatedorispossibletobeallocatedfortheUE.

E-DCHisallocatedorispossibletobeallocatedfortheUE.

SRBsarepossibletobemappedtoHS-DSCH.

SRBsarepossibletobemappedtoE-DCH.

FreeF-DPCHslotformatisavailable.

RRMcontinuouslymonitorspreviousrulesandifatleastoneofthembecomestorestrict
useofF-DPCH,RRMreconfiguresF-DPCHasDPCH.Also,ifF-DPCHbecomes
possiblewhenDPCHisallocated,RRMreconfiguresDPCHasF-DPCH.Minimum
intervalbetweentwoconsecutiveF-DPCHallocationsofthecertainUEishowever
limitedwithRNCconfigurationparameterFDPCHAllocMinInterval.Timerisstarted
aftereverysuccessfullyexecutedF-DPCHtoDPCHreconfiguration.Duringthetime
period,F-DPCHallocationisforbidden.FunctionalitydoesnotrestrictF-DPCH
reconfigurationasDPCH.TimerisstoppedwhennewRABissetupi.e.F-DPCH
allocationisnotrestrictedinRABsetupphase.WhenF-DPCHiscurrentlyallocatedand
newsofthandoverbranchwhichdoesnotsupportF-DPCHneedstoadded,procedureis
performedsothatF-DPCHisfirstreconfiguredasDPCHandafterthatnewbranchis
addedimmediately.

98

DN0638161

R: 98/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

TheuplinkanddownlinkchanneltypeselectionbetweenSRBson
DCH,SRBsonHSUPA,andSRBsonHSPA
TheuplinkanddownlinkchanneltypeselectionbetweenDCH/DCH,E-DCH/DCHandEDCH/HS-DSCHforSRBsisperformedbytheUE-specificpacketscheduler,handover
controlandcell-specificpacketschedulers.
Notethattherecanbeseveralcell-specificpacketschedulersbecauseofsofthandover.
ThechanneltypeselectionalgorithmforSRBsproceedstogetherwithdownlinkand
uplinkchanneltypeselectionalgorithmandwhenthereissetupofRBsimultaneouswith
SRBsonHSPA.
NotethatSRBswithchanneltypeHS-DSCHisnotpossibleifuseofF-DPCHisnot
possible.
InitialavailabilitycheckingofSRBsonHSPAisdoneUE-specificpacketschedulerand
handovercontrol.SRBsonHSPAinitialavailabilitycheckingmeetsthefollowing
requirements:

F-DPCHcanbeallocatedtotheUE

ThereisatlistonecellwhichreportedCPICHRSCPvalueishigherthansetbythe
RNPparameterCPICHRSCPThreSRBHSDPA.

CPICHRSCPorCPICHEcNomeasurementresultofthetargetcellisnotknownin
thetargetRNCduringinter-RAThandoverfromLTE.InsuchcasesthefixedCPICH
EcNovalueiscomputedandmustbehigherthanLoadBasedCPICHEcNoSRBHSPA
asdescribedinAllocationofF-DPCHintargetRNCduringinter-RAThandoverfrom
LTE.

IfthereisHS-DSCHalreadyallocatedfortheUE,thenreportedservingcellCPICH
RSCPvalueishigherthansetbytheRNPparameterCPICHRSCPThreSRBHSDPA.

Ifcurrentactivesetsizeismorethanone,thereportedCPICHEcNoofservingcellis
notlowerthanreportedCPICHEcNoofbestcellsubtractedbyRNPplanning
parameterHSDPASRBWindow.

ThecandidateofHSDPAservingcellsincaseofSRBsonHSPAisthecellswhose:

reportedCPICHRSCPvalueishigherthansetbytheCPICHRSCPThreSRBHSDPA
parameter

CPICHEcNoofcandidateofHSPAservingcellisnotlowerthanreportedCPICH
EcNoofbestcellsubtractedbyRNPplanningparameterHSDPASRBWindow

Whentheinitialcheckinghasbeendone,theUE-specificentityrequestscapacityfor
SRBsonE-DCH(withRBrequestifneededatthesametime)fromallactivesetcells.
CapacityforSRBsonHS-DSCHcapacityisrequestedonlyfromthecellthatisplanned
tobeHSDPAservingcell.Cell-specificentitymakesthefinaldecisionofSRBsonHSPA
onbytakingaccountthecelllevelresourcesituationandBTScapability.IftheSRBson
HS-DSCHallocationfailsforthecandidateoftheHSDPAservingcellsthentheSRBson
HSPAarenotallocatedanduseofSRBsonE-DCHconfigurationwith10msTTIis
forbidden.ButifthesametimeallocationoftheSRBsonE-DCHconfigurationwith2ms
TTIsucceedthentheSRBsonHSUPA2msTTIconfigurationisusedinsteadofSRBs
onHSPA.TheUE-specificpacketschedulercheckswhetherfinalE-DCHactivesetfor
SRBsonHSPAisacceptable.FinalE-DCHactivesetsupposedtobeequalwithcurrent

Issue:06H

DN0638161

R: 99/396

99

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

DCHactivesetsize.IfnotthenconfigurationofSRBsonHSPAandSRBsonEDCH/DCHisnotconfigured/used.Functionstohuntingresourcesareapplicablealsoin
caseoftheSRBsonHSPA.IfonlytheSRBsonDCH/DCHtoSRBsonHSPA
reconfigurationhasbeenfailed,itdoesnotleadtotriggeranyRToverNRTorRTover
RTfunctionalities,thatistheSRBsarekeptonDCH/DCHconfiguration.
UseofF-DPCHissupportedduringthediversityhandover.Allradiolinksornoneof
theminthecurrentactivesetmustuseF-DPCH.UEnotinvolvedrelocationwithFDPCHallocationisperformedsimilarlyaswithDPCH.
UseofF-DPCHandmappingofSRBsonHSPAforcertainQoSclassesarecontrolled
withRNCconfigurationparameterFDPCHAndSRBOnHSPATC.Inputfortheparameter
mappingistrafficclassandtraffichandlingpriority.InthemultiservicecaseF-DPCHis
usedandSRBsaremappedonHSPAifalltheservicessupportit.
TheRAN:1762DirectResourceAllocationfeaturehasnoimpactontheSRBCTSand
F-DPCHallocation.

Cell-specificentitymakesthefinaldecisionofSRBsonHSPA
WhenthecelllevelentityreceivescapacityrequestincludingtheSRBsonHSPA,it
checksthatSRBsonHSPAispossibletoconfigureinthecell.
ThepowerincreaseestimationforSRBsisnotdone(=0).IncaseoftheRRCconnection
establishment,thepuresignalinglinkcapacityrequestisadmittedorrejectedbasedon
loadconditioninULandDLdirection,asincaseofSRBsonDCHwhenneeded,against
thenon-controllableload.
WhenSRBsonHSPAwithRB(s)resourceallocationfailsbecauseofmaximumnumber
ofHSUPA/HSDPAusers,theRT-over-RTorRT-over-NRTtypeoffunctionsaretrieddo
tohuntingforresourcesforthenewHSPArequest.WhenSRBsonHSPAwithRB(s)
resourceallocationfailsbecauseofmaximumnumberofHS-DSCHMAC-dflows,the
RT-over-RTandRT-over-NRTtypeoffunctionsistriedtohuntresourcesonlyforRB(s)if
SRBsonDCHresourcesalreadyexist.

AllocationofF-DPCHinRRCconnectionsetupphase
WhenevertheRNCreceivestheRRC:RRCCONNECTIONREQUESTfromtheUE,the
RNCperformstheactionsasshowninthefollowingfigures.

100

DN0638161

R: 100/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Figure 35

Issue:06H

UE-specificresourcehandling

RRC:RRCCONNECTIONREQUESTreceived

DN0638161

R: 101/396

101

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

Figure 36

RRC:RRCConnectionSetup,SRBmappingtoHSPA

Figure 37

RRC:RRCConnectionSetup,SRBmappingtoDCH

WhenevertheRNCreceivestheRRC:RRCCONNECTIONREQUESTmessageonthe
PRACH/RACH/CCCH,itmakestheCELL_FACHorCELL_DCHstatedecisionforthe
signalinglink,andincaseofCELL_DCHstate,aDCH3.4,orDCH13.6,orF-DPCHwith
SRBonHSPAconfigurationaccordingtothesignaledEstablishmentCause(EC)and
UEreleaseversion.Whenmakingthedecision,theRNCalsotakesintoaccountsome
internalandexternalmeasurementsofloadandcurrentradioconditions.The
EstablishmentCauseisreceivedfromtheUEintheRRC:RRCCONNECTION
REQUESTmessage.
TheRNCperformstheRRCConnectionSetuponCCHifthefollowingconditionsare
fulfilled:
1. TheCCHSetupEnabledWCELparameterissettoEnabled,whichallowstheRRC
ConnectionSetuponcommonchannelsintheRNC.

102

DN0638161

R: 102/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

2. ThereceivedEstablishmentCausepreferstheRRCConnectionSetuponcommon
channels.TheECintheRRC:RRCCONNECTIONREQUESTmessageischecked
againsttheSRBMapRRCSetupECparametervalue.TheSRBMapRRCSetupEC
parameterdefinestheEstablishmentCause(EC)valuesthatpreferSRBmappingto
thecommonchannels(CCH)intheRRCconnectionsetupprocedure.
3. IfAccessStratumReleaseIndicatorisRel99,thenthevalueofthe
RRCSetupCCHEnabledR99parameterindicatesthattheRRCconnectionsetup
procedureonCCHisallowedforR99UEs.
4. RNCInternalMeasurementsindicatethatRACHandFACHarenotoverloaded.
5. Externalmeasurements(EcNoorRSCP)indicatethatUEisingoodradiocondition.
PtxTotalisnotexceeded.
Ifanyoftheaboveconditionsarenotfulfilled,thentheRNCperformstheRRC
ConnectionSetuponCELL_DCHstatewiththeconfigurationofDCHorF-DPCHwith
SRBonHSPA.DCHvs.F-DPCHwithSRBonHSPAdecisionisperformedbasedon
thereceivedEstablishmentCauseandtheUEreleaseversion.
TheDCHisallocatedforSRBsiftheEstablishmentCausereceivedfromtheUEis
definedtouseDCHforSRBsbytheFDPCHSetupECRNPparameter(bitvalueofthe
causeset1).
NotethatduringtheRRCConnectionSetupphasetheDCHbitrateoftheSRBis
controlledbytheSRBBitRateRRCSetupECRNPparameter.IftheECprefersDCH
bitrateof13.6kbit/sthentheDCHbitrate13.6kbit/sisallocatedtotheSRB.Otherwise,
theDCHbitrateof3.4kbit/sisallocatedtotheSRB.
IfAccessStratumReleaseIndicatorisRel.7orhigherandtheEstablishmentCause
receivedfromUEisdefinedtouseHSPAforSRBs(bytheFDPCHSetupECRNP
parameter),itfollowstheallocationofF-DPCH(controlledbytheFDPCHSetup
parameter).
IftheF-DPCHisenabledinthecellandtheFDPCHSetupparameterhasvalue0,the
attemptofF-DPCHwithSRBsonHSPAallocationisperformedimmediatelyintheRRC
connectionsetupphase.ThisisvalidfortheRel-7andnewerUEwhichsupportsRel-7
F-DPCH.ThisindicationisreceivedintheRRC:RRCCONNECTIONREQUEST
message.CPICHRSCPorCPICHEcNo(whicheverisavailable)RACHmeasurement
resultoftheUEiscomparedagainstthethresholdsdefinedbytheCPICHECNOSRBHSPA
orCPICHRSCPThreSRBHSDPAparameters.MeasuredCPICHEcNoorCPICHRSCP
valueshouldfulfillthecriteriaasdefinedinRRCconnectionestablishmentwith
standaloneSRBsonHSPAchapterbeforeitispossibletomaptheSRBonHSPA.
IftheUErejectstheRRCConnectionSetupwithF-DPCH,thenthesetupwithoutFDPCHisperformedimmediately.IftheUEindicatesthatitdoesnotsupportRel-7FDPCHoriftheCPICHEcNoorCPICHRSCPmeasurementresultdoesnotfulfillthe
criteriaasdefinedbytheCPICHECNOSRBHSPAorCPICHRSCPThreSRBHSDPAthreshold
parameters,statetransitiontotheCELL_DCHstateisperformedandDCHisallocated
forSRBs.
IncaseofasuccessfulRRCconnectionsetuponcommonchannels,theFDPCHSetup
RNPparameterischeckedagainwhenF-DPCHisenabledinthecurrentservingcell(by
FDPCHEnabledRNPparameter):

Issue:06H

DN0638161

R: 103/396

103

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

IftheFDPCHSetupRNPparameterhasvalue1,thenF-DPCHisallocated
immediatelyafterRRC:RRCConnectionSetupCompletemessageisreceivedand
theUEhasindicatedthatitsupportsRel-7F-DPCH.IftheUEwasoncommon
channelsthenstatetransitiontoCELL_DCHstateisperformedandSRBis
allocatedtoHSPAchannel(ifallconditionsarefulfilled).

IftheFDPCHSetupRNPparameterhasvalue2,thenF-DPCHisallocatedafterRRC
ConnectionSetupmessagealongwithuser-planeallocation.Thishappenswhenthe
UEhasindicatedthatitsupportsRel-7F-DPCH.IftheUEhasindicatedthatitdoes
notsupportRel-7F-DPCH,itcontinueswithSRBsonDCHmode.

TheseproceduresarevalidalsoifDirectedRRCconnectionsetuporDirectedRRC
connectionsetupforHSDPAlayeristriggered.IftheUEisF-DPCHcapableandthe
currentlayerdoesnotsupportF-DPCH,thentheRRCConnectionSetupisredirectedto
atargetlayerthatsupportsF-DPCH.ThetargetcellisF-DPCHcapableifvalueofthe
FDPCHEnabledcell-specificradionetworkplanningparameterisdefinedasEnabled.
Also,theFDPCHSetupRNPparameterofthetargetcellischecked.IfFDPCHSetup
parameterhasvalue0or2,procedureisperformedsimilarlybutRRCconnectionis
directedtothenewfrequencyandcell.IfFDPCHSetupparametervalueis1,directionto
thenewfrequencyoncommonchannelsisnotperformedbutRRCconnectionissetup
accordingtoprocedurewhenFDPCHSetupRNPparametervalueis2.
Incaseoftheestablishment,theFDPCHSetupECparametervaluesConversationalcall
orEmergencycallhaveaneffectonlyonUEsindicatingsupportforCSvoiceover
HSPA.ForUEsthatarenotCSvoiceoverHSPAcapable,theSRBsarealwaysmapped
toDCH.
Later,thefullHSPAconfigurationcanbeusedeveniftheuseofHSPAinRRC
connectionphaseisnotallowedfortheCSvoiceoverHSPAcapableUE.Alsothe
channeltypeswitchtofullHSPAconfigurationcanoccur.ThismayhappenwhenHSPA
canbeselectedwithnormalchanneltypeselectionfortheUEinquestion.However,in
caseofpriorityoremergencycall,whentheuseofHSPAisnotallowedwiththe
FDPCHSetupECparameter,theHSPAcannotbeusedinRABphaseeither.

AllocationofF-DPCHintargetRNCduringinter-RAThandoverfrom
LTE
F-DPCHallocationfortheUEduringinter-RAThandovertoUTRANfromLTEfollowsthe
principlesdescribedinConfigurationneededforF-DPCHandConditionsforallocatingFDPCHinUE.TheselectionofULandDLchanneltypeforSRBsduringinter-RAT
handovertoUTRANfromLTEfollowstheprinciplesdescribedinTheuplinkand
downlinkchanneltypeselectionbetweenSRBsonDCH,SRBsonHSUPA,andSRBs
onHSPAwiththefollowingexception:
SincetheCPICHEcNoandCPICHRSCPmeasuredresultsofthetargetcellarenot
forwardedbytheLTEsystemtothetargetRNCintheRelocationRequestmessage,the
targetRNCisnotawareofthesevaluesforthetargetcellduringtheresourceallocation.
HencethefixedvalueofCPICHEcNoisusedforthetargetcellwhensomecomparison
needstobemade.TheCPICHEcNovalueiscomputedbythecell-specificpacket
schedulerasindicatedintheequation:
Figure 38

104

CPICHEcNovaluecalculation

DN0638161

R: 104/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

where:
Ptx,CPICHisthecodepowerofthePrimaryCPICHand
isthetransmittedcarrier
power.TheirvaluesaredefinedasdescribedintheWCDMA RAN RRM Admission
Control.
HencethecomputedCPICHEcNo(C)valuemustfulfillthefollowingcriteriabeforeitis
possibletomapSRBsonHSPA:
CALC_CPICH_ECNO>LOAD_BASED_CPICH_ECNO_SRB_HSPA
where:
CALC_CPICH_ECNOisCPICHEcNovalueobtainedusingFigure38:CPICHEcNo
valuecalculationequation.
LOAD_BASED_CPICH_ECNO_SRB_HSPAisthecoverageareaofSRBsonHSDPA
definedbytheLoadBasedCPICHEcNoSRBHSPAWCELparameter.
LoadBasedCPICHEcNoSRBHSPAparameterisalsousedinCTSfrom
CELL_FACH,CELL_PCH,URA_PCHtoCELL_DCHscenarioswhentheCPICHEcNo
measurementresultoftheservingcellisnotreportedbytheUE.Thisisageneric
changeforSRBsonHSPAfeatureandisnotaffectedbytheLTEInterworkinglicense
state.
IftheLoadBasedCPICHEcNoSRBHSPAparameterhasvalue0thenonlyDCHallocation
ispossibleforSRBs.

RRCconnectionestablishmentwithstandaloneSRBsonHSPA
TheRNCisabletoestablishstandaloneSRBsonHSPAinsteadSRBsonDCH/DCH.
ThedecisionwithcriteriaandtheCPICHEcNomeasurementmustbefulfillthefollowing
criteriabeforeitisabletomapSRBsonHSPA:
MEAS_CPICH_ECNO>CPICH_ECNO_SRB_HSPA
Where:
MEAS_CPICH_ECNOisCPICHEcNoismeasurementresultofthecellreportedbyUE.
CPICH_ECNO_SRB_HSPAiscoverageareaofSRBsonHSDPAdefinedbythe
managementparameterCPICHECNOSRBHSPA.
ThisthresholdisusedduringthestatetransitionfromIDLE,CELL_FACH,CELL_PCH
andCELL_URAtoCELL_DCHstate,andduringthesetupoftheRABwhentheCPICH
RSCPmeasurementresultisnotreportedbyUE.
IftheRSCPisdefinedwithWCEL-RACHIntraFreqMesQuantparameterasa
measurementquantityforRACHmeasurement,thedecisionwiththecriteriadefinedin
AllocationofF-DPCHinRRCconnectionsetupphaseaswellastheCPICHRSCP
measurementmustbothfulfillthefollowingcriteriabeforeitisabletomapSRBson
HSPA:
MEAS_CPICH_RSCP>CPICH_RSCP_SRB_HSPA

Issue:06H

DN0638161

R: 105/396

105

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

Where:
MEAS_CPICH_RSCP is CPICH RSCPisthemeasurementresultofthecellreportedby
theUE.
CPICH_RSCP_SRB_HSPAisthecoverageareaofSRBsonHSDPAdefinedbythe
CPICHRSCPThreSRBHSDPAmanagementparameter.
TheusedUEcapabilityoftheHS-PDSCHcategoryis11andtheE-DPDCHcategoryis
1inthiscase,whenthemaximumbitrate/configurationofthestandaloneSRBson
HSPAisdefined.
TheusedE-DCHTTIis10mswithSTconfigurationandthemaximumsymbolrate
correspondingSF32.
TheRNCincludesIEE-DCH Maximum BitratewithinRadiolinksetupmessagesentto
theBTSwithvalueof35kbit/s.
ForDLSRBs(SRBsonHS-DSCH)theallocatedbitrateis38.4kbps.
WhenthecompleteRRCconnectionsetupisreceivedwithUEcapabilityinformation,it
istakenintoaccountduringU-PLANE(RB)resourceallocationofRAB.IftheHS-DSCH
physicallayercategorysignaledtotheBTSdiffersfromtheonereceivedfromtheUE,it
isupdatedtowardstheBTSduringtheRBsetupoftheRABbyusingNBAP:RADIO
LINKRECONFIGURATIONPREPAREmessage.
TheRNCdoesnotstarttheinter-frequencymeasurementswhenonlySRBsonEDCH/
HS-DSCHisallocatedfortheRRCconnection.
TheRNCstarts/modifiesintra-frequencymeasurementswhenonlySRBsonEDCH/HSDSCHisallocatedfortheRRCconnection,thatiswhenanyRBsdoesnotexist.Intrafrequencymeasurementsarestarted/modifiedasincaseofRBallocationwithHSPA
withfollowingmodifications:

PeriodicalCPICHEcNomeasurementisstartedwithCPICHRSCPreporting
quantitysetTRUE.

ULSIRErrormeasurementisnotstartedbeforeE-DCH/HS-DSCHuserplane(RB)
allocation.

NotethatiftheSRBismappedtoHSPA(E-DCH/HS-DSCH)ortoHSUPA(EDCH/DCH),thentheperiodicalCPICHEcNomeasurementsarealsostartedwhenAS
size=1.
WhentheE-DCH/HS-DSCHuserplane(RB)allocationhasbeendone,theSIRerror
measurementisconfiguredbasedontrafficclassoftheservice(s)oftheRABdefinedof
theRB.
Handlingofstandalonesignalinglinkinsoft/softerhandoverdoesnotdifferbetween
SRBsonE-DCH/HS-DSCHallocationandSRBsonDCH/DCHallocation.

106

DN0638161

R: 106/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

7.3 DirectNRTresourceallocation
DirectNRTresourceallocationwhenF-DPCHandHS-DSCH/E-DCH
alreadyexist
IftheHS-DSCH/E-DCHandF-DPCH(possiblyalsoDCH0/0kbit/s)configuration
alreadyexists,theRRMmapsNRTRBintheNRTRABsetupdirectly,withoutwaitingfor
thenextschedulingmomentfortheexistingHS-DSCH/E-DCH.Incasewhenthe
RANAP:RABASSIGNMENTREQUESTmessagecontainstwoormoresimultaneous
NRTRABsetups,oneismappedtotheexistingHS-DSCH/E-DCH,andtheothertothe
DCH0/0kbit/s.ThedirectresourceallocationisattemptedforthehighestpriorityRAB.
ThepriorityoftheRABisdefinedbytheSPI(SchedulingPriorityIndicator).IftheSPI
valuesarethesame,theTC(TrafficClass)andTHP(TrafficHandlingPriority)areused
fordifferentiation.IfRANAP:RABASSIGNMENTREQUESTcontainsRTRABin
additiontoNRTPSRAB,thedirectresourceallocationisnotattemptedforNRTPSRAB
buttheDCH0/0kbit/sisallocated.
ThisisvaliddirectlyaftertheRRCconnectionsetup,andalwayswhenNRTRABisset
upafterwards.
ForthehighestpriorityRAB,atfirsttheproceduredoesnotrequiretheDCH0/0kbit/s
allocationandtheRB>0/>0allocation,basedontrafficvolumemeasurementreport.
Bothcell-specificPScheckandUE-specificPScheckareperformed(beforethe
procedureisattempted)iftheRBmappingtoHSPAispossible.Thefollowingcriteriaare
checked:

UECapability(RLClayer)

RABcombinationsupportedfortheUEwhenF-DPCHisallocated
(FDPCHAndSRBOnHSPATC)

TrafficClass/TrafficHandlingPriorityisallowed(HSDSCHQoSclassesand
EDCHQOSClasses)

maximumnumberofHS-DSCHMAC-dflows

IftheRBmappingtoHSPAisnotpossible,theDCH0/0kbit/sisallocated,andtraffic
volumemeasurementsarestartedaccordingtotheexistingprinciples.Afterthat,
similarlytotheexistingfunctionality,theUEandcell-specificpacketschedulershandle
thereceivedcapacityrequests.Thefailedproceduredoesnotaffectthechannel-type
selectionorschedulingofthecapacityrequests.
F-DPCHisreleasedifitispreventedbyFDPCHAndSRBOnHSPATCparameterwhena
capacityrequestarrivesfromtheRABinquestion.Similarly,HSPAisreleasedifitis
preventedbyHSDSCHQoSclassesorEDCHQOSClassesparameterswhenacapacity
requestarrivesfromtheRABinquestion.
AllocationoftheDirectResourceAllocation(DIREAL)featurewhenF-DPCHandHSDSCH/E-DCHalreadyexistissupportedasspecifiedabove.Thisfunctionisnot
controlledbyRNCRABDRAEnabledparameter.DIREALhasnoimpactontheSRBCTS
andF-DPCHallocation.

Issue:06H

DN0638161

R: 107/396

107

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

HS-DSCHMAC-dflowsetupwithDirectResourceAllocation
(DIREAL)
WithsupportofDirectResourceAllocation(DIREAL),theRBscanbealreadymappedto
HSPA/HSDPAduringRABsetup.
WhentheUErequestsanewPSNRTserviceandtheRABtobeestablishedsupports
theHS(D)PAconfiguration,then,ifneeded,theHS(D)PARBismappedtotheincoming
RAB.
IftheE-DCHallocationisnotpossibleduringdirectresourceallocation,andthecellspecificPStriesfortheUL-DCH/HS-DSCHconfiguration,thenthe
HSDPAinitialBitrateULparameterdefinesthebitrateforUL-DCH.ThisUL-DCHbit
ratecanbemodifiedbycapacityrequestsfromtheUE.
TheRAN1762: Direct Resource AllocationisnotappliediftheDLRBandULRBboth
aremappedtoRel99DCH.
NotethatduringsetupoftheNRTRAB,RBresourceallocationisperformedbeforenew
RABcanbeadmitted.SetupoftheNRTRABcanbeperformedwithoutsuccessfulRB
resourceallocation,thatis,whentheDCH0/0RBisallocatedforNRTRAB,andtraffic
volumemeasurementsarestartedinULandDLdirectionsasdefinedinWCDMA RAN
RRM Packet Scheduler.
IftheUEisinCell_DCHstate,thesynchronizedNBAPradiolinkreconfiguration
procedureisusedforthesetup/reconfigurationoftheMAC-dflowintheHS-DSCH
servingcell.TheRRCreconfigurationprocedureoftheRBisusedtosetupthe
configurationintheUE.
TheRBsetupwithHSPAallocationcouldalsobeperformedinCell_FACHstate.Inthis
case,thestatetransitionfromCell_FACHtoCell_DCHbeginsandHSPAallocationis
performedfornewRB.
DIREALisnotsupportedforalltheRABsinthemulti-RABrequestcominginasingle
RANAP:RABASSIGNMENTREQUEST.
IfRANAP:RABASSIGNMENTREQUESTcontainsmorethanoneNRTPSRAB,the
DIREALforHSPA/HSDPAisattemptedforthehighestpriorityRAB,onlyifRNC
HSPAMultiNRTSupportparameterisenabled.IncasewhentheRNC
HSPAMultiNRTSupportparameterisdisabled,theDIREALforHSPA/HSDPAisnot
attempted.
ThepriorityoftheRABisdefinedbytheSPI(SchedulingPriorityIndicator).IftheSPI
valuesarethesame,theTC(TrafficClass)andtheTHP(TrafficHandlingPriority)is
usedfordifferentiation.IfallSPI,TC,andTHPforRABarethesame,theorderofRAB
receivedinRANAP:RABASSIGNMENTREQUESTisused.
DIREALforHSPA/HSDPAissupportedforanewsecond/thirdPSNRTRABifother
RABsexists.
DIREALissupportedforDC-HSDPAwhenallprerequisites,describedinDual-Cell
HSDPAchapter,aremet.
DIREALissupportedforMIMOwhenallprerequisites,describedinMIMO(MultipleInput
MultipleOutput)chapter,aremet.

108

DN0638161

R: 108/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

7.4 Dual-cellHSDPAallocation
DCHSDPAallocationisattemptedinsteadofSCHSDPAwheneveritispossible.
DCHSDPAwithoutMIMOcanhavenon-servingbranchoverIurwhenSRBsare
mappedtoDCH.InothercasesHSPAoverIurisnotsupportedwithDCHSDPA.
SRBsonHSPA/HSUPAareswitchedasSRBsonDCHwhenthefirstbranchoverIuris
tobeaddedtotheactiveset.WhenSRBsareonDCH,oneortwoHSUPAsofthandover
branchesoverIuraresupportedinDCHSDPAconfiguration.
TheRRMallocatesDCHSDPAfortheUEonlyif:

Issue:06H

EitherF-DPCHorDCHforSRBsisallocatedorispossibletobeallocatedforthe
UE.ChanneltypeselectionforSRBs,whenDCHSDPAistobeallocated,isdefined
inMappingofSRBsincaseofDCHSDPA.

ThereisnoradiolinkoverIurintheactivesetwhenF-DPCH(SRBsonHSPA)or
SRBsonHSUPAaretobeused.

DCHSDPAisenabledwiththeDCellHSDPAEnabledRNPparameterintheHSPA
servingcellanditsadjacentDCHSDPAcellpairinthesamecellsector.

InfixedDCHSDPAconfigurationtheUEiscurrentlyinpotentialprimarycell.Fixed
DCHSDPAconfigurationmeansthatonlytheothercelloftheDCHSDPAcellpairis
capabletoactastheprimarycell.DCHSDPAconfigurationisfixediftheothercellof
theDCHSDPAcellpairdoesnotsupportHSUPA.

InflexibleDCHSDPAconfigurationtheUEiscurrentlyineithercelloftheDC
HSDPAcellpair.FlexibleDCHSDPAconfigurationmeansthatbothcellsoftheDC
HSDPAcellpairarecapabletoactastheprimarycell.

DCHSDPAisallowedforusedservicecombination.Formoreinformation,seeDC
HSDPAsupportedforNRTPSdata.

UEhasinformedthatitsupportsDCHSDPA.SeeSelectionbetweenDCHandHSDSCHchapter.

BTShasinformedthatitsupportsDCHSDPA.SeeDual-CellHSDPAchapter.

FlexibleRLCisallocatedorispossibletobeallocatedfortheUE.FlexibleRLCis
allowedtobeallocatedfortheUEonlywhentheBTShasinformedthatbothprimary
andsecondarycellsupportsit.

QoSAwareHSPASchedulingiseitheractivatedordeactivatedinbothcellsofthe
DCHSDPAcellpair.

DCHSDPAcanbeallocatedwithMIMOiftheDCHSDPAwithMIMOfeatureis
supportedbytheBTSandUE.ThisisdefinedwiththeDCellAndMIMOUsageWCEL
parameter.Ifsimultaneoususageisimpossible,theDCellVsMIMOPreference
RNCparametercheckisvalid.

HSDPAMobilityisenabledintheRNC.

ActivityofcertainfeaturesintheDCHSDPAcellpairarecheckedinthecell-setup
phaseandarethusbehindtheDCellHSDPAEnabledRNPparameter.

ULloadbasedACforHSPA+featuresallowstheallocationofDC-HSDPA.This
checkisdoneonlyifthisMassEvenHandlerfeatureisenabled.

DN0638161

R: 109/396

109

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

Allocationof64QAMisallowedbytheRNCwhenbothcellsintheBTSsupportsit,the
UEsupportsit,anditisenabledinbothcellsusingtheHSDPA64QAMallowedRNP
parameter.
AllocationofDCHSDPAwithMIMOisallowedbytheRNCwhenbothcellsintheBTS
supportsit,theUEsupportsit,andwhentheconditionsdescribedinActivationinthe
primaryandsecondarycellsectionaremet.
TheRRMcontinuouslymonitorsthepreviousrulesandifatleastoneofthemrestrictthe
useofDCHSDPA,theRRMreconfigurestheRRCconnectionfromtheDCHSDPA
modetoaSCHSDPAoraDCHmode.Also,iftheDCHSDPAmodebecomespossible,
andSCHSDPAorDCHiscurrentlyallocated,theRRMreconfigurestheRRC
connectionfromDCHorSCHSDPAmodetoaDCHSDPAmode.
Whentheexistingalgorithmstriggerchannel-typeswitchfromDCHtoHS-DSCHorfrom
DCHtoE-DCH,theRRMprimarilytriestoallocatetheDCHSDPAsimultaneously,if
possible.Ifnot,thenSCHSDPAisattemptedtobeallocated.
TheminimumintervalbetweenthetwoconsecutiveDCHSDPAallocationsofcertainUE
isnotlimitedbecausetheSCCs,F-DPCHallocations,andstreamingRB>0/>0
allocationscancauserepeatedproceduresthatarealreadylimitedwiththeexisting
algorithms.
WhentheDCHSDPAisalreadyallocatedandthereistheneedforSCCtothecell
whichdoesnotsupportDCHSDPA,theprocedureisperformedsothattheSCCandDC
HSDPAtoSCHSDPAreconfigurationisperformedwithoneNBAP/RRCreconfiguration
procedure.
Inordertoreachthemaximumpeakrateof42Mbit/sbyDCHSDPA,theHSDPA64
QAMfeatureisrequired.
TheCPCisactivatedfortheRRCconnectiononlyiftheUEsupportstheCPCandthe
CPCisenabledintheprimarycell.OtherwisetheCPCisnotactivatedfortheRRC
connection.TheCPCisnotrequiredfromthesecondarycell.
BasicconditionsforDual-Cell HSDPAdescribedinthischapterarevalidalsoforDual
Band Dual Cell HSDPA(DB-DC-HSDPA).

MappingofSRBsincaseofDCHSDPA
TheRRMmakesadecisiontomaptheSRBstoHSPA,HSUPA,orDCHwhentheDC
HSDPAisused.Thefollowingrulesarefollowed:

110

ThebasicSRBmappingrulesarevalidinDCHSDPAcase.

IftheF-DPCHisallocatedorispossibletobeallocatedfortheUEintheprimary
layer,thentheSRBsaremappedtoHSPA.ThatiswhenboththeUEandnetwork
supporttheF-DPCH.
NotethattheF-DPCHmustbeallocatedinallcellsofcurrentDCHactiveset,and
theE-DCHactivesetisequaltoDCHactiveset.

IfitisnotpossibletoallocatetheF-DPCHfortheUEintheprimarylayer,thenthe
SRBsaremappedtoHSUPAorDCH.ThathappenswhentheUEornetworkdoes
notsupporttheF-DPCH.

DN0638161

R: 110/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

SRBsonHSPAaretheSRBsmappedtoDL/UL:HS-DSCH/E-DCHwithF-DPCHandEDCHTTI2msor10mssupported.
SRBsonHSUPAaretheSRBsmappedtoDL/UL:DCH/E-DCHwithE-DCHTTI2ms
supported.
SRBsonDCHaretheSRBsmappedtoDL/UL:DCH/DCH3.4kbit/s.

UseofDCHSDPAdeniedbytheoperationalstateofthecell
IftheoperationalstateofthesecondarycellgetsblockedduringtheDCHSDPA
allocation,theRRMreconfigurestheDCHSDPAallocationasaSC-HSDPAallocation.If
theoperationalstateoftheprimarycellgetsblockedduringtheDCHSDPAallocation,
theRRMreleasestheDCHSDPAallocation.
TheRRMdoesnotallocateDCHSDPAiftheoperationalstateofthesecondarycellis
blocked.Normally,theRRMdoesnotallocateDCHSDPA(orSCHSDPA)ifthe
operationalstateoftheprimarycellisblocked.

RNCproceduresafterfailedDCHSDPAallocationorservingcell
changebecauseofanytypeofcongestion
IfthereisanumberofUEspercell/MAC-hs/ehsscheduler,numberofHS-DSCHMAC-d
flowspercell/MAC-hs/ehsscheduler,F-DPCHcode,F-DPCHslotformat,TRS,orRNC's
DSPcongestionduringtheDCHSDPAallocationattemptorduringtheservingcell
change,theRRMdoesnottrytoallocatetheSCHSDPA,butinsteadthe
UL:DCH/DL:DCHconfigurationisattempted.
IncaseofanumberofUEspercell/MAC-hs/ehsscheduler,anumberofHS-DSCH
MAC-dflowspercell/MAC-hs/ehsscheduler,F-DPCHcode,F-DPCHslotformat,BTS,
TRS,orRNC'sDSPcongestion,theSCHSDPAallocationalsofailsiftheDCHSDPA
allocationhasfacedcongestion.InalltheabovementionedcasestheSCHSDPA
allocationrequiresthesameamountofresourcesastheDCHSDPAallocation.
IfthereisaBTScongestionduringtheDCHSDPAallocationattemptorduringserving
cellchange,theRRMtriestoallocateUL:DCH/DL:HS-DSCHconfiguration.Exceptionis
whentheBTShasrespondedwithNBAPcausevalueDL Radio Resources not
Available.InthatcasetheRRMtriestoallocateUL:DCH/DL:DCH.
IncaseoftheBTScongestionalsotheHSUPAcanbecongested.However,theBTS
doesnotindicatethatwiththespecialcausecodeandthustheRRMretriesallocation
procedurewithouttheHSUPAforthecasewhenuplinkhasbeenthecongested
direction.ThisisalsosimilartoSCHS-DSCHcase.
Formoreinformation,seeHSPART-over-NRTprocedureinDCHSDPAuserisatarget
inHSPART-over-NRTproceduresection.

7.5 Admissiondecision
ForallnewHS-DSCHMAC-dflowsitischeckedifthemaximumnumberofMAC-dflows
percellandmaximumnumberofHSDPAuserspercellisnotexceeded.These
maximumvaluesdependsonthevaluesoftheMaxNumberHSDSCHMACdFlows,

Issue:06H

DN0638161

R: 111/396

111

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

MaxNumberHSDPAUsers,HSDPA48UsersEnabled,HSDPA64UsersEnabledand
HSPA72UsersPerCellparameters.Dependingontheuser'smulti-RABcombinations
(seeRABcombinationsforHSDPA),oneHSDPAusercanhaveassignedmultipleHSDSCHMAC-dflows.
IfonlybasicHSDPAfunctionalityisenabled,theRNClimitsthemaximumnumberofHSDSCHMAC-dflowsto16usersinthecell.
IfHSDPA 48 Users per CellfeatureisenabledbytheRNC-levelRNPparameter
HSDPA48UsersEnabled,theabsolutemaximumnumberofHSDPAusersinthecellis
48,otherwiseitis16.
ThemaximumnumberofHSDPAusersinthecellis64iftheHSDPA 64 Users per Cell
featureisenabledwiththecelllevelRNPparameterHSDPA64UsersEnabled.When
theHSDPA64userspercellfeatureisnotenabled,theabsolutemaximumnumberof
HSDPAusersinthecelldependsonwhethertheHSDPA48userspercellfeatureis
enabledornot.
ThemaximumnumberofHSDPAusersinthecellis72iftheHSPA 72 Users per Cell
featureisenabledwiththecelllevelRNPparameterHSPA72UsersPerCell.Whenthe
HSPA72userspercellfeatureisnotenabled,theabsolutemaximumnumberofHSDPA
usersinthecelldependsonwhichfeature(HSDPA64userspercell,HSDPA48users
percell)isenabledornot.
ThemaximumnumberofHSDPAusersinthecellis128iftheHSPA 128 Users per Cell
featureisenabledwiththecelllevelRNPparameterHSPA128UsersPerCell.Ifthecell
doesnotindicateusageofRel2BBHW,then128usersisnotallowedevenifHSPA 128
Users Per Cellfeatureisenabledinthecell.Whensomeofthecelllevelmanagement
parameterslimitstheusernumber,themaximumnumberofHSDPAuserspercellisset
accordingtothelimitingparameter.
ThemaximumnumberofHSDPAusersdependsonwhichofthosefeaturesisactivated
tothecellwiththoseparameters.Theuseramountcanberestrictedwiththat
MaxNumberHSDPAUsersparameter.
BeforeresourcesforRTRBsarereserved,admissioncontrolconfirmsthatenoughfree
resourcesareavailablesothatthedesiredguaranteedbitrate(GBR)canbeachieved.
SettingupRABswithaGBRhaseffecttothehandlingofRANresourcesinthefollowing
cases:

112

RABsetup

ActivitychangeforPSservicefrominactivetoactive

HS-DSCHservingcellchange

ChanneltypeswitchbetweenDCHandhighspeedtransportchannels(HS-DSCH/EDCH)

Hardhandover

RRCre-establishment

DN0638161

R: 112/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

SRNSrelocation

Inthisway,servicesofalreadyadmitteduserswiththesameorahigherpriorityarenot
affected.Thatmeans,HSDPAuserswithRTRBswillbeadmittedifthepowerrequired
forthisserviceisavailable.TherequiredpowerisestimatedbySRNC/ServingFlexi
DirectRNC'sadmissioncontrol,basedonthe

TotalDLpowerusedforHSDPAinthecell

Guaranteedbitrate(GBR)requirementoftheUEwhichistobeadmitted

Estimatedtotalthroughputofthecell

Activityfactoroftheservice

Iftheamountoffreeresourcesisnotsufficientorthemaximumnumberofuserspercell
areotherwiseexceeded,admissioncontrolcheckswhetherRT-over-NRT,RT-over-RT
and/orpre-emptionactionscanpossiblybeexecuted.InRT-over-RTandRT-over-NRT
thetargetRABisnotreleasedbuttheresourcesusedbythisRABarereleased.
Howeverincaseofpre-emptiontargetRABisreleased.
IfboththeresourcechecksfailandRT-over-NRTactionsareeithernotpossibleornot
successful,thismayalsoleadtosituationsinwhichtheRTRABisrejectedandDCHis
nottried.

HSDPApreventionbecauseofVoicecallprioritizationduringhigh
trafficload
TheRAN2954: Voice call prioritisation during high traffic loadfeatureutilizestheDL
poweradmissioncontrol(AC)whereAMRCSDCHspeechcallcanbeadmitted.This
happens:

Issue:06H

if(Ptx,nc+Ptx,nc)<(PtxTarget+PtxOffset).

whentherearesimultaneousHSDPAusersinthecell.

DN0638161

R: 113/396

113

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

Figure 39

WCDMARANRRMHSDPA

Voicecallprioritizationduringhightrafficload

Iftheestimatednon-controllabletxpowerisequalorhigherthanthethreshold
determinedbytheVCPPtxOffsetWCELparameter(Ptx,nc(PtxTarget
VCPPtxOffset)),thentheRNCstartsusingthetemporary maximum number of HSDPA
users(TMHD)determinedbytheVCPMaxHSDPAUsersWCELparameter.
Atthesametime,whentheRNCstartsusingtheTMHD,thetimerMinimum duration of
temporary maximum number of HSDPA users(determinedbythe
VCPHSDPAPrevDurationRNHSPAparameter)isstarted.Thetimerisalso
started/restartedeverytimewhenAMRCSDCHspeechcalldoesnotpasslegacyDL
AC,asdescribedin WCDMA RAN RRM Admission Control.IftheTMHDisrunningand
theAMRCSDCHcalldoesnotpassthelegacyDLAC,theTMHDremainsinuse.
TMHDisnothigherthantheallowedvalueforthemaximumnumberofHSDPAusersin
thecelldeterminedbythespecificlicensesandWCELparameters(seeMaximum
numberofHSDPAuserschapter).TMHDistakenintoaccountforanewHSDPA
allocation,includingSCCandothermobilityprocedures.TheTMHDdoesnotinitiate
HSDPAreleasesorchanneltypeswitchestoDCH.
IftheHSDPApreventionison,theincreasedtrafficvolumemeasurement(TVM)
(enabledbytheMassEventHandlerWCELparameter)pendingtimeistakenintouse.
TheincreasedTVMpendingtimefunctionisdescribedinWCDMA RAN RRM Packet
Scheduler.
TheHSDPApreventionceasesandtheoriginalmaximumnumberofHSDPAusersare
restoredif:

114

Ptx,nc<(PtxTargetVCPPtxOffset),and

TimerMinimum duration of temporary maximum number of HSDPA usershas


expired.

DN0638161

R: 114/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

RestorationoftheoriginalmaximumnumberofHSDPAuserscanbeperformed
immediatelyorgradually.Themodeofrestorationischosenbyusingthe
VCPHSDPAUserIncrRNHSPAparameter.
IfthevalueoftheVCPHSDPAUserIncrparameterissetto0,theoriginalvalueis
restoredimmediately.Ifanyothervalueisset,thecell-specificPSrestorestheoriginal
valuegradually,asfollows:

AftertheHSDPApreventionceases,TMHDisincreasedbytheIncrement.

TheIncrementisdeterminedbytheVCPHSDPAUserIncrRNHSPAparameter.

AfterTMHDincrease,1secondtimerisset.

After1secondtimerexpires,TMHDisincreasedagain.

GradualincreaseisstoppedwhenTMHDreachestheoriginalmaximumnumberof
HSDPAusers.

7.5.1 PSNRTservices
IfthereisanattempttoreserveresourcesforNRTRBmappedtoHS-DSCHtransport
channel,thenonlyuser-amountchecksareexecuted.Ifthecheckdoesnotsucceed,
thenthereisanattempttoreservetheDCH.Formoreinformationonchecking,see
MaximumnumberofHSDPAusers.

7.5.2 PSRTservices
InadditionoftheuseramountcheckalsotheDLpowerischeckedincaseofthePS
streaminguser.
FigureFigure40:ResourcechecksforPSstreamingdepictsthegeneralbasic
mechanismoftheDLpowercheckforstreamingusers.

Issue:06H

DN0638161

R: 115/396

115

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

Figure 40

WCDMARANRRMHSDPA

ResourcechecksforPSstreaming

ThepowerneededbyanewHSDPAstreaminguserisestimatedasfollows:
Figure 41

EstimatedpowerfornewHSDPAstreaminguser

with
PtxHSPDSCH

CurrenttotalDLpowerusedforHSDPAinthecell
Itiscalculatedasthetotaltransmittedpowerintheservingcells
(PtxTotal),subtractedbyboththeaveragedestimatedPtxnonHSPA
andtheestimatedpowerusedbyHSUPADLcontrolchannels
(PHSUPADLCNTRCHs),thatis:

116

DN0638161

R: 116/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

PtxHSPDSCH=PtxTotal-PtxnonHSPA-PHSUPADLCNTRCHs
PHSUPADLCNTRCHs,inturn,dependsonthetotalnumberofHSUPA
users(#HSUPA_UEs),theHSUPANRTuserswith10msE-TTI
(#ST1_UEs),thenumberofHSUPANRTusers(#ST2_UEs),andthe
cell'smaximumoutputpower(Pmax),thatis:

GBRnew

whentheHSUPADLcontrolchannelpowercontrolisnotinuse:
PHSUPADLCNTRCHs=[#HSUPA_UEs*0.0013+#ST1_UEs*0.0005+
MIN(0.009,#ST2_UEs*0.009/15)]*Pmax

whentheHSUPADLcontrolchannelpowercontrolisinuse:
PHSUPADLCNTRCHs=[#HSUPA_UEs*0.0006+#ST1_UEs*0.0002+
MIN(0.0042,#ST2_UEs*0.0042/15)]*Pmax

GuaranteedbitraterequiredbytheUEwiththestreamingservice
whichrequeststobeadmitted

Throughputawg
Estimatedtotalthroughputofthecell
Thethroughputiscalculatedbasedonthe

Averagesignal-to-interference-and-noiseratioexperiencedbythe
newUE(HS-DSCHSINRavg),

ModulationandcodingschemesupportedbyboththeUEandthe
BTS,

NumberofreservedHS-PDSCHcodes.

ThecalculationoftheaverageSINRdependsonwhetherornottheCPICHEc/N0is
available,seeequationsFigure42:AverageHS-DSCHSINRifCPICHEc/N0is
availableandFigure44:AverageHS-DSCHSINRifCPICHEc/N0isnotavailable,
respectively.
Figure 42

AverageHS-DSCHSINRifCPICHEc/N0isavailable

where

Issue:06H

SF16

Spreadinggainofspreadingfactor16(equalsto16)

PCPICH

TransmissionpoweroftheP-CPICH

DN0638161

R: 117/396

117

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

Ec/N0

LatestreceivedP-CPICHEc/N0,reportedbytheUEfortheserving
cell

(alpha)

DLorthogonalityfactor,definedbytheOrthogonalityRNP
parameter

However,ifthefollowingconditionistrue:
Figure 43

AverageHS-DSCHSINRifCPICHEc/N0isavailable(conditionfor
(alpha)=0)

Thefixedvalue0isusedfor(alpha)whentheaverageHS-DSCHSINRiscalculated
withCPICHEc/N0.
Figure 44

AverageHS-DSCHSINRifCPICHEc/N0isnotavailable

where
(Eb/N0)i

DLplannedEb/N0forthei:thcontrolplaneoruserplaneserviceofthe
userdefinedforthedifferentservicesbytheEbNoPlannedCSAMRDL
andEbNoPlannedSLDLmanagementparameters
Eb/N0isprovidedinlinearform

Numberofdifferentcontrolplaneoruserplaneservicesoftheuser

WCDMAchiprate

Ri

Userbitrateofthei:thservice

WhenCPICHEcNoandPtx_averagemeasurementsarenotavailable,theCPICHEcNois
estimatedwiththefollowingformula:

118

DN0638161

R: 118/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Figure 45

UE-specificresourcehandling

CPICHEcNocalculationwhenCPICHEcNoandPtx_averagemeasurements
arenotavailable

Where:
Ptx,CPICHisthetransmissionpowerofthePrimaryCPICHdefinedwiththe
PtxPrimaryCPICHmanagementparameter.
Ptx_totalistheaveragedestimatedtransmittedcarrierpower.
EstimatedEcNoisusedtodefineaverageSINRforthesituationwhenCPICHEcNo
reportisavailable.
AnewHSDPAstreaminguserwillthenbeadmittediftheamountofunused(free)power,
Pfree,issufficienttofulfilltheuser'srequirements.Inotherwords,Pfreehastobelarger
thantheestimatedpowerforthenewHSDPAstreaminguser,Pnew.Pfreeisthus
calculatedasshowninfigureFigure46:Calculationoftheunused(free)power.
Figure 46

Calculationoftheunused(free)power

with
Pmax

Cellmaximumoutputpower,definedbytheminimumofthefollowing
twoparameters:PtxCellMaxandMaxDLPowerCapability

PtxTotal

Currenttotaltransmittedpower

PtxInactive

PowerrequiredbyallinactiveRTRBsmappedtoDCHandHS-DSCH
andinactivePSRTRBsmappedtoDCH

FreePtxSafetyMarginStr
Safetymarginforunusedpowerwhichtheoperatorcanconfigured
withtheFreePtxSafetyMarginStrRNPparameter
PtxMaxHSDPA MaximumHSDPApowerdefinedbythePtxMaxHSDPAparameter
PtxnonHSPA

AveragedestimatedPtxnonHSPA

PtxInactiveHSDPA
SumpowerneededbyinactiveRTRBsofHSDPAusers
(Ptx,inactiveHSDPA)

Issue:06H

DN0638161

R: 119/396

119

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

Iftheamountofunused(free)powerishowevernotsufficienttoadmitthenewHSDPA
streaminguser,admissioncontroltriestoreservesomeadditionalpowerfrombothbest
effortusers,PBE,andusershavingbiggerbitratesthanpromised,PPB>GBR.Onlyifthe
sumofPBE,PPB>GBR,andPfreeislargerthantheestimatedpowerforthenewHSDPA
streaminguser,thatisPnew<PBE+PPB>GBR+Pfree,willthenewHSDPAstreaminguser
beadmitted.Otherwise,RT-over-NRTfunctionalityisappliedtoreserveextrapowerfor
theHSDPAstreaminguser.

7.5.3 CSservices
InadditionoftheuseramountcheckalsotheDLpowerischeckedincaseoftheCS
voiceuser.IncaseoftheuseramountcongestionforCSvoiceuser,theRT-over-NRT
andRT-over-RTisusedandafterthatDCHistried(pre-emptionisnotused).
TxpowerneededbyconversationalservicemappedtoHSDPAisestimatedby
admissioncontrol.EstimationisdoneinsamewayasincaseofPSstreamingexcept
thatactivityfactorisusedfortheservice:
Figure 47

PowerneededbynewCSvoiceservice

Where:
PnewistxpowerneededbynewCSvoiceservice
GBRisacalculatedguaranteedbitrateforAMRRAB
PtxHSPDSCHistxpowerthatcanbeusedforHSDPAinthecell
ActivityFactorisactivityfactorforCSvoiceservice,calculationbasedonmeasurements
isused(ifcalculatedvalueisnotavailable,thenvaluereadfromtheRNPparameter
RRMULDCHActivityFactorCSAMRisused)
ThroughputawgistotalHSDPAthroughputofthecell.Thevalueisestimatedbasedon
SINRandthenumberofHS-PDSCHcodes.
Admissiondecisionismadefortxpowerneededbyconversationalservicemappedto
HSDPA.TxpowerforthenewservicemappedtoHSDPAisfound,ifthefollowingtwo
conditionsarepassed:
1.PtxNCDCH+PtxNCHSDPA+Pnew<PtxTargetTot
2.PtxNCHSDPA+Pnew<PtxMaxHSDPA
where:
PtxNCDCHisnon-controllableloadofDCHside.Italsocontainsadmittedbutnotactive
CSservicesonDCH.
PtxNCHSDPAisexistingnon-controllableloadofHSDPAside.Italsocontainsadmitted
butnotactiveCSservicesonHSPA:

120

DN0638161

R: 120/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

admittedbutnotyetreconfiguredservices

admittedbutnotactiveservices(datatransferisnotstartedyet)

Pnewispowerneededbythenewservice
PtxTargetTotisthetotaltargetpowerfornon-controllableloadcalculatedforthisdecision
PtxMaxHSDPAisaRNPparametertodefinemaximumtxpowerthatcanbeusedfor
HSDPA.
Iftheconditionsarenotpassed,thenitischeckedcouldpre-emptionbeused.
Cell-specificadmissioncontrolappliesparticularconditionsinthedownlinkadmission
decisionsoftheresourcerequestsfortheestablishmentoftheWPScall.Whenthe
power-basedadmissiondecisionisdoneforthedownlinkresourcerequestoftheWPS
call,thentheconditions1and2areappliedsothatPtxTargetTotisreplacedwiththe
quantityMIN(PtxTargetTot+PtxOffsetWPS,PtxTargetTotMax).PtxOffsetWPSisthe
valueofthemanagementparameterPtxOffsetWPS.PtxTargetTotMaxisthevalueof
themanagementparameterPtxTargetTotMax.
AdmissiondecisionisalsomadefornumberofconversationalHSDPAusersperone
HSDPAcontrolcode.AdmissioncontrolchecksthatthenumberofadmittedHSDPA
conversationalusersdoesnotexceedthenumberofconversationaluserscalculatedby
thefollowingformula:
Figure 48

HSDPAconversationalusers

where:
MaxNbrofHSSCCHCodesisaRNPparameterdefiningnumberofusedHS-SCCHcodes
UsersPerHSSCCHCodeisaRNPparameterdefiningmaximumnumberofusersper
onereservedHS-SCCHcode.
Ifthisconditionisnotfulfilled,thenconversationalserviceistriedtobemappedtoDCH.
IftheRRCconnectionre-establishmentisbeingperformedwhentheUEhasCSvoice
overHSPA,thennoqualitychecksareperformed,andthetryisperformedonlytoacell
wheretheUEiscampedto.However,theneededresourcesarecheckedinACin
normalway(likeinRABsetup),andRT-over-(N)RTandpre-emptioncanbeusedtoget
missingresources.

7.6 Actionsincaseofunsuccessfulresource
reservation
IfBTSrejectsRLsetuporreconfigurationforHSDPAservice(DLreason),thenitis
handledliketheBTScannothandlenewHSDPAuseranymore.Ifthishappens,thenRTover-NRT,RT-over-RTorpre-emption(dependingonthecongestedservice)areusedto
getresourcesforthenewuser.

Issue:06H

DN0638161

R: 121/396

121

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

TransportresourcesareneededforRTservicemappedtoHSPAandifneeded
resourcesarenotavailable,thentransportrejectstheresourcerequestandthenRTover-NRT,RT-over-RTorpre-emptioncanbeusedtogetresourcesforthenewuser.
UnsuccessfuladmissiondecisionorresourcereservationinRABsetupfor
conversationalHSPAservicecancauseDCHreservation.IfHSPAreservationisnot
possiblewitheitherRT-over-(N)RTorpre-emption,thentheserviceattemptsDCH
mapping.OnDCHsidetheactionisperformedinaccordancewithDCHrules.However,
incaseofpower/interferencecongestionDCHmappingisnotattempted,butpreemptioncapablecallisadmittedevenifnocandidateforforcedreleaseisfound(call
withnopre-emptioncapabilityisrejectedinthiscase).Also,iftheDLACdoesnot
succeedbecauseofthemaximumHSDPApowerlimitation(PtxMaxHSDPA),thecallis
notrejected,buttheDCHreservationisattempted.
Ifthereasonfortheblockingisthereceivedwidebandinterferenceorthetransmitted
carrierpower,theCSvoicecall,whichmaytriggerthepre-emption,isadmitted.This
happenseventhoughnocandidateforforcedreleaseisfound.
Resourcechecksandresourcereservationcanfailforonlyuplink,onlydownlink,orboth
directions.Specialactionsaretakenwhenresourcereservationisnotsuccessfulwhen
DCH/HS-DSCHorE-DCH/HS-DSCHareusedinUL/DLdirection.Thesemeasuresare
appliedinthefollowingcases:

Case1:ResourcereservationfailsforthefirstPSRABoftheUEwhenUEdoesnot
haveotherPSRABs
SpecialactionsareexecutedduringRABsetup,statechangefrominactivetoactive,
servingcellchange,orchanneltypeswitchfromHS-DSCHtoDCHtransport
channelsinULand/orDLdirection.

Case2:ResourcereservationfailsforallPSRABsofoneUE
Specialactionsareexecutedduringservingcellchangeorchanneltypeswitchfrom
HS-DSCHtoDCHtransportchannelsinULand/orDLdirection.

Basically,ifnewresourcescannotbereservedbuttheassignedresourcescanbe
maintained,thecurrentresourcesarekeptandtheprocessofreservingnewresources
iscanceled.Thissituationmayoccurintheeventofnoncriticalservingcellchanges,for
example.Ifthecurrentlyallocatedresourcescanhowevernolongerbemaintained,a
step-by-stepprocedureisexecutedtotryandreservenewresources.Duringthis
procedure,wheneverRT-over-(N)RTorpre-emptioncasesoccurandwouldleadto
releaseoftargetresources,anumberofretriesarestartedtokeeptheseresourcesif
necessary.Thisnumber,inturn,iscontrolledbytheMaxNumberOfReAttemptsCong
parameter.

Actionsusedinunsuccessfulresourceallocationincaseofnotfull
HSPAconfiguration
Thesubsequentstepsareappliedinthegivenorder,wherestepn+1isonlyexecutedif
resourcescouldnotbereservedduringstepn:
1. ResourcesaretriedtobereservedforallPSRBs
Thefurtherproceedingdependsonthecauseofthecongestion:

122

DN0638161

R: 122/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

IfthenumberofMAC-dflowsishigherthanthethreshold,thoseMAC-dflowsof
theuserwhichexceedthethresholdaredropped.However,withtheCPC
feature,inactiveMAC-dflowsarefirstlydropped.

Ifthenumberofadmittedusershasexceededthethreshold,step3istakennext.

2. Reservationretry:ResourcesaretriedtobereservedforRBswiththehighest
priority.

Thefirstcriteriontodeterminethepriorityistherespectivevalueofthe
QosPriorityMappingparameter.Secondly,theradiobearer(RB)allocation
timesaretakenintoaccount,whereRABswiththeshortestRBallocationtime
areconsideredtohavehighestpriority.

However,withtheCPCfeature,theinactiveMAC-dflowsarereleasedfirst.

3. Reservationretry:PossibilitytotakeresourcesofexistingRBsischecked.
IfRT-over-NRTisapplied,resourcereservationcontinuesfromstep1forthoseRBs
whichexistedbeforestep3.
4. Reservationretry:IfE-DCHallocationcausedthefailure,allocationofDL/UL
combinationHS-DSCH/DCHistriedinstead.
5. Reservationretry:DCHX/XistriedtobereservedforthePSRBwiththehighest
priority,determinedinstep2.
X/XthusmeansinitialbitratesincaseofNRTservicesandGBRsincaseofRT
services.
6. Reservationretry:PossibilityforRT-over-NRTactionsischeckedagainwhenaRT
RBisaffected,seePre-emption,RT-over-RTandRT-over-NRT.
7. Releasingresources:DCH0/0isallocatedforallPSRBs.
ThepowerrequiredtoadmitanewHSDPAuserisonlycheckedforRTRBs,butnot
checkedandreservedforHSDPANRTRBs.Asaconsequence,missingpowerduring
resourcereservationphasedoesnotcauseHSDPANRTRBstobedropped.

Actionsusedinunsuccessfulresourceallocationincaseoffull
HSPAconfiguration
ReservationforHSPAresourcesisdonebyusingthefollowingstepswhenthereisa
musttogetnewresources(inothercasetheexistingresourcesarestillused):
1. ResourcesaretriedtobereservedforSRBsandforallRBspassingtheAC

Issue:06H

AtleastSRBsandRBwiththehighestQoSprioritymustanywaypasstheACin
ordertodoresourcereservationinthisstep.

IfallRBsdoesnotpasstheAC,thenallotherRBsthanRBwiththehighestQoS
prioritycanbedroppedinorderofQoSpriority(thosethatdoesnotpasstheAC
aredropped).

IfatleastRBwiththehighestQoSprioritydoesnotpasstheAC,thenRBwith
theQoShighestpriorityisselectedforthenextsteps.

Ifthepower/interferenceACdoesnotsucceed,thepossibleNRTRABsofthe
UEarenotmappedtoDCH0/0whentheresourcesreservationisattempted
againafterthe(N)RT-over-NRTorpre-emptionactions.

DN0638161

R: 123/396

123

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

Ifconditionsofthissteparenotfulfilledorresourcereservationdoesnot
succeed,thennextstepistakenwithouttryforresourcereservationatall.

2. (N)RT-over-NRTorpre-emptioninHSPAsidefortheSRBsandRBselectedinstep
1

UsedfunctiondependsontrafficclassoftheRBusedinthisstep.

Iftargetsarenotfoundorresourcereservationdoesnotsucceed,thenthenext
stepistaken.

3. DCHreservationfortheSRBsandRBselectedinstep1(DCHswitch)

IncaseofE-DCHproblems,HSDPAconfigurationischeckedfirst(notpossible
withconversationalservice).

4. (N)RT-over-NRTorpre-emptioninDCHsidefortheRBselectedinstep1

UsedfunctiondependsontrafficclassoftheRBusedinthisstep.

InsomecasesadmissiondecisionismadeforpowerneededbySRBs.Admission
decisionforSRBsismadeincasesdescribedinWCDMA RAN RRM Admission Control.
Admissiondecisionitselfcontainsjustcheckthatthepresentnon-controllableloadisnot
biggerthantargetPtxTargetTot.

ReleaseofPSRBsinAMRonDCHmultiRABcases
IfthebranchadditionforAMRonDCH+PSHSPAorAMRonDCH+PSHSDPAmulti
RABcasesfails,thenthePSRBsaremappedtoDCH0/0onebyoneandthebranch
additionisreattempted.RT-over-(N)RTand/orpre-emptioncanbeattemptedwhenall
PSRBsaremappedtoDCH0/0.However,ifanewbranchisnotaddedtoE-DCHactive
set,thenRT-over-(N)RTand/orpre-emptioncanbeattemptedwithoutdroppingPSRBs.

HSDPApreventionincaseofBTSHSDPAscheduler(MAC-hs/ehs
entity)congestion
ThisfunctionalityisvalidonlyincaseofWBTS(N-NB).
IftheBTSrejectstheHS-DSCHMAC-dflowsetupwiththefailurecauseDL radio
resources not available,theRNCconsidersthefailurecausedbytheMAChs/ehsschedulercongestion,thatis,whenthemaximumnumberofHSDPAusersorthe
maximumnumberofHS-DSCHMAC-dflowssupportedbytheMAC-hs/ehsscheduler
hasbeenreached.Inthiscase,theRNCtriestoallocateDLDCHinsteadofHS-DSCH.
Also,theRNCdoesnotre-attemptwithlowerULDCHbitrateorinitiatePriorityBased
SchedulingactionsforULDCH.SeethespecialhandlingoftheDL radio resources
not availablefailurecauseinULDCHreturnchannelchapter.
IftheBTSrejectstheHS-DSCHMAC-dflowsetupwiththefailurecauseDL radio
resources not available,theRNCpreventstheHS-DSCHMAC-dflowsetupsin
thecellorcellgroupuntilanyHS-DSCHMAC-dflowinthecellorcellgrouphasbeen
released.TheRNCutilizestheHSDPACellGroupinginformationreceivedfromtheBTS
intheCapabilityIndicationmessage.TheRNCpreventsnewHS-DSCHMAC-dflow
setupattemptsinthecellsthatarecontrolledbythesameMAC-hs/ehsschedulerinthe
BTS.Inthiscase:

124

DN0638161

R: 124/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

RNCsetsthe10secondtimerduringwhichHS-DSCHMAC-dflowsetupis
prevented.

RNCstopsthetimerifanyHS-DSCHMAC-dflowisdeletedbeforeexpiryofthe
timer.

Whenthetimerexpires,HS-DSCHMAC-dflowsetupisallowedagain.

ThisfunctionalityisactivebydefaultintheRNC.Thefunctionalitycanbedeactivated
withthePRFILEparameter(007:0290).TheleastsignificantbitofthePRFILEparameter
definesiftheHSDPApreventionisinuseasfollows:

Value0:HSDPApreventioninuse(default)

Value1.HSDPApreventionnotinuse

IftheHSDPApreventiontimerisrunningandHS-DSCHMAC-dflowsetupisprevented,
theRNCstartspre-emption,RT-over-RT,andRT-over-NRTactionsforRTHSDPA
attempts.Formoreinformation,seePre-emption,RT-over-RTandRT-over-NRT.

7.7 Pre-emption,RT-over-RTandRT-over-NRT
RT-over-RTandpre-emptionarepossibleincaseofCSvoiceoverHSPA.RT-over-NRT
istriggeredbyCSorPSstreamingservicesandtargetedagainstNRTservices.The
basicmechanismbehindeitheralgorithmisthatresourcesofthetargetserviceare
releasedandreservedforthetriggeringservice.IncaseofRT-over-RTandRT-overNRT,thetargetRABisnotreleased.
RT-over-NRT,RT-over-RTand/orpre-emptionactionsarepossibleinthefollowing
cases:

RRCconnectionsetup

CSvoiceRABsetup

streamingRABsetup

activitychangefrominactivetoactive(PSservices)

criticalservingcellchange

channeltypeswitchfromHSPAtoDCH

RRCre-establishment

Hardhandover

Pre-emption(thetriggercanbeCSserviceoranRRCconnectionrequestwiththe
emergency callindicationandtargetisCSservice)andRT-over-RT(thetriggercanbe
CSserviceoranRRCconnectionrequestwithoneoftheestablishmentcauseslistedin
theWCDMA RAN RRM Admission ControlandtargetisPSstreamingservice)andRTover-NRT(thetriggercanbeCSorPSstreamingserviceoranRRCconnectionrequest
withoneoftheestablishmentcauseslistedintheWCDMA RAN RRM Admission Control
andtargetisNRTservice)areusedincaseofcongestion.

Issue:06H

DN0638161

R: 125/396

125

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

7.7.1 Pre-emption
IfRT-over-(N)RTcannotbeused,thenpossibilitytousepre-emptionischecked.PreemptionismadewiththesamerulesasincaseofservicesmappedtoDCH(preemptioncapability/vulnerability,ARPlevel,RRCconnectionrequestwiththeemergency
callindication,freezingoftheresources,numberofattempts,seeWCDMA RAN RRM
Admission Control.Selecteduserisselectedinthatwaythatit'sreleaseshouldgive
resourcesthatcanbeusedbythenewservice.Targetsareselectedaccordingthe
followingrules:

Power/interferencecongestion

user(includinguserperoneHS-SCCHcode)amountcongestionnoticedinRNC

seePre-emption,RT-over-RT,andRT-over-NRTforBTScongestionchapter.

HS-DSCHMAC-damountcongestion

onlyHSPAorHSDPAusercanbeaselecteduser

congestionnoticedinBTS(RLNACKorresourcestatusindication)

anyCSusercanbeaselecteduser

onlyHSPAorHSDPAusercanbeaselecteduser

Transportcongestion

candidatesindicatedbytransportlayercanbeselectedusers

Pre-emptionactionscanbemadeasmanytimesasitisdefinedintheRNPparameter
MaxNumberOfReAttemptsCong.Ifpre-emptionisnotpossibleordoesnothelpthen
allocationmightbetriedtoDCHsideusingtheDCHprinciples.
IftheHSPAuserisacandidateforpre-emptionvictim,thenitspriorityforpre-emptionis
definedbypre-emptionRABparametersofconversationalRAB(forexampleCSvoice
RAB)(pre-emptionvulnerability,ARPlevel).
IfHSDPAuserisselectedtobedropped,powerthatitisusingisestimatedusingthe
sameformulathatisusedtoestimatepowerneededbynewconversationalRAB.
IfCSvoicemappedtoHSPAfacestransportcongestionandtransportresourcesare
triedtobereleasedwithpre-emption,RT-over-RTorRT-over-NRT,thenfixedactivity
factor100%isusedwhenitiswhencalculatedhowmuchtransportresourcesare
needed.

7.7.2 RT-over-RTandRT-over-NRT

NotethatlicenseinformationisrelevantonlytotheIPA-RNCsolution.
RT-over-NRTinitiatedbyPSstreamingisappliedaccordingtothefollowingprinciples
whennotsufficientradioresourcescanbereservedforPSstreaminginaotherway:

126

DN0638161

R: 126/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

Resourcesaretakenfromuserswithlowerpriorities
Basically,ifaPSstreamingservicealreadyexists,thenallNRTservices
automaticallyhavelowerpriorities,exceptforsignalingNRTservices.IfanewPS
streamingserviceistobesetup,thentheprioritiesconfiguredbytheoperatorare
usedtodeterminewhichNRTservicesaretargetedforRT-over-NRT.Thepriorityof
NRTservicesisdefinedbytheQoSPriorityMappingRNPparameter;itis
consideredlowerthanthatofPSstreamingiftheirpriorityvalueisequaltoorsmaller
thanvalueoftherespectiveRTOverNRTPriThresholdARP1,
RTOverNRTPriThresholdARP2,orRTOverNRTPriThresholdARP3RNP
parameter.TheparameterusedforcomparisonisthusidentifiedbythePS
streamingservice'sARPvalue.IfARPequalsto1,forexample,thevalueof
RTOverNRTPriThresholdARP1parameterisusedforcomparepurposes.
IfauserhasseveralRBs,theuser'spriorityhasthesamevalueasthepriorityofthe
user'shighest-prioritizedPSRB.

RT-over-NRTisnotappliedincaseofnon-criticalservingcellchanges
Thus,situationsareavoidedinwhichconnectionsofNRTuserswithgoodradiolink
qualityarereleasedbecauseofadmissionofPSstreaminguserswithbadradiolink
quality.

BitratesforNRTULDCHscanbedecreasedwhennewPSstreamingRBisadded
fortheUE

SituationsmayoccurinwhichaddinganewPSstreamingRBtoaUEcausestheUEspecificmaximumPSbitrateof384kbit/stobeexceeded.FortheparticularUE,theUL
DCHbitratesofNRTservicesarethendowngradedinsuchawaythatenough
resourcesareavailabletoallocatetheULDCHbitrateofthenewPSstreamingRB.
IncaseofCSserviceRT-over-NRTand/orRT-over-RTisusedwithallotherresource
problemsthanpowerproblems.
Takeintotheaccountthefollowingprinciples:

AllexistingPSserviceshaslowerprioritythanCSservice.

LackofpowerforCSservicedoesnotcausedirectlyreleaseordowngradeofPS
service.CSserviceshavetheirownpowertargets,whichdoesnotdependonPS
services.

AdmissionofCSservicescancauseanoverloadofacell.PSservicesarereleased
withoverloadactions.

Inotherthanpowercongestioncase,CSservicecantakeanyresourceofPS
service.

RT-over-NRTand/orRT-over-RTactionscanbeexecutedasmanytimesasitisdefined
withtheRNPparameterMaxNumberOfReAttemptsCong.
IfRT-over-NRTorRT-over-RTcannotbeused(noPSservices),thenapossibilityfor
pre-emptionischecked.
IfRT-over-NRTorRT-over-RTdoesnotsucceed,thenallocationistriedtoDCHside
usingtheexistingDCHprinciples.
FreeingDCHresourcesisdoneintwosteps,ifnecessary:first,therelevantULbitrates
aredowngradedtotheirrespectiveminimumvalues.Iftheamountoffreeresourcesis
notyetsufficient,theselectedNRTRBsarereleasedinasecondstep.Prioritiesdefined

Issue:06H

DN0638161

R: 127/396

127

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

intheQoSPriorityMappingRNPparameterdeterminetheorderinwhichboth
downgradingbitratesandreleasingRBsisdoneasdescribedinWCDMA RAN RRM
Packet Scheduler.
TheRT-over-NRTfunctionalityisstartedonlyinthefollowingcases:

ThereisnotenoughtransmissionpowerincaseofPSservice.

IncaseofCSservicepowerisoverbooked(noRT-over-NRT).

ThemaximumnumberofsimultaneousHSDPAusersisexceededintheRNC.

AlimitforthenumberofMAC-dflowsissetintheRNCbythe
MaxNumberHSDSCHMACdFlowsRNPparameter.

AlimitforthenumberofusersissetintheRNCbyanactivecapacitylicensefor
thenumberofusersandtheMaxNumberHSDPAUsersRNPparameter(the
numberofHSDPAusers).

AlimitforthenumberofMAC-dflowsissetintheRNCbythe
MaxNumbHSDSCHMACdFSRNPparameter.

AlimitforthenumberofusersissetintheRNCbytheMaxNumbHSDPAUsersS
RNPparameter.

UserlimitsindicatedbytheBTS

ThereistheBTSHWcongestion(notenoughHWresourcesintheBTS).

Transportcongestionisindicated.

ThePSRBscanbereleased.

TheHS-DSCHandE-DCHMAC-dflowsoverIurdonottriggertheRT-over-RTandpreemptionintheDRNC,becauseCSvoiceoverHSPAisnotsupportedoverIur.
TheRT-over-NRTfunctionalityisfurthermoretriggerediftheWCDMABTS(WBTS)
indicateshardwarecongestion.SituationswithblockedWBTShardwarearehandledin
thesamewaysasthosewithtoolargenumbersofusers.Inotherwords,because
releasingindividualMAC-dflowsdoesnothelptosolvetheproblem,theusersare
completelyreleased.

F-DPCHcodeisnotatargetofthepre-emption,RT-over-RTandRTover-NRTprocess
F-DPCHcodeandF-DPCHslotformatcongestionarenewspecialcasesofdownlink
spreadingcodecongestion.
IncaseofdownlinkspreadingcodecongestionforDPCHorF-DPCH,F-DPCHcode
doesnottargetofRT-over-RT,RT-over-NRTorNRT-over-NRTprocess.ReleaseofRB
becauseofRT-over-RTorRT-over-NRTprocesscanhowevercausereleaseofF-DPCH
code.
IncaseofF-DPCHslotformatcongestionfornewF-DPCHuser,F-DPCHslotformatof
existingF-DPCHuserorDPCHofexistingusercanbetargetintheRT-over-RTorRTover-NRTprocess.ThisisvalidonlyifnewF-DPCHcodecannotbeallocatedorexisting
DPCHcannotbemodifiedasF-DPCH.MaximumspreadingfactorofDPCHis256.

128

DN0638161

R: 128/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

DCHSDPAuserisatargetinHSPART-over-NRTprocedure
TheDCHSDPAusercanbeselectedasatargetonlyifthefollowingcriteriaarefulfilled
intheprimarycell:

anumberofUEs/HS-DSCHMAC-dflowspercell

F-DPCHcode

F-DPCHslotformatcongestion

AllthementionedresourcesoftheDCHSDPAconnectionarereservedbytheprimary
cellandthusareleaseofthoseresourcesrequiresthereleaseofDCHSDPAconnection
fromtheprimarycell.Forexample,thereleaseofDCHSDPAconnectiondoesnot
releasethementionedresourcestobeusedinthesecondarycell.Currentlyinsucha
caseinter-frequencyhandoverisnotsupportedandthustheDCHSDPAconnectionis
releasedsimultaneouslyfromboththeprimaryandsecondarycell.
DCHSDPAusercanbeselectedasatargetincaseofnumberofUEs/HS-DSCHMAC-d
flowsperMAC-hs/ehsscheduler,BTS,andTRScongestioninboththeprimaryand
secondarycell.ReleasingresourcesrequiresthatDCHSDPAuserisreleasedfromboth
theprimaryandsecondarycell.
NotethattheHSPART-over-NRTprocedureisnotperformedincaseofRNCsDSP
congestion.
WhentheDCHSDPAUEisatargetintheHSPART-over-NRTprocedure,thereleaseof
HSPAmappingcausesthereleaseofHSPAmappinginboththeprimaryandthe
secondarycell.TheRAB(s)aremappedtoDCH0/0ortheconnectionisreleased.
TheDCHSDPAusercanalsobeatargetfortheDCHallocationattempt.
AselectionoftheDCHSDPAuserfortheprocedureissimilartotheselectionoftheSC
HSDPAuser.ThetargetoftheRT-over-NRTprocedureisselectedfromamongtheUEs
inthecellorthecellpairaccordingtopriorities.
TheDCHSDPAuser'sSRBDCH/DCHcanbeatargetinthepre-emptionandRT-overNRTproceduresimilarlyasintheSCHSDPAuser'sSRBDCH/DCH.IftheDCHSDPA
user'sSRBDCH/DCHisselectedasatargetofthepre-emptionorRT-over-NRT
procedure,alltheradiolinksoftheRRCconnectionarereleasedandtheconnectionis
movedtotheCELL_FACHRRCstate.

7.7.3 Pre-emption,RT-over-RTandRT-over-NRTfortransport
resources
Pre-emption,RT-over-RTandRT-over-NRTcanbeappliedfortransportresourcesin
caseofPSstreamingandCSvoicewhencongestiononthetransportnetworklayerhas
beenindicated.Thefollowingcasesarevalid:

Issue:06H

pre-emption(CSoverCS)

CS(onDCHoronHSPA)overPSDCHstreaming

CS(onDCHoronHSPA)overPSHSPAstreaming

DCHstreamingoverHSPANRT(CIDcongestion)

DN0638161

R: 129/396

129

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

HSPAstreamingoverHSPANRT(CIDcongestion)

HSPAstreamingoverDCHNRT

NRT-over-NRTisnotusedincaseoftransportcongestioninHS-DSCH.
Incaseofcongestiononthetransportnetworklayer,thecell-specificpacketscheduler
selectsthecandidatesinthefollowingway:
1. RBsusingthesametransportresourcesasthecongestedRB.
2. InactiveNRTusers.

InactiveNRTusersareselectedaccordingtoprinciplesdescribedinExtended
inactivitytimeinCell_DCHstatewithCPCSection.

3. RBswithlowerprioritythannewRB.

Theradiobearersareselectedfromallradiobearersidentifiedinstep1
accordingtothebasicprioritizationprinciples.

FurthermoreinRT-over-RTcaseallPSRBshavelowerpriority.

TheprioritizationprinciplesforRT-over-NRTaredescribedinRT-over-RTand
RT-over-NRTSection.

Theprioritizationprinciplesforpre-emptionaredescribedinPre-emptionSection.

4. RBsstartingfromthelowestpriority.

Theradiobearersareselectedfromallradiobearersidentifiedinstep2
accordingtotheQoSprioritizationspecifiedbytheQoSPriorityMapping
parameterorARPlevel(pre-emption)dependingonthecase.

5. Radiobearerswiththehighesttransportbitratereservation.

Theradiobearersareselectedfromallradiobearersidentifiedinstep3.

Thetransportbitratereservationiscalculatedbymultiplyingtheactivityfactor
witheithertheDCHbitrateortheGBRvalue,dependingofusedtransport
channeltype.Inotherwords:

DCHNRT

activityfactor*DCHbitrate

DCHRT

activityfactor*DCHbitrate

HSPART

activityfactor*GBR

CaseswhereCSDCHcalltriggersRT-over-RTfunctionalityaredescribedinWCDMA
RAN RRM Admission Control.IneachcasewhereRT-over-NRTistriggered,thecellspecificpacketschedulerconfirms,however,thatreleasingparticularusersreallyfrees
theamountofresources,requiredbytheuserwithhigherpriority,beforeanyuseris
actuallyreleased.Theschedulerfurthermorechecksthattheusertobereleasedhasa
lowerprioritythantheuserwiththestreamingservice.
RRMpreventsRT-over-NRTandactionsifthetrafficclassofrelatedtransportbeareris
notprotectedandIP/Ethernetpathisdown.

130

DN0638161

R: 130/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

UE-specificresourcehandling

7.7.3.1 CIDsrunoutcongestion
WhentransportresourceallocationfailsbecauseofCIDcongestion,thecell-specific
packetschedulertriestogettheresourceswithpre-emption,RT-over-RTorRT-overNRT.
Cell-specificpacketschedulercalculatestheneededamountofCIDswithfollowing
rules:

EachSRB/RBonDCH(oringeneralATMconnection/ATMchannel)requiresown
CID(thatisUEwith2NRTDCHRABs+SRBsonDCHrequires3CIDs)

EachSRB/RBonHSDPA+DCH/HSUPA+DCH/HSDPA+HSUPArequires2CIDs
becausetheULandDLuserplanetrafficarecarriedwithtwoseparateATM
channels:

onetocarryHSDPADLtrafficandtheothertocarryeitherDCH/HSUPAUL
traffic

onetocarryHSUPAULtrafficandtheothertocarryeitherDCH/HSDPADL
traffic.

(thatis,UEwith2NRTHS-DSCH/E-DCHRABs+SRBsonDCHrequires5CIDs
andUEwith2NRTHS-DSCH/E-DCHRABs+SRBsonHS-DCH/E-DCHrequires6
CIDs)
IncaseofCIDcongestionthecandidateMAC-dflows/usersareselectedinfollowing
way:
1. RBsusingthesametransportresourcesasthecongestedRB.
2. InactiveNRTusers.

InactiveNRTusersareselectedaccordingtoprinciplesdescribedinExtended
inactivitytimeinCell_DCHstatewithCPCSection.

3. InactiveMAC-dflowsofNRTusers.

LowestprioritySPIsareselected.

Notethatifthereisstillmoreinactiveusers/MAC-dflowsthanrequiredforthe
procedureuptoInactUserNbrXXXOverNRTparametertimes,thecapacityneeded
fornewuser/MAC-dflowisreleased.Thisreducestheprobabilityforthesame
proceduretoberepeated.
4. RBswithlowerprioritythannewRB.

Issue:06H

Theradiobearersareselectedfromallradiobearersidentifiedinstep1
accordingtothebasicprioritizationprinciples.

FurthermoreinRT-over-RTcaseallPSRBshavelowerpriority.

TheprioritizationprinciplesforRT-over-NRTaredescribedinRT-over-RTand
RT-over-NRTSection.

Theprioritizationprinciplesforpre-emptionaredescribedinPre-emptionSection.

DN0638161

R: 131/396

131

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

UE-specificresourcehandling

WCDMARANRRMHSDPA

7.7.4 Pre-emption,RT-over-RT,andRT-over-NRTforBTS
congestion
TheRNCattemptstoselectthosetargetsforpre-emption,RT-over-RT,andRT-overNRTwhosereleasewouldhelptogetresourcesfromtheBTSfortherejectedradiolink.
ThisperformanceisbasedoninformationreturnedbytheBTS(LocalCellGroupID,
HSPApoolID,causecode)andRABcombinationortransportchanneltypecombination
oftheUEthatneedsnewresources.
ResourceinformationreturnedbytheBTSdependsontheSWreleaseoftheBTS.
HSPApoolinformationisreturnedbytheBTSonlyonRU30ornewerlevel.BTSswith
olderSWreleasedoesnotprovidethisinformation.
Thetargetforpre-emption,RT-over-RT,andRT-over-NRTactionsincaseofBTS
congestionisselectedamongthecellsthatareusingthesameLocalCellGroup(LCG)
andHSPApoolasthecongestedUE.Thishappenswhenresourcepoolinformationis
available.Otherwise,thetargetsareselectedonlyfromLocalCellGroup.
ThecausecodeisusedtodefinewhetherDLdirection,ULdirection,orbothdirections
arecongested.InnormalcasesbothULandDLresourcesareattemptedtobereleased.
ThesameprinciplesareusedwhenBTSresources(radiolink)aremissingfortheRRC
connectionandforradiobearer.
Ifmorethanonepropertargetisfoundinoneofthesteps,thedifferentiationbetween
thetargetsofthestepfollowsthemethodsspecifiedinWCDMARANRRMAdmission
Control.

HandlingofBTSHSDPAscheduler(MAC-hs/ehsentity)congestion
IftheBTSrejectsanRTHSDPAservicewiththecausecodeDL radio resources not
available,thentheRNChandlesitasanHSDPAscheduler(MAC-hs/ehsentity)
congestion(HSDPAuseramountcongestion)intheBTS.ThatmeanstheRNCattempts
toreleaseonlyHSDPAuser.Theuplinktype(DCHorE-DCH)ofthenewuserhaveno
effectonthisfunctionality.

AllresourcesofHSPAmulti-RABusermustbereleased
IfHSPAmulti-RABuserisselectedasatargetforpre-emption,RT-over-RT,orRT-overNRTactions,thenallitsRBsarereleased(ormappedtoDCH0/0).OtherwisenoBTS
resourcesarereleased.

Entityfreezing
Whenpre-emption,RT-over-RT,orRT-over-NRTactionsareperformed,thenthecells
capableofusingfreedresourcearefrozen.Thismeansthatduringthattimenew
resourcereservationsforthosecellsareputonhold.Thefrozenentitycanbethewhole
LocalCellGrouporonlycellsusingthesameresourcepoolintheBTS.

132

DN0638161

R: 132/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Channeltypeswitching

8 Channeltypeswitching

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
Channeltypeswitchingisfunctionalitywhereradiobearermappingischangedfrom
DCHtoHS-DSCHorfromHS-DSCHtoDCH.SwitchtoDCHisneededifuseofHSDSCHisnotpossibleanymore.SwitchtoHS-DSCHisneededwhenRBismappedto
DCHbutconditionstouseHS-DSCHarefulfilled.DCHtoHS-DSCHswitchfollowsthe
basicpolicythatHSDPAisusedeverytimewhenitsuseispossible.
BasicHSDPAfunctionalitycontainsthefollowingswitches:

DirectDCHtoHS-DSCHswitch

DirectHS-DSCHtoDCHswitch

Intheswitchesabove,DCH0/0isnotusedoritis,atleast,triedtobeavoided.
Ifchannel-typeswitchingistriggeredforsomereason,alltheexistingRBsoftheUE
mustbetakenintoaccount,sothatRABcombinationisstillsupportedaftertheswitch.If
theDCHtoHS-DSCHswitchdoesnotsucceed,DCHisusedandtheexistingswitch
retryisapplied.OtherwiseiftheHS-DSCHtoDCHswitchdoesnotsucceed,DCH0/0is
usedforPSservices.
WheneverchanneltypeswitchinghastobeperformedforUEswithULDCHandDLHSDSCHforPSstreamingRB,thecell-specificpacketschedulertriestoallocateanuplink
DCHbitratewhichisequaltoGBRorthenexthighersupportedDCHbitrate,definedby
theHSDPABRULStreamingparameter.IfasuitableULDCHisnotavailable,eitherDCH
0/0isused(directHS-DSCHtoDCHswitchcase)ortheswitchisnotexecuted(direct
DCHtoHS-DSCHswitchcase).
NoticethatchanneltypeswitchingdoesnotmeanHS-DSCH(re)selectionforexample
duringRRCstatetransitions.
WhenchanneltypeswitchfromHS-DSCHtoDCHistriggeredforauserthathasallits
PSRBsinactive,theUE-specificpacketschedulerreleasestheMAC-dflowsanddoes
thestatetransitionawayfromCell_DCHinsteadofchanneltypeswitch.Whenchannel
typeswitchforSRBsfromHS-DSCHtoDCHistriggeredforauserthathasallitsRBs
inactive,theUE-specificpacketschedulerreleasestheMAC-dflowsanddoesthestate
transitionawayfromCell_DCHinsteadofchanneltypeswitch.
Ifthechanneltypeswitchistriggered,thenthebestpossibletransportchannel
configurationisselectedfortheUE.Thefollowinglistdescribesorderofconfigurations
(thefirstisthebestandthefourthistheworst):

Issue:06H

DN0638161

R: 133/396

133

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Channeltypeswitching

WCDMARANRRMHSDPA

1. FullHSPA
2. AMRandSRBsonDCH+PSonHSPA
3. AMRandSRBsonDCH+PSonHSDPA(PSULonDCH)
4. FullDCH

RABsetupwhenPSNRTHS-DSCHand/orE-DCHMac-dflowexists
overIur
IfAMR/WB-AMR/PSRAB(StreamingorI/B)setuprequestisreceivedwhenE-DCH
MAC-dflowforsinglePSNRTRABexistsoverIur,thenE-DCHtoDCHchanneltype
switchisperformed.ThishappensiftheservingcellisunderSRNC/ServingFlexiDirect
RNC.
However,iftheservingcellisDRNC/DriftFlexiDirectRNCcell,thenCTSfromHSDSCH/E-DCHtoDCH/DCHisperformedandthenewRABissetuponDCH.
IfAMR/WB-AMR/PSRAB(StreamingorI/B)setuprequestisreceivedwhenHS-DSCH
MAC-dflowforsinglePSNRTexistsoverIur,thenCTSfromHS-DSCH/DCHto
DCH/DCHisperformedandthenewRABissetuponDCH.
ULSIRErrorMeasurementoverIurisreleased:

aftertheswitchtoULDCHisperformed

aftertheswitchtoDCH/DCHisperformed

8.1 DirectDCHtoHS-DSCHswitch
IndirectDCHtoHS-DSCHswitchradiobearerthatismappedtoDCHisreconfiguredto
HS-DSCH.

Triggersandpreconditionsoftheswitch
ThesystemtriggerscheckingofswitchingpreconditionsifitwaspossibletouseHSDSCHinsteadofDCH.Thisisdoneforexampleinthefollowingcases:

134

ThefirstcellwhichsupportstheusedRABcombinationswithHSDPAisaddedtothe
activeset

Inter-frequencyandinter-systemhandovermeasurementsdidnotcausethe
respectivehandovers

RABcombinationoftheUEchangessothatitsupportsuseofHS-DSCH

InitialHS-DSCHreservationdidnotsucceedfortemporaryreasons(noHSDPA
capacityintheRNC)

ResourcesforanewRTRBaretriedtobereserved
IftheUEhasactiveradiobearersmappedtotheDCHtransportchannel,resource
reservationforPSstreamingorCSvoiceRABtriggerscheckingthepossibilityto
switchthechanneltypetoHS-DSCH.3GPPRel5UEscanhowevernottriggerthis
switch.

AftertheUE not involvedSRNSrelocationisperformedbythenewservingRNC.

DN0638161

R: 134/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Channeltypeswitching

IftheUEhasnofullHSPAconfiguration,thenCSvoice/PSRABestablishmenttriggers
checkingsofpossibilitytoswitchtofullHSPAconfiguration.Thefollowingarethe
triggersfortheswitch:

CSvoice/PSRABestablishment,

activesetupdate,sothatfullHSPAconfigurationispossible(F-DPCHconditions)

RABcombinationchangetocombinationwhereCSvoiceoverHSPAissupported.

Beforetheactualswitchisstartedallthefollowingpreconditionsmustbefulfilled:

Atleastoneinteractive/backgroundorstreamingRBwhichismappedtoDCHexists,
havingabitratedifferentfrom0/0kbit/sorCSvoiceRABmappedtoDCH.

TheUEandatleastonecellintheactivesetareHSDPAcapable.

IfatleastonestreamingRBexists,thecellhastobecapableofhandlingstreaming
HSDPA(HSPAQoSEnabledparametersettoEnabled).

UEhasaRABcombinationthatissupportedwithHSDPA.

Selectedservingcellisgoodenoughcomparedtotheothercellsintheactiveset
(CPICHEc/No).SwitchisstartedwithoutCPICHEc/Nomeasurementifthereisonly
onecellintheactiveset.IncaseoftheFullHSPAfollowingconditionsaremet:
1. CPICH_ECNOADD>=CPICH_ECNObest_cellHSDPASRBWindow,
2. CPICH_RSCPADD>CPICH_RSCPbest_cell
and
3. CPICH_RSCPADD>CPICHRSCPThreSRBHSDPA

Issue:06H

Noguardtimersarerunning,preventingtheselectionoftheHS-DSCH.
Inotherwords,theswitchisnotallowedifaguardtimerisrunninginthefollowing
cases:

HS-DSCHwasswitchedtoDCHbecauseofhandoverreasons
TherespectiveHS-DSCHguardtimeafterswitchingtoDCHbecauseofHOis
controllablewiththeHsdschGuardTimerHORNPparameter.

HS-DSCHwasswitchedtoDCHbecauseofthroughputreasons
TherespectiveHS-DSCHguardtimerbecauseoflowthroughputiscontrollable
withtheHSDSCHGuardTimerLowThroughputRNPparameter.

HS-DSCHwasswitchedtoDCHbecauseofanyreasons
TherespectiveUE-specificHS-DSCHchanneltypeswitchguardtimeris
controllablewiththeHSDSCHCTSwitchGuardTimerRNPparameter.The
systemalwaysusesaminimumguardtime(>0s).

DCHtoHS-DSCHswitchdidnotsucceed
TherespectiveguardtimerisnotcontrollablebecausetheinternalDCH to HSDSCH switch retry prevention timerisused.

IfHSDPAMobilityisdisabled,theactivesetsizemustbe1.

RABattributeMaximumbitratedoesnotpreventuseofHSDPA(bypreventing
reservationofneededULbitrate).

Noactiveinter-frequencyorinter-systemhandovercausesexist.Assoonasall
thosecauseswillbecanceled,channeltypeswitchingtoHSDPAconfigurationis
againpossible.FordetailsrefertoWCDMA RAN RRM Handover Control.

DN0638161

R: 135/396

135

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Channeltypeswitching

WCDMARANRRMHSDPA

BeforeaswitchtofullHSPAconfiguration,thefollowingconditionsmustbefulfilled:

SRBmappingtoHSPAispossible

HSPAcanbeselectedforCSvoiceRAB(channeltypeselection)providedtheUE
hasCSvoiceRAB.

IfaswitchtofullHSPAconfigurationdoesnotsucceed,thenDCHisusedforCSvoice.
TheCSvoicecanbemappedtoHSPAifthereisapossibilitytousetheMAC-ehsinthe
servingcell.InanyothercasetheDCHisused.TheCSvoicecanbemappedtoHSPA
when:

MAC-ehsisalreadyusedfortheUEinquestion,
or

thechangefromMAC-hstoMAC-ehscanbeperformedforSRBsand,possibly,
otherRBsoftheUE.

Thatmeans,ifFlexibleRLC(MAC-ehs)isnotsupportedanymore,theCSvoiceover
HSPARABmustbeswitchedtoDCH(SRBsandotherpossibleRBsusingHSDPAare
changedtouseMAC-hs).
Ifanyofthepreconditionsisnotfulfilled,preconditionsarecheckedagainwhennext
periodicalCPICHEc/Nomeasurementisreceived(however,recheckingisdoneonlyif
HS-DSCHisstillpossiblefortheUEinquestion).
ResourcecheckscanfurthermorepreventtheDCHtoHS-DSCHswitch.Inpacket
scheduling,theRNCchecksthattherequiredresourcesareavailableforallRBsofthe
userbeforethechanneltypeswitchisdone.Asaconsequence,theuserstaysallocated
totheDCHiftheseresourcesarenotfree.
Ifallthepreconditionsarefulfilled,theswitchitselfisstarted.
IfuserplaneresourcereservationdoesnotsucceedforCSvoiceoverHSPARB,the
channeltypeswitchtofullHSPAconfigurationisnotattemptedfortheUEinquestion,as
longastheUEhas.CSvoiceRAB.DCHtoHSPAchanneltypeswitchforPSservices
canbeexecutedinastandardway.Resourcereservationcanbeunsuccessfulif:

thereservationofthefirstHSPAresourcesisattemptedforCSvoiceRAB.
or

DCHtoHSPAchanneltypeswitchisattempted.

TheRNCfollowsthestandardsofthefunctionalitydescribedinchapterDual-cellHSDPA
allocationinadditiontothefunctionalitydescribedinchapterSelectionbetweenDCH
andHS-DSCHwhenitmakesadecisionwhethertoallocatetheDCHSDPAinDCHto
theHS-DSCHchanneltypeswitch(theRNCallocatesDCHSDPAwheneveritis
possible).
TheRNCfollowsthestandardsofthefunctionalitydescribedinchapterDual-cellHSDPA
allocationinadditiontothefunctionalitydescribedinchapterSelectionbetweenDCH
andHS-DSCHwhenitmakesadecisionwhethertomakeachanneltypeswitchtoDC
HSDPAafteranunsuccessfulIFHOorISHOattempt(theRNCallocatesDCHSDPA
wheneveritispossible).

136

DN0638161

R: 136/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Channeltypeswitching

Measurementsfortheswitch
ThequalityofthecandidatecellisvalidatedbyusingperiodicalCPICHEc/No
measurement.RNCmusthaveatleastonemeasurementreportcontainingCPICH
Ec/Novaluesforthebranchesoftheactivesetbeforetheswitchcanbemade.Also
CPICHRSCPisusedinfullHSPAcases.
ThismeasurementhasthesameattributesandprinciplesasperiodicalCPICHEc/No
measurementinmobilitycase(see,SettinguptheDLCPICHEc/NoandULSIRerror
measurements)exceptthatithasitsownreportingperioddefinedbythe
HSDPACPICHCTSRepPerRNClevelRNPparameterandexceptthatmeasurementfor
theswitchisstartedwithoutHS-DSCH.
ThecandidatecellisgoodenoughifitsCPICHEc/NoisbetterthanorequaltoCPICH
Ec/Noofthebestcellintheactivesetdecreasedbythevalueofthe
HSDPAChaTypeSwitchWindowRNClevelRNPparameter.

Executionoftheswitch
Ifmorethanonecellfulfilledthepreconditions,theresultofperiodicalCPICHEc/No
measurementdefinestheorderoftriedcells(bestfirst).Thepossiblenextcandidateis
triediftheswitchdoesnotsucceedinpresentcandidate.Theswitchdoesnotsucceed,
forexample,ifmaximumnumberofHSDPAusersisexceeded.
Thesuccessfulswitchcontainsthefollowingphases:
1. TheRNCandtransportresourcesarereservedforHS-DSCH
2. Radiolinks,transportchannelandradiobearerarereconfigured(DCHX/X-->
DL:HS-DSCH,UL:DCHXorE-DCH)
3. RadiobearerismappedtoHS-DSCH
4. RNCandtransportresourcesarereleasedforDCH
5. HS-DSCH-specificmeasurementsareconfiguredtotheUE
TheexistingDCHiskeptupandrunningaslongaspossiblesothatthebreaktodata
flowwouldbeasshortaspossibleinsuccessfulcase.Thisalsominimizesdataflow
interruptionsinerrorcases,becauseinmanycasesDCHisstillworkingwhenitis
noticedthattheswitchisnotsucceed.
Ingeneral,iftheswitchdoesnotsucceed,channeltypeswitchingisnotretrieduntilthe
UE-specificDCH to HS-DSCH switch retry prevention timerwillhaveexpired.The
durationoftheDCH to HS-DSCH switch retry prevention timerisdeterminedbythe
minimumvalueof{10;nbr_of_fails*2},unitisseconds[s].Iftheswitchdoesnotsucceed
becauseoflayer-2(L2)ortransportreasons,however,handovercontrolstartstheDCH
to HS-DSCH switch retry prevention timerwiththefollowingvalues:5s,20s,40s,80s.
Aftereachunsuccessfulswitchattempt,thenextvalueisused.Assoonasthelastvalue
(80s)hasbeenusedandtheswitchstilldidnotsucceed,nofurtherretryisstarted.
Normalservingcellselection,admissioncontrolandresourcereservationsaremadefor
SRBsandRBsareswitched.Howeveradmissiondecisionforpowerisnotdonefor
SRBsinchanneltypeswitchesbetweenDCHandHSPAtransportchannels.RT-over-

Issue:06H

DN0638161

R: 137/396

137

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Channeltypeswitching

WCDMARANRRMHSDPA

NRT,RT-over-RTorpre-emptionactionsarenotusedinDCHtoHSPAswitch.IfHSPA
resourcesarenotfoundfromallswitchedRBsand/orSRBs,thenswitchisabortedand
DCHresourcesareused.
AMRcodecsetisselectedfromtheconfiguredAMRcodecsetsoftheactivesetcells
withthealgorithmsspecifiedintheWCDMA RAN Admission Control.Theexceptionis
thattheload-basedAMRcodecmodeselectionisnotappliedinthechanneltypeswitch
fromDCHtoHS-DSCH.

RRMmakesdecisionaboutusingflexibleRLCPDUsizeduring
channeltypeswitch
RRM(AdmissioncontrolandPacketScheduler)makesdecisionaboutusingflexible
RLCPDUsizeincaseofchanneltypeswitchbetweenHS-DSCHandDCHtransport
channels.DLRLCre-establishmentisrequiredbecauseofthefactthattheRLCPDU
sizeischangedbetweenflexibleandfixedsize.FlexibleRLCPDUsizeisused,ifthe
followingconditionsarefulfilled:

theHS-DSCHservingcellisflexibleRLCPDUsizecapable,

theUEisflexibleRLCPDUsizecapable,

HS-DSCHisbeingselectedastheDLtransportchanneltypeforthePSRB,

AMRLCisused,

ParameterFRLCEnabledissettovalue1(Enabled)intheRNC,

E-DCHisbeingselectedasULchanneltypeforthePSRB,

Otherwise,fixedRLCPDUsizesisused.

Unsuccessfulcombinedservingcellchangeandchanneltype
switch
IncaseofunsuccessfulcombinedDCHtoHSPAswitch(HSPAtofullHSPA)andserving
cellchange,onlyservingcellchange(noswitch)isattemptedtobeperformedinnormal
wayandwithnormalrules(allcandidatesareattempted).

UE not involvedSRNSrelocation
AftertheUE not involvedSRNSrelocationisperformed,thehandovercontrolofthe
targetRNCinitiatesthechanneltypeswitchtoSRBonHSPA,SRBonHSUPA,andRB
onE-DCH2msTTI.Thehandovercontrolusesthemeasurementresults(CPICHRSCP
andCPICHEc/No)receivedduringSRNSrelocationforchanneltypeselection.The
CPICHRSCPandCPICHEc/NomeasurementresultsoccurintheRRCcontainer
(RRC:SRNSRELOCATIONINFO/MeasurementReportIE).Thosemeasurement
resultsareneededformapping:

SRBonHSPA

SRBonHSUPA

RBonE-DCH2msTTI

SRBandRBaremappedtothebestpossibleHSPAconfiguration.

138

DN0638161

R: 138/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Channeltypeswitching

FormoreinformationonSRNSrelocation,seeWCDMA RAN SRNS Relocation.

8.2 DirectHS-DSCHtoDCHswitch
IndirectHS-DSCHtoDCHswitchradiobearerthatismappedtoHS-DSCHis
reconfiguredtoDCHsothatuseofDCH0/0istriedtobeavoided.
ThefollowingsituationsmaycauseHS-DSCHreconfiguration:

Servingcellcannotbefound(qualityreasons,neededfeaturenotsupported).

AnewRABcombinationisnotsupportedwithHSDPAorHSPA(butsupportedwith
DCH).

ResourcesarenotfoundforCSRABfromtheHSPAside.

FullHSPAconfigurationcannotbekeptanymore,forexample:

notsuccessfulHSUPATTIswitchfrom2msto10ms

forqualityreasons(F-DPCH)

initiationofcompressedmode

WhenacellnotsupportingCSvoiceonHSPAorF-DPCHisaddedtoactiveset.

WhenacellundertheDRNC/DriftFlexiDirectRNCisaddedtoanactiveset.

AnewRABcombinationisnotsupportedwithfullHSPAconfiguration(but
supportedwithDCH).

AUEwithPSRABsmappedtoHS-DSCHmovestoanothercellalthoughHSDPA
mobilityisdisabled.

HS-DSCHofPSservicescanbeswitchedtoDCHorFACH.However,FACHcannotbe
usediftheUEhasaCSRAB.
OtherthanSRBsandCSvoiceRBarenotdirectlyaffectedaboutDCHswitch,ifonly
SRBsandRBforCSvoiceareswitchedtoDCH,PSservicesstilluseHSPA,andifno
reconfigurationneedstobeperformedforthePSservices.
Incaseofmulti-RABconfigurationsallorsomePSRBsoftheUEbeingswitchedcanbe
mappedtoDCH0/0iftheswitchdoesnotsucceed.Alsopre-emption,RT-over-RT,or
RT-over-NRTcanbetriggered.
WhentheBTSrejectsRLreconfigurationrequestincaseofCSvoicesetupandtheUE
inquestionhasalreadyRBonHSPA,theCSvoiceisputtoDCH(alsoSRBsareputto
DCH)andtheexistingRBsareswitchedtoDCH/HS-DSCHconfiguration.Ifthisdoesnot
succeed,thenPSRBsaremappedtoDCH0/0andpre-emption,RT-over-RT,orRTover-NRTcanbeused.
ChanneltypeswitchfromHS-DSCHtoDCH>0isatriggeringpointforredirectiontoLTE
functionality.Fordetails,seeWCDMA RAN RRM Handover Control.

Issue:06H

DN0638161

R: 139/396

139

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Channeltypeswitching

WCDMARANRRMHSDPA

Phasesofthechanneltypeswitch
ThesuccessfulHS-DSCHtoDCHswitchcontainsthefollowingphases:
1. TheRNCandtransportresourcesarereservedforDCH.
2. Radiolinks,transportchannelandradiobearerarereconfigured
3. RadiobearerismappedtoDCH
4. TheRNCandtransportresourcesforHS-DSCHarereleased
5. DCH-specificmeasurementsareconfiguredtotheUE
DCHreservationsareexecutedinthefollowingorderinHSPAtoDCHswitchforRBs
(andSRBs):
1. RBwiththehighestQoSprioritypassingadmissioncontrolandallpossibleotherPS
RBspassingtheadmissioncontrol

resourcesotherthanpowerresourcesforSRBsandCSRBsarechecked(if
switchisexecutedalsoforSRBs)

PSRBswithanegativeadmissiondecisionaredropped(DCH0/0)inthisstepin
theorderofQoSpriority

Thenextstepistakenstraightaway(withoutanattemptforresourcereservation)
iftheconditionsforthissteparenotfulfilled

2. RT-over-RT,RT-over-NRTorpre-emptiononlyfortheRBwiththehighestpriority(+
SRBs)
3. SRBs/RBsaredropped

incaseofCSRBproblem,itsRABisreleased

incaseofSRBproblem,RRCre-establishmentmayhappen

OtherthanSRBsandCSvoiceRBarenotdirectlyaffectedbyDCHswitch,ifonlySRBs
andRBforCSvoiceareswitchedtoDCHandPSservicesstilluseHSPA.
RT-over-RT,RT-over-NRTandpre-emptionisexecutedinaccordancewithDCHrules
describedinCode tree optimizationsectioninWCDMA RAN RRM Admission Control.
AMRcodecsetconfigurationoftheHSPAispreservedwhenthechanneltypeis
switchedfromHSPAtoDCH.Load-basedAMRcodecmodeselectionisnotappliedat
thechanneltypeswitch.Formoreinformation,seeWCDMA RAN RRM Admission
Control.

Bitrateallocationafterthechanneltypeswitch
Inthegeneral,thefollowingapplies:forNRTservices,ontheonehand,DCHistriedto
bereservedinthenextschedulingperiodwiththeinitialbitratesdefinedbythe
InitialBitRateULandInitialBitRateDLRNPparameters.Iftheinitialbitrates
cannotbeallocated,thenzerobitratesareusedinstead(DCH0/0).
Somespecialcases/exceptionsexist,however:

140

DN0638161

R: 140/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Channeltypeswitching

Iftheactivesetcontainsmorethanonebranch,thelowestinitialbitrateofall
branchesisused.

TheongoingHS-PDSCHcodedowngradesarecompletedbeforetheresourcesare
triedtobereservedforDCH.

IftheselectedinitialbitrateoftheDCHislargerthantheRAB'smaximumbitrate,
however,theDCHwillbetriedtobereservedwiththesupportedbitratethatis
smallerthanorequaltotheRAB'smaximumbitrate.

Forstreamingservices,ontheotherhand,thepacketschedulertriestoallocateULand
DLDCHbitrateswhichareequaltoGBRorthenexthighersupportedDCHbitrate.
AllocationisdoneforbothULandDLandisperformedimmediately.Intheeventof
unsuccessfulallocation,however,theRBismappedtoDCH0/0.IfaparticularUEhas
allocatedoneormorePSstreamingRB(s)andatleastoneNRTRAB,allPSRBsare
switchedsimultaneously.Thebitratesarehoweverallocatedinthenextscheduling
period.
Somespecialcasesexist:

IftheDCH'sinitialbitrateislargerthantheRAB'smaximumbitrate,theDCHistried
tobereservedwithabitratecorrespondingtotheRAB'smaximumbitrate.

IfmorethanoneNRTRBhadbeenmappedtoaHS-DSCHwithactivePSstreaming
RB,DCHwithbitratesequalto8/8kbit/sistriedtobereservedfortheactiveNRT
RBwithhighestpriority(HSPAQoSMapping).If8/8kbit/sisnotpossible,DCH0/0is
used.AllotherNRTRBsareputtoDCH0/0bydefault.
IfmanyactiveRBshaveidenticalpriorityvalues,theRBwiththelongestallocation
timeisselected.

Ifthesumofnon-controllableandsemi-controllabledownlinktransmissionpowerhas
crossedtherespectivethreshold,PtxTarget,streamingRBswillbemappedtoDCH
0/0,aswell.

Unsuccessfulcombinedservingcellchangeandchanneltype
switch
IncaseofcombinedHSPAtoDCHswitch(fullHSPAtoHSPA)andservingcellchange,
onlythebestservingcellcandidateisattempted.Ifthechangedoesnotsucceed,allbut
thehighestpriorityservicecanbemappedtoDCH0/0andtheswitchisreattemptedas
fullHSPAtofullDCHswitch.Afterthatactionsdefinedfornormalswitchcasesaretaken
dependingonRABcombination.

Issue:06H

DN0638161

R: 141/396

141

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

9 HSDPAmobilityhandling

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
InNSNRAN,therearetwomethodsavailabletohandletheHSDPAmobility:

HSDPAmobilityhandlingwiththeservingHS-DSCHcellchange(seeServingHSDSCHCellChange)

HSDPAcellreselectionandHSDPAmobilityhandlingwithDCHswitching

TheoperatorscansetthepreferredmethodwiththeHSDPAMobilitymanagement
parameter.
ChangingtheparametervaluedoesnotaffecttheexistingRRCconnections.Thenew
valueisusedfornewRRCconnectionsonly.
Inter-RNCmobilityisdescribedinthechaptersHSPAoverIurandHSPAInter-RNCCell
Change.
Inter-frequencyhandoversforHSDPAservicesaredescribedinsectionHSDPAinterfrequencyhandover.

9.1 Measurementreporting
ThemeasurementeventswhenHSDPAMobilityissetto'enabled'areexplainedinthe
tablebelow:
Table 8

Intra-frequencymeasurements,whichareusedforUEhavingalsotheHSDSCHallocated

Event

Description

1A:AprimaryCPICHentersthereporting ThiseventisatriggerforstartingHSDPArange
specificmeasurementsandactivesetupdateforassociatedchannels.
1B:AprimaryCPICHleavesthereportingrange

142

ThiseventisatriggerforservingHSDSCHcellchangeandactivesetupdate
forassociatedchannels

DN0638161

R: 142/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 8

HSDPAmobilityhandling

Intra-frequencymeasurements,whichareusedforUEhavingalsotheHSDSCHallocated(Cont.)

Event

Description

1C:Anon-activeprimaryCPICHbecomesbetterthananactiveone

ThiseventisatriggerforservingHSDSCHcellchangeandactivesetupdate
forassociatedchannels.

Table 9

ReportingeventswhichareusedwhenHSDPAassociatedDPCHisin
SHO

Event

Description

6F:UERx-TxtimedifferenceforaRLincludedintheactivesetbecomeslarger
thananabsolutethreshold

ThiseventisatriggerforservingHSDSCHcellchange.

6G:UERx-TxtimedifferenceforaRLin- ThiseventisatriggerforservingHScludedintheactivesetbecomesless
DSCHcellchange.
thananabsolutethreshold

Table 10

TriggersforreleasingtheHS-DSCHMAC-dflow

Event

Description

1F:AprimaryCPICHgoesbelowtheabsolutethreshold

Thiseventisatriggerforreleasingthe
HS-DSCHMAC-dflow

1E:AprimaryCPICHbecomesbetter
thananabsolutethreshold

Thiseventcancelsevent1F.

6A:'UETxpowerbecomeslargerthanan Thiseventisatriggerforreleasingthe
absolutethreshold'
HS-DSCH.
6B:'UETxpowerbecomeslessthanan
absolutethreshold'

Thiseventcancelsevent6A.

Inadditiontotheabove-mentionedevents,aULqualitydeteriorationreportfromouter
looppowercontrolcantriggertheHS-DSCHMAC-dflowrelease.
InthecaseofasingleNRTPSRAB,themeasurementevent1F(A primary CPICH goes
below the absolute threshold)initiatesHS-DSCHMAC-dflowreleaseandmappingofa
radiobearertoDCH0/0kbit/s.Themeasurementevent1E(A primary CPICH becomes

Issue:06H

DN0638161

R: 143/396

143

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

better than an absolute threshold)cancelsthemeasurementevent1F.Eachcellofthe


activesetmusttriggerthemeasurementevent1FbeforeHS-DSCHMAC-dflowrelease
isstarted.
InthecaseofanAMRmulti-service,themeasurementevents1F(A primary CPICH
goes below the absolute threshold)and1E(A primary CPICH becomes better than an
absolute threshold)areusedtoinitiatetheinter-frequencymeasurements.TheHSDSCHMAC-dflowisthenreleasedbeforeinitiationoftheinter-frequencymeasurements
forAMRspeechCSRAB.ThesameappliesalsototheDLTransmittedCodePower
measurement.
However,iftheHSDPA Inter-Frequency Handoveroptionalfeatureisactivatedandinterfrequencyhandovertriggersarepresent,HS-DSCHreleaseisnottriggered.Instead,an
E-DCHtoDCHswitchinuplinkisperformedifneededandinter-frequencyhandover
measurementisstartedafterthatimmediatelywithDL:HS-DSCH/UL:DCH
configuration.Formoredetails,seeHSDPAinter-frequencyhandover.
Formoreinformationonmeasurementeventsintroducedabove,see Measurement
procedure for inter-frequency handoverinWCDMA RAN RRM Handover Control.
WhentheF-DPCHissupported,thetransportchanneloftheSRBschangebetween
HSPAandDCHbasedonthereportedmeasurementresultsoftheCPICHEcNoand
CPICHRSCP.SRBscannotbemappedonHSPAifMultiRABoftheUEisnotsupported
withHSPA.
StandaloneSRBsonHSPA(inthatcaseE-TTIis10ms)configurationispossibledirectly
afterRRCconnectionsetuporreleaseoflastRABbyCNwithoutreleasingofsignaling
bearertoCN.InthatcasetheSRBstransportchannelscanbechangedfromHSPAto
DCHbutnotbacktoHSPAfromDCHbecauseofreportedCPICHEcNoandCPICH
RSCPmeasurementvalues.
WhenCSvoiceismappedtoHS-DSCH,thensamemeasurementsareusedaswith
AMRmultiRAB.InthiscaseSRBsarealsomappedtoHS-DSCHandsoalsothose
measurementsareactive.
TheRNCselectsthenewServingHS-DSCHcellbasedonDLCPICHEc/NoandUL
SIRerrormeasurementresults.These,andtheotherrelatedparameters,areintroducedin
thenextchapter.

SettinguptheDLCPICHEc/NoandULSIRerrormeasurements
TheRNCorderstheUEtoreportDLCPICHEc/NoandCPICHRSCPofthecellsinthe
activesetperiodicallyandtheBTStoreportULSIRerrormeasurementperiodically.The
propertiesofbothmeasurementsandtherelatedparametersaredescribedbelow.
The downlink CPICH Ec/No measurement
Periodicalintra-frequencyCPICHEc/NomeasurementisappliedtotheservingHSDSCHcellchangeprocedurefortriggeringandselectionofthenewservingcell.The
measurementisstartedinconjunctionofthesetupoftheHS-DSCHMAC-dflowand
stoppedinconjunctionofthedeletionoftheHS-DSCHMAC-dflow.
PeriodicalCPICHEc/Nomeasurementisstartedonlyifthesizeoftheactivesetis
greaterthanone.Ifthesizeoftheactivesetisone,thatisthereisonlyoneradiolinkin
theactiveset,periodicalCPICHEc/Noreportingisnotused.However,whentheactive

144

DN0638161

R: 144/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

setsizeisoneandtheSRBsaremappedtofullHSPA(E-DCH/HSDPA)orHSUPA(EDCH/DCH),theperiodicalmeasurementsareusedtodeterminethequalityofDLSRB
onHSDPAandtheuseofE-TTIbetween2msand10ms.IfSRBismappedtoHSPAor
HSUPA,theperiodicalreportingisappliedirrespectiveoftheASsize.
Astheexceptiontothementionedrule,thehandovercontrolstartstheperiodical
reportingofintra-frequencyCPICHEc/Nomeasurementifthefollowingconditionsare
met:

Thereisonlyonecellintheactiveset.

TheUEisE-DCH2msTTIcapableorRel.7enhancedF-DPCHcapable.

E-DCH2msTTI(HSUPA2MSTTIEnabledparameter)orRel.7enhancedF-DPCH
(FDPCHEnabledparameter)canbeusedinallcellsoftheactiveset.

UEisinCell_DCHstate.

SRBismappedtoDCH.

NRTRABisestablished.

AMRCSRAB(DCH)isnotestablishedorAMRCSRAB(DCH)isestablishedand
UEisCSvoiceoverHSPAcapable.CSvoiceoverHSPAcanbeusedinallcellsof
theactiveset(HSPAQoSEnabledparameter).

IfthereismorethanonecellintheactivesetorifSRBismappedtofullHSPA(EDCH/HSDPA)orHSUPA(E-DCH/DCH),periodicalreportingremainsunchanged,as
describedintheparagraphabove.
TheRNCstartsandstopsthemeasurementwiththeRRC:MEASUREMENTCONTROL
message.
TheoperatorcannotswitchofftheperiodicalCPICHEc/Nomeasurement.The
measurementisalwaysactiveaccordingtotheconditionsdescribedabove.
Theintra-frequencymeasurementreportingcriteriaoftheperiodicalCPICHEc/No
measurementforHSDPAservingcellchangeisthefollowing:

Issue:06H

Measurement reporting mode,cannotbecontrolledbyanyoftheRNPparameters.

Transfer Mode-iscontrolledbythePRFILE002:2100parameter.Itisin
AcknowledgedmodeRLCorUnacknowledgedmodeRLC,whenthevalueof
theparameteris0Hor1Hrespectively.

Reporting Mode isPeriodicalreporting

Measurement quantityisCPICHEc/No.Theoperatorscancontrolthefilteringof
CPICHEc/NomeasurementswiththeEcNoFilterCoefficientparameter,
definedbytheHSDPAFmcsIdentifierortheRTWithHSDPAFmcsIdentifier
parameterset.WhentheDCHSDPAisallocated,thesettingofFMCSparameteris
definedwiththeDCellHSDPAFmcsIdWCELparameter.

Reporting quantity isCPICHEc/NoforactivesetcellsandincaseoffullHSPA


configurationCPICHRSCP.Thereportingquantityofthemeasurementisfixed.

Reporting criteriaisperiodicalreporting.Theoperatorscanconfigurethereporting
intervalwiththeHSDPACPICHreportPeriodparameter.

DN0638161

R: 145/396

145

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

PeriodicallyreportedDLCPICHEc/Nomeasurementresultsarethenaveragedinthe
RNC.Averagingisdonewithinaslidingaveragingwindow.

TheoperatorscanusetheHSDPACPICHAveWindowparametertodefinehowmany
CPICHEc/Nomeasurements,whicharereceivedintheRRC:MEASUREMENT
REPORTmessage,areincludedintheslidingwindowusedintheaveraging.

Averagingisperformedusingthefollowingformula:

WhereCPICHEc|No(t)isthelatestreceivedCPICHEc|Nomeasurementandnequalsto
thevalueofparameterHSDPACPICHAveWindow.
TheRNCcalculatestheaveragedvaluesfromtheavailablemeasurementsamples,until
thenumberofmeasurementsamplesisadequatetocalculateaveragedvaluesoverthe
wholeaveragingwindow.
NoticethatperiodicalCPICHEc/NomeasurementisalsousedinthecaseofdirectDCH
toHS-DSCHswitch(seeDirectDCHtoHS-DSCHswitch).
The uplink SIRerror measurement
ThededicatedULSIRerrormeasurementisusedtoselecttheservingHS-DSCHcellin
theservingHS-DSCHcellchangeprocedure.Itisalsousedasacriterionforthe
sufficientULqualityforHS-DPCCHtransmission.InsufficientqualitytriggerstheHSDSCHrelease.
TheULSIRerrormeasurementisdefinedinthe3GPP TS 25.215: Physical Layer
Measurementsspecifications.
TheperiodicalULSIRerrormeasurementisstartedaftertheHS-DSCHhasbeen
allocatedtotheUE.
TheNBAP:DEDICATEDMEASUREMENTINITIATIONprocedureisusedtostartand
stoptheULSIRerrormeasurement.
TheoperatorscanswitchtheperiodicalULSIRerrorreportingoffbysettingthereporting
intervaltozerowiththeHSDPASIRErrorReportPeriodparameter.Ifthereportingis
switchedoff,theRNCdoesnotuseULSIRerrorasacriterionfortheservingHS-DSCH
cellchange.
Ifthe(007:0284 RN40_MAINT_014)PRFILEparameterhasvalue1,theHS-DSCH
MAC-dflowisnotreleasedfortheULSIRerrorreasons.Thedefaultvalueofthe
parameteris0.
IfaUEhasafullHSPAconfigurationandmultipleRABs,thenSIR errormeasurementis
usedaccordingofthatnonzeromeasurementperiod,thatistheshortestoneforthose
RABsthattheUEhas.ThismeansthatwiththedefaultparametervaluesSIR error
measurementisusedonlyiftheUEhasaPSserviceandthemeasurementperiodis
definedbytheperiodofPSservices.ThisrulealsomeansthatSIRerrormeasurementis
modifiedaccordingofchangesinRABconfiguration.

146

DN0638161

R: 146/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

IncaseofstandaloneSRBsonHSPAULSIRerrormeasurementisnotstarted.
ThereportingofULSIRerrorisperiodical,butareportisonlysentifthevaluehas
changedsignificantly.ThereportingcriteriaofthededicatedULSIRerrormeasurement
aredeterminedasfollows:

DedicatedmeasurementtypeisSIRerror.

Measurement filter coefficientcanbeconfiguredwith


HSDPASIRErrorFilterCoefficientparameter.Theparameterdeterminesthe
filteringcoefficientvaluetobeusedinhigherlayerfilteringofthemeasurement
result.Thehigherlayerfilteringhasbeenspecifiedinthe3GPP TS 25.433: UTRAN
Iub interface NBAP signallingspecification.

Report characteristicsisperiodic.Thereportperiodicitydefinedwiththe
HSDPASIRErrorReportPeriodoperatorconfigurableparameter.

PeriodicallyreportedULSIRerrormeasurementresultsareaveragedintheRNC.
Averagingisdonewithinaslidingaveragingwindow.

TheoperatorscanusetheconfigurableHSDPASIRErrorAveWindowparameterto
definehowmanySIRerrormeasurements,whicharereceivedintheNBAP:
DEDICATEDMEASUREMENTREPORTmessage,areincludedinthesliding
windowusedintheaveraging.

Ifthemeasurementreportwasnotreceivedwithinthereportingperiod,theRNCuses
thelatestreceivedvalueinsteadinaveraging.
Theaveragingisperformedusingthefollowingformula:

WhereSIRError(t)isthelatestreceivedSIRErrormeasurementandnequalstothevalue
oftheHSDPASIRErrorAveWindowparameter.
TheRNCcalculatestheaveragedvaluesfromtheavailablemeasurementsamples,until
thenumberofmeasurementsamplesisadequatetocalculateaveragedvaluesoverthe
wholeaveragingwindow.

9.2 ServingHS-DSCHCellChange
ThisfeaturecanbeactivatedbyenablingtheHSDPAMobilityparameter.

Issue:06H

DN0638161

R: 147/396

147

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

Figure 49

WCDMARANRRMHSDPA

TheservingHS-DSCHcellchangeinactiveset

Inthefigureabove,theHS-PDSCHallocationforagivenUEonlybelongstooneofthe
radiolinksassignedtotheUE,theserving HS-DSCH radio link.Thecellassociatedwith
theservingHS-DSCHradiolinkisdefinedastheserving HS-DSCH cell.TheHS-DSCH
transportchannelisneverindiversityhandover.Aserving HS-DSCH cell change
facilitatesthetransferoftheroleofservingHS-DSCHradiolinkfromoneradiolink
belongingtothesourceHS-DSCHcelltoaradiolinkbelongingtothetargetHS-DSCH
cell.
TheservingHS-DSCHcellchangeisanetworkcontrolledsynchronousprocedure(for
example,transmissionandreceptionofHS-DSCHarestoppedandstartedatthetime
instantgivenbytheRNC).TheRNCbasesthetargetcellselectionontheperiodically
reportedmeasurementsfromUE(intra-frequencyCPICHEc/No)andtheBTS(dedicated
ULSIRerror).IfthereisnosuitabletargetcellwhentheCPICHEc/Notriggerstheserving
HS-DSCHcellchange,thecurrentcelliskept.Ifthereisnosuitabletargetcellwhenany
othertriggerinitiatestheservingHS-DSCHcellchange,theHS-DSCHMAC-dflowis
releasedandtheRBismappedtoDCHX/X(0/0orinitialbitrates,seeDirectHS-DSCH
toDCHswitch).
Eitheranintra-BTSintra-LCG,anintra-BTSinter-LCG,oraninter-BTScanexecutethe
servingHS-DSCHcellchange.TheservingHS-DSCHcellchangefeaturealsoincludes
thesofthandoverofanassociatedDPCH(thatis,signalinglinkandULDCHreturn
channelcanbeinSHO).

148

DN0638161

R: 148/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Figure 50

HSDPAmobilityhandling

Inter-BTSservingHS-DSCHcellchangecombinedwithservingHS-DSCH
BTSrelocation

Ataninter-BTSservingHS-DSCHcellchange,aservingHS-DSCHBTSrelocationmust
beperformedattheUTRAN.ServingHS-DSCHBTSrelocationandservingHS-DSCH
cellchangearetwoseparateprocedures,eveniftheservingHS-DSCHBTSrelocation
cannotbeperformedwithoutaservingHS-DSCHcellchange.
Fordetailsaboutinter-RNCservingHS-DSCHcellchange,refertoHSPAInter-RNCCell
Change.
Intra-BTSinter-LCGservingHS-DSCHcellchangefromoneHSDPAcelltoanother
HSDPAcellunderadifferentLCGwithinthesameBTSishandledinsimilarwayasthe
inter-BTSservingHS-DSCHcellchange.

BasicalgorithmforselectingtheinitialservingHS-DSCHcell
TheinitialservingHS-DSCHcellselectionalgorithmisexecutedwhenthefirstHSDSCHallocationisdonetotheUE.

Issue:06H

DN0638161

R: 149/396

149

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

Figure 51

WCDMARANRRMHSDPA

AlgorithmforselectingtheinitialservingHS-DSCHcell

Finding the candidate cells


InitialselectionoftheservingHS-DSCHcellisbasedonthelatestreceivedintrafrequencyDLCPICHEc/NomeasurementresultreportedbytheUE.TheRNCtakesthe
CPICHEc/Nomeasurementresultfromthelatestreceivedandstoredmeasurement
event.Periodicalintra-frequencyCPICHEc/Nomeasurementisnotusedfortheinitial
selectionoftheservingHS-DSCHcell.
IftheHSDPAdynamicresourceallocationisdisabledintheRNC,thecellwhichis
alreadyinHSDPApowerallocated,isprimarilychosenastheservingcell.Thisisnot
validiftheHSDPAdynamicresourceallocationisenabledintheRNC.

150

DN0638161

R: 150/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

Iftheactivesetsizeisone,thatis,thereisonlyonecellintheactiveset,theHS-DSCH
allocationisexecutedwithouttakingDLCPICHEc/Nointoaccount.
Iftheactivesetsizeisgreaterthanone,thatis,thereismorethanonecellintheactive
set,theDLCPICHEc/Noisusedascriteria.AlltheHSDPA-capablecellsthatfulfillthe
followingconditionareselectedaspossiblecandidatecellsfortheHS-DSCHallocation:
Figure 52

Conditionforselectingthecandidatecells

Where:

CPICHEc/NoCellistheCPICHEc/Nomeasurementofthecandidatecell.

CPICHEc/NoBest_cellistheCPICHEc/Nomeasurementofthebestcellintheactive
set.

HSDPAServCellWindowisanoperatorparameter,whichdeterminesthewindowrelativetothebestcellintheactiveset-insideofwhichtheservingHS-DSCHcell
mustbeinordertoallocateHS-DSCH.

Allthecells,whichfulfilltheDLCPICHEc/Noconditiondescribedabove,areprioritized
accordingtotheDLCPICHEc/No.Primarily,thecellhavingthebestDLCPICHEc/Nois
chosenastheservingcell.Alsothesecondandthirdbestcellcanbeattemptedifthe
primarycandidatefails.
Inaddition,HSPAstreaminghastobeactivated(HSPAQoSEnabledparametersetto
Enabled)inthecandidatecelliftheUEpossessesaPSstreamingRB.Otherwise,the
cellwillnotbeselectedascandidate.
SupportofCSvoiceoverHSPAdoesnothaveaneffectinservingcellselectionphase,
becauseallcellsoftheactivesetmustsupportit.
IfHS-DSCHallocationfails,thenextbestcell,inaccordancewiththeprioritiesabove,is
attempted.IfnoneofthecellsintheactivesetcanbechosenastheservingHS-DSCH
cell,orifalltheattemptedallocationsoftheHS-DSCHareunsuccessful,aDCHis
scheduled.
NoticethatinordertoexecutetheservingHS-DSCHcellchangeandallocatetheHSDSCHatthetargetcell,thechanneltypeselectionalgorithmmustbesuccessful,thatis,
theCell/BTSmustfulfillallthecriteriaregardingHS-DSCHallocation.

SelectionoftheservingHS-DSCHcellincaseSRBsonHSPA
TherecanbemorethanoneHSPAcapablecellsintheactivesetthatmeetthe
requirementsofSRBsontheHSDPA.TheorderoftheHSPAservingcellallocation
followstherequirementsofSRBsonHS-DSCH.TheservingHS-DSCHcellselectionis
basedonaveragedintra-frequencyCPICHEc/NoandthelatestCPICHRSCP
measurementresultsreportedbytheUE.Ifthesizeoftheactivesetismorethanone,
CPICHEc/NoisusedascriteriaofcandidateforHS-DSCHallocation.SRBsonHSDCSHmustfulfillthefollowingconditions:

Issue:06H

FortheallocationofSRBsonHS-DSCHrequiresthatalltheactivesetcellsare
HSPA-capablecells.(Note:thiscriterionisvalidalsoincaseactivesetsize1).

DN0638161

R: 151/396

151

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

PossiblecandidatecellsforSRBsonHS-DSCHallocationfulfillsfollowingequation:
Figure 53

PossiblecandidatecellsforSRBsonHS-DSCHallocation

whereCPICHEc/NoCellistheCPICHEc/Nomeasurementofthecandidatecell,
CPICHEc/NoBest_cellistheCPICHEc/Nomeasurementofthebestcellintheactive
setandHSDPASRBWindowisthemanagementparameter,whichdeterminesthe
window-relativetothebestcellintheactiveset-insideofwhichtheservingHSDSCHcellcanbeinordertoallocateSRBsonHS-DSCH.
ThecandidatestoallocateSRBsonHS-DSCHalsofulfillstheCPICHRSCPcriteria.The
conditiontobefulfilledis:
Figure 54

ThecandidatestoallocateSRBsonHS-DSCH

where CPICHRSCPCellistheCPICHRSCPmeasurementresultofthecandidatecelland
CPICHRSCPThreSRBHSDPAisthemanagementparameter,whichdeterminesthelowest
absolutevalueofthecellthatitcanbecandidatetoallocateSRBsonHS-DSCH.(Note:
thiscriterionisvalidalsoincaseactivesetsize1).
SRBsonHSDPAcannotbeusedwithoutallocationofSRBsonHSUPA.
Thecriteriamentionedabovearecheckedwhentheperiodicalmeasurementsare
received.TheresultofthatmaytriggertransportchannelchangeofSRBsbetween
HSPAandDCHaswellasHSPAservingcellchange.Ifanyofaboverequirementsisnot
fulfilledthenHS-DSCHallocationwithoutSRBsonHSPAfollowstheinitialservingcell
criteria.TheallocationofSRBsonHS-DSCH,thatispreferredHSPAservingcell,is
attemptedfirstfromtheselectedcandidatewhichmeasuredCPICHRSCPisbestone
(thevalueofthemeasurementresultishighest).Ifthatdoesnotsucceedthenallocation
isattemptedfromthesecondbestcandidatewhichbelongstogroupofHSPAserving
cellcandidates.Ifneeded,thethirdcandidateisattempted.
Iftheservingcellchangedoesnotsucceedandtheservingcellchangeisnon-critical,
thepresentservingcelliskeptforpossiblePSRBsoftheUE(PS+AMRmultiRAB
case).TheSRBsandCSAMRareswitchedtoDCH.
Incaseofunsuccessfulcriticalservingcellchange,theactionsdescribedinActions
usedinunsuccessfulresourceallocationincaseoffullHSPAconfigurationsectionare
executedonlyinthebestservingcellcandidate.Ifnewservingcellcandidatescannotbe
found,theswitchtoDCHisperformed.

AlgorithmforchangingtheservingHS-DSCHcell
Thischapterexplainstheprinciplesusedtoselectthetargetcellseparatelyforeach
eventthatcantriggertheservingHS-DSCHcellchange.
Operation when DL CPICH Ec/No triggers the serving HS-DSCH cell change
Periodicalreportingoftheintra-frequencyCPICHEc/Nomeasurementisusedforthe
servingHS-DSCHcellchangeprocedure.TheCPICHEc/NooftheservingHS-DSCH
cellhastobecloseenoughtothecurrentlybestcellintheactivesetorelsetheserving

152

DN0638161

R: 152/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

HS-DSCHcellchangeisinitiated.EachtimetheUEsendstheperiodicalintra-frequency
CPICHEc/Nomeasurementreport,theneedfortheservingHS-DSCHcellchangeis
evaluated:
Figure 55

TheconditiontoinitiateservingHS-DSCHcellchange

Intheequation,CPICHEc/NoServ_cellistheCPICHEc/Nomeasurementoftheserving
HS-DSCHcell,CPICHEc/NoBest_cellistheCPICHEc/Nomeasurementofthebestcellin
theactivesetandHSDPAServCellWindowisthemanagementparameter,which
determinesthewindow-relativetothebestcellintheactiveset-insideofwhichthe
servingHS-DSCHcellmustbeinordertoallocateHS-DSCH.
IftheHSDPACellChangeMinIntervaltimerisrunningtheservingHS-DSCHcell
changeisnotinitiatedbecauseoftheCPICHEc/Nomeasurement.
IfCPICHEc/NooftheservingHS-DSCHcellisgreaterthanorequaltothethreshold,
determinedbytheHSDPACPICHEcNoThresholdparameter,thecurrentservingcellis
kept.
Toexecuteinter-BTSservingHS-DSCHcellchange,theULSIRerrorofthetargetBTS
mustexceedthethresholddeterminedbytheHSDPASIRErrorTargetCellparameter.
SIRerrormeasurementtobeusedforevaluationisthelatestaveragedvalue.Alsointhe
caseofintra-BTSinter-LCGservingHS-DSCHcellchange,theULSIRerrorofthetarget
cellmustbeabovethethreshold.Inthecaseofanintra-BTSintra-LCGservingHSDSCHcellchange,theULSIRerrorisnotchecked.
AlltheHSDPA-capablecellsthatfulfilltheconditiondefinedbytheEquationFigure52:
Conditionforselectingthecandidatecellsareselectedaspossiblecandidatecellsfor
newservingHS-DSCHcells.
Furthermore,iftheUEusesaPSstreamingRB,HSPAstreaminghastobeactivated
(HSPAQoSEnabledparameter)inthetargetcell,aswell.Ifthisconditionisnotfulfilled,
therespectivecellisthennotselectedascandidatecell.
WhenthecellsthatfulfilltheDLCPICHEc/NoandULSIRerrorconditionsarefound,the
servingHS-DSCHselectionisexecutedaccordingtothesameprioritiesasinthe
selectionofinitialservingHS-DSCHcell.
IfnoneofthecellsintheactivesetcanbechosenastheservingHS-DSCHcell,thatis,
theservingHS-DSCHcellchangecannotbeexecuted,thecurrentHS-DSCHallocation
iskept.
IftheservingHS-DSCHcellchangefails,theservingHS-DSCHcellchangeisretriedat
intervalsdeterminedasfollows:
Interval = min (10 seconds, Number of failures * 2 seconds)
Whenthetimeintervalfromthepreviousunsuccessfulattempthaselapsed,thenext
periodicalCPICHEc/Noreportiswaitedfor.IftheconditiontostartservingHS-DSCH
cellchangeisstilleffective,areattemptismade.
TheservingHS-DSCHcellchangealgorithmisillustratedinthefollowingflowchart.

Issue:06H

DN0638161

R: 153/396

153

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

Figure 56

ServingHS-DSCHcellchangealgorithm

Operation with other triggers, which initiate the serving HS-DSCH cell change
ThefollowingreasonsinitiatetheservingHS-DSCHcellchange:

154

TheleveloftheULSIRerrorintheservingcellthatinitiatestheinter-BTSandintraBTSinter-LCGservingHS-DSCHcellchangecanbeconfiguredwith
HSDPASIRErrorServCellparameter.

DN0638161

R: 154/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

Intra-frequencymeasurementevent1B(A primary CPICH leaves the reporting


range)or1C(A non-active primary CPICH becomes better than an active one)
initiatestheservingHS-DSCHcellchangeifthecelltoberemovedfromtheactive
setistheservingHS-DSCHcell.ActivesetupdateisdelayeduntileitherservingHSDSCHcellchangeorHS-DSCHrelease(switchtoDCHX/X(0/0orinitialbitrates,
seeDirectHS-DSCHtoDCHswitch)hasbeenperformed.

ConsecutiveASUandSCCtriggeredbytheMeasurementEvent1Aor1C(for
details,seeFastercompletionofconsecutiveASUandSCCproceduressection).

Thefollowingreasons,whichmaycauseremovaloftheradiolinkfromtheactiveset,
triggertheservingHS-DSCHcellchange:

RadiolinkfailureoftheservingHS-DSCHradiolink(lossofULsynchronization)
IftheBTSsendsNBAP:RADIOLINKFAILUREmessage(lossofUL
synchronization)totheRNCregardingthecurrentservingHS-DSCHradiolinkand
thereareotherHSDPA-capablecellsintheactiveset,theservingHS-DSCHcell
changeisexecuted.Handovercontrolinitiatestheservingcellchangeinthree
secondsafterdetectionofthelossofsynchronization.

RLremovalbecauseofRx-Txtimedifference

ConsecutiveASUandSCCtriggeredbytheMeasurementEvent1Aor1C(for
details,seeFastercompletionofconsecutiveASUandSCCprocedures).

IfthecurrentservingHS-DSCHradiolinkisdeletedfromtheactivesetbecauseofRx-Tx
timedifferencemeasurement(Event6F,6G),andthereareotherHSDPA-capablecells
intheactiveset,theservingHS-DSCHcellchangeisexecuted.
TheDLCPICHEc/No,ULSIRerror,andthesupportofHSPAstreaming(ifaPS
streamingRBexists)areusedascriteriawhenfindingthecandidatecells:

Issue:06H

DLCPICHEc/Noofthecandidatecelldoesnothavetobeinsideofthewindow
(determinedbytheHSDPAServCellWindowparameter)tochangeservingHSDSCHcell.Thisisbecauseinthiscaseitisbettertoallocateanycellthantoswitch
toDCH.
TheDLCPICHEc/NomeasurementsusedtobothselectthenewservingHS-DSCH
cellanddefinethepriorityorderofthecandidatecellsaretakenfromthereported
measurementevent1Bor1C,dependingonwhichmeasurementinitiatedthecell
change.However,ifmorerecentCPICHEc/Noisavailablewhenhandlingofthe
measurementevent1Bor1Cisstartedbythehandovercontrol,thelatestCPICH
Ec/Nomeasurementreport,suchastheperiodicalCPICHEc/Noreport,isused
insteadoftheCPICHEc/Noreportedintheoriginalmeasurementevent1Bor1C.

IfthelevelofULSIRerrortriggersthechange,ULSIRerrorofthetargetcellmustbe
aboveorequaltothethresholddeterminedbytheHSDPASIRErrorTargetCell
operatormanagementparametertoallocateHS-DSCH.Withothertriggersitis
enoughthattheULSIRerrorofthetargetcellisaboveorequaltothethreshold
determinedbytheHSDPASIRErrorServCelloperatormanagementparameterto
allocateHS-DSCH.TheULSIRerrortriggerisvalidonlyinthecaseoftheinter-BTS
orintra-BTSinter-LCGservingHS-DSCHcellchange.ULSIRerrorcannottriggerthe
intra-BTSintra-LCGservingcellchange.

IfthePRFILE (007:0284 RN40_MAINT_014) parameterequals3(Bit0=1and


Bit1=1),andtheservingcellchange(SCC)istriggeredbecauseoftheremovalof
theservingHS-DSCHradiolinkfromtheactiveset,thehandovercontroldoesnot

DN0638161

R: 155/396

155

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

usetheULSIRerrormeasurementofthetargetcellasacriterion.ThePRFILE
(007:0284 RN40_MAINT_014)(Bit0)parameteralsocontrolsalegacyfunction,
wherethechanneltypeswitchfromHSDPA/HSPAtoDCHbecauseoftheUL
SIRerrormeasurementisprevented.HandovercontrolignorestheULSIRerror
measurementofthetargetcell(newfunction)onlyifthechanneltypeswitch
preventionisenabled(legacyfunction).

IftheUEusesaPSstreamingRB,HSPAstreaminghastobeactivated
(HSPAQoSEnabledparameter)inthetargetcell,aswell.Ifthisconditionisnot
fulfilled,therespectivecellisthereforenotselectedascandidatecell.

WhenthecellsthatfulfilltheULSIRerrorconditionarefound,theservingHS-DSCH
selectionisexecutedaccordingtosameprioritiesaswhenselectingtheinitialserving
HS-DSCHcell.
IftheservingHS-DSCHchangetotargetcellfails,theothercandidatecellsare
attempted.Ifsimilarfailureoccursalsoforothercandidatecells,theservingHS-DSCH
cellisnotchanged.IftheservingHS-DSCHcellcannotbekept,forexample,becauseof
lowULSIRerrororlostradiolink,HS-DSCHisreleasedandmappedtoDCHX/X(0/0or
initialbitrates,seeDirectHS-DSCHtoDCHswitch).IfthereleaseofHS-DSCHfails,the
releaseisretriedaslongastheconditiontoperformthereleaseremains.
TheRNCsetsaUE-specificguardtimerafterHS-DSCHMAC-dflowreleasetoprevent
immediateandrecurringHS-DSCHallocations,whenHS-DSCHMAC-dflowhasbeen
releasedbecauseofanyhandoverreasonandtheradiobearerismappedontoDCH
afterrelease.HS-DSCHtransportchannelisnotallowedtobeallocatedduringtheguard
timeperioddeterminedbytheHsdschGuardTimerHOmanagementparameter.
TheguardtimerconcernstheparticularUEanditiseffectiveinallthecellsunderthe
RNC.TherestrictioniseffectivefortheUEintheCELL_DCHandCELL_FACHstates.
Whenthetimerexpires,HS-DSCHallocationisallowedtotheparticularUEagain.

HSPAservingcellchangebecauseofevent1Aand1Cissupported
byusingactivesetupdate(ASU)message
RNCisabletoperformHSPAservingcellchange(SCC)tothecellthatistobeaddedin
theactivesetbecauseoftheevent1Aor1C.Thisisperformedbyusingtheactiveset
updateinsteadoftheradiobearerreconfigurationprocedurebetweenUEandRNC.
TheSCCwithASUissupportedwithFullHSPAconfiguration.SCCwithASUis
performedonlyforRel7ornewerUEs.TheSCCwithASUisnotsupportedifDLSRBis
mappedtoDCH.
IncasetheSRBsonHSPAexist,thenewcellintheactivesetcellsshouldbethetarget
ofHSPAservingcellif:
1. CPICH_ECNOADDHSDPASRBWindow>CPICH_ECNObest_cell,
2. CPICH_RSCPADD>CPICH_RSCPbest_celland
3. CPICH_RSCPADD>CPICHRSCPThreSRBHSDPA.

156

DN0638161

R: 156/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

CPICH_ECNOADDandCPICH_RSCPADDareCPICHEcNoandCPICHRSCP
measurementresultsofcellreceivedfromUE,whichtheRNCdecidestoaddtothe
mobilestationactiveset.CPICH_ECNObest_cellandCPICH_RSCPbest_cellare
CPICHEcNoandCPICHRSCPmeasurementresultsofthebestcellwhichbelongsto
thecurrentactivesetoftheUE.
TheHSDPASRBWindowandtheCPICHRSCPThreSRBHSDPAareRNPmanagement
parameters.Followinginformationcanbechangedduringcapacityallocationofthenew
branchwithHSPAservingcellconfiguration.
E-DCHreconfigurationinformation:

ServingGrantvalue

Primary/SecondaryGrantSelector

E-DPCCH/DPCCHpoweroffset

ReferenceE-TFCIs-ReferenceE-TFCI

ReferenceE-TFCIPO

PowerOffsetforSchedulingInfo

3-Index-StepThreshold

2-Index-StepThreshold

E-HICHInformation

CHOICEE-RGCHInformation

E-RGCHInformation

E-RGCHreleaseindicator

IftherearenootherchangesbecauseofHSPAservingcellchange,theSCCcanbe
performedbysendingonlyASUmessagewithactivationtimetotheUE.Forexample,
thechangeofEDCHTTIorHARQprocessallocationcannotbesignaledtotheUEby
usingASUmessage.ThefunctionalityiseffectivewhentheHSDPAMobilityparameter
isenabled.Forexample,servingHS-DSCHcellchangeandSHOoftheassociated
DPCHareallowed.
TheservingcellchangewithASUcanbeonlyperformedwhenASUcontainsthe
neededparametersforreconfiguringtheUE.Forexample,RLCreconfigurationisnot
possiblebyusingASU.ThismeansthatifHS-DSCHMAC-dflowpeakratechangesin
SCC,ASUcannotbeused.
TypicallytheHS-DSCHMAC-dflowpeakratechangeswhentheDC-HSDPA,MIMO,or
64QAMactivationordeactivationoccurs.ThusseparateASUandSCCproceduresare
needed.ItisalsonotfeasibletoincreasethesizeoftheRRC:ActiveSetUpdate
messagebecauseoftheparametersneededforDC-HSDPA,MIMO,or64QAM
activation.

ServingcellchangesupportedforMIMOUE
MIMOhasnoeffectontriggeringoftheservingcellchange(SCC),butitoughttobe
activatedalwayswhenitispossible.MIMOcanbeactivatedordeactivatedintargetside
dependingonitssupportthere.AlsoanSCCwithASUcanbeusedwhenMIMOis
activated,asdescribedinHSPAservingcellchangebecauseofevent1Aand1Cis

Issue:06H

DN0638161

R: 157/396

157

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

supportedbyusingactivesetupdate(ASU)messagesection.Activationordeactivation
ofthefeatureisnotsupportedwhentheSCCisperformedwithanactivesetupdate
(ASU)procedure.
MIMOavailabilityischeckedinthetargetcellwhentheserving-cellchangeisinitiated.If
thetargetcelldoesnotsupportMIMO,theSCCisperformedwithoutMIMO,thatis,
MIMOisdeactivatedinconnectionwiththeSCC.
TheprinciplesabovealsoapplywhenMIMOisactivatedsimultaneouslywith64QAM.
MIMOwith64QAMiskeptactiveduringtheservingcellchange.Whenthereisno
possibilitytouseMIMOwith64QAMinthetargetcellthenpreferablyMIMOwithout
64QAMisused.Thereisalsoapossibilitytouse64QAMwithoutMIMO.
ThisisalsorelevantwhenMIMOisusedsimultaneouslywithDCHSDPA.

Serving-cellchangesupportedforDCHSDPA
TheRNCsupportstheservingcellchange(SCC)whenDCHSDPAisallocatedforthe
UE.DCHSDPAdoesnotaffectthetriggeringofservingcellchangebuttheexisting
triggersareeffective.
TheRNCfollowsthestandardsofthefunctionalitydescribedinchapterDual-cellHSDPA
allocationwhenitmakesadecisionwhethertoallocatetheDCHSDPAinthetargetcell
oftheservingHS-DSCHcellchange(theRNCallocatesDCHSDPAwheneveritis
possible).
ThisisalsorelevantwhenDCHSDPAisusedsimultaneouslywithMIMO.

FastercompletionofconsecutiveASUandSCCprocedures
TheRNCexecutestheservingHS-DSCHcellchange(SCC)immediatelyaftertheintrafrequencymeasurementevent1Aor1Ctriggeredactivesetupdate(ASU)procedurein
casewhenthenewcelladdedtotheactivesetshouldbetheservingHS-DSCHcelland
itisnotpossibletochangetheservingHS-DSCHcellduringtheASUprocedure.
TheSCCprocedureisbasedonthemeasurementevent1A/1C,reportedbytheUE
(RRC:MEASUREMENTREPORT).Inthiscase,theRNCdoesnotneedtowaitfora
newMeasurementreporttotriggertheSCC.Thefunctionalityfollowstheseprinciples:
1. UEreportsMeasurementEvent1a(CellAddition)orMeasurementEvent1c(Cell
Replacement),toaddanewcell/replaceanexistingcellintheactiveset.
2. RNCinitiatesASU(RRC:ACTIVESETUPDATE).
a) IncaseofEvent1a,RNCinitiatesCellAdditionprocedure.
b) IncaseofEvent1c,RNCinitiatesCellReplacementprocedure.
3. AftercompletionoftheASUprocedure(RRC:ACTIVESETUPDATECOMPLETE),
RNCinitiatesSCC.
IftheRNCreceivesthenewintra-frequencymeasurementreportsfromtheUE,
duringtheASUprocedure,itrechecks,iftheSCCisstillneededandwhichactiveset
cellshouldbetheservingHS-DSCHcell.
Theintra-frequencymeasurementreportssentbytheUEtotheRNC,maybe
periodicalorevent-triggered.

158

DN0638161

R: 158/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

SimultaneousactivationofdelayedHS-DPCCHpoweroffsetupdatefunctionality,
describedinPrioritizationofSCCandASUoverpoweroffsetupdatesection,is
recommended.
TomakethecompletionoftheconsecutiveASUandSCCproceduresfaster,theFast
HSPAMobilityfeaturemustbeactiveintheSRNC,andthevaluesoftheWCELDirectSCCEnabledandWCEL-FastHSPAMobilityEnabledparametersmustbe
settoEnabledintheservingHS-DSCHcell.
Thefunctionalityisalsoenabledduringanchoring,providedtheFastHSPAMobility
featureisenabledintheSRNCandthevalueoftheVCEL-DirectSCCEnabled
parameterisEnabled.

LimitingthenumberandintervalofservingHS-DSCHcellchanges
TheoperatorscandefinethemaximumnumberofallowedservingHS-DSCHcell
changes(HSDPAMaxCekkChangeRepetitionparameter)withinadesiredtimeframe
(HSDPACellChangeRepetitionTimeparameter).IfthenumberofservingHS-DSCH
cellchangesisexceededwithintheconfiguredtimeframe,theRNCreleasestheHSDSCHandmapstheRBtoDCHX/X(0/0orinitialbitrates,seeDirectHS-DSCHtoDCH
switch).
TheoperatorscandefinetheminimumintervalbetweenservingHS-DSCHcellchanges
causedbyDLCPICHEc/Noreason(HSDPACellChangeMinIntervalparameter).
Whilethetimerisrunning,theRNCdoesnotperformservingHS-DSCHcellchange.

9.3 HSPAoverIur

NotethatlicenseinformationisrelevantonlytotheIPA-RNCsolution.
TheHSPAoverIur(RAN1231)featureoverridesHSPAinter-RNCcellchange
(RAN1515)featurementionedinchapterHSPAInter-RNCCellChange.
TheHSPAoverIurfeatureiscontrolledbytheparameterHSPAOverIur.TheSRNC
readstheparameter.TheDRNCdoesnotreadtheparameterbutthelicenseonly.The
HSPAOverIurparameterdefinessupportperneighboringRNC(Iur-object).
IftheHSPAOverIurparameterissetEnabled:

TheSRNCisallowedtosetupHS-DSCHandE-DCHradiolinkoverIur-interface

TheSRNCisallowedtoperformSCCfromtheSRNCcelltotheDRNCcell

IftheHSPAOverIurparameterissetDisabled:

Issue:06H

TheSRNCdoesnotsetupHS-DSCHandE-DCHradiolinkoverIur-interface

TheSRNCdoesnotperformSCCfromtheSRNCcelltotheDRNCcell

DN0638161

R: 159/396

159

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

TheDRNCdoesnotreadtheparameterHSPAOverIurbutthelicenseonly.Ifthe
licenseexistsandthestateisON:

TheDRNCisallowedtoacceptradiolinkoverIur-interfacecontainingHS-DSCHand
E-DCHMAC-dflowinformation

IfHSPAoverIurisdisabledintheDRNC,DRNCusesRNSAPcausevalueRequested
Configuration not Supported.ReleaseversionofneighboringRNCmustbeRel6orlater
inordertoenabletheHSPAOverIurparameter.IfHSPAoverIurfeatureisDisabled,an
associatedDPCHisallowedtobeinSHOovertheIur-interfaceaslongastheserving
HS-DSCHradiolinkisundercontrolofSRNC.IfalsoHSPAInter-RNCCellChangeis
disabledandtheservingradiolinkistoberemovedfromSRNCandiftheservingcell
changecannotbeexecutedsothattheservingradiolinkremainsundertheSRNC,HSDSCHMAC-dflowisreleasedandchanneltypeswitchtoDCHisperformed.
TheSRNCchecksthelicensesforthevirtualcellandvirtualBTS.TheSRNCusesthe
virtualcell(VCELobject)andvirtualBTS(VBTSobject)toobtaincell-andBTS-specific
parameters.InordertoenablethefollowingfeaturesinthevirtualcellorvirtualBTS,the
correspondingcapacitylicensesarerequiredintheRNC.ThevirtualcellorvirtualBTS
doesnotconsumecapacityoftheexistinglicenses.Thismeansthatifoperatoractivates
afeature,whichrequirescapacitylicense,theRNCdoesnotdeductthecapacityofthe
licensebutonlychecksifthecorrespondinglicenseexistsandthestateisONinthe
RNCbeforeactivationisallowedinVCELorVBTS.TheRNCalsoallowsactivationin
VCELandVBTSevenifthewholecapacityofthelicenseisconsumedintheRNC.
TheSRNCusesthecell-andBTS-specificparametersofthevirtualcell(VCEL)andthe
virtualBTS(VBTS)fortheDRNCcells.TheSRNCusesthecell-andBTS-specific
parametersoftheSRNCcell(WCEL)andSRNCBTS(WBTS)fortheSRNCcells.The
DRNCusesthecell-andBTS-specificparametersoftheDRNCcell(WCEL)andDRNC
BTS(WBTS)fortheDRNCcells.Thevirtualcell(objectclassVCEL)andthevirtualBTS
(objectclassVBTS)aredescribedinWCDMA RAN RRM Packet Scheduler.VCELand
VBTSparameterscanbemodifiedonline.Thevaluesoftheparametersarereadbythe
programblocksinconjunctionwiththeHS-DSCHandE-DCHMAC-dflowsetup.

Channeltypeselection
ChanneltypeselectionisperformedbytheSRNCandtheDRNC.Channeltype
selectioncriteriaischeckedbytheSRNCandtheDRNC.
TheSRNCchecksthefollowingcriteriaforHS-DSCHandE-DCHallocation:

160

HSPAoverIur,HSDPAservingcellchangeandHSDPAdynamicresourceallocation
featuresareenabled(HSPAOverIur,HSDPAMobilityand
HSDPADynamicResourceAllocationparametersaresetEnabled)

RABcombinationsupportedfortheUE(OnlysinglePSNRTRABcombinationis
supported)

TrafficClass/TrafficHandlingPriorityisallowed(HSDSCHQoSclassesand
EDCHQOSClasses)

UECapability

DN0638161

R: 160/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

HSPAisenabledandthecellsupportsHSPA(HSDPAenabled,
HSDPAAvailabilityIur,HS-DSCHSupportIndicator,HSUPAEnabled,
HSUPAAvailabilityIur,E-DCHSupportIndicator)

IFHO/ISHOmeasurementsrunning

Guardtimers(HsdschGuardTimerHO,HsdschGuardTimerLowThroughput)

E-DCHisnotallocatedifRBmappedtoDCH>0andcapacityrequesttoupgrade
DCHisreceived

E-DCHactivesetisacceptable

TheDRNCchecksthefollowingcriteriaforHS-DSCHandE-DCHallocation:

HSDPAMobilityandHSDPADynamicResourceAllocationenabled

NeededHSPAQoSfeaturessupported(HSPAQoSEnabled)

RABcombinationsupportedfortheUE(OnlysinglePSNRTRABcombinationis
supported)

HSPAisenabledandthecellsupportsHSPA(HSDPAenabled,HSUPAEnabled,
HSDPACapability,HS-DSCHResourceOperationalState,E-DCHCapability,EDCHResourceOperationalState)

MaxnumberofHS-DSCHMAC-dflows/HSDPAusers/HSUPAusers/E-DCH
allocations

LocalcellgroupspecificBTSResourceStatusinformation

TheSRNCperformschanneltypeselectiontasksfortheDRNCcellasdescribedabove.
TheSRNCrequestsHS-DSCHMAC-dflowtobesetupoverIurbyusingRadioLink
ReconfigurationprocedureandE-DCHMAC-dflowtobesetupoverIurbyusingRadio
LinkReconfiguration/RadioLinkSetupprocedures.RadioLinkAdditionprocedurecan
beusedforSHObranchaddition(DCHorE-DCH).Afterthis,theDRNCperforms
channeltypeselectiontasksasdescribedabove.
TheDRNC(UE-specificPS)doesnotcheckHS-DSCHandE-DCHQoSclassesas
definedbytheparametersHSDSCHQoSclassesandEDCHQOSClasses.TheDRNC
acceptsHS-DSCHMAC-dflowandE-DCHMAC-dflowsetupoverIur,SCC,andUEnot
involvedSRNSregardlessofthevaluesoftheparameters.

Maximumnumberofallocations
TheDRNC(Cell-specificPS)checksthemaximumnumberofHSDPAusers,HS-DSCH
MAC-dflows,HSUPAusers,andE-DCHallocationsiftheSRNCrequestsHS-DSCH
MAC-dflowsetupovertheIur-interface.TheDRNCdoesnotadmitthenewuserifany
userlimitisexceeded.
TheSRNCallocatesE-DCHMAC-dflowovertheIur-interfacewithoutHSUPAresource
reservationstatusinformation.TheusageofHSUPAresourcereservationstatusinthe
DRNCfollowsthemethodsofoperation.

(N)RT-over-(N)RTandpre-emption
TheDRNCdoesnotstartNRT-over-NRT(PBSforULDCH)orRT-over-NRTorRT-overRTorpre-emptionactionsifSRNCattemptsDCHtoHSPAchanneltypeswitch(CTS)
andtheDRNCisnotabletoallocateHSPAresources.TheDRNCnoticesDCHtoHSPA

Issue:06H

DN0638161

R: 161/396

161

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

switchattemptiftheSRNCsendsRadioLinkReconfigurationandrequeststochange
mappingoftheexistingradiobearersfromDCH/DCHtoHS-DSCH/E-DCHorHSDSCH/ULDCH.
TransportlayerreturnsinformationaboutreservedresourcestoRRMandRRMutilizes
thisinformationforRT-over-RT,RT-over-NRTandpre-emption.Thisfunctionalityis
appliedintheDRNCforHS-DSCHandE-DCHMAC-dflowsoverIur-interface.The
DRNCappliesNRT-over-NRT(SHObranchaddition),PriorityBasedScheduling(PBS)
andoverloadcontrolfunctionalitiestoULDCHreturnchannelwhenDLRBismapped
ontoHS-DSCH.NRT-over-NRT,PBSandoverloadcontrolfunctionstargetedtotheUL
DCHreturnchannelfollowthefunctionalitiesdescribedfortheFlexiDirectBTSSharing
(SchedulingofRel99PSdata)inWCDMA RAN RRM Packet Scheduler.
NotethattheFlexiDirectBTSSharingrelatedlicenseandfeatureactivationoftheDCH
schedulingduringanchoringarenotneededbutitisenoughthatHSPAoverIuris
enabledinordertosupportabovementionedULDCHrelatedschedulingfunctionalities
overIur-interface.NRT-over-NRTtargetedattheHS-DSCHorE-DCHMAC-dflowsare
notsupported.
IftheBTSsendsRadioLinkFailuremessagewithcausecodeUL Radio Resources Not
AvailabletotheRNC,theRNCswitchesE-DCHtoDCH.IncaseofE-DCHMAC-dflow
overIur-interface,theDRNCforwardsthesametotheSRNCviaRNSAP:RadioLink
FailureIndicationmessage.TheSRNCstartsE-DCHtoDCHchanneltypeswitchupon
receivingRNSAP:RadioLinkFailureIndicationmessagewithcausecodeUL Radio
Resources Not AvailablewhenE-DCHMAC-dflowoverIur-interface.Whenchannel
typeswitchisdonethehandovercontroldoesnotsettheEDCHCTSwitchGuardTimer
timerbutstartsDCHtoE-DCHchanneltypeswitchimmediately.

ServingCellChange
Theservingcellchange(SCC)overIur-interfaceissupportedforsinglePSNRTHSDSCHandE-DCHMAC-dflowinthefollowingscenarios:

SCCfromtheSRNCcelltotheDRNCcell(Inter-BTSSCC)

SCCfromtheDRNCcelltotheDRNCcellinsideoneRNC(Intra-BTSSCC/InterBTSSCC)

SCCfromtheDRNCcelltotheDRNCcellbetweentwodifferentRNCs(Inter-BTS
SCC)

SCCfromtheDRNCcelltotheSRNCcell(Inter-BTSSCC)

TheBTSIdoftheDRNCBTScontrollingtheDRNCcellsisnotknownattheSRNC.
HencetheSRNCcannotdifferentiatebetweeninter-BTSandintra-BTSservingcell
changebasedontheBTSIdinthefollowingscenario:

SCCfromtheDRNCcelltotheDRNCcellinsideoneRNC

TheSRNCHCstoresandutilizestheDiversity IndicationIEandReference RL IDIEs


receivedinRNSAP:RadioLinkSetup/AdditionResponse/Failuremessagesforthe
DRNCRLssuccessfullyaddedoverIur.IftheDiversity IndicationIEissettoCombining
foraRadiolink,thenthecorrespondingradiolinkandradiolinkidentifiedbythe
Reference RL IDbelongtothesameBTSandLCG.Iftheservingcellandcandidate

162

DN0638161

R: 162/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

cellsarecombined,thentheSCCisconsideredtobeanintra-BTSintra-LCGservingcell
change.Thishappenswhentheservingcellandcandidatecellarelocatedinthesame
DRNC.
TheSRNCdeterminesHSDPAcapabilityoftheDRNCcellbasedonthe
HSDPAAvailabilityIurparameterandHS-DSCHSupportIndicator(CellCapability
ContainerIE)asspecifiedinSRNCperformsinitialselectionoftheservingcelland
SRNCchecksHS-DSCHandE-DCHsupportoftheneighboringcellsoftheDRNCcell.
TheSRNCdeterminesHSUPAcapabilityoftheDRNCcellbasedonthe
HSUPAAvailabilityIurparameterandE-DCHSupportIndicator(CellCapability
ContainerIE)asspecifiedinSRNCperformsinitialselectionoftheservingcelland
SRNCchecksHS-DSCHandE-DCHsupportoftheneighboringcellsoftheDRNCcell.
Thefollowingservingcellchange(SCC)withchanneltypeswitch(CTS)scenariosare
supportedoverIurinterfacewhentheRABcombinationoftheUEissinglePSNRT
RAB:
1. DCHtoE-DCHchanneltypeswitchinULduringtheaboveSCCscenarios
2. E-DCHtoDCHchanneltypeswitchinULduringtheaboveSCCscenarios
RadioLinkSetup/RadioLinkAddition(branchaddition)forE-DCHMAC-dflowis
supportedoverIur-interfaceiftheRABcombinationoftheUEissinglePSNRTHSPA
RAB.RadioLinkReconfiguration(SCC/initialHSPAallocation)forHS-DSCHMAC-d
flowandE-DCHMAC-dflowissupportedoverIur-interfaceiftheRABcombinationof
theUEissinglePSNRTHSPARAB.
TheDRNCcellcanbechosenastheservingcellduringinitialselectionphase.
InitialselectionoftheservingHSPAcellisperformedbytheSRNC.TheSRNCchooses
theservingcellfromthoseSRNCandDRNCcells,whichbelongtotheactiveset.RAB
combinationmustbesinglePSNRTRAB.

SRNCperformsinitialselectionoftheservingcell
InitialselectionoftheservingHSPAcellisperformedbytheSRNC.TheSRNCchooses
theservingcellfromthoseSRNCandDRNCcells,whichbelongtotheactiveset.Initial
selectionoftheservingcellfollowstheprinciplesandwiththeseexceptions:

Issue:06H

TheHSPAOverIurparameterofthatparticularIur(neighboringRNC)mustbesetto
EnabledinordertochoosetheDRNCcellastheservingone

RABcombinationoftheUEmustbesinglePSNRTRABinordertochooseDRNC
cellasservingHS-DSCHcellandservingE-DCHcell

HSDPAmustbeavailableandsupportedintheDRNCcellinordertochooseDRNC
cellastheservingHS-DSCHcell

HSUPAmustbeavailableandsupportedintheDRNCcellinordertochooseDRNC
cellastheservingE-DCHcell

TheHSDPAServCellWindowparameterfromtheSRNCisusedfortheDRNCcells
incaseofinitialselectionoftheservingcell

DN0638161

R: 163/396

163

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

TheSRNCchecksHSDPAandHSUPAavailabilityoftheDRNCneighboringcell.The
HSDPAAvailabilityIurHOPSparameterdetermineswhethertheDRNCneighboring
cellsupportsHSDPA.TheHSDPAAvailabilityIurHOPSparameterdetermines
whethertheDRNCneighboringcellsupportsHSUPA.HOPSparametersetreservedfor
VCELisusediftheDRNCneighborcellisnotdefinedintheADJSlistoftheSRNCand
isreceivedoverIurintheNeighboringUMTScellinformationfromtheDRNC.

Channeltypeswitching
DCHtoHSPAchanneltypeswitch(CTS)issupportedifactivesetcellsarelocated
simultaneouslyintheSRNCandDRNC.CTSfromDCHtoHSPAmayresultinHSDSCHandE-DCHMAC-dflowtobesetupoverIur-interface.Theservingcellischosen
fromtheSRNCandtheDRNCcellsaccordinginitialservingcellselectionprocedure.
DCHtoHSPACTScontrolledbytheSRNCfollowstheexistingfunctionalitiesalsoif
CTSresultsinHS-DSCHandE-DCHMAC-dflowtobesetupoverIur-interface.The
followingadditionsareeffective:

RABcombinationoftheUEmustbesinglePSNRTRABinordertochooseDRNC
cellasservingHS-DSCHandservingE-DCHcell.AlsoDRNCAScellcanbeanon
servingE-DCHcellonlyiftheRABcombinationissinglePSNRT.

theSRNCdeterminesHSDPAcapabilityoftheDRNCcellbasedon
HSDPAAvailabilityIurparameterandHS-DSCHSupportIndicator(Cell
CapabilityContainerIE)

theSRNCdeterminesHSUPAcapabilityoftheDRNCcellbasedon
HSUPAAvailabilityIurparameterandE-DCHSupportIndicator(CellCapability
ContainerIE)

HSPA(HS-DSCHand/orE-DCHMAC-dflow)toDCHchanneltypeswitch(CTS)is
supportediftheservingcellislocatedinDRNCornon-servingE-DCHAScellislocated
intheDRNC.
HSPAtoDCHCTScontrolledbytheSRNCfollowsthefunctionalitiesdescribedin
WCDMA RAN RRM HSUPA.
IftheHSPAoverIurfeatureisenabledintheSRNC(HSPAInter-RNCCellChange
LicenseisOn),HSPA/HSDPAtoDCHswitchisnotperformediftheservingcellisunder
DRNCandthelastSRNCcellisremovedfromtheactivesetresultinginrelocationto
DRNC.WhenthelastactivesetcellintheSRNCisdeleted,UE not involvedSRNS
relocationistriggeredwhileHSPAserviceisinuse.AlsoUE involvedSRNSrelocationis
supportedifIur-interfaceiscongested.However,incaseofRelocationfailure,CTSto
DCHisperformedsinceHSPAoverIurisnotsupportedduringanchoring.
IfUE Involved/Not InvolvedRelocationcannotbestartedbytheSRNCtowardsthe
DRNC(forexample,incaseswhenrelocationisnotsupportedbytheDRNC/CNorif
morethanoneDRNCexistsintheAS)andthelastSRNCcellmustbedeleted(withthe
servingcellundertheDRNC)resultinginanchoringsituationthenaCTSfrom
HSPA/HSDPAtoDCHisperformedbeforeenteringintoanchoring.

164

DN0638161

R: 164/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

DRNCsetsHS-DSCHandE-DCHSupportIndicator
TheDRNCsetsHS-DSCHandE-DCHSupportIndicator(NeighbouringUMTSCell
Information/NeighbouringFDDCellInformation/CellCapabilityContainerFDDIE)in
conjunctionwiththeRadioLinkSetuporRadioLinkAdditionandsignalthevalueinthe
responsemessagetotheSRNC.IftheHSDPAenabledparameterissettoEnabledin
thecell,theDRNCsetstheHS-DSCHSupportIndicatortoSupported.Ifthe
HSDPAenabledparameterissettoDisabledinthecell,theDRNCsetstheHS-DSCH
SupportIndicatortoNotSupported.IftheHSDPAenabledparameterissettoEnabled
inthecell,theDRNCsetstheE-DCHSupportIndicatortoSupported.Ifthe
HSDPAenabledparameterissettoDisabledinthecell,theDRNCsetstheE-DCH
SupportIndicatortoNotSupported.
However,iftheneighborcelliscontrolledbyadifferentRNCthanowntheDRNC,then
HSDPAandHSUPAsupportintheneighboringDRNCcellisnotknown.Hencethe
DRNCdoesnotsettheCellCapabilityContainerforsuchneighborcells.

SRNCchecksHS-DSCHandE-DCHsupportoftheneighboringcells
oftheDRNCcell
TheSRNCcheckstheHS-DSCHandE-DCHsupportoftheneighboringcellsofthe
DRNCcell.TheSRNCreadstheHS-DSCHSupportIndicatorandE-DCHSupport
Indicator(NeighbouringUMTSCellInformation/NeighbouringFDDCellInformation/
CellCapabilityContainerFDDIE)ifreceivedinconjunctionwiththeRadioLinkSetupor
RadioLinkAdditionovertheIur-interface.TheSRNCdoesnotsetupHS-DSCHMAC-d
flowtothatparticularDRNCcelliftheHS-DSCHSupportIndicatorindicatesthatHSDSCHisnotsupported.TheSRNCdoesnotsetupE-DCHMAC-dflowtothatparticular
DRNCcelliftheE-DCHSupportIndicatorindicatesthatE-DCHisnotsupported.Ifthe
SRNCdoesnotreceivetheHS-DSCHSupportIndicatorinconjunctionwiththeRadio
LinkSetuporRadioLinkAdditionovertheIur-interface,theSRNCassumesthatHSDSCHissupported.IftheSRNCdoesnotreceivetheE-DCHSupportIndicatorin
conjunctionwiththeRadioLinkSetuporRadioLinkAdditionoverIur-interface,the
SRNCassumesthatE-DCHissupported.
TocheckHSDPAandHSUPAavailability,theSRNCreadsHSDPAAvailabilityIur/
HSUPAAvailabilityIurHOPSparametervalueforneighborcellsoftheDRNC/cell
receivedoverIur.ThosecellsaredefinedasADJSneighborofanySRNCactivesetcell.

ThenumberofconsecutiveservingHSPAcellchangesarehandled
afterUEnotinvolvedSRNSrelocation
CurrentlyfrequentandconsecutiveservingHSPAcellchangesinitiateHS-DSCHandEDCHMAC-dflowrelease.IfthenumberofservingHSPAcellchanges,determinedby
theRNC-specificHSDPAMaxCellChangeRepetitionparameter,inatimeperiod
determinedbytheRNC-specificHSDPAMaxCellChangeRepetitionTimeparameter,
isexceeded,HS-DSCHandE-DCHMAC-dflowisreleased.AftersuccessfulUE not
involvedSRNSrelocationthetargetRNCsetsthevalue0(zero)forthecounter,which
calculatesthenumberofconsecutiveservingHSPAcellchanges.Thetimerthatkeeps
trackofthetimeperiodisnotset.AftersuccessfulUE not involvedSRNSrelocationthe
targetRNCdoesnotsettimerHSDPACellChangeMinInterval.

Issue:06H

DN0638161

R: 165/396

165

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

SRNCstartsULSIRErrormeasurementoverIur
TheSRNC(HandoverControl)startsULSIRErrormeasurementforanyradiolinkover
Iur-interfaceifallthefollowingconditionsareeffective:

HS-DSCHMAC-dflowexists(ULSIRErrormeasurementisstartedinconjunctionwith
theHS-DSCHMAC-dflowsetupfortheUE)

TheHSPAOverIurparameterissettoEnabled

RABcombinationoftheUEissinglePSNRTRAB

TheHSDPAAvailabilityIurparameteroftheDRNCcellissettoEnabled

HS-DSCHSupportIndicatoroftheDRNCcellisnotsettoNotSupported

SIRerrormeasurementisusedforusedservices

WhenRAN2270: Extension of HSPA over Iurfeatureisinuse,themeasurementis


startedalsoincaseofCSAMRonDCH+PSNRTonHS(D)PARABcombination

ULSIRErrormeasurementisstartedascurrentlydescribedinsectionHSDPA UL SIRerror
measurementin WCDMA RAN RRM Admission Control.TheSRNCterminatestheUL
SIRErrormeasurementoverIurafterthelastSRNCcellisdeletedfromtheASoftheUE.
SCCisnotsupportedoverIurduringanchoring.
TheDRNCsupportsULSIRErrormeasurementoverIur-interfaceiftheSRNCinitiates
measurement(RNSAP:DEDICATEDMEASUREMENTINITIATIONREQUEST).The
DRNCsupportsperiodicalreportingoftheULSIRErrormeasurement.
TheSRNC(HandoverControl)usesULSIRErrormeasurementreportedbytheDRNC
accordingtotheexistingprinciples.TheSRNCusestheRNC-parameters
HSDPASIRErrorServCellandHSDPASIRErrorTargetCelloftheSRNCfor
decisionmaking.TheSRNC(HandoverControl)usestheDiversityIndicationIEreceived
inconjunctionwiththeRadioLinkSetuporRadioLinkAdditiontodefineiftheradiolink
iscontrolledbydifferentbasestationsornot.

Combininginformationoftheradiolinks
TheDRNCindicatesthecombininginformationoftheradiolinkstoSRNCinconjunction
withtheRadioLinkSetuporRadioLinkAddition(DiversityIndicationIE)overIurinterface.SRNCusescombininginformation(DiversityIndicationIE)oftheradiolinksto
defineSHOstateinformation.TheSRNCupdatesHS-DPCCHrelatedparameters
accordingtoSHOstate.

SRNCusesexistingmeasurementsforSCCoverIur-interface
TheSRNC(HandoverControl)usestheexistingmeasurementsandtriggersforthe
ServingCellChange(SCC)decisionmakingoverIur-interface.Additionalinformation:
PeriodicalCPICHEc/No,Event1B,Event1C,ULSIRError,RLFailureoranyother
reasoncausingservingRLtoberemovedfromtheactivesetareusedforSCC.HSPA
overIurdoesnotintroduceanynewtriggersormeasurementsforSCCdecisionmaking.

166

DN0638161

R: 166/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

PrioritiesoverIurinterface
TheSRNCdefinesprioritiesoverIurinterface.TheSRNCsetsAllocation/Retention
Priority(ARP)andTrafficClass(TC)informationreceivedfromRANAPwhentheHSDSCHand/orE-DCHMAC-dflowissetupoverIur-interface.TheSRNCsetsScheduling
PriorityIndicator(SPI)to0whentheHS-DSCHand/orE-DCHMAC-dflowissetupover
Iur-interface.
TheDRNCusesAllocation/RetentionPriority(ARP)andTrafficClassinformation(TC)
informationreceivedfromtheSRNCwhentheHS-DSCHand/orE-DCHMAC-dflowis
setupoverIur-interface.
TheDRNCverifiesthereceivedSPIvalue(againstDRNCQoSPriorityMapping
parameter)andactsinthefollowingways:

HSPAQoSprioritizationisenabledintheDRNCcell:
SPIvaluesentbytheSRNCforNRTPSdata(Interactivesignaling,Interactive,
Background)mustbelowerthanorequaltothehighestSPIvaluedefinedforany
NRTPStrafficclassinDRNC.Ifthisisnottrue,theDRNCrejectsHS-DSCH/EDCHMAC-dflowsetupoverIur-interface.

HSPAQoSprioritizationisdisabledintheDRNCcell:
IfthevaluesentbytheSRNCisgreaterthat0(zero),theDRNCrejectsHS-DSCH
/EDCHMAC-dflowsetupoverIurinterface.

TheDRNCusesthefailurecauseRequested Configuration not Supported.


TheDRNCdefinesTrafficHandlingPriority(THP)iftheInteractiveTrafficClassHSDSCHorE-DCHMAC-dflowissetupovertheIur-interface.TheDRNCalwaysgives
THPvalue1forHS-DSCHandE-DCHMac-dflowsoverIurinterface.Duringrelocation
withHSDPA/HSPA,theDRNCacceptstheHSDPA/HSPARABsintherelocation
regardlessofthevalueoftheE-DCHQoSclasses/HS-DSCHQoSclassesparameters.
TheRABparametersreceivedintheRelocationRequestcontaintheTHPvalueforthe
RABsinvolvedinrelocation.TheDRNCupdatesinternallytheTHPvalue.Thisvalueis
takenintouseintheSRNCrolepostrelocation.IncaseofULDCH(HSDPA),theDRNC
followstheexistingprinciplesdescribedinWCDMA RAN RRM Admission Control.
SPIisnotreconfiguredimmediatelyafterUE not involvedSRNSrelocationevenifthe
SPIvaluereceivedfromtheSRNCdiffersfromtheDRNCmapping
(QoSPriorityMapping).SPIisreconfiguredonlyafterHSPAresourcesareallocated
nexttimefortheradiobearer.

Multi-RABcombinationsoverIur-interface
OnlysingleInteractive/BackgroundPSRABissupportedoverIurforHSDPA/HSPAby
theSRNCandtheDRNC.
TheDRNCrejectstheRadioLinkSetup/Addition/ReconfigurationrequestifRAB
combination,otherthansinglePSNRT,isrequestedbytheSRNCwiththefailurecause
Requested Configuration not Supported.

Issue:06H

DN0638161

R: 167/396

167

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

ULDCHreturnchannelbitratesoverIur-interface
IfDLRBismappedontoHS-DSCH,ULRBcanbemappedontoE-DCHorDCH.The
supportedULDCHbitratesaredefinedbytheSRNCaccordingtotheexistingprinciples.
TheDRNCrejectsHS-DSCHMAC-dflowsetup/reconfiguration(RBsetup,RB
reconfiguration,orservingcellchange)overtheIur-interfaceiftheSRNCrequestsUL
DCHbitratethatisnotallowed.
TheDRNCdoesnotlimitULDCHbitratesbasedontheinitial
(HSDPAinitialBitrateUL)ortheminimum(HSDPAminAllowedBitrateUL)bitrate
whentheSRNCrequestsallocation,upgrade,ordowngradefortheULDCHreturn
channeloverIur-interface.TheDRNClimitsULDCHreturnchannelallocationbasedon
themaximumULDCHbitratedefinedbytheHSDPAMaxBitrateULparameterwhen
HS-DSCHMAC-dflowissetup.TheHSDPAMaxBitrateULparameterischeckedfor
theservingcellandnon-servingcell(s).
SRNCusestheHSDPAMaxBitrateULWACparameterfortheradiolinksoverIur
interface.
Duringanchoring,thecell-specificparameters(HSDPAMaxBitRateUL,
HSDPAinitialBitrateUL, HSDPAminallowedBitrateUL),requiredbytheSRNC,
arereadfromtheWACobjectusingtheWACSetIdentifiermanagementparameter,
whichisaddedtoVCEL.
IncaseoftheULDCHbitrateupgraderejectionbytheDRNC(becauseoftheDCH/HSDCHconfiguration),anotherupgradeisperformed,nowwithlowerbitrate(ifsupported).
Whenallupgradesarerejectedthen,thenewupgradeisperformed,asincaseof
DCH/DCH.Thisupgradeistriggeredafterpenaltytime,bynewcapacityrequest.For
moreinformation,seetheWCDMA RAN RRM Packet Scheduler.

SRNCusesutilizationandthroughputmeasurementsforradiolinks
overIur-interface
TheSRNCuseslowutilizationandlowthroughputmeasurementsforHS-DSCHMAC-d
flowandE-DCHMAC-dflowoverIur-interface.Lowutilizationandlowthroughput
measurementsforHS-DSCHMAC-dflowareused.LowthroughputmeasurementforEDCHMAC-dflowisused.Inactivity,lowthroughput,andlowutilizationdetectionforthe
ULDCHreturnchannelfollowsthewaysofworkingdescribedinWCDMA RAN RRM
Packet Scheduler.

SRNCdoesnotperformHS-DSCHMAC-dPDUsizeselection
algorithmforDRNCcell
TheSRNCdoesnotperformHS-DSCHMAC-d(RLC)PDUsizeselectionalgorithm
whentheHS-DSCHMAC-dflowissetupoverIur-interface.TheSRNC(Cell-specificPS
andUE-specificPS)doesnotchangethecurrentlyallocatedMAC-dPDUsizeifthe
servingcellchangetotheDRNCcell,butkeepstheexistingsize.TheSRNCalways
allocatesHS-DSCHMAC-dPDU656bitswhenthenewHS-DSCHMAC-dflowissetup
overIur-interface.MAC-dPDUsizeof336bitsisalwaysusedforHSPAStreaming(no
changestotheexistingfunctionality).TheDRNCrejectsHS-DSCHMAC-dflowsetup
includingMAC-dPDUsizeof656bitsifMAC-dPDUsizeof656bitsisdisabledinthe
basestation(thePDUSize656WithHSDSCHparameterandtheWBTScapability).The
DRNCusesthefailurecauseRequested Configuration not Supported.

168

DN0638161

R: 168/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

DRNCsendstheMeasurementPowerOffsettoSRNC
TheDRNCdefinestheMeasurementPowerOffset(MPO)forHSDPA.TheDRNC
signalsthevaluetotheSRNCwhenHS-DSCHMAC-dflowissetupovertheIurinterface.TheDRNCdefinestheMPOandtheSRNCsignalstheMPOtotheUE.

SRNClimitationoftheNRTHS-DSCHMAC-dflowbitrateoverIur
TheSRNClimitsNRTHS-DSCHMAC-dflowbitrateoverIur-interface.TheIur-specific
parameterMaxIurNRTHSDSCHBitRatedefinestheupperlimitforNRTHS-DSCH
MAC-dflowwhenHS-DSCHMAC-dflowistransmittedovertheIurinterface.

UE-specificPSlimittheHSDPApeakratewhentheHS-DSCHMac-d
flowexistsoverIur.
WhentheHS-DSCHMac-dflowexistsoverIur,theUE-specificpacketschedulerlimits
thepeakrateoftheNRTRBto10Mbit/s.TheSRNClimitstheNRTHS-DSCHMAC-d
flowbitrateovertheIur-interface.TheIur-specificMaxIurNRTHSDSCHBitRate
parameterdefinestheupperlimitforNRTHS-DSCHMAC-dflowwhenHS-DSCHMACdflowistransmittedovertheIur-interface.Theupperrangeofthisparameterisfixedto
9600kbit/s.

SRNCdefinestheHS-SCCHpoweroffset
TheSRNCsendsHS-SCCH(HS-SCCHPowerOffsetIE)poweroffsetIEtotheDRNCin
conjunctionwiththeHS-DSCHMAC-dflowsetupintheDRNC.TheSRNCusesthe
parametersofthevirtualcell(VCEL)fortheDRNCcells.HS-SCCHPoweroffsetis
definedbythePtxOffsetHSSCCHparameter.TheSRNCdoesnotdefinetheHSUPA
commoncontrolchannelpoweroffsets(E-AGCH,E-RGCH,E-HICHPowerOffsets)in
conjunctionwiththeHS-DSCHandE-DCHMAC-dflowsetupoverIurintheDRNC.
However,theDRNCmayreceivealsotheE-AGCH(E-AGCHPowerOffsetIE),E-RGCH
(E-RGCHPowerOffsetIE),andE-HICH(E-HICHPowerOffsetIE)poweroffsetsin
conjunctionwiththeHS-DSCHandE-DCHMAC-dflowsetupintheDRNCwhenthe
SRNCisothervendorsRNC.
TheDRNCremovesparametersfromtheRadioLinkSetup/RadioLinkReconfiguration
/RadioLinkAdditionmessagesbeforesendingthemtothebasestationinthecaseof
WBTS.ParametersaresentonlytoNB/RSxxx.TheNBAPCommModeparameterdefines
thebasestationtype(WBTSFlexiBTS,PicoBTS,orNB/RSxxx).
TheDRNCdoesnotsignalthe3GPP-specificHS-SCCHpowerOffsettotheWBTS.The
WBTS(FlexiBTS,PicoBTS)usesparametersreceivedviaPrivateNBAPmessage.
IftheSRNC(othervendorsRNC)signals3GPP-specificE-AGCH,E-RGCH,andEHICHpoweroffsetstotheWBTSwhenitsupportsE-DCHTTI=2ms,theDRNCdoes
notremovethembuttheoffsetsaresenttotheWBTS.
IftheDRNCdoesnotreceivetheE-AGCH(E-AGCHPowerOffsetIE),E-RGCH(ERGCHPowerOffsetIE),andE-HICH(E-HICHPowerOffsetIE)poweroffsetsin
conjunctionwiththeHS-DSCHandE-DCHMAC-dflowsetupintheDRNC,thenthe
DRNCdefinestheHSUPApoweroffsetsasspecifiedinWCDMA RAN RRM HSUPA.
TheDRNCalwaysassumesthattheconnectionexistsinE-DCHsofterhandoverstate.
HencetheDRNCalwaysaddsthevalueofthePtxOffsetExxCHSHORNPparameter

Issue:06H

DN0638161

R: 169/396

169

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

tothesignaledvaluebecauseF-DPCHisalsonotsupportedintheDRNC.IftheWBTS
supportsE-DCH2msTTI,thentheDRNCsignalstheHSUPApoweroffsetinformationto
theWBTS(UltraSiteBTS,FlexiBTS,PicoBTS)asspecifiedinWCDMA RAN RRM
HSUPA.
IftheDRNCdoesnotreceivetheHS-SCCH(HS-SCCHPowerOffsetIE)poweroffsetIE
inconjunctionwiththeHS-DSCHMAC-dflowsetupintheDRNC,thentheDRNC
definestheHS-SCCHPowerOffsetincaseofNBxxx.

9.3.1 SoftHandoverOverIur
RadioLinkSetup/RadioLinkAddition(branchaddition)forE-DCHMAC-dflowis
supportedoverIur-interfaceonlyforUEswithsinglePSNRTRABcombinationon
HS(D)PAwithSRBonDCH.
TheSRNCcheckstheHSUPACapabilityoftheneighboringDRNCcelltobe
added/replacedand/orE-DCHsupportoftheneighborcelloftheDRNCAScelltobe
added/replacedasdescribedinSRNCperformsinitialselectionoftheservingcelland
SRNCchecksHS-DSCHandE-DCHsupportoftheneighboringcellsoftheDRNCcell
inordertodetermineifabranchadditionforE-DCHMac-dflowispossibleoverIurtoa
theDRNCcell.
TheSRNCsetupE-DCHMAC-dflowoverIur-interfaceduringabranchadditiononlyif
VCEL-HSUPAEnabledparameterissettoEnabled.
TheSRNCHCcannotdistinguishbetweensoftandsofterhandoverscenariosoverIur
whenanintra-frequencymeasurementreporte1aore1cisreceivedindicatingthata
DRNCcellmustbeaddedorreplaced.TheBTSIdoftheDRNCBTScontrollingthe
DRNCcellisnotknownintheSRNC.
TheSRNCtreatsallbranchadditionrequestsoverIurassofthandoverrequesttothe
DRNC.
AccordingtothecurrentsofterhandoverprinciplesdefinedintheSRNC,bothsofter
handovercellsmustbeinE-DCHactivesetorneitherofthosecanbeinE-DCHactive
set.Hencewhenasofterhandoverbranchistobeadded,theSRNCrequestsE-DCH
fromthenewsofterhandoverbranchonlyiftheremainingcellsunderthesameBTSand
LCGhavetheE-DCHallocated.However,thiscannotbeensuredfortheDRNCcellsin
theASsincetheSRNCdoesnotknowthatasofterbranchisbeingaddedoverIur.
TheDRNCrejectsthebranchadditionrequest(RNSAP:RadioLinkSetup/Addition
Request)ifE-DCHchanneltypeisrequestedforthenewcelltobeaddedwhilethe
remainingAScellsunderthesameBTSandLCGdonothavetheE-DCHallocatedor
viceversa.TheDRNCusestheRNSAPcausevalueRequested Configuration not
SupportedintheRNSAP:RadiolinkSetup/AdditionFailuremessage.
TheSRNCreceivesthecombininginformation(Diversity Indication IE)fortheradiolinks
successfullyaddedintheDRNCviaRNSAP:RadiolinkSetup/AdditionResponse
message.TheSRNCusesthisinformationtodefinetheSHOstateasdescribedin
Combininginformationoftheradiolinks.

170

DN0638161

R: 170/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

9.3.2 Failurecases
If UE not involvedSRNSrelocationfailswhenthereareHS-DSCH/E-DCHMAC-dflows
allocated,theSRNC(HandoverControl)followstheexistingmethodsofoperationfor
NRTPSRAB.HSPAovertheIur-featuredoesnotchangetheexistingfailure
procedures.
TheSRNCexcludesE-DCHfromtheSHObranchandtriestosetupSRBDCHonlyif
SHObranchadditionisrejectedbytheDRNC.TheSRNC(HandoverControl)follows
theacceptabilityoftheE-DCHactiveset.IftheE-DCHactivesetchangesto
unacceptable,theSRNCperformsaswitchtoDCH.AsdescribedintheRAN1515:
HSPA Inter-RNC Cell Changefeature,theSRNCdoesnotinitiateHSPAinter-RNCcell
change(HHO)iftheE-DCHactivesetchangestounacceptableandHSPAoverIuris
enabled.
TheDRNCusesthefailurecauseinformationiftheSRNCrequestsHS-DSCHorE-DCH
MAC-dflowsetupoverIur-interfaceandtheDRNCrejectsthesetuprequestbecauseof
congestion,thatis,therearenotenoughradioresourcesavailableintheDRNCorifthe
requestedconfigurationisnotsupportedbytheDRNC.Acausecodeissetasa
responsemessageinconjunctionwiththeRadioLinkSetup,RadioLinkAddition,or
RadioLinkReconfiguration.

IfHS-DSCHMAC-dflowsetupiscongested,theDRNCsetsthecausecodeDL
Radio Resources not Available.

IfHS-DSCHMAC-dflowsetupisnotcongestedbutE-DCHMAC-dflowsetupis
congested,theDRNCsetsthecausecodeUL Radio Resources not Available.

IfHS-DSCHMAC-dflowsetupisnotcongestedbutULDCHallocationiscongested,
theDRNCsetsthecausecodeUL Radio Resources not Available.

TheDRNCsetsthecausecodeE-DCH not supportedifE-DCHisdisabledinthe


cell.

TheDRNCsetsthecausecodeDL Radio Resources not AvailableiftheDRNC


cannotdistinguishwhetherDLorULdirectioniscongestedorifbothdirectionsare
congested.

Incaseofservingcellchange(SCC)failureovertheIur-interface,theSRNCfollowsthe
sameprinciplesasinnon-Iurcases.Theprinciplesusedinnon-Iurcasesindicatesthat
firstallcandidatesarecheckedandthenextstepsareasfollows:

Incaseofnon-criticalSCC,thepresentservingcelliskept.

IncaseofcriticalSCC,aswitchtoDCHisperformed(ifnewservingcellcannotbe
found).

SRNCretriesHS-DSCHandE-DCHMAC-dflowsetupovertheIurinterface
HS-DSCHandE-DCHallocationfails(FailurecauseUL Radio Resources not
AvailableorE-DCH not supported):

Issue:06H

DN0638161

R: 171/396

171

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

TheSRNCretrieswithULDCHallocatedinsteadofE-DCH.InthecaseofNRTPS
RABinitialbitrate,DCHisattempted

IfHS-DSCHsetupstillfails,theSRNCdoesnotretryanymore.Inthiscase,the
SRNCfollowstheexistingfailureprocedures(DCH/DCHallocated)

HS-DSCHandE-DCHallocationfails(FailurecauseDL Radio Resources not


Available):

TheSRNCretrieswitheverypossibleservingcellcandidate.

IfHS-DSCHsetupisunsuccessfulineveryservingcellcandidate,theSRNCfollows
theexistingfailureprocedures(DCH/DCHallocated).

HS-DSCHandE-DCHallocationfails(FailurecauseUnspecified):

TheSRNCretrieswiththenextbestconfiguration(HS-DSCH/DCH).Failurecause
Unspecified istreatedasacongestion-relatedcause.However,thecongestion
directionisnotknown.

IfHS-DSCHsetupstillfails,thentheSRNCfollowstheprocedurementionedinHSDSCHandULDCHallocationfails(FailurecauseUnspecified).

HS-DSCHandE-DCHallocationfails(anyotherfailurecause):

inasimilarwaytotheDL Radio Resources not Availablecase

HS-DSCHandULDCHallocationfails(FailurecauseUL Radio Resources not


Available):

IncaseofNRTPSRAB,theSRNCretrieswiththeinitialbitrateULDCHifnot
alreadytried.

IfHS-DSCHsetupstillfails,theSRNCdoesnotretryanymore.Inthiscase,the
SRNCfollowstheexistingfailureprocedures(DCH/DCHallocated).

HS-DSCHandULDCHallocationfails(FailurecauseDL Radio Resources not


Available):

TheSRNCretrieswitheverypossibleservingcellcandidate.

IfHS-DSCHsetupisunsuccessfulineveryservingcellcandidate,theSRNCfollows
theexistingfailureprocedures(DCH/DCHallocated).

HS-DSCHandULDCHallocationfails(FailurecauseUnspecified):

172

TheSRNCretrieswiththenextbestconfiguration(DCH/DCHinitialbitrate).Failure
causeUnspecified istreatedasacongestion-relatedcause.However,the
congestiondirectionisnotknown.

IfDCH/DCHsetupfails,thentheSRNCfollowstheexistingSRNCprocedure
(FailurecauseUnspecified).

DN0638161

R: 172/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

HS-DSCHandULDCHallocationfails(anyotherfailurecause):

inasimilarwaytotheDL Radio Resources not Availablecase

9.3.3 Inter-operabilitywithotherfeaturesandfunctionalities
HSDPAandHSUPAbasicRRM
TheSRNCsetsupneitherHS-DSCHMAC-dflowovertheIur-interfaceifthe
HSDPAenabledparameterissettoDisablednorE-DCHMAC-dflowovertheIurinterfaceiftheHSUPAenabledparameterissettoDisabled.TheDRNCchecksthe
HSDPAenabledandHSUPAenabledparameters.TheDRNCrejectsHS-DSCHMAC-d
flowsetupovertheIur-interfaceiftheHSDPAenabledissettoDisabledandE-DCH
MAC-dflowsetupovertheIur-interfaceiftheHSUPAenabledissettoDisabled.If
HSUPAisdisabledbutHSDPAenabled,theDRNCusesthefailurecauseE-DCH not
Supported.IfHSDPAisdisabled,theDRNCusesthefailurecauseRequested
Configuration not Supported.Capacitylicensesandrestrictionswithregardtothe
maximumnumberofusers(HSDPA,HSUPA),themaximumnumberofE-DCH
allocations,andthemaximumnumberofHS-DSCHMAC-dflowsarecheckedbythe
DRNC.

HSDPAServingCellChange
TheHSPAoverIurfeaturerequiresRAN828:HSDPAServingCellChangeandRAN829:
HSDPASoft/softerHandoverforAssociatedDPCHfeatures.TheHSPAOverIur
parameterisnotallowedtobesettoEnablediftheHSDPAMobilityparameterissetto
Disabled.ThisconditionischeckedbyO&MwhentheHSPAOverIuror
HSDPAMobilityparameterismodified.TheSRNC(HandoverControl)alsochecksthe
licenseoftheHSDPAServingCellChangeandSoft/SofterHO.

HSDPADynamicResourceAllocation
HSPAoverIurfeaturerequirestheRAN312:HSDPADynamicResourceAllocation
feature.TheHSPAOverIurparameterisnotallowedtobesettoEnabledifthe
HSDPADynamicResourceAllocationparameterissettoDisabled.Thisconditionis
checkedbyO&MwhentheHSPAOverIurorHSDPADynamicResourceAllocation
parameterismodified.

16kbit/sReturnChannelDCHDataRateSupportforHSDPA
TheSRNCcheckstheHSDPA16KBPSReturnChannelparameterandthelicenseofthe
16kbit/sReturnChannelDCHDataRateSupportfortheHSDPAfeature(RAN1013).
TheDRNCchecksneithertheHSDPA16KBPSReturnChannelparameternorthe
licensebutallows16kbpsULDCHreturnchannelregardlessoftheparametervalueor
thestateofthelicense.TheSRNC(Cell-specificPS)doesnotallocate16kbpsULDCH
ifDLRBismappedontoHS-DSCHandiftheHSDPA16KBPSReturnChannel
parameterissettoDisabledorifthestateofthelicenseofthe16kbit/sReturnChannel
DCHDataRateSupportforHSDPAfeatureisnotON.

Issue:06H

DN0638161

R: 173/396

173

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

HSDPA10MbpsperUser
TheSRNCchecksthelicensefortheRAN1249:HSDPA10MbpsperUserfeature.Ifthe
licenseforHSDPA10MbpsperUserisOff/Config,theSRNCrestrictsHS-DSCHMACdflowbitrateovertheIur-interfacewhenthemaximumpeakbitrateforHS-DSCHMAC-d
flowiscalculated.

HSDPA14MbpsperUser
TheSRNCdoesnotsupport14MpbsperUserovertheIur-interface.Themaximumpeak
bitrateforHS-DSCHMac-dflowoverIurisrestrictedto9600kbit/sirrespectiveofthe
valueoftheHSDPA14MbpsPerUserparameterintheSRNC.Forthisreason,the
MaxIurNRTHSDSCHBitRateparameterisintroduced,whichrestrictsthemaximum
configurablepeakrateoftheNRTRBmappedtoHS-DSCHoverIurto9600kbit/s.
TheSRNCrestrictstheHS-DSCHMAC-dflowbitrateovertheIur-interfaceto9600kbit/s
whenthemaximumpeakbitrateforHS-DSCHMAC-dflowiscalculatedbycomparing
thevalueoftheMaxIurNRTHSDSCHBitRateIURparameterwiththemaximumpeak
ratecalculated(seeFigure2:HS-DSCHMAC-dflowpeakdatarate).Ifthecalculated
peakrateisgreaterthantheMaxIurNRTHSDSCHBitRateparametervalue,thenthe
SRNCchoosesthevalueoftheMaxIurNRTHSDSCHBitRateparameterasthepeak
ratetobeconfiguredfortheHS-DSCHMac-dflowoverIur.
TheDRNCisabletosupport14MbpsbitrateovertheIur-interfaceregardlessofthe
valueoftheHSDPA14MbpsPerUserparameteriftheHSPAoverIurfeatureisactive.

HSUPA2.0Mbps
TheSRNCcheckstheMaxTotalUplinkSymbolRAteparameter(RAN979).The
SRNCrestrictsthemaximumE-DCHbitratewhenthemaximumtotaluplinksymbolrate
oftheUEiscalculated.TheSRNCdefinesthemaximumtotaluplinksymbolrateforthe
E-DCHMAC-dflowoverIur-interfacewithoutBTScapabilityinformation,whichis
availableinthecontrollingtheRNConly(E-DCHSFCapability).TheDRNCdoesnot
checktheMaxTotalUplinkSymbolRAteparameterbutallowsE-DCHMAC-dflow
setupoverIurregardlessofthemaximumE-DCHbitrate(MaximumSetofE-DPDCHs
IE).However,theDRNCchecksiftheEDCHSFcapabilityoftheDRNCBTSsupports
theMaximumSetofE-DPDCHs(maximumE-DCHbitrate)requestedbytheSRNC.If
theBTScapabilityoftheDRNCBTSdoesnotsupporttheMaximumSetofE-DPDCHs,
thentheDRNCrejectstheEDCHMac-dflowsetupoverIurwithacauseRequested
Configuration not Supported.

HSUPA5.8Mbps
TheHSUPA5.8MbpsfeatureisnotsupportedoverIur.
TheDRNCdoesnotchecktheMaxTotalUplinkSymbolRAteparameterbutallowsEDCHMAC-dflowsetupoverIurregardlessofthemaximumE-DCHbitrate(Maximum
SetofE-DPDCHsIE).

174

DN0638161

R: 174/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

HSUPA2msTTI
TheSRNCdoesnotsupporttheHSUPA2msTTIfeature(RAN1470)overtheIurinterface(seeWCDMA RAN RRM HSUPA).IftheDRNCreceivesE-DCHsetupoverIur
withE-TTI=2ms,thentheDRNCrejectsthebranchadditionwithanerrorcauseE-DCH
TTI2ms not supported.

QoSAwareHSPAScheduling
Ifthebit1ofthePRFILE(002:1764 RN50_MAINT_47)parameterissettoON:

TheSRNCsupportsHSPAQoSprioritization(RAN1262)overIur-interface.

SPIvaluedefinedwiththeQoSPriotiyMappingparameterisusedforNRTHSDSCHandE-DCHMac-dflowsoverIur.

Ifthebit1ofthePRFILE(002:1764 RN50_MAINT_47)parameterissettoOFF,then
theSPIvalue0isusedforNRTHS-DSCHandE-DCHMAC-dflowsoverIur(HSPAQoS
prioritization(RAN1262)isnotsupportedoverIur-interface)
TheSRNCsendstheTC,ARP,SPItotheDRNCwhenNRTHS-DSCH/E-DCHMac-d
flowissetupoverIur.
TheDRNCacceptsAllocation/RetentionPriority(ARP).TheDRNCperformschecking
fortheTrafficClass(TC)andSchedulingPriorityIndicator(SPI)valuesinconjunction
withtheHS-DSCHMAC-dflowsetupandE-DCHMAC-dflowsetup.

HSPAwithStreamingQoSSupport
TheSRNCdoesnotsupportHSPAPSStreaming(RAN1004)overtheIur-interface.
However,theULDCHreturnchannelforStreamingHSDPAisallowedoverIur.
TheDRNCrejectstheHSPAPSStreamingsetupoverIur-interface.
TheDRNCrejectstheHS-DSCHMAC-dflowsetupand/orE-DCHMAC-dflowsetup
overtheIur-interfaceforPSStreamingRABifrequestedbytheSRNC.TheDRNCuses
thefailurecauseRequested Configuration not Supported.
ThisfeaturealsomakesitpossibletohaveNominalBitRate(NBR)forNRTtraffic
classes.NominalBitRateissenttotheBTSbyusingGBRIEintheNBAPmessage.
However,forthePSNRTHS-DSCH/E-DCHMac-dflowsoverIurinterface,theSRNC
doesnotsettheMAC-hsGuaranteedBitRateIE/MAC-esGuaranteedBitRateIEin
theRNSAPmessagestotheDRNC.Theyareomittedastheyareoptionalparameters.
TheSRNCreconfigurestheMAC-esGuaranteedBitRateIE(ULNBR)valueto0in
caseofHS-DSCHandE-DCHservingcellchangefromtheSRNCcelltotheDRNCcell
fortheE-DCHMac-dflowsintheSRNCiftheMAC-esGuaranteedBitRate(ULNBR)
valuethathasbeensetearlierisgreaterthan0intheNBAPmessagetotheBTS.
TheDRNCrejectsthePSNRTHS-DSCHand/orE-DCHMAC-dflowsetupovertheIurinterfaceiftheGuaranteedBitRate(MAC-hsGuaranteedBitRateIE/MAC-es
GuaranteedBitRateIE)isincludedoriftheE-DCHgranttypeissettoE-DCH NonScheduled Transmission GrantforPSNRTE-DCHMac-dflowoverIurintheRNSAP
messagefromtheSRNC.TheDRNCusesthefailurecauseRequested Configuration
not Supported.

Issue:06H

DN0638161

R: 175/396

175

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

CSVoiceoverHSPASupport
TheSRNCdoesnotsupportCSVoiceoverHSPA(RAN1689)overIur-interface.
TheDRNCrejectsCSVoiceoverHSPAsetupovertheIur-interface.TheDRNCuses
thefailurecauseRequested Configuration not Supported.

HSPAMultiNRTRABs
TheSRNCdoesnotsetupamultipleHS-DSCHand/orE-DCHNRTMAC-dflowsover
theIur-interface.However,HSDPAULDCHreturnchannelforMultiNRTRABsis
allowedoverIur.TheSRNCdoesnotperformE-DCHbranchadditionoverIurforMulti
NRTRABs.
TheDRNCrejectsmultipleHS-DSCHand/orE-DCHNRTMAC-dflowsovertheIurinterface.
TheDRNCusesthefailurecauseRequested Configuration not Supported.

HSPAwithSimultaneousAMRVoiceCall
TheSRNCdoesnotsetupAMRCSvoiceRAB+HS-DSCHmulti-RABovertheIurinterface.InthiscasetheSRNCallocatesDLDCHinsteadofHS-DSCHMAC-dflowfor
thePSRABifasuitableservingcellcannotbefoundundertheSRNC.However,UL
DCH(incaseofHSDPA)issupportedoverIurfortheAMRCSRAB+HS-DSCHmultiRABcombinationaslongastheservingcellisundertheSRNC.
TheSRNCdoesnotsetupAMRCSvoiceRAB+E-DCHmulti-RABovertheIurinterface.Inthiscase,theHS-DSCHandE-DCHservingcellischosenundertheSRNC.
However,theSRNCallocatesULDCHinsteadofE-DCHMAC-dflowforthePSRABif
theminimumE-DCHAScannotbeformedamongtheSRNCAScells.TheSRNC
allocatesDLDCHinsteadofHS-DSCHMAC-dflowforthePSRABifasuitableserving
cellcannotbefoundundertheSRNC.
TheSRNCdoesnotperformE-DCHbranchadditionoverIurforAMRCSRAB+E-DCH
multi-RAB.TheDRNCrejectsAMRCSvoiceRAB+HS-DSCH(ULeitherDCHorEDCH)multi-RABoverIur-interface.TheDRNCrejectsAMRCSvoiceRAB+E-DCH(DL
HS-DSCH)multi-RABovertheIur-interface.TheDRNCrejectsE-DCHbranchaddition
overtheIur-interfaceforAMRCSRAB+E-DCH(DLHS-DSCH)multi-RAB.TheDRNC
usesthefailurecauseRequested Configuration not Supported.
TheSRNCreceivesarequesttosetupCSAMRRABduringanchoringwhentwoPS
NRTRABsexistonHS(D)PA.OnePSNRTRABismappedtoDCH/DCH0/0whenthe
followingconditionsoccur:

Bit7ofthePRFILE(002:1764 RN50_MAINT_47)parameterissettothevalueON

InterfaceModeforgivenDRNCisconfiguredasMode2

TheDRNCrejectstheAMRcallsetup

Otherwise,theNSNSRNCdowngradesorswitchesonePSRABtoDCH0/0whenthe
followingconditionsoccur:

176

Bit7ofthePRFILE(002:1764 RN50_MAINT_47)parameterissettothevalueOFF

DN0638161

R: 176/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

InterfaceModeforgivenDRNCisotherthanMode2

TheDRNCrejectsAMRcallsetup

TwoPSRABsareactive

PSNRTRABReconfiguration
TheSRNCtriggersCTStoDCHifPSNRTRABReconfigurationprocedureisrequested
fortheNRTRABwhoseHS-DSCHMAC-dfloworE-DCHMAC-dflowexistsoverIur.
RABreconfigurationoftheULDCHincaseofHSDPAisnotrestrictedoverIur.This
followstheprinciplescurrentlyspecifiedbythePSNRTRABReconfiguration(RAN930)
feature.
TheDRNCrejectsRadioLinkReconfigurationifRABparametersoftheHS-DSCHMACdfloworE-DCHMAC-dflowattempttomodify.TheDRNCusesthefailurecause
Requested Configuration not Supported.

HSPAInter-RNCCellChange
TheSRNCandtheDRNCusethefunctionalitiesdescribedfortheHSPAoverIurfeature
iftheHSPAoverIurfeatureisenabledandactiveregardlessofthevaluesofthe
HSPAInterRNCMobilityparameter(RAN1515).TheSRNCdoesnotutilizetheHSPA
Inter-RNCCellChangefeatureifthereisatleastonecellintheactivesetovertheIurinterface,whichsupportsHSPAoverIur(theHSPAOverIurparametersettoEnabled).
Inthiscase,theSRNCfollowsthemethodsofoperationdescribedbytheHSPAoverIur
feature.

MIMO
MIMOwithorwithoutDCHSDPAisnotsupportedovertheIur-interface.
TheSRNCdoesnotconfigureMIMOfortheHS-DSCHMAC-dflowifthereis(are)radio
link(s)overtheIurinterfaceintheactiveset(SRBonHSPA/HSUPAisnotpossibleif
thereisaradiolinkoverIurinterface).WhentheradiolinkisaddedovertheIurinterface
andMIMOisconfiguredfortheHS-DSCHMAC-dflow,theSRNCsetsMIMOtoOFF.
TheDRNCrejectstheHS-DSCHMAC-dflowovertheIurinterfaceifMIMOwithor
withoutDC-HSDPAisactive.
TheDRNCdoesnotset:

Issue:06H

MIMO Support Indicator(NeighboringUMTSCellInformation/NeighboringFDDCell


Information/CellCapabilityContainerFDDIE)=1(Supported)inconnectionwiththe
RadioLinkSetuporRadioLinkAddition.

SixtyfourQAM DL and MIMO Combined Support Indicator(NeighbouringUMTSCell


Information/NeighbouringFDDCellInformation/CellCapabilityContainerFDDIE)=
1(Supported)

Multi Cell and MIMO Support Indicator(NeighbouringUMTSCellInformation/


NeighbouringFDDCellInformation/CellCapabilityContainerFDDIE)=1
(Supported)

DN0638161

R: 177/396

177

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

TheDRNCusesMIMO not supportedfailurecauseiftheSRNCattemptstoactivate


MIMO,orMulti Cell operation with MIMO not supportedfailurecauseifSRNC/triesto
activateDC-HSDPAwithMIMO,fortheHS-DSCHMAC-dflowovertheIurinterface,and
ifthefailureexplicitlyoriginatesfromMIMO,orfromDCHSDPAwithMIMOrespectively.
IfthefailureprimarilyhasbeencausedbyotherreasonsthanMIMO,suchasHS-DSCH,
E-DCH,F-DPCH,orFlexibleRLCcannotbeallocatedintheDRNC,aMIMO-specific
failurecausedoesnotoccur.

ContinuousPacketConnectivity
WhentheSRNCaddssofthandoverbranchtotheDRNC,theDRNCindicatesthatCPC
isnotsupportedoverIur.
IftheSRNCsendsContinuous Packet Connectivity HS-SCCH lessInformationtothe
DRNC,theDRNCindicateswithacausevalueContinuous Packet Connectivity HSSCCH less operation not supportedthatitisnotsupportedinRNSAP:RadioLinkSetup
Failure,orRNSAP:RadioLinkAdditionFailure,orRNSAP:RadioLinkReconfiguration
Failuremessages.
IftheSRNCsendsContinuous Packet Connectivity DTX-DRX Information or Continuous
Packet Connectivity DTX-DRXInformationToModifytotheDRNC,theDRNCindicates
withacausevalueContinuous Packet Connectivity DTX-DRX operation not supported
thatitisnotsupportedinRNSAP:RadioLinkSetupFailure,orRNSAP:RadioLink
AdditionFailure,orRNSAP:RadioLinkReconfigurationFailuremessages.
IftheSRNCsendsinULDPCCHslotformatIE,withvalue4,whichisanewslotformat,
theDRNCrejectstherequest.TheDRNCusesthecauseRequested Configuration not
Supported.
WhentheSRNCneedstoaddanewsofthandoverbranchoverIur,itfirstdeactivates
theCPCfortheUE.

HSDPA64QAM
FeatureRAN1643:HSDPA64QAMisnotsupportedoverIurinterface.
FeatureHSDPA64QAMdoesnottriggerreconfigurationtoallowthe64QAMmodulation
inthetargetRNCincaseofUEnotinvolvedSRNCrelocation.IncaseofUEnot
involvedSRNCrelocation,the64QAMmodulationpermissionisbasedontheexisting
functionality(thatistheservingcellchange)inthetargetRNCassumingthatthe
conditionsneededforthe64QAMmodulationpermissionarefulfilledinthetargetRNC.
FeatureRAN1643doesnottriggerareconfigurationtoallowthe64QAMmodulationin
thetargetRNCincaseofUEinvolvedSRNCrelocation.IncaseofUEinvolvedSRNC
relocation,the64QAMmodulationpermissionisbasedontheexistingfunctionality(that
isthechanneltypeswitching)inthetargetRNCassumingthattheconditionsneededfor
the64QAMmodulationpermissionarefulfilledinthetargetRNC.

FlexibleRLC(DL)
FeatureRAN1638:FlexibleRLC(DL)isnotsupportedovertheIur-interface.

178

DN0638161

R: 178/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

IftheHS-DSCHMAC-dPDUSizeFormatIEissettoFlexibleMAC-dPDUSizeorifthe
MaximumMAC-dPDUSizeextendedIEispresentintheRNSAP:RadioLink
ReconfigurationPreparemessagefromtheSRNCforHS-DSCHMac-dflow,theDRNC
rejectstherequestwiththecauseRequested Configuration Not Supportedinthe
RNSAP:RadioLinkReconfigurationFailuremessage.
IncaseofservingcellchangefromanSRNCcell(whereflexibleRLCisinuse)toa
DRNCcell,afixedRLCPDUsizeisconfiguredinthetargetDRNCcellduringthe
servingcellchangebytheSRNC.
FeatureRAN1638:FlexibleRLC(DL)doesnottriggerareconfigurationtoconfigurea
flexibleRLCPDUsizeinthetargetRNCincaseofUEnotinvolvedSRNCrelocation.In
caseofUEnotinvolvedSRNCrelocation,aflexiblePDUsizeconfigurationisbasedon
theexistingfunctionality(thatistheservingcellchange)inthetargetRNCassumingthat
theconditionsneededforflexiblePDUsizearefulfilledinthetargetRNC.

F-DPCHandSRBsonHSPA
SRBsonHSPAarenotsupportedoverIur.
SRBsonHSPAarenotsupportedifatleastoneradiolinkisoverIur.SRBsonHSPAare
reconfiguredtoSRBsonDCHwhenthefirstbranchoverIuristobeaddedtoanactive
set.
TheDRNCdoesnotsupportSRBonHSPA.TheDRNCusesthecauseRequested
Configuration not Supported.
F-DPCHisnotsupportedoverIur.
F-DPCHisnotsupportedifatleastoneHSPAradiolinkisoverIur.F-DPCHisswitched
asDPCHwhenthefirstbranchoverIuristobeaddedtoanactiveset.
TheDRNCdoesnotsupportF-DPCH.
TheDRNCrejectsaF-DPCHconfigurationattemptwithacausecodeF-DPCH Slot
Format operation not supported.
TheDRNCneversetsthefifthbit:F-DPCHSupportIndicatorandtwentiethbit:F-DPCH
SlotFormatSupportIndicatorintheCellCapabilityContainerFDDinformationelement
astrue.

Dual-CellHSDPA
DCHSDPAisnotsupportedovertheIur-interface.
TheSRNCswitchesthechanneltypefromDCHSDPAtoSCHS(D)PAwhenthefirst
branchoverIuristobeaddedtotheactiveset.
TheDRNCrejectsradiolinkprocedureconcerningDCHSDPAoperationwithcause
valueMultiCelloperationnotsupported.TheDRNCdoesnotsetMultiCellSupport
Indicator(NeighboringUMTSCellInformation/NeighboringFDDCellInformation/Cell
CapabilityContainerFDDIE)=1(Supported)inconnectionwiththeRadioLinkSetupor
RadioLinkAddition.

Issue:06H

DN0638161

R: 179/396

179

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

9.4 ExtensionofHSPAoverIur
RAN2270: Extension of HSPA over Iurfeatureintroducesnewmulti-RABcombination
overIur.ItalsopresentsasupportofHS-DSCHandE-DCHMac-dflowsetupand
releaseoverIurforsinglePSNRTRAB.ThisfunctionalityalsointroducesHSPAoverIur
supportforotherproductslikemcRNCandFlexiDirectRNC.ExtensionofHSPAoverIur
iscontrolledbytheHSPAOverIurExtparameter.
WhentheparameterHSPAOverIurExtissettoEnabled:

TheSRNCisallowedtosetuptheHS-DSCHand/orE-DCHRLoverIurduring
anchoring.

TheSRNCisallowedtoperformSCCfromDRNCcelltoDRNCcellduring
anchoring.

TheSRNCcansetupasingleHS-DSCHand/orE-DCHMac-dflowwithCSAMR
onDCHoverIur.

TheSRNCallowsforthePSNRTRABreconfigurationforHS-DSCHandE-DCH
Mac-dflowoverIur.

9.4.1 MobilityhandlingwithextensionofHSPAoverIur
InitialselectionoftheservingHSPAcellduringanchoringisperformedbytheSRNC.
Duringanchoring,theSRNCchoosestheservingcellfromDRNCcells,whichbelongto
theactivesetaccordingtotheprinciplesdefinedinSRNCperformsinitialselectionofthe
servingcell.SupportedRABcombinationoftheUEisdescribedinSupportedmulti-RAB
combinationsoverIurinterface.

ServingcellchangeoverIurduringanchoring
Theservingcellchange(SCC)overIurinterfaceduringanchoringissupportedforthe
PSNRTHS-DSCHandE-DCHMAC-dflowinthefollowingscenariosfortheRAB
combinations(asdescribedinSupportedmulti-RABcombinationsoverIurinterface):

SCCfromDRNCcelltoDRNCcellinsideoneRNC(Intra/Inter-BTSSCC)

SCCfromDRNCcelltoDRNCcellbetweentwodifferentRNCs(Inter-BTSSCC)

ThefollowingSCCwithchanneltypeswitch(CTS)scenariosaresupportedoverIur
interface:
1. DCHtoE-DCHchanneltypeswitchinULduringtheaboveSCCscenarios
2. E-DCHtoDCHchanneltypeswitchinULduringtheaboveSCCscenarios
RadioLinkReconfiguration(SCC/initialHSPAallocation)forHS-DSCHMAC-dflowand
E-DCHMAC-dflowaresupportedoverIurinterfacefortheRABcombinationsas
describedinSupportedmulti-RABcombinationsoverIurinterface.
CheckforselectingaDRNCcellasHS-DSCHandE-DCHservingcellisperformedwith
thesameprocedureasforHSPAoverIurfeature.

180

DN0638161

R: 180/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

ULSIRErrormeasurementoverIur
SRNCstartstheULSIRErrormeasurementforanyradiolinkoverIurinterfaceifthe
conditionsdescribedinSRNCstartsULSIRErrormeasurementoverIurareeffective.
TheSRNCutilizetheULSIRErrormeasurementreportsreceivedfromDRNCforserving
cellchangealgorithmduringanchoringinthesamewayasforHSPAoverIurfeature.
TheSRNCdoesnotterminatetheULSIRErrormeasurementsoverIurwhenthelast
SRNCcellisdeletedfromactivesetasSCCissupportedoverIur.

SofthandoveroverIur
RadioLinkSetup/RadioLinkAddition(branchaddition)forE-DCHMAC-dflowand
RadioLinkReconfiguration(SCC/initialHSPAallocation)forHS-DSCHMAC-dflowand
E-DCHMAC-dflowaresupportedoverIurinterfaceduringanchoringfortheRAB
combinationsasdescribedinSupportedmulti-RABcombinationsoverIurinterface.
TriggeringandcheckinginordertorequestE-DCHchannelforDRNCbranchdoesnot
changeincomparisonwithHSPAoverIurfeature.

9.4.2 Channeltypeselectionduringanchoring
TheSRNCperformsthechanneltypeselectionalgorithmtoallocateuserplane
resourcesforNRTRABiftherearenoradiolinksunderSRNC.Thatmeansallradio
linksoftheactivesetareunderDRNC.NRTRABthatisrequestingcapacitycanbethe
existingornewone.
TheSRNCchecksthechanneltypeselectioncriteriaduringanchoringasspecifiedinthe
ChanneltypeselectionwiththeexceptionwhenRABcombinationoftheUEissupported
(seeSupportedmulti-RABcombinationsoverIurinterface).
TheSRNCsetsuptheHS-DSCHand/orE-DCHMAC-dflow(s)whentherearenoradio
linksunderSRNC.ThatmeansallradiolinksoftheactivesetareunderDRNC.
Incaseoflowutilizationandlowthroughputmeasurementsduringanchoring,theSRNC
followsthesameprinciplesasdescribedinSRNCusesutilizationandthroughput
measurementsforradiolinksoverIur-interface.
TheSRNCfollowsthesameprinciplesforHS-DSCHMac-dPDUsizeselectionduring
anchoringasdescribedinSRNCdoesnotperformHS-DSCHMAC-dPDUsizeselection
algorithmforDRNCcell.

Supportedmulti-RABcombinationsoverIurinterface
TheDRNCrejectstheRadio Link Setup/Addition/Reconfigurationrequestwiththefailure
causeRequested Configuration not SupportedwhenSRNCrequestsRAB
combinationotherthanthosedescribedinRABcombinationsforHSDPA.Hence
SCC,CTS,andE-DCHbranchsetup/addition/replacementoverIurissupportedonlyfor
thesupportedmulti-RABcombinations.AlsoULSIRErrormeasurementsarestartedover
IurforthesesupportedRABcombinations.

Issue:06H

DN0638161

R: 181/396

181

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

IftheRABcombinationoftheUEisotherthanthosedescribedinRABcombinationsfor
HSDPA,thenonlyDCH/DCHorULDCHisthetransportchannelsupportedoverIurfor
thecorrespondingmulti-RABcombinations.
NotethatwithHSPAoverIuronlysinglePSNRTRABonHS(D)PAwassupported.
RAN2270: Extension of HSPA over Iurfeatureextendsthemulti-RABsupportoverIurby
allowingtheCSAMRRABonDCH.

LimitationoftheNRTHS-DSCHMAC-dflowbitrateoverIurduring
anchoring
TheupperlimitforNRTHS-DSCHMAC-dflowbitrateovertheIurinterfaceisdefined
withtheMaxIurNRTHSDSCHBitRateIur-specificparameter.Theupperrangeofthis
parameterisfixedat9600kbit/s.

9.4.3 Channeltypeswitchduringanchoring
DCHtoHSPAchanneltypeswitchduringanchoring
DCHtoHSPAchanneltypeswitch(CTS)issupportedduringanchoringwhenallactive
setcellsarelocatedintheDRNCandtheRABcombinationoftheUEisasdescribedin
Supportedmulti-RABcombinationsoverIurinterface.TheCTSfromDCHtoHSPAmay
resultinNRTHS-DSCHandE-DCHMAC-dflowsetupovertheIurinterface.The
servingcellselectionprocedureisthesameasspecifiedforHSPA over Iurfeature.
ChanneltypeswitchfromDCHtoHSPAissupportedasfollows:

DLDCH/ULDCHtoDLHS-DSCH/ULDCH

DLDCH/ULDCHtoDLHS-DSCH/ULE-DCH

DLHS-DSCH/ULDCHtoDLHS-DSCH/ULE-DCH

HSPAtoDCHchanneltypeswitchduringanchoring
HSPA(HS-DSCHand/orE-DCHMAC-dflow)toDCHCTSissupportedduring
anchoringwhentheservingcellislocatedintheDRNC.
ChanneltypeswitchfromHSPAtoDCHissupportedasfollows:

DLHS-DSCH/ULDCHtoDLDCH/ULDCH

DLHS-DSCH/ULE-DCHtoDLHS-DSCH/ULDCH

DLHS-DSCH/ULE-DCHtoDLDCH/ULDCH

CTSfromHSPAtoDCHcontrolledbytheSRNCfollowstheexistingfunctionalitiesas
specifiedinChanneltypeswitchingandChannel type switch from E-DCH to DCH.

9.4.4 Inter-operabilitywithotherfeaturesandfunctionalities
HSPAOverIur
TheRAN1231: HSPA Over IurfeatureshouldbeactivatedandsupportedintheRNCin
ordertoperformextensionofHSPAoverIur.

182

DN0638161

R: 182/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

HSPAwithSimultaneousAMRVoiceCall
TheSRNCdoesnotsetupAMRCSRAB+HS-DSCH/E-DCHmulti-RABoverIur
interfacewhenrespectiveparameters(AMRWithHSDSCH/AMRWithEDCH)aresetto
Disabled.DL/ULDCHisallocatedforPSRABinstead.
TheDRNCrejectsAMRCSRAB+HS-DSCH/E-DCHmulti-RABoverIurinterfacewhen
therespectiveparameters(AMRWithHSDSCH/AMRWithEDCH)aresettoDisabled.
TheDRNCusesthegeneralcauseRequested Configuration not Supported.
IfPSRAB(DLHS-DSCHandULE-DCH,orULDCH)alreadyexistswithHS-DSCH
and/orE-DCHMac-dflowintheDRNCandtheAMRCSRABsetupisrejectedbythe
DRNCwiththegeneralcauseRequested Configuration Not Supported,theSRNC
reconfiguresPSRABtoDCH/DCHandretriesAMRCSRABsetup.IfAMRCSRAB
alreadyexistsandallocation(HS-DSCHandULE-DCH,orULDCH)forPSRABis
rejectedbytheDRNC,theSRNCretriesaccordingtoprinciplesdescribedinFailure
cases.
ThefailurehandlingspecifiedhereisappliedalsototheSHObranchadditionoverIur
interface.InthiscasealsoSRNCradiolinksisreconfigured.

PSNRTRABReconfiguration
PS NRT RAB ReconfigurationfeatureisappliedforHS-DSCH/E-DCHMAC-dflowsover
IuronlyifthelicenseoffeaturePS NRT RAB ReconfigurationexistsandthestateisON.
WithRAN2270: Extension of HSPA over Iurfeature,theSRNCfollowsthesame
principlesasdescribedinPSNRTRABReconfiguration.
TheDRNCrejectsRadioLinkReconfigurationwhentheNodeBRABReconfigSupport
parameterissettoPSRABReconfigurationisnotsupportedorthelicenseofthePS
NRTRABReconfigurationfeatureisnotON.
RABreconfigurationoftheULDCHisnotrestricted.

HSUPAIFHO
HSUPAcompressedmode(CM)isnotsupportedoverIuriftheservingcellisunder
DRNCornon-servingE-DCHcellisunderDRNC.IftheservingcellisunderDRNC,the
channeltypeswitchingisperformedonDCH/DCHandCMisstartedonDCH.
However,iftheservingcellisunderSRNCandHSDPACMisallowedinSRNC,the
channeltypeswitchfromE-DCHtoDCHinULisperformed.IfHSDPACMisnotallowed
intheSRNC,thenchanneltypeswitchtoDCH/DCHisperformed.DCHsareallocated
withinitialbitrate(PSNRT).

HSUPA16QAM
HSUPA 16QAMisnotsupportedoverIur.
ThisisbecauseRAN981: HSUPA 5.8 MbpsandRAN1470: HSUPA 2 ms TTIfeatures
whichareneededbyHSUPA 16QAM,arenotsupportedoverIur.
TheDRNCrejectstherequestwiththecauseSixteenQAM UL not Supported.

Issue:06H

DN0638161

R: 183/396

183

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

FlexibleRLCUL
Flexible RLC in ULisnotsupportedoverIur.
WhenflexibleRLCuplinkPDUsizeisinuseonE-DCHMAC-dflow(s)andthefirst
DRNCbranchmustbeaddedtotheactivesetoftheUE,theSRNCreconfiguresE-DCH
MAC-dflow(s)fromFlexibleRLCtoFixedRLCPDUsizeintheULforallactivesetcells.
DRNCrejectstherequestwiththecauseRequested Configuration Not Supported.

9.5 HSPAInter-RNCCellChange

NotethatlicenseinformationisrelevantonlytotheIPA-RNCsolution.
TheHSPAInter-RNCcellchangeisappliedtoFlexiDirectRNCwhenanyofthe
followingconditionsareeffective:
1. TheIurinterfacebetweentheAdaptersdoesnotexist(isnotconfigured).
2. S-FlexiDirectRNChasoneormoreradiolinks(RL)withtheRNC.
3. WhenSHOoverIurisnotenabled,thatistheRNPparameter
EnableInterRNCshoisdisabled.
4. IurinterfaceisenabledandSHOoverIurfails(PSRABSonly).
TheHSPAInter-RNCCellChangefeatureimprovestheenduserperformanceby
maintainingahighdatarateHSPAserviceduringintra-frequencyinter-RNCmobility.
CapacitygainisachievedatthecellsborderareawhenHSPAinsteadofDCHcanbe
utilized.InthecaseofCSAMRspeechmulti-service,directswitchtoDCHisappliedin
ordertoguaranteestrictqualityanddelayrequirementsforthespeech.BothHSDPAand
HSUPAarecoveredbythischapter.
Whenintra-frequencymeasurementsindicatethatthestrongestcellintheactivesetis
locatedundertheDRNC,HSPAintra-frequencyinter-RNCcellchangeisperformed.
Triggeringpointforinter-RNCcellchangecanbespecificallydefinedbytheoperatorby
meansofthemanagementparameters.
HSPAintra-frequencyinter-RNCcellchangeutilizesSRNSrelocationwithUE
involvement,thatis,theUEisreconfiguredaccordingtotheresourcesofthetargetRNC
duringSRNSrelocation.
TargetRNCallocatesresourcesonabesteffortbasis,thatis,eventhoughHSPAis
primarilyallocated,alsoDCH/DCHcanbeallocatedincaseHSPAisnotavailable.
SourceRNCdeletestheoldconfigurationafterasuccessfulSRNSrelocation.HSPA
servingcellchange(servingHS-DSCH/E-DCHcellchange)iscombinedwithaninterRNCcellchange.

184

DN0638161

R: 184/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

HSPAdataflowisnotestablishedoverIur-interfacebutHSPAresourcesarereserved
andallocatedunderDRNCinconjunctionwiththeSRNSrelocation.AssociatedDCH
(signalinglink)anduplinkDCHreturnchannelcanbesetupoverIur-interface,whereas
HS-DSCHandE-DCHarenotallowedoverIur-interface.HSPAInter-RNCcellchangeis
supportedalsowhenIur-interfaceisdisabled,congestedornotexisting.
FigureFigure57:SituationpriortoHSPAinter-RNCcellchangebelowillustratesthe
situationpriortoHSPAinter-RNCcellchange.Inthisfigure,theactivesetcontainsthree
cells.TwocellsarelocatedunderSRNCandonecellunderDRNC.ServingHSPAcellis
locatedunderSRNC.AssociatedDCHistransmittedandreceivedviaeachcellinthe
activeset.Thefunctionalitydependsonthetypeoftheallocateduplinktransport
channel.EitherE-DCHorDCHcanbeallocated.ShouldE-DCHbeallocatedinuplink
direction,DRNCcellisexcludedfromtheE-DCHactiveset,thatis,E-DCHnonserving
radiolinkisnotallocatedoverIur-interface.ShouldDCHbeallocatedinuplinkdirection,
DCHistransmittedandreceivedviaeachcellintheactiveset.Bothofthesescenarios
areillustratedinthebelow.
FigureFigure58:SituationaftersuccessfulHSPAinter-RNCcellchangebelow
illustratesthesituationafterasuccessfulHSPAinter-RNCcellchange.Inthisfigure,a
HSPAinter-RNCCellChangehassuccessfullybeenperformed.SourceRNChas
deletedtheoldconfigurationandDRNChasestablishednewHSPAresources.
AdditionallytheFlexiDirectnetworkarchitecturecaseispresentedduringHSPAinterRNCcellchange.Inbothcasesthesameactionsareperformedbutbydifferentnetwork
elements.
Figure 57

Issue:06H

SituationpriortoHSPAinter-RNCcellchange

DN0638161

R: 185/396

185

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

Figure 58

SituationaftersuccessfulHSPAinter-RNCcellchange
/GGSN

/Gn
/Flexi Direct RNC

/Flexi Direct RNC

ThefunctionalityoftheHSPAintra-frequencyinter-RNCcellchangedependsonthe
valueoftheparameterHSPAInterRNCMobility.
HSPAInterRNCMobilityparametermayhavethreedifferentvalues:

(0)Disabled
Thisvaluemeansthatthefeatureisinactive.

(1)EnabledwithoutE-DCHtrigger
ThisvaluemeansthatthefeatureisactivebutanunacceptableE-DCHactiveset
doesnottriggeranHSPAinter-RNCcellchange.

(2)Enabled
ThisvaluemeansthatthefeatureisactiveandanunacceptableE-DCHactiveset
triggersanHSPAinter-RNCcellchange.

HSPAintra-frequencyinter-RNCcellchangeisonlyappliediftheHSDPAServingCell
ChangeandHSDPASoft/SofterHandoverforAssociatedDPCHfeaturesareenabled.In
otherwords,theHSDPAMobilityparameterhastobesettoEnabled.HSPAInterRNCcellchangefromsourceRNCtotargetRNCisperformedbymeansoftheUE
involvedSRNSrelocationprocedure.
SRNCsupportsHSPAinter-RNCcellchangeonlyiftheHSPAInterRNCMobility
parameterissettoEnabledorEnabledwithoutE-DCHtrigger.Iftheparameterisset
toDisabled,HSPAInter-RNCcellchangeisnotsupportedbutSRNCappliesaswitch
fromHSPAtoDCHattheRNCborder.Ifthevalueoftheparameter
HSPAInterRNCMobilityischangedonline,currentRRCconnectionsarenotaffected.
Instead,thenewvaluewillbecomeeffectiveonlyfornewRRCconnectionsinCell_DCH
state.

186

DN0638161

R: 186/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

DRNC,whichisthetargetRNCforUEinvolvedSRNSrelocationprocedure,supports
HSPAinter-RNCcellchange.DRNCignoresHSDPAMobilityand
HSPAInterRNCMobilityparametersinconjunctionwiththeHSPAinter-RNCcell
change.DRNCalsoignoresstateofthelicenseoftheHSPAInter-RNCcellchange
feature.
HSPAInter-RNCcellchangeisnotsupported(inRNCsolutiononly),iftheUEhasCS
voiceoverHSPARAB.AnewservingcellcannotbeselectedundertheDRNC,ifthe
featureHSPAoverIurisnotinuseortheDRNCdoesnotsupportCSvoiceoverHSPA
(virtualcellparameterHSPAQoSEnabled).Inthatcase,ifthenewservingcellcannotbe
foundundertheSRNCandtheoldcellcannotbekept,thenaswitchtoDCHis
performed.
ThesourceRNCchecksthe3GPPreleaseversionofthetargetRNC.Ifthe3GPP
releaseversionofthetargetRNCdoesnotsupportHS-DSCHor/andE-DCH,SRNC
executesaswitchtoDCH/DCHinsteadofstartingaHSPAinter-RNCcellchange.

Issue:06H

DN0638161

R: 187/396

187

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

Figure 59

WCDMARANRRMHSDPA

HSPAinter-RNCcellchange

9.5.1 Servingcellselection
Thissectiondealswiththeinitialselectionoftheservingcell,theservingcellchange,the
ULSIRerrormeasurement,andotherservingcellchangereasons.

188

DN0638161

R: 188/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

Initialselectionoftheservingcell
TheSRNCinitiallyselectstheservingHSPAcellfromthoseSRNCcellswhichbelongto
theactiveset.IfeithernocellsexistundertheSRNCorifHSPAallocationeitherHSDSCH/E-DCHorHS-DSCH/DCHisnotpossibleinanycellunderSRNC,HSPA
allocationisprevented.DRNCcellisnotchosenasaservingHSPAcellattheinitial
selectionoftheservingHSPAcellphase.
InitialselectionoftheservingHSPAcellfollowstheexistingprinciplesasdescribedin
thechapterServingHS-DSCHCellChangeexceptforthefollowingspecialcondition:
Currentlythefollowingconditioniseffectivefortheinitialselectionoftheservingcell.
Figure 60

Conditionforselectingthecandidatecells

CPICHEc/NoCellistheCPICHEc/Nomeasurementofthecandidatecell,
CPICHEc/NoBest_cellistheCPICHEc/Nomeasurementofthebestcellintheactiveset
andHSDPAServCellWindowistheparameterthatdeterminesthewindowinsideof
whichtheservingcellmustbe.
Allthecells,whichfulfilltheDLCPICHEc/Nocondition,areprioritizedaccordingtothe
DLCPICHEc/No.Primarily,thecellhavingthebestDLCPICHEc/Noischosenasthe
servingcell.Alsothesecondandthirdbestcellcanbeattemptediftheprimary
candidatefails.
However,ifallconditionsdescribedbelowaretrue,SRNCignorestheconditioninthe
equationFigure60:Conditionforselectingthecandidatecellswheninitiallyselectingthe
servingHSPAcell.Ifanyofthesubsequentconditionsisfalse,initialselectionofthe
servingHSPAcellisperformedonlyaccordingtotheexistingprinciples,whichmeans
thattheSRNCtakestheconditionintheequationFigure60:Conditionforselectingthe
candidatecellsintoaccount.

HSPAInterRNCMobilityparameterissettoEnabledorEnabledwithoutE-DCH
triggerunderSRNC

AMRCSspeechRABisnotsimultaneouslyestablished

PSstreamingRABisnotsimultaneouslyestablished

BothSRNC(CN)andDRNCsupportSRNSrelocation

ThereisatleastoneHSPAcapablecellunderSRNCandatleastonecellunder
DRNCintheactiveset

ThebestcellintermsofreportedCPICHEc/NoislocatedunderDRNC

Servingcellchange
SRNCselectsthenewservingHSPAcellfromthoseSRNCandDRNCcellswhich
belongtotheactiveset.IfSRNCdecidestoselectaDRNCcellasthenewserving
HSPAcell,SRNCinitiatesanintra-frequencyinter-RNCcellchangebyusingtheUE

Issue:06H

DN0638161

R: 189/396

189

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

involvedSRNSrelocationprocedure.IfSRNCdecidestoselectanSRNCcellasnew
servingHSPAcell,however,theexistingservingHSPAcellchangeprinciplesare
followedasdescribedinServingHS-DSCHCellChange.
HSPAinter-RNCcellchangecanbeperformedifthefollowingconditionsareeffective:

HSPAInterRNCMobilityparameterissettoEnabledorEnabledwithoutE-DCH
triggerunderSRNC

AMRCSspeechRABisnotsimultaneouslyestablished

PSstreamingRABisnotsimultaneouslyestablished

BothSRNC(CN)andDRNCsupportsSRNSrelocation

ThereisatleastonecellunderDRNCintheactiveset

Basicdifferencebetweenthetraditionalintra-RNservingHSPAcellchangeand
theHSPAinter-RNCcellchangeisthefollowing:ifSRNCselectstheDRNCcell
asanewservingcell,UEinvolvedSRNSrelocationisstartedinsteadofthe
traditionalservingcellchange
EachDRNCcellwhichfulfillsbothofthefollowingconditionscanbeselectedas
candidatecellfortheservingHSPAcellchange:
Figure 61

Comparisontothebestcell

Figure 62

Comparisontotheexistingservingcell

CPICHEc/NoCellistheCPICHEc/NomeasurementoftheDRNCcandidatecell,
CPICHEc/NoBest_cellistheCPICHEc/Nomeasurementofthebestcellintheactiveset
andCPICHEc/NoServ_cellistheCPICHEc/NomeasurementofthecurrentservingHSPA
cell.
TheHSDPAServCellWindowparameterdefinestherangeinwhichtheservingcell's
CPICHEc/Nomeasurementhastobe.TheHSPADRNCEcNoOffsetparameterdefines
anoffsetdeductedfromtheCPICHEc/NomeasurementresultoftheDRNCcell.
IfmorethanonecandidatecellfortheservingHSPAcellchangehasbeendetectedand
thecandidatecellsaretobeprioritized,HSPADRNCEcNoOffsetistakenintoaccount
whendecidingthepriorityorderofthecells.ThismeansthatHSPADRNCEcNoOffsetis
deductedfromtheCPICHEc/NomeasurementoftheDRNCcell.
RepetitiveHSPAinter-RNCcellchangesarepreventedbyusinghigherthresholdsfor
triggeringthenewHSPAinter-RNCcellchangeduringtheguardtimeperiodafter
successfulHSPAinter-RNCcellchange.
TheSRNC(targetRNC,whichhasstartedtooperateasanewSRNCafterSRNS
relocation)setsthetimerHSPA inter-RNC cell change prevention timer.Thevalueofthe
timerisfixedto10s.AslongasthetimerHSPA inter-RNC cell change prevention timer
isrunning,theSRNCapplieshigherthresholdsfortriggeringtheHSPAinter-RNCcell

190

DN0638161

R: 190/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

change.SRNCaddsanadditionaloffsetHSPA inter-RNC cell change prevention offsetto


thevalueofthemanagementparameterHSPADRNCEcNoOffset.Thevalueofthe
additionaloffsetisfixedto1dB.
TargetRNCforUE involvedSRNSrelocationperformsachanneltypeselectionandsets
uptheHSPAresources.ThebasicprincipleisthatthetargetRNCallocatesthebest
possibleconfigurationforPSRABinconjunctionoftheSRNSrelocation.

IfPSRAB(withoutmulti-RAB)wasestablishedinthesourceRNCbeforetheSRNS
relocation,thetargetRNCexecutesachanneltypeselectionprocedureinorderto
allocateeitherHSPAorDCHresourcesforthePSRAB.

WhenmultipleNRTRABsaresupportedbyHSPA(seeRABcombinationsfor
HSDPA),HSPAinter-RNCcellchangecanbestarted.Thefollowingcaseshaveto
bedistinguished:

WhenevermultipleNRTRABsarecombinedwithAMRorPSStreamingorboth,
however,channeltypeswitchingfromHSPAtoDCHisperformed.

HSPAinter-RNCcellchangeisnotappliediftheUEhasastreamingRBmapped
totheHS-DSCH.
Inthiscase,thenewservingcellisnotselectedundertheDRNC.Instead,ifthe
newservingcellcannotbefoundundertheSRNCandtheoldcellcannotbe
kept,channeltypeswitchtoDCHisperformed.

HSPAInter-RNCcellchangeisnotappliedifUEhasCSvoiceRABmappedto
HS-DSCH.NewservingcellisnotselectedunderDRNC.Ifnewservingcell
cannotbefoundunderSRNCandoldcellcannotbekept,thenswitchtoDCHis
done.

Primarily,DLHS-DSCHandULE-DCHallocationsareattempted.F-DPCHisallocated
wheneverpossible.IfHS-DSCHandE-DCHallocationfailsbecauseoftheBTSor
transportcongestion,DCH/DCHinitialbitrateisattempteddirectly(noHS-DSCH/UL
DCHattempt).Secondarily,DLHS-DSCHandULDCHisattempted.Ifneitherofthe
previousalternativesissuccessful,thetargetRNCallocatesDLDCHandULDCHfor
thePSRAB.InitialbitrateisallocatedtotheHSDPAULDCHreturnchannelorDLDCH
/ULDCH.IfthetargetRNCcannotallocateanyuserplaneresources,whichimpliesthat
thetargetRNCcannotallocateanyotherresourcesthanSRBDCH(signalinglink),
SRNSrelocation(HSPAinter-RNCcellchange)isrejected.

ULSIRerrormeasurement
SRNCstartstheULSIRerrormeasurementfortheSRNCcellsaccordingtotheexisting
principlesasdescribedinthechapterSettinguptheDLCPICHEc/NoandULSIRerror
measurements.ULSIRerrormeasurementisnotstartedforDRNCcellsbutforSRNC
cellsonly.
SincetheULSIRerrormeasurementisnotreceivedfromtheDRNC,thismeasurementis
nottakenintoaccountasservingHSPAcellchangecriterionforDRNCcells.Asa
consequence,prioritizationandselectionoftheDRNCcandidatecellsarebasedonthe
periodicallyreportedCPICHEc/Nomeasurementsonly.

Issue:06H

DN0638161

R: 191/396

191

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

RNCoffsetisappliedinthecaseofHSPAinter-RNCcellchange.DRNCoffsetisdefined
bytheparameterHSPADRNCSIRErrorOffset.SRNCapplies
HSPADRNCSIRErrorOffsetwhentheULSIRerrormeasurementtriggersaserving
HSPAcellchange.
IftheperiodicallyreportedULSIRerrormeasurementofthecurrentservingHSPAcellis
belowthethresholddeterminedbytheHSDPASIRErrorServCellparameter,this
measurementresulttriggersaninter-BTSorintra-BTSinter-LCGservingHSPAcell
change.Inthiscase,thefollowingprocedureisapplied:

IfanapplicablecellisallocatedunderDRNCandiftheservingHSPAcellchange
cannotbeperformed,HS-DSCH/E-DCHMAC-dflowisnotreleased.Insteadthe
HSPAtransportchannelsremainconnected.

AdirectswitchfromHSPAtoDCH(thatmeansHS-DSCH/E-DCHMAC-dflowis
releasedandRBmappedontoDCH)isappliedonlywhenthefollowingconditions
apply:

TheULSIRerrormeasurementofthecurrentservingHSPAcell(BTS)goesbelow
thethresholddeterminedbytheparameterHSDPASIRErrorServCell
deductedbytheoffsetHSPADRNCSIRErrorOffsetandthe(007:0284
RN40_MAINT_014)PRFILEparametervalueequals0.

TheservingHSPAcellchangestillcannotbeperformed.

Ifthe(007:0284 RN40_MAINT_014)PRFILEparameterhasvalue1,theHSDSCHMAC-dflowisnotreleased.

Otherservingcellchangereasons
HSPAinter-RNCcellchangecanalsobestartedbecauseoffollowingreasons:

Measurementevent1Bor1CinitiatesHSPAinter-RNCcellchangeiftheserving
HSPAradiolinkistobedeletedfromtheactiveset,andiftheselectedcandidatecell
islocatedunderDRNC.

TheservingHSPAradiolinkistoberemovedfromtheactivesetbecauseofother
reasons:

RadiolinkfailureoftheservingHS-DSCH/E-DCHradiolink(lossofUL
synchronization).

RadiolinkremovalbecauseofRx-Txtimedifference.

Theselectionoftheservingcellintheabovementionedcasesfollowstheprinciples
describedpreviouslyinthischapter.
RNCchecksiftheE-DCHactivesetchangestounacceptableasdescribedinWCDMA
RAN RRM HSUPAfunctionalareadescription.IftheE-DCHactivesetchangesto
unacceptable,SRNCinitiatesaHSPAinter-RNCcellchangeinsteadofE-DCHtoDCH
switchprovided:

192

HSPAInterRNCMobilitymanagementparameterissetto(2)Enabled

NonE-DCHcellislocatedunderDRNCwhenevaluatingacceptabilityoftheE-DCH
activeset.

DN0638161

R: 192/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

MotivationistoavoidE-DCHtoDCHswitchbecauseofanunacceptableE-DCHactive
set,whichwouldimmediatelybefollowedbytheHSPAinter-RNCcellchange.Ifthe
managementparameterHSPAInterRNCMobilityissetto(0)Disabledor(1)
EnabledwithoutE-DCHtrigger,unacceptableE-DCHactivesetdoesnotinitiateHSPA
inter-RNCcellchange.

9.5.2 Iur-interfacedisabled
AllocationoftheassociatedSRBDCH(andULDCHreturnchannelifapplicable)under
DRNCfailsifbothanHS-DSCH(andE-DCH)MAC-dflowissetupintheSRNCandthe
SHObranchsetupovertheIur-interfacefails.Inthiscase,SRNCmayinitiateanHSPA
inter-RNCcellchangewhichistriggeredinasimilarwayastheexistingintra-frequency
inter-RNCHHOtriggering.Fordetailsabouttheexistingintra-frequencyinter-RNCHHO
triggering,refertotheWCDMA RAN RRM Handover ControlFAD.Inordertoinitiate
HSPAinter-RNCcellchange,thefollowingconditionsmustthenbeeffective:

HSPAInterRNCMobilityparameterissettoEnabledorEnabledwithoutE-DCH
triggerunderSRNC

AMRCSspeechRABisnotsimultaneouslyestablished

PSstreamingRABisnotsimultaneouslyestablished

BothSRNC(CN)andDRNCsupportsSRNSrelocation

ThehandoverdecisionmadebytheSRNCisbasedontheDLCPICHEc/Noofthebest
activesetcell(EcNoDownlink),DLCPICHEc/Nooftheneighboringcell(EcNoNcell)and
handovermargins.BecauseRNCisnotabletoaddtherequestedDRNCcellintothe
activeset,theUEproceedstoperiodicmeasurementreporting.Themeasurement
resultsoftheneighboringDRNCcellmustsatisfyeitherofthefollowingequations(1)or
(2)beforetheHSPAinter-RNCcellchangecanbeinitiated:
1. AveEcNoDownlink+HHoMarginAverageEcNo(n)<AveEcNoNcell(n)
2. EcNoDownlink+HHoMarginPeakEcNo(n)<EcNoNcell(n)
AveEcNoDownlinkistheaveragedDLCPICHEc/Noofthebestactivesetcell.
AveEcNoNcell(n)istheaveragedDLCPICHEc/NooftheneighboringDRNCcell(n).
RNCcalculatestheaveragedvaluesfromaspecifiednumberofperiodicaleventtriggeredintra-frequencymeasurementreports.Theaveragingwindowiscontrolledby
theexistingmanagementparameterEcNoAveragingWindow.
TheparameterHHoMarginAverageEcNo(n)determinesthemaximumallowed
differencebetweentheaveragedCPICHEc/NooftheneighboringDRNCcell(n)andthe
averagedCPICHEc/Noofthebestactivesetcell.Theparameter
HHoMarginPeakEcNo(n)determinesthemaximumalloweddifferencebetweenthe
CPICHEc/NooftheneighboringDRNCcell(n)andtheCPICHEc/Noofthebestactive
cell.
SRNCusestheparametersfromtheHSDPA-specificparametersetsindecisionmaking.
InthecaseofAMRmulti-service,SRNCusestheparametersfromtheRT+HSDPAspecificparametersets.

Issue:06H

DN0638161

R: 193/396

193

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

InthecaseofAMRmulti-service,HSPAinter-RNCcellchangeisnotallowed,butHSPA
toDCHswitchisperformedbeforeintra-frequencyinter-RNCcellchangecanbestarted.

9.6 HSDPAhandovers
9.6.1 HSDPAinter-frequencyhandover
Basedoninter-frequencyhandover(IFHO)triggers,theRNCorderscompressedmode
onHSDPAsothatinter-frequencymeasurementscanbeperformedonHSDPAwithout
channeltypeswitchingtoDCH.Thus,highHSDPAthroughputcanbeexperienced
duringcompressedmodeandthetotalhandoverexecutiontimeisreducedupto1.5s.
ThefollowingchangesinthechanneltypearesupportedduringHSDPAinter-frequency
handover:

DCH/HSDPAtoDCH/HSDPA

DCH/HSDPAtoHSUPA/HSDPA

DCH/HSDPAtoDCH/DCH

DCH/DCHtoDCH/HSDPA

DCH/DCHtoHSUPA/HSDPA

Inter-frequencyhandoveristriggeredbecauseofcoverageandqualityreasons,butalso
IMSIbasedhandoverandHSPAcapabilitybasedhandovercanbeinitiated.TheRNC
selectsthetargetcellaccordingtothemeasurementresultsandperformsinterfrequencyhandoveralongwithHSDPAservingcellchange.Thetargetcellcanbean
intra-orinter-RNCcelldependingonthedefinedneighboringcells.
Normalchannel-typeselectionisalwaysperformedinthetargetside.IftheHSDPA
allocationisnotpossibleinthetargetcell,handoverisperformedtoDCH.Channeltype
switchingtoDCHorFACHmaybeperformedduringcompressedmode,forexampleif
theactivesetisupdatedorinactivityisdetected.
FordetailsaboutHSDPAinter-frequencyhandover,seetheWCDMA RAN RRM
Handover Controlfunctionalareadescription.
HSDPACMisnotsupportedoverIuriftheservingcellisundertheDRNC.Channeltype
switchingisperformedfirsttoDCH/DCHandCMisstartedonDCH.DCHsareallocated
withaninitialbitrate(PSNRT).
IfHSDPAorHSPACMisrequestedbytheSRNC,theDRNCrejectstheHSDPAor
HSPAcompressedmodefortheradiolinkovertheIur-interface.TheDRNCusesthe
failurecauseCM not Supported.However,theHSDPACMissupported,ifthe
002:1902 RN60_MAINT_26PRFILEparameterbit0issetto1andwhentheHSDPA
servingcellisunderDRNC.

194

DN0638161

R: 194/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

TheSRNCmightsendcompressedmodepreparationparameterstotheDRNCin
RNSAP:RADIOLINKSETUPREQUESTmessage.InthatcaseDRNCsetsupthe
compressedmodeparameterstotheBTSinthelegacymanner.
Ifthe002:1902 RN60_MAINT_26PRFILEparameterbit0issetto1,theHS-DSCH
servingcellchangewithCMisacceptedbytheUE-specificRRCinDRNCfornonactive/activecompressedmode.SRNCmightthensendagainthesamecompressed
modepreparationparametersinTransmission Gap Pattern Sequence Information IEto
DRNCinRNSAP:RADIOLINKRECONFIGURATIONPREPAREmessage.UE-specific
RRCinDRNCcomparestheparameterswiththeonesreceivedinRNSAP:RADIOLINK
SETUPREQUESTmessage.
Iftheparametersareidentical,thereisnoneedtoupdatetheBTS.Thatmeansthat
NBAP:RADIOLINKRECONFIGURATIONprocedureinIubinterfaceisnotperformed.
Iftheparametersarenotidentical,thereisaneedtoupdateBTS.Thatmeansthat
NBAP:RADIOLINKRECONFIGURATIONprocedureinIubinterfaceisperformed.
Ifthe002:1902 RN60_MAINT_26PRFILEparameterbit0issetto0andtheSRNC
requeststhatHS-DSCHservingcellchangewithCMfromSRNCcelltoDRNCcell
(RNSAP:RADIOLINKRECONFIGURATIONprocedure),theDRNCbehavesinlegacy
wayandrejectstherequestbecauseofthecompressedmodeparameterssentearlier.
TheSRNCmightactivatethecompressedmodebysendingRNSAP:COMPRESSED
MODECOMMANDmessagewithActive Pattern Sequence Information IEtoDRNC.
Ifthe0002:1902 RN60_MAINT_26PRFILEparameterbit0issetto1,theUE-specific
RRCinDRNCactivatesthecompressedmodeinBTSwithNBAP:COMPRESSED
MODECOMMANDmessage.Otherwise,theUE-specificRRCinDRNCdoesnot
activateCMintheBTS.
TheSRNCmightrequestfromDRNC(withRNSAP:RADIOLINKRECONFIGURATION
PREPAREmessage)channeltypeswitchfromDCH/DCHconfigurationtoHS-DSCH/UL
DCHconfigurationwithcompressedmodeparameters.
Ifthe002:1902 RN60_MAINT_26PRFILEparameterbit0issetto1,theUE-specific
RRCinDRNCacceptsthisrequestfornon-active/activecompressedmode.Otherwise,
theDRNCbehavesinlegacywayandrejectstherequestbecauseofthecompressed
modeparameterssentearlier.
TheHSDPAcompressedmodeduringanchoringrequiresthattheinter-frequency
neighborcellinformationisavailableintheSRNC.TheDRNCsendstheinter-frequency
neighborcellinformationtotheSRNCifIFHOoverIurfeatureisenabled.TheSRNC
usestheFMCIandHOPIparametersetsoftheADJIobjectclassiftheservingcellis
locatedintheSRNC.TheSRNCusestheFMCIandHOPIparametersdefinedinthe
virtualcell(VCEL)iftheservingcellislocatedintheDRNC.
TheDRNCconsiderstheHSDPAinter-frequencyhandover(compressedmode)tobea
criticalhandover.
TheRNCfollowsthestandardsofthefunctionalitydescribedinchapterDual-cellHSDPA
allocationwhenitmakesadecisionwhethertoallocatetheDCHSDPAinthetargetcell
ofthehardhandover(theRNCallocatestheDCHSDPAwheneveritispossible).

Issue:06H

DN0638161

R: 195/396

195

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

9.6.2 Inter-systemhandover
HandovertoUTRANisdonetotheR99configurationfortheCSvoiceservice(2Gto
3G).BecauseTS25.331doesnotintroduceanyproperdefaultconfigurationforthe
HSPAconfigurationoftheCSvoicebearerthentheInter-RATHandovertoUTRANis
doneintheR99configuration.Ifintersystemhandoverto2GispreventedwiththeRNP
parameterGsmHandoverAMRandtheUEhasAMRRBmappedtoHStransport
channels,thenAMRRBsmappedtoHStransportchannelsarenotswitchedtoDCH
whenmeasurementsforISHOaretriggered.ThismeansalsothatISHOmeasurements
arenotstarted.IfISHOisallowed,thenswitchtoDCHismadeandmeasurementsare
started.

9.6.3 Serviceandload-basedhandover
Thefollowingrestrictionswithregardstotheservice-andload-basedhandoversare
effectivetotheHSDPAcapableUE:

Service-andload-basedhandoversarenotappliedtotheUEwithHS-DSCHMAC-d
flowsetup

Service-andload-basedhandoversarenotappliedtotheHSDPA-capableUEwith
NRTDCHgreaterthan0kbit/sand/orPSstreamingDCHgreaterthan0kbit/s
allocatedwhenHSDPAisenabledinthecell.

9.7 Measurementcontrolandhandoverpath
parameters
ThischapteriscommonforbothvaluesofHSDPAMobility.
TheHSDPAcoveragecanbemaximizedbydefiningseparatemeasurementcontroland
handoverpathparametersforUEsthatsupportHSDPA.TheseHSDPA-specific
parametersetsaresentwiththeRRC:MEASUREMENTCONTROLwhenaHS-DSCH
transportchannelisallocated.
WhenusershaveestablishedonlyPSRABs(oneormore)havingHS-DSCHtransport
channelallocated,aparticularparametersetisassociatedwiththeHSDPAUEbythe
identifiers:

196

HSDPAFmcsIdentifier(intra-frequencymeasurementcontrol)

HSDPAFmciIdentifier(inter-frequencymeasurementcontrol)

HSDPAFmcgIdentifier(inter-systemmeasurementcontrol)

HSDPAHopsIdentifier(intra-frequencyhandoverpath)

AdjdHSDPAHopsId(additionalintra-frequencyhandoverpath)

DN0638161

R: 196/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

WhenAMRspeechCSRABisestablishedsimultaneously(possiblewhen
AMRWithHSDSCHparameterisenabled)withPSRABs(oneormore)havingHS-DSCH
transportchannelallocated,aparticularparametersetisassociatedwiththeHSDPAUE
bytheidentifiers:

RTWithHSDPAFmcsIdentifier(intra-frequencymeasurementcontrol)

RTWithHSDPAFmciIdentifier(inter-frequencymeasurementcontrol)

RTWithHSDPAFmcgIdentifier(inter-systemmeasurementcontrol)

RTWithHSDPAHopsIdentifier(intra-frequencyhandoverpath)

AdjdRTWithHSDPAHopsId(additionalintra-frequencyhandoverpath)

WhentheDCHSDPAisallocated,aparticularparametersetisassociatedwiththeDC
HSDPAUEbytheidentifiers:

DCellHSDPAFmcsId(intra-frequencymeasurementcontrol)

HSDPAFmciIdentifier(inter-frequencymeasurementcontrol)

HSDPAFmcgIdentifier(inter-systemmeasurementcontrol)

HSDPAHopsIdentifier(intra-frequencyhandoverpath)

AdjdHSDPAHopsId(additionalintra-frequencyhandoverpath)

Thefollowingtableslistthecontentsoftheparametersetsthatwillbededicatedtothe
UEthathasaHS-DSCHallocated.
Seethefollowingnotesinthetables:
*)

AvailableforasingleNRTPSRAB(HS-DSCH),multiNRTPSRABs
(HS-DSCH),andPSstreamingRABwhenHSDPAMobilitydisabled.

**)

AvailableforasingleNRTPSRAB(HS-DSCH),multiNRTPSRABs
(HS-DSCH),andPSstreamingRABwhenHSDPAMobilityenabled.

***)

AvailableforanAMR+HSDPAmulti-serviceandforAMR+multi
NRTRABs(HS-DSCH)andforAMR+PSstreamingRAB(HSDSCH)whenHSDPAMobilitydisabled.

****)

AvailableforanAMR+HSDPAmulti-serviceandforAMR+multi
NRTRABs(HS-DSCH)andforAMR+PSstreamingRAB(HSDSCH)whenHSDPAMobilityenabled.

Table 11

Issue:06H

Intra-frequencymeasurementcontrol(FMCS)parameters

FMCSparametername

Availability

AdditionWindow(1A)

*),**),***),****)

DN0638161

R: 197/396

197

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

Table 11

198

WCDMARANRRMHSDPA

Intra-frequencymeasurementcontrol(FMCS)parameters(Cont.)

FMCSparametername

Availability

AdditionTime(1A)

*),**),***),****)

AdditionReportingInterval(1A)

*),**),***),****)

DropWindow

**),****)

DropTime

**),****)

ReplacementWindow

**),****)

ReplacementTime

**),****)

ReplacementReportingInterval

**),****)

MaximumActiveSetSize

**),****)

CPICHEc/NoFilterCoefficient

*),**),***),****)

ActiveSetWeightingCoefficient

**),****)

CPICHEc/NoHHOCancellation(1E)

*),**),***),****)

CPICHEc/NoHHOCancellationTime(1E)

*),**),***),****)

CPICHEc/NoHHOThreshold(1F)

*),**),***),****)

CPICHEc/NoHHOTimeHysteresis(1F)

*),**),***),****)

CPICHRSCPHHOCancellation(1E)

*),**),***),****)

CPICHRSCPHHOCancellationTime(1E)

*),**),***),****)

CPICHRSCPHHOFilterCoefficient

*),**),***),****)

CPICHRSCPHHOThreshold(1F)

*),**),***),****)

CPICHRSCPHHOTimeHysteresis(1F)

*),**),***),****)

IMSIbasedHO

N/A

DN0638161

R: 198/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 12

Inter-frequencymeasurementcontrol(FMCI)parameters

FMCIparametername

Availability

IFHOcausedbyCPICHEc/No

*),**),***),****)

IFHOcausedbyCPICHRSCP

*),**),***),****)

IFHOcausedbyDLDPCHTXPower

***),****)

IFHOcausedbyUETXPower

*),**),***),****)

IFHOcausedbyULDCHQuality

*),**),***),****)

DLDPCHTXPowerThresholdforAMR

***),****)

MaximumMeasurementPeriod

***),****)

MeasurementAveragingWindow

***),****)

MeasurementReportingInterval

***),****)

MinimumIntervalBetweenIFHOs

***),****)

MinimumMeasurementInterval

***),****)

NeighbourCellSearchPeriod

***),****)

UETXPowerFilterCoefficient

*),**),***),****)

UETXPowerThresholdforAMR

***),****)

UETXPowerThresholdforNRTPS

*),**)

MinimumIntervalBetweenIFSLHOs

N/A

IMSIBasedIFHO

N/A

Table 13

Issue:06H

HSDPAmobilityhandling

Inter-systemmeasurementcontrol(FMCG)parameters

FMCGparametername

Availability

GSMHOcausedbyCPICHEc/No

*),**),***),****)

GSMHOcausedbyCPICHRSCP

*),**),***),****)

DN0638161

R: 199/396

199

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

Table 13

Inter-systemmeasurementcontrol(FMCG)parameters(Cont.)

FMCGparametername

Availability

GSMHOcausedbyDLDPCHTXPower

***),****)

GSMHOcausedbyUETXPower

*),**),***),****)

GSMHOcausedbyULDCHQuality

*),**),***),****)

DLDPCHTXPowerThresholdforAMR

***),****)

MaximumMeasurementPeriod

***),****)

MeasurementAveragingWindow

***),****)

MeasurementReportingInterval

***),****)

MinimumIntervalBetweenHos

***),****)

MinimumMeasurementInterval

***),****)

GSMNeighbourCellSearchPeriod

***),****)

UETXPowerFilterCoefficient

*),**),***),****)

UETXPowerThresholdforAMR

***),****)

UETXPowerThresholdforNRTPS

*),**)

IMSIbasedGSMHO

N/A

MinimumIntervalBetweenISSLHOs

N/A

Table 14

200

WCDMARANRRMHSDPA

Intra-frequencycellre-selectionandhandoverpathcontrolparameters
(HOPS)

HOPSparametername

Availability

HHOMarginforAverageEc/No

Notrelevant

HHOMarginforPeakEc/No

Notrelevant

ReleaseMarginforAverageEc/No

*),**),***),****)

DN0638161

R: 200/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 14

HSDPAmobilityhandling

Intra-frequencycellre-selectionandhandoverpathcontrolparameters
(HOPS)(Cont.)

HOPSparametername

Availability

ReleaseMarginforPeakEc/No

*),**),***),****)

CPICHEc/NoAveragingWindow

*),**),***),****)

EnableRRCConnectionRelease

*),**),***),****)

EnableInter-RNCSoftHandover

**),****)

Fordetailsaboutparametersinparametersets,seeManagement data for handover


controlinWCDMA RAN RRM Handover Control.

9.8 MobilityhandlingduringPSNRTRAB
reconfiguration
SituationsmayoccurinwhichaRABmodificationprocedureisongoing(seePSNRT
RABreconfiguration)-itstarted,forexample,immediatelyuponreceiptofRANAP:RAB
AssignmentRequestorcapacityrequestfromtheUE,forexampleviaRRC:
MeasurementReportmessage-whensuddenlyoneorseveraltriggerconditionsforone
ormoreHSDPAmobilityproceduresarereceived.IftriggersforHSDPAmobilityemerge
duringongoingPSNRTRABreconfigurations,theRNCnormallysuspendsthemobility
procedure.
Specialcases:

Incontrasttothatgeneralapproach,SRNSrelocationandhardhandoversoverride
howeverongoingRABmodificationsandstartimmediately.

ChangesoftheservingcellarenotinitiatedbeforetheRABconfigurationis
completedbecauseoldIubconnectionsfromtheservingcellchangeareremoved.
ThesameapplieswhenRABreconfigurationtriggersarereceivedduringongoing
servingcellchange.Forthesamereason,theservingcellchangeprocedurehasto
befinishedbeforetheRABmodificationcanactuallystart.

9.9 InterCircleRoamingforHSDPA
TheRAN2596: Inter Circle Roaming for HSDPA(ICRforHSDPA)featureallowsa3G
operatortosharenetworkHSDPAcapacitywithotheroperatorswhodonothave3G
coverageinthisarea.ThedifferencebetweenICRandnormalnationalroamingisthat

Issue:06H

DN0638161

R: 201/396

201

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAmobilityhandling

WCDMARANRRMHSDPA

ICRallowscapacitysharingaccordingtocertainweightsforHSDPA.TheBTSHSDPA
schedulersplitstheresourcesbetweentheoperators.TheRNCindicatestheoperator
foreachcall(uptofiveoperatorsperRNC).
TheRAN2596: Inter Circle Roaming for HSDPAfeatureisenabledbytheexistingBTSlevelICREnabledparameter.ItcanalsobeenabledbytheHSDPAOperatorWeight
parameter.
TheRAN2596: Inter Circle Roaming for HSDPAisconsideredtobeenabledintheBTSif
theHSDPAoperatorweightisconfigured(WBTS-HSDPAOperIdWeightPair)andthe
configuredweightforalltheoperators(WBTSHSDPAOperIdWeightPair-HSDPAOperatorWeight)andIurusers
(HSDPAIurWeight)isnotequaltozero.

9.9.1 ICRcapabilityindication
TheBTSindicatestheICRcapabilityofitscellstotheRNCbyincludingthe ICR
Capability InformationIEinNBAP:PRIVATEMESSAGE(CapabilityIndication)during
theAuditprocedure.The ICR Capability InformationIEcontainsthelistofcellIDsand
theircorrespondingICRcapability.IftheICRfunctionalityissupportedinthecell,the
BTSsetstheICR Capability IndicatorIEtoICR Capable.IftheBTSdoesnotsendthe
ICR Capability InformationIE,itmeanstheBTSdoesnotsupportICRforHSDPA.
TheRNCalsosupportsthereceptionofNBAP:PRIVATEMESSAGE(Capability
Indication)outsidetheAuditprocedure.
ThemessageincludesonlythosecellswhoseICRcapabilityhaschanged.

9.9.2 Inter-operabilitywithotherfeatures
InterCircleRoaming
TheRAN2596: Inter Circle Roaming for HSDPAfeatureusesthesamelicenseand
featureenablingparameterastheRAN2412: Inter Circle Roamingfeature.Hence,
RAN2412: Inter Circle RoamingfeatureisapreconditionforRAN2596: Inter Circle
Roaming for HSDPA.RAN2596: Inter Circle Roaming for HSDPAisconsideredtobe
enabledinaBTSundertheRNConlyiftheRAN2412: Inter Circle Roamingfeatureis
enabledinthecorrespondingBTS.

MOCN
MOCNisnotsupportedsimultaneouslywiththeICRforHSDPAfeature.MOCN
activationisrestrictedintheRNCwhileICRisactiveandviceversa.

MORAN
MORANisnotsupportedsimultaneouslywiththeICR for HSDPAfeature.Aconsistency
checkisperformedsotheoperatordoesnotconfiguremultiplePLMNIDsforthehost
operatorintheIUOobject.ThisoccurswhenICRisenabledforatleastoneBTSinthe
RNCandviceversa.

202

DN0638161

R: 202/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAmobilityhandling

QoSAwareHSPAScheduling
TheRAN1262: QoS Aware HSPA Schedulingfeatureintroducedtheconceptofthe
schedulingweightfortheusers.Thisfeatureenablesserviceandsubscriber
differentiationinHSDPAforNRT-trafficclassesaccordingtotheQOSweightswithinthe
operatorshare.ICR for HSDPAusesthisfunctionalitytointroducethecapacitysplitof
theHSDPAresourceacrosstheoperatorsbymodifyingtheschedulingweightaccording
totheoperatorshare.Hence,theHSDPAoperatorsharecanbeconfiguredforall
operatorsandIurusersonlyiftheRAN1262: QoS Aware HSPA Schedulingfeatureis
enabledforatleastonecellunderthecorrespondingBTS(usingtheWCELQosEnabledparameter).

Issue:06H

DN0638161

R: 203/396

203

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

RABinactivityhandlingforPSservices

WCDMARANRRMHSDPA

10 RABinactivityhandlingforPSservices
10.1 MonitoringtheutilizationandthroughputofHSDSCH

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
Thischapterdescribestheutilizationandthroughputmeasurementsrelatedtothe
downlinkHS-DSCHMAC-dflow.UplinkDCHandE-DCHrelatedinactivitycontrol
mechanismsaredescribedinsectionsUplink (inWCDMA RAN RRM Packet Scheduler)
andChannel type switch between DCH and E-DCH(inWCDMA RAN RRM HSUPA),
respectively.
IfthePSselectstheHS-DSCH,theMAClayerceasesthetrafficvolumemeasurements.
ThemeasurementsarenotneededbecausethereisnobitrateupgradeforHS-DSCH.
MAC-dflowutilizationandthroughputaremonitoredandHS-DSCHisreleasedwhen
eitherindicatesinefficientuseofresources.
Thefundamentaldifferencebetweenthetwoisthatthelowutilization,incontrasttothe
lowthroughput,requiresthattheRLCdoesnothaveanydataorunacknowledgedPDUs
tobesent.Inotherwords,thelowutilizationrepresentsnormaldatainactivitywhereas
thelowthroughputrepresentsthesituationwherethereisstilldatatobesentbutactual
throughputisabnormallylow.
IfthereleaseoftheMAC-dflowiscausedbylowthroughput,theUEisnotallowedto
useHS-DSCHuntiltheHS-DSCHguardtimerhasexpiredbecauseoflowthroughput.
Thevalueoftheguardtimercanbedefinedwiththe
HsdschGuardTimerLowThroughputparameter.
LowutilizationisdetectedwhenthereisnomoredataintheRLCbuffer.Lowthroughput
canbesentevenwhenthereisstilldataintheRLCbuffer.Thedefaultvaluesare
configuredsothatlowutilizationtriggersthereleaseoftheHS-DSCHMAC-dflowin
normalcasesandlowthroughputtriggerstheflowinabnormalcases,thatis,thereis
dataontheRLCbutitcannotbesent.
HS-DSCHMAC-dflowutilizationismonitoredbyRLC/MAC-d.Thedetectionisbasedon
downlinkthroughputandthenumberofPDUsintheRLCtransmissionwindows.While
forPSNRTRBsinactivitydetectioncannotbedeactivatedseparately,inactivation
detectionforPSstreamingRBscanbeactivatedanddeactivatedbyoperatorsusingthe
InactDetForSreamingRBRNPparameter.Changingthisparameterhasnoeffecton
existingPSstreamingRBsbutwillonlybetakenintoaccountwhenresourcesare
allocatedormodifiedforneworexistingRBs,respectively.

204

DN0638161

R: 204/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Figure 63

RABinactivityhandlingforPSservices

HSDPAmonitoringscenario

Thefigureabovedepictsawindow-basedmeasurementofdownlinkthroughput,
thresholdsforlowutilizationandlowthroughput,andhysteresistimersforsending
reportstoL3whenthresholdsarecrossed.Theirusageisdescribedbelow.
ThereleaseoftheDCHSDPAallocationfollowsprinciplesofreleaseoftheSCHSDPA
allocation.InbothcasesthereisonlyoneHS-DSCHMAC-dflowandtheincreaseinthe
maximumbitratedoesnotaffectthereleasingalgorithm.
ThevaluesofthethroughputmeasurementparametersMACdflowutilRelThr,
MACdflowutilTimetoTrigger,MACdflowthroughputAveWinarereadfromthe
WACobjectidentifiedwiththeWACSetIdentifiermanagementparameter.
ToconfigurethethroughputmeasurementparametersMACdflowutilRelThr,
MACdflowutilTimetoTrigger,MACdflowthroughputAveWinthefollowing
parametersetsareused:

ForHSPA/HSDPARABs,theparametersetoftheservingcell.

ForPSNRTRABswithDCH/DCH0/0,theparametersetofthemaincell.

Theexistingthroughputmeasurementsarenotreconfiguredbecauseofthechangeof
servingcellormaincell(becauseofSHOorSCC)inthecurrentfrequencylayer.

Issue:06H

DN0638161

R: 205/396

205

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

RABinactivityhandlingforPSservices

WCDMARANRRMHSDPA

Downlinkthroughputinmeasurementwindow
Downlinkthroughputiscalculatedbycountingalltransmittedbitsduringaconfigurable
slidingmeasurementwindow.TheslidingmeasurementwindowismovedbyeveryHSDSCHMAC-dschedulinginterval.Thethroughputwithinthewindow[bps]iscalculated
aftertheHS-DSCHMAC-dschedulinginterval.
TheoperatorcansettheslidingmeasurementwindowsizeforHS-DSCHMAC-dflow
throughputmeasurementorturnthemeasurementoffwiththe
MACdflowthroughputAveWinparameter.

LowandnormalutilizationindicationsofMAC-dflow
Layer2hasmanagementparametersthatdefinethethresholdforlowutilizationofHSDSCHMAC-dflowandhysteresistimerforsendingoflowor'normal'MAC-dflow
utilizationindicationstoL3.

WiththeMACdflowutilRelThrparameter,theoperatorcansetthelowutilization
thresholdoftheHS-DSCHMAC-dflowthroughputmeasurement.

WiththeMACdflowutilTimetiTriggerparameter,theoperatorcansetthe
periodoftimethatthethroughputofPSNRTRBshastobebelowthelowutilization
thresholdbeforeanindicationissent.

WiththeMACdflowutilStrTtTparameter,theoperatorcansettheperiodoftime
thatthethroughputofPSstreamingRBshastobebelowthelowutilizationthreshold
beforeanindicationissent.

IfdownlinkthroughputgoesbeloworequaltoMACdflowutilRelThr,the
MACdflowutilTimetiTrigger(PSNRT)orMACdflowutilStrTtT(PSstreaming)
timerisstarted(t1andt6inFigureFigure63:HSDPAmonitoringscenario).Ifdownlink
throughputgoesaboveMACdflowutilRelThr,theMACdflowutilTimetiTrigger
(PSNRT)orMACdflowutilStrTtT(PSstreaming)isstoppedandreset(t5inFigure
Figure63:HSDPAmonitoringscenario).IftheMACdflowutilTimetiTrigger(PS
NRT)orMACdflowutilStrTtT(PSstreaming)expires,thenumberofRLCPDUsin
thetransmissionwindow(s)ischecked:

IfthesumofRLCPDUsinthetransmissionwindow(s)oftheNRTRB(s)mappedto
theMAC-dflowequalstozeroandthereisnocontrolPDUstobesent,L2checksif
lowthroughputisdetectedforE-DCHMAC-dflowofsameRAB.Ifitisdetected,L2
sendslowutilizationindicationtoL3.Iflowthroughputisnotdetected,noindication
issenttoL3.L2alsoresetstheMACdflowutilTimetiTrigger(PSNRT)or
MACdflowutilStrTtT(PSstreaming)(t2andt4inFigureFigure63:HSDPA
monitoringscenario).

IfthereareanyRLCPDUsinthetransmissionwindow(s)orcontrolPDUstobesent
(t7inFigureFigure63:HSDPAmonitoringscenario),L2keepscheckingthe
transmissionwindow(s)untiltheyareemptyandallthependingcontrolPDUsare
sentordownlinkthroughputgoesaboveMACdflowutilRelThr.

IfMACdflowutilTimetiTrigger(PSNRT)orMACdflowutilStrTtT(PS
streaming)valueissettozerosecondswhenthedownlinkthroughputgoesbelowor
equaltoMACdflowutilRelThrandthesumofRLCPDUsinthetransmission

206

DN0638161

R: 206/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

RABinactivityhandlingforPSservices

windowsoftheNRTRBsmappedtotheMAC-dflowequalstozeroandthereisno
controlPDUstobesent,L2checksiflowthroughputisdetectedforE-DCHMAC-dflow
ofsameRAB.Ifitisdetected,L2sendsimmediatelythelowutilizationindicationtoL3.
L2sendsanormalutilizationindicationtoL3(t3andt5inFigureFigure63:HSDPA
monitoringscenario)whenthefollowingconditionsaremet:

AlowutilizationindicationhasbeensenttoL3.

DownlinkthroughputexceedsMACdflowutilRelThr.

Or

ThesumofRLCPDUsinthetransmissionwindowsoftheNRTRBsmappedtothe
HS-DSCHMAC-dflowexceedszero.

IfMACdflowutilRelThrissettoOFF,alow/normalutilizationindicationisnotsentto
L3.
WithrespecttoPSHSPAmulti-RABcombinations,lowutilizationofoneRABishandled
inthesamewaysasitwouldbehandledforasinglePSRAB.Inotherwords,iftheRBis
inactive,theRABwillbereleased.IflowutilizationisindicatedforDL,theRBinquestion
isthereforereleasediftheULisalsoinactive.

LowandnormalthroughputindicationofHS-DSCHMAC-d
Layer2hasmanagementparametersthatdefinethethresholdforlowthroughputofHSDSCHMAC-dflowandhysteresistimerforsendingofMAC-dflowlowthroughputor
'MAC-dflownormalthroughput'indicationstoL3.
IfdownlinkthroughputisbeloworequaltoMACdflowthroughputRelThr,the
MACdflowthroughputTimetoTrigger(PSNRT)orMACdflowtputStrTtT(PS
streaming)timerisstarted(t6inFigureFigure63:HSDPAmonitoringscenario).If
downlinkthroughputexceedsMACdflowthroughputRelThr,then
MACdflowthroughputTimetoTrigger(PSNRT)orMACdflowtputStrTtT(PS
streaming)isstoppedandreset.
IftheMACdflowthroughputTimetoTrigger(PSNRT)orMACdflowtputStrTtT
(PSstreaming)expiresthenumberofRLCPDUsinthetransmissionwindow(s)is
checked:

Issue:06H

IfthesumofRLCPDUsinthetransmissionwindow(s)oftheNRTRB(s)mappedto
theMAC-dflowisgreaterthanzeroorthereiscontrolPDU(s)tobesent,L2checks
iflowthroughputisdetectedforE-DCHMAC-dflowofsameRAB.Ifitisdetected,L2
sendsMAC-dflowlowthroughputindicationtoL3.Iflowthroughputisnotdetected,
noindicationissenttoL3.L2alsoresetsthe
MACdflowthroughputTimetoTrigger(PSNRT)orMACdflowtputStrTtT(PS
streaming).

IfthereareneitherRLCPDUsinthetransmissionwindow(s)norcontrolPDUstobe
sent,L2doesnotsendlowthroughputindicationtoL3.InthiscaseL2keeps
checkingtheRLCbufferstatusuntilthroughputgoesabove
MACdflowthroughputRelThr.Withinthisperiod,ifthereareRLCPDUsinRLC

DN0638161

R: 207/396

207

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

RABinactivityhandlingforPSservices

WCDMARANRRMHSDPA

bufferorcontrolPDUstobesent,L2checksiflowthroughputisdetectedforE-DCH
MAC-dflowofsameRAB.Ifitisdetected,L2sendslowthroughputindicationtoL3.
Iflowthroughputisnotdetected,noindicationissenttoL3.
IfMACdflowthroughputTimetoTrigger(PSNRT)orMACdflowtputStrTtT(PS
streaming)valueissettozerosecondwhenthedownlinkthroughputgoesbelowor
equaltoMACdflowthroughputRelThrandthesumofRLCPDUsinthetransmission
windowsoftheNRTRBsmappedtotheMAC-dflowisgreaterthanzeroorthereis
controlPDU(s)tobesent,L2checksiflowthroughputisdetectedforE-DCHMAC-dflow
ofsameRAB.Ifitisdetected,L2sendsimmediatelythelowthroughputindicationtoL3.
IfMACdflowthroughputTimetoTrigger(PSNRT)orMACdflowtputStrTtT(PS
streaming)expires,L2sendsaMAC-dflowlowthroughputindicationtoL3andresets
MACdflowthroughputTimetoTrigger(PSNRT)orMACdflowtputStrTtT(PS
streaming)(t8inFigureFigure63:HSDPAmonitoringscenario).
L2doesnotsendthelowthroughputindicationtoL3ifthereisnodatatobesentinthe
RLCbufferbecausethisisnotconsideredlowthroughputbutlowutilization.
IfaMAC-dflowlowthroughputindicationhasbeensenttoL3anddownlinkthroughput
exceedsMACdflowthroughputRelThr,L2sendsaMAC-dflownormalthroughput
indicationtoL3.
IfMACdflowthroughputRelThrissettoOFF,alow/normalthroughputindicationis
notsenttoL3.
WithrespecttoPSHSPAmulti-RABcombinations,lowthroughputofoneRABdoesnot
causetheRBinquestiontobereleased.Instead,RBscanonlybereleasedafterallPS
RABsoftheparticularUEarefoundtobeinactive.OneRBisthusconsideredtobe
inactiveifbothULandDLareinactive.
LowthroughputindicationofaPSservicedoesnottriggerareleaseofRBresourcesin
thefollowingscenarios:

theUEinquestionhassimultaneousCSservicemappedtoHSPA
and/or

theUEinquestionhasatleastonesimultaneousactivePSservicemappedtoHSPA

Lowthroughputindication(s)triggerstheRBresourcereleaseonlywhentheUEin
questioncanbeputtoCell_FACHstateor,incaseofCSRBonDCH,ifallPSRBsare
inactive.

10.2 ReleaseofDLHS-DSCHMAC-dflowandULDCH/
E-DCH
L3startstheproceduretoreleaseDLHS-DSCHMAC-dflowandcorrespondingULDCH
/ULE-DCHifoneofthefollowingeventsoccurs:

208

TheDLHS-DSCHMAC-dflowhaslowutilizationandULDCHcanbereleased(as
specifiedintheWCDMA RAN RRM Packet Scheduler,section Upgrading of the nonreal time dedicated channel bit rate)/ULE-DCHcanbereleased(asspecifiedinthe

DN0638161

R: 208/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

RABinactivityhandlingforPSservices

WCDMA RAN RRM HSUPA,sectionUplink NRT DCH overload control in the E-DCH
cell).However,whenContinuousPacketConnectivityfeatureisenabled,the
decisionofreleasestartsasdescribedinExtendedinactivitytimeinCell_DCHstate
withCPC.

TheDLHS-DSCHMAC-dflowhaslowthroughputandULDCHcanbereleased(as
specifiedintheWCDMA RAN RRM Packet Scheduler,sectionUpgrading of the nonreal time dedicated channel bit rate)/ULE-DCHcanbereleased(asspecifiedinthe
WCDMA RAN RRM HSUPA,sectionUplink NRT DCH overload control in the E-DCH
cell).Inthiscase,theUE-specificoperator-configurable
HsdschGuardTimerLowThroughputtimerisstarted.

IftheDLHS-DSCHMAC-dflowhasbothlowutilizationandlowthroughputconditions
validatthesametime,thefunctionalitydescribedforlowutilizationisfollowed.
TheinactivitysupervisioninL2andtheinactivitytimerinL3arenotusedfortheHSDSCHandE-DCH,theyareonlyusedforuplinkanddownlinkDCHs.

10.3 ExtendedinactivitytimeinCell_DCHstatewith
CPC
LongerinactivitytimersinCell_DCHstateforCPCusersareappliedifCPCisactivated
fortheUE.Longerinactivitytimersfornon-CPCusersareappliedirrespectiveofthe
CPCEnabledparametervalue.
Formoreinformationontheusageoflongerinactivitytimerssee,Inactiveuserhandling.

InactiveMAC-dflowhandlingformulti-RABusers
ThisisappliedwhenCPCisactivatedfortheUEoroneoftheextendedtimersfornon
CPCusers(InactNonCPCBatOptT,InactNonCPCNoBatOptT)hasvaluegraterthan
zero.UEhasseveralNRTand/orstreamingRABs.IfuserhasatleastoneactiveRB,
theinactiveRBsMAC-dflowsarenotreleasedimmediatelyafterinactivityindication(low
utilization)fromL2.Followingrulesareapplied:

StreamingRABsaremappedtoDCH0/0whentheybecomeinactive.

OtherRABsoftheUEaremappedtoDCH0/0whenpreventiveoverloadcontrol
actionsaredoneorRT-over-NRTisdone.

IftheUEhasactiveandinactiveRABsinchanneltypeswitchawayfromHSPA,the
inactiveRABsaremappedtoDCH0/0.IftheUEdoesnothaveactiveRAB,thechannel
typeswitchisnotexecutedexceptwhenthechannel-typeswitchisstartedbecauseof
HSPAcapabilitybasedHO.WheneventtriggeredHSPAcapabilitybasedHOisstarted,
thechanneltypeswitchisdonefromHSPAtoHSDPA,andCPCisdeactivated.

Issue:06H

DN0638161

R: 209/396

209

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

RABinactivityhandlingforPSservices

WCDMARANRRMHSDPA

Inactiveuserhandling
WhentheUE-specificpacketschedulerreceivesHSPAMAC-dflowlowutilization
indicationtothelastPSRAB(lowutilizationreceivedforotherPSRBsearlier),itchecks
iftheextrainactivitytimerissetfortheuser.Decisionwhichparameterisreadis
describedinthefollowingfigure.
Figure 64

SettingoftimertoextendthetimeofinactiveuserinCell_DCHstate

Iftheselectedparametervalueiszero,theUE-specificpacketschedulerstartsthestate
transitiontoCell_FACHfortheUE.Iftheparametervalueisbiggerthanzero,theUEspecificpacketschedulersetsextrainactivitytimertothatvalueandstartsthetimer.
Followingfiguredescribestherelationshipofthesetimersandtimersrelatedtoinactivity
indicationsentfromL2.

210

DN0638161

R: 210/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Figure 65

RABinactivityhandlingforPSservices

RelationshipoftheextendedtimeinCell_DCHstatetimerandinactivity
indications

IfanyPSRABoftheuserbecomesactiveornewPSRABisestablishedfortheUE
whenextrainactivitytimerisrunning,theUE-specificpacketschedulerreleasesthe
extrainactivitytimer.
WhentheRABallocatedforCSvoiceoverHSPAisreleased,UE-specificpacket
schedulercheckswhetherithasreceivedHSPAMAC-dflowlowutilizationindicationfor
allotherPSRBs(sotheseareonHSPA).Ifithasreceived,thenitsetsextrainactivity
timer.
Whenextrainactivitytimerexpires,theUE-specificpacketschedulerreleasesallPS
MAC-dflowsfromtheUEandstatetransitionawayfromCell_DCHisdone(Notethat
statetransitioncanbedelayedbecauseofactivityinSRB).

HandlingofInactiveRBsandusersinthecaseofcongestion
Cell-specificpacketschedulerhandlesinactiveusersdifferentlyinthefollowing
congestioncases:

Issue:06H

MaximumnumberofHSDPAMAC-dflows

MaximumnumberofHSDPAusers

MaximumnumberofE-DCHallocationsinthecell

MaximumnumberofE-DCHallocationsintheBTSlocalcellgroup

MaximumnumberofE-DCHallocationsintheBTS

BTSHWcongestionindicationwithHSUPAresourcestatusIEornegative
acknowledgementmessagewithcausevalueUL radio resources not available

DN0638161

R: 211/396

211

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

RABinactivityhandlingforPSservices

WCDMARANRRMHSDPA

Transportresources

F-DPCHslotformatcongestion(celllevel)

Congestionishandledwith:

preventiveoverloadcontrol(seebelow)(exceptF-DPCHslotformatcongestion)

RT-over-NRT(seeSectionRT-over-RTandRT-over-NRT)

10.4 Preventiveoverloadcontrol
Theaimofpreventiveoverloadcontrolistoreleaseinactiveusersbeforetheoverloadis
faced.

PreventiveoverloadcontrolbecauseofMAC-dflowamount
Everytimeanewallocationisperformedorinactivityforauserisdetected,thecellspecificpacketschedulerchecksifpreventiveoverloadcontrolisneededtobedone.
Thepreventiveoverloadcontrolisstartediffollowingequationistrue:
Figure 66

PreventiveoverloadcontrolformaximumnumberofHSDPAMAC-dflows

NumberOfMACdFlowsisthecurrentnumberofHSDPAMAC-dflowsinthecell
(includingnewuser).
MaxNumberOfMACdFlowsisthemaximumnumberofHSDPAMAC-dflowsinthecell.
InacUsersOverloadFactisthevalueofidenticallynamedparameter.
Inthepreventiveoverloadcontrolcell-specificpacketschedulerreleasesthenumberof
inactiveMAC-dflows(mapsRABtoDCH0/0ifuserhaveanyotherRABwhichisnot
mappedtoDCH0/0)thatisexceedingthethreshold.InactiveMAC-dflowscanbe
selectedsothatinactiveuser(allMAC-dflowsoftheuser)isselectedorinactiveMAC-d
flowsfromactiveuserisselected.Firsttheselectionisdoneforinactiveusers.Ifthe
neededamountofresourcescannotbereleasedfrominactiveusers,nexttheinactive
MAC-dflowsaretargeted.TheselectiongoesbasedonSPI.MAC-dflowswithlowest
SPIareselected.AlsoinsideoneuserselectionofinactiveMAC-dflowsgoesbasedon
SPI.InactiveMAC-dflow(s)isreleasedafterthenewMAC-dflow(s)hasbeen
successfullysetup.

PreventiveoverloadcontrolbecauseofHSDPAuseramount
Everytimeanewallocationisperformedorinactivityforauserisdetected,acellspecificpacketschedulercheckswhetherapreventiveoverloadcontrolisnecessary.
Thepreventiveoverloadcontrolisstartedifthefollowingequationistrue:
Figure 67

212

PreventiveoverloadcontrolformaximumnumberofHSDPAusers

DN0638161

R: 212/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

RABinactivityhandlingforPSservices

NumberOfUsersisthecurrentnumberofHSDPAusersinthecell(includingnewuser).
MaxNumberOfUsersisthemaximumnumberofHSDPAusersinthecell(setbyaRNP
parameterorusedcapacityfeature).
InacUsersOverloadFactisthevalueofidenticallynamedparameter.
Inthepreventiveoverloadcontrolcell-specificpacketschedulerreleasesallMAC-dflows
ofoneinactiveuser.InactiveuserisreleasedafterthenewuserMAC-dflowshasbeen
successfullysetup.TheinactiveuserisselectedasdescribedinInactiveusersselection
algorithmchapter.
ThepreventiveoverloadcontrolfunctionalitytoreleaseinactiveHSDPAusersisapplied
totheMaxNumbHSDPAUsersSandMaxNumbHSDSCHMACdFSRNWparameterssimilarly
asitisdefinedinthePreventiveoverloadcontrolbecauseofMAC-dflowamountand
PreventiveoverloadcontrolbecauseofHSDPAuseramountfor
MaxNumberHSDPAUsersandMaxNumberHSDSCHMACdFlowsRNWparameters
correspondingly.IftheDCHSDPAuseristobereleased,itisreleasedfromboththe
primaryandsecondarycellsimultaneously.

Preventiveoverloadcontrolbecauseoftransportresources
Everytimewhennewallocationisperformed,transportreports:

transportidentifier(fornewallocation),

transportidentifierFRatiomask,

statusfield.

ThestatusfieldindicatesthatCACfillingratiohasbeenexceeded.Insuchcase,
preventiveoverloadcontrolactionsarestarted.
WhentransporthasreportedinstatusfieldthatCACfillingratioisexceeded,thecellspecificpacketschedulerchecksifthereareinactiveusersundertheBTS.Ifthereare
inactiveusers,thecell-specificpacketschedulercheckswhichuser-releasecan
help.FromtransportidentifierFRatiomaskcell-specificpacketschedulerfindsoutwhich
SRBsandRBsreleasehelpstodecreaseCACfillingratio.
Firsttheselectiononuserlevelisperformed.UserswhosetransportidentifierforSRB
matchesthetransportidentifierFRatiomaskareselected.Thenthe
selection/prioritizationofusersisperformedasdescribedinInactiveusersselection
algorithm.
Capacityrequiredforreleasedependsonhowmuchcapacityhasbeenrequestedfrom
thetransport.Sameamountofthecapacityisreleased.Thecapacityiscalculatedbased
onrequestedRRMallocatedbitrate(GBR)andactivityfactorreturnedfromthe
transport.ThiscalculationisthesameasalreadyperformedforRT-over-NRT.Notethat
allotherMAC-dflowsexceptPSNRTRBonHS-DSCHhavecapacityreservedinthe
transport.(NBRMAC-dflowshavenoreservationinthetransport).Thismeansthat,
whenreleasinguserwithPSNRTRBallocatedinHSPA,SRBreleaseonlyfreesthe
capacity(transportallocatedbitrateofSRBdefineshowmuchcapacitybecomesfree).

Issue:06H

DN0638161

R: 213/396

213

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

RABinactivityhandlingforPSservices

WCDMARANRRMHSDPA

PreventiveoverloadcontrolbecauseofCIDamount
Everytimewhennewallocationisperformed,transportreports:

transportidentifier(fornewallocation),

transportidentifierFRatiomask,

statusfield.

ThestatusfieldindicatesthatCIDfillingratiohasbeenexceeded.Insuchcase,
preventiveoverloadcontrolactionsarestarted.
WhentransporthasreportedinstatusfieldthatCIDfillingratioisexceeded,thecellspecificpacketschedulerchecksifthereareinactiveusersundertheBTS.Ifthereare
inactiveusers,thecell-specificpacketschedulercheckswhichuser-releasecan
help.FromtransportidentifierFRatiomaskcell-specificpacketschedulerfindsoutwhich
SRBsandRBsreleasehelpstodecreaseCIDfillingratio.
Firsttheselectiononuserlevelisperformed.UserswhosetransportidentifierforSRB
matchesthetransportidentifierFRatiomaskareselected.Thenthe
selection/prioritizationofusersisperformedasdescribedinInactiveusersselection
algorithm.
Ifneedednumberofresourcescannotbereleasedfrominactiveusers,nexttheinactive
MAC-dflowsaretargeted.TheselectionisperformedbasedonSPI.MAC-dflowswith
lowestSPIareselected.
Capacityrequiredforreleasedependsonhowmuchcapacityisneededfornew
connection.Sameamountofcapacityisreleased.Thecalculationmethodisdescribedin
CIDsrunoutcongestion.

PreventiveoverloadcontrolbecauseofthemaximumHSDPAuser
numbers
PreventiveoverloadactionsinitiatedbytheHSDPAuserorHS-DSCHMAC-dflow
amountsareperformedagainstmaximumHSDPAusernumbersreturnedbytheBTS.It
isperformedinthefollowingcases:

#all_HSDPA_users_in_cellInacUsersOverloadFact*
Max_HSDPA_users_per_cell_BTS,

#all_HSDPA_users_in_schedulerInacUsersOverloadFact*
Max_HSDPA_users_per_cell_group_BTS,

#all_MACds_in_cellInacUsersOverloadFact*Max_MACds_per_cell_BTS,

#all_MACds_in_schedulerInacUsersOverloadFact*
Max_MACds_per_cell_group_BTS,

#all_HSDPA_users_in_LCG>=InacUsersOverloadFact*
Max_HSDPA_users_per_LCG_BTS,

#all_HSDPA_users_in_BTS>=InacUsersOverloadFact*
Max_HSDPA_users_per_BTS_BTS.

WherethefollowingvaluesarereturnedbytheBTS:

214

DN0638161

R: 214/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

RABinactivityhandlingforPSservices

Max_HSDPA_users_per_cell_BTS,

Max_HSDPA_users_per_cell_group_BTS,

Max_MACds_per_cell_BTS,

Max_MACds_per_cell_group_BTS,

Max_HSDPA_users_per_LCG_BTS,

Max_HSDPA_users_per_BTS_BTS.

Theselectionofthecandidatesforthepreventiveoverloadcontrolisperformedas
describedinInactiveusersselectionalgorithm.
ThepreventiveoverloadcontrolforBTSlimitreasonsisnotinitiatediftheBTSdoesnot
sendtheHSDPAusernumberlimits.
TheLCGandBTS-specificHSDPAcheckscanbeactivated/deactivatedbythespecific
PRFILE002:2107 RU40_MAINT_11parameterandareactivebydefault(thevalueis
0).Todeactivate,settheparametervalueto1.Formoreinformationonthemaximum
numberofHSDPAusers,seetheMaximumnumberofHSDPAuserschapter.

10.5 Inactiveusersselectionalgorithm
Thefollowingselectionalgorithmisusedforselectionofinactiveusertobetargetedfor
pre-emption,RT-over-NRTorpreventiveoverloadcontrol.
Thecell-specificpacketschedulerkeepsUEcurrentinactivitystatus(active/inactive)
updated.Thecell-specificpacketschedulerstartstocalculatethenumberofinactivity
occasionsfrom

zerowhen

firstPSRABisestablishedfortheUEundertheBTS.

UEdoesintraBTShardHO.

UEcomestotheBTSwithinterBTSHOandUEisknowntobeactiveorthe
inactivity/activitystatusoftheUEisnotknown(inthiscaseitisassumedtobe
active).

onewhenUEcomestothecellwithinterBTSHOandUEisknowntobeinactive.

EverytimewheninactivityindicationisreceivedforonePSRABoftheUE,thecellspecificpacketschedulercheckswhetheranyPSRABisactivefortheUE.Ifthereare
noactivePSRABsfortheUE,thenumberofinactiveoccasionsisincreasedbyone.
OnlytheUEthathasthecurrentinactivitystatusasinactivecanbeselectedhere.The
cell-specificpacketschedulercalculatesAverageInactivityOccasionPeriod(AIOP)for
allinactiveUEsinthecell/BTSwithfollowingformula.However,forUEsthathavecome
totheBTSwithinter-BTSHOandhavebeenundertheBTSlessthan30seconds,AIOP
isassumedtobebiggerthan30seconds.

Issue:06H

DN0638161

R: 215/396

215

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

RABinactivityhandlingforPSservices

Figure 68

WCDMARANRRMHSDPA

AverageInactivityOccasionPeriod

Where:
tCell_DCHisthetimethatUEhasbeenundertheBTSduringthecurrentstayinCell_DCH
statewithHSPAchannelsallocatedcontinuously.
ninactivityisthenumberofinactivityoccasionsundertheBTSduringthecurrentstayin
Cell_DCHstate.
Intheintra-BTShardHandovers tCell_DCHand ninactivityarezeroed.Thecell-specific
packetschedulerselectstheUEsbasedonprinciplesshowninthefollowingpicture.
Figure 69

InactiveusersmovedfromCell_DCHstate

10.6 HS-DSCHinactivitycontroloftheidentifiedLegacy
Fastdormancysmartphone
HS-DSCHinactivitycontrolofidentifiedLegacyFastdormancysmartphonesisbasedon
theRAN2451: Fast Dormancy Profilingfeature.InthischapterLegacyFastdormancy
smartphonecorrespondstoRel5UE(excludingRel5-iPhone),whichgoestoIdlestate
aftersendingSCRImessagewithoutcauseIEandagainmakeRRCconnectionwithin
90secondsaftergoingtoIdlestate.Formoreinformation,seeWCDMA RAN RRM
Packet Scheduler.
HS-DSCHInactivity:

216

DN0638161

R: 216/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

RABinactivityhandlingforPSservices

HS-DSCHinactivity(HS-DSCHlowutilization)isdetectedbyRLC/MAC-dbasedonthe
downlinkthroughputandthenumberofPDUsintheRLCtransmissionwindowsas
describedinchapterMonitoringtheutilizationandthroughputofHS-DSCH.
IncaseoftheidentifiedLegacyFastdormancysmartphone,the
SmartHSPATputAveWinparameterdefinestheslidingaveragingwindowforthe
throughputmeasurementoftheHS-DSCHMAC-dflowinsteadofthe
MACdflowthroughputAveWinparameter.Thespecialvalue0meansthatLegacyFast
dormancysmartphone-specificthroughputmeasurementisnotactive.Inthiscase,
legacythroughputmeasurementsandparametersareusedalsofortheidentifiedLegacy
Fastdormancysmartphone.
IncaseoftheidentifiedLegacyFastdormancysmartphone,the
SmartHSPATimeToTriggerparameterdefinesthelowutilizationtime-to-triggerforthe
throughputmeasurementoftheMAC-dflowinsteadofthe
MACdflowutilTimetoTriggerparameter.
Otherwise,theHS-DSCHinactivitycontrolincaseoftheidentifiedLegacyFast
dormancysmartphonefollowstheprinciplesdescribedinthechapterMonitoringthe
utilizationandthroughputofHS-DSCH.

Issue:06H

DN0638161

R: 217/396

217

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

ULDCHreturnchannel

WCDMARANRRMHSDPA

11 ULDCHreturnchannel

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
Thisschedulingfeatureprovidesdynamicdatarateselectiontotheuplinkreturnchannel
forefficientusageofradioandIub-transportresources.
Figure 70

PSdataupto384kbit/sinuplinkandHSDPAindownlink

WhentheradiobearerismappedontoHS-DSCHtransportchannelindownlink,either
E-DCHorDCHisallocatedinuplinkasareturnchannel.Thischapterdescribesthe
usageoftheULDCHreturnchannel.E-DCHisdescribedintheWCDMA RAN RRM
HSUPA.
SupporteddataratesforULDCHreturnchannelare16,64,128and384kbit/s,except
whenanUEhasPSstreamingRBanditismappedtoHS-DSCH.Inthatcaseonly16,
64,or128kbit/sareusedfortheUEinquestion.
TheRNCdeterminestheinitialbitratetobeusedintheuplinkreturnchannelfromthe
measuredtrafficvolumeandtheconfiguredinitialbitrate.
Thecell-specificadmissioncontrolreadsthevalueoftheHSDPAinitialBitrateUL
parameterfromtheWACobjectidentifiedwiththeWACSetIdentifiermanagement
parameter.Thedecisionsofthecell-specificadmissioncontrolentityisbasedonthecellspecificparametersasincaseoftheDCH/DCHconfiguration.
TheparameterHSDPAMaxBitrateULdefinesthemaximumallowedbitrateinacellfor
HSDPAULDCHreturnchannel.ItisapplicabletothePSdomainNRTRAB.Online
modificationoftheHSDPAMaxBitrateULparameterisallowed.Thenewvalueistaken
intoaccountwhenULDCHreturnchannelisschedulednexttime.Changingthevalueof
theparameterdoesnotcausedowngradeofthebitrate.Thevalueofthe
HSDPAMaxBitrateUL(WAC)parameterisreadfromtheWACobjectidentifiedwiththe
WACSetIdentifiermanagementparameter.

218

DN0638161

R: 218/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

ULDCHreturnchannel

TheRNCdefinesthemaximum,initialandminimumbitrateoftheULDCHreturn
channel.IfthevalueoftheHSDPAMaxBitrateULparameterislowerthantheinitialbit
rate(HSDPAinitialBitrateUL,HSDPAInitialBRULStrNRT),thevalueofthe
HSDPAMaxBitrateULparameterisusedasaninitialbitrateforthisparticularcell.The
valueoftheHSDPAMaxBitrateULparametermustbehigherthanorequaltotheinitial
bitrate(HSDPAinitialBitrateUL,HSDPAInitialBRULStrNRT)andtheminimum
bitrate(HSDPAminAllowedBitrateUL,HSDPAMinBRULStrNRT).
HSDPAMaxBitrateULdoesnotlimitthebitrateinthetargetcellofdiversityhandover.
ThevalueoftheHSDPAinitialBitrateUL,HSDPAInitialBRULStrNRT,
HSDPAminAllowedBitrateUL,HSDPAMinBRULStrNRTparametersisreadfromthe
WACobjectidentifiedwiththeWACSetIdentifiermanagementparameter.
Duringbranchaddition,theallocationoftheexistingbitratesisattempted.Incaseofa
newcallandwhentheactivesetoftheRRCconnectionisbiggerthan1,thenthelowest
valueamongtheSRNCcellsoftheactivesetisused(VCELparametersarenotusedin
non-anchoringcase)fortheparameters:HSDPAInitialBRULStrNRT,
HSDPAMinBRULStrNRT,HSDPAinitialBitrateUL,HSDPAminallowedBitrateUL,
andHSDPAMaxBitrateUL.Thevaluesoftheseparametersarenotreconfiguredor
changedbecauseoftheactivesetupdates.
TheHSDPAULDCHreturnchannelwithAMRcanbelimitedto64kbpsbythePRFILE
(007:0285)parameter.ThePRFILEparametervaluedoesnotlimittheHSDPAULDCH
returnchannelto64kbpsbydefault.
Featureactivation:
UseZWOC:7,285,1;command.Within10minutesthefeatureisactivatedinthewhole
system.TheULDCHbitrateislimitedto64kbps.
Featuredeactivation:
UseZWOC:7,285,0;command.Within10minutesthefeatureisdeactivatedinthe
wholesystem.TheULDCHbitrateisnotlimitedto64kbps.
Tointerrogatetheactivationstatus,useZWOI:7,285command.
TheDCHbitratebalancingisappliedtotheHSDPAULDCHreturnchannels.Ifthe
extensionofHSPAoverIurissupportedintheanchoringRNC,thenduringthe
anchoringaDCHbitratebalancingisappliedtoHSDPAULDCHreturnchannelsover
Iur.Themaximumsupportedtotalbitrateoftheradiolink(inadditiontoAMRandSRB)
is384kbps.IncaseofmultiplePSRABs,thetotalbitrateoftheradiolinkisbalanced
betweenradiobearersinordertoguaranteetheDCHbitrateinalltheestablishedNRT
PSRABs.FormoreinformationontheDCHbitratebalancing,seeWCDMA RAN RRM
Packet Scheduler.
IfthetrafficvolumemeasurementindicatesHightrafficvolume,theRNCattemptsto
allocateareturnchannelwiththehighestpossiblebitrate.

TheoperatorcanconfigurethethresholdvalueofHightrafficvolumewiththe
TrafVolThresholdULHighparameter.

IfthetrafficvolumemeasurementindicatesLowtrafficvolume,theRNCattemptsto
allocateareturnchannelwiththeconfiguredinitialbitrate.

Issue:06H

DN0638161

R: 219/396

219

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

ULDCHreturnchannel

WCDMARANRRMHSDPA

TheoperatorcanconfigurethethresholdvalueofLowtrafficvolumewiththe
TrafVolThresholdULLowparameter.

Furthermore,theoperatorcansettheinitialbitratewitheitherthe
HSDPAInitialBitrateULparameter(ifonlyNRTPSservicesareusedonthe
downlink(DL))ortheHSDPAInitialBRULStrNRTparameter(ifPSstreamingis
simultaneouslyappliedtotheDL).

IftheHS-DSCHallocationistriggeredbydownlink,theRNCattemptstoallocatethe
uplinkwitharatespecifiedbytheHSDPAInitialBitrateUL(PSNRTinDL)or
HSDPAInitialBRULStrNRT(simultaneousPSstreaminginDL)parameter.
InthecaseofdirectDCHtoHS-DSCHswitchforasingleNRTRB,HSDPAULDCHbit
ratecanbesameasexistingDCHULbitrate.Incongestionsituation,theUE-specific
PacketSchedulercanreattemptwiththeDCHbitratedecreasedtotheminimum,as
definedinWCDMA RAN RRM Packet Scheduler.However,thebitratemustbesuitable
forHSDPAULDCH(mustbeallowedforHSDPAULDCHuse,andmustbethesameor
biggerthantheinitialHSDPAULDCHbitrate).Iftheseconditionsarenotfulfilled,then
theULbitrateisdowngraded/upgradedtothenearestallowedHSDPAULbitrate.In
caseofmultiRBs,theinitialbitratesareusedforallRBs.
IfschedulingoftheHSDPAassociatedULDCH(returnchannel)isunsuccessful,thatis,
noteveninitialbitratecannotbeallocated,HS-DSCHallocationisnotpossibleeither,
butDL/ULDCHisscheduledtotheUE.
ThefollowingexistingfunctionalitiesareappliedtotheHSDPA-associatedULDCH:

Prioritybasedschedulingandoverloadcontrol

DecreaseoftheretriedNRTDCHbitrate

RT-over-NRT

Throughput-basedoptimization

UpgradeoftheNRTDCHbitrate

TheULDCHusedforPSstreamingcanhowevernotbeatargetforthementionedNRT
actions,butoverloadcontrolcandropULDCHforPSstreaming,aswell.Inthiscase,
thebitrateoftheULDCHreturnchannelmustnotbelessthantheguaranteedbitrate
(GBR).IfPSstreamingUListargetforoverloadcontrolactions,theseactionsimply
releasingtheDCH.This,inturn,leadstothereleaseoftheHS-DSCHMAC-dflow.
IncaseofNRTHSDPAcongestion(HS-DSCHMAC-dflow),theRNCdoesnotinitiate
thePriorityBasedSchedulingfunctioniftheDL radio resources not available
failurecauseisreceivedfromtheBTS.
SpecialhandlingoftheDL radio resources not availablefailurecauseincase
ofNRTHSDPAcongestion(HS-DSCHMAC-dflow)ishandledinthefollowingway:

220

TheRNCconsidersthefailurecausedbytheBTSHSDPAscheduler(MAC-e/hs
entity)congestion(themaximumnumberofHSDPAusershasbeenexceeded).

TheRNCtriestoallocateDLDCHinsteadofHS-DSCHincaseofNRTrequest.

DN0638161

R: 220/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

ULDCHreturnchannel

TheRNCdoesnotinitiatetheDecreaseofthere-triedDCHbitrateorthePriority
BasedSchedulingfunctionforULDCH.

TheRNCassumesthatonlytheBTSHSDPAscheduleriscongested(maximum
numberofHSDPAusers).IncaseofanyothersupportedNBAPfailurecause,the
RNCassumesthattheULDCH(CEblocking)iscongested.

DuringBTScongestion,NRT-over-NRTULtargetsareselectedfromthesameHSPA
poolasthetriggerer.Atfirst,theDCH/HS-DSCHusersareselected,andthenDCH/DCH
users.
TheoperatorcandecidewhetherornotthefeaturesThroughput-based optimisationand
Flexible upgrade of NRT DCH Data RateareappliedtoHSDPAreturnchannelwith
DynUsageHSDPAReturnChannelmanagementparameter.
TheRNCcontrolsthebitrateofasuccessfullyallocateduplinkreturnchannelaccording
tothetrafficvolumemeasurements(upgrade)andtheload/congestionstateofthecell
(downgrade).Therangeofdynamicadjustmentislimitedbythemaximumbitrateonthe
associatedreturnchannel(384kbit/s)andtheconfiguredminimumallowedbitrate.
TheRAN2879: Mass Event HandlerfeaturemightlimittheULDCHbitrateduringthe
highloadstateifthecell-specificPSsetsthetemporarymaximumbitrate(TMBR)forUL
DCH.TMBRissettotheminimumbitrateofthecell,whichisdefinedbythe
HSDPAminAllowedBitrateUL/HSDPAMinBRULStrNRTparametersfortheHSDPA
ULDCHreturnchannel.Formoredetailsaboutthedetectionoftheloadstateand
TMBR,seeWCDMA RAN Packet Scheduler.

Issue:06H

Theoperatorcanconfigurethemaximumallowedbitratewiththe
HSDPAMaxBitrateULparameter.

Theoperatorcanconfiguretheminimumallowedbitratewiththe
HSDPAminAllowedBitrateULparameter.

TheoperatorcanconfiguretheminimumallowedULbitrateforapossible
simultaneousNRTRBwhenPSstreamingisused.TheULbitrateforthepossible
simultaneousNRTRBisspecifiedwiththeHSDPAMinBRULStrNRTparameter.
FortheparticularULDCHassociatedtotheDLPSstreamingRABitself,minimum
allowedbitratedoesnotexistbecausetheselectedusedbitrateisalwaysbasedon
theguaranteedbitrate(GBR).

ThebitrateswhichcanbeusedforNRTULDCHwhenasimultaneousPS
streamingRABexistarecontrolledwithanRNC-internalRNPparameter.
WhenthesimultaneousstreamingRABisestablishedandiftheNRTbitratedoes
notmatchthevaluesallowedbytheRNC-internalRNPparameter,theNRTbitrate
willhoweverbedowngradedtothenearestsupportedbitrate.Iftheallowedbitrate
isstillnotachievedbythisaction,theNRTRBwillbemappedtoDCH0/0.
FortheparticularULDCHassociatedtotheDLPSstreamingRABitself,initialbit
rateisnotspecifiedbecausetheselectedusedbitrateisalwaysbasedonthe
guaranteedbitrate(GBR).

Thebitratesetthathasbeenconfiguredwithmanagementparameter
BitRateSetPSNRTdoesnotlimitbitrateofHSDPAassociateduplinkreturn
channel.

DN0638161

R: 221/396

221

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

ULDCHreturnchannel

WCDMARANRRMHSDPA

TheBTSHSUPAHWcongestionalgorithmmightadditionallylimittheULDCHbitrateat
LCGlevel.Dependingonthealgorithmstatus,thebitratecanbelimitedto:

Initialbitrate,whichisdefinedwith
HSDPAinitialBitrateUL/HSDPAMinBRULStrNRTparameters.

Minimumbitrate,whichisdefinedwith
HSDPAminAllowedBitrateUL/HSDPAMinBRULStrNRTparameters.

FormoreinformationonBTSHSUPAHWcongestionalrogytmfunctionality,see
WCDMA RAN RRM Packet Scheduler.

Exampleusecase:NRTHSDPAULDCHwithinitialbitrate64kbit/s
Theinitialbitrate(HSDPAInitialBitrateUl)issetto64kbit/s.Theminimumbitrate
issetto16kbit/s(HSDPAminAllowedBitrateUL).
Figure 71

222

HSDPAULDCHwithinitialbitrate64kbit/s

t1:

UEsendsanuplinkcapacityrequest(lowtrafficvolumethreshold).
HS-DSCHisallocatedasadownlinktransportchannel.Initialbitrate
(64kbit/s)isallocatedasanuplinkDCHreturnchannelbitrate.

t2:

UEsendsanuplinkcapacityrequest(hightrafficvolumethreshold).
UpgradeoftheULDCHisrequested.Duetocongestion(AAL2,BTS,
HW)allocationofthemaximumbitrate(384kbit/s)isnotpossible.
AllocationoftheULDCHisreattemptedwithlowerbitrate(128
kbit/s).

DN0638161

R: 222/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Issue:06H

ULDCHreturnchannel

t3:

DuetocongestioninthecellthebitrateoftheULreturnchannelis
downgraded.ReasonforthedowngradeintheexampleiseitherRTover-NRTorPrioritybasedscheduling.Downgradefrom128kbit/sto
64kbit/sisperformed.

t4:

DuetocontinuouscongestioninthecellthebitrateoftheULreturn
channelisdowngradedagain.Downgradefrom64kbit/sto16kbit/sis
performed.Ifthedowngradeisstillrequired,ULDCHisreleased,
becauselowerbitrateisnotallowed.

t5:

UEsendsanuplinkcapacityrequest(hightrafficvolumethreshold).
UpgradeoftheULDCHisrequested.ULDCH384kbit/sisallocated.

DN0638161

R: 223/396

223

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

WCDMARANRRMHSDPA

12 HSDPAphysicalchannel,transportchannel,
radiobearer,andRLCconfiguration

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
WhentheHS-DSCHchanneltypeisselected,thepacketschedulerderivestheradio
bearer,transportchannel,andphysicalchannelparametersneededfortheHS-DSCH.
NewHSDPA-relatedparameterssignaledfromtheRNCtotheBTSinradiolinksetupor
reconfigurationproceduresaresummarizedintableTable15:HS-DSCHrelated
parameterssignaledfromtheRNCtotheBTSinNBAP(reference1).WhentheBTSis
havingtheservingHS-DSCHRLundertheDRNCandthebit3ofPRFILE(002:1764
RN50_MAINT_47)parameterissettoON,theSRNCchecksthetargetDRNC.This
occursiftheInterfaceModeforgivenDRNCisconfiguredasMode2andtheCQI
poweroffset,ACKpoweroffset,andNACKpoweroffsetparametersarenotreconfigured
totheDRNCinRLReconfigurationprocedure.Normalreconfigurationprocedureisused
tosignaltheseparameterstotheUE.Otherwise,alegacyhandlingisfollowed.
NewHSDPA-relatedparameterssignaledfromtheRNCtotheUEinRadio
Bearer/TransportChannel/PhysicalChannelreconfigurationproceduresaresummarized
intableTable16:HS-DSCHrelatedparameterssignaledfromtheRNCtotheUEin
RRC(reference2).TheRLCconfigurationisalsoHSDPA-specificwhenaHS-DSCHis
selected.PartoftheRLCparametersisdeterminedinternallyintheRNCandpartof
themisoperatorcontrollable.

Table 15

HS-DSCHrelatedparameterssignaledfromtheRNCtotheBTSinNBAP
(reference1)

Parameter

Source

Description

HS-DSCH-RNTI

Determinedinternally

IdentifieroftheUEforHS-DSCHusage

MAC-dFlowID

Determinedinternally

IdentifieroftheHS-DSCHMAC-dflow.
MAC-dFlowId=0x7reservedforSRB.

Allocation/RetentionPriority

DeterminedinternallybasedonthesameprincipleasforDCH

SameparameterasforDCH

PriorityQueueID

Determinedinternally

Identifierofthepriorityqueue

SchedulingPriorityIndicator

UE-specificpacketscheduler

Identifiestherelativeprioritylevelfor
eachpriorityqueue

SPIforSRBisdeterminedbytheQoSPriorityMappingRNPparameter.

224

DN0638161

R: 224/396

Fordetails,seeHSDPAqualityofservice(QoS)management

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 15

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

HS-DSCHrelatedparameterssignaledfromtheRNCtotheBTSinNBAP
(reference1)(Cont.)

Parameter

Source

Description

T1

The120msvalueisusedwhenMIMOisnot
UEtimer.TheBTSusesittostopthe
usedfortheUE.The100msvalueisusedwhen retransmission
MIMOorDC-HSDPAisusedfortheUE.The50
msvalueisusedwhenDCHSDPAwithMIMOis
usedsimultaneouslyfortheUE.

DiscardTimer

UE-specificpacketscheduleraccordingtospecificRNPparameters.

IndicatesthelifespanforaHS-DSCH
MAC-dPDUstartingfromthetimeinstantofitsarrivalintheBTSbuffer.
UsedincaseofPSstreamingandCS
voice.

GBR

RANAP(RTservices)
SetinternallyNBR(PSNRT)

Indicatestheguaranteednumberof
bitspersecondthattheBTSshoulddeliverovertheairinterfaceundernormal
operatingconditions.
SetforCSserviceaccordingtothe
highestAMRmodebitrateofthecodec
isset.Predefinedbitrateissetfor
SRBs.

MAC-hsWindowSize

IftheHS-DSCHphysicallayercategory1to12
issignaledtotheBTS,theMAC-hs/ehswindow
sizefortheBTSisdefinedasfollows:

Definesthetransmittingwindowsizein
numberofMAC-hsPDUs
UsedalsoincaseofMAC-ehs.

HS-DSCHcategory(left):
MAC-hsWindowSize(right):
1.4
2.4
3.8
4.8
5.16
6.16
7.16
8.16
9.16
10..16
11..8

Issue:06H

DN0638161

R: 225/396

225

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

Table 15

WCDMARANRRMHSDPA

HS-DSCHrelatedparameterssignaledfromtheRNCtotheBTSinNBAP
(reference1)(Cont.)

Parameter

Source

Description

12..16
IftheHS-DSCHphysicallayercategory13or
greaterissignaledtotheBTS,theMAC-hs/ehs
windowsizefortheBTSisdefinedasfollows:
MAC-hsWindowSize(right):
HSDPAactivated................16
64QAMactivated................16
MIMOactivated..................24
DCHSDPAactivated.............24
MIMOand64QAMactivated.24
DCHSDPA,MIMOand64QAMactivated...................................24
SID

Determinedinternally

Identifierofsizeindex.EachSIDcorrespondtooneMAC-dPDUsize

HS-DSCHMAC-dPDUSize
Format

Derived

Ifnotpresent,indexedMAC-dPDU
sizeforexampleMAC-dPDUsizeis
used.

MAC-dPDUSize

336or656,144forSRBs

ThesizeinbitsofHS-DSCHMAC-d
PDUcorrespondstoeachSID
PSstreamingalwaysusesMAC-d
PDUsofsize'336'

MaximumMAC-dPDUsize
Extended

Settodefaultvalue(5568bits)oftheRLCinternalparameter.

MaximumsizeofMAC-dPDUsize

RLCMode

AMorUM

RLCmodeoftheRButilizingthepriorityqueue

HS-DSCHPhysicalLayer
Category

ReceivedinRRC:RRCconnectionsetupcomplete,doesnotknownduringRRCsetup.

IndicatestheUEsHSDPA-relatedcapability.TheRNCrelaysthisIEfrom
theUE(inradioaccesscapability)to
theBTS
HS-DSCHcategory11usedduring
RRCconnectionsetupphase.

226

DN0638161

R: 226/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 15

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

HS-DSCHrelatedparameterssignaledfromtheRNCtotheBTSinNBAP
(reference1)(Cont.)

Parameter

Source

Description

MAC-hsReorderingBuffer
SizeforRLC-UM

Notused

Indicatestheportionofthebufferinthe
UEthatcanbeusedforMAC-hs
queuesUM-RLCtraffic

CQIFeedbackCycle

Non-SHO:4ms

DefinesthedurationoftheCQIfeedbackcycleinms

SHO:4ms
ContinuousPacketConnectivityactivatedtoUE
thisisdefinedwithoperator-configurablemanagementparameter.
The4msvalueisthelowestallowedvalueifDC
HSDPAwithMIMOisactivatedintheUE.
ForinformationonincreasedCQIfeedbackcycle,seeIncreasedCQIfeedbackcyclechapter.
CQIRepetitionFactor

Non-SHO:1

DefinesthenumberofconsecutiverepetitionsoftheCQIfromtheUE

SHO:1
ACK-NACKRepetitionFactor

CQIPowerOffset

Non-SHO:1
SHO:1

DefinesthenumberofconsecutiverepetitionsoftheACKandNACKfeedbackfromtheUE

Symbolrate(left)

TherelativepoweroffsetofCQI

Amplituderatio(right)
Non-SHO:
15ks/s.................15/15
30ks/s.................15/15
60ks/s.................15/15
120ks/s...............15/15
240ks/s...............12/15
480ks/s...............12/15
960ks/s......9/15
E-DPCH12/15
MIMO..................12/15
SHO:

Issue:06H

DN0638161

R: 227/396

227

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

Table 15

WCDMARANRRMHSDPA

HS-DSCHrelatedparameterssignaledfromtheRNCtotheBTSinNBAP
(reference1)(Cont.)

Parameter

Source

Description

15ks/s.................30/15
30ks/s.................30/15
60ks/s.................30/15
120ks/s...............30/15
240ks/s...............24/15
480ks/s...............24/15
960ks/s....19/15
E-DPCH24/15
MIMO..................24/15
MIMOvaluesarevalidwithorwithoutDCHSDPA.
ACKPowerOffset

Symbolrate(left)

TherelativepoweroffsetofACK

Amplituderatio(right)
Non-SHO:
15ks/s..................19/15
30ks/s..................19/15
60ks/s..................19/15
120ks/s...............19/15
240ks/s...............15/15
480ks/s...............15/15
960ks/s.....12/15
E-DPCH.15/15
MIMO...................15/15
SHO:
15ks/s..................30/15
30ks/s..................30/15
60ks/s..................30/15
120ks/s...............30/15

228

DN0638161

R: 228/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 15

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

HS-DSCHrelatedparameterssignaledfromtheRNCtotheBTSinNBAP
(reference1)(Cont.)

Parameter

Source

Description

240ks/s...............24/15
480ks/s...............24/15
960ks/s.....19/15
E-DPCH.24/15
MIMO...................24/15
MIMOvaluesarevalidwithorwithoutDCHSDPA.
NACKPowerOffset

Symbolrate(left)

TherelativepoweroffsetofNACK

Amplituderatio(right)
Non-SHO:
15ks/s..................19/15
30ks/s..................19/15
60ks/s..................19/15
120ks/s...............19/15
240ks/s...............15/15
480ks/s...............15/15
960ks/s.....12/15
E-DPCH.....15/15
MIMO...................15/15
SHO:
15ks/s..................30/15
30ks/s..................30/15
60ks/s..................30/15
120ks/s...............30/15
240ks/s...............24/15
480ks/s...............24/15
960ks/s.....19/15
E-DPCH.24/15

Issue:06H

DN0638161

R: 229/396

229

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

Table 15

WCDMARANRRMHSDPA

HS-DSCHrelatedparameterssignaledfromtheRNCtotheBTSinNBAP
(reference1)(Cont.)

Parameter

Source

Description

MIMO...................24/15
MIMOvaluesarevalidwithorwithoutDCHSDPA.
HS-SCCHPowerOffset

UsedtowardNB/RSxxx

IndicatesthepoweroffsetofHS-SCCH
relativetothepilotbitsontheDL
DPCCH
RNCsignalsthisNBAPinformationelementtotheNB/RSxxx.Thevaluefor
theinformationelementisreadfrom
thePtxOffsetHSSCCHRNPparameter.Theinformationelementissignaled
toHSDPAservingcell.
ThevalueofthePtxOffsetHSSCCH
RNPparameterisreadonlywhenthe
radiolinkissetup.Changingthevalue
oftheparameterdoesthereforenotaffectexistingradiolinks.

MeasurementPowerOffset

ActualvaluedependsonwhichBTStypeserves
thecell*)

IndicatesthemeasurementpoweroffsetbetweenHS-PDSCHandP-CPICH.
UsedalsoforDCHSDPAusers.

HS-PDSCHRLID

Determinedinternally

IndicatestheServingHS-DSCHRadio
Link.Informationelementisusedalso
forthesecondaryRL.

HARQPreamblemode

Notused

IndicatestheHARQpreamblemodeto
beused

UnidirectionalDCHIndicator

Notused

IndicatesuseofunidirectionalDCH

64QAMUsageAllowed

DerivedbyL3

RNCusesthisparametertoindicate
whetherfeatureHSDPA64QAMisallowedornotallowed.

64QAMDLusageIndicator

DerivedbyL3

BTSincludesthisparametertoindicate
thatfeatureHSDPA64QAMisused.

MACPDUSizeExtended

CalculatedbyUE-specificpacketscheduler

SizeinoctetsoftheMAClevelPDU.

230

DN0638161

R: 230/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 15

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

HS-DSCHrelatedparameterssignaledfromtheRNCtotheBTSinNBAP
(reference1)(Cont.)

Parameter

Source

Description

HS-SCCHCodeChange
Grant

DerivedbyL3

RNCenablesHS-SCCHcodechange
inBTSusingNBAPIEHS-SCCHCode
ChangeGranteverytimewhenreconfigurationisdonefromSCHSDPAto
DCHSDPAorviceversa.

*)ThemeasurementpoweroffsetsignaledtowardtheBTSviaNBAPmessagedepends
onwhichtypeofBTSservestherelevantcell,WBTSorNB/RSxxx.Thisinformationis
obtainedfromtheNBAPCommModeparameter:

NB/RSxxxisnotsupportedbyFlexiDirectRNCsolution.

CellisservedbyNB/RSxxx(notservedbyFlexiDirectRNCsolution)
TheRNCrecognizestheHSDPAMPOWCELparameterwhichdefinestheHSDPA
measurementpoweroffsetfortheNB/RSxxx.

IftheHSDPAMPOparameterissettoanyvaluedifferentfromthespecial value,
theRNCsetstheHSDPAmeasurementpoweroffsettothisparticularvalueand
signalsittotheNB/RSxxx.

Otherwise,iftheHSDPAMPOparameterissettothespecial value,theHSDPA
measurementpoweroffsetsignaledtotheNB/RSxxxiscalculatedinsimilar
fashionasisdoneforcellsservedbyaWBTS.

SpecialvaluereferstothespecialvaluefieldoftheHSDPAMPOparameter.

CellisservedbyWBTS(servedbyRNCandFlexiDirectRNCsolution).
Themeasurementpoweroffsetiscalculatedandroundedtosignalingvalues:
Where:

Poweroffset

PCPICH

CPICHPower

PtxallowedHSPA
AvailableHSDPApowerinthesetupphaseofHS-DSCHMAC-d
flow

Issue:06H

DN0638161

R: 231/396

231

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

WCDMARANRRMHSDPA

Ptx_allowed_HSDPAformeasurementpoweroffsetiscalculatedaccordingtothefollowing
formulas,dependingonwhethertheHSDPADynamicResourceAllocationfeatureis
disabled(equationFigure72:HSDPADynamicResourceAllocationfeatureisdisabled)
orenabled(equationFigure73:HSDPADynamicResourceAllocationfeatureis
enabled):
Figure 72

HSDPADynamicResourceAllocationfeatureisdisabled

Figure 73

HSDPADynamicResourceAllocationfeatureisenabled

,wherePmaxisthecellmaximumoutputpowerandPtx_non_HSPAisthelatestreceived
PtxNonHSPAmeasurement.ThePtxMaxHSDPAparameterdefinesthemaximum
allowedHSDPAtransmissionpower.IncasetheHSDPADynamicResourceAllocation
featureisenabled,GammaFactorisanRNC-internalparameterwhichhasanactual
valueof0.5.
Table 16

HS-DSCHrelatedparameterssignaledfromtheRNCtotheUEinRRC
(reference2)

Parameter

Source

Description

H-RNTI

Determinedinternally

IdentifiesaUEhavingaHS-PDSCH
assignmentwithinacell

MAC-dFlowIdentity

Determinedinternally

IdentifieroftheMAC-dflow
MAC-dFlowId=0x7reservedforSRB.

MAC-hsqueueId

Determinedinternally

IdentifieroftheMAC-hsqueue(priority
queueinNBAP)

T1

SeetableTable15:HS-DSCHrelatedparameterssignaledfrom
theRNCtotheBTSinNBAP
(reference1)

UEtimer(inmilliseconds)whenMAChsPDUsinre-orderingbufferarereleasedtotheupperlayerseventhough
thereareoutstandingPDUswithlower
TSNvalues

MAC-hsWindowSize

SeetableTable15:HS-DSCHre- Definesthereceivingwindowsizein
latedparameterssignaledfrom
numberofMAC-hsPDUs
theRNCtotheBTSinNBAP
(reference1)

232

DN0638161

R: 232/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 16

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

HS-DSCHrelatedparameterssignaledfromtheRNCtotheUEinRRC
(reference2)(Cont.)

Parameter

Source

Description

MAC-ehsWindowsize

SeetableTable15:HS-DSCHre- Definesthereceivingwindowsizein
latedparameterssignaledfrom
numberofMAC-hsPDUs
theRNCtotheBTSinNBAP
(reference1)

MAC-dPDUsizeindex

Determinedinternally

MAC-dPDUSize

SeetableTable15:HS-DSCHre- DefinesthesizeinbitsofMAC-dPDU
latedparameterssignaledfrom
PSstreamingalwaysusesMAC-d
theRNCtotheBTSinNBAP
PDUsofsize'336'
(reference1)

Identifiesthesizeindex.EachMAC-d
PDUsizeindexcorrespondstoone
MAC-dPDUsize

IncaseofCSserviceaccording
tomaximumAMRrateofallocatedAMRmode.144forSRBs
CQIFeedbackCycle

SeetableTable15:HS-DSCHre- DefinesthedurationoftheCQIfeedlatedparameterssignaledfrom
backcycleinms
theRNCtotheBTSinNBAP
(reference1)

CQIRepetitionFactor

SeetableTable15:HS-DSCHre- Definesthenumberofconsecutivereplatedparameterssignaledfrom
etitionsoftheCQIfromtheUE.
theRNCtotheBTSinNBAP
(reference1)

ACK-NACKRepetitionFactor

SeetableTable15:HS-DSCHre- Definesthenumberofconsecutivereplatedparameterssignaledfrom
etitionsoftheACKandNACKfeedtheRNCtotheBTSinNBAP
backfromtheUE
(reference1)

CQIPowerOffset

SeetableTable15:HS-DSCHre- Therelativepoweroffsetisquantized
latedparameterssignaledfrom
intoamplituderatiointheUE
theRNCtotheBTSinNBAP
(reference1)

ACKPowerOffset

SeetableTable15:HS-DSCHre- Therelativepoweroffsetisquantized
latedparameterssignaledfrom
intoamplituderatiointheUE
theRNCtotheBTSinNBAP
(reference1)

NACKPowerOffset

SeetableTable15:HS-DSCHre- Therelativepoweroffsetisquantized
latedparameterssignaledfrom
intoamplituderatiointheUE
theRNCtotheBTSinNBAP
(reference1)

Issue:06H

DN0638161

R: 233/396

233

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

Table 16

WCDMARANRRMHSDPA

HS-DSCHrelatedparameterssignaledfromtheRNCtotheUEinRRC
(reference2)(Cont.)

Parameter

Source

Description

MeasurementPowerOffset

SeetableTable15:HS-DSCHre- IndicatespoweroffsetbetweenHSlatedparameterssignaledfrom
PDSCHandP-CPICH.Usedalsofor
theRNCtotheBTSinNBAP
DCHSDPAusers.
(reference1)

HARQinfo

ReceivedinNBAP:RLSetupRe- Includesthenumberofprocessesand
sponse/RLReconfiguration
memorypartitioning.TheRNCrelays
Ready
theHARQinfofromtheBTStotheUE

HS-SCCHInfo

Determinedinternally

HS-SCCHScrambling&ChannelizationCodes

MAC-hsresetindicator

Determinedinternally

TRUEIndicatesthattheMAC-hsentity
intheUEneedstobereset

ServingHS-DSCHradiolink
indicator

Determinedinternally

TRUEindicatesthattheradiolinkisthe
servingHS-DSCHradiolink

PrimaryCPICHinfo

Notused

IndicatestheservingHS-DSCHradio
link.Informationelementisusedalso
forthesecondaryRL.

HARQPreamblemode

Notused

IndicatestheHARQpreamblemodeto
beused.

Delayrestrictionflag

Notused

Indicatesuseofdelayrestrictionfunctionality

Downlink64QAMconfigured

DerivedbyL3

RNCusesthisparametertoindicate
thatlicenseoffeatureHSDPA64QAM
existsandthefeatureisactivated.

HS-DSCHTBsizetable

DerivedbytheBTS.

Ifthisinformationelementispresent,
octetalignedtableisused,elsebit
alignedtableisused.

InRN6.0theH-RNTIallocationalgorithmintheRNChasbeenmovedfromtheBTS
leveltothecelllevel.Thisisbecausethenewfeaturesandconfigurationsrequiremore
H-RNTIs.
TheH-RNTIhas16bitsandtoavoiddecodingerrorsintheUE,itisrequiredthatthe
particularH-RNTIsusedhaveatleastathree-bitdifferencetoanyotherH-RNTIthatcan
beallocated.ThusthemaximumnumberofavailableH-RNTIsismuchlessthan216.

234

DN0638161

R: 234/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

FromRN6.0ontoponwardsitispossibletoselectwhethertousetheBTS-orcell-level
H-RNTIpoolintheRNC.ThisiscontrolledbyaPRFILEparameterandthedefaultvalue
issettocelllevel.Fortheintra-BTSSCC,iftheBTS-levelpoolisselected,theH-RNTI
doesnotchange.
ThisfunctionalityiscontrolledbythePRFILEparameter(002:1939
RN60_INT_FEAT_RES_10)inthefollowingway:

Bit0(firstbit)setto0,thatis,cell-levelH-RNTIpoolisused(setbydefault).

Bit0(firstbit)setto1,thatis,BTS-levelH-RNTIpoolisused.

ThisBTS-levelH-RNTIpoolworkaroundisneededonlywiththeWBTS6.0configuration,
whichdoesnotusethenewH-RNTIallocatedfortheUEduringintra-BTSSCC.The
BTS-levelH-RNTIworkaroundisnotneededwiththeWBTS7.0configuration,wherethe
correctionexist.
Thecell-levelH-RNTIpoolisneededatleastwhenthenumberofHSDPA/HSPAusersin
CELL_DCHstatewithinaBTSismorethan400.Itisneededtoguaranteeatleasta
three-bitdifferenceofH-RNTIbetweentwoHSDPA/HSPAusers.Notethatwiththe
RAN1637: High Speed Cell_FACH DLfeatureonlycell-levelH-RNTIpoolingcanbe
used.
WBTS6.0configurationwhenthenewH-RNTIisallocatedfortheUEduringintraBTS
SCC:

BTSisconfiguredwithasharedschedulerlicense(thatis,oneMAC-hsscheduler
servesmultiplecells)oneschedulerishostedinoneDSPMAC-hscore.

MorethanoneHSDPAcellishostedbytheschedulerwiththesamefrequency(not
dualcarrier)thisismostlikelyinthe1+1+1scenario.

Intra-BTSSCCistriggeredbetweenthesecellsalongwiththechangeofH-RNTI.

Thisproblemdoesnotoccurinanyothercase,whereSCCisperformedacrossthe
HSDPAcellshostedondifferentMAC-hscores/schedulers.Howeverthereisachange
inH-RNTIduringintra-BTSSCC.
DiscardTimerisusedintheBTStodropobsoletedatapackets.ItisdefinedintheRNC
andsignaledwiththeNBAPmessagetotheBTSforRBs,whichareusingHS-DSCH
transportchannelforPSstreamingorCSvoiceservices.
DiscardTimerisdefinedwiththefollowingformulaforPSstreamingservice(forCS
voiceserviceDiscardTimerisdefinedinHS-DSCHMAC-dflowparametersoftheCS
voiceRABchapter):
Figure 74

DiscardTimer

where:
TDisavalueofTransferDelayfromRANAP
TDMultForHSDPAStreamingisaRNClevelparameter.

Issue:06H

DN0638161

R: 235/396

235

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

WCDMARANRRMHSDPA

Roundingisdonetowardstheclosestvaluefromthefollowinglist:
20,40,60,80,100,120,140,160,180,200,250,300,400,500,750,1000,1250,1500,
1750,2000,2500,3000,3500,4000,4500,5000,7500.
ValueoftheTDMultForHSDPAStreamingparametercanbechangedonline.Thenew
valueistakeninuseonlyforRBsestablishedafterthechange.

IncreasedCQIfeedbackcycle
The Increased CQI feedback cyclefunctionalityincreasetheCQIfeedbackcycleofnonCPCusersduringhighloadtodecreaseULinterferencecausedbythecontinuousCQI
reportingofHSDPAusers.
CQIfeedbackcycleincreaseiscontrolledbythefollowingparameters:

MassEventHandler(On/Offswitchforthefunction)

MEHHSDPAUserNbrCQI(ThresholdforthenumberofHSDPAuserstotrigger
increasedCQIfeedbackcycle)

MEHCQIFeedbackCycle(Temporary(increased)CQIfeedbackcycle)

UsageoftheincreasedCQIfeedbackcycleisdecidedbasedonthenumberofHSDPA
usersinthecell.TheincreasedCQIfeedbackcycleisusedif:

CQIfeedbackcycleincreaseisenabledbytheMassEventHandlerWCEL
parameter,

thenumberofservingHSDPAusersinthecellisequalorhigherthanthevalue
definedbytheMEHHSDPAUserNbrCQIWCELparameter,

CQIvalue(definedbytheMEHCQIFeedbackCycleRNHSPAparameter)isgreater
thantheCQIfeedbackcyclevalue4ms.

NeedfortheincreasedCQIfeedbackcycleischeckedwhenHSDPAuserplane(thefirst
HS-DSCHMAC-dflow)isallocatedfortheuserinthecell.Itoccursduring:

StatetransitiontoCell_DCH

UserplanesetupinCell_DCH

Directresourceallocation(RBsetup)

SCC

CTStoHSDPA

HHO

CQIfeedbackcycleofexistingHSDPAusersisnotreconfiguredifthenumberofHSDPA
usersinthecellchanges,orifthevaluesofthecontrollingparametersarechanged.
CQIfeedbackcycleincreaseisvalidonlyforausernotusingCPCbecauselongerCQI
feedbackcycleisappliedbydefaultwhenCPCisusedandtheCQIfeedbackcycleof
CPCuserismodifiedbyRNWparameter.

236

DN0638161

R: 236/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

PrioritizationofSCCandASUoverpoweroffsetupdate
PacketschedulerproducestheACK,NACK,andCQIpoweroffsets(RRC/NBAP:ACK
PowerOffset,NACKPowerOffset,andCQIPowerOffset)when:

HS-DSCHMAC-dflowissetup,

SoftHandover(SHO)stateoftheUEchanges,

theminimumULspreadingfactorSFminischanged,

E-DPCHpresenceinformationischanged(E-DCHisallocatedorremoved).

ACK,NACK,andCQIpoweroffsetupdatesaresignaledwiththesynchronizedphysical
channelreconfigurationprocedure.
DuringHS-DPCCHpoweroffsetupdatealltheotherhandoverrelatedprocedures,such
asActiveSetUpdate(ASU)orServingCellChange(SCC)requestsarerejectedwith
parallel procedures not allowedcause.ThenewfunctionalitydelaystheHS-DPCCH
poweroffsetupdatewithapredefinedtimersothathandovercontrolcanstartanew
procedure(ASUorSCC)rightafterthepreviousASUhasbeencompleted.Asaresultof
thischange,anyreceivedmeasurementreport(eventbasedorperiodic)resultingin
ASUorSCCcanbetriggeredimmediatelywithoutwaitingfortheHS-DPCCHpower
offsetupdateprocedurecompletion.
TheHS-DPCCHpoweroffsetupdatecanalsobecombinedwithSCC(orotherRB
reconfiguration)procedureifRBreconfigurationprocedureistriggeredduringthe
predefinedwaittime.DelayedHS-DPCCHpoweroffsetupdatealsoreduces
unnecessarysignalinginfastchangingradioenvironment,whereSHOstateoftheUE
changesrapidly.
ThefunctionalityiscontrolledbythePRFILE(002:1714 RN50_MAINT_36)parameter.
Rangeoftheparameterisfrom0to5secondswitha100msstep.Therecommended
valueis3seconds,thatis,value1EH.Theparameterdefaultvalueis0H(disabled).In
thiscase,delayedHS-DPCCHpoweroffsetupdateisnotapplied.
ThefunctionalitycanbeactivatedbychangingthePRFILEparametertoavaluegreater
than0H.Thevaluedefinesthedelayinsecondsasfollows:
0H

DelayedHS-DPCCHpoweroffsetupdatedeactivated

1H

Delay100ms

2H

Delay200ms

3H

Delay300ms

...
1EH

Delay3000ms(recommendedvalue)

...

Issue:06H

DN0638161

R: 237/396

237

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

32H

WCDMARANRRMHSDPA

Delay5000ms

Thenewfunctionalityisactivatedwithin10minutesaftertheparameterchange.
ThefollowingunnecessaryinformationelementsinRRC:PHYSICALCHANNEL
RECONFIGURATIONmessageusedforHS-DPCCHpoweroffsetupdateareremoved
resultinginthereducedmessagesize:

dl-InformationPerRLlist

dl-CommonInformation.

WhentheRNCusesRRC:PHYSICALCHANNELRECONFIGURATIONmessageto
updateHS-DPCCHpoweroffsets,unnecessaryIEsDownlinkinformationcommonforall
radiolinksIEandDownlinkinformationperradiolinklistIEisremoved.Thisreducesthe
messagesize,inmanycasesfromonetotwoTB.Thisfunctionalityiscontrolledbybit3
ofthePRFILEparameter(002:1712 RN50_MAINT_34).Defaultvalueofbit3is
0(Functionalitydisabled).Functionalitycanbeactivatedbychangingbit3to1.The
functionalitywillbeactivatedwithin10minutesaftertheparameterchange.

12.1 RLCconfiguration
TheRLCtransfermodeindicateswhethertheRLCentityofanRBusesan
acknowledged(AM),anunacknowledged(UM)oratransparent(TM)datatransfer
mode.Equaltransfermodesareusedinuplinkanddownlinkforradiobearers.The
transfermodeisdeterminedfromtheRABattributesandthecorenetworkdomain
informationoftheresourcerequest.
AM-RLCisalwaysemployedfortheradiobearersofthepacket-switchedinteractiveand
background(PSNRT)andPSstreamingtrafficclassesRABs.Retransmission
parametersoftheAMRLCentitiescanbeconfiguredwithasetofmanagement
parameters.ThoughonlyafixedsetofthepollingandstatusreportingtriggersoftheAM
RLCisallowedtobeusedwithHSDPA,thevaluesofthetriggersandtimersare
changeable.
TheRNCimplementsalsoanalgorithm,whichenablesthedynamicdefinitionofthe
transmissionandreceivingwindowsizesfortheAMRLCentitiesinaccordancewiththe
RLCbufferingcapabilityoftheUEandusedradiobearerdatarates.Whendatais
transferredinHS-DSCH/E-DCHconfiguration,algorithmallowsusingeventhewhole
RLCbufferingcapabilityoftheUEtobeemployedforeachtransferdirectionto
maximizethetransmissionwindowsizes.Theoperatorisprovidedwithmeanstocontrol
thealgorithmwithasetofthemanagementparameters.
UM-RLCisalwaysemployedfortheradiobearersoftheCSvoiceoverHSPARABs.

238

DN0638161

R: 238/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

12.1.1 RetransmissionparametersofAMRLC
Highpeakdataratesandlargevariationsinthedataratesoftheradiobearersare
typicalforHSPA.HighdatarateincreasestheprobabilityintheblockingoftheRLC
transmissionwindow.Dataratedependentpollingandstatusreporttriggersareusedto
minimizetheblockingprobability.Aproblemwiththedataratedependenttriggersisthat
ifthedataratesare(temporarily)lowand,forinstance,theRLCstatusreportislost,the
RLCretransmissionofalostAMDPDUisdelayedwhichforitspartsmaysignificantly
delaythedeliveryoftheRLCSDUtothehigherlayers.Timerbasedpollingandstatus
reportingprovidesamechanismtorecoverfromtheloststatusreportswithinacontrolled
timeperiod;timerbasedpollingguaranteesaminimumpollingfrequencyalsowiththe
lowdatarates.

TheoperatorisabletomanagetheAMRLCretransmissionparametersofthePS
interactiveandbackgroundbearerswithasetoftheparametersbelongingtothe
parameterstructureAM RLC configuration for PS NRT with HSDSCH(AMRLCOnHSDSCHOfNRTPS).

TheoperatorisfurthermoreabletomanagetheRLCretransmissionparametersof
thePSstreamingbearerswithasetoftheparametersbelongingtotheparameter
structureAM RLC configuration for PS streaming with HSDSCH(AMRLCOnHSDSCHOfStrPS).

Table3summarizestheusedpollingandstatusreportingtriggersfortheAMRLCsofthe
bearers,whicharetransferredwiththeHS-DSCHMAC-dflow.
Table 17

Issue:06H

StatusreportingandretransmissiontriggersfortheAM-RLCwithHSDSCH

Pollorstatus
reporttrigger

SupportinRNC
(Yes,No)

Triggerused
(Yes,No)

Definition
methodforthe
trigger

Configurationof
thevalue

Timerpollperiod- Yes
ic

Yes

Managementpa- Valueofthetimer
rameter
changeable

Timerstatusperi- Yes
odic

No

Managementpa- Unchangeable
rameter

Timerpoll

Yes

No

Managementpa- Unchangeable
rameter

PollPDU

Yes

Yes

Setinternallyby
analgorithm

No

Managementpa- Unchangeable
rameter

DN0638161

R: 239/396

Minimumvalue
ofthePoll_PDU
changeable

239

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

Table 17

WCDMARANRRMHSDPA

StatusreportingandretransmissiontriggersfortheAM-RLCwithHSDSCH(Cont.)

Pollorstatus
reporttrigger

SupportinRNC
(Yes,No)

Triggerused
(Yes,No)

Definition
methodforthe
trigger

Configurationof
thevalue

PollSDU

Yes

No

Managementpa- Unchangeable
rameter

MissingPDUde- Yes
tection

Yes

Managementpa- Unchangeable
rameter

Timerstatuspro- Yes
hibit

Yes

Managementpa- Valueofthetimer
rameter
changeable

Timerpollprohib- Yes
it

No

Managementpa- Unchangeable
rameter

LasttransmissionPDUpoll

Yes

Yes

Managementpa- Unchangeable
rameter

LastretransmissionPDUpoll

Yes

Yes

Managementpa- Unchangeable
rameter

PollWindow

Yes

No

Managementpa- Unchangeable
rameter

FilteringofunnecessaryRLC
retransmissions

Yes

Yes

Managementpa- Valueofthetimer
rameter
changeable

ThevaluesofthecolumnTriggerusedaredefinedwiththeselectorsofthe
AMRLCOnHSDSCHOfNRTPSTriggersortheHSDSCHStrPSTriggersmanagement
parameterincaseofPSNRTorPSstreaming,respectively.Thevaluesoftheselectors
arecurrentlynotpossibletobemodified.Thismeansthatareducednumberofthe
triggersandtimerscanbeconfiguredfortheAMRLCentities.Itguaranteesthatonlythe
testedtriggersareusedfortheRLC.Therearemanagementparameterswhichenable
onetomodifythevaluesoftheusedtriggersandtimers.
Itisstrictlyrecommendedthatthevaluesofthemanagementparametersarenot
modifiedintheworkingradionetworkwithoutknowingtheconsequencesofthenew
valuestotheperformanceinthedatatransferandthesignalprocessingloadofthe
RNC,thatis,withouttestingthembeforehandinaseparatetestnetwork.

240

DN0638161

R: 240/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

AMRLCroundtriptime
Theminimumpollingfrequencyisdeterminedbydefiningfirsttheaverageroundtrip
time(RTT)forthesignalingbetweentheAMRLCentitiesinUEandRNC.AMRLCRTT
isusedtoestimatetheaverageresponsetimefromthemoment,whentheAMRLC
entitysendsanAMDPDUtoitspeerentitywiththepollbitset,tothereceivingmoment
ofthecorrespondingstatusPDU.RTTdependsontheL1/L2processingdelayofUE
andRNC,processingdelayofBTS,UuinterfacedelayandIubtransferdelay.
ThevaluesoftheAMRLCRTTsaredefinedwithtwoparametersofthemanagement
parameterstructureAM RLC round trip times with HSDSCH(AMRLCRespTimeHSDSCH).TheseparateRTTvaluescanbedefinedforthe
caseswhenthereversetransportchannelisDCHorE-DCH:

ThevalueoftheRTTfortransferringdataintheHS-DSCHconfigurationissetwith
theAMRLCRespTimeHSDSCHRevDCHmanagementparameterwhenthereverse
transportchannelisDCH.

ThevalueoftheRTTfortransferringdataintheHS-DSCHconfigurationissetwith
theAMRLCRespTimeHSDSCHRevEDCHmanagementparameterwhenthereverse
transportchannelisE-DCH.

ThevaluesoftheseparametersaredenotedasTRTT.

Maximumpollingandstatusreportingfrequency
IfoneormoreofthethreeAMRLCtimers,Timer_poll_periodicorTimer_pollintheRLC
entityofUEorTimer_status_periodicintheRLCentityofRNC,areused,theywillhave
equalvalue,whichisdefinedwiththe

AMRLCOnHSDSCHOfNRTPSPeriodMaxmanagementparameterincaseofPS
interactiveandbackgroundservices

HSDSCHStrPSPeriodMaxmanagementparameterincaseofPSstreaming
services

TherespectivevaluerepresentsthemaximumstatusreportingperiodoftheAMRLC
entities;itisdefinedintherelationtotheAMRLCroundtriptimeandisdenotedasmax.
IncombinationwiththevalueoftheAMRLCRespTimeHSDSCHRevDCHparameteror
AMRLCRespTimeHSDSCHRevEDCHparameterdependingonthetypeoftheused
reversetransportchannel(DCHorE-DCH)-whichisdenotedasTRTT,theabsolute
valueforthetimersbecomesequaltotheproductofmaxTRTT.
TheuseoftheRLCtimersTimer_poll_periodic,Timer_pollandTimer_status_periodicin
HS-DSCHconfigurationisdefinedwiththeselectorsTimerpollperiodic,Timerpolland
Timerstatusperiodicofthe

Issue:06H

AMRLCOnHSDSCHOfNRTPSTriggersmanagementparameterincaseofPS
interactiveandbackgroundservices

HSDSCHStrPSTriggersmanagementparameterincaseofPSstreamingservices

DN0638161

R: 241/396

241

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

WCDMARANRRMHSDPA

Theselectorvaluesarecurrentlyunchangeableandtheyaredefinedsothatthe
Timer_poll_periodicisalwaysusedintheHS-DSCHconfiguration,theothersarenot
used.

Algorithmtodefinethedataratedependentpollingtriggers
DataratedependpollingtriggerPoll every Poll_PDUispossibletobesetintheRLC
entityoftheRNCwiththefollowingalgorithm.
AssumingthatatleaststatusAMRLCstatusreportsisexpectedtobereceivedduring
theAMRLCtransmissionwindow,thepollingperiodissupposedtoconformtothevalue
ofthequantityTexpected
Figure 75

ExpectedAMRLCstatusreportingperiodforHS-DSCH

Thevalueofstatusismanagedwiththe

AMRLCOnHSDSCHOfNRTPSCountparameterincaseofPSinteractiveand
backgroundservices

HSDSCHStrPSCountparameterincaseofPSstreamingservices

QuantitySTxWsisthesizeofthetransmissionwindowoftheRLCentityinUE, SPDUis
thepayloadsizeoftheuplinkAMDPDUandRmaxisthemaximumuserdatarateofthe
HS-DSCHMAD-dflowasspecifiedintheSupportedbitratesforHSDPA.TTIisthe
maximumvalueofthetransmissiontimeintervalsoftheHS-DSCHandthereverse
channel.
Iftheexpected status reporting period Texpectedissmallerthanthemaximumstatus
reportingperioddefinedwiththeproductmaxTRTT,admissioncontroldefinesthe
quantityPoll_PDUwiththeequation
Figure 76

ValueofAMRLCPoll_PDUforHS-DSCH

NPollPDUisthevalueoftheAMRLCOnHSDSCHOfNRTPSPollPDU(PSinteractiveand
backgroundcase)orHSDSCHStrPSPollPDU(PSstreamingcase)management
parameter.RLCentityoftheRNCisconfiguredtousethepolltriggerPoll every
Poll_PDU PDUanditsvalueissettoPoll_PDU.

242

DN0638161

R: 242/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

IftheexpectedstatusreportingperiodTexpectedisnotsmallerthanthemaximumstatus
reportingperiodmaxTRTT,thealgorithmdoesnotsetthedataratedependpolling
triggerPoll every Poll_PDU PDU.
TheuseofthealgorithmisdefinedwiththeselectorExpected status reporting periodof
theAMRLCOnHSDSCHOfNRTPSTriggers(PSinteractiveandbackgroundcase)or
HSDSCHStrPSTriggers(PSstreamingcase)managementparameter.Theselector
valueiscurrentlyunchangeable,thealgorithmisusedintheHS-DSCHconfiguration.

Minimumpollingandstatusreportingfrequency
TheminimumperiodisdefinedfortheRLCpollingandstatusreportingtocontrolthe
statusreportingfrequencyandtoreducetheamountofthemultipleretransmissionsof
anunsuccessfullytransmittedAMDPDU.
IncaseofPSinteractiveandbackgroundservices,theminimumperiodisdefinedwith
theAMRLCOnHSDSCHOfNRTPSPeriodMinmanagementparameter:

Timer_poll_prohibitissettothevalueoftheAMRLCOnHSDSCHOfNRTPSPeriodMin
parameterintheRLCentityoftheSRNC/ServingFlexiDirectRNC,ifithasbeen
activatedwiththeselectorTimer_poll_prohibitofthe
AMRLCOnHSDSCHOfNRTPSTriggersparameter.Theselectorvalueiscurrently
unchangeable;thetimerisnotusedintheHS-DSCHconfiguration.

Timer_status_prohibitissettothevalueofthe
AMRLCOnHSDSCHOfNRTPSPeriodMinparameterintheRLCentityofUE,ifithas
beenactivatedwiththeselectorTimerstatusprohibitofthe
AMRLCOnHSDSCHOfNRTPSTriggersparameter.Theselectorvalueiscurrently
unchangeable;thetimerisusedintheHS-DSCHconfiguration.

IncaseofPSstreamingservices,theminimumperiodisdefinedwiththe
HSDSCHStrPSPeriodMinmanagementparameter:

Timer_poll_prohibitissettothevalueoftheHSDSCHStrPSPeriodMinparameterin
theRLCentityoftheSRNC/ServingFlexiDirectRNC,ifithasbeenactivatedwith
theselectorTimer_poll_prohibitoftheHSDSCHStrPSTriggersparameter.The
selectorvalueiscurrentlyunchangeable;thetimerisnotusedintheHS-DSCH
configuration.

Timer_status_prohibitissettothevalueoftheHSDSCHStrPSPeriodMinparameter
intheRLCentityofUE,ifithasbeenactivatedwiththeselectorTimerstatus
prohibitoftheHSDSCHStrPSTriggersparameter.Theselectorvalueiscurrently
unchangeable;thetimerisusedintheHS-DSCHconfiguration.

Othermethodstosetthepollingandstatusreportingtriggersin
caseofPSinteractiveandbackgroundservices
ThesenderoftheRLCentityinSRNC/ServingFlexiDirectRNCisconfiguredasfollows:

Issue:06H

PollingtriggerPoll_PDUissettothevalueofthe
AMRLCOnHSDSCHOfNRTPSPollPDUparameterifthetriggerhasbeenactivatedwith
theselectorPoll_PDUoftheAMRLCOnHSDSCHOfNRTPSTriggersparameter,
unlessithasalreadybeengivenavaluewiththealgorithmExpectedstatus

DN0638161

R: 243/396

243

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

WCDMARANRRMHSDPA

reportingperiod.ThevalueoftheselectorPoll_PDUiscurrentlyunchangeable.
ThetriggerisnotactivatedfortheHS-DSCHconfigurationwiththemanagement
parameter.

PollingtriggerPoll_SDUissettothevalueofthe
AMRLCOnHSDSCHOfNRTPSPollSDUparameterifthetriggerhasbeenactivatedwith
theselectorPoll_SDUoftheAMRLCOnHSDSCHOfNRTPSTriggersparameter.The
valueoftheselectorPoll_SDUiscurrentlyunchangeable.Thetriggerisnotused
fortheHS-DSCHconfiguration.

PollingtriggerPoll_Windowissettothevalueofthe
AMRLCOnHSDSCHOfNRTPSPollWindowparameterifthetriggerhasbeenactivated
withtheselectorPoll_windowoftheAMRLCOnHSDSCHOfNRTPSTriggers
parameter.Thevalueoftheselectoriscurrentlyunchangeable.Thetriggerisnot
usedfortheHS-DSCHconfiguration.

PollingtriggersLast transmission PDU pollandLast retransmission PDU pollcanbe


setseparatelywithtwoselectorsLasttransmissionPDUpollandtheLast
retransmissionPDUpolloftheAMRLCOnHSDSCHOfNRTPSTriggersparameter.
Thevaluesoftheselectorsarecurrentlyunchangeable.Thetriggersarebothused
fortheHS-DSCHconfiguration.

ReceiveroftheRLCentityinUEisconfiguredasfollows:

StatusreporttriggerMissing PDU indicatorissetifthetriggerhasbeenactivated


withtheselectorMissingPDUindicatorofthe
AMRLCOnHSDSCHOfNRTPSTriggersparameter.Thevalueoftheselectoris
currentlyunchangeable.ThetriggerisactivatedfortheHS-DSCHconfiguration.
MissingPDUindicationisusedforthefasterindicationofthelostAMDPDUsandfor
thefasterrecoveryfromthelostpolling.

Othermethodstosetthepollingandstatusreportingtriggersin
caseofPSstreamingservices
ThesenderoftheRLCentityinSRNC/ServingFlexiDirectRNCisconfiguredasfollows:

244

PollingtriggerPoll_PDUissettothevalueoftheHSDSCHStrPSPollPDUparameter
ifthetriggerhasbeenactivatedwiththeselectorPoll_PDUofthe
HSDSCHStrPSTriggersparameter,unlessithasalreadybeengivenavaluewith
thealgorithmExpectedstatusreportingperiod.Thevalueoftheselector
Poll_PDUiscurrentlyunchangeable.ThetriggerisnotactivatedfortheHS-DSCH
configurationwiththemanagementparameter.
IfPoll_PDUhasalreadybeenassignedavalue,whichisthevalueofthe
AMRLCOnHSDSCHOfNRTPSPollPDUparameter,however,thisfirstvalueremains
valid.

PollingtriggerPoll_SDUissettothevalueoftheHSDSCHStrPSPollSDUparameter
ifthetriggerhasbeenactivatedwiththeselectorPoll_SDUofthe
HSDSCHStrPSTriggersparameter.ThevalueoftheselectorPoll_SDUis
currentlyunchangeable.ThetriggerisnotusedfortheHS-DSCHconfiguration.

PollingtriggerPoll_WindowissettothevalueoftheHSDSCHStrPSPollWindow
parameterifthetriggerhasbeenactivatedwiththeselectorPoll_windowofthe
HSDSCHStrPSTriggersparameter.Thevalueoftheselectoriscurrently
unchangeable.ThetriggerisnotusedfortheHS-DSCHconfiguration.

DN0638161

R: 244/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

PollingtriggersLast transmission PDU pollandLast retransmission PDU pollcanbe


setseparatelywithtwoselectorsLasttransmissionPDUpollandtheLast
retransmissionPDUpolloftheHSDSCHStrPSTriggersparameter.Thevaluesof
theselectorsarecurrentlyunchangeable.ThetriggersarebothusedfortheHSDSCHconfiguration.

ReceiveroftheRLCentityinUEisconfiguredasfollows:

StatusreporttriggerMissing PDU indicatorissetifthetriggerhasbeenactivated


withtheselectorMissingPDUindicatoroftheHSDSCHStrPSTriggersparameter.
Thevalueoftheselectoriscurrentlyunchangeable.Thetriggerisactivatedforthe
HS-DSCHconfiguration.MissingPDUindicationisusedforthefasterindicationof
thelostAMDPDUsandforthefasterrecoveryfromthelostpolling.

FilteringofunnecessaryRLCretransmissions
ThesenderoftheAMRLCentityretransmitsanAMDPDUwhenitreceivesastatus
report,whichisindicatingthattheAMDPDUismissinginthereceiverentity.Ifthe
periodofthetimebetweenthetwoconsecutivesettings,thepollingbitinthetransmitter
isshorterthantheRTT,itcausesthatthetransmitterreceivesmultipleSTATUSPDUs
indicatingthesamemissingAMDPDU.Consequently,thesameAMDPDUis
retransmittedforeachstatusreport.Thenumberofunnecessaryretransmissionscan
increasesignificantlywithregardtothehighdatarates,thusreducingtheactual
throughputofthebearer.
AdedicatedtimerisusedintheRLCentityoftheRNCtofilterunnecessaryRLC
retransmissions:

Thetimerisstatusreportspecific.Itisstartedwhenastatusreportindicatingmissing
AMDPDUorAMDPDUsisreceivedfromthereceiverentity.TheAMDPDUor
PDUsareretransmitted.

Whilethetimerisrunning,allstatusreportsreceivedbythesenderRLCentity
exceptACKSUFIsarediscarded.NACKs,thatis,LIST,BITMAPandRLISTSUFIs
inthestatusreportsdonottriggerretransmissionofanyofthosePDUs.

WhenACKisreceivedforthelastretransmittedAMDPDUinthestatusreport,the
timerisstoppedanditsvaluereset.

Aftertheexpirationofthetimer,anewretransmissionoftheAMDPDUorPDUSis
triggeredbasedonthelaststatusreportreceived,whilethetimerwasrunning.Ifno
statusreportwerereceivedduringthetimer,theretransmissionoftheAMDPDUor
PDUsistriggeredbasedonthenextstatusreportreceivedaftertheexpirationofthe
timer.

Thefilteringtimer,whichisusedintheHS-DSCHconfiguration,issettothevalueofthe
respectivemanagementparameter.

Issue:06H

PSinteractiveandbackgroundcase:thetimerissetto
AMRLCOnHSDSCHOfNRTPSFilterReTXifthefilteringhasbeenactivatedwiththe
selectorRetransmissionfilterinDLtransferofthemanagementparameter.Itis
AMRLCOnHSDSCHOfNRTPSTriggersiftheselectorvalueiscurrentlyunchangeable.

DN0638161

R: 245/396

245

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

WCDMARANRRMHSDPA

PSstreamingcase:thetimerissettoHSDSCHStrPSFilterReTXifthefilteringhas
beenactivatedwiththeselectorRetransmissionfilterinDLtransferofthe
managementparameter.ItisHSDSCHStrPSTriggersiftheselectorvalueis
currentlyunchangeable.

OperationmodesoftheSDUdiscardfunctionincaseofPS
interactiveandbackgroundservices
Timer based SDU discard with explicit signallingisnotemployedfortheAMRLCsofthe
PSinteractiveandbackgroundbearers,whicharetransferredintheHS-DSCH
configuration.
SDU discard after MaxDAT number of transmissionsandNo_discard after MaxDAT
number of transmissionsarebothimplementedmodesinRNC.TheSDU discard after
MaxDAT number of transmissionsmodeisusedifthismodehasbeenactivatedwiththe
selectorSDUdiscardafterMaxDATtransmissionsofthe
AMRLCOnHSDSCHOfNRTPSTriggersmanagementparameter.Otherwise,the
No_discard after MaxDAT number of transmissionsmodeisused.Thevalueofthe
selectoriscurrentlyunchangeable;triggerissetsothatthelattermodeisused.
ThesenderoftheRLCentityinSRNC/ServingFlexiDirectRNCisconfiguredasfollows:

ThevalueoftheMaxMRWRLCparameterissettothevalueofthe
AMRLCOnHSDSCHOfNRTPSMaxMRWmanagementparameter.TheRLCparameteris
significantonlyifSDU discard after MaxDAT retransmissionsisapplied.

ThevalueoftheTimer_MRWRLCtimerissettothevalueoftheproductmaxTRTT,
ifSDUdiscardafterMaxDAT retransmissionsisapplied.

ThevalueoftheMaxDATRLCparameterissettothevalueofthe
AMRLCOnHSDSCHOfNRTPSMaxDATmanagementparameter.

ThevalueoftheMaxRSTRLCparameterissettothevalueofthe
AMRLCOnHSDSCHOfNRTPSMaxRSTmanagementparameter.

ThevalueoftheTimer_RSTRLCtimerissettothevalueoftheproductmaxTRTT.

TheretransmissionparametersoftheAMRLCentitiescandifferinthedifferenttransport
channelconfigurationsandthereforemayneedtheupdateifthetransportchannel
configurationsaremodified.TheparametersoftheAMRLCentityemployedfortheRB,
whichistransferringdataintheDCHorFACHorRACHconfiguration,areintroducedin
sectionRadio bearersoftheWCDMA RAN RRM Admission Controlfunctionalarea
description.TheretransmissionparametersoftheAMRLCentityemployedforthe
reverseRB,whichistransferringdataintheE-DCHconfigurationareintroducedin
sectionRLC layer configurationoftheWCDMA RAN RRM HSUPAfunctionalarea
description.

OperationmodesoftheSDUdiscardfunctionincaseofPS
streamingservices
Timer based SDU discard with explicit signallingisnotemployedfortheAMRLCsofthe
PSstreamingbearers,whicharetransferredintheHS-DSCHconfiguration.

246

DN0638161

R: 246/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

SDU discard after MaxDAT number of transmissions,No_discard after MaxDAT number


of transmissions,andTimer based discardaretheonlymodesimplementedintheRNC.
EithermodewillbeappliedifithasbeenactivatedwiththeSDUdiscardModeRTPS
managementparameter.
IftheTimer based discardmodeisused,theRNC'sRLCentityisconfiguredwiththe
Timer_discardRLCtimer.Thistimer'svalueisdenotedasTdiscardandcalculated
accordingtothesubsequentequation:
Figure 77

ValueofTimer_discardRLCtimer

WithTDisc,offsetbeingdefinedbythevalueoftheHSDSCHStrDiscardTime
managementparameterandthefollowingparameterbeingincludedintheRAB
attributes:

Rgbeingthevalueoftheguaranteedbitrate(GBR)

SSDUbeingthevalueoftheMaximum SDU sizeinbits

TRABbeingthevalueoftheTransfer delay

Ingeneral,thesenderoftheRLCentityinSRNC/ServingFlexiDirectRNCisconfigured
asfollows:

ThevalueoftheMaxMRWRLCparameterissettothevalueofthe
HSDSCHStrPSMaxMRWmanagementparameter.TheRLCparameterissignificant
onlyiftheSDU discard after MaxDAT retransmissionsortheTimer based discard
modeisapplied.

ThevalueoftheTimer_MRWRLCtimerissettothevalueoftheproductmaxTRTT
iftheSDU discard after MaxDAT retransmissionsortheTimer based discardmodeis
applied.

ThevalueoftheMaxDATRLCparameterissettothevalueofthe
HSDSCHStrPSMaxDATmanagementparameter.

ThevalueoftheMaxRSTRLCparameterissettothevalueofthe
HSDSCHStrPSMaxRSTmanagementparameter.

ThevalueoftheTimer_RSTRLCtimerissettothevalueoftheproductmaxTRTT.

TheretransmissionparametersoftheAMRLCentitiescandifferinthedifferenttransport
channelconfigurationsandthereforemayneedtheupdateifthetransportchannel
configurationsaremodified.TheparametersoftheAMRLCentityemployedfortheRB,
whichistransferringdataintheDCHorFACHorRACHconfiguration,areintroducedin
Radio bearersofWCDMA RAN RRM Admission Control.Theretransmissionparameters

Issue:06H

DN0638161

R: 247/396

247

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

WCDMARANRRMHSDPA

oftheAMRLCentityemployedforthereverseRB,whichistransferringdataintheEDCHconfigurationareintroducedinRLC layer configurationofWCDMA RAN RRM


HSUPA.

12.1.2 TransmissionandreceivingwindowsoftheAMRLC
entities
TheRNCimplementsanalgorithm,whichenablesthedynamicdefinitionofthe
transmissionareceivingwindowsizesfortheAMRLCentitiesinaccordancewiththe
RLCbufferingcapabilityofUEandusedradiobearerdatarates.Theoperatoris
providedmeanstocontrolthealgorithmwiththemanagementparameters.The
algorithmisdescribedindetailsinthefeatureapplicationdocumentoftheadmission
control;descriptioncoversalsothecaseswhenthePSbeareristransferredintheHSDSCHconfiguration.
WhenabearertransfersdataintheHS-DSCH/E-DCHconfiguration,thedataratesmay
behighineitherofthetwotransferdirectionsandalsovarybetweenuplinkand
downlink;actualdatatransferdirectionisnotnecessarilyknownwhenthetransport
channelresourcesareallocatedfortheRAB.Ifthetransmissionandreceivingwindows
areallocatedsothatthewindowsaretogethertakingjustthesizeoftheRLCbuffer,
whichUEhasreportedforitscapability,andthecapabilityislimited,thereisariskthat
thetransmissionwindowofthedatatransferdirectionbecomesfullwhilethe
transmissionwindowoftheoppositedirectionisalmostempty.
ThememoryoftheUEisdynamicallysharedbytheRLCAMentitiesandtheMAC-hs
reorderingentitiesatanytime.TheUEisabletoevaluateitsconsumption.REL-06
3GPPspecifications25.321and25.322ofMACandRLCarespecifyinghowtheUE
shouldconsideritselfinamemoryshortagesituationwhentheamountofstoredAM
RLCPDUsandMAC-hsPDUsexceedsitscapabilityandthemeasurementstheUE
shouldtakeagainstit.ThisabilityoftheUEenablestheRNCtooverbooktheRLCbuffer
oftheUEwhentheRNCisallocatingthetransmissionandwindowsizesfortheUEs
AMRLCentity.
AdmissioncontroloftheSRNC/ServingFlexiDirectRNCproducesthemaximumAM
RLCbufferofUE,whichcanbeusedintheallocationofthetransmissionandreceiving
windows.MaximumbuffersizesaremappedfromtheTotal RLC AM and MAC-hs buffer
sizeinformationreportedbytheUE.MaximumAMRLCbufferisdefinedseparatelyfor
eachreportedvalueof50,100,150,and200Kbytesusingfourparametersofthe
managementparameterstructureAM RLC maximum buffer allocation for
UE(AMRLCMaximumBufferUE)inthemapping.Themanagementofthebuffersizes
enablesbearertouseeventhewholeRLCbufferingcapabilityinonedatatransfer
directionatatime.IftheUEreportshigherRLCbufferingcapability,thereportedvalueis
usedinthedefinitionsoftheRLCwindowsizes.
ThemanagementoftheRLCbuffersizeisvalidforonlythoseAMRLCentitiesofthe
RRCconnectionswhichhavetheE-DCHconfiguredatleastinoneoftheirradiolinks.
TheUEreportedRLCbufferingcapabilityvalueisonlyusedinthedefinitionof
transmissionandreceivingwindowsizes,whenthereversechanneltypeisDCH.

248

DN0638161

R: 248/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

Themaximumallocatedradiobearerdataratethatisusedinthedynamicwindowsize
allocationalgorithmissetequaltothemaximumuserdatarateoftheHS-DSCHMAC-d
flow,whichisdefinedinSupportedbitratesforHSDPA.
AdmissionControlmonitorstheuseofaspecialvalueoftheHEfieldforHS-DSCH
streaming,PSinteractive,andbackgroundradiobearers.IfconfigurationHS-DSCH/EDCHorHS-DSCH/DCHisused,thenRRMsetstheIEUse special value of HE fieldso
thatitispresentintheRLCinformationoftheRRCmessageunderthefollowing
conditions:

ValueofUse special value of HE fieldbitofparameterAMRLCOnHSDSCHOfStrPS.


HSDSCHSTRPSTriggersis1,

UEreleaseisMAC-ehscapable(theRNCreceivestheinformationaboutMAC-ehs
capabilityinRRCCONNECTIONREQUESTmessageviaIEMAC-ehs support).

Otherwise,RRMsetstheIEUse special value of HE fieldtonotpresentinRLCinfoof


theRRCmessage.
AfterRRMhassettheuse of the special value of the HE fieldtopresent,thenintheRLC
infotheuse of the special value of the HE fieldissettonotpresent.Thishappenswhen
thelastSRNC/ServingFlexiDirectRNCradiolinkisremovedandreleaseofthetarget
RNCisRel6orearlier.ThemessageRRC:Radio bearer reconfigurationisusedto
informUERLC.AlsotheRNCRLCneedstobeinformedaboutthechangeoftheusage
oftheHEfieldspecialvalue.
RRMstoresaspecialvaluesettingwhentheUEisinCell_FACH/Cell_DCHandinforms
thesettingtoL3whentheUEmovestoCell_PCH.L3storesthespecialvaluesetting
whentheUEmovestoCell_PCHandinformstheRRMwhentheUEgoesbacktothe
Cell_FACH/DCH.TheideaisthattheusageofspecialHEvalueshouldbeactivated
whentheUEismovingtootherSRNC.Thisisperformedbecause3GPPRLC
specificationdoesnotrequirere-establishmentwhenotherRLCparametersthanAMD
PDUsizearechanged.However,theusageofspecialHEvaluecanbedeactivatedin
caseofRNCrelocationifthetargetRNCisRel6orearliersinceforPSRABs,theRLC
re-establishmentisperformedinRNCrelocations.
AdmissionControlproducesvalueoflengthindicatorparameterfortransmitterand
receiverRLCentityofeachRABsubflowRB.WhenRRMisconfiguringflexibleRLC
PDUsize,RRMsetssizeofthelengthindicatorfortheAMDPDUasfollows:

IfAMDRLCPDUpayloadsizeisnotover1000bits(125bytes),then7-bitlength
indicatorsareused.

Otherwise,15-bitlengthindicatorsareused.

TheRLCtransmissionwindowfortheAMRLCincaseofDCHSDPAisproduced
similarlyasinthecaseofSCHSDPA.

Issue:06H

DN0638161

R: 249/396

249

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

WCDMARANRRMHSDPA

12.1.3 AMRLCwindowsizeandretransmissionparametersfor
SRBsonHSPA
AdmissioncontrolproducethetransmissionwindowsizesoftheAMRLCentitiesofthe
UEandtheRNCfortheSRBsRB2,RB3andRB4mappedonHSPAasithasbeen
definedinsectionCode tree optimizationinWCDMA RAN RRM Admission Controlfor
SRBsonDCHbyusingexistingAMRLCTXWindowSizeSRBparameter.AswellRLC
windowsizesfortheSRNSrelocations,hardhandovers-intra-RNC,inter-RNCand
inter-RAThardhandoversaredoneasithasbeendefinedasinsectionCode tree
optimization inWCDMA RAN RRM Admission Control.
ThisfunctionalitycoverstheRB2,RB3andRB4oftheSRBwhichistransferringinEDCH/HS-DSCHconfiguration.Followingmanagementparametersareintroducedforthe
definitionofthelengthoftheAMRLCstatusreportingperiod:

250

ParameterAMRLCRespTimeSRBHSPAdefinestheL2roundtriptimebetweentheAM
RLCentitiesoftheUEandtheSRNC/ServingFlexiDirectRNCasintroducedinthe
descriptionsoftheparameter.ValueoftheL2roundtriptimeisdenotedwithTRTT.If
theRAN2494: Fast CELL_PCH switchingfeatureisenabled,thenonevaluecanbe
usedfortheL2roundtriptimeofsignalingbearerersRB3andRB4regardlessofthe
usedtransportchannel.ThisvalueisdefinedbythemanagementparameterRNRLCAMRLCSRB3n4RespTime.

ParameterAMRLCSRBHSPAPeriodMaxdefinesthemaximumstatusreportingperiod
inrelationtotheL2roundtriptime-valueoftheparameterisdenotedwith maxIf
theRAN2494: Fast CELL_PCH switchingfeatureisenabled,thenonevaluecanbe
usedforthemaximumstatusreportingperiodinrelationtotheL2roundtriptimeof
signalingbearerersRB3andRB4regardlessoftheusedtransportchannel.This
valueisdefinedbythemanagementparameterRNRLC-AMRLCSRB3n4PeriodMax.

SenderoftheRLCentityisconfiguredasfollows:

TimersTimer_poll andTimer_poll_periodicaresettothevaluemaxTRTTifthey
havebeenactivatedwiththeTimer poll periodicandtheTimer pollofthe
parameterAMRLCSRBHSPATriggers.

TimerTimer_poll_prohibitissettothevalueoftheparameter
AMRLCSRBHSPAPeriodMinifithasbeenactivatedwiththeTimer_poll_prohibit
oftheparameterAMRLCSRBHSPATriggers.

PollingtriggerPoll_PDUissettothevalueoftheparameter
AMRLCSRBHSPAPollPDUifthetriggerhasbeenactivatedwiththePoll_PDUof
theparameterAMRLCSRBHSPATriggers.

PollingtriggerPoll_SDUissettothevalueoftheparameter
AMRLCSRBHSPAPollSDUifthetriggerhasbeenactivatedwiththePoll_SDUof
theparameterAMRLCSRBHSPATriggers.

PollingtriggerPoll_Windowissettothevalueoftheparameter
AMRLCSRBHSPAPollWindowifthetriggerhasbeenactivatedwiththe
Poll_windowoftheparameterAMRLCSRBHSPATriggers.

PollingtriggersLasttransmissionPDUpollandLastretransmissionPDUpollare
setifthetriggershavebeenactivatedwiththeLast transmission PDU polland
theLast retransmission PDU polloftheparameterAMRLCSRBHSPATriggers.

DN0638161

R: 250/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

ValueoftheRLCparameterMaxDATissettothevalueoftheparameter
AMRLCSRBHSPAMaxDAT.

ReceiveroftheRLCentityisconfiguredasfollows:

TimerTimer_status_periodicissettothevalue maxTRTTifithasbeenactivated
withtheTimer status periodicoftheparameterAMRLCSRBHSPATriggers.

TimerTimer_status_prohibitissettothevalueoftheparameter
AMRLCSRBHSPAPeriodMinifithasbeenactivatedwiththeTimer status prohibitof
theparameterAMRLCSRBHSPATriggers.

StatusreporttriggerMissingPDUindicatorissetifthetriggerhasbeenactivated
withtheparameterAMRLCSRBHSPATriggers.

ManagementparametervaluesareappliedwhentheAMRLCentityiscreatedorthe
retransmissionparametersoftheentityaremodified.Modificationofthevaluesofthe
managementparametersisnotsufficientreasonforthereconfigurationoftheAMRLC
entities.ValuesoftheRLCvariablesandtimerssignaledtotheRLCentitiesoftheUE
andtheRNCareroundedasdescribedinthedefinitionofeachparameterofthe
structureAMRLCSRBHSPA.
ThevalueofthemaximumTxWssize(TxWsCDSP)dependsontheHS-DSCHMAC-d
flowpeakrate:

IfHS-DSCHMAC-dflowpeakrateislowerthanorequalto21.1Mbit/s,theRLC
supportsthemaximumTxWssize(TxWsCDSP)of450000B.

IfHS-DSCHMAC-dflowpeakrateisbiggerthan21.1Mbit/sbutlowerthanorequal
to42Mbit/s,theRLCsupportsthemaximumTxWssize(TxWsCDSP)of930kB
(952320B).

12.1.4 DeliveryoftheRLCSDUstothehigherlayers
TheSRNC/ServingFlexiDirectRNCsignalsRLC In-Sequence delivery informationin
theIn-Sequence deliveryflagoftheRRCRLC infototheUE.RLC In-Sequence delivery
informationisanindicationtotheRLCentityoftheUEaboutwhetherornotithasto
preservetheorderoftheRLCSDUswhenitistransferringthemtothehigherlayers.
Basically,theSRNC/ServingFlexiDirectRNC'sadmissioncontrolsetstheflagInsequence deliverydependingonthevalueofDelivery Orderparameterreceivedin
RANAPRABattributesfromSGSNforthePSinteractiveandbackgroundandPS
streamingRABs.TheSRNC/ServingFlexiDirectRNCthenestablishestheHS-DSCH
MAC-dforthebearer:

Issue:06H

IfthevalueoftheattributeDelivery OrderequalstoDeliveryorderrequested,the
flagIn-sequence deliveryissettoTRUE.

IfthevalueoftheattributeDelivery OrderequalstoDeliveryordernotrequested:

DN0638161

R: 251/396

251

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

WCDMARANRRMHSDPA

IftheselectorInsequencedeliveryofSDUsinUEofthe
AMRLCOnHSDSCHOfNRTPSTriggers(PSinteractiveandbackgroundservices)
orHSDSCHStrPSTriggers(PSstreamingservices)managementparameteris
notset,theIn-sequence deliveryflagissettoFALSE.

Otherwise,iftheselectorInsequencedeliveryofSDUsinUEofthe
AMRLCOnHSDSCHOfNRTPSTriggers(PSinteractiveandbackgroundservices)
orHSDSCHStrPSTriggers(PSstreamingservices)managementparameteris
set,theIn-sequence deliveryflagissettoTRUE.

Thevalueoftheselectoriscurrentlyunchangeable.Itsvalueisset.
Thus,insequencedeliveryisguaranteedbytheRLCentityofSRNC/ServingFlexiDirect
RNCregardlessofthepossiblevalueoftheRANAPRABattributeDelivery Order.

12.1.5 UMRLCconfiguration
WhentheHSPAisestablishedfortheCSvoiceRAB,theUE-specificadmissioncontrol
configuresthetransmittingandreceivingUMRLCentitiesfortheradiobearerbothinthe
SRNC/ServingFlexiDirectRNCandUE.TheCSvoicebearerisstilltransferredwiththe
TMradiobearersintheR99transportchannelconfiguration.
WhentheHSPAisestablishedfortheCSvoiceRAB,theUEspecificadmissioncontrol
shallconfigurethetransmittingUMRLCentityofRNCwiththefollowingparameters:

ConcatenationoftheRLCSDUsisnotallowed.

SegmentationoftheRLCSDUsisnotallowed.

SDUdiscardfunctionshallnotbeconfigured,meaningthatSDUsinthetransmitter
isnotdiscardedunlessthetransmissionbufferisfull.

AlternativeextensionbitinterpretationissetforenablingtheRLCentitytoindicate
withtheE-bitwhentheUMDPDUincludescompleteSDU,whichisnotsegmented,
concatenatedorpadded.

7-bitLengthindicatorvalueisusedfortheDLUMDPDUs.

UMDPDUsizesNUMDfortheAMRmodesofcodecsetthecell-specificadmission
controlhasselectedforthecall,includingthepossibleSIDframe.

TheSRNC/ServingFlexiDirectRNCreceivesfromtheMSCintheRANAPresource
allocationrequestmessagedescriptionoftheexactRABsubflowSDUsizesforeach
AMRmodeandthepossibleSIDframe.UE-specificACcanproduceforeachAMR
modethesizeSPDCPofthePDCPSDUbysummingoverthesub-flowsthesubflowspecificSDUsizes.SizesofthePDCPandtheUMRLCheadersequalbothto8bits.
RecallingthatPDCPPDUisoctet-aligned,UE-specificACcanusethegeneralformula
forcalculatingNUMD:

252

DN0638161

R: 252/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Figure 78

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

NUMDcalculating

PDCPSDUsizecanalsobeproducedsimplybymultiplyingtheAMRmodebitrate
receivedfromthecell-specificAMRwith20ms.SizeoftheAMRSIDframeis39bits,
andAMRWBSIDframe40bits.RLCPDUsizevaluesNUMDisusedassuchasthe
MAC-dPDUsizevaluesfortheCSvoicebearer.Theformulacanalsobeusedto
implementatablefortheMAC-dPDUsizes.
WhentheHSPAisestablishedfortheCSvoiceRAB,theUE-specificadmissioncontrol
configuresthereceivingUMRLCentityoftheUEwiththefollowingparameters:

AlternativeextensionbitinterpretationissetforinformingtheRLCentityofusingthe
E-bittoindicatethattheUMDPDUincludescompleteSDU,whichisnotsegmented,
concatenatedorpadded.RRCIEAlternative E-bit interpretationissignaledtothe
UE.

7-bitLengthindicatorvalueisusedfortheDLUMDPDUs.

OutofsequencedeliveryofSDUsfunctionisnotconfigured.RRCIEUMOutof
sequencedeliveryinfoisnotsignaledtoUE.

Duplicateavoidanceandreorderingfunctionisnotconfigured.RRCIEUM
Duplication Avoidance and Reordering infoisnotsignaledtoUE.

12.1.6 Jitterbuffermanagement
WhentheHS-DSCHMAC-dflowisestablishedfortheCSvoiceRAB,theUE-specific
admissioncontroloftheSRNC/ServingFlexiDirectRNCdefinesthemaximumbuffering
timefortheCSvoiceframesinUE.QuantityissignaledtoUEwiththeRRCparameter
Max CS delayoftheCS-HSPA informationincludedinthe RAB information for setup
IE.ValueoftheMax CS delayisreadfromthemanagementparameterMaxCSdelayUE,
whentheRRCradiobearersetupprocedureisinitiatedfortheHS-DSCHMAC-dflow
establishment.

12.1.7 AMRcodecsetsinCSvoiceoverHSPA
SameAMRcodecsetsaresupportedfortheCSvoiceoverHSPAasfortheCSvoice
overtheR99.ThesupportedAMRandAMR-WBcodecsetsare:

Issue:06H

AMR(12.2,7.95,5.9,4.75),(5.9,4.75)and(12.2)

AMR-WB(12.65,8.85,6.6).

DN0638161

R: 253/396

253

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

WCDMARANRRMHSDPA

WhentheCSvoiceRABisestablishedovertheHSPA,thecell-specificadmission
controlusesalgorithmintroducedinthefunctionOperator is able to configure sets of CS
AMR modes, which are allowed to use in UTRAN for speech callsoftheWCDMA RAN
RRM Admission ControlintheselectionbetweentheAMRcodecsets.FeatureRAN580
Load Based AMR Codec Mode SelectionisnotappliedfortheCSvoiceRAB
establishmentoverHSPA.
IftheAMRcodecsetoftheRABassignmentisthe(12.2,7.95,5.9,4.75)setandthe
outcomeofthecodecsetallocationalgorithmisthe(5.9,4.75)set,theUE-specific
admissioncontrol(AC)firstsetsuptheAMRbearerwiththe(12.2,7.95,5.9,4.75)set.
TheIEUL AMR rateoftheRRCRadio Bearer Setupmessageissettorepresentthe
codecmode5.9kbit/s,whilealltransmissionanduserplane(UP)resourcesare
allocatedforthemaximummodeof12.2kbit/s.AfterthecompletionoftheRAB
assignment,theUE-specificACdowngradesthebearerto(5.9,4.75)setby
reconfiguringtheMAC-dflowsoftheAMRbearer.ThishappensafterthefirstDLactivity
indicationisreceivedfromtheUPfortheAMRbearer.
TheIEUL AMR rateoftheRRCRadio Bearer Reconfiguremessageisset:

equaltothemaximummodeoftheallocatedcodecset(5.9,4.75)
or

equaltothemaximumuplinkmodeoftheuplinkratecontrolrequestifithasbeen
receivedfromMGWandissmallerthanthemaximummodeoftheallocatedcodec
set

FortheRel7UE,theIEUL AMR rateissignaledusingtheRRCTFCcontrolprocedure


afterthecompletionoftheRBreconfigurationprocedure.
IubandIurtransmissionsarereconfiguredtoconformtothemaximummodeofthe
allocatedAMRcodecset.
Inanyothercase,includingallkindsofthehardhandovers,theUE-specificACuses
directlytheselectedAMRcodecsetwhensettinguptheAMRbearerintheHSPA
configuration.
3GPPreferenceconfigurationscanbefoundfromtheTR25.993foreachofthecodec
modeset.

12.1.8 SelectionoftheRLCPDUsize
RLCPDUsizecanbefixedorflexible.FlexiblesizeisusedwhentheFlexibleRLC
featurecanbeusedandthatiswhenthefollowingconditionsaremet:
1. theHS-DSCHservingcellisflexibleRLCPDUsizecapable,
2. theUEisflexibleRLCPDUsizecapable,
3. HS-DSCHisbeingselectedastheDLtransportchanneltypeforthePSRB,
4. AMRLCisused,
5. FRLCEnabledparameterissettovalue1(Enabled)intheRNC,
6. E-DCHisbeingselectedasULchanneltypeforthePSRB,
Otherwise,fixedRLCPDUsizesisused.

254

DN0638161

R: 254/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

ForinformationaboutHS-DSCHMAC-dflowpeakratecalculation,seeHS-DSCHMACdflowpeakdatarate.

FixedRLCPDUsize
SelectingtheRLCPDUsizeisonlyapplicableforPSNRTRBsmappedtotheHSDSCHindownlinkdirection.
RLC(MAC-d)PDUsizeof656bits-inadditiontothecurrentlysupported336bitsis
applicable,whenNRTRBismappedtoHS-DSCHindownlink.RLCPDUsize656bitsis
applicableifHSDPA 15 Codesfeatureisenabled.HigherRLCPDUsizeprovidesless
headeroverhead;therelativepayloadsizeoftheRLCPDUishigherinproportiontothe
smallerRLCPDUsize.
ThebasicprincipleistouseRLCPDUsize656bitsforhighbitratesandRLCPDUsize
336bitsforlow/mediumbitrates.RLCPDUsize656bitscanbeappliedindownlinkonly
(HS-DSCH);RLCPDUsize336bitsisappliedinuplink(E-DCH,DCH).
RLCPDUsizeandMAC-dPDUsizeisfixedforSRBs.RLCPDUsizeis144bitsand
correspondingMAC-dPDUsizeis148bitswhenMAC-hsisused.RLCPDUand
correspondingMAC-dPDUsizeis144bitswhenMAC-ehsisused.
RLCPDUsizeisreconfiguredusingtheRadioBearerReconfigurationprocedurein
conjunctionofthestatetransitionsbetweenCell_FACHandCell_DCH(DLHS-DSCH)
andtransportchannelswitchesbetweenCell_DCH(DLDCH)andCell_DCH(DLHSDSCH).LosslessDLRLCPDUsizechangeandone-sidedre-establishmentoftheDL
RLCentityaresupported.
RLCPDUsizeischoseninthesetupoftheHS-DSCHMAC-dflow.RLCPDUsize656
bitsisusedproviding:

Issue:06H

UEcapabilityMaximumnumberofHS-DSCHcodesreceivedisgreaterthanor
equalto10.

BTScapability,indicatedbytheWCDMABTS(WBTS),supportsRLCPDUsizeof
656bits.
AsregardstheNB/RSxxxBTStypes,theRNCdoesnotusethisindication.Instead,
theRNCassumesthattheNB/RSxxxispersecapableofsupportingMAC-dPDU
sizesof656bits.

TheuseofRLCPDUsize656bitsisallowed,asdefinedbythe
PDUSize656WithHSDSCHmanagementparameter.

ThetotalnumberofcurrentlyallocatedHS-PDSCHcodesisgreaterthanorequalto
PDUSizeCodeThresholdintheservingHS-DSCHcell.
IfthefirstHS-DSCHMAC-dflowistobesetupinthecell,thetotalnumberof
allocatedHS-PDSCHcodesusedforRLCPDUsizeselectionisthenumberwhichis
triedtobeallocatedinconjunctionwiththesetupofthefirstHS-DSCHMAC-dflow.
ThetotalnumberofHS-PDSCHcodesreferstotheHS-PDSCHcodesallocatedby
theRNCfromthespreadingcodetree.

DN0638161

R: 255/396

255

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

WCDMARANRRMHSDPA

PeakdatarateoftheHS-DSCHMAC-dflowisgreaterthanorequaltothe
PDUSizeBitRateThr.SeeequationFigure8:PeakrateatRLCPDUpayloadlevel
aboutthecalculationoftheHS-DSCHMAC-dflowpeakbitrate.TheRNCPDUSizeBitRateThrparameterdefinestheleveloftheHS-DSCHMAC-dflow
peakratebelowwhichRLCPDUsize336bitsisused.Correspondingly,the
parameterdefinestheleveloftheHS-DSCHMAC-dflowpeakrateabovewhich
RLCPDUsize656shouldbeused.

SIRHS-DSCHisgreaterthanorequaltothePDUSizeSizeSIRThr.Seeequation
Figure79:SIRHS-DSCHcalculationbasedonCPICHEc/N0measurementand
equationFigure80:SIRHS-DSCHcalculationbasedonTransmittedCodePower
measurementaboutthecalculationoftheSIRHS-DSCH.

PDUSize656WithHSDSCH,PDUSizeCodeThreshold,PDUSizeBitRateThrand
PDUSizeSizeSIRThrareoperatorcontrollablemanagementparameters.

HS-DSCHSignal-to-Interferenceratio(SIRHS-DSCH)
TherearetwomethodstoestimateSignal-to-Interferenceratio(SIRHS-DSCH)oftheHSDSCHMAC-dflow,whichisutilizedintheselectionoftheRLCPDUsize.Thefirst
alternativeistoutilizeCPICHEc/N0measurementreportedbytheUEandtheotherone
istoutilizeDedicatedTransmittedCodePowermeasurementreportedbytheBTS.
CPICHEc/N0measurementisavailablewhentransferringfromCell_FACHstateto
Cell_DCHstate.InCell_DCHstateCPICHEc/N0measurementisnotconsidered
availablebecausethetimethelastCPICHEc/N0measurementresultisreceivedcanbe
considerablylong.Thus,theDedicatedTransmittedCodePowermeasurementreported
bytheBTSisusedinstead.
TheSIRHS-DSCHcalculationbasedontheCPICHEc/N0measurementreportedbytheUE
isdescribedintheequationFigure79:SIRHS-DSCHcalculationbasedonCPICHEc/N0
measurementandontheDedicatedTransmittedCodePowermeasurementreportedby
theBTSisdescribedintheequationFigure80:SIRHS-DSCHcalculationbasedon
TransmittedCodePowermeasurement.
Figure 79

SIRHS-DSCHcalculationbasedonCPICHEc/N0measurement

TheequationFigure79:SIRHS-DSCHcalculationbasedonCPICHEc/N0measurement
includesthefollowingparameters:

256

PHS-PDSCHistheapproximated,currentlyavailableHS-PDSCHtransmissionpower
[W].ItisobtainedbysubtractingthePtxNonHSPA(Transmittedcarrierpowerofall
codesnotusedforHS-PDSCH,HS-SCCH,E-AGCH,E-RGCHorE-HICH
transmission)measurementvaluefromPmax(BTSmaximumoutputpower).

DN0638161

R: 256/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

GSF16isthespreadinggainoftheSF=16,equalsto16.

PCPICHisthetransmissionpoweroftheprimaryCPICH[W]intheservingHS-DSCH
cell.

(Ec/N0)CPICHisthereceivedprimaryCPICHEc/N0intheservingHS-DSCHcell
reportedbytheUE.

istheDLorthogonalityfactordefinedbytheOrthogonalitymanagementparameter

Ptx_totalistheaveragedtotaltransmittedcarrierpowerofthecell.[W]

Figure 80

SIRHS-DSCHcalculationbasedonTransmittedCodePowermeasurement

TheequationFigure80:SIRHS-DSCHcalculationbasedonTransmittedCodePower
measurementincludesthefollowingparameters,apartfromtheparametersalready
definedfortheFigure79:SIRHS-DSCHcalculationbasedonCPICHEc/N0
measurementequation:

(Eb/N0)iistheDLplannedEb/N0forthe(controloruserplane)serviceoftheuser
definedbyEbNoPlannedCSAMRDLandEbNoPlannedSLDLmanagement
parametersforthedifferentservicesrespectively.

Misthenumberofdifferentservices(controloruserplane)oftheuser.

WistheWCDMAchiprate.

Riistheuserbitrateofthei:thservice.

Ptx_averageisthetransmittedcodepoweroftheradiolinkset[W].

IfCPICHEcNoorPtx_averagemeasurementreportisnotavailable,SIRHS-DSCHconditionis
notevaluated.

12.2 HS-DSCHMAC-dflowparametersoftheCSvoice
RAB
CSvoiceoverHSPAisonlysupportedwithMAC-ehs,soiftheuseofMAC-ehsisnot
possible,thenCSvoiceRABcannotbemappedtoHSPA.
WhentheHS-DSCHMAC-dflowisestablishedfortheCSvoiceRAB,theUE-specific
admissioncontroloftheSRNC/ServingFlexiDirectRNCdefinesthevalueoftheDiscard
Timer.DiscardTimerdefinesthetimetoliveforaMAC-ehsSDUstartingfromtheinstant
ofitsarrivalintoanHSDPAPriorityQueue.TheBTScanuseitasadelayinformationfor

Issue:06H

DN0638161

R: 257/396

257

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

WCDMARANRRMHSDPA

guidingthescheduling.ValueoftheDiscardTimerisreadfromthemanagement
parameterDiscardTimerSCSVoice.IfthevalueoftheparameterisnotOFF,thenit
issignaledastheNBAPpriorityqueueinformationtotheBTS.
WhentheHS-DSCHMAC-dflowisestablishedfortheCSvoiceRAB,theUE-specific
admissioncontroloftheSRNC/ServingFlexiDirectRNCdefinesthevalueofthe
reorderingreleasetimerT1.Intheexpirationofthetimer,thereorderingentityinUE
releasesMAC-ehsPDUstotheupperlayerseventhoughthereareoutstandingPDUs
withlowersequencenumbers.TheBTSmayusethetimertostoptheHSDPA
retransmissionoftheassociatedMAC-ehsPDUs.ValueoftheT1isreadfromthe
managementparameterT1HSCSVoice.ItissignaledastheRRCAdded or reconfigured
MAC-ehs reordering queue information to UE, as the NBAP priority queueinformationto
theBTS.
WhentheHS-DSCHMAC-dflowisestablishedfortheCSvoiceRAB,theUE-specific
admissioncontroloftheSRNC/ServingFlexiDirectRNCdefinesthevalueoftheMACehswindowsizeinthenumberofMAC-ehsPDUs.TheUEusesintheRRCAddedor
reconfiguredMAC-ehsreorderingqueueinformationsignaledvalueoftheIEMAC-ehs
windowsizeasthereceivingwindowsizefortheMAC-ehsPDUsofthepriorityqueue.
ThevalueoftheMAC-ehswindowsizeisreadfromtheexistingmanagementparameter
MAChsrxwidnowsize.TheBTSusesintheNBAPpriorityqueueinformationsignaled
valueoftheIEMAC-hswindowsizeasthetransmittingwindowsizefortheMAC-ehs
PDUsofthepriorityqueue.ThevalueoftheMAC-hswindowsizeaisreadfromthe
existingmanagementparameterMAChstxwidnowsize.OptionalIEMAC-hs
ReorderingBufferSizeforRLC-UMIEoftheNBAPHS-DSCHinformationindicatesin
termsofkBytestheportionofthebufferintheUEthatcanbeusedforRLC-UMtrafficthatis,forthePriorityQueues,whoseRLCModeIEissettoRLC-UM.TheIEisnot
signaledtotheBTS,theBTShasnouseofit.
WhentheHS-DSCHMAC-dflowisestablishedfortheCSvoiceRAB,theUE-specific
admissioncontroloftheSRNC/ServingFlexiDirectRNCdefinestheMAC-dPDUsize
informationfortheBTS.SizeNUMDoftheMAC-DPDUconformingtothemaximumAMR
rateoftheallocatedAMRmodesetissignaledtotheBTSintheNBAPMaximumMACdPDUSizeExtendedIE.MAC-ehsheaderincludestheinformationofthereordering
SDUsizes(MAC-dPDUsizes)thereforeitisnotsignaledonRRCtoUE.
WhentheHS-DSCHMAC-dflowisestablishedfortheCSvoiceRAB,theUE-specific
admissioncontroloftheSRNC/ServingFlexiDirectRNCdefinesthevalueoftheMAChs guaranteed bit ratetoconformtothehighestAMRmodebitrateofthecodecsetthe
cell-specificAChasselectedfortheCSvoicebearer.ConsiderthatNUMDistheMAC-d
PDUsizeofthemaximumAMRmodeofthecodecset.SizeoftheMAC-ehsPDUis
obtainedfromtheequation
Figure 81

SizeoftheMAC-ehsPDU

NLCHID=4bitsfortheLogicalchannelidentifier
NL=11fortheLength
NTSN=6bitsfortheTransmissionSequenceNumber
NSI=2bitsfortheSegmentationIndication

258

DN0638161

R: 258/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HSDPAphysicalchannel,transportchannel,radio
bearer,andRLCconfiguration

NF=1fortheFlag
WhenTTIAMRistheframeperiod0.02softheAMRthevalueGBRMACehsoftheMAC-hs
guaranteed bit rate is (bit/s):
Figure 82

ValueGBRMACehsoftheMAC-hs guaranteed bit rate is (bit/s)

MAC-hsguaranteedbitratevalueintheNBAPMAC-hsGuaranteedBitRateIEtoBTS.
MAC-hs Guaranteed Bit RateIEindicatestheguaranteednumberofbitspersecondthat
theBTSshoulddeliverovertheairinterfaceundernormaloperatingconditions(provided
thereisdatatodeliver).

Issue:06H

DN0638161

R: 259/396

259

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

PowerSavingModeforBTS

WCDMARANRRMHSDPA

13 PowerSavingModeforBTS

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
ThischapteriseffectiveforPowerSavingModeforBTS(RAN955:PWSM).
TheHSPA05reconfigurationduringcellshutdownandcellactivationproceduresin
PowersavingmodeisexecutedattherestrictedenvironmentdefinedinWCDMA RAN
Admission Control.ThepurposeofHSPA05reconfigurationistoswaptheHSPA
servicesfromHSPAlayercellstoDCHcellsbyreconfiguringcellswithoutlockingcells
andlosingcalls.
SwappingofHSPAconfigurationduringshutdownandactivation
Figure 83

HSPAincellshutdownandactivation

IncaseofHSPA5-HSPA0reconfigurationduringshutdownandactivationdescribedin
theexampleoffigureFigure83:HSPAincellshutdownandactivation,theswappingof
HSPAcellsiscarriedoutasfollows:
Table 18

HSPA0-5swappingexample

Start

1stconf

Shutdownofcells

Activationofcells

Cellsoff1

CellSetup

Cellsoff2

CellSetup

0(noPSCR)

IntheHSPA05reconfiguration(HSPA0-5swapping)exampleabovethemeaningsareas
follows:
5meanscellconfiguredasHSPA5cell.
0meanscellconfiguredasHSPA0cell.
-meanscellshutdownbecauseofPWSM(celldeletedfromBTS).

260

DN0638161

R: 260/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

PowerSavingModeforBTS

InHSPAconfigurationexamplethecellinf1phaserepresentsnon-remainingcelland
thecellinf2phaserepresentsremainingcell.InHSPAreconfigurationarequired
numberofNBAP:Physicalsharedchannelreconfigurationrequest(PSCR)messagesis
sentfromtheRNCtotheBTS.ThePSCRismadeafterCellSetupsforHSPA5cellsat
thebeginningandinpointswheretheHSPAtypeofcellischangedfrom5to0orfrom0
to5.

13.1 ConfiguringandreconfiguringHSPA05inacell
HSDPAandHSUPAenabled
WhenconfiguringHSDPAinHSPA05reconfiguration,theHSDPAenabledparameteris
takenintoaccount:

IftheHSDPAenabledparametervalueissettoEnabled,theHSDPAconfigurationat
theCellSetupandattheHSPA05reconfigurationisexecutedaccordingtothe
PWSMlicense,PWSMfeatureusageinBTS,andthecell-levelparameter
PowerSaveHSPAType.

IftheHSDPAenabledparametervalueissettoEnabledandPowerSaveHSPAType
parameterhastheHSPA0value,theHSDPAisnotsetuptoacellandtheHSDPA
(andHSUPA)servicesarenotavailableinthatcell.TheactivationstatusofPower
SavingModeforBTSfeatureisnotrelevant.

IftheHSDPAenabledparametervalueissettoDisabled,noHSDPAisconfiguredto
acellintheCellSetupandintheHSPA05reconfiguration.Thevalueof
PowerSaveHSPATypeparameterhasnorelevanceinthiscase.

IftheHSDPAenabledparametervalueissettoDisabled,theRNCdoesnotreserve
theHS-SCCHsinthecodetree.

ThestatusofHSDPAenabledisverifiedwhenshutdowncellsarebeingactivated.

NotethatifthePowerSaveHSPATypeparameterhastheHSPA5value,andthe
HSDPAenabledparametervalueissettoDisabled,theHSDPAisnotusedinthatcell,
andnoHSDPAresourceswappingintheBTSisrequiredinthiscell.Thereforethe
HSPA05reconfigurationisnotperformedinthiscell.
WhenconfiguringHSUPAinHSPA05reconfiguration,theHSUPAenabledparameteris
takenintoaccount:

Issue:06H

IftheHSUPAenabledparametervalueissettoEnabled,theHSUPAconfigurationat
theCellSetupandattheHSPA05reconfigurationisexecutedaccordingtothe
PWSMlicense,PWSMfeatureusageinBTS,andthecell-levelparameter
PowerSaveHSPAType.

IftheHSUPAenabledparametervalueissettoEnabledandPowerSaveHSPAType
parameterhastheHSPA0value,theHSUPAisnotsetuptoacellandtheHSUPA
servicesarenotavailableinthatcell.TheactivationstatusofPowerSavingModefor
BTSfeatureisnotrelevant.

IftheHSUPAenabledparametervalueissettoDisabled,noHSUPAisconfiguredto
acellintheCellSetupandintheHSPA05reconfiguration.Thevalueof
PowerSaveHSPATypeparameterhasnorelevanceinthiscase.

DN0638161

R: 261/396

261

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

PowerSavingModeforBTS

WCDMARANRRMHSDPA

IftheHSUPAenabledparametervalueissettoDisabled,theRNCdoesnotreserve
theE-AGCHandE-RGCH/E-HICHinthecodetree.

ConfiguringHSPAtoacell
Foreachcell,meanttobeusedforHSPAinFlexiorinUltraBTS,theHSPAcellis
configuredasaHSPA0cell,asaHSPA5cell,orasaNoHSPA05ReConfcell(thatis,
HSPAaccordingtotheconfigurationdefinedinthecontrollerDB).Theconfigurationis
executedaccordingtotheWCELparameterPowerSaveHSPATypeandthecontroller
DBparametersrelatedtotheHSPAconfigurationsetbythenetworkoperator.

NBAPsignalinginHSPAconfiguration
TheHSPAconfigurationisindicatedtotheBTSbytheNBAP:Physicalsharedchannel
reconfigurationrequest(PSCR)message.TheNBAP:PSCRmessageissentbythe
RNC.
Ifthereconfigurationissuccessful,theBTSsendsaNBAP:PSCRmessagetotheRNC.
Ifitfails,theNBAP:Physicalsharedchannelreconfigurationfailuremessageissent
fromtheBTStotheRNC.Thereconfigurationisnotre-attemptedbytheRNC.Analarm
isset.
WhentheHSPAstatusofacellchanges,theBTSindicatestotheRNCtheHSPA
operationalstatebysendingNBAP:Resourcestatusindicationmessage.

HSPAconfigurationatthecellsetupandatthecellactivation
TheHSPAconfigurationisprovidedfromtheRNCtotheBTSattheCellSetupusing
NBAP:PSCRmessageforbothoriginalandmodifiedHSPA5cells.TheHSPA
configurationisalsoprovidedforthecellswhereHSPAisconfiguredwiththe
PowerSaveHSPATypeparametervalueNoHSPA05ReConf(thatis,theHSPAdefinition
accordingtootherHSPAconfiguration-relatedparametersincontrollerDB).AttheCell
SetuptheNBAP:PSCRmessageisnotusedforconfiguringtheHSPA0cellstothe
BTS.TheCellSetupisexecuted,whensettingupthecellforthefirsttime(thatis,after
resettingtheRNCandtheBTS).Duringthecellactivation,theusedHSPAconfiguration
istheonethatwasusedbeforethecellshutdown.

ConfiguringHSPA5toacellintheRNC
IftheHSPAconfigurationisdefinedbytheparameterPowerSaveHSPATypewiththe
HSPA5value,oriftheHSPA0cellisreconfiguredasamodifiedHSPA5cell,theHSPA5
cellconfigurationofacellintheRNCisexecutedasfollows:

262

HSDPAisconfiguredwiththerequiredamountoftheHS-PDSCHsaccordingtothe
parametersetHSPDSCHCodeSet,andwithone(1)tofour(4)HS-SCCHsaccording
tothedynamicallydefinedamountofHS-SCCHs.

HSUPAisconfiguredwiththecodeamountdynamicallysetbytheRNCforbothEAGCHandE-RGCH/E-HICHaccordingtothefunctionIncreasingthenumberof
HSUPAuserspercell.TheconfigurationstartswithonecodeforE-AGCHandone
forE-RGCH/E-HICH.

TheBTSisprovidedwiththeNBAP:PSCRmessagefromtheRNCinbothHSPA5
CellSetupandHSPA0-HSPA5reconfiguration.

DN0638161

R: 262/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

PowerSavingModeforBTS

ConfiguringHSPA0toacellintheRNC
IftheHSPAconfigurationisdefinedbytheparameterPowerSaveHSPATypewiththe
HSPA0value,oriftheoriginalHSPA5cellisreconfiguredasanHSPA0cell,theHSPA0
configurationofacellintheRNCisexecutedasfollows:

HSDPAisconfiguredwith:

zerocodesfortheHS-PDSCHinbothRNCandBTS

one(1)tofour(4)codesperHS-SCCHintheRNCaccordingtotheconfiguration
intheRNWDB,andzerocodesintheBTS

HSUPAisconfiguredwithonecodeforE-AGCHandonecodeforE-RGCH/E-HICH
intheRNC.HSUPAisconfiguredwithzerocodesintheBTS.

TheHS-SCCH,E-AGCH,andE-RCGH/E-HICHcodesareallocatedalwaysinthe
RNCattheCellSetupphasefortheHSPA0cell.

NBAP:PSCRmessagedoesnotprovidezerocodesofHS-SCCH,E-AGCH,andERGCH/E-HICHtotheBTSintheHSPA0configurationattheCellSetupphase.

NBAP:PSCRmessageprovideszerocodesofHS-SCCH,E-AGCH,andERGCH/E-HICHtotheBTSintheHSPA0configurationattheHSPA5-HSPA0
reconfiguringphase.

HSPAcapabilityadditionandremoval
TheHSPAcapabilityadditiontotheHSPA0cellismadebyreconfiguringtheHSPA0cell
asamodifiedHSPA5cell.Thepre-reservedHS-SCCH,E-AGCH,andE-RGCH/E-HICH
codesintheRNCareindicatedtotheBTSintheNBAP:PSCRmessage.TheRNC
reservestherequirednumberofHS-PDSCHcodesfromthecodetreeandindicates
themtotheBTSinthesameNBAP:PSCRmessage.
TheHSPAcapabilityremovalfromacellisexecutedbyreconfiguringanoriginalHSPA5
cellasaHSPA0cellwithNBAP:PSCRmessagefromtheRNCtotheBTSasfollows:

theHSDPAwithzeroHS-PDSCHcodesandzeroHS-SCCHcodestoacell(HSSCCHzerocodesindicatedinPSCRwithHS-SCCHFDDCodeInformationIE
choice remove)

theHSUPAwithzerocodesforbothE-AGCHandE-RGCH/E-HICH

TheRNCreleasesallHS-PDSCHcodesinthecodetreeandstopsallthe
measurementsrelatedtotheHSPA.TheRNCkeepstheHS-SCCHcodesreserved(one
(1)tofour(4)accordingtotheRNCRNW)inthecodetree.TheRNCalsokeepsoneEAGCHcodeandoneE-RGCH/E-HICHcodereservedinthecodetree.

Issue:06H

DN0638161

R: 263/396

263

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

PowerSavingModeforBTS

WCDMARANRRMHSDPA

13.2 PWSMlicenseandBTSfeatureswitchinHSPA05
reconfiguration
Thecell-levelHSPA05configurationattheCellSetupandtheHSPA05reconfiguration
duringcell/layershutdownandactivationisexecutedonlyifthePWSMlicenseinthe
RNCissettoON.IfthePWSMlicenseissettoOFForCONFIG,theHSPA
configurationinacellisdefinedinthecontrollerDB.

BTSlevelPWSMfeatureswitch
Thecell-levelHSPA05configurationattheCellSetupandtheHSPA05reconfiguration
duringcell/layershutdownandactivationisexecutedonlyifthePWSMfeatureswitch
PWSMInUseintheBTSissettoON.IfthePWSMfeatureswitchPWSMInUseintheBTS
issettoOFF,theHSPAconfigurationinacellisdefinedinthecontrollerDB.

PWSMlicenseandfeatureparameterchange
ThefollowingissuesaretakenintoaccountbytheRNCinactivatingtheshutdowncells,
whenthePWSMlicenseischangedfromONtoOFF/CONFIG,orwhentheBTSlevel
featureswitchPWSMInUseischangedfromONtoOFF.
WhenthePWSMlicenseischangedfromONtoOFForCONFIG,therulesapplytoall
thecellsintheRNC.WhentheBTSlevelfeatureswitchPWSMInUseischangedfrom
ONtoOFF,therulesapplytothecellsofthatBTS.TheprocedureismadeontheBTS
basis(thatisfollowingtheresultsontheBTSbasis).Theprocedureusedincell
activationandHSPA05reconfigurationisdefinedinsectionHSPA05reconfigurationin
PWSMcell/layeractivation.TheHSPAconfigurationincellisexecutedasdefinedin
sectionConfiguringandreconfiguringHSPA05inacell.
NotethattheHSPA05reconfigurationatPWSMlicensechangetoOFF/CONFIGor
PWSMfeatureparameterchangetoOFFdoesnotapplytolockedcells.

13.3 RequirementstoHSPA05reconfiguration
HS-PDSCHcodereservation
ReconfigurationofacellfromHSPA0toHSPA5requiresroomforHS-PSDCHs.The
requirednumberofHS-PDSCHsistheminimumvaluedefinedbytheparameterset
HSPDSCHCodeSet.Thecode-treeoptimizationiscarriedoutcontinuouslyintheRNCto
HSPA0cells,focusingtoprovidingroomfortheHS-PDSCHcodesasdefinedinthis
document.WhenHSUPAisenabledinacell,theallocationtoHS-SCCH,E-AGCH,and
E-RGCH/E-HICHcodesisalwayskeptintheRNC(thesecodesarenotremovedfrom
theRNCinHSPA5-HSPA0reconfigurationeveniftheyareremovedfromtheBTS).
TherequirednumberoftheHS-PDSCHcodesisreservedfromthecodetreeofallthese
cells.IftheHS-PDSCHreservationfromthecodetreeissuccessfulinallthecells
selectedfromHSPA0-HSPA5reconfiguration,thecellshutdownandHSPA05

264

DN0638161

R: 264/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

PowerSavingModeforBTS

reconfigurationprocedurecontinues.OtherwisetheHS-PDSCHreservationsare
releasedinthecellswherereservationwassuccessfulandnocell/layershutdownor
HSPA05reconfigurationisattempted.

Channel-typeswitchfromHSPAtoDCHincellsforshutdown
TheHSPA-DCHchannel-typeswitchisattemptingfirstfortheCSservices.Ifthe
channel-typeswitchissuccessfulforallCEservicesinallthecellsforshutdown,then
thechannel-typeswitchisexecutedforallPSservicesinallthecellsforshutdown.At
minimum,DCH0/0isallocatedforthePSservices.Afterthechannel-typeswitch,the
cellshutdownandHSPA05reconfigurationprocedurestarts.
Ifthechannel-typeswitchisunsuccessfulforoneormoreCSservices,thennocell
shutdownorHSPA05reconfigurationisattempted.

TimingofHSPAreconfiguration
AlltheunlockedandactivecellsinonefrequencylayerandinonePWSMcellgroupin
theBTSarereconfiguredatthesametimeinbothPWSMcellshutdownandPWSMcell
activation.ThisisrequiredbecauseoftheneedtohavethesameActiveSetforboth
DCHandHSPAcellsinonefrequencyintheBTS.TheRNCsendsthePSCRmessages
atthesametimetotheBTSindicatingallthecellsinthesamefrequencythatneedtobe
reconfigured.

13.4 HSPA05reconfigurationinPWSMcell/layer
shutdown
Whenthecriteriaforcell/layershutdownaretriggered,aspartoftheshutdowncriteria,
theneedforHSPA05reconfigurationisverified.IfthereisaneedforHSPA05
reconfiguration,thecellsforthereconfigurationareselectedandtheHS-PDSCHcode
reservationsinthesecellsaremade.IfeachcellforreconfigurationfromHSPA0to
HSPA5hasenoughroomatleastfortherequirednumberofHS-PDSCHs,thenthecells
forshutdownarereconfiguredfromHSPA5toHSPA0andtheselectedcellsfromHSPA0
toHSPA5.
Thepre-requisitestotheproceduresare:

ThePWSMcellshutdowncriteriaaretriggeredtoallthecellsforshutdown.

AneedforHSPA05reconfigurationisdetected.

CellsforHSPA05reconfigurationareselected.

HS-PDSCHreservationinthecellsforreconfigurationissuccessful.

Channel-typeswitchfromHSPAtoDCHinthecellforshutdownissuccessful.

NotethattheHSPA05reconfigurationtakesplaceaspartoftheprocedurecell/layer
shutdownbecauseofPWSM.ThereconfigurationisnotexecutedinCellDeletionfor
administrativereason(likecelladminlock).

Issue:06H

DN0638161

R: 265/396

265

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

PowerSavingModeforBTS

WCDMARANRRMHSDPA

13.4.1 HSPA5-HSPA0reconfiguration
TheHSPA0-HSPA5reconfigurationincludesproceduresforreconfiguringshutdown
cellsfromHSPA5toHSPA0withPSCR.
Whenthepre-requisitesarefulfilled,theHSPA5cellsforshutdownarereconfiguredto
HSPA0cells.ForeachcellaPSCRmessageissenttotheBTSatthesametime.
IftheHSPA5-HSPA0reconfigurationissuccessfulinallthecells(thatis,whentheRN
receivesfromtheBTSaPSCRResponsemessagesrelatedtoallcellsattemptedfor
reconfiguration),theprocedurecontinueswiththeHSPA0-HSPA5reconfiguration.
IftheHSPA5-HSPA0reconfigurationisunsuccessfulinsomecells(thatis,whenthe
RNCreceivesfromtheBTSaPSCRFailuremessagerelatedtocellswithfailed
reconfiguration),theCellDeletionprocedureisstartedforcellstobeshutdown.Afterthe
CellDeletionprocedures,theHSPA0-HSPA5reconfigurationisattemptedforthe
selectedcells.

13.4.2 HSPA0-HSPA5reconfiguration
AftertheHSPA5-HSPA0successfulreconfigurationtoallthecellsfortheshutdownor
whentheCellDeletionhasbeenperformedtocellsfortheshutdown(unsuccessful
HSPA5-HSPA0reconfigurationcase),theHSPA0-HSPA5reconfigurationisattempted
forallthecellsselectedforreconfiguration.ForeachcellaPSCRmessageissenttothe
BTSatthesametime.IftheRNCreceivesfromtheBTSallthePhysicalsharedchannel
reconfigurationresponsemessagesrelatedtoallcellsattemptedforreconfiguration,the
reconfigurationisconsideredsuccessfulandthecorrespondingcounterisupdatedby
theRNC.AfterthattheCellDeletionprocedureisexecutedinallthecellsforthe
shutdownbecauseofthePWSMunlessithasalreadybeenexecutedduringtheHSPA5
-HSPA0reconfiguration.
IftheHSPA0-HSPA5reconfigurationisunsuccessfulinsomecells(thatis,whenthe
RNCreceivesfromtheBTSaPSCRFailuremessagesrelatedtocellswithfailed
reconfiguration),theHSPArecoveryisappliedtounsuccessfulcases.TheCellDeletion
proceduresareexecutedinallthecellsfortheshutdownbecauseofthePWSMunlessit
hasalreadybeenexecutedduringtheHSPA5-HSPA0reconfiguration.

13.5 HSPA05reconfigurationinPWSMcell/layer
activation
Whenthecriteriaforcell/layeractivationaretriggeredandthecell/layeractivation
becauseofthePWSMisexecuted,theneedforHSPA05reconfigurationisverified.Ifa
needforHSPA05reconfigurationisdetected,theHSPA5-HSPA0reconfigurationis
executedforselectedcells.AfterthattheHSPA5configurationstartsinactivatedcells.
Thepre-requisitestotheproceduresare:

266

ThecellsselectedforactivationbecauseofthePWSMaresuccessfullysetup.

AneedforHSPA05reconfigurationisdetected.

DN0638161

R: 266/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

PowerSavingModeforBTS

CellsforHSPA5-HSPA0reconfigurationareselected.

NotethattheHSPA05reconfigurationtakesplaceaspartofthecell/layeractivation
procedureexecutedbecauseofthePWSM.Thereconfigurationdoesnottakeplacein
CellSetupprocedureexecutedforothercellsetupreasonsthancellactivationinPWSM.

13.5.1 HSPA5-HSPA0reconfiguration
TheHSPA5-HSPA0reconfigurationisexecutedafterthecellsetupprocedureforeach
cellforactivationthatissuccessfullycompleted,andbeforetheHSPA5configurationto
activatedcells.Itincludesthefollowingprocedures:

channel-typeswitchfromHSPAtoDCHinmodifiedHSPA5cells

reconfigurationfromHSPA5toHSPA0inmodifiedHSPA5cellsselectedfor
reconfigurationwithPSCR

Whenthepre-requisitesarefulfilled,theRNCexecutesthechannel-typeswitchfrom
HSPAtoDCHinmodifiedHSPA5cellsselectedforHSPA05reconfiguration.TheHSPADCHchannel-typeswitchisattemptedfirstfortheCSservices.AfterthatthechanneltypeswitchisexecutedforallPSservicesinallthecellsforshutdown.Atminimum,
DCH0/0isallocatedforPSservices.Theunsuccessfulchannel-typeswitchforCS
servicedoesnotpreventthecell-activationattempt.Afterthechannel-typeswitchthe
HSPA5cellsarereconfiguredtoHSPA0cells.ForeachcellaPSCRmessageissentto
theBTSatthesametime.
IftheHSPA5-HSPA0reconfigurationissuccessfulinallthecells(thatis,whentheRNC
receivesfromtheBTSaPSCRResponsemessagesrelatedtoallcellsattemptedfor
reconfiguration),theprocedurecontinueswithconfiguringHSPA5toactivatedcells.
IftheHSPA5-HSPA0reconfigurationisunsuccessfulinsomecells(thatiswhenthe
RNCreceivesfromtheBTSaPSCRFailuremessagesrelatedtocellswithfailed
reconfiguration),theHSPA5-HSPA0reconfigurationisattempteduntilsuccessful.After
thattheprocedurecontinueswithconfiguringHSPA5toactivatedcells.

13.5.2 HSPA5configurationtosetupcells
AfterthesuccessfulreconfigurationofHSPA5-HSPA0inallthecellsisselectedfor
reconfiguration,theHSPA5configurationisattemptedforallthecellsactivatedbecause
ofthePWSM.ThePSCRmessages(oneperconfiguredcell)aresenttotheBTSatthe
sametime.WhentheRNCreceivesallthePhysicalsharedchannelreconfiguration
responsemessagesfromtheBTS,theHSPA5configurationisconsideredsuccessful
andtheHSPA05reconfigurationincellactivationissuccessful.Thecorresponding
counterisupdatedbytheRNC.IftheconfigurationofHSPA5inactivatedcellsis
unsuccessfulinsomecells(thatis,whentheRNCreceivesfromtheBTSaPSCR
Failuremessagesrelatedtocellswithfailedreconfiguration),theHSPArecoveryis
appliedtotheunsuccessfulcases.

Issue:06H

DN0638161

R: 267/396

267

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

PowerSavingModeforBTS

WCDMARANRRMHSDPA

13.6 OtherHSPA05reconfigurationissues
13.6.1 CTSfromDCHtoHSPAincellswithconfiguredHSPA
WhentheHSPAisconfiguredtoacell(eitheraHSPA5cellatcellactivationbecauseof
PWSM,oraHSPA0cellreconfiguredtoprovideHSPAservices),thechannel-typeswitch
isperformedfromDCHtoHSPA.Thisswitchisexecutedduetotheexistingtriggering
reasons(seeWCDMA RAN RRM Handover Control),orisexecutedduetoachangeof
HSPAoperationalstate.Thedetectionisbasedonverificationperformedperiodicallyat
one-minuteintervals.

13.6.2 RNCReset
AftertheRNCreset,theHSPAconfigurationofallthecellsisusedasdefinedin
controllerDBandbyPowerSaveHSPATypeparameter.Theconfigurationistakeninto
accountinthecellsetupphase.TheoriginalHSPA05configurationisused.

13.6.3 BTSReset
AftertheBTSreset,theHSPAconfigurationofallthecellsintheBTSisdefinedin
controllerDBandbyPowerSaveHSPATypeparameter.Theconfigurationistakeninto
accountinthecellsetupphase.TheoriginalHSPA05configurationisused.

13.6.4 HSPA05reconfigurationstatistics
TheRNCprovidescountersformeasuringthenumberofsuccessfulandunsuccessful
HSPA05reconfigurationcasesincell/layershutdownsandincell/layeractivations
becauseofthePowerSavingModeforBTS.TheHSPA05reconfigurationincludesboth
HSPA0-HSPA5reconfigurationandHSPA5-HSPA0reconfiguration.Relevantcounter
forsuccessfulHSPA05reconfigurationisupdatedifallthecellsinreconfiguredlayers
havebeensuccessfullyreconfigured.RelevantcounterforunsuccessfulHSPA05
reconfigurationisupdatedifreconfigurationofoneormorecellsfails.
RNCprovidesthefollowingcountersinthemeasurementtypeM1031WBTSResource
(thecountersareupdatedfortheWBTSobject.):

268

NumberofsuccessfulHSPA05reconfigurationsatcellshutdownduetoPWSM

NumberofunsuccessfulHSPA05reconfigurationsatcellshutdownduetoPWSM

NumberofsuccessfulHSPA05reconfigurationsatcellactivationduetoPWSM

NumberofunsuccessfulHSPA05reconfigurationsatcellactivationduetoPWSM

DN0638161

R: 268/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

MIMO(MultipleInputMultipleOutput)

14 MIMO(MultipleInputMultipleOutput)

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
ThischapteriseffectiveforMultipleInputMultipleOutput(RAN1642:MIMOand
RAN1912:MIMO42Mbps).
MIMOiscontrolledbythecelllevelON/OFFswitchparameterintheRNC.MIMOis
enabled/disabledbytheWCEL-MIMOEnabledparameter.Inordertomodify
MIMOEnabledparameter,objectlocking(WCEL)isrequired.Stateofthecellisnot
allowedtochangefromLockedtoUnlockedifthestateofthelicenseisCONFIG/OFF
andtheMIMOEnabledmanagementparameterissettoEnabled.
ThevalueoftheMIMOEnabledparameterisreadinconnectionwiththeHS-DSCH
MAC-dflowsetup.TheMIMOEnabledparameterisreadintheservingcell.The
parameterisnotreadintheE-DCHnon-servingcell.
InFlexiDirectRNCtherearenolicensesthatcontrolMIMOfeature.MIMOiscontrolled
bytheRNClicensekeyintheIPA-RNCsolution.Thelicenseisalong-termcapacitybasedlicense.Thelicensecapacityinformationisthenumberofcells.TheRNC
monitorsandreportstoNetActhowmanycellshavethefeatureactivated.
O&MverifiesthattheMIMOfeaturedoesnotexceedthecapacityvalueindicatedinthe
licenseintermsofnumberofcells.ThechangeoftheWCEL-MIMOEnabledparameter
toEnabledconsumesthelicenseintermsofnumberofcells.ThechangeoftheWCELMIMOEnabledparametertoDisabledfreesthelicenseintermsofnumberofcells.
O&M,cellandUE-specificpacketschedulerreadthelicenseintheprogramblocksetup
phaseandwhennotificationarrivesfromthelicensecontrolsystem.
MIMOisnotusedfornewRRCconnectionsifthestateofthelicenseisCONFIG/OFFor
thevalueoftheWCEL-MIMOEnabledparameterissettoDisabled.

14.1 MIMOsupportedforNRTPSdata
MIMOisnotsupportedforCSservicesorRTPS(ConversationalandStreaming
services).MIMOisnotsupportedifthereisasimultaneousCSRAB(s),orwhentheRT
StreamingPSRABisestablished.
MIMOissupportedforthefollowingRBandSRBmappingoptions:

RBmappedontoHS-DSCHinDLandE-DCHinUL

SRBmappedontoHS-DSCHinDLandE-DCHinUL

SRBmappedontoDCHinDLandE-DCHinUL

IfSRBismappedontotheDLDCH,theULSRBismappedontoE-DCH,andE-DCH2
msTTIisused.MIMOisnotusedifE-DCH2msTTIcannotbeused,andifSRBis
mappedontoDCHinDL.

Issue:06H

DN0638161

R: 269/396

269

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

MIMO(MultipleInputMultipleOutput)

WCDMARANRRMHSDPA

IfSRBismappedontotheDLHS-DSCH(F-DPCH),theULSRBismappedontoEDCH,andeitherE-DCH10msTTIorE-DCH2msTTIcanbeused.
MIMOisnotusedifULSRBcannotbemappedontoE-DCH.
IfSRBismappedontoDLHS-DSCH,theF-DPCHisusedasdescribedinFractional
DedicatedPhysicalChannel(F-DPCH)andSRBsonHSPA.E-DCH2msTTIisusedas
describedinWCDMA RAN RRM HSUPA,ifSRBismappedontoE-DCHinUL,andEDCH2msTTIisused.

14.2 MIMOactivationanddeactivationfortheHS-DSCH
MAC-dflow
TheRNCactivatesMIMOfortheUEandtheBTSwhenHS-DSCHMAC-dflowissetup
forNRTRAB.MIMOisactivatedanddeactivatedperUE,notperHS-DSCHMAC-dflow.
MIMOactivationmeansthatMIMOparametersaresenttotheUE(RRC)andtheBTS
(NBAP).
MIMOactivationisnotpossibleintheRRCconnectionsetupphasewithRRC
CONNECTIONSETUPmessage.
MAC-ehsisconfiguredwhenMIMOisactivatedfortheUE.MAC-hsisnotusedfor
MIMO
E-DCHismandatoryforHSDPAMIMO,otherwiseHSDPAMIMOdoesnotaffectE-DCH
allocation.DLSRBcanbemappedontoDCHorHS-DSCH(F-DPCH).ULSRBis
mappedontoE-DCH.
IfHS-DSCHMAC-dflowsetupforMIMOwithorwithout64QAMfailsintheBTS,the
failureprocedurefollowstheseprinciples:

SpecialhandlingoftheDL radio resources not availablefailurecause.


See,ULDCHreturnchannel.

OtherpossiblefailurecausesdonotcauseMIMO-specifichandling.

TherearenoMIMO-specificfailurehandlingprocedureswhenMIMOwithorwithout
64QAMfailsbecauseoftheRNCinternalreasonsortheBTSrejection.
MIMOisalwaysactivatedfortheUEandtheBTSwhenMIMOusageispossible.If
conditionschangesothatMIMOactivationbecomespossible,theRNCactivatesMIMO.
InordertoactivateMIMOfortheUE,UEmustbeMIMOcapable.
ConditionsthatmakeMIMOactivationpossiblearepresentedinthefollowingsteps:

270

MIMOEnabledWCEL-parameterissettoEnabled

BTSMIMOcapabilityissettoMIMOCapable

RABconfigurationoftheUEchangessothatMIMOissupported

FlexibleRLC(MAC-ehs)canbeconfigured

DN0638161

R: 270/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

MIMO(MultipleInputMultipleOutput)

E-DCH2msTTIcanbeused(ULSRBmappedontoE-DCH)ifDLSRBismapped
ontoDCH,oralternativelyDLSRBcanbemappedontoHS-DSCH(F-DPCH),and
ULSRBcanbemappedontoE-DCH.

SimultaneoususageofMIMOandDCHSDPAissupported.Formoreinformation,see
SimultaneoususagewithMIMO.
MIMOisdeactivatedintheUEandBTSalwayswhenMIMOusageisimpossible.The
RNCdeactivatesMIMOwhenMIMOusagebecomesimpossible.
ConditionsthatrequireMIMOdeactivationarepresentedinthefollowingsteps:

MIMOEnabledWCEL-parameterissettoDisabled

BTSMIMOcapabilityissettoMIMONon-Capable

RABconfigurationoftheUEchanges,sothatMIMOisnotsupported

FixedRLCmustbeconfigured(FlexibleRLC,orMAC-ehscannotbeused)

E-DCH2msTTIcannotbeusediftheDLSRBismappedontoDCH,oralternatively
DLSRBcannotbemappedontoHS-DSCH(F-DPCH).

MIMOEnabledWCEL-parameterandBTScapabilityarereadintheservingcellin
connectionwiththeHS-DSCHMAC-dflowsetup.Thisincludesthehardhandover
(HHO)andtheservingcellchange(SCC).
MIMOdoesnotintroducenewtriggerstostartthechanneltypeswitchfromDCHtoHSDSCH/E-DCH(RB),ortoF-DPCH(SRB).AlsoMIMOdoesnotintroducenewtriggersto
changethefixedRLCtotheflexibleRLC.
MIMOactivationanddeactivationisperformedbyusingthesameNBAPandRRC
procedurethatisusedfortheRL/RBreconfiguration.
TheULloadbasedACforHSPA+featuresarepossibletobeappliedfortheMIMO
allocations.

Inter-operabilitywithHSDPA64QAM
TheconfigurationthatusesMIMOwith64QAMintheUEandBTSisallowed.Thisis
trueinconnectionwiththeHS-DSCHMAC-dflowsetupforNRTRAB.MIMO
configurationisperformedasmentionedinprinciplesforMIMOwithout64QAM.64QAM
configurationfollowstheprinciplesfor64QAMwithoutMIMO.
MIMOwith64QAMisactivatedintheUEandBTSalwayswhentheconditionsallows
theRNCtoconfigurethesimultaneoususageoftheMIMOwith64QAM.Thefollowing
conditionsmakestheMIMOwith64QAMpossible:

Issue:06H

MIMOisusedasdescribedinMIMOsupportedforNRTPSdataandMIMO
activationanddeactivationfortheHS-DSCHMAC-dflow

HSDPA64QAMisused

ThesimultaneoususageoftheMIMOand64QAMisallowedwiththe
MIMOWith64QAMUsageWCELparameter

BTScapabilityindicatesSixtyfourQAM DL and MIMO Combined Capability

DN0638161

R: 271/396

271

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

MIMO(MultipleInputMultipleOutput)

WCDMARANRRMHSDPA

TheMIMOWith64QAMUsageparameterandBTScapabilityarereadintheservingcellin
connectionwiththeHS-DSCHMAC-dflowsetup.Thisincludesthehardhandover
(HHO)andtheservingcellchange(SCC).UEmustbeMIMOwith64QAMcapableto
usesimultaneousMIMOand64QAMconfiguration.
IfoneofthedescribedconditionschangesandthesimultaneoususageofMIMOwith
64QAMisnotpossibleanymore,theRNCattemptstoconfigureMIMOwithout64QAM
atfirst.IfMIMOcannotbeused,the64QAMremainsinuse.ThishappenswhenMIMO
without64QAMor64QAMwithoutMIMOisstillpossible.Whenneitherofthosetwois
possible,theHSDPAwithoutMIMOandwithout64QAMisconfigured.MIMOwith
64QAMactivation/deactivationandotherneededradiolinkandradiobearer
reconfigurationsareperformedbyusingthesameNBAP/RRCprocedure.MIMOwith
64QAMsupportsthesameRABcombinations,RB,andSRBmappingoptionsasMIMO
without64QAM,asdescribedinMIMOactivationanddeactivationfortheHS-DSCH
MAC-dflow.

14.3 MIMOutilizationofS-CPICH
TheRNCallocatessecondaryCPICH(S-CPICH)forMIMO.Channelization(spreading)
codeforthesecondaryCPICH(S-CPICH)isallocatedinthecellsetupifMIMOis
enabledinthecell.FormoreinformationonhowtoenableMIMOinthecell,seeMIMO
(MultipleInputMultipleOutput).SpreadingfactoroftheS-CPICHisSF256.The
channelizationcodefortheS-CPICHisallocatedinconnectionwiththecellsetup,so
thatthecodetreeconsumptionisminimized,takingintoaccountalltheothercommon
channelcodesallocatedinthecellsetup.
S-CPICHchannelizationcodeisnotreleasedorreconfiguredaslongasMIMOis
enabledinthecell.CodetreeoptimizationisnotappliedtoS-CPICH.
TransmissionpowerofthesecondaryCPICH(S-CPICH)isdefinedbytheRNCinthe
cellsetup.ThesamepowerisallocatedtoS-CPICHandP-CPICH.P-CPICH
transmissionpowerisdefinedbytheWCEL-PtxPrimaryCPICHRNW-parameter,which
alsodefinestheS-CPICHtransmissionpower.S-CPICHtransmissionpowerissignaled
relativetoP-CPICHtransmissionpowerinNBAP.

14.4 Featuredependencies
MIMOrequiresthefollowingfeaturesintheRNC:

RAN1638 Flexible RLCthatisenabledbytheFRLCEnabled(RNC)parameter

RAN1258 HSDPA 14 Mbps per userthatisenabledbytheHSDPA14MbpsPerUser


(WBTS)parameter

RAN1470 HSUPA 2 ms TTIthatisenabledbytheHSUPA2MSTTIEnabled(WCEL)


parameter

AdditionallyMIMOalsorequiresthefollowingfeatures:

272

HSDPAthatiscontrolledbytheHSDPAenabled(WCEL)parameter.

DN0638161

R: 272/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

MIMO(MultipleInputMultipleOutput)

RAN828 HSDPA Serving Cell Changeand RAN829 HSDPA Soft/softer Handover for
Associated DPCHthatarecontrolledbytheHSDPAMobility(RNC)parameter.

RAN312 HSDPA Dynamic Resource Allocationthatiscontrolledbythe


HSDPADynamicResourceAllocation(RNC)parameter.

HSUPAthatiscontrolledbytheHSUPAEnabled(WCEL)parameter.

AlsothecorrespondinglicensesarerequiredintheRNC.
MIMOHSDPACapabilityBasedHandover(MIMOCAHO)requirestheexistingHSPA
CapabilityBasedHandover(HSCAHO)feature.HSCAHOisanoptionalfeature
controlledbythesameRNClevelON/OFFlicensekeyasHSDPAIFHO.
MIMOmodificationstotheHSPALayeringforUEsinCommonChannelsfeatureare
applicableonlyifHSPALayeringforUEsinCommonChannelsfeatureisenabled.For
moreinformation,seeWCDMA RAN RRM Handover Control.

Issue:06H

DN0638161

R: 273/396

273

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Dual-CellHSDPA

WCDMARANRRMHSDPA

15 Dual-CellHSDPA

g
g
g

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
ForIPA-RNCsolutiontheRAN1906: Dual-Cell HSDPA 42 Mbpsfeatureis
controlledbyalong-termcapacitylicensekeyDCHSDPA.Thetypeofthe
licensekeyisthecapacitylicense(numberofcells).
ForFlexiDirectRNCsolutiontherearenolicenseswhatsoeversothe
RAN1906featureisavailablebydefault.Thefeaturecanbeenabledbysetting
theDCellHSDPAEnabledparametertoEnabled.
TheDCHSDPAfeatureisenabledinthecellwhenthefollowingconditionsareeffective:

ThelicenseofthefeatureisinstalledintheRNCandthestateofthefeatureisON.

ThevalueoftheDCellHSDPAEnabledWCELparameterissettoEnabled.See
chapterConfigurationoftheDCHSDPAinthecellsetupphaseformoreinformation
aboutthepre-conditionsthatarerequiredtosettheparametervaluetoEnabled.

ThefeatureisoutofuseinthecellifeitherthestateofthefeatureisOFF/CONFIG,or
thevalueoftheDCellHSDPAEnabledWCELparameterissettoDisabled.
O&MverifiesthattheDCHSDPAfeaturedoesnotexceedthecapacityvalueindicatedin
thelicensecapacityfieldintermsofnumberofcells(forRNCsolutiononly).Thechange
oftheDCellHSDPAEnabledWCELparametertoEnabledconsumesthelicensein
termsofnumberofcells.ThusaDCHSDPAcellpairconsumestwolicenses.The
changeoftheDCellHSDPAEnabledWCELparametertoDisabledfreesthelicensein
termsofnumberofcells.O&Mreadsthelicenseintheprogramblocksetupphaseand
whennotificationarrivesfromthelicensecontrolsystem.
StandaloneSRBsarenotmappedtoDCHSDPA.ThisisvalidbothintheRRC
connectionsetupphaseandwhenthelastNRTRB>0/>0mappedtoDCHSDPAis
released.IntheRRCconnectionsetup,optionsdefinedinthesectionAllocationofFDPCHinRRCconnectionsetupphaseareappliedinstead.
InCELL_DCHstate,theRRMdoesnotchangethefrequencyinordertomaketheDC
HSDPAallocationpossible.ThisrestrictionisvalidinfixedDCHSDPAconfiguration
whentheRRCconnectioniscurrentlyinthepotentialsecondarylayer.
TheRNCallocatesasecondaryH-RNTIfortheUE.TheRNCallocatesasecondaryHRNTIfromthesamepoolastheprimaryH-RNTI.Alsotheallocationalgorithmissimilar
asinthecurrentprimaryH-RNTIallocation.AlltheallocatedH-RNTIsmustbeindividual.
ThesettingofNBRfortheSCorDCHSDPAallocationisnotestimatedintermsofused
powerbytheRRM.

274

DN0638161

R: 274/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Dual-CellHSDPA

15.1 DCHSDPAsupportedforNRTPSdata
DCHSDPAissupportedwithNRTPSservicesonly.
DCHSDPAisnotsupportedwhenatleastoneofthefollowingservicesisconfigured:

conversationalservice

streamingservice

WhenF-DPCHisconfiguredandSRBsareonHSPA,theDCHSDPAwithorwithout
MIMOisnotsupportedifatleastoneradiolinkisoverIur.DCHSDPAisswitchedtoa
SCHSDPAwhenfirstbranchoverIurisbeingaddedtoactiveset.
WithDCHSDPA,amaximum4MAC-dflowsperUEisutilized.
ThesetupofthefirstRT(conversationalorstreaming)RABcausesthereleaseofDC
HSDPAmapping.
ThereleaseofthelastRT(conversationalorstreaming)RABmakestheDCHSDPA
allocationpossible.

15.2 ConfigurationoftheDCHSDPAinthecellsetup
phase
TheRNC(O&M)verifieswhetheritispossibletoconfiguretheDCHSDPAinthecell
setupphase.TwocellscanformapotentialDCHSDPAcellpairwhen:

Thedownlinkcarrierfrequenciesofthecellsbelongtothesamefrequencyband.
TheUARFCNWCELparameter(UTRA Absolute Radio Frequency Channel
Number)definesthedownlinkchannelnumberandthedownlinkcarrierfrequencyof
thecell.

Theybelongtothesamesector.TheSectorIDWCELparametergivesaunique
identifiertoasectorofthebasestationtowhichthecellbelongs.

TheyhavethesameTcellvalue.TheTcellWCELparameterdefinesthestartof
theSCH,CPICH,PrimaryCCPCH,andDLScramblingCode(s)inacellrelativeto
BFN.ThecellswhichbelongtothesameTcellgroupareallocatedtothesame
MAC-hs/ehsscheduler.

ThecellsoftheDCHSDPAcellpaircanbelongtothesamePLMNortodifferent
PLMNs.
TheDCHSDPAfeatureisenabledinacellwiththeDCellHSDPAEnabledWCEL
parameter.TheDCHSDPAfeaturecanbeenabledinacellpair(thefeaturemustbe
enabledinbothcells)whenthefollowingfeaturesareenabledintheRNC,intheBTS,
andinbothcellsofthecellpairduringthecellsetupphase:

Issue:06H

MobilitywiththeservingHS-DSCHcellchange

DN0638161

R: 275/396

275

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Dual-CellHSDPA

WCDMARANRRMHSDPA

ThefeaturemustbeenabledinordertoactivatetheDual-CellHSDPAfeature.The
HSDPAMobilityRNCparameterenables/disablestheservingHS-DSCHcell
changeandSHOoftheassociatedDPCH.TheservingHS-DSCHcellchangeand
SHOoftheassociatedDPCHmustbeenabledinordertoactivatetheDual-Cell
HSDPAfeature.TheDual-CellHSDPAfeatureisoutofuseifthevalueofthe
HSDPAMobilityRNCparameterisdisabled.

FlexibleRLC
ThefeaturemustbeenabledintheRNCinordertoactivatetheDual-CellHSDPA
feature.TheFRLCEnabledRNCconfigurationparameterdefineswhetherFlexible
RLCisenabledintheRNC.

HSDPA14MbpsperUser
ThefeaturemustbeenabledintheBTSinordertoactivatetheDual-CellHSDPA
featureinthecellpair.TheHSDPA14MbpsPerUserWBTSparameterdefines
whetherHSDPA14MbpsperuserisenabledintheBTS.

HSDPA15Codes
ThefeaturemustbeenabledintheRNCinordertoactivatetheDualCellHSDPA
featureinthecellpair.Atleast10codeslicensefortheHSDPA15Codesfeatureis
required.TheHSPDSCHCodeSetWCEL-parameterdefinestheHS-PDSCHcodeset
usabilityinthecell.Toreachthemaximumpeakdatarate,15HS-PDSCHcodes
mustbeavailableinbothcells.However,activationoftheDualCellHSDPAfeature
doesnotrequireanyspecificnumberofHS-PDSCHcodes.Dualcelloperationis
possiblewithanysupportednumberofHS-PDSCHcodes.

HSUPA
Thefeaturemustbeenabledinone(fixedconfiguration)orbothcells(flexible
configuration)oftheDCHSDPAcellpair.TheHSUPAEnabledWCELparameter
defineswhetherHSUPAisenabledinthecell.

QoSAwareHSPAScheduling
TheHSPAQoSEnabledWCELparameterdefineswhetherQoSAwareHSPA
Schedulingisenabledinthecell.Theparametermusthavethesamevalueinboth
cellsoftheDCHSDPAcellpair.

MIMO
ThefeaturecanbeenabledinaDCHSDPAcelliftheHSUPAfeatureisenabledin
theDCHSDPAcell.TheMIMOfeaturemustbedisabledinaDCHSDPAcellifthe
HSUPAfeatureisdisabledintheDCHSDPAcell.InordertoactivatetheDCHSDPA
featureinacellpair,theMIMOfeaturemustnotbeenabledinanyotherthanDC
HSDPAcellwithinthesector.TheMIMOEnabledWCELparameterdefineswhether
theMIMOfeatureisenabledinthecell.

TheRNCconsidersaDCHSDPAcellpairasaflexibleDCHSDPAconfigurationwhen
theHSUPAfeatureisenabledinbothcellsoftheDCHSDPAcellpair.Inflexible
configurationbothcellscanoperateatthesametimeas:

276

primaryservingHS-DSCHcellforsomeDCHSDPAcapableUEs

secondaryHS-DSCHservingcellforsomeotherDCHSDPAcapableUEs

singlecarrierHS(D)PAservingcellforSCHS(D)PAcapablebutnotDCHSDPA
capableUEs

memberoftheActiveSetforyetotherUEs

DN0638161

R: 276/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Dual-CellHSDPA

TheRNCconsidersaDCHSDPAcellpairasafixedDCHSDPAconfigurationwhenthe
HSUPAfeatureisenabledonlyinoneoftheDCHSDPAcells.Infixedconfigurationthe
cellwhichhastheHSUPAfeatureenabled(primaryservingHS-DSCHcell)canoperate
as:

primaryservingHS-DSCHcellforsomeDCHSDPAcapableUEs

singlecarrierHS(D)PAservingcellforSCHS(D)PAcapablebutnotDCHSDPA
capableUEs

memberoftheActiveSetforyetotherUEs

InfixedconfigurationthecellwheretheHSUPAfeatureisnotenabled(secondary
servingHS-DSCHcell)canoperateas:

secondaryservingHS-DSCHcellforsomeDCHSDPAcapableUEs

singlecarrierHS(D)PAservingcellforSCHS(D)PAcapablebutnotDCHSDPA
capableUEs

memberoftheActiveSetforyetotherUEs

AgroupofcellsfromwhichthecellpairisformedbytheRNCisdefinedbytheWCELTcellparameter.AllDCHSDPAcapablecells,fromwhichthecellpairisformed,needs
tohavesetthesameTcellparametervalue.ThesameTcellvalueispossiblein
threeDCHSDPAcellsinthesamesector.TheonlyconditionthatthosethreeDC
HSDPAcellsneedtofulfillisthattheyhaveadjacentfrequencieswithinthesame
frequencyband.ThereisalsoapossibilitytodefinetwodistinctDC-HSDPAcellpairsin
thesector.inthiscasesecondpairmusthavedifferentTcellvaluethatthefirstone.
Iftherearetwopossiblesecondaryservingcellcandidates,theRNCchoosesthe
secondarycellasdescribedinSelectionofthesecondarycell.

15.3 RNCreceivescapabilityinformationfromBTS
TheRNCreceivesinformationfromtheBTSwhetheritsupportstheDCHSDPA.The
usedmessagesareNBAP:AUDITRESPONSEandNBAP:RESOURCESTATUS
INDICATIONandtheusedinformationelementisMultiCellCapabilityInfo.
TheBTSincludestheMultiCellCapabilityInfoIEintheNBAP:AUDITRESPONSE
messageandsetstheMultiCellCapabilityIEvaluetoMulti Cell CapableforeveryDC
HSDPAcapableLocalCell.ThesecondaryservingHS-DSCHcelllistisnotvalidandthe
RNCignoresthePossibleSecondaryServingCellListIEintheNBAP:AUDIT
RESPONSEmessage.
TheBTSreportsthepossiblesecondaryservingHS-DSCHcellsintheNBAP:
RESOURCESTATUSINDICATIONmessage.Thatis,theBTSincludestheMultiCell
CapabilityInfoIEintheNBAP:RESOURCESTATUSINDICATIONmessageandsets
theMultiCellCapabilityIEvaluetoMulti Cell CapableforeveryDCHSDPAcapable
LocalCell.IftheLocalCellcanoperateasaprimaryservingHS-DSCHcell,thenthe
PossibleSecondaryServingCellListIEcontainstheidentifieroftheLocalCellthatcan
operateasasecondaryservingHS-DSCHcell.

Issue:06H

DN0638161

R: 277/396

277

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Dual-CellHSDPA

WCDMARANRRMHSDPA

WhenthecapabilitiesofaLocalCellchangeattheWBTS,theWBTSreportsthenew
capabilitybysendingaRESOURCESTATUSINDICATIONmessagecontaininga
Service ImpactingIndicationandtheLocalCellIDIE.IftheMultiCellCapabilityand/or
thepossiblesecondaryservingcellshavechangedfortheLocalCell,thenewcapability
isindicatedintheMultiCellCapabilityInfoIE.

VerificationoftheDCHSDPAconfigurationsupport
TheRNCverifieswhethertheLocalCellsintheWBTSsupporttheDCHSDPA
configurationduringtheNBAP:AuditandNBAP:Resource Status Indicationprocedures.
InbothcasesthevalueoftheMulti Cell Capability InfoIEmustbeMultiCellCapablein
everyLocalCellwheretheDCHSDPAfeatureisenabled(DCellHSDPAEnabledWCEL
parameter).WhenDCHSDPAisenabledbuttheWBTSreportsthattheLocalCellisnot
multi-cellcapable,theRNCsetsthe7795INCONSISTENCYINHIGHPEAKRATE
HSPACONFIG(MultiCelloperationnotavailable)alarmduringacellsetup.
Asaconsequenceofthisalarm,theDCHSDPAfeaturecannotbeusedintheparticular
cell.

15.4 SimultaneoususagewithMIMO
ThefunctionalitiesdescribedinthischapterarerelevantwhenDCHSDPAwithMIMOis
activatedinUE.
DCHSDPAisenabledwiththeDCellHSDPAEnabledparameter,andthesectoris
definedwiththeSectorIDparameter.
IfDCHSDPAisenabledinanycellofthesector,thefollowingpossibilitiesare
introduced:

MIMOcanbeenabled(WCEL-MIMOEnabled)intheprimaryDCHSDPAcapable
cellsincaseofthefixedconfiguration

MIMOcanbeenabledintheprimaryDCHSDPAcapablecellsincaseoftheflexible
configuration

MIMOcannotbeenabledinthecellifthecellisonlythesecondaryDCHSDPA
capablecell

MIMOcannotbeenabledinanyothercellthanDCHSDPAcell

ThecellisconsideredastheprimarycapablecellifHSUPAisenabledinthecellwiththe
HSUPAEnabledWCELparameter.
IfDC-HSDPAisnotenabledinanycellofthesector,theMIMOlayerconfigurationisnot
restrictedbytheRNC.
CellconfigurationrestrictionsarecheckedbyO&Mwhenthefollowingparametersare
modified:

278

WCEL-DCellHSDPAEnabled

WCEL-MIMOEnabled

WCEL-HSUPAEnabled

DN0638161

R: 278/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Dual-CellHSDPA

WCEL-SectorID

ThefollowingcombinationsofsimultaneoususageofMIMOwithDCHSDPAinthe
primaryandsecondaryDCHSDPAcellsarepossible:

MIMOwithDCHSDPAisactivatedintheUEintheprimaryandsecondaryDC
HSDPAcell.

MIMOwithDCHSDPAisactivatedintheUEonlyintheprimaryDCHSDPAcell.

MIMOwithDCHSDPAisactivatedintheUEinthesecondaryDC-HSDPAcell.This
ispossibleonlyifMIMOwithDCHSDPAisactivatedintheUEalsointheprimary
DCHSDPAcell.

Ifitispossible,MIMOisattemptedtobeactivatedinbothprimaryandsecondarycell
(DualMIMO).IfMIMOusageinsecondarycellisnotpossiblethenitisactivatedonlyin
primarycell(PrimaryMIMO).InPrimaryMIMO,withHSDPA 64QAMfeatureactivated,
themaximumachievabledatarateis63Mbit/s.Without64QAMthemaximumdaterate
is42Mbit/s.
TheRAN1907: DC-HSDPA with MIMO 84 MbpsfeaturesupportsSRBsmappedto
HSPA(HS-DSCH/E-DCH).Hence,theRAN1201: Fractional DPCHfeaturemustbe
enabledinthecell(withtheFDPCHEnabledWCELparameter)toallocateDCHSDPA
withMIMOfortheUE.Formoreinformationonpreconditionsforsimultaneoususageof
DC-HSPDAwithMIMO,seechaptersActivationintheprimaryandsecondarycelland
SupportoftheRABcombinations.

15.4.1 Selectionofthesecondarycell
TheselectionofthesecondarycellismadeintheRNCwhenDCHSDPAwithMIMOis
activatedintheUE.TheprimaryDCHSDPAcellcanhavetwosecondaryservingcell
candidates.ThesecondaryservingcellselectionisexecutedalwayswhenthefirstHSDSCHMAC-dflowissetupfortheUEinCell_DCHstate.Thatincludesthehard
handover(HHO)andtheservingcellchange(SCC).WhenDC-HSDPAisdeactivatedin
Cell_DCHstate,forexample,becauseofnon-supportedRABcombinations,the
secondarycellisnotreselected.WhenDC-HSDPAisactivatedagaininthesame
primaryservingcell,theoriginalsecondarycellisused.
Figure 84

DCHSDPAwithtwopossiblesecondarycellcandidates

ThefigureshowsanexampleofacellconfigurationwheretheRNCmustchoosethe
secondarycellfromtwopossiblecandidates.Thecellf1andcellf2canoperateasthe
primaryDCHSDPAcell.MIMOcanbeactivatedincellf1andcellf2.MIMOcannotbe
activatedinthecellf3.Ifcellf2operatesastheprimaryDC-HSDPAcell,cellf1andcellf3
canoperateassecondaryDCHSDPAcell.Inthiscase,theRNCchooseswhethercell
f1orcellf3isconfiguredasthesecondarycell.

Issue:06H

DN0638161

R: 279/396

279

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Dual-CellHSDPA

WCDMARANRRMHSDPA

WhenDCHSDPAwithMIMOisactivated,theMIMO-capablesecondarycell(f1inthe
figure)ischosenfortheDCHSDPAwithMIMOcapableUE.IncaseofDCHSDPAwith
MIMO,thesecondarycellisselectedasfollows:
1. MIMOwith64QAM-capablesecondarycellischosenifMIMOwith64QAMcanbe
activatedintheUEintheprimarycell
2. TheMIMO-capablesecondarycellischosenifMIMOcanbeactivatedintheUEin
theprimarycell
3. TheRNCchoosesthesecondarycellwheretheabsolutenumberofexistingHSDSCHMAC-dflowsislower.IftheabsolutenumberofexistingHS-DSCHMAC-d
flowsisthesame,candidatesareconsideredequalandeitherofthemcanbe
chosen.

ThesecondarycellselectionincaseofDCHSDPAwithoutMIMO
WhenDCHSDPAwithMIMOcannotbeactivatedintheprimarycell,thesecondarycell
isselectedasfollows:
1. The64QAM-capablesecondarycellischosenif64QAMcanbeactivatedintheUE
intheprimarycell
2. TheRNCchoosesasthesecondarycelltheonewheretheabsolutenumberof
existingHS-DSCHMAC-dflowsislower.IftheabsolutenumberofexistingHSDSCHMAC-dflowsisthesame,candidatesareconsideredequalandeitherofthem
canbechosen.
Figure 85

DCHSDPAwithtwopossiblenon-MIMOsecondarycellcandidates

AslongasthereisanHS-DSCHMAC-dflowsetupfortheUEandDCHSDPAis
activated,theRNCdoesnotchangethesecondaryserving.Thesecondaryservingcell
ischangedonlyiftheprimaryservingcellchanges.

15.4.2 ActivationinconnectionwiththeHS-DSCHMAC-dflow
setup
TheconfigurationofDCHSDPAwithMIMOfortheUEandBTSinconnectionwiththe
HS-DSCHMAC-dflowsetupisusedforNRTRAB.TheDCHSDPAconfigurationfollows
theprinciplesdescribedintheDual-CellHSDPA,andMIMOconfigurationfollowsthe
principlesdescribedintheMIMO(MultipleInputMultipleOutput).The64QAMisused
simultaneouslywithDCHSDPAandMIMOalwayswhenpossible.
IfHS-DSCHMAC-dflowsetupforDCHSDPAwithMIMOfailsintheBTS,thefailure
procedurefollowstheseprinciples:

280

DN0638161

R: 280/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Dual-CellHSDPA

SpecialhandlingoftheDL radio resources not availablefailurecause.


See,ULDCHreturnchannel

OtherpossiblefailurecausesdonotcauseDCHSDPAorMIMO-specifichandling

TherearenoanyDCHSDPAorMIMO-specificfailurehandlingprocedureswhenDC
HSDPAwithMIMOfailsbecauseofRNCinternalreasonsoraBTSrejection.

15.4.3 Activationintheprimaryandsecondarycell
DCHSDPAwithMIMOisactivatedintheUEandBTSintheprimaryandsecondarycell
(DualMIMO)whentheconditionsallowtheRNCtoconfigurethesimultaneoususageof
theDCHSDPAandMIMO.ThefollowingconditionsmakestheDC-HSDPAwithMIMO
possible:

MIMOisusedasdescribedinMIMO(MultipleInputMultipleOutput).

DCHSDPAisusedasdescribedinDual-CellHSDPA.

ThesimultaneoususageoftheDCHSDPAandMIMOisallowedwiththe
DCellAndMIMOUsageWCELparameter.

BTScapabilityindicatesMulticell and MIMO Combined Capability.

SRBismappedtoDLHS-DSCH/ULE-DCHandF-DPCHisused.

FlexibleRLC(MAC-ehs)isactivated.

RABconfigurationoftheUEchangessothatDCHSDPAwithMIMOissupported.

TheDCellAndMIMOUsageWCELparameterandBTScapabilityarereadintheserving
cellinconnectionwiththeHS-DSCHMAC-dflowsetup.Thisincludesthehardhandover
(HHO)andtheservingcellchange(SCC).
MIMOisactivatedintheUEandBTSinthesecondarycell(DualMIMO)alwayswhen
thesimultaneoususageoftheDCHSDPAandMIMOispossibleandMIMOisactivated
intheprimarycell(PrimaryMIMO).
IfoneofthedescribedconditionschangesandthesimultaneoususageofDCHSDPA
andMIMOisnotpossibleanymore,theRNCattemptstochoosebetweenDCHSDPA
andMIMO.ThechoiceisbasedonRNC-DCellVsMIMOPreferenceRNCparameter.
ThishappenswhenDCHSDPAwithoutMIMOorMIMOwithoutDCHSDPAisstill
possible.IfsimultaneoususageofDCHSDPAwithMIMOisnotpossible,thenoneofthe
featuresisused(DCHSDPAorMIMO),dependingonpreferences.WhenneitherDC
HSDPAnorMIMOispossibleanymore,theSCHSDPAwithoutMIMOisused.
IfoneofthedescribedconditionschangesandthesimultaneoususageoftheDC
HSDPAwithMIMOisnotpossibleanymoreinthesecondarycell,theMIMOoperation
changesfromDualMIMOtoPrimaryMIMO.

15.4.4 SupportoftheRABcombinations
DCHSDPAwithMIMOsupportsthesameRABcombinationsastheparentfeatures:

Issue:06H

OnlyNRT(InteractiveandBackground)PSservicesaresupported

DN0638161

R: 281/396

281

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Dual-CellHSDPA

WCDMARANRRMHSDPA

ThreesimultaneousPSNRTRABsaresupportedprovidedthatHSPA Multi NRT


RABsfeatureisenabled

CSservicesorRTPS(ConversationalandStreamingservices)arenotsupported.

SimultaneousCSRAB(s)orRTPSRAB(s)arenotallowed

DCHSDPAwithMIMOissupportedforthefollowingRBandSRBmappingoptions:

RBmappedontoHS-DSCHinDLandE-DCHinUL

SRBmappedontoHS-DSCHinDLandE-DCHinUL(F-DPCH)

IfRBcannotbemappedontoDLHS-DSCHandULE-DCH,DCHSDPAwithMIMO
cannotbeconfiguredintouse.IfDCHSDPAwithMIMOisconfiguredinuse,andifRB
cannotbemappedontoDLHS-DSCHandULE-DCHanymore,DCHSDPAwithMIMO
isdeactivated.
ThesamesituationoccursincaseofSRBmappedontoDLHS-DSCHandULE-DCH.
IfSRBismappedontoDLDCH/ULDCHorDLDCH/ULE-DCH,SRBmappingis
switchedtoDLHS-DSCH/ULE-DCHbeforeDCHSDPAwithMIMOcanbeactivated.
SRBmappedontoDLHS-DSCH/ULE-DCHandF-DPCHissupportedandusedas
describedintheFractionalDedicatedPhysicalChannel(F-DPCH)andSRBsonHSPA.
DCHSDPAwithMIMOdoesnotaffectE-DCHallocationbutE-DCHissupportedand
usedaccordingtotheexistingprinciples.Both10msand2msE-DCHTTIissupported.

15.5 ULloadbasedACforHSPA+features
TheRAN2879: Mass Event HandlerfeatureincludestheUL load based AC for HSPA+
featuresfunction,whichlimitstheusageoffollowingHSPA+features:

MIMOwithsinglecellHSDPAallocation,referredasSC-HSDPAwithMIMORAN1912:MIMO42Mbps

DualCellHSDPAallocation,referredasDC-HSDPA-RAN1906:Dual-CellHSDPA
42Mbps

DC-HSDPAwithMIMO-RAN1907:DC-HSDPAwithMIMO84Mbps

TheallocationoftheseHSPA+featuresisnotallowed,whenthedefinedULload
thresholdinthecellisexceededorwhentheMassEventHandlerLoad_State = High
(thecheckofthestateisperformedonlyintheprimaryservingcell).
WhentheusageofHSPA+featureisnotallowedforthenewHS-DCSH,theallocation
canbedoneonlyasnormalsinglecellHSDPA,referredasSC-HSDPA.

ULloadbasedACuseramountcalculationincell
Thecell-specificPSmaintainstheULloadbasedHSDPAuseramountinthecell,with
reconfiguredHS-DSCHandDCHallocationsofthecell.
TheULloadbasedHSDPAuseramountofthecellUL_LOAD_HSDPA_UA_CELLis
definedwiththefollowingformula:

282

DN0638161

R: 282/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Dual-CellHSDPA

Figure 86

ULloadbasedHSDPAuseramountofthecellformula.

Figure 87

UEwithprimaryHS-DSCHallocationinacell.

Where:

UL_LOAD_HSDPA_UA_UE:istheUEwithprimaryHS-DSCHallocationinacell

CQI_type_UE:istheCQItypemultiplieroftheUEandequalstooneofthefollowing
values:

UEwithdefaultCQIallocation(noMassEventHandler,neitherCPC):
CQI_type_UEis1.0

UEwithMassEventHandlerCQIallocation(theMEHCQIFeedbackCycle
parameterused):CQI_type_UEis0.8.

UEusingCPC:CQI_type_UEis0.4.

HS-DSCH_type_UE:istheHS_DSCHallocationtypeoftheUEandhasthe
followingvalues:

UEwithSC-HSDPA=1.0

UEwithSC-HSDPAwithMIMO=1.2

UEwithDC-HSDPA=1.2

UEwithDC-HSDPAwithMIMO=2.4

NormDCHUAis0,2*(IDCH_CELL/IDPDCH_amr_12_2_NB)
TheIDCH_CELListhetotalDCHloadfactorinacell,wheretheDPCCHLFpartis
subtracted.
TheIDPDCH_amr_12_2_NBistheloadfactorofAMR12.2kbpsNBreferenceservice.

TheULloadbasedHSDPAuseramountiscalculatedbysummingupallocatedHSDPA
usertypesofthecell.ThecellspecificPSkeepstrackofthe
UL_LOAD_HSDPA_UA_CELLandNormDCHUAineachcell,withtheUEcurrent
reconfiguredconfiguration.TheadmittedHSDPAusers,whicharenotreconfigured,are
nottakenintoaccount.

DecisiontoalloworpreventuseofHSPA+feature
Thecell-specificPSexecutestheULloadbasedACforthefollowingHSPA+
functionalities:

Issue:06H

MIMOwithsinglecellHSDPAallocation

DualCellHSDPAallocation

MIMOwithDualCarrierHSDPAallocation

DN0638161

R: 283/396

283

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Dual-CellHSDPA

WCDMARANRRMHSDPA

TheULloadbasedACisdonewhenthenbothofthefollowingconditionsare
simultaneouslymet:

theWCEL-MassEventHandlerparameterissettothevalue:bit5

theWCEL-MEHULLHSDPAUALimitparameterissettovalidlimitationvalue(>0)

TheULloadbasedACforHSPA+isbasedonthefollowingcondition(theACis
successful,whentheconditionisfulfilled):
Figure 88

TheULloadbasedACfortheHSDPA+condition

TheACisexecutedfortheprimaryservingcell,whentheHS-DSCHMAC-dflow
allocationforUEisrequestedfromtheCellspecificPS.Thecheckisdoneforthefirst
andthefollowingHS-DSCHMAC-dflowallocationrequestsintheprimaryservingcell.
TheACdoesnotconsidertheloadofthenewHS-DSCHallocation,butonlythe
reconfiguredallocationsinthecellatthemomentoftheadmissiondecision.Ifthevalue
oftheUL_LOAD_HSDPA_UA_CELLexceedstheWCEL-MEHULLHSDPAUALimit
parameter,noactionisdonetoexistingHSPA+allocationinthecell.TheACistargeted
onlytonewHS-DSCHallocations.
WhentheACisfailed,thenewHS-DSCHuserallocationisadmittedonlyasSC-HSDPA
allocationwithoutanyHSPA+features.
TheusageoftheHSPA+featuresisalsoprevented,whentheMEHLoad_State=High
andtheWCEL-MassEventHandlerparameterissettothevalue:bit5.
Whentheallocationofnon-firstHS-DSCHMAC-dflowisrequestedforUE,existing
HSPA+allocationnotanymoreallowedfortheUE,iftheACpreventstheusageof
HSPA+features.
WhenaUEalreadyhastheHS-DSCH MAC-d flowwithHSPA+configurationandthe
useofHSPA+ispreventedfornewHS-DSCHMAC-dflowofthatsameUE,thentheUE
ismappedtoSC-HSDPAconfiguration.

284

DN0638161

R: 284/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HighSpeedCell_FACH

16 HighSpeedCell_FACH

NotethatallthedescribedfunctionalitiesandfeaturesarevalidforIPA-RNC
solution,mcRNCsolution,andtheFlexiDirectRNCsolution.Ifthefeatureis
product-specificthentherelevantinformationisgiveninthedescription.
ThischapteriseffectiveforHighSpeedCell_FACH(RAN1637: High Speed Cell_FACH
DLandRAN1913: High Speed Cell_FACH).
TheRAN1637: High Speed Cell_FACH DL featureenablestheHSDPAusageinthe
Cell_FACHstate.ThisfeatureutilizestheenhancedCell_FACHstatespecificationsof
the3GPPR7release.TheRAN1913: High Speed Cell_FACHfeatureenablestheHSPA
usageintheCell_FACHstate.Thisfeatureusesthe3GPPenhancedCell_FACHstate
fordownlink(Rel7)anduplink(Rel8).
Thelogicalchannels(BCCH/CCCH/DCCH/DTCH)mappedinpreviousreleasestothe
FACHtransportchannelcanbemappedtoHS-DSCHforimprovingtheperformance.
Thelogicalchannels(CCCH/DCCH/DTCH)mappedinpreviousreleasestotheRACH
transportchannelcanbemappedtoE-DCHforimprovingtheULperformance.Thenew
logicalchanneltotransportchannelmappingschemeisappliedattheMAClayer.No
newtransportorphysicalchannelsareintroduced.
Figure 89

Logical/transport/physicalchannelmappingintheDLwithHSDPAusagein
Cell_FACHstate

FortheHSDPAreceptionintheCell_FACHstate,theconfigurationofHS-DSCH,HSSCCH,andcommonH-RNTIareincludedinthesysteminformationbroadcast(SIB5).
CommonH-RNTIisusedtoaddressmultipleUEsintheCell_FACHstatewhentheUE
doesnothaveavaliddedicatedH-RNTI.
TheUEstartsmonitoringtheHS-SCCHandwhenitdetectstheH-RNTI,itdecodesthe
datafromtheHS-DSCH.WhenthecommonH-RNTIisused,theU-RNTIisincludedin
theMACheaderforaddressingtheUE.WhentheUEhasRRCConnection,validCRNTI,andvalidH-RNTI,thededicatedH-RNTIisusedalsoinaCell_FACHstate.

Issue:06H

DN0638161

R: 285/396

285

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HighSpeedCell_FACH

WCDMARANRRMHSDPA

Becauseoflackofdedicateduplinkfeedbacksignalingchannel,theHSDPAHARQ
cannotbeusedintheCell_FACHstate.Instead,MAClayerisconfiguredtoexecute
fixedretransmissions.TheuplinkuserdataistransmittedviaR99RACH.
Figure 90

HSDPAusageinCell_FACHstatewithULRACHvs.HSDPAusagein
Cell_DCHstatewithdedicatedchannels.

WhenHS-RACHisused,theassignedcommonE-DCHresourcesareallocatedforthe
UE,innerlooppowercontrolisstarted,andtheUEisabletosendACK/NACKandCQI
fortheHS-DSCH.

16.1 HS-FACHfunctionality
16.1.1 SetupofHS-FACHconfigurationtothecell
TheBTSinformstheRNCwhetheracertaincellsupportsHS-FACH(capabilityofHigh
Speed-FACH)bysendingaNBAP:AUDITRESPONSEor/andaRESOURCESTATUS
INDICATIONmessageinEnhancedFACHCapabilityIE.ThecellsupportsHS-FACH
whentheIEisincludedinthemessagewithvaluesettoEnhancedFACHCapable.
IfthecellsupportsHS-FACHandtheHigh Speed Cell_FACH DLfeatureisenabled(by
usingHSFACHEnabledWCELparameter),theHS-FACHconfigurationissetuptothe
cellduringthecell-setupphaseimmediatelyafterasuccessfulsetup/configurationof
HSDPAinthecell.
SetupofHS-FACHtowardstheBTSisperformedbyusingtheNBAP:PhysicalShared
ChannelReconfigurationprocedure.
TheRNCbroadcaststheHS-FACHconfigurationwithinappropriateIEsvia
RRC:SIB5/SIB5bismessageiftheHS-FACHisconfiguredsuccessfullyinthecell.

286

DN0638161

R: 286/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HighSpeedCell_FACH

Figure 91

SetupofHS-FACH

BTS

RNC

loop

Audit Procedure
loop

Cell Setup & Common Transport Channel Setup (RACH) procedure

One or two times per BTS

Repeated as many times as there


are cells in the BTS. Can happen
in parallel / concurrently

loop

Common Transport Channel Setup procedure / FACH / PCH

Repeated as many times as there


are SCCPCH channels configured
at the cell.

loop

Common Measurement Initiation procedure

R99
For each measurement in current
cell

Physical Shared Channel Reconfiguration procedure /


HSDPA setup for CELL_DCH
Dedicated channel DL high speed
data in current cell

Measurement Initiation procedure

Physical Shared Channel Reconfiguration procedure /


HSUPA setup for CELL_DCH
Dedicated channel UL high speed
data in current cell

Measurement Initiation procedure

NBAP: PHYSICAL SHARED CHANNEL RECONFIGURATION REQUEST

Physical Shared Channel Reconfiguration procedure /


HSDPA setup for HS CELL_FACH

HS-FACH setup;
- Request message indicates HSDSCH Common System Information
IE.
- Response message indicates HSDSCH Common System Information
Response IE (includes, for example,
HS-SCCH code and HARQ memory
information for HS-FACH

NBAP: PHYSICAL SHARED CHANNEL RECONFIGURATION RESPONSE

loop

Iub Transport Bearer Setup procedure


(Common flow setup for HS-FACH)

System Information Update procedure

Note ALCAP Only


Executed 2 times:
once for BCCH + CCCH + DCCH,
and once for DTCH

SYS INFOs + System Information Block


type 5/5bis:
- HS-DSCH common system information

Activation/deactivationofthecellrequiresWCELobjectlockingprocedure.

16.1.2 UEcapabilityoftheHS-FACH
HS-FACH(HighSpeed-FACH)issupportedbyRel7andnewerUE.ItinformstheRNC
aboutitsHS-FACHcapabilitybysendingtheRRCmessage:RRCCONNECTION
REQUESTorCELLUPDATE(URA_UPDATE)withtheHS-PDSCHinCELL_FACHIE
valuesettoTRUE.ThevalueoftheHS-PDSCHinCELL_FACHIEisalsosettoTRUE
intheUEradioaccesscapabilityinformationiftheUEsupportsit.UEradiocapability
informationcanbereceivedfromtheUEintheoptionalUEradioaccesscapabilityIEof
theRRC:RRCCONNECTIONSETUPCOMPLETEmessage.
TheabsenceofHS-PDSCHinCELL_FACHIEindicatesthattheUEdoesnotsupport
HS-FACH(HS-PDSCHreceptioninCell_FACH).

Issue:06H

DN0638161

R: 287/396

287

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HighSpeedCell_FACH

WCDMARANRRMHSDPA

InhandoversituationsthetargetRNCcanreceiveinformationaboutHS-FACHsupport
withintheInterRATHandoverInfowithInterRATCapabilitiesfromthesourceRATorin
theSRNSRelocationInfofromthesourceRNCintheRRCInformationtotargetRNCof
theRANAP:RELOCATIONREQUESTmessage.

16.1.3 HS-DSCHCommonSystemInformation
DuringsetupofHS-FACH,CRNCincludestheHS-DSCH Common System Information
IEintheNBAP:PHYSICALSHAREDCHANNELRECONFIGURATIONREQUEST
message.
TheCRNCdeterminesthevaluesforRACH Measurement ResultIE,BCCH Specific
HS-DSCH-RNTI InformationIE,andCommon MAC Flow Priority Queue InformationIE
oftheCommonMACFlowSpecificInformation.
ThevaluefortheRACH Measurement ResultIEisdeterminedbytheRNPparameter
RACHIntraFreqMesQuant(defaultvalueisCPICHEc/No).
BCCH Specific HS-DSCH-RNTI InformationIEincludesH-RNTI,HS-SCCHPower,and
HS-PDSCHPowerinformationforBCCHtransmissionusingHS-DSCH:

ThevaluefortheBCCH Specific HS-DSCH RNTIIEisgeneratedbytheRNC


algorithm.

ThevaluefortheHS-SCCHPowerIEisdeterminedbythePtxBCCHHSSCCHRNP
parameter(defaultvalueis-2dB).

ThevaluefortheHS-PDSCH PowerIEisdeterminedbythePtxBCCHHSPDSCH
RNPparameter(defaultvalueis+7dB).

TherehavebeendefinedtwoCommonMACFlows,oneforBCCH,CCCH,andDCCH
useandtheotheroneforDTCHuse.

16.1.4 PriorityqueueinformationfortheCommonMACFlow
carryingBCCH,CCCH,andDCCHdata
TheRNCdefinesCommon MAC Flow Priority queue informationIEvaluesofthe
CommonMACFlow-specificinformationcarryingBCCH,CCCH,andDCCHdataas
follows:

288

Scheduling Priority IndicatorIE(SPI)isdefinedbyradionetworkconfiguration


parameterPriForSRBsOnHSPA(defaultvalueis15).

T1IEisdefinedbyradionetworkconfigurationparameterT1HSFACH(defaultvalue
is20ms).

MAC-ehs Reset TimerIEisdefinedbyradionetworkconfigurationparameter


HSFACHResetTimer(defaultvalueis2).

Discard TimerIEisdefinedbyradionetworkconfigurationparameter
HSFACHDiscardTimer(defaultvalueis40ms).

MAC-hs Window sizeIE,constantvalue16isused.

Maximum MAC-c PDU sizeIE,constantvalue18bytesisused.

DN0638161

R: 288/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HighSpeedCell_FACH

InformationissenttotheBTSusingNBAP:PHYSICALSHAREDCHANNEL
RECONFIGURATIONREQUESTmessage.

16.1.5 PriorityqueueinformationfortheCommonMACFlow
carryingDTCHdata
TheRNCdefines Common MAC Flow Priority queue informationIEvaluesofthe
CommonMACFlow-specificinformationcarryingDTCHdataasfollows:

Scheduling Priority IndicatorIE(SPI)isdefinedbyradionetworkconfiguration


parameterPriForHSFACHDTCH(defaultvalueis0).

T1IE,constantvalue120msisused.

MAC-ehs Reset TimerIEisdefinedbyradionetworkconfigurationparameter


HSFACHRestTimerDTCH(defaultvalueis2).

Discard TimerIEisdefinedbyradionetworkconfigurationparameter
HSFACHDiscardTimerDTCH(defaultvalueis160ms).

MAC-hs Window sizeIE,constantvalue16isused.

Maximum MAC-c PDU sizeIE,constantvalue42bytesisused.

InformationissenttotheBTSusingNBAP:PHYSICALSHAREDCHANNEL
RECONFIGURATIONREQUESTmessage.

16.1.6 ThemaximumnumberofdedicatedH-RNTIsforHS-FACH
users
ThemaximumnumberofallocateddedicatedH-RNTIsforHS-FACHusersis:

600percell

1024perBTS

If600H-RNTIshavebeenallocatedforHS-FACHusersandthecell-specificentity
receivesnewH-RNTIrequestfortheHS-FACHuser,itisrejectedwithanappropriate
cause.
If1024H-RNTIshavebeenallocatedforHS-FACHusers,theallocationofnewH-RNTI
isforbiddenforthecomingHS-FACHuserwithanappropriatecause.
BecauseoftheshortageofH-RNTIs,thehandlingoftheUE,whichistryingtomoveto
Cell_FACHstate,isbasedonthestatefromwhichtheUEiscoming:

FromIDLEorCell_PCHstate-resourcesfromCell_DCHstateareattempted.

FromCell_DCHstate-itismovedtoCell_PCHstatewithoutanH-RNTIallocation.

NotethatHS-FACHuserisauserwithdedicatedH-RNTIinCell_FACHorCell_PCH
state.
NotethatwhenevertheHS-FACHisactivated,thecell-levelH-RNTIallocationpool
needstobeused.Formoreinformation,seeHSDPAphysicalchannel,transport
channel,radiobearer,andRLCconfiguration.

Issue:06H

DN0638161

R: 289/396

289

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HighSpeedCell_FACH

WCDMARANRRMHSDPA

16.1.7 CommonMAC-ehsreorderingattributesforCCCHand
SRB1
RNCdefinesCommonMAC-ehsreorderingattributesT1,Treset,andMAC-ehswindow
sizeforCCCHandSRB1broadcastedviaSIB5/SIB5bistotheUE:

ThevalueoftheT1,constantvalue120msisused.

ThevalueofTresetisdefinedbyusingHSFACHResetTimermanagement
parameter.

MAC-ehswindowsize,constantvalue16isused.Inputparameterforthereadingis
HS-DSCHphysicallayercategory.InthiscasefixedHS-DSCHcategoryvalue12is
usedforthereadingofMAC-ehswindowsize.

16.1.8 BroadcastsofHS-FACHHS-SCCHcodes
TheRNCbroadcastsHS-FACHHS-SCCHcodesassuchviaSIB5/SIB5bistotheUE
withinHS-SCCH Channelization Code InformationIE.
TheRNCreceivesHS-FACHHS-SCCHcodeinformationfromtheBTSwiththeNBAP:
PHYSICALSHAREDCHANNELRECONFIGURATIONRESPONSEmessagesent
duringtheHS-FACHsetup.HS-SCCHcodeinformationisincludedinthe HS-SCCH
Specific Information Response IE.
NotethatHS-SCCHcodesareallocatedbytheRNCduringthesetupofHSDPA,not
duringthesetupofHS-FACH.

16.1.9 RLCconfiguration
16.1.9.1 RetransmissionparametersfortheAMRLCwhentheUEisin
Cell_FACHstate
ThisrequirementdefinesthePSRABsoftheUEinCell_FACHstatethataretransferred
withtheAMRLCRBsintheHS-DSCHconfiguration.
ThefollowingmanagementparametersareintroducedtodefinethelengthoftheAM
RLCstatusreportingperiod:

ParameterAMRLCRespHSFACHandRACHdefinestheL2roundtriptimevalues
measuredbetweentheAMRLCentitiesoftheRNCandtheUEwhentheused
configurationisRACH/HS-DSCH(RACH/HS-FACH).Valuesoftheparametersare
denotedwithTRTT.

ParameterAMRLCHSFACHPSPeriodMaxdefinesthemaximumstatusreporting
periodinrelationtotheL2roundtriptime-thevalueoftheparameterisdenoted
withmax.

ParameterAMRLCHSFACHPSPeriodMindefinestheminimumstatusreporting
period.

SenderoftheRLCentityintheRNCisconfiguredasfollows:

290

DN0638161

R: 290/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HighSpeedCell_FACH

Timers Timer_pollandTimer_poll_periodicissettothevaluemaxTRTTif
theyhavebeenactivatedwiththeTimerpollperiodicandtheTimerpollofthe
AMRLCHSFACHPSTriggersparameter.

Timer Timer_poll_prohibitissettothevalueofthe
AMRLCHSFACHPSPeriodMinparameterifithasbeenactivatedwiththe
Timer_poll_prohibitoftheAMRLCHSFACHPSTriggers parameter.

PollingtriggerPoll_PDUissettothevalueoftheAMRLCHSFACHPSPollPDU
parameterifthetriggerhasbeenactivatedwiththePoll_PDUofthe
AMRLCHSFACHPSTriggers parameter.IftheflexiblesizesareusedfortheAM
RBthentheabsolutevalueofthePoll_PDUisexpressedinbytes.

PollingtriggerPoll_SDUissettothevalueoftheAMRLCHSFACHPSPollSDU
parameterifthetriggerhasbeenactivatedwiththePoll_SDUofthe
AMRLCHSFACHPSTriggers parameter.FinalvalueofthePoll_SDUissetin
suchawaythatthePoll_SDU*SSDUbecomessmallerthanthedownlink
transmissionwindowsizeinbytes.SSDUisthemaximumSDUsizeoftheRAB.

PollingtriggerPoll_WindowissettothevalueoftheAMRLCHSFACHPSPollWin
parameterifthetriggerhasbeenactivatedwiththePoll_windowofthe
AMRLHSFACHPSTriggersparameter.

PollingtriggersLast transmission PDU pollandLast retransmission


PDU pollaresetifthetriggershavebeenactivatedwiththeLasttransmission
PDUpollandtheLastretransmissionPDUpolloftheAMRLCHSFACHPSTriggers
parameter.

SDU discard after MaxDAT number of transmissionsisusedifthemode


hasbeenactivatedwiththeSDUdiscardafterMaxDATtransmissionsofthe
managementAMRLCHSFACHPSTriggersparameter.Otherwisethemode
No_discardafterMaxDATnumberoftransmissionsisused.SDUdiscardmode
Timerbaseddiscardisnotused.

ThevalueoftheMaxMRWRLCparameterissettothevalueofthe
AMRLCHSFACHPSMaxMRW parameter.TheRLCparameterissignificantonlyifthe
SDU discard after MaxDAT retransmissionsisapplied.

ThevalueoftheTimer_MRWRLCtimerissettothevaluemaxTRTTiftheSDU
discard after MaxDAT retransmissionsisapplied.

ThevalueoftheMaxDATRLCparameterissettothevalueofthe
AMRLCHSFACHPSMaxDATparameter.

ThevalueoftheMaxRSTRLCparameterissettothevalueofthe
AMRLCHSFACHPSMaxRSTparameter.

ThevalueoftheRLC timer Timer_RSTissettothevaluemaxTRTT.

ReceiveroftheRLCentityintheUEisconfiguredasfollows:

Issue:06H

TimerTimer_status_periodicissettothevaluemaxTRTTifithasbeenactivatedwith
theTimerstatusperiodicoftheAMRLCHSFACHPSTriggersparameter.

TimerTimer_status_prohibitissettothevalueoftheAMRLCHSFACHPSPeriodMin
parameterifithasbeenactivatedwiththeTimerstatusprohibitofthe
AMRLCHSFACHPSTriggers parameter.

StatusreporttriggerMissing PDU indicatorissetifthetriggerhasbeenactivated


withtheAMRLCHSFACHPSTriggers parameter.

DN0638161

R: 291/396

291

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HighSpeedCell_FACH

WCDMARANRRMHSDPA

ManagementparametervaluesareappliedwhentheAMRLCentityiscreatedorthe
retransmissionparametersoftheentityaremodified.Modificationofthevaluesofthe
managementparametersisnotasufficientreasonforthereconfigurationoftheAMRLC
entities.
ValuesoftheRLCvariablesandtimerssignaledtotheRLCentitiesoftheUEandthe
RNCareroundedasdescribedinthedefinitionofeachparameterofthe
AMRLCHSFACHPSstructure.
Retransmissionparametersmaydifferinthedifferenttransportchannelconfigurations
andthereforemayneedanupdateiftheconfigurationsaremodified.
ForgeneraldescriptionoftheretransmissionparametersoftheAMRLC,seeWCDMA
RRM Admission Control.

16.1.9.2 TransmissionandreceivingwindowsoftheAMRLCentities
TransmissionandreceivingwindowsizesincaseofHS-FACHusageisproducedas
previouslydescribedinthischapter.DeterminationofbuffersizeandmaximumHSDSCHuserdatarateforPSRBisbasedonthecapabilityofHS-DSCHCategory12.
ThiscategoryisusedalsoinL2bysendingHS-FACHdatatowardsBTSonFPlayer.

16.1.9.3 AMRLCwindowsizeandretransmissionparametersforSRBson
HSPA
AdmissioncontroloftheRNCdeterminesparametersfortheAMRLCentitiesofthe
SRBs,whicharetransferringthedataintheRACH/HS-DSCHconfigurationwhentheUE
isintheCell_FACHstate.Thisisperformedinthesamewayasithasbeendefinedfor
REL99RACH/FACHconfiguration.

16.1.9.4 DeliveryoftheRLCSDUstothehigherlayers
AdmissioncontroloftheRNCdeterminesthevalueofIn sequence delivery of SDUs in
UEforAMRLCentityoftheUEusingHS-FACHasfollows:

292

IftheRANAP:RABattributeDeliveryOrder=deliveryorderrequested,thenthe
RRCRLCinfo:In-sequencedelivery=TRUE.

IfRANAP:RABattributeDeliveryOrder=deliveryordernotrequested,then:

IfInsequencedeliveryofSDUsinUEisnotsetwiththemanagement
parameterAMRLCHSFACHPSTriggersthentheRRCRLCinfo:In-sequence
delivery=FALSE.

IfInsequencedeliveryofSDUsinUEissetwiththemanagementparameter
AMRLCHSFACHPSTriggersthentheRRCRLCinfo:In-sequencedelivery=
TRUE.

DN0638161

R: 292/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HighSpeedCell_FACH

16.1.10 Channeltypeselectionforpacketdatatransferindownlink
inCell_FACHstate
WhentheUEisintheCell_FACHstateanddataarrivestothedownlinkRLCbufferin
theRNC,theRLCindicatesbufferstatustoMAC.MACentityhandlescommonand
sharedchannelsofonecellonHS-FACH.OnMAC,thechanneltypeselectionis
performedbasedonRLCbufferstatusinformation.Afterthechanneltypeselectionis
performed,MACinitiatesdatatransmissionintheCell_FACHstateviaHS-FACH.When
theDCH/DCH,DCH/HS-DSCH,orE-DCH/HS-DSCHisselected,MACsendsDL
capacityrequest(downlinktrafficvolumemeasurementreport)tothepacketscheduler.
TheRNCconfigurationparameterTrafVolPendingTimeDLdefinesthetimebetween
consecutivecapacityrequests.Newcapacityrequestissenttopacketschedulerifthere
isnoresponseduringthetimethatTrafVolPendingTimeDLdefines.
Figure 92

DownlinkchanneltypeselectionbetweenCell_FACHandCell_DCHstates
onMAC

The purple color of the MAC-c functionality is an existing implementation of Rel99


common channels (RACH/FACH). The yellow color of the MAC-sch/MAC-c/MAC-d
functionality implies changes brought with RAN1637.

Issue:06H

DN0638161

R: 293/396

293

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HighSpeedCell_FACH

WCDMARANRRMHSDPA

Figure92:DownlinkchanneltypeselectionbetweenCell_FACHandCell_DCHstateson
MACpresentsthechanneltypeselectionprocedureonMAC.Intheprocedurethe
followingparametersareneeded:

DownlinktrafficvolumemeasurementthresholdforHS-FACH(HSFACHVolThrDL).

DownlinktrafficvolumemeasurementtimetotriggerforHS-FACH
(HSFACHRLCTimeToTrigger).

Downlinktrafficvolumemeasurementpendingtimeaftertrigger
(TrafVolPendingTimeDL).

ThresholdforRACHload(RachLoadThresholdCCH,existingparameter),used
whentheULreturnchannelisRACH.

MarginforRACHload(RachLoadMarginCCH,existingparameter),usedwhenthe
ULreturnchannelisRACH.

ThedecisiononthedownlinkchanneltypeselectionbetweenHS-FACHandDCH/HSDSCHonMACisbasedonthefollowinginformation:

bufferstatus(payloadofRLCbuffers)-indicatedbyRLCs

RACHloadwhentheULreturnchanneloftheRBisRACH-measuredbytheBTS

HS-DSCHorDCHisselectedandtheDLcapacityrequestissenttopacketschedulerif
oneofthefollowingconditionsarefulfilled:
1. ThereisanydatainRLCbufferofPSstreamingdata.
2. SumloadofRLCbuffersofeachNRTRBsishigherthanHSFACHVolThrDL.
3. PacketschedulerdoesnotallowtouseHS-FACHbecauseoftheloadofDSPor
therearenocreditsfromtheBTSforDTCHtransmissionviacommonMACflowof
thecell.
OtherwisetheHS-FACHdatatransmissionisinitiated.
WhentheUEusesRACH/HS-FACHconfigurationintheCell_FACHstate,andRACH
loadexceedsRachLoadThresholdCCH,thepacketschedulerdoesnotallowtouse
HS-FACH.PacketschedulerindicatestotheMACthatHS-FACHisnotallowed.HSFACHusageispossibleagainwhentheRACHloadisdecreasedunderthresholdsby
marginsRachLoadMarginCCH.
PacketschedulerallowstousetheHS-FACHwhentheUEusesHS-RACH/HS-FACH
configurationintheCell_FACHstate.
Fromthesignalingpointofview,theHS-FACHismoreefficientthanHS-DSCHandDCH
intheCell_DCHstate,becauseitdoesnotrequireL3signaling.IfHS-FACHisused
whenthecellisnotheavilyloaded,itdecreasesthetotalsignalingloadoftheRNC.
ThepacketschedulerperformsthechanneltypeselectionintheCell_FACHstate
accordingtothefollowingrules:

294

IfNRTRBhasdatatosendandsumloadoftheRLCbuffersofNRTRBsexceeds
thresholddefinedbyRNPparameterHSFACHVolThrDL,astatetransitionto
Cell_DCHisperformedandtransportchannelselectionisperformedinthewaythat
iscurrentlyvalidintheCell_DCHstate.

DN0638161

R: 294/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HighSpeedCell_FACH

IfPSstreamingRBhasdatatosend,astatetransitiontoCell_DCHisperformed
andDCH/DCH,DCH/HS-DSCH,orE-DCH/HS-DSCHisallocated.

Thedownlinktrafficvolumemeasurementsaresetup,modified,andreleasedinthe
samewayasfortheCell_DCHstate.

16.1.11 Measurementmanagement
ThischapterdescribesmeasurementsusedintransportchannelHS-FACH.
TheRNCconfiguresTVMtotheUEandhandlesTVMreportreceivedfromtheUEofthe
HS-FACHuserasinpreviousreleasesintheCell_FACHstatewheretheuplinktransport
channelisRel99RACHintheuplinkandRel7HS-FACHinthedownlink.

16.1.11.1 ActivitymeasurementoftheHS-FACHuserwithPSRB(s)in
downlink
HS-FACHuser'sactivedecisioninthedownlinkisbasedonthethroughputofHS-DSCH
andthedataamountintheDLRLCbuffer.
MeasurementsareconfiguredwhenthePSRBhasbeensetup.Theyareperformedper
PSRBoftheUE(MeasurementsarenotperformedforSRBs).
RLC/MAC-dlayermeasurestheactivityoftheHS-DSCHNRTMAC-dintheCell_FACH
statebasedonthroughputoftheHS-DSCH:

MAC-doftheRNCcalculatestheHS-FACHactivitysothatalltransmittedbytes
duringtheslidingmeasurementwindowaremeasured.

ManagementparameterHSFACHActivityAveWindefinesslidingmeasurement
windowsizeforNRTMAC-dofHS-DSCH.Whenthemeasurementwindowsizeis
settoOFF,theactivityoftheHS-FACHmeasurementisnotperformed.

SlidingmeasurementwindowismovedeveryMAC-dschedulinginterval.

Activityduringtheslidingmeasurementwindow[bps]iscalculatedeveryMAC-d
schedulinginterval(asithasbeenperformedintheCell_DCHstate).

CollectionofthesamplesisstartedwhenthefirstactivityintheMAC-dflowhasbeen
detected.

Slidingmeasurementwindowhastoincludeatleastonesamplebeforethefirst
activitymeasurementresultiscalculated.

L2informsL3abouttheHS-FACHuseractivity(HS-FACHwithRACH):

Issue:06H

IfthedownlinkthroughputgoesaboveorequaltoHSFACHActivityThr,
HSFACHActTimeToTriggertimerisstarted.

IfthedownlinkthroughputgoesbelowHSFACHActivityThr,the
HSFACHActTimeToTriggertimerisstoppedandreset.

IftheHSFACHActTimeToTriggerexpires,L2sendshighactiveHS-FACHindication
toL3.L2resetstheHSFACHActTimeToTriggertimerandstarts
HSFACHActPendingTimetimer.IfHSFACHActPendingTimehasbeenalready
startedandthedownlinkthroughputisaboveorequaltotheHSFACHActivityThr,
L2restartstheHSFACHActTimeToTriggertimer.

DN0638161

R: 295/396

295

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HighSpeedCell_FACH

WCDMARANRRMHSDPA

HSFACHActivityThrisdefinedbytheHSFACHActivityThrWCELparameter.

HSFACHActTimeToTriggerisdefinedbyHSFACHActTimeToTriggerWCEL
parameter.

RLC/MAC-dlayermeasuresthedataamountintheDLRLCbuffer:

RLC/MAC-dperformsthetrafficvolumemeasuringforeachRB.Themeasured
quantityisRLCbufferpayloadinnumberofbytes.

IfNRTRBdataintheRLCbufferishigherorequaltothethresholddefinedby
WCELRNPparameterHSFACHVolThrDLforthetimedefinedbyWCELRNP
parameterHSFACHRLCTimeToTrigger,L2sendshighactiveHS-FACHindication
toL3andstartsHSFACHActPendingTimetimer.IfHSFACHActPendingTimehas
beenalreadystarted,L2restartsthemeasurementofthedataamountintheDLRLC
buffer.

IftheUEhasonlySRBdatatosend,L2doesnotsendhighactiveHS-FACH
indicationtoL3.RRCmessagescontainingpurecontrolsignalingorSMS/NASdata
donotcausestatetransition.

HSFACHActPendingTimeisdefinedbytheTrafVolPendingTimeDLexisting
parameter.
WhenL3receiveshighactiveHS-FACHindicationfromL2,L3considersitasahigh
capacityrequestintheDLandforwardsittoRRM.TheRRMdeterminesthatthe
preferredallocationisHSDPA/HSPA(dependsonthecapabilityoftheUEandwhether
configurationissupportedinacellfortheUEsintheCell_DCHsate).

16.2 HS-RACHfunctionality
16.2.1 SymboloffsetsandF-DPCHcodesforHS-RACH
Symboloffset(Soffset)rangeis0..9.SoffsetforthefirstCommonE-DCHresourceisset
to0,forsecondoneitissetto1,andsoon,uptotenthCommonE-DCHresource.After
that,itcontinuesstartingfromSoffset0,dependingontheamountofE-DCHresources
tobeconfigured.
OneF-DPCHcode(SF256)canhandleupto10CommonE-DCHresources.TheFDPCHcodestobereservedduringHS-RACHsetup=roundeduptothenearestinteger
[HSRACHCommonEDCHRes/10].F-DPCHcodesallocatedforHS-RACHpurposearenot
pre-empted/releasedforanyreason.
TheF-DPCHcodesallocatedforCommonE-DCHresourceconfigurationpurposeare
notusedfortheUEsontheCELL_DCHstate.
TheF-DPCHcodeandSoffsetaresignaledtotheBTSbyusingNBAP:PHYSICAL
SHAREDCHANNELRECONFIGURATIONREQUESTmessagewithinSoffsetandFDPCH DL Code NumberIEsoftheCommonE-DCHResourceCombinationInformation
duringtheHS-RACHsetup.
TheF-DPCHcodeandSoffsetaresignaledtoUEsbyusingRRC:SIB5/5bismessage
afterasuccessfultheHS-RACHsetupwithinSoffsetandF-DPCH DL Code Number
IEsoftheCommonE-DCHResourceConfigurationlist.

296

DN0638161

R: 296/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HighSpeedCell_FACH

TheSoffsetIEintheRRC:SIB5/5bismessagesignaledtoUEsisoptimized,sothatin
eachE-DCHresourcethemandatorydefault(MD)valueisused.
TheF-DPCH DL Code NumberIEintheRRC:SIB5/5bismessagesignaledtoUEsis
optimized,sothattheIEispresentinthefirstoccurrenceandafterthatineverytenthof
E-DCHresource.

16.2.2 F-DPCHslotformat,TPCDLstepsize,andTPCcommand
errorratetargetforHS-RACH
F-DPCHslotformatfixedvalue0isusedwithHS-RACH.
TPCstepsizevalueisreadfromtheexistingRNCDownLinkInnerLoopPCStepSize
configurationparameter,similarlyaswiththeDPCH.TheRRMreadstheparameter
whentheHS-RACHissetup.Thesignaledvalueisnotupdatedwhentheparameter
valuehaschanged.
TheinitialpowerandmaximumpowerfortheF-DPCHisdefinedbyusingtheWCELPtxFDPCHMaxRNPparameter.Thevaluedefinedbytheparameterisnegatedandthen
signaledtotheBTS.
TheminimumpowerfortheF-DPCHisdefinedbyusingtheWCEL-PtxFDPCHMinRNP
parameter.ThevaluedefinedbytheparameterisnegatedandthensignaledtotheBTS.
Slotformat,TPCstepsize,Initialpower,MaximumpowerandMinimumpower
informationaresignaledtotheBTSbyusinganNBAP:PHYSICALSHAREDCHANNEL
RECONFIGURATIONREQUESTmessagewithinF-DPCH slot format,FDD TPC DL
Step Size,Initial DL Transmission Power,Maximum DL PowerandMinimum DL Power
IEsoftheCommonF-DPCHInformationduringtheHS-RACHsetup.
AdmissionControldefinestheusedcommanderrortargetrateoftheF-DPCHforHSRACHbyusingtheexistingRNPTPCCommandERTargetparameter.Informationis
signaledtoUEsbyusingtheRRC:SIB5/5bismessagewithintheF-DPCH command
error rate targetIEoftheCommonE-DCHsysteminfo.

16.3 UEDRXinCELL_FACH
TheRAN1908: UE DRX in CELL_FACHfeaturesupportsthediscontinuousreceptionin
thehighspeedCELL_FACHstate.
IntheRAN1908: UE DRX in CELL_FACH feature,theUEisconfiguredtouseDRX
cycleintheCell_FACHstate.TheUEDRXoperationdeterminesoccasionsinwhichthe
UEisallowedtodiscontinuouslyreceivetheHS-DSCHtransmissionsinthe
CELL_FACHstate.InDRXoperation,insteadofdecodingalltheHS-SCCHframes,the
UEperiodicallyreadstheHS-SCCHframesattheregularinterval.TheUEinterruptsthe
DRXoperationintheCell_FACHstatewhendatatransmissionisstarted.
DRXcycleincludes:
RXburstlength

Issue:06H

DN0638161

R: 297/396

297

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HighSpeedCell_FACH

WCDMARANRRMHSDPA

ThedurationinframesduringwhichtheUEreadstheHS-SCCH
transmission.
DRXcyclelength
IncludestheRXburstlengthandtheDRXcycle.
DRXcycleisadurationduringwhichtheUEdoesnotreadtheHS-SCCHframe.
Figure 93

DRXcycles

FeatureRAN1908: UE DRX in CELL_FACHrequirestheRAN1913: High Speed


Cell_FACHfeature.HighSpeedCell_FACHmustbeactiveforUEDRXactivation.The
resourceallocationconfigurationsofRAN1913: High Speed Cell_FACHfeaturehaveto
betakenintoaccountwhenconfiguringtheDRXparameters.

16.3.1 BTS/CellcapabilityoftheUEDRXsupport
TheRNCasksforcapabilitiesoftheBTSvianormalauditprocedure,bysendingNBAP:
AUDITREQUESTmessagetotheBTS.
TheBTSsendsaresponsewithitscapabilitiesoftheUEDRXfeature,bysending
NBAP:AUDITRESPONSEmessagethatincludesanewEnhanced UE DRX
CapabilityIE.TheEnhanced UE DRX CapabilityIEisincludedintheLocalCell
Information.
ThisIEissettoEnhanced-UE-DRX-capableifacellisUEDRXcapable.Otherwise,itis
settoEnhanced-UE-DRX-non-capable.
IftheUEDRXinCELL_FACHissupportedforthecellintheRNC,andtheBTShas
indicatedthecellasnoUEDRXcapable(Enhanced-UE-DRX-non-capable),thenthe
RNCraisesthe7xxxHIGHSPEEDCOMMONCHANNELPROBLEMalarmwithcause
No UE DRX support in BTS.
IncaseoftheNBAP:AUDITFAILUREmessagewithappropriatecausevalue,handling
ofthefailureisthesameasinpreviousreleases.

16.3.2 ResourceStatusIndicationprocedure
TheBTScansendtheNBAP:RESOURCESTATUSINDICATIONmessagetotheRNC
toindicatethechangeinitscapabilityfortheUEDRXinlocalcell(includingthenew
Enhanced UE DRX CapabilityIE).

298

DN0638161

R: 298/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

HighSpeedCell_FACH

NBAPconveysallthisinformationtotheO&Mentityandtheinformationisstoredinthe
RNCO&M.TheRRMentitygetstheUEDRXrelatedinformationfromdatabase
readings(sameasinoldimplementation).
TheRNChandlestheUEDRXcapabilitychangeindicationfromtheBTSforacellinthe
NBAP:RESOURCESTATUSINDICATIONmessageasfollows:

IfthecapabilityischangedfromEnhanced-UE-DRX-non-capabletoEnhanced-UEDRX-capable,theRNCinitiatestheUEDRXconfigurationtowardstheBTSandthe
UE.

IfthecapabilityischangedfromEnhanced-UE-DRX-capabletoEnhanced-UE-DRXnon-capable,theRNCdoestheSIB5/5BisbroadcasttotheUEwithoutUEDRX
parameters,andraisesthe7xxxHIGHSPEEDCOMMONCHANNELPROBLEM
alarmwithcauseNo UE DRX support in BTS.Existingusersthatwereoperatingin
theUEDRXmodebeforethecapabilitychangeareunaffected.Newuserswillnotbe
abletousetheUEDRX.

16.3.3 ConfigurationofUEDRXintheBTS
IftheUEDRXinCELL_FACHissupportedforthecell(HSFACHDRXEnabledissetto
Enabled),andtheBTShasindicated(inAuditprocedure)thatthecellisUEDRX
capable(Enhanced-UE-DRX-capable),theRRMentityintheRNCreadstheconfigured
EnhancedUEDRXInformationfromtheRNCO&Mandprovidestherequired
informationtotheBTSinEnhanced UE DRX InformationIEusingNBAP:PHYSICAL
SHAREDCHANNELRECONFIGURATIONprocedure.Theinformationissentto
configuretheUEDRXintheBTSinordertoallowUEstodiscontinuouslyreceiveHSDSCHintheCELL_FACHstate.TheRNCusesasingleNBAP:PHYSICALSHARED
CHANNELRECONFIGURATIONREQUESTprocedureforUEDRXparameter
(Enhanced UE DRX InformationIE)configurationandHSRACH(CommonE-DCH
SystemInformation)configurationtowardstheBTS.
AfterthesuccessfulUEDRXconfigurationintheBTS,theRNCbroadcaststheUEDRX
inCell_FACHinformationtotheUE.

16.3.4 UEDRX-specificparametermodification
ModificationofHSFACHDRXEnabledparameterrequiresWCELobjectlocking.
WhentheHSFACHDRXEnabledcelllevelparameterissettoDisabled,theRRCentity
doesnotincludetheUEDRXconfigurationinsidetheSYSTEMINFORMATION
BLOCK5/5bisduringSystemInformationUpdateprocedure.TheRRMentitydoesnot
includetheUEDRXinformationinthePhysicalSharedChannelReconfiguration
procedureeither.
WhentheHSFACHDRXEnabledparameterissettoEnabled,theRRCentityincludes
theUEDRXconfigurationinsidetheSYSTEMINFORMATIONBLOCK5/5bisduring
SystemInformationUpdateprocedure.TheRRMentityalsoincludestheUEDRX
informationinthePhysicalSharedChannelReconfigurationprocedure.
Thefollowingparameterscanbemodifiedonline:

Issue:06H

T321

DN0638161

R: 299/396

299

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

HighSpeedCell_FACH

WCDMARANRRMHSDPA

DRXCycHSFACH

RXBurstHSFACH

DRXInterruptHSDSCHData

Whenthoseparametersaremodified,thenO&MtriggerstheSIB5/5bisbroadcasttothe
UE,byinformingtheRRCentityintheRNC.TheRRCentityintheRNCincludesthe
modifiedUEDRXinformationinsidetheSYSTEMINFORMATIONBLOCK5/5bis.The
RNCO&MalsotriggersthePhysicalsharedchannelreconfigurationproceduretowards
theBTS,byinformingtheRRMentity.
WhenDRXInactiveTimerHSFACHparameterismodified,theexistingCell_FACH(HS)
userswillusetheoldtimervalue,butthenewCell_FACH(HS)userswillusethe
new/modifiedvalue.

300

DN0638161

R: 300/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

17 Managementdataforradioresource
managementofHSDPAforWCDMA
17.1 AlarmsforradioresourcemanagementofHSDPA
ThischapterprovidesanoverviewonHSDPAradioresourcemanagementrelated
alarmsthatareavailableforfaultdetectionandtroubleshootingpurposes.Thealarms
aregroupedinthesamewayastheHSDPAfeaturesarestructured,seeFeaturesand
functionsrelatedtoradioresourcemanagementofHSDPA.Withineachgroup,the
alarmsaresortedbytherespectivefeatureinnumericalorder.
ApartfromtheseHSDPARRMfeature-relatedalarms,otheractivefaultsinthesystem
canalsoaffectthedifferentqualityindicatorsindirectly.
Foralarmdescriptions,seeAlarms and BTS FaultsreferenceintheNSNWCDMARAN
SystemLibrary.
AllRANalarmsarecategorizedsothateachalarmhasanalarmnumberbelongingto
oneofthefollowingcategories:
AlarmstriggeredbytheRNC:

1-999Notices

1000-1999Disturbances

2000-3999FailurePrintouts(*,**,***alarms)

AlarmstriggeredbybasestationandRNC:
7000-7999BaseStationAlarms,where

7401-7699BaseStationAlarmstriggeredbybasestations

7700-7799BaseStationAlarmstriggeredbyRNC

17.1.1 HSDPAresourceallocationalarms
Table 19

RAN821:HSDPAResourceAllocationalarms

Alarmnumber

Alarmname

Base station related alarms

Issue:06H

7650

BASESTATIONFAULTY

7651

BASESTATIONOPERATIONDEGRADED

DN0638161

R: 301/396

301

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 19

WCDMARANRRMHSDPA

RAN821:HSDPAResourceAllocationalarms(Cont.)

Alarmnumber

Alarmname

7652

BASESTATIONNOTIFICATION

HSDPA related alarms


7772

HSDPACONFIGURATIONFAILURE

7776

HSDPADISABLEDINWCEL

Therearenoalarmsdefinedforthefollowingbasicandoptionalfeaturesrelatedto
HSDPAresourceallocation:

RAN763:BasicHSDPAwithQPSKand5Codes

RAN764:HSDPA16QAMSupport

RAN235:HSDPAChannelSwitching

RAN233:HSDPAAssociatedUplinkDPCHScheduling

RAN1013:16kbit/sReturnChannelDCHDataRateSupportforHSDPA

RAN312:HSDPADynamicResourceAllocation

RAN852:HSDPA15Codes

RAN853:HSDPACodeMultiplexing

RAN1305:HSDPA14.4MbpsperCell

RAN1643:HSDPA64QAM

17.1.2 HSDPAmobilityalarms
NoalarmshavebeendefinedforthefollowingbasicandoptionalHSDPAmobility
features:

302

RAN230:HSDPAMobilityHandlingwithDCHSwitching

RAN1148:HSDPACellReselection

RAN828:HSDPAServingCellChange

RAN829:HSDPASoft/softerHandoverforAssociatedDPCH

RAN1515:HSPAInter-RNCCellChange

RAN1276:HSDPAInter-frequencyHandover

RAN1596:HSPACapabilityBasedHandover

DN0638161

R: 302/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

17.1.3 MultiRABcombinationswithHSDPAalarms
Noalarmsexistforthefollowingfeaturesrelatedtomulti-RABcombinationswith
HSDPA:

RAN820:HSDPAwithAdditionalRABInitiation

RAN827:HSDPAwithSimultaneousAMRVoiceCall

RAN1727:EnhancementtoHSDPAwithSimultaneousAMRVoiceCall

RAN285:HSPAMultiNRTRABs

17.1.4 Userexperiencealarms
Table 20

RAN955:PowerSavingModealarms

Alarmnumber

Alarmname

7761

RNWO&MSCENARIOFAILURE

Table 21

RAN1906:Dual-CellHSDPA42Mbpsalarms

Alarmnumber

Alarmname

7795

INCONSISTENCYINHIGHPEAKRATEHSPACONFIG

3325

INCONSISTENCYINCONFIGURATIONPARAMETERS

TherearenoalarmsrelatedtothefollowinguserexperiencefeaturesrelatedtoHSDPA
RRM:

Issue:06H

RAN839:HSDPA16UsersperCell

RAN1033:HSDPA48UsersperCell

RAN1464:HSDPA64UsersperCell

RAN1249:HSDPA10MbpsperUser

RAN1258:HSDPA14MbpsperUser

RAN1201:FractionalDPCH

RAN1470:HSUPA2msTTI

RAN1638:FlexibleRLC(DL)

RAN1642:MIMO

RAN1644:ContinuousPacketConnectivity

RAN1686:HSPA72UsersPerCell

RAN1689:CSVoiceOverHSPA

DN0638161

R: 303/396

303

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

WCDMARANRRMHSDPA

17.1.5 Qualityofservicemanagementalarms
NoalarmsexistforthefollowingQoSmanagementfeatures:

RAN930:PSNRTRABReconfiguration

RAN1004:StreamingQoSforHSPA

RAN1262:QoSAwareHSPAScheduling

17.2 CountersforradioresourcemanagementofHSDPA
ThischaptergivesashortsummaryofHSDPAcountersthatareavailablefor
performancemanagementpurposes.FormoreinformationonCellresource,Service
level,Trafficandothermeasurements,seeRNC Counters - RNW part.
ThecountersaregroupedinthesamewayastheHSDPAfeaturesarestructured,see
FeaturesandfunctionsrelatedtoradioresourcemanagementofHSDPA.Withineach
group,thecountersaresortedbytherespectivefeatureandorderedaccordingtotheir
PIID.

17.2.1 HSDPAresourceallocationcounters
Table 22

RAN821:HSDPAResourceAllocationcounters

PIID

Name

Abbreviation

AAL2 resource reservation measurements


M800C6

AAL2_SUCCEEDED_HSDPA

AAL2_SUCCEEDED_HSDPA

M800C7

TRANSPORT_REJECTED_EXT_HSDPA

TRANSPORT_REJECTED_EXT_HSDPA

M800C8

TRANSPORT_REJECTED_INT_HSDPA

TRANSPORT_REJECTED_INT_HSDPA

M800C9

OTHER_REJECTED_HSDPA

OTHER_REJECTED_HSDPA

M800C10

ACTIVE_HSDPA_RES_TIME

ACTIVE_HSDPA_RES_TIME

M800C11

WAITING_HSDPA_RES_TIME

WAITING_HSDPA_RES_TIME

M800C12

RELEASE_TIMER_LENGTH

RELEASE_TIMER_LENGTH

Cell resource measurements

304

DN0638161

R: 304/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 22

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN821:HSDPAResourceAllocationcounters(Cont.)

PIID

Name

Abbreviation

M1000C138

AVERAGERATIOBETWEENNONHSDPA
POWERANDTHEMAXIMUMPOWER

AVG_NON_HSDPA_PWR

M1000C139

NONHSDPAPOWERDENOMINATOR

AVG_NON_HSDPA_PWR_DENOM

M1000C140

AVERAGERATIOFORACTIVENONHSD- AVG_ACTIVE_NON_HSDPA_PWR
PAPOWERANDTHEMAXIMUMPOWER

M1000C141

ACTIVENONHSDPAPOWERDENOMINA- AVG_ACT_NON_HSDPA_PWR_DENOM
TOR

M1000C144

DLDCHSELECTEDDUETOHSDPA
POWER

CELL_RESOURCE_SPARE_1

M1000C149

HS-DSCHRELEASEDUETODLOVERLOAD

CELL_RESOURCE_SPARE_2

Traffic measurements
M1002C385

HS-DSCHMAC-DFLOWALLOCATIONS
FORINTERACTIVE

M1002C386

HS-DSCH64KBPSRETURNCHALLOCA- ALLO_HS_DSCH_RET_64_INT
TIONSFORINTERACTIVE

M1002C387

HS-DSCH128KBPSRETURNCHALLOCATIONSFORINTERACTIVE

ALLO_HS_DSCH_RET_128_INT

M1002C388

HS-DSCH384KBPSRETURNCHALLOCATIONSFORINTERACTIVE

ALLO_HS_DSCH_RET_384_INT

M1002C389

HS-DSCHMAC-DFLOWALLOCATIONS
FORBACKGROUND

ALLO_HS_DSCH_FLOW_BGR

M1002C390

HS-DSCH64KBPSRETURNCHALLOCA- ALLO_HS_DSCH_RET_64_BGR
TIONSFORBACKGROUND

M1002C391

HS-DSCH128KBPSRETURNCHALLOCATIONSFORBACKGROUND

ALLO_HS_DSCH_RET_128_BGR

M1002C392

HS-DSCH384KBPSRETURNCHALLOCATIONSFORBACKGROUND

ALLO_HS_DSCH_RET_384_BGR

M1002C393

HS-DSCHMAC-DFLOWDURATIONFOR
INTERACTIVE

ALLO_DUR_HS_DSCH_FLOW_INT

Issue:06H

DN0638161

R: 305/396

ALLO_HS_DSCH_FLOW_INT

305

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 22

WCDMARANRRMHSDPA

RAN821:HSDPAResourceAllocationcounters(Cont.)

PIID

Name

Abbreviation

M1002C394

HS-DSCH64KBPSRETURNCHDURATIONFORINTERACTIVE

ALLO_DUR_HS_DSCH_RET_64_INT

M1002C395

HS-DSCH128KBPSRETURNCHDURATIONFORINTERACTIVE

ALLO_DUR_HS_DSCH_RET_128_INT

M1002C396

HS-DSCH384KBPSRETURNCHDURATIONFORINTERACTIVE

ALLO_DUR_HS_DSCH_RET_384_INT

M1002C397

HS-DSCHMAC-DFLOWDURATIONFOR
BACKGROUND

ALLO_DUR_HS_DSCH_FLOW_BGR

M1002C398

HS-DSCH64KBPSRETURNCHDURATIONFORBACKGROUND

ALLO_DUR_HS_DSCH_RET_64_BGR

M1002C399

HS-DSCH128KBPSRETURNCHDURATIONFORBACKGROUND

ALLO_DUR_HS_DSCH_RET_128_BGR

M1002C400

HS-DSCH384KBPSRETURNCHDURATIONFORBACKGROUND

ALLO_DUR_HS_DSCH_RET_384_BGR

M1002C401

REJECTEDHS-DSCHRETURNCHFOR
INTERACTIVE

REJ_HS_DSCH_RET_INT

M1002C402

REJECTEDHS-DSCHRETURNCHFOR
BACKGROUND

REJ_HS_DSCH_RET_BGR

M1002C407

HS-DSCHNORMALRELEASEFORINTERACTIVE

REL_ALLO_NORM_HS_DSCH_INT

M1002C408

HS-DSCHRELEASEDUETOOTHER
FAILUREFORINTERACTIVE

REL_ALLO_OTH_FAIL_HSDSCH_INT

M1002C409

HS-DSCHRELEASEDUETOMOBILITY
DCHTRANSITIONFORINTERACTIVE

REL_ALLO_HS_DSCH_MOB_DCH_INT

M1002C410

HS-DSCHNORMALRELEASEFORBACK- REL_ALLO_NORM_HS_DSCH_BGR
GROUND

M1002C411

HS-DSCHRELEASEDUETOOTHER
FAILUREFORBACKGROUND

REL_ALLO_OTH_FAIL_HSDSCH_BGR

M1002C412

HS-DSCHRELEASEDUETOMOBILITY
DCHTRANSITIONFORBACKGROUND

REL_ALLO_HS_DSCH_MOB_DCH_BGR

306

DN0638161

R: 306/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 22

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN821:HSDPAResourceAllocationcounters(Cont.)

PIID

Name

Abbreviation

M1002C413

HS-DSCHSETUPFAILUREDUETORNC
INTERNALFORINTERACTIVE

SETUP_FAIL_RNC_HS_DSCH_INT

M1002C414

HS-DSCHMAC-DFLOWSETUPFAILURE SETUP_FAIL_IUB_MAC_D_INT
DUETOIUBTRANSPORTFORINTERACTIVE

M1002C415

HS-DSCHSETUPFAILUREDUETOUE
FORINTERACTIVE

SETUP_FAIL_UE_HS_DSCH_INT

M1002C416

HS-DSCHSETUPFAILUREDUETOBTS
FORINTERACTIVE

SETUP_FAIL_BTS_HS_DSCH_INT

M1002C417

HS-DSCHTOTALIUBTRANSPORTSETUPFAILFORINTERACTIVE

SETUP_FAIL_IUB_HS_TOTAL_INT

M1002C418

HS-DSCH64KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFORINTERACTIVE

SETUP_FAIL_64_IUB_HSDSCH_INT

M1002C419

HS-DSCH128KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFORINTERACTIVE

SETUP_FAIL_128_IUB_HSDSCH_IN

M1002C420

HS-DSCH384KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFORINTERACTIVE

SETUP_FAIL_384_IUB_HSDSCH_IN

M1002C421

HS-DSCHSETUPFAILUREDUETORNC
INTERNALFORBACKGROUND

SETUP_FAIL_RNC_HS_DSCH_BGR

M1002C422

HS-DSCHMAC-DFLOWSETUPFAILURE
DUETOIUBTRANSPORTFORBACKGROUND

SETUP_FAIL_IUB_MAC_D_BGR

M1002C423

HS-DSCHSETUPFAILUREDUETOUE
FORBACKGROUND

SETUP_FAIL_UE_HS_DSCH_BGR

M1002C424

HS-DSCHSETUPFAILUREDUETOBTS
FORBACKGROUND

SETUP_FAIL_BTS_HS_DSCH_BGR

M1002C425

HS-DSCHTOTALIUBTRANSPORTSETUPFAILFORBACKGROUND

SETUP_FAIL_IUB_HS_TOTAL_BGR

Issue:06H

DN0638161

R: 307/396

307

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 22

WCDMARANRRMHSDPA

RAN821:HSDPAResourceAllocationcounters(Cont.)

PIID

Name

Abbreviation

M1002C426

HS-DSCH64KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFOR
BACKGROUND

SETUP_FAIL_64_IUB_HSDSCH_BGR

M1002C427

HS-DSCH128KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFOR
BACKGROUND

SETUP_FAIL_128_IUB_HSDSCH_BG

M1002C428

HS-DSCH384KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFOR
BACKGROUND

SETUP_FAIL_384_IUB_HSDSCH_BG

M1002C429

HS-DSCHRETURNCHUPGRADESFOR
INTERACTIVE

HS_DSCH_RET_UPGRADE_INT

M1002C430

HS-DSCHRETURNCHDOWNGRADES
FORINTERACTIVE

HS_DSCH_RET_DOWNGRADE_INT

M1002C431

HS-DSCHRETURNCHUPGRADESFOR
BACKGROUND

HS_DSCH_RET_UPGRADE_BGR

M1002C432

HS-DSCHRETURNCHDOWNGRADES
FORBACKGROUND

HS_DSCH_RET_DOWNGRADE_BGR

M1002C477

HS-DSCHRELEASEDUETOOTHERDCH REL_ALLO_HS_DSCH_OTH_DCH_INT
TRANSITIONREASONFORINTERACTIVE

M1002C478

HS-DSCHRELEASEDUETOPREEMPTIONFORINTERACTIVE

REL_ALLO_HS_DSCH_PRE_EMP_INT

M1002C479

HS-DSCHRELEASEDUETORLFAILURE
FORINTERACTIVE

REL_ALLO_RL_FAIL_HS_DSCH_INT

M1002C480

HS-DSCHRELEASEDUETOOTHERDCH REL_ALLO_HS_DSCH_OTH_DCH_BGR
TRANSITIONREASONFORBACKGROUND

M1002C481

HS-DSCHRELEASEDUETOPREEMPTIONFORBACKGROUND

REL_ALLO_HS_DSCH_PRE_EMP_BGR

M1002C482

HS-DSCHRELEASEDUETORLFAILURE
FORBACKGROUND

REL_ALLO_RL_FAIL_HS_DSCH_BGR

M1002C501

HS-DSCH16KBPSRETURNCHALLOCA- ALLO_HS_DSCH_RET_16_INT
TIONSFORINTERACTIVE

308

DN0638161

R: 308/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 22

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN821:HSDPAResourceAllocationcounters(Cont.)

PIID

Name

Abbreviation

M1002C502

HS-DSCH16KBPSRETURNCHALLOCA- ALLO_HS_DSCH_RET_16_BGR
TIONSFORBACKGROUND

M1002C503

HS-DSCH16KBPSRETURNCHDURATIONFORINTERACTIVE

ALLO_DUR_HS_DSCH_RET_16_INT

M1002C504

HS-DSCH16KBPSRETURNCHDURATIONFORBACKGROUND

ALLO_DUR_HS_DSCH_RET_16_BGR

M1002C505

HS-DSCH16KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFORINTERACTIVE

SETUP_FAIL_16_IUB_HSDSCH_INT

M1002C506

HS-DSCH16KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFOR
BACKGROUND

SETUP_FAIL_16_IUB_HSDSCH_BGR

M1002C507

CHANNELTYPESWITCHFROMDCHTO
HS-DSCHFORINTERACTIVE

SWI_DCH_TO_HS_DSCH_INT

M1002C508

CHANNELTYPESWITCHFROMDCHTO
HS-DSCHFORBACKGROUND

SWI_DCH_TO_HS_DSCH_BGR

M1002C521

DLDCHSELECTEDFORINTERACTIVE
DUETOHSDPAPOWER

DL_DCH_SEL_HSDPA_POWER_INT

M1002C522

DLDCHSELECTEDFORBACKGROUND
DUETOHSDPAPOWER

DL_DCH_SEL_HSDPA_POWER_BGR

M1002C545

HS-DSCHALLOFORINTERRNCHHOIN- ALLO_HS_INTER_RNC_HHO_INT
TERACTIVE

M1002C546

HS-DSCHALLOFORINTERRNCHHO
BACKGROUND

ALLO_HS_INTER_RNC_HHO_BGR

M1002C547

HS-DSCHSETUPFAILFORINTERRNC
HHOINTERACTIVE

STP_F_HS_INTER_RNC_HHO_INT

M1002C548

HS-DSCHSETUPFAILFORINTERRNC
HHOBACKGROUND

STP_F_HS_INTER_RNC_HHO_BGR

M1002C568

CHANNELTYPESWITCHFROMDCHTO
HS-DSCHFORSTREAMING

SWI_DCH_TO_HS_DSCH_STR

M1002C569

HS-DSCHMAC-DFLOWALLOCATIONS
FORSTREAMING

ALLO_HS_DSCH_FLOW_STR

Issue:06H

DN0638161

R: 309/396

309

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 22

WCDMARANRRMHSDPA

RAN821:HSDPAResourceAllocationcounters(Cont.)

PIID

Name

Abbreviation

M1002C570

HS-DSCH16KBPSRETURNCHALLOCA- ALLO_HS_DSCH_RET_16_STR
TIONSFORSTREAMING

M1002C571

HS-DSCH64KBPSRETURNCHALLOCA- ALLO_HS_DSCH_RET_64_STR
TIONSFORSTREAMING

M1002C572

HS-DSCH128KBPSRETURNCHALLOCATIONSFORSTREAMING

ALLO_HS_DSCH_RET_128_STR

M1002C573

HS-DSCHMAC-DFLOWDURATIONFOR
STREAMING

ALLO_DUR_HS_DSCH_FLOW_STR

M1002C574

HS-DSCH16KBPSRETURNCHDURATIONFORSTREAMING

ALLO_DUR_HS_DSCH_RET_16_STR

M1002C575

HS-DSCH64KBPSRETURNCHDURATIONFORSTREAMING

ALLO_DUR_HS_DSCH_RET_64_STR

M1002C576

HS-DSCH128KBPSRETURNCHDURATIONFORSTREAMING

ALLO_DUR_HS_DSCH_RET_128_STR

M1002C577

REJECTEDHS-DSCHRETURNCHFOR
STREAMING

REJ_HS_DSCH_RET_STR

M1002C578

HS-DSCHNORMALRELEASEFOR
STREAMING

REL_ALLO_NORM_HS_DSCH_STR

M1002C579

HS-DSCHRELEASEDUETOOTHER
FAILUREFORSTREAMING

REL_ALLO_OTH_FAIL_HSDSCH_STR

M1002C580

HS-DSCHRELEASEDUETOMOBILITY
DCHTRANSITIONFORSTREAMING

REL_ALLO_HS_DSCH_MOB_DCH_STR

M1002C581

HS-DSCHSETUPFAILUREDUETORNC
INTERNALFORSTREAMING

SETUP_FAIL_RNC_HS_DSCH_STR

M1002C582

HS-DSCHMAC-DFLOWSETUPFAILURE
DUETOIUBTRANSPORTFORSTREAMING

SETUP_FAIL_IUB_MAC_D_STR

M1002C583

HS-DSCHSETUPFAILUREDUETOUE
FORSTREAMING

SETUP_FAIL_UE_HS_DSCH_STR

M1002C584

HS-DSCHSETUPFAILUREDUETOBTS
FORSTREAMING

SETUP_FAIL_BTS_HS_DSCH_STR

310

DN0638161

R: 310/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 22

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN821:HSDPAResourceAllocationcounters(Cont.)

PIID

Name

Abbreviation

M1002C585

HS-DSCHTOTALIUBTRANSPORTSETUPFAILFORSTREAMING

SETUP_FAIL_IUB_HS_TOTAL_STR

M1002C586

HS-DSCH16KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFOR
STREAMING

SETUP_FAIL_16_IUB_HSDSCH_STR

M1002C587

HS-DSCH64KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFOR
STREAMING

SETUP_FAIL_64_IUB_HSDSCH_STR

M1002C588

HS-DSCH128KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFOR
STREAMING

SETUP_FAIL_128_IUB_HSDSCH_ST

M1002C589

HS-DSCHRETURNCHUPGRADESFOR
STREAMING

HS_DSCH_RET_UPGRADE_STR

M1002C590

HS-DSCHRETURNCHDOWNGRADES
FORSTREAMING

HS_DSCH_RET_DOWNGRADE_STR

M1002C592

HS-DSCHRELEASEDUETOOTHERDCH REL_ALLO_HS_DSCH_OTH_DCH_STR
TRANSITIONREASONFORSTREAMING

M1002C593

HS-DSCHRELEASEDUETOPREEMPTIONFORSTREAMING

REL_ALLO_HS_DSCH_PRE_EMP_STR

M1002C594

HS-DSCHRELEASEDUETORLFAILURE
FORSTREAMING

REL_ALLO_RL_FAIL_HS_DSCH_STR

M1002C613

HS-DSCHALLOFORINTERRNCHHO
STREAMING

ALLO_HS_INTER_RNC_HHO_STR

M1002C614

HS-DSCHSETUPFAILFORINTERRNC
HHOSTREAMING

STP_F_HS_INTER_RNC_HHO_STR

Table 23

RAN763:BasicHSDPAwithQPSKand5Codescounters

PIID

Name

Abbreviation

Cell resource measurements


M1000C167

Issue:06H

DURATIONOFNOACTIVEHSDPA
USERS

DN0638161

R: 311/396

DUR_HSDPA_NO_USERS

311

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 23

WCDMARANRRMHSDPA

RAN763:BasicHSDPAwithQPSKand5Codescounters(Cont.)

PIID

Name

Abbreviation

M1000C168

DURATIONOFACTIVEHSDPAUSERS-1 DUR_HSDPA_USERS_1_OR_2
OR2SIMULTANEOUSUSERS

M1000C169

DURATIONOFACTIVEHSDPAUSERS-3 DUR_HSDPA_USERS_3_OR_4
OR4SIMULTANEOUSUSERS

M1000C170

DURATIONOFACTIVEHSDPAUSERS-5 DUR_HSDPA_USERS_5_OR_6
OR6SIMULTANEOUSUSERS

M1000C171

DURATIONOFACTIVEHSDPAUSERS-7 DUR_HSDPA_USERS_7_OR_8
OR8SIMULTANEOUSUSERS

M1000C172

DURATIONOFACTIVEHSDPAUSERS-9 DUR_HSDPA_USERS_9_OR_10
OR10SIMULTANEOUSUSERS

M1000C173

DURATIONOFACTIVEHSDPAUSERS11OR12SIMULTANEOUSUSERS

DUR_HSDPA_USERS_11_OR_12

M1000C174

DURATIONOFACTIVEHSDPAUSERS13OR14SIMULTANEOUSUSERS

DUR_HSDPA_USERS_13_OR_14

M1000C175

DURATIONOFACTIVEHSDPAUSERS15OR16SIMULTANEOUSUSERS

DUR_HSDPA_USERS_15_OR_16

M1000C240

DURATIONOFACTIVEHSDPAUSERS17TO20SIMULTANEOUSUSERS

DURA_HSDPA_USERS_17_TO_20

M1000C241

DURATIONOFACTIVEHSDPAUSERS21TO24SIMULTANEOUSUSERS

DURA_HSDPA_USERS_21_TO_24

M1000C242

DURATIONOFACTIVEHSDPAUSERS25TO28SIMULTANEOUSUSERS

DURA_HSDPA_USERS_25_TO_28

M1000C243

DURATIONOFACTIVEHSDPAUSERS29TO32SIMULTANEOUSUSERS

DURA_HSDPA_USERS_29_TO_32

M1000C244

DURATIONOFACTIVEHSDPAUSERS33TO36SIMULTANEOUSUSERS

DURA_HSDPA_USERS_33_TO_36

M1000C245

DURATIONOFACTIVEHSDPAUSERS37TO40SIMULTANEOUSUSERS

DURA_HSDPA_USERS_37_TO_40

M1000C246

DURATIONOFACTIVEHSDPAUSERS41TO44SIMULTANEOUSUSERS

DURA_HSDPA_USERS_41_TO_44

312

DN0638161

R: 312/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 23

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN763:BasicHSDPAwithQPSKand5Codescounters(Cont.)

PIID

Name

Abbreviation

M1000C247

DURATIONOFACTIVEHSDPAUSERS45TO48SIMULTANEOUSUSERS

DURA_HSDPA_USERS_45_TO_48

M1000C282

MAXNUMBEROFHSDPAUSERSPER
CELL

MAX_HSDPA_USERS_IN_CELL

M1000C284

SUMOFHSDPAUSERSPERCELL

SUM_HSDPA_USERS_IN_CELL

M1000C285

HSDPAUSERSPERCELLDENOMINATOR

DENOM_HSDPA_USERS_PER_CELL

M1000C312

DURATIONOFACTIVEHSDPAUSERS-1 DURA_HSDPA_USERS_1
SIMULTANEOUSUSER

M1000C313

DURATIONOFACTIVEHSDPAUSERS-3 DURA_HSDPA_USERS_3
SIMULTANEOUSUSERS

M1000C314

DURATIONOFACTIVEHSDPAUSERS49TO52SIMULTANEOUSUSERS

DURA_HSDPA_USERS_49_TO_52

M1000C315

DURATIONOFACTIVEHSDPAUSERS53TO56SIMULTANEOUSUSERS

DURA_HSDPA_USERS_53_TO_56

M1000C316

DURATIONOFACTIVEHSDPAUSERS57TO60SIMULTANEOUSUSERS

DURA_HSDPA_USERS_57_TO_60

M1000C317

DURATIONOFACTIVEHSDPAUSERS61TO64SIMULTANEOUSUSERS

DURA_HSDPA_USERS_61_TO_64

Service level measurements


M1001C548

UESUPPORTFORHSDSCHCLASS1TO
6

UE_SUPP_HSDSCH_CLASS_1_6

M1001C549

UESUPPORTFORHSDSCHCLASS7OR UE_SUPP_HSDSCH_CLASS_7_8
8

M1001C550

UESUPPORTFORHSDSCHCLASS9OR UE_SUPP_HSDSCH_CLASS_9_10
10

M1001C551

UESUPPORTFORHSDSCHCLASS11
OR12

UE_SUPP_HSDSCH_CLASS_11_12

Packet call measurements

Issue:06H

DN0638161

R: 313/396

313

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 23

WCDMARANRRMHSDPA

RAN763:BasicHSDPAwithQPSKand5Codescounters(Cont.)

PIID

Name

Abbreviation

M1022C5

HS-DSCH/DCHPACKETCALLATTFOR
INTERACTIVE

PS_ATT_HSDSCH_DCH_INT

M1022C6

HS-DSCH/DCHPACKETCALLATTFOR
BACKGROUND

PS_ATT_HSDSCH_DCH_BGR

M1022C25

HS-DSCH/DCHALLOAFTERHSDSCH/DCHREQFORINTERACTIVE

HS_D_REQ_HS_D_ALLO_INT

M1022C26

HS-DSCH/DCHALLOAFTERHSDSCH/DCHREQFORBACKGROUND

HS_D_REQ_HS_D_ALLO_BGR

M1022C29

DCH/DCHALLOAFTERHS-DSCH/DCH
REQFORINTERACTIVE

HS_D_REQ_D_D_ALLO_INT

M1022C30

DCH/DCHALLOAFTERHS-DSCH/DCH
REQFORBACKGROUND

HS_D_REQ_D_D_ALLO_BGR

M1022C47

HS-DSCH/DCHPACKETCALLNORMREL PS_REL_NORM_HS_D_INT
FORINTERACTIVE

M1022C48

HS-DSCH/DCHPACKETCALLNORMREL PS_REL_NORM_HS_D_BGR
FORBACKGROUND

M1022C53

HS-DSCH/DCHPACKETCALLRELDUE
TOPRE-EMPFORINTERACTIVE

PS_REL_PRE_EMP_HS_D_INT

M1022C54

HS-DSCH/DCHPACKETCALLRELDUE
TOPRE-EMPFORBACKGROUND

PS_REL_PRE_EMP_HS_D_BGR

M1022C59

HS-DSCH/DCHPACKETCALLRELDUE
TORLFAILFORINTERACTIVE

PS_REL_RL_FAIL_HS_D_INT

M1022C60

HS-DSCH/DCHPACKETCALLRELDUE
TORLFAILFORBACKGROUND

PS_REL_RL_FAIL_HS_D_BGR

M1022C65

HS-DSCH/DCHPACKETCALLRELDUE
TOOTHERFAILFORINTERACTIVE

PS_REL_OTH_FAIL_HS_D_INT

M1022C66

HS-DSCH/DCHPACKETCALLRELDUE
TOOTHERFAILFORBACKGROUND

PS_REL_OTH_FAIL_HS_D_BGR

314

DN0638161

R: 314/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 24

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN235:HSDPAChannelSwitchingcounters

PIID

Name

Abbreviation

Traffic measurements
M1002C475

DCHSELECTEDFORINTERACTIVEDUE
TOMAXHSDPAUSERS

DCH_SEL_MAX_HSDPA_USERS_INT

M1002C476

DCHSELECTEDFORBACKGROUND
DUETOMAXHSDPAUSERS

DCH_SEL_MAX_HSDPA_USERS_BGR

M1002C477

HS-DSCHRELEASEDUETOOTHERDCH REL_ALLO_HS_DSCH_OTH_DCH_INT
TRANSITIONREASONFORINTERACTIVE

M1002C478

HS-DSCHRELEASEDUETOPREEMPTIONFORINTERACTIVE

REL_ALLO_HS_DSCH_PRE_EMP_INT

M1002C479

HS-DSCHRELEASEDUETORLFAILURE
FORINTERACTIVE

REL_ALLO_RL_FAIL_HS_DSCH_INT

M1002C480

HS-DSCHRELEASEDUETOOTHERDCH REL_ALLO_HS_DSCH_OTH_DCH_BGR
TRANSITIONREASONFORBACKGROUND

M1002C481

HS-DSCHRELEASEDUETOPREEMPTIONFORBACKGROUND

REL_ALLO_HS_DSCH_PRE_EMP_BGR

M1002C482

HS-DSCHRELEASEDUETORLFAILURE
FORBACKGROUND

REL_ALLO_RL_FAIL_HS_DSCH_BGR

Table 25

RAN1013:16kbit/sReturnChannelDCHDataRateSupportforHSDPA
counters

PIID

Name

Abbreviation

Traffic measurements
M1002C501

HS-DSCH16KBPSRETURNCHALLOCA- ALLO_HS_DSCH_RET_16_INT
TIONSFORINTERACTIVE

M1002C502

HS-DSCH16KBPSRETURNCHALLOCA- ALLO_HS_DSCH_RET_16_BGR
TIONSFORBACKGROUND

M1002C503

HS-DSCH16KBPSRETURNCHDURATIONFORINTERACTIVE

Issue:06H

DN0638161

R: 315/396

ALLO_DUR_HS_DSCH_RET_16_INT

315

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 25

WCDMARANRRMHSDPA

RAN1013:16kbit/sReturnChannelDCHDataRateSupportforHSDPA
counters(Cont.)

PIID

Name

Abbreviation

M1002C504

HS-DSCH16KBPSRETURNCHDURATIONFORBACKGROUND

ALLO_DUR_HS_DSCH_RET_16_BGR

M1002C505

HS-DSCH16KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFORINTERACTIVE

SETUP_FAIL_16_IUB_HSDSCH_INT

M1002C506

HS-DSCH16KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFOR
BACKGROUND

SETUP_FAIL_16_IUB_HSDSCH_BGR

M1002C570

HS-DSCH16KBPSRETURNCHALLOCA- ALLO_HS_DSCH_RET_16_STR
TIONSFORSTREAMING

M1002C574

HS-DSCH16KBPSRETURNCHDURATIONFORSTREAMING

ALLO_DUR_HS_DSCH_RET_16_STR

M1002C586

HS-DSCH16KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFOR
STREAMING

SETUP_FAIL_16_IUB_HSDSCH_STR

Table 26

RAN312:HSDPADynamicResourceAllocationcounters

PIID

Name

Abbreviation

Cell resource measurements


M1000C232

MINIMUMPTXTARGETPS

MIN_PTX_TARGET_PS

M1000C233

MAXIMUMPTXTARGETPS

MAX_PTX_TARGET_PS

M1000C234

AVERAGEPTXTARGETPS

AVE_PTX_TARGET_PS

M1000C235

PTXTARGETPSDENOM

PTX_TARGET_PS_DENOM

M1000C236

MINHSPADLPOWER

MIN_HSPA_DL_POWER

M1000C237

MAXHSPADLPOWER

MAX_HSPA_DL_POWER

M1000C238

AVEHSPADLPOWER

AVE_HSPA_DL_POWER

M1000C239

HSPADLPOWERSAMPLES

HSPA_DL_POWER_SAMPLES

316

DN0638161

R: 316/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 26

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN312:HSDPADynamicResourceAllocationcounters(Cont.)

PIID

Name

Abbreviation

M1000C248

DURATIONOFHSDPA5CODESRESERVATION

DURA_HSDPA_5_CODE

M1000C249

DURATIONOFHSDPA6CODESRESERVATION

DURA_HSDPA_6_CODE

M1000C250

DURATIONOFHSDPA7CODESRESERVATION

DURA_HSDPA_7_CODE

M1000C251

DURATIONOFHSDPA8CODESRESERVATION

DURA_HSDPA_8_CODE

M1000C252

DURATIONOFHSDPA9CODESRESERVATION

DURA_HSDPA_9_CODE

M1000C253

DURATIONOFHSDPA10CODESRESER- DURA_HSDPA_10_CODE
VATION

M1000C254

DURATIONOFHSDPA11CODESRESER- DURA_HSDPA_11_CODE
VATION

M1000C255

DURATIONOFHSDPA12CODESRESER- DURA_HSDPA_12_CODE
VATION

M1000C256

DURATIONOFHSDPA13CODESRESER- DURA_HSDPA_13_CODE
VATION

M1000C257

DURATIONOFHSDPA14CODESRESER- DURA_HSDPA_14_CODE
VATION

M1000C258

DURATIONOFHSDPA15CODESRESER- DURA_HSDPA_15_CODE
VATION

M1000C259

CHANNELIZATIONCODESF4REQUESTED

CHAN_CODE_SF4_REQUEST

M1000C260

CHANNELIZATIONCODESF8REQUESTED

CHAN_CODE_SF8_REQUEST

M1000C261

CHANNELIZATIONCODESF16REQUESTED

CHAN_CODE_SF16_REQUEST

M1000C262

CHANNELIZATIONCODESF32REQUESTED

CHAN_CODE_SF32_REQUEST

Issue:06H

DN0638161

R: 317/396

317

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 26

WCDMARANRRMHSDPA

RAN312:HSDPADynamicResourceAllocationcounters(Cont.)

PIID

Name

Abbreviation

M1000C263

CHANNELIZATIONCODESF64REQUESTED

CHAN_CODE_SF64_REQUEST

M1000C264

CHANNELIZATIONCODESF128REQUESTED

CHAN_CODE_SF128_REQUEST

M1000C265

CHANNELIZATIONCODESF256REQUESTED

CHAN_CODE_SF256_REQUEST

M1000C266

HSDPACHCODEDOWNGRADEDUETO
RT

CH_CODE_DOWNG_RT

M1000C267

HSDPACHCODEDOWNGRADEDUETO
NRTDCH

CH_CODE_DOWNG_NRT_DCH

Traffic measurements
M1002C507

CHANNELTYPESWITCHFROMDCHTO
HS-DSCHFORINTERACTIVE

SWI_DCH_TO_HS_DSCH_INT

M1002C508

CHANNELTYPESWITCHFROMDCHTO
HS-DSCHFORBACKGROUND

SWI_DCH_TO_HS_DSCH_BGR

RRC signaling measurement


M1006C127

CELLFACHSTATETOHS-DSCH

CELL_FACH_STATE_TO_HS_DSCH

Packet call measurements


M1022C33

SWIHS-DSCH/E-DCHTOHS-DSCH/DCH
FORINTERACTIVE

PS_SWI_HS_E_TO_HS_D_INT

M1022C34

SWIHS-DSCH/E-DCHTOHS-DSCH/DCH
FORBACKGROUND

PS_SWI_HS_E_TO_HS_D_BGR

M1022C35

SWIHS-DSCH/E-DCHTODCH/DCHFOR
INTERACTIVE

PS_SWI_HS_E_TO_D_D_INT

M1022C36

SWIHS-DSCH/E-DCHTODCH/DCHFOR
BACKGROUND

PS_SWI_HS_E_TO_D_D_BGR

M1022C37

SWIHS-DSCH/DCHTODCH/DCHFORIN- PS_SWI_HS_D_TO_D_D_INT
TERACTIVE

318

DN0638161

R: 318/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 26

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN312:HSDPADynamicResourceAllocationcounters(Cont.)

PIID

Name

Abbreviation

M1022C38

SWIHS-DSCH/DCHTODCH/DCHFOR
BACKGROUND

PS_SWI_HS_D_TO_D_D_BGR

M1022C39

SWIHS-DSCH/DCHTOHS-DSCH/E-DCH
FORINTERACTIVE

PS_SWI_HS_D_TO_HS_E_INT

M1022C40

SWIHS-DCSH/DCHTOHS-DSCH/E-DCH
FORBACKGROUND

PS_SWI_HS_D_TO_HS_E_BGR

M1022C41

SWIDCH/DCHTOHS-DSCH/DCHFORIN- PS_SWI_D_D_TO_HS_D_INT
TERACTIVE

M1022C42

SWIDCH/DCHTOHS-DSCH/DCHFOR
BACKGROUND

PS_SWI_D_D_TO_HS_D_BGR

M1022C43

SWIDCH/DCHTOHS-DSCH/E-DCHFOR
INTERACTIVE

PS_SWI_D_D_TO_HS_E_INT

M1022C44

SWIDCH/DCHTOHS-DSCH/E-DCHFOR
BACKGROUND

PS_SWI_D_D_TO_HS_E_BGR

Table 27

RAN852:HSDPA15Codescounters

PIID

Name

Abbreviation

Cell resource measurements


M1000C254

DURATIONOFHSDPA11CODESRESER- DURA_HSDPA_11_CODE
VATION

M1000C255

DURATIONOFHSDPA12CODESRESER- DURA_HSDPA_12_CODE
VATION

M1000C256

DURATIONOFHSDPA13CODESRESER- DURA_HSDPA_13_CODE
VATION

M1000C257

DURATIONOFHSDPA14CODESRESER- DURA_HSDPA_14_CODE
VATION

M1000C258

DURATIONOFHSDPA15CODESRESER- DURA_HSDPA_15_CODE
VATION

Issue:06H

DN0638161

R: 319/396

319

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 28

WCDMARANRRMHSDPA

RAN1643:HSDPA64QAMcounters

PIID

Name

Abbreviation

M1001C672

UESUPPORTFORHSDSCHCLASS13
OR14

UE_SUPP_HSDSCH_CLASS_13_14

M1001C673

UESUPPORTFORHSDSCHCLASS15
OR16

UE_SUPP_HSDSCH_CLASS_15_16

M1001C674

UESUPPORTFORHSDSCHCLASS17
OR18

UE_SUPP_HSDSCH_CLASS_17_18

Table 29

RAN2954:Voicecallprioritisationduringhightrafficloadcounters

PIID

Name

Abbreviation

M1002C687

MASSEVENTHANDLERREJECTEDHSDSCH

MEH_REJECT_HSDSCH

Table 30

RAN2879:MassEventHandlercounters

PIID

Name

Abbreviation

M1000C406

MASSEVENTHANDLERACTIVEDURATION

MEH_ACTIVE_DURATION

M1000C407

MASSEVENTHANDLERACTIVATIONS

MEH_ACTIVATIONS

M1002C679

SC-HSDPASELECTEDDUETOULLOAD

TRAFFIC_SPARE_1

M1002C685

MASSEVENTHANDLERRESTRICTED
R99ULBITRATE

MEH_RESTR_R99_UL_DCH

M1002C686

MASSEVENTHANDLERREJECTEDEDCH

MEH_REJECT_EDCH

M1002C689

MASSEVENTHANDLERPREVENTED
2MSEDCHTTI

MEH_REJECT_2MS_EDCH_TTI

M1006C301

MASSEVENTHANDLERINCREASED
TVMPENDINGTIME

MEH_INCR_TVM_PEND_TIME

M1006C302

MASSEVENTHANDLERINCREASEDCQI MEH_INCR_CQI_CYCLE
FEEDBACKCYCLE

320

DN0638161

R: 320/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

NocountershavebeendefinedforthefollowingHSDPAresourceallocationfeatures:

RAN764:HSDPA16QAMSupport

RAN233:HSDPAAssociatedUplinkDPCHScheduling

RAN853:HSDPACodeMultiplexing

RAN1305:HSDPA14.4MbpsperCell

17.2.2 HSDPAmobilitycounters
Table 31

RAN828:HSDPAServingCellChangecounters

PIID

Name

Abbreviation

Intra system hard handover measurements


M1008C213

HS-DSCHSERVINGCELLCHANGES
STARTEDDUETOCPICHEC/NO

SCC_STARTED_CPICH_ECNO

M1008C214

HS-DSCHSERVINGCELLCHANGES
STARTEDDUETOULSIRERROR

SCC_STARTED_UL_SIR_ERROR

M1008C215

HS-DSCHSERVINGCELLCHANGES
STARTEDDUETOACTIVESETUPDATE

SCC_STARTED_ACTIVE_SET_UPD

M1008C216

HS-DSCHSERVINGCELLCHANGES
STARTEDDUETOOTHERREASON

SCC_STARTED_OTHER_REASON

M1008C217

HS-DSCHSERVINGCELLCHANGES
FAILEDDUETOUE

SCC_FAILED_DUE_TO_UE

M1008C218

HS-DSCHSERVINGCELLCHANGES
FAILEDDUETOBTS

SCC_FAILED_DUE_TO_BTS

M1008C219

HS-DSCHSERVINGCELLCHANGES
FAILEDDUETOTRANSPORT

SCC_FAILED_DUE_TO_TRANSM

M1008C220

HS-DSCHSERVINGCELLCHANGES
FAILEDDUETOAC

SCC_FAILED_DUE_TO_AC

M1008C221

HS-DSCHSERVINGCELLCHANGES
FAILEDDUETOOTHERREASON

SCC_FAILED_DUE_TO_OTHER

M1008C222

HS-DSCHINTRABTSSERVINGCELL
CHANGESSUCCESSFUL

SCC_INTRA_BTS_SUCCESSFUL

M1008C223

HS-DSCHINTERBTSSERVINGCELL
CHANGESSUCCESSFUL

SCC_INTER_BTS_SUCCESSFUL

Issue:06H

DN0638161

R: 321/396

321

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 31

WCDMARANRRMHSDPA

RAN828:HSDPAServingCellChangecounters(Cont.)

PIID

Name

Abbreviation

M1008C224

HS-DSCHSERVINGCELLCHANGES
PREVENTEDDUETOTIMER

SCC_PREVENTED_DUE_TO_TIMER

Table 32

RAN829:HSDPASoft/softerHandoverforAssociatedDPCHcounters

PIID

Name

Abbreviation

Soft handover measurements


M1007C48

ONECELLINTHEACTIVESETFORHSD- ONE_CELL_IN_ACT_SET_HSDPA
PAMOBILITY

M1007C49

TWOCELLSINTHEACTIVESETFOR
HSDPAMOBILITY

TWO_CELLS_IN_ACT_SET_HSDPA

M1007C50

THREECELLSINTHEACTIVESETFOR
HSDPAMOBILITY

THREE_CELLS_IN_ACT_SET_HSDPA

M1007C51

SOFTERHANDOVERDURATIONONTHE
SRNCSIDEFORHSDPAMOBILITY

SOFTER_HO_DUR_HSDPA

M1007C52

INTER-RNCSOFTHANDOVERDURATIONONTHESRNCSIDEFORHSDPA
MOBILITY

INTER_RNC_SOFT_HO_DUR_HSDPA

M1007C53

CELLADDITIONREQUESTONSHOFOR
HSDPAMOBILITY

CELL_ADD_REQ_ON_SHO_HSDPA

M1007C54

CELLDELETIONREQUESTONSHOFOR CELL_DEL_REQ_ON_SHO_HSDPA
HSDPAMOBILITY

M1007C55

CELLREPLACEMENTREQUESTONSHO CELL_REPL_REQ_ON_SHO_HSDPA
FORHSDPAMOBILITY

M1007C56

CELLADDITIONFAILUREONSHOFOR
HSDPAMOBILITY

CELL_ADD_FAIL_ON_SHO_HSDPA

M1007C57

CELLDELETIONFAILUREONSHOFOR
HSDPAMOBILITY

CELL_DEL_FAIL_ON_SHO_HSDPA

M1007C58

CELLREPLACEMENTFAILUREONSHO
FORHSDPAMOBILITY

CELL_REPL_FAIL_ON_SHO_HSDPA

322

DN0638161

R: 322/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 32

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN829:HSDPASoft/softerHandoverforAssociatedDPCHcounters
(Cont.)

PIID

Name

Abbreviation

M1007C59

SUCCESSFULACTIVESETUPDATESON SUCC_UPDATES_ON_SHO_HSDPA
SHOFORHSDPAMOBILITY

M1007C60

UNSUCCESSFULACTIVESETUPDATES
ONSHOFORHSDPAMOBILITY

UNSUCC_UPDATES_ON_SHO_HSDPA

M1007C61

HIGHUERX-TXTIMEDIFFERENCEFOR
HSDPAMOBILITY

HIGH_UE_RX_TX_TIME_DIF_HSDPA

M1007C62

LOWUERX-TXTIMEDIFFERENCEFOR
HSDPAMOBILITY

LOW_UE_RX_TX_TIME_DIF_HSDPA

Table 33

RAN1515:HSPAInter-RNCCellChangecounters

PIID

Name

Abbreviation

Traffic measurements
M1002C545

HS-DSCHALLOFORINTERRNCHHOIN- ALLO_HS_INTER_RNC_HHO_INT
TERACTIVE

M1002C546

HS-DSCHALLOFORINTERRNCHHO
BACKGROUND

ALLO_HS_INTER_RNC_HHO_BGR

M1002C547

HS-DSCHSETUPFAILFORINTERRNC
HHOINTERACTIVE

STP_F_HS_INTER_RNC_HHO_INT

M1002C548

HS-DSCHSETUPFAILFORINTERRNC
HHOBACKGROUND

STP_F_HS_INTER_RNC_HHO_BGR

M1002C549

E-DCHALLOFORINTERRNCHHOINTERACTIVE

ALLO_ED_INTER_RNC_HHO_INT

M1002C550

E-DCHALLOFORINTERRNCHHO
BACKGROUND

ALLO_ED_INTER_RNC_HHO_BGR

M1002C551

E-DCHSETUPFAILFORINTERRNCHHO STP_F_ED_INTER_RNC_HHO_INT
INTERACTIVE

M1002C552

E-DCHSETUPFAILFORINTERRNCHHO STP_F_ED_INTER_RNC_HHO_BGR
BACKGROUND

Issue:06H

DN0638161

R: 323/396

323

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 33

WCDMARANRRMHSDPA

RAN1515:HSPAInter-RNCCellChangecounters(Cont.)

PIID

Name

Abbreviation

Intra system hard handover measurements


M1008C243

INTERRNCHHOATTEMPTSDUETO
HSPASCC

INTER_RNC_HHO_ATT_HSPA_SCC

M1008C244

SUCCESSFULINTERRNCHHODUETO
HSPASCC

INTER_RNC_HHO_SUCC_HSPA_SCC

M1008C245

UNSUCCESSFULINTERRNCHHO
CAUSEDBYHSPASCC

UNSUCC_INTER_RNC_HHO_SCC

M1008C246

CONNECTIONDROPSDURINGINTER
RNCHHOCAUSEDBYHSPASCC

INTER_RNC_HHO_DROP_SCC

Packet call measurements


M1022C78

HS-DSCH/E-DCHALLOAFTERHSDSCH/E-DCHHHOREQ

M1022C79

HS-DSCH/DCHALLOAFTERHS-DSCH/E- HS_E_REQ_HS_D_ALLO_HHO
DCHHHOREQ

M1022C80

HS-DSCH/DCHALLOAFTERHSDSCH/DCHHHOREQ

HS_D_REQ_HS_D_ALLO_HHO

M1022C81

DCH/DCHALLOAFTERHS-DSCH/E-DCH
HHOREQ

HS_E_REQ_D_D_ALLO_HHO

M1022C82

DCH/DCHALLOAFTERHS-DSCH/DCH
HHOREQ

HS_D_REQ_D_D_ALLO_HHO

Table 34

HS_E_REQ_HS_E_ALLO_HHO

RAN1276:HSDPAInter-frequencyHandovercounters

PIID

Name

Abbreviation

Traffic measurements
M1002C623

ALLOCATIONFORHSDPAIFHOCOMPRESSEDMODE

ALLO_CM_HSDPA_IFHO

M1002C624

ALLOCATIONDURATIONFORHSDPA
IFHOCOMPRESSEDMODE

ALLO_DURA_CM_HSDPA_IFHO

324

DN0638161

R: 324/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 34

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1276:HSDPAInter-frequencyHandovercounters(Cont.)

PIID

Name

Abbreviation

M1002C625

REJECTEDHSDPAIFHOCOMPRESSED
MODE

REJ_CM_HSDPA_IFHO

Intra system hard handover measurements


M1008C247

HSPAIFHOMEASSTARTATTEMPTS

ATT_HSPA_IFHO_MEAS

M1008C248

HSPAIFHOMEASSTARTFAILURES

FAIL_HSPA_IFHO_MEAS

M1008C249

NOTSTARTEDHSPAIFHOBECAUSENO
CELLGOODENOUGH

NOT_START_HSPA_IFHO_NO_CELL

M1008C250

HSPAINTRA-RNCIFHOATTEMPTS

ATT_HSPA_INTRA_IFHO

M1008C251

HSPAINTER-RNCIFHOATTEMPTS

ATT_HSPA_INTER_IFHO

M1008C252

SUCCESSFULHSPAINTRA-RNCIFHOTO SUCC_HSPA_INTRA_IFHO_REL99
REL99

M1008C253

SUCCESSFULHSPAINTRA-RNCIFHOTO SUCC_HSPA_INTRA_IFHO_HSDPA
HSDPA

M1008C254

SUCCESSFULHSPAINTRA-RNCIFHOTO SUCC_HSPA_INTRA_IFHO_HSUPA
HSUPA

M1008C255

SUCCESSFULHSPAINTER-RNCIFHO

SUCC_HSPA_INTER_IFHO

M1008C256

FAILEDHSPAINTRA-RNCIFHODUETO
UTRAN

FAIL_HSPA_INTRA_IFHO_UTRAN

M1008C257

FAILEDHSPAINTER-RNCIFHODUETO
UTRAN

FAIL_HSPA_INTER_IFHO_UTRAN

M1008C258

FAILEDHSPAINTRA-RNCIFHODUETO
UENACK

FAIL_HSPA_INTRA_IFHO_UE_NACK

M1008C259

FAILEDHSPAINTER-RNCIFHODUETO
UENACK

FAIL_HSPA_INTER_IFHO_UE_NACK

M1008C260

FAILEDHSPAINTRA-RNCIFHODUETO
UELOST

FAIL_HSPA_INTRA_IFHO_UE_LOST

M1008C261

FAILEDHSPAINTER-RNCIFHODUETO
UELOST

FAIL_HSPA_INTER_IFHO_UE_LOST

Issue:06H

DN0638161

R: 325/396

325

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 35

WCDMARANRRMHSDPA

RAN1596:HSPACapabilityBasedHandovercounters

PIID

Name

Abbreviation

Intra system hard handover measurements


M1008C262

IFHOMEASSTARTATTEMPTSDUETO
HSPACAPA

ATT_HCAP_IFHO_MEAS

M1008C263

IFHOMEASSTARTFAILURESDUETO
HSPACAPA

FAIL_HCAP_IFHO_MEAS

M1008C264

NOTSTARTEDIFHOBECAUSENOCELL
GOODENOUGHDUETOHSPACAPA

NOT_START_HCAP_IFHO_NO_CELL

M1008C265

INTRA-RNCIFHOATTEMPTSDUETO
HSPACAPA

ATT_HCAP_INTRA_IFHO

M1008C266

INTER-RNCIFHOATTEMPTSDUETO
HSPACAPA

ATT_HCAP_INTER_IFHO

M1008C267

SUCCESSFULINTRA-RNCIFHODUETO
HSPACAPA

SUCC_HCAP_INTRA_IFHO

M1008C268

SUCCESSFULINTER-RNCIFHODUETO
HSPACAPA

SUCC_HCAP_INTER_IFHO

M1008C269

FAILEDHSPACAPATRIGGEREDINTRARNCIFHODUETOUTRAN

FAIL_HCAP_INTRA_IFHO_UTRAN

M1008C270

FAILEDHSPACAPATRIGGEREDINTERRNCIFHODUETOUTRAN

FAIL_HCAP_INTER_IFHO_UTRAN

M1008C271

FAILEDHSPACAPATRIGGEREDINTRARNCIFHODUETOUENACK

FAIL_HCAP_INTRA_IFHO_UE_NACK

M1008C272

FAILEDHSPACAPATRIGGEREDINTERRNCIFHODUETOUENACK

FAIL_HCAP_INTER_IFHO_UE_NACK

M1008C273

FAILEDHSPACAPATRIGGEREDINTRARNCIFHODUETOUELOST

FAIL_HCAP_INTRA_IFHO_UE_LOST

M1008C274

FAILEDHSPACAPATRIGGEREDINTERRNCIFHODUETOUELOST

FAIL_HCAP_INTER_IFHO_UE_LOST

NocountersexistforthefollowingHSDPAmobility-relatedfeatures:

326

RAN230:HSDPAMobilityHandlingwithDCHSwitching

DN0638161

R: 326/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1148:HSDPACellReselection

17.2.3 MultiRABcombinationswithHSDPAcounters
Table 36

RAN827:HSDPAwithSimultaneousAMRVoiceCallcounters

PIID

Name

Abbreviation

Traffic measurements
M1002C403

REJECTEDAMR+HS-DSCHFORBACKGROUND

REJ_HS_DSCH_AMR_BGR

M1002C404

AMR+HS-DSCHSETUPFAILUREFOR
BACKGROUND

SETUP_FAIL_HS_DSCH_AMR_BGR

M1002C405

AMR+HS-DSCHALLOCATIONSFOR
BACKGROUND

ALLO_HS_DSCH_AMR_BGR

M1002C406

AMR+HS-DSCHNORMALRELEASE
FORBACKGROUND

REL_ALLO_NORM_HSDSCH_AMR_BGR

M1002C483

REJECTEDAMR+HS-DSCHFORINTERACTIVE

REJ_HS_DSCH_AMR_INT

M1002C484

AMR+HS-DSCHSETUPFAILUREFOR
INTERACTIVE

SETUP_FAIL_HS_DSCH_AMR_INT

M1002C485

AMR+HS-DSCHALLOCATIONSFORINTERACTIVE

ALLO_HS_DSCH_AMR_INT

M1002C486

AMR+HS-DSCHNORMALRELEASE
FORINTERACTIVE

REL_ALLO_NORM_HSDSCH_AMR_INT

Table 37

RAN285:HSPAMultiNRTRABscounters

PIID

Name

Abbreviation

Traffic measurements
M1002C617

AMR+MULTI-NRTHSPAALLOCATION

ALLO_AMR_MULTINRT_HSPA

M1002C618

MULTI-NRTHSPAALLOCATION

ALLO_MULTINRT_HSPA

M1002C620

AMR+RT-HSPA+MULTI-NRT-HSPAALLOCATION

ALLO_AMR_RT_MULTINRT_HSPA

Issue:06H

DN0638161

R: 327/396

327

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 37

WCDMARANRRMHSDPA

RAN285:HSPAMultiNRTRABscounters(Cont.)

PIID

Name

Abbreviation

M1002C622

RT-HSPA+MULTI-NRT-HSPAALLOCATION

ALLO_RT_MULTINRT_HSPA

Nocountersexistforthefollowingfeaturesrelatedtomulti-RABcombinationswith
HSDPA:

RAN820:HSDPAwithAdditionalRABInitiation

RAN1727:EnhancementtoHSDPAwithSimultaneousAMRVoiceCall

17.2.4 HSDPAuserexperiencecounters
Table 38

RAN839:HSDPA16UsersperCellcounters

PIID

Name

Abbreviation

Cell resource measurements


M1000C167

DURATIONOFNOACTIVEHSDPA
USERS

M1000C168

DURATIONOFACTIVEHSDPAUSERS-1 DUR_HSDPA_USERS_1_OR_2
OR2SIMULTANEOUSUSERS

M1000C169

DURATIONOFACTIVEHSDPAUSERS-3 DUR_HSDPA_USERS_3_OR_4
OR4SIMULTANEOUSUSERS

M1000C170

DURATIONOFACTIVEHSDPAUSERS-5 DUR_HSDPA_USERS_5_OR_6
OR6SIMULTANEOUSUSERS

M1000C171

DURATIONOFACTIVEHSDPAUSERS-7 DUR_HSDPA_USERS_7_OR_8
OR8SIMULTANEOUSUSERS

M1000C172

DURATIONOFACTIVEHSDPAUSERS-9 DUR_HSDPA_USERS_9_OR_10
OR10SIMULTANEOUSUSERS

M1000C173

DURATIONOFACTIVEHSDPAUSERS11OR12SIMULTANEOUSUSERS

DUR_HSDPA_USERS_11_OR_12

M1000C174

DURATIONOFACTIVEHSDPAUSERS13OR14SIMULTANEOUSUSERS

DUR_HSDPA_USERS_13_OR_14

328

DUR_HSDPA_NO_USERS

DN0638161

R: 328/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

WCDMARANRRMHSDPA

Table 38

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN839:HSDPA16UsersperCellcounters(Cont.)

PIID

Name

Abbreviation

M1000C175

DURATIONOFACTIVEHSDPAUSERS15OR16SIMULTANEOUSUSERS

DUR_HSDPA_USERS_15_OR_16

Table 39

RAN1033:HSDPA48UsersperCellcounters

PIID

Name

Abbreviation

Cell resource measurements


M1000C240

DURATIONOFACTIVEHSDPAUSERS17TO20SIMULTANEOUSUSERS

DURA_HSDPA_USERS_17_TO_20

M1000C241

DURATIONOFACTIVEHSDPAUSERS21TO24SIMULTANEOUSUSERS

DURA_HSDPA_USERS_21_TO_24

M1000C242

DURATIONOFACTIVEHSDPAUSERS25TO28SIMULTANEOUSUSERS

DURA_HSDPA_USERS_25_TO_28

M1000C243

DURATIONOFACTIVEHSDPAUSERS29TO32SIMULTANEOUSUSERS

DURA_HSDPA_USERS_29_TO_32

M1000C244

DURATIONOFACTIVEHSDPAUSERS33TO36SIMULTANEOUSUSERS

DURA_HSDPA_USERS_33_TO_36

M1000C245

DURATIONOFACTIVEHSDPAUSERS37TO40SIMULTANEOUSUSERS

DURA_HSDPA_USERS_37_TO_40

M1000C246

DURATIONOFACTIVEHSDPAUSERS41TO44SIMULTANEOUSUSERS

DURA_HSDPA_USERS_41_TO_44

M1000C247

DURATIONOFACTIVEHSDPAUSERS45TO48SIMULTANEOUSUSERS

DURA_HSDPA_USERS_45_TO_48

Table 40

RAN1464:HSDPA64UsersperCellcounters

PIID

Name

Abbreviation

Cell resource measurements


M1000C312

Issue:06H

DURATIONOFACTIVEHSDPAUSERS-1 DURA_HSDPA_USERS_1
SIMULTANEOUSUSER

DN0638161

R: 329/396

329

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 40

WCDMARANRRMHSDPA

RAN1464:HSDPA64UsersperCellcounters(Cont.)

PIID

Name

Abbreviation

M1000C313

DURATIONOFACTIVEHSDPAUSERS-3 DURA_HSDPA_USERS_3
SIMULTANEOUSUSERS

M1000C314

DURATIONOFACTIVEHSDPAUSERS49TO52SIMULTANEOUSUSERS

DURA_HSDPA_USERS_49_TO_52

M1000C315

DURATIONOFACTIVEHSDPAUSERS53TO56SIMULTANEOUSUSERS

DURA_HSDPA_USERS_53_TO_56

M1000C316

DURATIONOFACTIVEHSDPAUSERS57TO60SIMULTANEOUSUSERS

DURA_HSDPA_USERS_57_TO_60

M1000C317

DURATIONOFACTIVEHSDPAUSERS61TO64SIMULTANEOUSUSERS

DURA_HSDPA_USERS_61_TO_64

Table 41

RAN1249:HSDPA10MbpsperUserandRAN1258:HSDPA14Mbpsper
Usercounters

PIID

Name

Abbreviation

RCPM RLC measurements


M1017C50

USERDLTHROUGHPUTDISTRIBUTION- USER_DL_THRP_DIST_CLASS_11
CLASS11

M1017C51

USERDLTHROUGHPUTDISTRIBUTION- USER_DL_THRP_DIST_CLASS_12
CLASS12

M1017C52

USERDLTHROUGHPUTDISTRIBUTION- USER_DL_THRP_DIST_CLASS_13
CLASS13

Table 42

RAN955:PowerSavingModeforBTScounters

PIID

Name

Abbreviation

M1000C377

WCELLPOWERSAVINGMODEACTIVATIONS

WCELL_POWER_SAVING_MODE_ACT

M1000C378

AVAILABILITYWCELLINPOWERSAVING
MODE

AVAIL_WCELL_IN_POWER_SAVING

330

DN0638161

R: 330/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

WCDMARANRRMHSDPA

Table 42

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN955:PowerSavingModeforBTScounters(Cont.)

PIID

Name

Abbreviation

M1008C286

INTERFREQHOATTEMPTSFORCEDBY
CELLSHUTDOWNFORNRT

ATT_IFHO_CELL_SHUTDOWN_NRT

M1008C287

INTERFREQHOATTEMPTSFORCEDBY
CELLSHUTDOWNFORRT

ATT_IFHO_CELL_SHUTDOWN_RT

M1008C288

SUCCESSFULINTERFREQHOFORCED
BYCELLSHUTDOWNFORNRT

SUCC_IFHO_CELL_SHUTDOWN_NRT

M1008C289

SUCCESSFULINTERFREQHOFORCED
BYCELLSHUTDOWNFORRT

SUCC_IFHO_CELL_SHUTDOWN_RT

M1010C225

INTERSYSTEMHOATTEMPTSFORCED
BYCELLSHUTDOWNFORNRT

ATT_ISHO_CELL_SHUTDOWN_NRT

M1010C226

INTERSYSTEMHOATTEMPTSFORCED
BYCELLSHUTDOWNFORRT

ATT_ISHO_CELL_SHUTDOWN_RT

M1010C227

SUCCESSFULINTERSYSTEMHO
FORCEDBYCELLSHUTDOWNFORNRT

SUCC_ISHO_CELL_SHUTDOWN_NRT

M1010C228

SUCCESSFULINTERSYSTEMHO
FORCEDBYCELLSHUTDOWNFORRT

SUCC_ISHO_CELL_SHUTDOWN_RT

M1031C6

UNSUCCESSFULHSPA05RECONFDUE
CELLSHUTDOWN

UNSUCC_HSPA05_RECONF_SHUTD

M1008C290

INTERFREQHOATTEMPTSFORCEDBY
BLOCKRESOURCEFORNRT

ATT_IFHO_CELL_BLOCK_NRT

M1008C291

INTERFREQHOATTEMPTSFORCEDBY
BLOCKRESOURCEFORRT

ATT_IFHO_CELL_BLOCK_RT

M1008C292

SUCCESSFULINTERFREQHOFORCED
BYBLOCKRESOURCEFORNRT

SUCC_IFHO_CELL_BLOCK_NRT

M1008C293

SUCCESSFULINTERFREQHOFORCED
BYBLOCKRESOURCEFORRT

SUCC_IFHO_CELL_BLOCK_RT

M1010C233

INTERSYSTEMHOATTEMPTSFORCED
BYBLOCKRESOURCEFORNRT

ATT_ISHO_CELL_BLOCK_NRT

M1010C234

INTERSYSTEMHOATTEMPTSFORCED
BYBLOCKRESOURCEFORRT

ATT_ISHO_CELL_BLOCK_RT

Issue:06H

DN0638161

R: 331/396

331

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 42

WCDMARANRRMHSDPA

RAN955:PowerSavingModeforBTScounters(Cont.)

PIID

Name

Abbreviation

M1010C235

SUCCESSFULINTERSYSTEMHO
FORCEDBYBLOCKRESOURCEFOR
NRT

SUCC_ISHO_CELL_BLOCK_NRT

M1010C236

SUCCESSFULINTERSYSTEMHO
FORCEDBYBLOCKRESOURCEFORRT

SUCC_ISHO_CELL_BLOCK_RT

M1031C7

SUCCESSFULHSPA05RECONFDUE
CELLACTIVATION

SUCC_HSPA05_RECONF_ACT

M1031C5

SUCCESSFULHSPA05RECONFDUE
CELLSHUTDOWN

SUCC_HSPA05_RECONF_SHUTD

M1031C8

UNSUCCESSFULHSPA05RECONFDUE
CELLACTIVATION

UNSUCC_HSPA05_RECONF_ACT

Table 43

RAN1201:FractionalDPCHcounters

PIID

Name

Abbreviated

M1002C665

E-DCHALLOFORSRBINDRNC

ALLO_EDCH_SRB_DRNC

M1002C664

E-DCHALLOFORSRBINSRNC

ALLO_EDCH_SRB_SRNC

M1002C667

HS-DSCHALLOFORSRBINDRNC

ALLO_HS_DSCH_SRB_DRNC

M1002C666

HS-DSCHALLOFORSRBINSRNC

ALLO_HS_DSCH_SRB_SRNC

Table 44

RAN1638:FlexibleRLC(DL)counters

PIID

Name

Abbreviation

M1006C202

RADIOBEARERCONFIGUREDFOR
FLEXIBLERLC

RB_CONFIGURED_FLEXIBLE_RLC

332

DN0638161

R: 332/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 45

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1642:MIMOcounters

PIID

Name

Abbreviation

M1001C699

ACCESSSTRATUMRELEASEINDICATOR ACCESS_STRATUM_REL_IND_8
RELEASE8

M1001C696

UESUPPORTFORHSDSCHCLASS19
OR20

UE_SUPP_HSDSCH_CLASS_19_20

M1001C697

UESUPPORTFORHSDSCHCLASS21
OR22

UE_SUPP_HSDSCH_CLASS_21_22

M1001C698

UESUPPORTFORHSDSCHCLASS23
OR24

UE_SUPP_HSDSCH_CLASS_23_24

Table 46

RAN1644:ContinuousPacketConnectivitycounters

PIID

Name

Abbreviation

M1001C677

UESUPPORTFORCONTINUOUSPACKET UE_SUPP_CPC
CONNECTIVITY

M1002C668

HS-DSCHMAC-DFLOWDURATIONININACTIVESTATEFORBACKGROUND

ALLO_DUR_HS_DSCH_INACTIV_BGR

M1002C669

HS-DSCHMAC-DFLOWDURATIONININACTIVESTATEFORINTERACTIVE

ALLO_DUR_HS_DSCH_INACTIV_INT

M1002C670

E-DCHALLOCATIONDURATIONININACTIVESTATEFORBACKGROUND

ALLO_DUR_EDCH_INACTIV_BGR

M1002C671

E-DCHALLOCATIONDURATIONININACTIVESTATEFORINTERACTIVE

ALLO_DUR_EDCH_INACTIV_INT

M1006C200

INACTIVEHSPAUPRELEASEDUETO
PREVENTIVEOVERLOAD

INACT_HSPA_REL_DUE_PREV_OVER

M1006C201

CAPACITYREQFORRELEASEDHSPA
DUETOPREVENTIVEOVERLOAD

CAP_REQ_REL_HSPA_DUE_PRE_OVE

Issue:06H

DN0638161

R: 333/396

333

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 47

WCDMARANRRMHSDPA

RAN1686:HSPA72userspercellcounters

PIID

Name

Abbreviated

M1000C363

DURATIONOFACTIVEHSUPAUSERS-65
TO72SIMULTANEOUSUSERS

DURA_HSDPA_USERS_17_OR_18

M1000C364

DURATIONOFACTIVEHSUPAUSERS-65
TO72SIMULTANEOUSUSERS

DURA_HSDPA_USERS_65_OR_72

M1000C365

DURATIONOFACTIVEHSUPAUSERS-65
TO72SIMULTANEOUSUSERS

DURA_HSDPA_USERS_17_OR_18

M1000C366

DURATIONOFACTIVEHSUPAUSERS-21
TO24SIMULTANEOUSUSERS

DURA_HSDPA_USERS_21_OR_24

M1000C367

DURATIONOFACTIVEHSUPAUSERS-25
TO28SIMULTANEOUSUSERS

DURA_HSDPA_USERS_25_OR_28

M1000C368

DURATIONOFACTIVEHSUPAUSERS-29
TO32SIMULTANEOUSUSERS

DURA_HSDPA_USERS_29_OR_32

M1000C369

DURATIONOFACTIVEHSUPAUSERS-33
TO36SIMULTANEOUSUSERS

DURA_HSDPA_USERS_33_OR_36

M1000C370

DURATIONOFACTIVEHSUPAUSERS-37
TO40SIMULTANEOUSUSERS

DURA_HSDPA_USERS_37_OR_40

M1000C371

DURATIONOFACTIVEHSUPAUSERS-41
TO44SIMULTANEOUSUSERS

DURA_HSDPA_USERS_41_OR_44

M1000C373

DURATIONOFACTIVEHSUPAUSERS-45
TO48SIMULTANEOUSUSERS

DURA_HSDPA_USERS_45_OR_48

M1000C373

DURATIONOFACTIVEHSUPAUSERS-49
TO52SIMULTANEOUSUSERS

DURA_HSDPA_USERS_49_OR_52

M1000C374

DURATIONOFACTIVEHSUPAUSERS-53
TO56SIMULTANEOUSUSERS

DURA_HSDPA_USERS_53_OR_56

M1000C375

DURATIONOFACTIVEHSUPAUSERS-57
TO60SIMULTANEOUSUSERS

DURA_HSDPA_USERS_57_OR_60

M1000C376

DURATIONOFACTIVEHSUPAUSERS-61
TO64SIMULTANEOUSUSERS

DURA_HSDPA_USERS_61_OR_64

M1031C0

DURATIONOFACTIVEHSUPAUSERS-65
TO72SIMULTANEOUSUSERS

DURA_HSDPA_USERS_65_OR_72

334

DN0638161

R: 334/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 47

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1686:HSPA72userspercellcounters(Cont.)

PIID

Name

Abbreviated

M1031C1

MAXNUMBEROFHSUPAUSERSPER
WBTS

MAX_HSUPA_USERS_PER_WBTS

M1031C2

SUMOFHSDPAUSERSPERWBTS

SUM_HSDPA_USERS_PER_WBTS

M1031C3

SUMOFHSUPAUSERSPERWBTS

SUM_HSUPA_USERS_PER_WBTS

M1031C4

HSPAUSERSPERWBTSDENOMINATOR

DENOM_HSPA_USERS_PER_WBTS

Table 48

RAN1689:CSvoiceoverHSPAcounters

PIID

Name

Abbreviation

M802C23

AMR_OVER_HSPA_AVERAGE

AMR_OVER_HSPA_AVERAGE

M802C24

AMR_OVER_HSPA_MAX

AMR_OVER_HSPA_MAX

M1001C671

UESUPPORTFORCSVOICEOVERHSPA

UE_SUPP_CS_VOICE_OVER_HSPA

M1002C636

HS-DSCHSETUPFAILUREDUETOBTSFOR
CSVOICE

SETUP_FAIL_BTS_HS_DSCH_AMR

M1002C637

HS-DSCHSETUPFAILUREDUETOUEFOR
CSVOICE

SETUP_FAIL_UE_HS_DSCH_AMR

M1002C638

HS-DSCHSETUPFAILUREDUETOTRANSPORTFORCSVOICE

SETUP_FAIL_TRANS_HS_DSCH_AMR

M1002C639

HS-DSCHSETUPFAILUREDUETOOTHER
REASONSFORCSVOICE

SETUP_FAIL_OTHER_HS_DSCH_AMR

M1002C640

E-DCHSETUPFAILUREDUETOBTSFORCS SETUP_FAIL_BTS_EDCH_AMR
VOICE

M1002C641

E-DCHSETUPFAILUREDUETOUEFORCS
VOICE

SETUP_FAIL_UE_EDCH_AMR

M1002C642

E-DCHSETUPFAILUREDUETOTRANSPORTFORCSVOICE

SETUP_FAIL_TRANS_EDCH_AMR

M1002C643

E-DCHSETUPFAILUREDUETOOTHER
REASONSFORCSVOICE

SETUP_FAIL_OTHER_EDCH_AMR

Issue:06H

DN0638161

R: 335/396

335

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 48

WCDMARANRRMHSDPA

RAN1689:CSvoiceoverHSPAcounters(Cont.)

PIID

Name

Abbreviation

M1002C644

HS-DSCHNORMALRELEASEFORAMR

REL_ALLO_NORM_HS_DSCH_AMR

M1002C645

HS-DSCHRELEASEDUETORLFAILURE
FORAMR

REL_ALLO_RL_FAIL_HS_DSCH_AMR

M1002C646

HS-DSCHRELEASEDUETOOTHERFAILUREFORAMR

REL_ALLO_OTH_FAIL_HSDSCH_AMR

M1002C647

E-DCHNORMALRELEASEFORAMR

REL_ALLO_NORM_EDCH_AMR

M1002C648

E-DCHRELEASEDUETORLFAILUREFOR
AMR

REL_ALLO_RL_FAIL_EDCH_AMR

M1002C649

E-DCHRELEASEDUETOOTHERFAILURE
FORAMR

REL_ALLO_OTH_FAIL_EDCH_AMR

M1002C650

CHANNELTYPESWITCHFROMR99DCHTO
HSPAFORAMR

SWI_R99_TO_HSPA_CS_AMR

M1002C651

CHANNELTYPESWITCHFROMHSPATO
R99DCHFORAMR

SWI_HSPA_TO_R99_CS_AMR

M1002C652

HS-DSCHALLOCATIONSFORAMR5.9KBPS
INSRNC

ALLO_HS_DSCH_5_9_AMR

M1002C653

HS-DSCHALLOCATIONSFORAMR12.2
KBPSINSRNC

ALLO_HS_DSCH_12_2_AMR

M1002C654

HS-DSCHALLOCATIONSFORAMR12.65
KBPSINSRNC

ALLO_HS_DSCH_12_65_AMR

M1002C655

HS-DSCHALLOCATIONDURATIONFORAMR ALLO_DUR_HS_DSCH_5_9_AMR
5.9KBPSINSRNC

M1002C656

HS-DSCHALLOCATIONDURATIONFORAMR ALLO_DUR_HS_DSCH_12_2_AMR
12.2KBPSINSRNC

M1002C657

HS-DSCHALLOCATIONDURATIONFORAMR ALLO_DUR_HS_DSCH_12_65_AMR
12.65KBPSINSRNC

M1002C658

E-DCHALLOCATIONSFORAMR5.9KBPSIN
SRNC

ALLO_SUCCESS_EDCH_AMR_5_9

M1002C659

E-DCHALLOCATIONSFORAMR12.2KBPS
INSRNC

ALLO_SUCCESS_EDCH_AMR_12_2

336

DN0638161

R: 336/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 48

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1689:CSvoiceoverHSPAcounters(Cont.)

PIID

Name

Abbreviation

M1002C660

E-DCHALLOCATIONSFORAMR12.65KBPS
INSRNC

ALLO_SUCCESS_EDCH_AMR_12_65

M1002C661

E-DCHALLOCATIONDURATIONFORAMR
5.9KBPSINSRNC

ALLO_DUR_EDCH_5_9_AMR

M1002C662

E-DCHALLOCATIONDURATIONFORAMR
12.2KBPSINSRNC

ALLO_DUR_EDCH_12_2_AMR

M1002C663

E-DCHALLOCATIONDURATIONFORAMR
12.65KBPSINSRNC

ALLO_DUR_EDCH_12_65_AMR

M1023C26

TRANSFERREDHS-DSCHDATAFORCS
VOICE

AMR_HS_DSCH_DATA_VOL

M1023C27

TRANSFERREDE-DCHDATAFORCSVOICE

AMR_EDCH_DATA_VOL

M1032C0

CSVOICEHSPAJITTERCLASS0

CS_VOICE_HSPA_JITTER_CLASS_0

M1032C1

CSVOICEHSPAJITTERCLASS1

CS_VOICE_HSPA_JITTER_CLASS_1

M1032C2

CSVOICEHSPAJITTERCLASS2

CS_VOICE_HSPA_JITTER_CLASS_2

M1032C3

CSVOICEHSPAJITTERCLASS3

CS_VOICE_HSPA_JITTER_CLASS_3

M1032C4

CSVOICEHSPAJITTERCLASS4

CS_VOICE_HSPA_JITTER_CLASS_4

M1032C5

CSVOICEHSPAJITTERCLASS5

CS_VOICE_HSPA_JITTER_CLASS_5

M1032C6

CSVOICEHSPADELAY10TTICLASS0

CS_VOICE_DELAY_10TTI_CLASS_0

M1032C7

CSVOICEHSPADELAY10TTICLASS1

CS_VOICE_DELAY_10TTI_CLASS_1

M1032C8

CSVOICEHSPADELAY10TTICLASS2

CS_VOICE_DELAY_10TTI_CLASS_2

M1032C9

CSVOICEHSPADELAY10TTICLASS3

CS_VOICE_DELAY_10TTI_CLASS_3

M1032C10

CSVOICEHSPADELAY10TTICLASS4

CS_VOICE_DELAY_10TTI_CLASS_4

M1032C11

CSVOICEHSPADELAY10TTICLASS5

CS_VOICE_DELAY_10TTI_CLASS_5

M1032C12

CSVOICEHSPADELAY10TTICLASS6

CS_VOICE_DELAY_10TTI_CLASS_6

Issue:06H

DN0638161

R: 337/396

337

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 48

WCDMARANRRMHSDPA

RAN1689:CSvoiceoverHSPAcounters(Cont.)

PIID

Name

Abbreviation

M1032C13

CSVOICEHSPADELAY2TTICLASS0

CS_VOICE_DELAY_2TTI_CLASS_0

M1032C14

CSVOICEHSPADELAY2TTICLASS1

CS_VOICE_DELAY_2TTI_CLASS_1

M1032C15

CSVOICEHSPADELAY2TTICLASS2

CS_VOICE_DELAY_2TTI_CLASS_2

M1032C16

CSVOICEHSPADELAY2TTICLASS3

CS_VOICE_DELAY_2TTI_CLASS_3

M1032C17

CSVOICEHSPADELAY2TTICLASS4

CS_VOICE_DELAY_2TTI_CLASS_4

M1032C18

CSVOICEHSPADELAY2TTICLASS5

CS_VOICE_DELAY_2TTI_CLASS_5

M1032C19

CSVOICEHSPADELAY2TTICLASS6

CS_VOICE_DELAY_2TTI_CLASS_6

M1032C20

TOTALULFRAMESCSVOICEHSPA

TOTAL_UL_FRAMES_CS_V_HSPA

M1032C21

LATEULFRAMESCSVOICEHSPA

LATE_UL_FRAMES_CS_V_HSPA

Table 49

RAN1906:Dual-CellHSDPA42Mbpscounters

PIID

Name

Abbreviation

M1005C252

MAC-DSETUPATTEMPTFORDC-HSDPA

ATT_MACD_SETUP_FOR_DCHSDPA

M1006C209

RBSETUPATTEMPTFORDC-HSDPA

ATT_RB_SETUP_DCHSDPA

M1005C254

FAILEDMAC-DSETUPFORDC-HSDPA

FAIL_MACD_SETUP_DCHSDPA

M1006C211

RBSETUPFAILFORDC-HSDPADUETONO
REPLY

FAIL_RB_SETUP_DCHSDPA_NOREP

M1006C212

RBSETUPFAILFORDC-HSDPADUETOUE
NACK

FAIL_RB_SETUP_DCHSDPA_UE

M1009C286

LTECSHHOINPREPFAILDUETORNL

LTE_CS_IN_PREP_FAIL_RNL

M1005C253

SUCCESSFULMAC-DSETUPFORDC-HSDPA

SUCC_MACD_SETUP_FOR_DCHSDPA

M1006C210

SUCCESSFULRBSETUPFORDC-HSDPA

SUCC_RB_SETUP_DCHSDPA

338

DN0638161

R: 338/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 50

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1762:DirectResourceAllocationforHSPAcounters

PIID

Name

Abbreviation

M1002C674

HSPADIREALSUCCESSFULFORBACKGROUND

ALLO_SUCC_HSPA_DIREAL_BGR

M1002C675

HSPADIREALSUCCESSFULFORINTERACTIVE

ALLO_SUCC_HSPA_DIREAL_INT

M1002C672

HSPADIREALATTEMPTSFORBACKGROUND

ATT_HSPA_DIREAL_BGR

M1002C673

HSPADIREALATTEMPTSFORINTERACTIVE

ATT_HSPA_DIREAL_INT

Table 51

RAN1912:MIMO42Mbpscounters

PIID

Name

Abbreviation

M1006C248

RADIOBEARERCONFIGURATIONFOR64QAM
FAILED

RB_CONFIG_64QAM_FAIL

M1006C247

RADIOBEARERCONFIGUREDFOR64QAM

RB_CONFIG_64QAM_SUCC

M1006C246

RADIOBEARERCONFIGURATIONFORMIMO
FAILED

RB_CONFIG_MIMO_FAIL

M1006C245

RADIOBEARERCONFIGUREDFORMIMO

RB_CONFIG_MIMO_SUCC

Table 52

RAN1907:DC-HSDPAwithMIMO84Mbpscounters

PIID

Name

Abbreviation

M1001C707

UESUPPORTFORHSDSCHCLASS25OR26

UE_SUPP_HSDSCH_CLASS_25_26

M1001C708

UESUPPORTFORHSDSCHCLASS27OR28

UE_SUPP_HSDSCH_CLASS_27_28

M1001C709

ACCESSSTRATUMRELEASEINDICATORRELEASE9

ACCESS_STRATUM_REL_IND_9

M1022C223

CHANNELSWITCHFROMDC-HSDPATOSCHSDPASUCCESSFUL

SUCC_SWI_DCHSDPA_TO_SCHSDPA

M1022C224

CHANNELSWITCHFROMSC-HSDPATODCHSDPASUCCESSFUL

SUCC_SWI_SCHSDPA_TO_DCHSDPA

Issue:06H

DN0638161

R: 339/396

339

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 53

WCDMARANRRMHSDPA

RAN2124:HSPA128UsersperCellcounters

PIID

Name

Abbreviation

M1000C384

DURATIONOFACTIVEHSUPAUSERS-73TO
80SIMULTANEOUSUSERS

DURA_HSUPA_USERS_73_TO_80

M1000C385

DURATIONOFACTIVEHSUPAUSERS-81TO
96SIMULTANEOUSUSERS

DURA_HSUPA_USERS_81_TO_96

M1000C386

DURATIONOFACTIVEHSUPAUSERS-97TO
112SIMULTANEOUSUSERS

DURA_HSUPA_USERS_97_TO_112

M1000C387

DURATIONOFACTIVEHSUPAUSERS-113OR
MOREUSERS

DURA_HSUPA_USERS_113_OR_MORE

M1000C388

MAXNUMBEROFHSUPAUSERSPERSERVINGCELL

MAX_HSUPA_USERS_IN_SERV_CELL

M1000C389

SUMOFHSUPAUSERSINSERVINGCELL

SUM_HSUPA_USERS_IN_SERV_CELL

M1000C390

DURATIONOFACTIVEHSDPAUSERS-73TO
80SIMULTANEOUSUSERS

DURA_HSDPA_USERS_73_TO_80

M1000C391

DURATIONOFACTIVEHSDPAUSERS-81TO
96SIMULTANEOUSUSERS

DURA_HSDPA_USERS_81_TO_96

M1000C392

DURATIONOFACTIVEHSDPAUSERS-97TO
112SIMULTANEOUSUSERS

DURA_HSDPA_USERS_97_TO_112

M1000C393

DURATIONOFACTIVEHSDPAUSERS-113OR
MORESIMULTANEOUSUSERS

DURA_HSDPA_USERS_113_OR_MORE

NocountershavebeendefinedforthefollowingHSDPAuserexperiencefeatures:

RAN1470:HSUPA2msTTI

17.2.5 Qualityofservicemanagementcounters
ThissectionprovidestheHSDPA-relatedcountersforQoSmanagement.Therespective
HSUPA-relatedcounterscanbefoundinthemanagementdataforHSUPARRM,section
Counters,oftheWCDMA RAN RRM HSUPAfunctionalareadescription.

340

DN0638161

R: 340/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 54

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1262:QoSAwareHSPASchedulingcounters

PIID

Name

Abbreviation

Cell resource measurements


M1000C300

SUMSTREAMINGHS-DSCHMAC-DIN
CELL

SUM_HSDSCH_MACD_STREA()

M1000C301

STREAMINGHS-DSCHMAC-DDENOMINATOR

DENOM_HSDSCH_MACD_STREA()

M1000C302

SUMINTERACTIVEHS-DSCHMAC-DIN
CELL

SUM_HSDSCH_MACD_INTERA()

M1000C303

INTERACTIVEHS-DSCHMAC-DDENOMI- DENOM_HSDSCH_MACD_INTERA()
NATOR

M1000C304

SUMBACKGROUNDHS-DSCHMAC-DIN
CELL

SUM_HSDSCH_MACD_BGR()

M1000C305

BACKGROUNDHS-DSCHMAC-DDENOMINATOR

DENOM_HSDSCH_MACD_BGR()

Packet call measurements


M1022C157

MAXIMUMDURATIONOFSTREAMING
HS-DSCHRADIOBEARER

MAX_DUR_HSDSCH_RB_STREA

M1022C158

MINIMUMDURATIONOFSTREAMING
HS-DSCHRADIOBEARER

MIN_DUR_HSDSCH_RB_STREA

M1022C159

SUMOFSTREAMINGHS-DSCHRADIO
BEARERDURATIONS

SUM_DUR_HSDSCH_RB_STREA

M1022C160

STREAMINGHS-DSCHRBDURATION
DENOMINATOR

DENOM_DUR_HSDSCH_RB_STREA

M1022C161

MAXIMUMDURATIONOFINTERACTIVE
HS-DSCHRADIOBEARER

MAX_DUR_HSDSCH_RB_INTERA

M1022C162

MINIMUMDURATIONOFINTERACTIVE
HS-DSCHRADIOBEARER

MIN_DUR_HSDSCH_RB_INTERA

M1022C163

SUMOFINTERACTIVEHS-DSCHRADIO
BEARERDURATIONS

SUM_DUR_HSDSCH_RB_INTERA

M1022C164

INTERACTIVEHS-DSCHRBDURATION
DENOMINATOR

DENOM_DUR_HSDSCH_RB_INTERA

Issue:06H

DN0638161

R: 341/396

341

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 54

WCDMARANRRMHSDPA

RAN1262:QoSAwareHSPASchedulingcounters(Cont.)

PIID

Name

Abbreviation

M1022C165

MAXIMUMDURATIONOFBACKGROUND
HS-DSCHRADIOBEARER

MAX_DUR_HSDSCH_RB_BGR

M1022C166

MINIMUMDURATIONOFBACKGROUND
HS-DSCHRADIOBEARER

MIN_DUR_HSDSCH_RB_BGR

M1022C167

SUMOFBACKGROUNDHS-DSCHRADIO SUM_DUR_HSDSCH_RB_BGR
BEARERDURATIONS

M1022C168

BACKGROUNDHS-DSCHRBDURATION
DENOMINATOR

Table 55

DENOM_DUR_HSDSCH_RB_BGR

RAN1004:StreamingQoSforHSPAcounters

PIID

Name

Abbreviation

Cell resource measurements


M1000C300

SUMSTREAMINGHS-DSCHMAC-DIN
CELL

SUM_HSDSCH_MACD_STREA

M1000C301

STREAMINGHS-DSCHMAC-DDENOMINATOR

DENOM_HSDSCH_MACD_STREA

Traffic measurements
M1002C568

CHANNELTYPESWITCHFROMDCHTO
HS-DSCHFORSTREAMING

SWI_DCH_TO_HS_DSCH_STR

M1002C569

HS-DSCHMAC-DFLOWALLOCATIONS
FORSTREAMING

ALLO_HS_DSCH_FLOW_STR

M1002C570

HS-DSCH16KBPSRETURNCHALLOCA- ALLO_HS_DSCH_RET_16_STR
TIONSFORSTREAMING

M1002C571

HS-DSCH64KBPSRETURNCHALLOCA- ALLO_HS_DSCH_RET_64_STR
TIONSFORSTREAMING

M1002C572

HS-DSCH128KBPSRETURNCHALLOCATIONSFORSTREAMING

ALLO_HS_DSCH_RET_128_STR

M1002C573

HS-DSCHMAC-DFLOWDURATIONFOR
STREAMING

ALLO_DUR_HS_DSCH_FLOW_STR

342

DN0638161

R: 342/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 55

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1004:StreamingQoSforHSPAcounters(Cont.)

PIID

Name

Abbreviation

M1002C574

HS-DSCH16KBPSRETURNCHDURATIONFORSTREAMING

ALLO_DUR_HS_DSCH_RET_16_STR

M1002C575

HS-DSCH64KBPSRETURNCHDURATIONFORSTREAMING

ALLO_DUR_HS_DSCH_RET_64_STR

M1002C576

HS-DSCH128KBPSRETURNCHDURATIONFORSTREAMING

ALLO_DUR_HS_DSCH_RET_128_STR

M1002C577

REJECTEDHS-DSCHRETURNCHFOR
STREAMING

REJ_HS_DSCH_RET_STR

M1002C578

HS-DSCHNORMALRELEASEFOR
STREAMING

REL_ALLO_NORM_HS_DSCH_STR

M1002C579

HS-DSCHRELEASEDUETOOTHER
FAILUREFORSTREAMING

REL_ALLO_OTH_FAIL_HSDSCH_STR

M1002C580

HS-DSCHRELEASEDUETOMOBILITY
DCHTRANSITIONFORSTREAMING

REL_ALLO_HS_DSCH_MOB_DCH_STR

M1002C581

HS-DSCHSETUPFAILUREDUETORNC
INTERNALFORSTREAMING

SETUP_FAIL_RNC_HS_DSCH_STR

M1002C582

HS-DSCHMAC-DFLOWSETUPFAILURE
DUETOIUBTRANSPORTFORSTREAMING

SETUP_FAIL_IUB_MAC_D_STR

M1002C583

HS-DSCHSETUPFAILUREDUETOUE
FORSTREAMING

SETUP_FAIL_UE_HS_DSCH_STR

M1002C584

HS-DSCHSETUPFAILUREDUETOBTS
FORSTREAMING

SETUP_FAIL_BTS_HS_DSCH_STR

M1002C585

HS-DSCHTOTALIUBTRANSPORTSETUPFAILFORSTREAMING

SETUP_FAIL_IUB_HS_TOTAL_STR

M1002C586

HS-DSCH16KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFOR
STREAMING

SETUP_FAIL_16_IUB_HSDSCH_STR

M1002C587

HS-DSCH64KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFOR
STREAMING

SETUP_FAIL_64_IUB_HSDSCH_STR

Issue:06H

DN0638161

R: 343/396

343

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 55

WCDMARANRRMHSDPA

RAN1004:StreamingQoSforHSPAcounters(Cont.)

PIID

Name

Abbreviation

M1002C588

HS-DSCH128KBPSRETURNCHIUB
TRANSPORTSETUPFAILUREFOR
STREAMING

SETUP_FAIL_128_IUB_HSDSCH_ST

M1002C589

HS-DSCHRETURNCHUPGRADESFOR
STREAMING

HS_DSCH_RET_UPGRADE_STR

M1002C590

HS-DSCHRETURNCHDOWNGRADES
FORSTREAMING

HS_DSCH_RET_DOWNGRADE_STR

M1002C591

DCHSELECTEDFORSTREAMINGDUE
TOMAXHSDPAUSERS

DCH_SEL_MAX_HSDPA_USERS_STR

M1002C592

HS-DSCHRELEASEDUETOOTHERDCH REL_ALLO_HS_DSCH_OTH_DCH_STR
TRANSITIONREASONFORSTREAMING

M1002C593

HS-DSCHRELEASEDUETOPREEMPTIONFORSTREAMING

REL_ALLO_HS_DSCH_PRE_EMP_STR

M1002C594

HS-DSCHRELEASEDUETORLFAILURE
FORSTREAMING

REL_ALLO_RL_FAIL_HS_DSCH_STR

M1002C595

REJECTEDAMR+HS-DSCHFOR
STREAMING

REJ_HS_DSCH_AMR_STR

M1002C596

AMR+HS-DSCHSETUPFAILUREFOR
STREAMING

SETUP_FAIL_HS_DSCH_AMR_STR

M1002C597

AMR+HS-DSCHALLOCATIONSFOR
STREAMING

ALLO_HS_DSCH_AMR_STR

M1002C598

AMR+HS-DSCHNORMALRELEASE
FORSTREAMING

REL_ALLO_NORM_HSDSCH_AMR_STR

M1002C599

ULDCHSELECTEDFORSTREAMING
DUETOMAXHSUPAUSERS

UL_DCH_SEL_MAX_HSUPA_USR_STR

M1002C600

ULDCHSELECTEDFORSTREAMING
DUETOBTSHWLIMIT

UL_DCH_SEL_BTS_HW_STR

M1002C602

DLDCHSELECTEDFORSTREAMING
DUETOHSDPAPOWER

DL_DCH_SEL_HSDPA_POWER_STR

M1002C613

HS-DSCHALLOFORINTERRNCHHO
STREAMING

ALLO_HS_INTER_RNC_HHO_STR

344

DN0638161

R: 344/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 55

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1004:StreamingQoSforHSPAcounters(Cont.)

PIID

Name

Abbreviation

M1002C614

HS-DSCHSETUPFAILFORINTERRNC
HHOSTREAMING

STP_F_HS_INTER_RNC_HHO_STR

M1002C619

AMR+RT-HSPA+NRT-HSPAALLOCATION

ALLO_AMR_RT_NRT_HSPA

M1002C620

AMR+RT-HSPA+MULTI-NRT-HSPAALLOCATION

ALLO_AMR_RT_MULTINRT_HSPA

M1002C621

RT-HSPA+NRT-HSPAALLOCATION

ALLO_RT_NRT_HSPA

M1002C622

RT-HSPA+MULTI-NRT-HSPAALLOCATION

ALLO_RT_MULTINRT_HSPA

Packet call measurements


M1022C157

MAXIMUMDURATIONOFSTREAMING
HS-DSCHRADIOBEARER

MAX_DUR_HSDSCH_RB_STREA

M1022C158

MINIMUMDURATIONOFSTREAMING
HS-DSCHRADIOBEARER

MIN_DUR_HSDSCH_RB_STREA

M1022C159

SUMOFSTREAMINGHS-DSCHRADIO
BEARERDURATIONS

SUM_DUR_HSDSCH_RB_STREA

M1022C160

STREAMINGHS-DSCHRBDURATION
DENOMINATOR

DENOM_DUR_HSDSCH_RB_STREA

M1022C181

HS-DSCH/E-DCHPACKETCALLATTFOR
STREAMING

PS_ATT_HSDSCH_EDCH_STRE

M1022C182

HS-DSCH/DCHPACKETCALLATTFOR
STREAMING

PS_ATT_HSDSCH_DCH_STRE

M1022C183

DCH/DCHPACKETCALLATTFOR
STREAMING

PS_ATT_DCH_DCH_STRE

M1022C184

PACKETCALLSETUPFAILDUETOAC
FORSTREAMING

PS_SETUP_FAIL_AC_STRE

M1022C185

PACKETCALLSETUPFAILDUETOBTS
FORSTREAMING

PS_SETUP_FAIL_BTS_STRE

M1022C186

PACKETCALLSETUPFAILDUETODMCURESFORSTREAMING

PS_SETUP_FAIL_DMCU_STRE

Issue:06H

DN0638161

R: 345/396

345

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 55

WCDMARANRRMHSDPA

RAN1004:StreamingQoSforHSPAcounters(Cont.)

PIID

Name

Abbreviation

M1022C187

PACKETCALLSETUPFAILDUETO
TRANSMFORSTREAMING

PS_SETUP_FAIL_TRANS_STRE

M1022C188

PACKETCALLSETUPFAILDUETOUE
FORSTREAMING

PS_SETUP_FAIL_UE_STRE

M1022C189

PACKETCALLSETUPFAILDUETOOTHERREASONSFORSTREAMING

PS_SETUP_FAIL_OTHER_STRE

M1022C190

HS-DSCH/E-DCHALLOAFTERHSDSCH/E-DCHREQFORSTREAMING

HS_E_REQ_HS_E_ALLO_STRE

M1022C191

HS-DSCH/DCHALLOAFTERHS-DSCH/E- HS_E_REQ_HS_D_ALLO_STRE
DCHREQFORSTREAMING

M1022C192

HS-DSCH/DCHALLOAFTERHSDSCH/DCHREQFORSTREAMING

HS_D_REQ_HS_D_ALLO_STRE

M1022C193

DCH/DCHALLOAFTERHS-DSCH/E-DCH
REQFORSTREAMING

HS_E_REQ_D_D_ALLO_STRE

M1022C194

DCH/DCHALLOAFTERHS-DSCH/DCH
REQFORSTREAMING

HS_D_REQ_D_D_ALLO_STRE

M1022C195

DCH/DCHALLOAFTERDCH/DCHREQ
FORSTREAMING

D_D_REQ_D_D_ALLO_STRE

M1022C196

SWIHS-DSCH/E-DCHTOHS-DSCH/DCH
FORSTREAMING

PS_SWI_HS_E_TO_HS_D_STRE

M1022C197

SWIHS-DSCH/E-DCHTODCH/DCHFOR
STREAMING

PS_SWI_HS_E_TO_D_D_STRE

M1022C198

SWIHS-DSCH/DCHTODCH/DCHFOR
STREAMING

PS_SWI_HS_D_TO_D_D_STRE

M1022C199

SWIHS-DSCH/DCHTOHS-DSCH/E-DCH
FORSTREAMING

PS_SWI_HS_D_TO_HS_E_STRE

M1022C200

SWIDCH/DCHTOHS-DSCH/DCHFOR
STREAMING

PS_SWI_D_D_TO_HS_D_STRE

M1022C201

SWIDCH/DCHTOHS-DSCH/E-DCHFOR
STREAMING

PS_SWI_D_D_TO_HS_E_STRE

346

DN0638161

R: 346/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 55

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1004:StreamingQoSforHSPAcounters(Cont.)

PIID

Name

Abbreviation

M1022C202

HS-DSCH/E-DCHPACKETCALLNORM
RELFORSTREAMING

PS_REL_NORM_HS_E_STRE

M1022C203

HS-DSCH/DCHPACKETCALLNORMREL PS_REL_NORM_HS_D_STRE
FORSTREAMING

M1022C204

DCH/DCHPACKETCALLNORMRELFOR PS_REL_NORM_D_D_STRE
STREAMING

M1022C205

HS-DSCH/E-DCHPACKETCALLRELDUE PS_REL_PRE_EMP_HS_E_STRE
TOPRE-EMPFORSTREAMING

M1022C206

HS-DSCH/DCHPACKETCALLRELDUE
TOPRE-EMPFORSTREAMING

PS_REL_PRE_EMP_HS_D_STRE

M1022C207

DCH/DCHPACKETCALLRELDUETO
PRE-EMPFORSTREAMING

PS_REL_PRE_EMP_D_D_STRE

M1022C208

HS-DSCH/E-DCHPACKETCALLRELDUE PS_REL_RL_FAIL_HS_E_STRE
TORLFAILFORSTREAMING

M1022C209

HS-DSCH/DCHPACKETCALLRELDUE
TORLFAILFORSTREAMING

PS_REL_RL_FAIL_HS_D_STRE

M1022C210

DCH/DCHPACKETCALLRELDUETORL
FAILFORSTREAMING

PS_REL_RL_FAIL_D_D_STRE

M1022C211

HS-DSCH/E-DCHPACKETCALLRELDUE PS_REL_OTH_FAIL_HS_E_STRE
TOOTHERFAILFORSTREAMING

M1022C212

HS-DSCH/DCHPACKETCALLRELDUE
TOOTHERFAILFORSTREAMING

PS_REL_OTH_FAIL_HS_D_STRE

M1022C213

DCH/DCHPACKETCALLRELDUETO
OTHERFAILFORSTREAMING

PS_REL_OTH_FAIL_D_D_STRE

M1022C214

HS-DSCH/DCHALLOAFTERHS-DSCH/E- HS_E_REQ_HS_E_ALLO_INT_CELL
DCHREQINTERADUECELLCAPABILITY

M1022C215

HS-DSCH/DCHALLOAFTERHS-DSCH/E- HS_E_REQ_HS_E_ALLO_BGR_CELL
DCHREQBACKGDUECELLCAPABILITY

M1022C216

HS-DSCH/DCHALLOAFTERHS-DSCH/E- HS_E_REQ_HS_E_ALLO_STR_CELL
DCHREQSTREAMDUECELLCAPABILITY

Issue:06H

DN0638161

R: 347/396

347

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 55

WCDMARANRRMHSDPA

RAN1004:StreamingQoSforHSPAcounters(Cont.)

PIID

Name

Abbreviation

M1022C217

DCH/DCHALLOAFTERHS-DSCH/E-DCH
REQINTERADUECELLCAPABILITY

HS_E_REQ_D_D_ALLO_INT_CELL

M1022C218

DCH/DCHALLOAFTERHS-DSCH/E-DCH
REQBACKGDUECELLCAPABILITY

HS_E_REQ_D_D_ALLO_BGR_CELL

M1022C219

DCH/DCHALLOAFTERHS-DSCH/E-DCH
REQSTREAMDUECELLCAPABILITY

HS_E_REQ_D_D_ALLO_STR_CELL

M1022C220

DCH/DCHALLOAFTERHS-DSCH/DCH
REQINTERADUECELLCAPABILITY

HS_D_REQ_D_D_ALLO_INT_CELL

M1022C221

DCH/DCHALLOAFTERHS-DSCH/DCH
REQBACKGDUECELLCAPABILITY

HS_D_REQ_D_D_ALLO_BGR_CELL

M1022C222

DCH/DCHALLOAFTERHS-DSCH/DCH
REQSTREAMDUECELLCAPABILITY

HS_D_REQ_D_D_ALLO_STR_CELL

Cell throughput measurements


M1023C23

TRANSFERREDDATAFORRTE-DCH
STREAMINGUL

RT_E_DCH_UL_STREA_DATA

M1023C24

TRANSFERREDDATAFORRTDCH
STREAMINGFORHSDPARETURN
CHANNELUL

RT_DCH_HSDPA_UL_STREA_DATA

M1023C25

TRANSFERREDDATAFORRTHS-DSCH
STREAMINGDL

RT_HS_DSCH_DL_STREA_DATA

Table 56

RAN930:PSRABReconfigurationcounters

PIID

Name

Abbreviation

Service level measurement


M1001C197

RABRECONFIGURATIONATTEMPTS

RAB_RECONF_ATT

L3 signalling at the Iu interface measurement


M1003C9

RABRECONFREQBYCN

RAB_REC_REQ_BY_CN

M1003C12

RABRECONFSUCC

RAB_RECONF_SUCC

348

DN0638161

R: 348/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 56

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN930:PSRABReconfigurationcounters(Cont.)

PIID

Name

Abbreviation

M1003C20

RABRECONFNONSUCCDUETORN
LAYERCAUSE

RAB_REC_NONSUCC_RNL

M1003C24

RABRECONFNONSUCCDUETOMISC
CAUSE

RAB_REC_NONSUCC_MISC

17.3 Keyperformanceindicatorsforradioresource
managementofHSDPA
ThischaptergivesashortsummaryofHSDPAkeyperformanceindicators(KPIs)that
areavailableforperformanceevaluationpurposes.TheKPIsaredescribedindetailin
theWCDMA RAN Key Performance Indicators.
TheKPIsaregroupedinthesamewayastheHSDPAfeaturesarestructured,see
FeaturesandfunctionsrelatedtoradioresourcemanagementofHSDPA.Withineach
group,theKPIsaresortedbytherespectivefeatureandorderedaccordingtotheirPIID.

17.3.1 HSDPAresourceallocationKPIs
Table 57

RAN821:HSDPAResourceAllocationKPIs

KPIID

Name

Cell Based KPI


RNC_1181a

Table 58

AverageHSPADownlinkLoad

RAN763:BasicHSDPAwithQPSKand5CodesKPIs

KPIID

Name

Cell Based KPIs


CAP_KPI_IUB_THROUGHPUT_SRNC_DL

IubthroughputofRNC:MAC

RNC_949b

SpreadingCodeBlockingrateinDL

Uu Based KPI

Issue:06H

DN0638161

R: 349/396

349

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 58

WCDMARANRRMHSDPA

RAN763:BasicHSDPAwithQPSKand5CodesKPIs(Cont.)

KPIID

Name

RNC_607c

HSDPAMAC-hsefficiency

Iub based KPI


RNC_608b

Table 59

HSDPAreceiveddata

RAN235:HSDPAChannelSwitchingKPIs

KPIID

Name

Cell Based KPIs


CAP_KPI_MULTI_RAB_HSPA_ALLOCATION MultiHSPANRTReservations
RNC_5014a

PacketSessionSuccessRatioforRT

E-2-E based KPIs

350

CAP_KPI_SPS_0103

HSDPAAccessibility

RNC_605a

HSDPAResourceAccessibilityforNRTTraffic

RNC_609a

HSDPAResourceRetainabilityforNRTTraffic

RNC_914b

HSDPASetupSuccessRatiofromuserperspectiveforNRT

RNC_916b

PacketSessionSetupSuccessRatio(SSSR)

RNC_920a

HSDPASuccessRatiofromuserperspective
forNRT

RNC_922b

PacketSessionSuccessRatio

RNC_5001a

HSDPASetupSuccessRatiofromuserperspectiveforRT

RNC_5006a

PacketSessionSetupSuccessRatioforRT

RNC_5010a

HSDPAResourceRetainabilityforRTTraffic

DN0638161

R: 350/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 59

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN235:HSDPAChannelSwitchingKPIs(Cont.)

KPIID

Name

RNC_5011a

HSDPASuccessRatiofromuserperspective
forRT

RNC_5013a

HSUPASuccessRatiofromuserperspective
forRT

RNC Based KPI


KPI_HSDSCH_SETUP_SUCCESS_3GPP

Table 60

HS-DSCHsetupsuccessaccordingto3GPP.

RAN312:HSDPADynamicResourceAllocationKPIs

KPIID

Name

Cell Based KPI


RNC_1181a

Table 61

AverageHSPADownlinkLoad

RAN852:HSDPA15CodesKPIs

KPIID

Name

Uu Based KPI
RNC_607c

HSDPAMAC-hsefficiency

Cell Based KPI


RNC_949b

Table 62

SpreadingCodeBlockingrateinDL

RAN1305:HSDPA14.4MbpsperCellKPIs

KPIID

Name

Uu Based KPIs
RNC_606d

Issue:06H

HSDPAMAC-daveragenetthroughputat
BTS

DN0638161

R: 351/396

351

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 62

WCDMARANRRMHSDPA

RAN1305:HSDPA14.4MbpsperCellKPIs(Cont.)

KPIID

Name

RNC_722c

ActiveHS-DSCHMAC-dthroughput,network
perspective

RNC_739c

HSDPAMAC-ddatavolumeatBTS

Iub based KPI


RNC_608b

Table 63

HSDPAreceiveddata

RAN1643:HSDPA64QAMKPIs

KPIID

Name
64QAMUsage
UEHS-DSCHclassdistribution

ForthefollowingfeaturesrelatedtoresourceallocationforHSDPA,noKPIshavebeen
defined:

RAN764:HSDPA16QAMSupport

RAN233:HSDPAAssociatedUplinkDPCHScheduling

RAN1013:16kbit/sReturnChannelDCHDataRateSupportforHSDPA

RAN853:HSDPACodeMultiplexing

17.3.2 HSDPAmobilityKPIs
Table 64

RAN828:HSDPAServingCellChangeKPIs

KPIID

Name

RNC Based KPI


RNC_733a

352

HSDPAServingCellChangeSuccessRate

DN0638161

R: 352/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 65

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1515:HSPAInter-RNCCellChangeKPIs

KPIID

Name

RNC Based KPIs


RNC_733a

HSDPAServingCellChangeSuccessRate

RNC_918a

HSUPAServingCellChangeSuccessRate

NoKPIsexistforthefollowingHSDPAmobility-relatedfeatures:

RAN230:HSDPAMobilityHandlingwithDCHSwitching

RAN1148:HSDPACellReselection

RAN829:HSDPASoft/softerHandoverforAssociatedDPCH

RAN1276:HSDPAInter-frequencyHandover

RAN1596:HSPACapabilityBasedHandover

17.3.3 MultiRABcombinationswithHSDPAKPIs
Table 66

RAN827:HSDPAwithSimultaneousAMRVoiceCallKPIs

KPIID

Name

E-2-E based KPI


CAP_KPI_SPS_0103

Table 67

HSDPAAccessibility

RAN285:HSPAMultiNRTRABsKPIs

KPIID

Name

Cell Based KPI


CAP_KPI_MULTI_RAB_HSPA_ALLOCATION MultiHSPANRTReservations

NoKPIsexistforthefollowingfeaturesrelatedtomulti-RABcombinationswithHSDPA:

Issue:06H

RAN820:HSDPAwithAdditionalRABInitiation

RAN1727:EnhancementtoHSDPAwithSimultaneousAMRVoiceCall

DN0638161

R: 353/396

353

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

WCDMARANRRMHSDPA

17.3.4 HSDPAuserexperienceKPIs
Table 68

RAN1249:HSDPA10MbpsperUserKPIs

KPIID

Name

Uu Based KPI
RNC_613b

Table 69

RAN1470:HSUPA2msTTIKPIs

KPIID

Name

RNC_5109a

SRBE-DCHusage

CAP_KPI_MACES_TTI_EFFICIENCY

E-DCHTTIefficiency

Table 70

RAN1642:MIMOKPIs

KPIID

Name

RNC_5113a

AveragenumberofactiveuserswithMIMO

RNC_5114a

MIMOutilizationratio

RNC_5115a

RetransmissionrateforMAC-ehsPDUsusing
MIMOdualstream

RNC_5141a

SumofuserswithMIMOcapableUEs

Table 71

354

AverageNRTHS-DSCHDLThroughput

RAN1689:CSVoiceoverHSPAKPIs

KPIID

Name

RNC_5122a

AverageallocatedDLHSPACSvoicechannel
capacity

RNC_5123a

AverageallocatedULHSPACSvoicechannel
capacity

DN0638161

R: 354/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 71

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1689:CSVoiceoverHSPAKPIs(Cont.)

KPIID

Name

RNC_5143a

AveragenumberofHSPACSvoicecallsper
RNC

RNC_5120a

Discardingratioduetojitterquality

RNC_5144a

HSPACSvoiceresourceaccessibility

RNC_5145a

HSPACSvoiceresourceretainability

RNC_5147a

HSPACSvoicethroughputinIubDL

RNC_5146a

HSPACSvoicethroughputinIubUL

RNC_5148a

HSPA_CS_voice_capability_ratio

RNC_5142a

MaximumnumberofHSPACSvoicecallsper
RNC

ForthefollowingHSDPAuserexperiencefeatures,noKPIshavebeendefined:

RAN839:HSDPA16UsersperCell

RAN1033:HSDPA48UsersperCell

RAN1464:HSDPA64UsersperCell

RAN1258:HSDPA14MbpsperUser

RAN955:PowerSavingModeforBTS

RAN1201:FractionalDPCH

RAN1638:FlexibleRLC(DL)

RAN1644:ContinuousPacketConnectivity

RAN1686:HSPA72UsersPerCell

17.3.5 QualityofservicemanagementKPIs
Table 72

RAN1004:StreamingQoSforHSPAKPIs

KPIID

Name

E-2-E based KPIs

Issue:06H

DN0638161

R: 355/396

355

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 72

WCDMARANRRMHSDPA

RAN1004:StreamingQoSforHSPAKPIs(Cont.)

KPIID

Name

RNC_5001a

HSDPASetupSuccessRatiofromuserperspectiveforRT

RNC_5003a

HSUPASetupSuccessRatiofromuserperspectiveforRT

RNC_5006a

PacketSessionSetupSuccessRatioforRT

RNC_5010a

HSDPAResourceRetainabilityforRTTraffic

RNC_5011a

HSDPASuccessRatiofromuserperspective
forRT

RNC_5012a

HSUPAResourceRetainabilityforRTTraffic

RNC_5013a

HSUPASuccessRatiofromuserperspective
forRT

RNC Based KPI


RNC_5007a

R99SetupSuccessRatiofromuserperspectiveforRT

Cell Based KPIs


RNC_5014a

PacketSessionSuccessRatioforRT

RNC_5015a

R99SuccessRatiofromuserperspectivefor
RT

Table 73

RAN930:PSRABReconfigurationKPIs

KPIID

Name

RNC Based KPIs

356

RAN_KPI_RAB_RECONFIGURATION_ATTEMPTS

RadioAccessBearerReconfigurationAttempts

RAN_KPI_RAB_RECONFIGURATION_SUCCESS

RadioAccessBearerReconfigurationSuccess

DN0638161

R: 356/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

NoKPIsexistforthefollowingHSDPA-relatedqualityofservicemanagementfeature:

RAN1262:QoSAwareHSPAScheduling

17.4 Managementparametersforradioresource
managementofHSDPA
Thissectionintroducesthemanagementparametersthatcanbeusedtocontrolthe
functionofHSDPARRM.Themanagementparametersaredescribedindetailinthe
WCDMA Radio Network Configuration ParametersExcelinWCDMARANOperating
Documentation,ParametersinNOLSPIC.
Theparametersaregroupedaccordingtothefeatureswhichtheyaffect.Thefeatures,in
turn,areorderedaccordingtotheirrespectivesub-categories,seeFeaturesand
functionsrelatedtoradioresourcemanagementofHSDPA.

17.4.1 BasicHSDPAparameters
Table 74

BasicHSDPAparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

AMRLCmaximumbuffer
allocationforUE

AMRLCMaximumBufferUE

On-Line

RNC

AMRLCmaximumbuffer AMRLCMaximumBufferallocationforUEcapabili- UE100


ty100

On-Line

RNC

AMRLCmaximumbuffer AMRLCMaximumBufferallocationforUEcapabili- UE150


ty150

On-Line

RNC

AMRLCmaximumbuffer AMRLCMaximumBufferallocationforUEcapabili- UE200


ty200

On-Line

RNC

AMRLCmaximumbuffer AMRLCMaximumBufferallocationforUEcapabili- UE50


ty50

On-Line

RNC

AMRLCconfigurationfor
PSNRTwithHS-DSCH

On-Line

RNC

Issue:06H

AMRLCOnHSDSCHOfNRTPS

DN0638161

R: 357/396

357

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 74

WCDMARANRRMHSDPA

BasicHSDPAparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

AMRLCstatusreports
countforPSNRTwith
HS-DSCH

AMRLCOnHSDSCHOfNRTPSCount*)

On-Line

RNC

AMRLCretransmission
AMRLCOnHSDSCHOfNfilterforPSNRTwithHS- RTPSFilterReTX*)
DSCH

On-Line

RNC

AMRLCMaxDATtransAMRLCOnHSDSCHOfNmissionsforPSNRTwith RTPSMaxDAT*)
HS-DSCH

On-Line

RNC

AMRLCMaxMRWtrans- AMRLCOnHSDSCHOfNmissionsforPSNRTwith RTPSMaxMRW*)


HS-DSCH

On-Line

RNC

AMRLCmaxRSTtrans- AMRLCOnHSDSCHOfNmissionsforPSNRTwith RTPSMaxRST*)


HS-DSCH

On-Line

RNC

AMRLCstatusperiod
AMRLCOnHSDSCHOfNmaxforPSNRTwithHS- RTPSPeriodMax*)
DSCH

On-Line

RNC

AMRLCstatusperiod
minforPSNRTwithHSDSCH

AMRLCOnHSDSCHOfNRTPSPeriodMin*)

On-Line

RNC

AMRLCperiodPoll_PDU AMRLCOnHSDSCHOfNforPSNRTwithHSRTPSPollPDU*)
DSCH

On-Line

RNC

AMRLCperiodPoll_SDU AMRLCOnHSDSCHOfNforPSNRTwithHSRTPSPollSDU*)
DSCH

On-Line

RNC

AMRLCperiodPoll_Win- AMRLCOnHSDSCHOfNdowforPSNRTwithHS- RTPSPollWindow*)


DSCH

On-Line

RNC

AMRLCstatusreport
triggersforPSNRTwith
HS-DSCH

AMRLCOnHSDSCHOfNRTPSTriggers*)

On-Line

RNC

AMRLCroundtriptimes
withHS-DSCH

AMRLCRespTimeHSDSCH

On-Line

RNC

358

DN0638161

R: 358/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 74

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

BasicHSDPAparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

AMRLCroundtriptime
withHS-DSCH/DCH

AMRLCRespTimeHSDSCHRevDCH**)

On-Line

RNC

AMRLCroundtriptime
withHS-DSCH/E-DCH

AMRLCRespTimeHSDSCHRevEDCH**)

On-Line

RNC

DCHtoHS-DSCHswitch
CPICHEc/Noreporting
period

HSDPACPICHCTSRepPer

On-Line

RNC

HSDPAchanneltype
switchingwindow

HSDPAChaTypeSwitchWindow

On-Line

RNC

HS-DSCHchanneltype
switchguardtimer

HSDSCHCTSwitchGuardTimer

On-Line

RNC

Maximumnumberofreattemptstohuntresources

MaxNumberOfReAttemptsCong

On-Line

RNC

PSloadcontrolperiod

LoadControlPeriodPS

On-Line

WBTS

RadioResourceIndicationPeriod

RRIndPeriod

On-Line

WBTS

HSDPAMeasurement
PowerOffset

HSDPAMPO

On-Line

WCEL

HS-PDSCHcodeset

HSPDSCHCodeSet

Requiresobjectlocking

WCEL

MaximumnumberofHSDPAusers

MaxNumberHSDPAUsers On-Line

WCEL

MaximumnumberofHSDSCHMAC-dflows

MaxNumberHSDSCHMACdFlows

On-Line

WCEL

Maximumuplinkbitrate
forPSdomainNRTdata

MaxBitRateULPSNRT

On-Line

WCEL

Maximumdownlinkpowerdecreaseinpacket
scheduling

DeltaPtxMaxDown

On-Line

WCEL

FilteringCoefficientof
PtxTotalmeasurement

PtxMeasFilterCoeff

On-Line

WCEL

Issue:06H

DN0638161

R: 359/396

359

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 74

WCDMARANRRMHSDPA

BasicHSDPAparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

EventEmeasurementof
nonHStransmittedcarrierpower

NonHSEventECommMeas

On-Line

WCEL

Reportingperiodforthe
TCPmeasurements.

PtxTotalReportPeriod

On-Line

WCEL

ThepoweroffsetoftheE- PtxOffsetEAGCHDPCCH
AGCH

On-Line

WCEL

ThepoweroffsetoftheE- PtxOffsetEHICHDPCCH
HICH

On-Line

WCEL

ThepoweroffsetoftheE- PtxOffsetERGCHDPCCH
RGCH

On-Line

WCEL

Thepoweroffsetofthe
HS-SCCH

PtxOffsetHSSCCH

On-Line

WCEL

Frametimingoffsetofa
cell

Tcell

Cellshutdownneeded

WCEL

*)

ChildparameteroftheAMRLCOnHSDSCHOfNRTPSparameter
structure

**)

ChildparameteroftheAMRLCRespTimeHSDSCHparameterstructure

17.4.2 HSDPAresourceallocationparameters
Table 75

RAN821:HSDPAResourceAllocationparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSDPApeakratelimita- HSDPAPeakRateLimitiontotheRABmaximum tRABMax

On-Line

RNC

HSDPApriority

HSDPAPriority

On-Line

RNC

MaximumbitrateofNRT
MAC-dflow

MaxBitRateNRTMACDFlow

On-Line

RNC

360

DN0638161

R: 360/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 75

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN821:HSDPAResourceAllocationparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSDPA14MbpsPerUser

HSDPA14MbpsPerUser

On-Line

WBTS

PtxnonHSPAaveraging
windowsizeforLC

WinLCHSDPA

On-Line

WBTS

MaximumallowedHSDPApower

PtxMaxHSDPA

Requiresobjectlocking

WCEL

Offsetfortransmitted
non-HSDPApower

PtxOffsetHSDPA

On-Line

WCEL

Targetfortransmitted
non-HSDPApower

PtxTargetHSDPA

On-Line

WCEL

Table 76

RAN763:BasicHSDPAwithQPSKand5Codesparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSDPACapability

HSDPAcapability

Notmodifiable

WCEL

Table 77

RAN235:HSDPAChannelSwitchingparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HS-DSCHguardtimer
duetolowthroughput

HSDSCHGuardTimerLowThroughput

On-Line

RNC

HS-DSCHQoSclasses

HSDSCHQoSclasses

On-Line

RNC

HS-DSCHguardtimeafterswitchingtoDCHdue
toHO

HsdschGuardTimerHO

On-Line

RNC

WindowsizeoftheMACdflowthroughputmeasurement

MACdflowthroughputAveWin

On-Line

RNC

On-Line

RNC

Lowthroughputthreshold MACdflowthroughpuoftheMAC-dflow
tRelThr

Issue:06H

DN0638161

R: 361/396

361

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 77

WCDMARANRRMHSDPA

RAN235:HSDPAChannelSwitchingparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

Lowthroughputtimeto
triggeroftheMAC-dflow

MACdflowthroughputTimetoTrigger

On-Line

RNC

Lowutilisationthreshold
oftheMAC-dflow

MACdflowutilRelThr

On-Line

RNC

Lowutilizationtimeto
triggeroftheMAC-dflow

MACdflowutilTimetoTrigger

On-Line

RNC

HSDPAenabled

HSDPAenabled

Requiresobjectlocking

WCEL

Table 78

RAN233:HSDPAAssociatedUplinkDPCHSchedulingparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSDPA16kbpsULDCH
returnchannelon/off
switch

HSDPA16KBPSReturnChannel

On-Line

RNC

HSDPApeakratelimita- HSDPAPeakRateLimitiontotheRABmaximum tRABMax

On-Line

RNC

InitialbitrateforHSDPA
associatedULDCH

On-Line

RNC

MinimumbitrateforHSD- HSDPAminAllowedBitraPAassociatedULDCH
teUL

On-Line

RNC

MaximumbitrateforHSDPAULDCHreturn
channel

On-line

WAC

362

HSDPAinitialBitrateUL

HSDPAMaxBitrateUL

DN0638161

R: 362/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 79

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1013:16kbit/sReturnChannelDCHDataRateSupportforHSDPA
parameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSDPA16kbpsULDCH
returnchannelon/off
switch

HSDPA16KBPSReturnChannel

On-Line

RNC

InitialbitrateforHSDPA
associatedULDCH

HSDPAinitialBitrateUL

On-Line

RNC

On-Line

RNC

MinimumbitrateforHSD- HSDPAminAllowedBitraPAassociatedULDCH
teUL

Table 80

RAN312:HSDPADynamicResourceAllocationparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSDPADynamicResourceAllocation

HSDPADynamicResourceAllocation

Requiresobjectlocking

RNC

HS-PDSCHcodeadjustmentperiod

HSPDSCHAdjustPeriod

On-Line

RNC

BitratethresholdforRLC PDUSizeBitRateThr
PDUsize656withHSDSCH

On-Line

RNC

NumberofHS-PDSCH
codesforgreaterRLC
PDUsize

PDUSizeCodeThreshold

On-Line

RNC

SIRthresholdforRLC
PDUsize656withHSDSCH

PDUSizeSIRThr

On-Line

RNC

WeightofNRTDCHUE

WeightDCH

On-Line

RNC

WeightofNRTDCHUE
BGRAB

WeightDCHBG*)

On-Line

RNC

WeightofNRTDCHUE
THP1RAB

WeightDCHTHP1*)

On-Line

RNC

Issue:06H

DN0638161

R: 363/396

363

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 80

WCDMARANRRMHSDPA

RAN312:HSDPADynamicResourceAllocationparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

WeightofNRTDCHUE
THP2RAB

WeightDCHTHP2*)

On-Line

RNC

WeightofNRTDCHUE
THP3RAB

WeightDCHTHP3*)

On-Line

RNC

WeightofHSPAUE

WeightHSPA

On-Line

RNC

WeightofHSPAUEBG
RAB

WeightHSPABG**)

On-Line

RNC

WeightofHSPAUETHP1RAB

WeightHSPATHP1**)

On-Line

RNC

WeightofHSPAUETHP2RAB

WeightHSPATHP2**)

On-Line

RNC

WeightofHSPAUETHP3RAB

WeightHSPATHP3**)

On-Line

RNC

UsageofRLCPDUsize
656withHS-DSCH

PDUSize656WithHSDSCH

On-Line

WBTS

PtxnonHSPAaveraging
windowsizeforLC

WinLCHSDPA

On-Line

WBTS

NRTDPCHoverHSPDSCHcodeoffset

DPCHOverHSPDSCHThres
hold

On-Line

WCEL

HS-PDSCHcodeupgrademarginforSF128
codes

HSPDSCHMarginSF128

On-Line

WCEL

MaximumnumberofHSSCCHcodes

MaxNbrOfHSSCCHCodes

Requiresobjectlocking

WCEL

HighthresholdofPtxTotal PtxHighHSDPAPwr
fordynamicHSDPApwr
alloc

On-Line

WCEL

MaximumallowedHSDPApower

Requiresobjectlocking

WCEL

364

PtxMaxHSDPA

DN0638161

R: 364/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 80

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN312:HSDPADynamicResourceAllocationparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

DCHPStargetadjustpe- PtxTargetPSAdjustPeriod
riodfordynHSDPApwr
alloc

On-Line

WCEL

MaxDCHPStargetfor
PtxTargetPSMax
dynamicHSDPApwrallocation

On-Line

WCEL

MinDCHPStargetfor
PtxTargetPSMin
dynamicHSDPApwrallocation

On-Line

WCEL

DCHPStargetstepdown PtxTargetPSStepDown
fordynamicHSDPApwr
alloc

On-Line

WCEL

DCHPStargetstepup
fordynamicHSDPApwr
alloc

On-Line

WCEL

Table 81

PtxTargetPSStepUp

*)

ChildparameteroftheWeightDCHparameterstructure

**)

ChildparameteroftheWeightHSPAparameterstructure

RAN852:HSDPA15Codesparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSDPADynamicResourceAllocation

HSDPADynamicResourceAllocation

Requiresobjectlocking

RNC

HS-PDSCHcodeadjustmentperiod

HSPDSCHAdjustPeriod

On-Line

RNC

MaximumbitrateofNRT
MAC-dflow

MaxBitRateNRTMACDFlow

On-Line

RNC

On-Line

RNC

BitratethresholdforRLC PDUSizeBitRateThr
PDUsize656withHSDSCH

Issue:06H

DN0638161

R: 365/396

365

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 81

WCDMARANRRMHSDPA

RAN852:HSDPA15Codesparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

NumberofHS-PDSCH
codesforgreaterRLC
PDUsize

PDUSizeCodeThreshold

On-Line

RNC

SIRthresholdforRLC
PDUsize656withHSDSCH

PDUSizeSIRThr

On-Line

RNC

UsageofRLCPDUsize
656withHS-DSCH

PDUSize656WithHSDSCH

On-Line

WBTS

NRTDPCHoverHSPDSCHcodeoffset

DPCHOverHSPDSCHThres
hold

On-Line

WCEL

HS-PDSCHcodeupgrademarginforSF128
codes

HSPDSCHMarginSF128

On-Line

WCEL

MaximumnumberofHSSCCHcodes

MaxNbrOfHSSCCHCodes

Requiresobjectlocking

WCEL

Table 82

RAN853:HSDPACodeMultiplexingparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

MaximumnumberofHSSCCHcodes

MaxNbrOfHSSCCHCodes

Requiresobjectlocking

WCEL

Table 83

RAN1643:HSDPA64QAMparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

On-line

WCEL

HSDPA64QAMusageal- HSDPA64QAMallowed
lowed

366

DN0638161

R: 366/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 84

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN2879:MassEventHandlerparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

MassEventHandlerfunc- MassEventHandler
tions

On-line

WCEL

HSDPACQIusernumber
fortheMassEventHandler

MEHHSDPAUserNbrCQI

On-line

WCEL

TemporaryCQIfeedback
cyclefortheMassEvent
Handler

MEHCQIFeedbackCycle

On-line

RNHSPA

ULloadbasedHSDPA
useramountlimitforthe
MEH

MEHULLHSDPAUALimit

On-line

WCEL

Table 85

RAN2954VoiceCallPrioritizationDuringHighTrafficLoadparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

VoiceCallPrioritization
DuringHighTrafficLoad

VoiceCallPriority

On-line

WCEL

Temporarymaxnumber
ofHSDPAusersforthe
VCP

VCPMaxHSDPAUsers

On-line

WCEL

DurationofHSDPApreventionforVoiceCallPriority

VCPHSDPAPrevDuration

On-line

RNHSPA

HSDPAuserincrement
fortheVoiceCallPriority

VCPHSDPAUserIncr

On-line

RNHSPA

VoiceCallPrioritytarget
thresholdforHSDPAprevention

VCPPtxOffset

On-line

WCEL

Noparametersexistforthefollowingfeatures:

Issue:06H

RAN764:HSDPA16QAMsupport

RAN1305:HSDPA14.4Mbpspercell

DN0638161

R: 367/396

367

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

WCDMARANRRMHSDPA

17.4.3 HSDPAmobilityparameters
Table 86

RAN230:HSDPAMobilityHandlingwithDCHSwitchingparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSDPAHOPSidentifier

HSDPAHopsIdentifier

On-Line

ADJS

SHOoftheHSDPAcapa- HSDPARRCdiversity
bleUE

On-Line

RNC

HSDPAFMCGidentifier

HSDPAFmcgIdentifier

On-Line

WCEL

HSDPAFMCIidentifier

HSDPAFmciIdentifier

On-Line

WCEL

HSDPAFMCSidentifier

HSDPAFmcsIdentifier

On-Line

WCEL

Table 87

RAN828:HSDPAServingCellChangeparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

Averagingwindowofthe
CPICHEc/Nomeasurement

HSDPACPICHAveWindow

On-Line

RNC

CPICHEc/Nothreshold
HSDPACPICHEcforservingHS-DSCHcell NoThreshold
change

On-Line

RNC

Reportingperiodofthe
CPICHEc/Nomeasurement

HSDPACPICHReportPeriod

On-Line

RNC

MinimumintervalbetweenservingHS-DSCH
cellchanges

HSDPACellChangeMinIn- On-Line
terval

RNC

WindowformaxrepetitiveservingHS-DSCH
cellchanges

HSDPACellChangeRepe- On-Line
titionTime

RNC

Maxnumberofrepetitive
servingHS-DSCHcell
changes

HSDPAMaxCellChangeRepetition

RNC

368

On-Line

DN0638161

R: 368/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 87

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN828:HSDPAServingCellChangeparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

ServingHS-DSCHcell
changeandSHOon/off
switch

HSDPAMobility

On-Line

RNC

Averagingwindowofthe
SIRerrormeasurement

HSDPASIRErrorAveWindow

On-Line

RNC

Higherlayerfilteringcoef- HSDPASIRErrorFilterCoficientforHSDPASIRefficient
error

On-Line

RNC

Reportingperiodofthe
SIRerrormeasurement

On-Line

RNC

SIRerrorthresholdforthe HSDPASIRErrorServCell
servingHS-DSCHcell

On-Line

RNC

SIRerrorthresholdforthe HSDPASIRErrorTargettargetcell
Cell

On-Line

RNC

CPICHEc/Nowindowfor
servingHS-DSCHcell
selection

HSDPAServCellWindow

On-Line

RNC

TGPLforAMRandHSDPAandIFmeasurement

TGPLAMRHSDPAInterFreq

On-Line

RNC

TGPLforHSDPAandIF
measurement

TGPLHSDPAInterFreq

On-Line

RNC

Table 88

HSDPASIRErrorReportPeriod

RAN829:HSDPASoft/softerHandoverforAssociatedDPCHparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

ServingHS-DSCHcell
changeandSHOon/off
switch

HSDPAMobility

On-Line

RNC

TGPLforAMRandHSDPAandIFmeasurement

TGPLAMRHSDPAInterFreq

On-Line

RNC

Issue:06H

DN0638161

R: 369/396

369

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 88

WCDMARANRRMHSDPA

RAN829:HSDPASoft/softerHandoverforAssociatedDPCHparameters
(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

TGPLforHSDPAandIF
measurement

TGPLHSDPAInterFreq

On-Line

RNC

Table 89

RAN1515:HSPAInter-RNCCellChangeparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

SIRerrorthresholdforthe HSDPASIRErrorServCell
servingHS-DSCHcell

On-Line

RNC

CPICHEc/Nowindowfor
servingHS-DSCHcell
selection

HSDPAServCellWindow

On-Line

RNC

DRNCEc/Nooffsetfor
HSPAInter-RNCCell
Change

HSPADRNCEcNoOffset

On-Line

RNC

SIRerroroffsetforHSPA
Inter-RNCCellChange

HSPADRNCSIRErrorOffset

On-Line

RNC

HSPAInter-RNCMobility

HSPAInterRNCMobility

On-Line

RNC

Table 90

RAN1276:HSDPAInter-frequencyHandoverparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

ADJIHSPACellforNon
CriticalHandover

AdjiNCHOHSPASupport

On-Line

ADJI

PenaltytimeforWCDMA
cellinnon-criticalHO

AdjiPenaltyTimeNCHO

On-Line

HOPI

On-Line

HOPI

NeighbourCellPriorityfor AdjiPriorityHSCAHO
HSPACapabilityBased
HO

370

DN0638161

R: 370/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 90

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1276:HSDPAInter-frequencyHandoverparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

RABCombinationsSupportedbyHSCAHO

HSCAHORabCombSupport

On-Line

RNC

TGPLforAMRandHSDPAandIFmeasurement

TGPLAMRHSDPAInterFreq

On-Line

RNC

TGPLforHSDPAandIF
measurement

TGPLHSDPAInterFreq

On-Line

RNC

BTSsupportforHSPA
CM

BTSSupportForHSPACM

On-Line

WBTS

HSPACapabilityBased
HSCapabilityHONumbUE On-Line
HandoverMaxNumberof
UE

WCEL

HSPACapabilityBased
HandoverPeriod

On-Line

WCEL

MaximumnumberofUEs MaxNumberUECmSLHO
inCMduetoSLHOmeasurement

On-Line

WCEL

MaxnumberofUEsin
MaxNumHSDPACMduetocritical berUEHSPACmHO
HO

On-Line

WCEL

MaxnumberofUEsin
MaxNumberUEHSPACm- On-Line
HSDPACMduetoNCHO NCHO

WCEL

MIMOHSDPACapability
Handover

MIMOHSDPACapaHO

On-Line

WCEL

DCHSDPACapability
HO

DCellHSDPACapaHO

On-Line

WCEL

Table 91

HSCapabilityHOPeriod

RAN1596:HSPACapabilityBasedHandoverparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSPACapabilityBased
Handover

HSPACapaHO

On-Line

WCEL

Issue:06H

DN0638161

R: 371/396

371

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 91

WCDMARANRRMHSDPA

RAN1596:HSPACapabilityBasedHandoverparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

ADJIHSPACellforNon
CriticalHandover

AdjiNCHOHSPASupport

On-Line

ADJI

Releaseversionof
NeighbouringRNC

NrncVersion

On-Line

IUR

RABCombinationsSupportedbyHSCAHO

HSCAHORabCombSupport

On-Line

RNC

TGPLforAMRandHSDPAandIFmeasurement

TGPLAMRHSDPAInterFreq

On-Line

RNC

TGPLforHSDPAandIF
measurement

TGPLHSDPAInterFreq

On-Line

RNC

BTSsupportforHSPA
CM

BTSSupportForHSPACM

On-Line

WBTS

HSDPAFMCIidentifier

HSDPAFmciIdentifier

On-Line

WCEL

HSPACapabilityBased
HSCapabilityHONumbUE On-Line
HandoverMaxNumberof
UE

WCEL

HSPACapabilityBased
HandoverPeriod

On-Line

WCEL

On-Line

WCEL

MaxnumberofUEsin
MaxNumberUEHSPACm- On-Line
HSDPACMduetoNCHO NCHO

WCEL

MIMOHSDPACapability
Handover

MIMOHSDPACapaHO

On-Line

WCEL

DCHSDPACapability
HO

DCellHSDPACapaHO

On-Line

WCEL

HSCapabilityHOPeriod

MaxnumberofUEsin
MaxNumHSDPACMduetocritical berUEHSPACmHO
HO

372

DN0638161

R: 372/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 92

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1231:HSPAoverIurparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSPAoverIur

HSPAOverIur

On-line

IUR

MaximumNRTHS-DSCH MaxIurNRTHSDSCHBiMAC-dflowbitrateover
tRate
Iur

On-line

IUR

HSDPAavailabilityofthe
neighbouringDRNCcell

HSDPAAvailabilityIur

On-line

HOPS

HSDPAenabled

HSDPAenabled

On-line

VCEL

HSDPAFMCSidentifier

HSDPAFmcsIdentifier

On-line

VCEL

HSDPAFMCIidentifier

HSDPAFmciIdentifier

On-line

VCEL

HSDPAFMCGidentifier

HSDPAFmcgIdentifier

On-line

VCEL

HSDPAHOPSidentifier

HSDPAHopsIdentifier

On-line

VCEL

Thepoweroffsetofthe
HS-SCCH

PtxOffsetHSSCCH

On-line

VCEL

HSPAFMCSidentifier

HSPAFmcsIdentifier

On-line

VCEL

HARQRVConfiguration

HARQRVConfiguration

On-line

VBTS

MaximumbitrateforHSDPAULDCHreturn
channel

HSDPAMaxBitrateUL

On-line

WAC

Table 93

RAN2270:ExtensionofHSPAoverIurrelatedparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSPAOverIurExtension

HSPAOverIurExt

On-line

RNC

HSPAFMCSidentifierfor
AMRmulti-service

RTWithHSPAFmcsIdenti- On-line
fier

VCEL

HSDPAFMCSidentifier
forAMRmulti-service

RTwithHSDPAFmcsIdentifier

VCEL

Issue:06H

On-line

DN0638161

R: 373/396

373

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 93

WCDMARANRRMHSDPA

RAN2270:ExtensionofHSPAoverIurrelatedparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSDPAFMCIidentifier
forAMRmulti-service

RTwithHSDPAFmciIdenti- On-line
fier

VCEL

HSDPAFMCGidentifier
forAMRmulti-service

RTWithHSDPAFmcgIdentifier

On-line

VCEL

HSDPAHOPSidentifier
forAMRmulti-service

RTwithHSDPAHopsIdentifier

On-line

VCEL

NodeBPSRABreconfigurationSupport

NodeBRABReconfigSup- On-line
port

VBTS

MaximumbitrateforHSDPAULDCHreturn
channel

HSDPAMaxBitrateUL

WAC

On-line

TherearenoparametersforfeatureRAN1148:HSDPACellReselection.
Table 94

RAN2172:Multi-BandLoadBalancingparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

MBLBduetoMobilityEcNoOffset

MBLBMobilityOffset

On-Line

FMCI

MBLBduetoMobility
RABCombinations

MBLBMobilityRABComb

On-Line

FMCI

MBLBGuardTimer

MBLBGuardTimer

On-Line

RNMOBI

MBLBinInactivityEnabled

MBLBInacitivityEnabled

On-Line

WCEL

MBLBinMobilityEnabled MBLBMobilityEnalbed

On-Line

WCEL

MBLBinRABSetupEnabled

MBLBRABSetupEnalbed

On-Line

WCEL

MBLBinRABSetupfor
MultiRAB

MBLBRABSetupMultiRAB

On-Line

WCEL

374

DN0638161

R: 374/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 94

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN2172:Multi-BandLoadBalancingparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

MBLBStateTransEnabled

MBLBStateTransEnabled On-Line

Table 95

WCEL

RAN2596:InterCircleRoamingforHSDPAparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSDPAOperatorIdentifierWeightPair

HSDPAOperIdWeightPair On-Line

WBTS

HSDPAOperatorIdentifier

HSDPAOperatorId

On-Line

WBTS

HSDPAOperatorWeight

HSDPAOperatorWeight

On-Line

WBTS

HSDPAIurWeight

HSDPAIurWeight

On-Line

WBTS

HSDPAUserThreshold

HSDPAUserThreshold

On-Line

WBTS

HSDPAUserHysterisis

HSDPAUserHysterisis

On-Line

WBTS

17.4.4 MultiRABcombinationswithHSDPAparameters
Table 96

RAN827:HSDPAwithSimultaneousAMRVoiceCallparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSDPAHOPSidentifier
forAMRmulti-service

RTWithHSDPAHopsIden- On-Line
tifier

ADJS

UsageofAMRservice
withHS-DSCH

AMRWithHSDSCH

On-Line

RNC

TGPLforAMRandHSDPAandIFmeasurement

TGPLAMRHSDPAInterFreq

On-Line

RNC

HSDPAFMCGidentifier
forAMRmulti-service

RTWithHSDPAFmcgIden- On-Line
tifier

Issue:06H

DN0638161

R: 375/396

WCEL

375

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 96

WCDMARANRRMHSDPA

RAN827:HSDPAwithSimultaneousAMRVoiceCallparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSDPAFMCIidentifier
forAMRmulti-service

RTWithHSDPAFmciIdentifier

On-Line

WCEL

HSDPAFMCSidentifier
forAMRmulti-service

RTWithHSDPAFmcsIden- On-Line
tifier

WCEL

Table 97

RAN285:HSPAMultiNRTRABsparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

AMRLCbuffermaxtotal
overbookingfor2PS
RABs

AMRLCBufMaxOverbook2NRT

On-Line

RNC

AMRLCbuffermaxover- AMRLCBufMaxOverbookingformorethan2
book3NRT
PSRABs

On-Line

RNC

FactorE-DCHmax.Bit
Ratefor2NRTRAB
combinations

FactorEDCHMaxBitRate2NRT

On-Line

RNC

FactorE-DCHmax.Bit
Ratefor3NRTRAB
combinations

FactorEDCHMaxBitRate3NRT

On-Line

RNC

HSPAmultiNRTRAB
Support

HspaMultiNrtRabSupport

On-Line

WCEL

Therearenoparametersexistforthefollowingfeatures:

376

RAN820:HSDPAwithAdditionalRABInitiation

RAN1727:EnhancementtoHSDPAwithSimultaneousAMRVoiceCall

DN0638161

R: 376/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

17.4.5 HSDPAuserexperienceparameters
Table 98

RAN1033:HSDPA48UsersperCellparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

On-Line

RNC

HSDPA48usersenabled HSDPA48UsersEnabled

Table 99

RAN1464:HSDPA64UsersperCellparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

Requiresobjectlocking

WCEL

HSDPA64usersenabled HSDPA64UsersEnabled

Table 100

RAN1249:HSDPA10MbpsperUserparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

MaximumbitrateofNRT
MAC-dflow

MaxBitRateNRTMACDFlow

On-Line

RNC

Table 101

RAN1258:HSDPA14MbpsperUserparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

MaximumbitrateofNRT
MAC-dflow

MaxBitRateNRTMACDFlow

On-Line

RNC

HSDPA14MbpsPerUser

HSDPA14MbpsPerUser

On-Line

WBTS

Table 102

RAN1201:FractionalDPCHparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

CPICHRSCPThreshold
forSRBsonHSDPA

CPICHRSCPThreSRBHSDPA

On-line

RNC

Issue:06H

DN0638161

R: 377/396

377

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 102

WCDMARANRRMHSDPA

RAN1201:FractionalDPCHparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

CPICHEc/Nowindowfor
SRBsonHS-DSCHcell
selection

HSDPASRBWindow

On-line

RNC

CPICHEcNoforSRBon
HSPA

CPICHECNOSRBHSPA

On-line

RNC

AMRLCSRBHSPAAM
RLCconfigurationfor
SRBonHSPA

AMRLCSRBHSPA

On-line

RNC

Offsetforactivationtime
ofSRBsonHSPA

ATOSRBsOnHSPA

On-line

RNC

SIRerrorreportingperiod
forHSPASRB

HSDPASIRErrorReportPeriod

On-line

RNC

F-DPCHenabled

FDPCHEnabled

On-line

WCEL

F-DPCHsetup

FDPCHSetup

On-line

WCEL

RNC-F-DPCHandSRBs FDPCHAndSRonHSPAperTC
BOnHSPATC

On-line

RNC

F-DPCHcodechangeen- FDPCHCodeChangeEnabled
abled

On-line

WCEL

F-DPCHmaximumtransmissionpower

PtxFDPCHMax

On-line

WCEL

F-DPCHminimumtransmissionpower

PtxFDPCHMin

On-line

WCEL

ThepoweroffsetofFDPCHforSHO

PtxOffsetFDPCHSHO

On-line

WCEL

TPCcommanderrorrate
target

TPCCommandERTarget

On-line

WCEL

Minimumintervalbetween FDPCHAllocMinInterval
F-DPCHallocations

On-line

RNC

CarriertointerferenceratioforF-DPCH

On-line

WCEL

378

CIRForFDPCH

DN0638161

R: 378/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 102

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1201:FractionalDPCHparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

MaximumsizeofAMD
RLCPDUpayloadwhen
flexibleAMDPDUsizeis
configured

FRLCPDUMaxSize

On-line

RNC

Table 103

RAN1686:HSPA72UsersperCellparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSPA72UsersperCell

HSPA72UsersPerCell

Requiresobjectlocking

WCEL

Table 104

RAN2124:HSPA128UsersperCellparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSPA128UsersperCell

HSPA128UsersPerCell

Requiresobjectlocking

WCEL

Table 105

RAN955:PowerSavingModeforBTSparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSPAtypeofacellin
PowerSavingModefor
BTS

PowerSaveHSPAType

On-line

WCEL

Table 106

RAN1642MIMOparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

MIMOEnabled

MIMOEnabled

Requiresobjectlocking

WCEL

DualCellversusMIMO
preference

DCellVsMIMOPreference

On-line

WCEL

Issue:06H

DN0638161

R: 379/396

379

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 107

WCDMARANRRMHSDPA

RAN1906Dual-CellHSDPA42Mbpsparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

DCHSDPAEnabled

DCellHSDPAEnabled

Requiresobjectlocking

WCEL

DCHSDPAFMCSIdentifier

DCellHSDPAFmcsId

On-line

WCEL

MaxnumberHSDPA
usersperMAChs/ehs
scheduler

MaxNumbHSDPAUsersS

On-line

WCEL

MaxnumberHSDSCH
MACdflowsperMAChs/ehsscheduler

MaxNumbHSDSCHMACdFS

On-line

WCEL

Table 108

RAN1912:MIMO42Mbpsparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

On-Line

WCEL

MIMOwith64QAMusage MIMOWith64QAMUsage

Table 109

RAN1907:DCHSDPAwithMIMO84Mbpsparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

DC-HSDPAandMIMO
Usage

DCellAndMIMOUsage

On-Line

WCEL

Table 110

RAN2067:LTEInterworkingparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

LoadBasedCPICHEcNo LoadBasedCPICHEcNoS- On-line


forSRBonHSPA
RBHSPA

380

DN0638161

R: 380/396

WCEL

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 111

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1644:ContinuousPacketConnectivityparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

InactiveCPCuserwith
batteryoptimizationtimer

InactCPCBatOptT

On-Line

RNC

InactiveCPCuserwithout InactCPCNoBatOptT
batteryoptimizationtimer

On-Line

RNC

InactivenonCPCuser
withbatteryoptimization
timer

InactNonCPCBatOptT

On-Line

RNC

InactivenonCPCuser
withoutbatteryoptimizationtimer

nactNonCPCNoBatOptT

On-Line

RNC

Inactiveusersoverload
preventivefactor

InacUsersOverloadFact

On-Line

RNC

Inactiveusersnumberin
XXXoverNRT

InacUserNbrXXXOverNRT

On-Line

RNC

DLinnerloopPCstep
sizewithCPCusers

DLInLoopPCStepSizeCPC

On-Line

RNC

Table 112

RAN1470:HSUPA2msTTIparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSUPA2msTTIenabled HSUPA2MSTTIEnabled

Requiresobjectlocking

WCEL

E-DCHmaximum#of
HARQretransmissions
for2msSRB

EDCHMaxHarqReTxSRB2MS

On-line

RNC

CPICHRSCPThreshold
forEDCHTTI2ms

CPICHRSCPThreEDCH2MS

On-line

RNC

Thresholdtodefinemaxi- ThresholdMaxEDPDCHSR
mumEDPDCHSR

On-line

RNC

Thresholdtodefinemaxi- ThresholdMaxEDPDCHmumEDPDCHSR3840 SR3840kbps


kbps

On-line

RNC

Issue:06H

DN0638161

R: 381/396

381

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 112

WCDMARANRRMHSDPA

RAN1470:HSUPA2msTTIparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

AMRLCroundtriptimes
withDCH

AMRLCRespTimeDCH

On-line

RNC

AMRLCroundtriptime
forEDCH/DCH

AMRLCRespTimeRevEDCH

On-line

RNC

MaximumReferenceUE
transmissionpower

UETxPowerMaxRef

On-line

RNC

CPICHECNOThreshold
forEDCHTTI2ms

CPICHECNOThreEDCH2MS

On-line

RNC

MaximumReordering
WaitTimeforMac-esEDCH2msTTI

MaxReWaitTime2msTTI

On-line

RNC

ProbabilityFactorforCon- ProbabilityFactorMax2msT- On-line


gestionIndicationsendTI
ing

WBTS

MaximumThresholdfor
HSUPAcongestiondelay
2msTTI

DelayThresholdMax2msTTI On-line

WBTS

MiddleThresholdfor
HSUPAcongestiondelay
2msTTI

DelayThresholdMid2msTTI

WBTS

Maximumtotaluplink
symbolrate

MaxTotalUplinkSymbolRate Requiresobjectlocking

Table 113

On-line

WCEL

RAN1762:DirectResourceAllocationparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

UsageofthedirectresourceallocationforPS
NRTHSPA

RABDRAEnabled

On-Line

RNC

382

DN0638161

R: 382/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 114

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1637:HighSpeedCELL_FACHDLparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HighSpeedCell_FACH
DLEnabled

HSFACHEnabled

Requiresobjectlocking

WCEL

HS-SCCHPowerofHSFACHforBCCH

PtxBCCHHSSCCH

On-Line

WCEL

HS-PDSCHPowerofHS- PtxBCCHHSPDSCH
FACHforBCCH

On-Line

WCEL

HSDPAre-orderingreleasetimerT1forxCCH
onHS-FACH

On-Line

RNHSPA

On-Line

RNAC

MAC-ehsResetTimerfor HSFACHRestTimerDTCH On-Line


DTCHdataonHS-FACH

RNPS

DiscardTimerforBCCH,
CCCHandDCCHdata
onHS-FACH

HSFACHDiscardTimer

On-Line

RNAC

DiscardTimerforDTCH
dataonHS-FACH

HSFACHDiscardTimerDTCH

On-Line

RNPS

AMRLCconfigurationfor
PSNRTwithHS-FACH

AMRLCHSFACHPS

On-Line

RNRLC

ThresholdoftheHSDSCHMAC-dflowofPS
RBonHS-FACH

HSFACHActivityThr

On-Line

WCEL

Timetotriggerforactivity
measurementonHSFACH

HSFACHActTimeToTrigger

On-Line

WCEL

DLtrafficvolumemeasurementthresholdof
HS-FACH

HSFACHVolThrDL

On-Line

WCEL

TimetotriggerforRLC
measurementonHSFACH

HSFACHRLCTimeToTrigger

On-Line

WCEL

T1HSFACH

MAC-ehsResetTimerfor HSFACHResetTimer
xCCHdataonHS-FACH

Issue:06H

DN0638161

R: 383/396

383

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 115

WCDMARANRRMHSDPA

RAN1913:HighSpeedCELL_FACHparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HS-RACHMeasurement
PowerOffset

HSRACHMPO

On-line

WCEL

InactiveHS-RACHcapableUE

InactHSRACH

On-line

WAC

Table 116

RAN2136:FastDormancyparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

FastDromancyactivation/deactivation

FastDormancyEnabled

On-Line

RNFC

FastDromancyandCPC
Priority

FastDromOverCpcPri

On-Line

RNMOBI

Table 117

RAN2451:FastDormancyProfilingparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

WindowsizeforLFD
phonethroughputmeasurement

SmartHSPATputAveWin

On-line

RNHSPA

Time-to-triggerforLFD
phonethroughputmeasurement

SmartHSPATimeToTrigger

On-line

RNHSPA

Table 118

RAN1908:UEDRXinCELL_FACHparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

Requiresobjectlocking

WCEL

UEDRXwithHighSpeed HSFACHDRXEnabled
CellFACHEnabled

384

DN0638161

R: 384/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 118

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1908:UEDRXinCELL_FACHparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HighSpeedCellFACH
DRXoperationtimer

T321

Requiresobjectlocking

WCEL

DiscontinuousReception
CycleHS-FACH

DRXCycleHSFACH

Requiresobjectlocking

WCEL

HS-FACHReception
Burst

RXBurstHSFACH

Requiresobjectlocking

WCEL

DRXInterruptionbyHSDSCHdata

DRXInterruptHSDSCHData

Requiresobjectlocking

WCEL

InactivitySupervision
TimerofHS-FACHfor
DRXUser

DRXInactiveTimerHSFACH

On-line

WCEL

Table 119

RAN2494:FastCELL_PCHswitchingparameters

Parametername

Abbreviatedname

Modifable/systemdefined

Object

AMRLCSRB3n4PeriodMaxAMRLCstatusperiodmaxforSRB3and
SRB4

AMRLCSRB3n4PeriodMax

On-line

RNRLC

AMRLCSRB3n4RespTimeAMRLCroundtrip
timeforSRB3andSRB4

AMRLCSRB3n4RespTime

On-line

RNRLC

TherearenoparametersforfeatureRAN839:HSDPA16UsersperCell.

17.4.6 Qualityofservicemanagementparameters
Table 120

RAN930:PSRABReconfigurationparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

NodeBPSRABreconfigurationSupport

NodeBRABReconfigSupport

On-Line

WBTS

Issue:06H

DN0638161

R: 385/396

385

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 121

WCDMARANRRMHSDPA

RAN1004:StreamingQoSforHSPAparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

AMRLCconfigurationfor
PSstreamingwithEDCH

AMRLCOnEDCHOfStrPS On-Line

RNC

AMRLCstatusreports
EDCHStrPSCount*)
countforPSstreamingEDCH

On-Line

RNC

AMRLCSDUdiscard
timeforPSstreamingEDCH

EDCHStrPSDiscardTime
*)

On-Line

RNC

AMRLCMaxDATtransmissionsforPSstreamingE-DCH

EDCHStrPSMaxDAT*)

On-Line

RNC

AMRLCMaxMRWtrans- EDCHStrPSMaxMRW*)
missionsforPSstreamingE-DCH

On-Line

RNC

AMRLCmaxRSTtransmissionsforPSstreamingE-DCH

EDCHStrPSMaxRST*)

On-Line

RNC

AMRLCstatusperiod
maxforPSstreamingEDCH

EDCHStrPSPeriodMax*)

On-Line

RNC

AMRLCstatusperiod
minforPSstreamingEDCH

EDCHStrPSPeriodMin*)

On-Line

RNC

AMRLCperiodPoll_PDU EDCHStrPSPollPDU*)
forPSstreamingE-DCH

On-Line

RNC

AMRLCperiodPoll_SDU EDCHStrPSPollSDU*)
forPSstreamingE-DCH

On-Line

RNC

AMRLCperiodPoll_Win- EDCHStrPSPollWindow
dowforPSstreamingE- *)
DCH

On-Line

RNC

AMRLCstatusreport
triggersforPSstreaming
E-DCH

On-Line

RNC

386

EDCHStrPSTriggers*)

DN0638161

R: 386/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 121

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1004:StreamingQoSforHSPAparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

AMRLCconfigurationfor
PSstreamingwithHSDSCH

AMRLCOnHSDSCHOfStrPS

On-Line

RNC

AMRLCSDUdiscard
timeforPSstreaming
withHS-DSCH

HSDSCHStrDiscardTime
**)

On-Line

RNC

AMRLCstatusreports
countforPSstreaming
HS-DSCH

HSDSCHStrPSCount**)

On-Line

RNC

AMRLCretransmission
filterforPSstreaming
HS-DSCH

HSDSCHStrPSFilterReTX**)

On-Line

RNC

AMRLCMaxDATtransmissionsforPSstreamingHS-DSCH

HSDSCHStrPSMaxDAT
**)

On-Line

RNC

AMRLCMaxMRWtrans- HSDSCHStrPSMaxMRW
missionsforPSstream**)
ingHS-DSCH

On-Line

RNC

AMRLCmaxRSTtransmissionsforPSstreamingHS-DSCH

HSDSCHStrPSMaxRST
**)

On-Line

RNC

AMRLCstatusperiod
maxforPSstreaming
withHS-DSCH

HSDSCHStrPSPeriodMax**)

On-Line

RNC

AMRLCstatusperiod
HSDSCHStrPSPeriodMin On-Line
minforPSstreamingwith **)
HS-DSCH

RNC

AMRLCperiodPoll_PDU HSDSCHStrPSPollPDU
forPSstreamingwith
**)
HS-DSCH

On-Line

RNC

AMRLCperiodPoll_SDU HSDSCHStrPSPollSDU
forPSstreamingwith
**)
HS-DSCH

On-Line

RNC

Issue:06H

DN0638161

R: 387/396

387

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 121

WCDMARANRRMHSDPA

RAN1004:StreamingQoSforHSPAparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

On-Line

RNC

AMRLCperiodPoll_Win- HSDSCHStrPSPollWindowforPSstreaming
dow**)
withHS-DSCH
AMRLCstatusreport
triggersforPSstreaming
HS-DSCH

HSDSCHStrPSTriggers
**)

Inactivationdetectionfor
streamingradiobearer

InactDetForStreamingRB

On-Line

RNC

Lowthroughputtimeto
triggerforstreamingEDCH

EDCHMACdflowtputStrTtT

On-Line

RNC

E-DCHmaxnumberof
HARQretransmissions
forstreaming

EDCHMaxHARQReTxStr

On-Line

RNC

FactorE-DCHmax.Bit
RateforPSstreaming
RABs

FactorEDCHMaxBRPSstream

On-Line

RNC

Safetymarginforfree
transmittedpowerfor
streaming

FreePtxSafetyMarginStr

On-Line

RNC

InitialbitrateforHSDPA
ULDCHforNRTwith
streaming

HSDPAInitialBRULStrNRT

On-Line

RNC

MinbitrateforHSDPAUL HSDPAMinBRULStrNRT
DCHforNRTwith
streaming

On-Line

RNC

QoSPriorityMapping

On-Line

RNC

PriorityforStreamingtraf- PriForStreamARP1***)
ficclasswithARP1

On-Line

RNC

PriorityforStreamingtraf- PriForStreamARP2***)
ficclasswithARP2

On-Line

RNC

PriorityforStreamingtraf- PriForStreamARP3***)
ficclasswithARP3

On-Line

RNC

388

QoSPriorityMapping

RNC

DN0638161

R: 388/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 121

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1004:StreamingQoSforHSPAparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

HSPANBRvalues

HSPANBRValues

On-Line

RNC

DownlinkNBRforPriority NBRForPri0DL****)
value0

On-Line

RNC

UplinkNBRforPriority
value0

On-Line

RNC

DownlinkNBRforPriority NBRForPri10DL****)
value10

On-Line

RNC

UplinkNBRforPriority
value10

NBRForPri10UL****)

On-Line

RNC

DownlinkNBRforPriority NBRForPri11DL****)
value11

On-Line

RNC

UplinkNBRforPriority
value11

NBRForPri11UL****)

On-Line

RNC

DownlinkNBRforPriority NBRForPri12DL****)
value12

On-Line

RNC

UplinkNBRforPriority
value12

On-Line

RNC

DownlinkNBRforPriority NBRForPri1DL****)
value1

On-Line

RNC

UplinkNBRforPriority
value1

NBRForPri1UL****)

On-Line

RNC

DownlinkNBRforPriority NBRForPri2DL****)
value2

On-Line

RNC

UplinkNBRforPriority
value2

NBRForPri2UL****)

On-Line

RNC

DownlinkNBRforPriority NBRForPri3DL****)
value3

On-Line

RNC

UplinkNBRforPriority
value3

On-Line

RNC

Issue:06H

NBRForPri0UL****)

NBRForPri12UL****)

NBRForPri3UL****)

DN0638161

R: 389/396

389

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 121

WCDMARANRRMHSDPA

RAN1004:StreamingQoSforHSPAparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

DownlinkNBRforPriority NBRForPri4DL****)
value4

On-Line

RNC

UplinkNBRforPriority
value4

NBRForPri4UL****)

On-Line

RNC

DownlinkNBRforPriority NBRForPri5DL****)
value5

On-Line

RNC

UplinkNBRforPriority
value5

NBRForPri5UL****)

On-Line

RNC

DownlinkNBRforPriority NBRForPri6DL****)
value6

On-Line

RNC

UplinkNBRforPriority
value6

NBRForPri6UL****)

On-Line

RNC

DownlinkNBRforPriority NBRForPri7DL****)
value7

On-Line

RNC

UplinkNBRforPriority
value7

NBRForPri7UL****)

On-Line

RNC

DownlinkNBRforPriority NBRForPri8DL****)
value8

On-Line

RNC

UplinkNBRforPriority
value8

NBRForPri8UL****)

On-Line

RNC

DownlinkNBRforPriority NBRForPri9DL****)
value9

On-Line

RNC

UplinkNBRforPriority
value9

NBRForPri9UL****)

On-Line

RNC

RT-over-NRTpriority
thresholdforARP1

RTOverNRTPriThresholdARP1

On-Line

RNC

RT-over-NRTpriority
thresholdforARP2

RTOverNRTPriThresholdARP2

On-Line

RNC

RT-over-NRTpriority
thresholdforARP3

RTOverNRTPriThresholdARP3

On-Line

RNC

390

DN0638161

R: 390/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 121

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1004:StreamingQoSforHSPAparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

Lowthroughputtimeto
MACdflowtputStrTtT
triggerofstreamingMACdflow

On-Line

RNC

Lowutiltimetotriggerof MACdflowutilStrTtT
MAC-dflowforstreaming

On-Line

RNC

MaximumMAC-esReorderingWaittimeforRT
user

On-Line

RNC

NRTRBuserbitratewith NRTRBBRWithEDCHStr
E-DCHstreaming

On-Line

RNC

TransferDelaymultiplier
forHSDPAstreaming

TDMultForHSDPAStreaming

On-Line

RNC

HSPAQoSenabled

HSPAQoSEnabled

Requiresobjectlocking

WCEL

EbNoforE-DCHStreaming

EbNoEDCHOfPSStr

On-Line

WRAB

EbNoforE-DCHStreaming128Kbps

EDCHPSStr128Kbps
*****)

On-Line

WRAB

EbNoforE-DCHStreaming16Kbps

EDCHPSStr16Kbps*****) On-Line

WRAB

EbNoforE-DCHStreaming248Kbps

EDCHPSStr248Kbps
*****)

On-Line

WRAB

EbNoforE-DCHStreaming32Kbps

EDCHPSStr32Kbps*****) On-Line

WRAB

EbNoforE-DCHStreaming64Kbps

EDCHPSStr64Kbps*****) On-Line

WRAB

EbNoforE-DCHStreaming8Kbps

EDCHPSStr8Kbps*****)

On-Line

WRAB

EbNoforE-DCHStreamingover248Kbps

EDCHPSStrOver248Kbps*****)

On-Line

WRAB

*)

Issue:06H

MaxReWaitTimeRT

ChildparameteroftheAMRLCOnEDCHOfStrPSparameterstructure

DN0638161

R: 391/396

391

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 122

WCDMARANRRMHSDPA

**)

ChildparameteroftheAMRLCOnHSDSCHOfStrPSparameter
structure

***)

ChildparameteroftheQoSPriorityMappingparameterstructure

****)

ChildparameteroftheHSPANBRValuesparameterstructure

*****)

ChildparameteroftheEbNoEDCHOfPSStrparameterstructure

RAN1262:QoSAwareHSPASchedulingparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

QoSPriorityMapping

QoSPriorityMapping

On-Line

RNC

PriorityforBackground
TCwithARP1

PriForBackARP1*)

On-Line

RNC

PriorityforBackground
TCwithARP2

PriForBackARP2*)

On-Line

RNC

PriorityforBackground
TCwithARP3

PriForBackARP3*)

On-Line

RNC

PriorityforInteractiveTC
markedforsignalinguse

PriForIntSignaling*)

On-Line

RNC

PriorityforInteractiveTC
withTHP1andARP1

PriForIntTHP1ARP1*)

On-Line

RNC

PriorityforInteractiveTC
withTHP1andARP2

PriForIntTHP1ARP2*)

On-Line

RNC

PriorityforInteractiveTC
withTHP1andARP3

PriForIntTHP1ARP3*)

On-Line

RNC

PriorityforInteractiveTC
withTHP2andARP1

PriForIntTHP2ARP1*)

On-Line

RNC

PriorityforInteractiveTC
withTHP2andARP2

PriForIntTHP2ARP2*)

On-Line

RNC

PriorityforInteractiveTC
withTHP2andARP3

PriForIntTHP2ARP3*)

On-Line

RNC

PriorityforInteractiveTC
withTHP3andARP1

PriForIntTHP3ARP1*)

On-Line

RNC

392

DN0638161

R: 392/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 122

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN1262:QoSAwareHSPASchedulingparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

PriorityforInteractiveTC
withTHP3andARP2

PriForIntTHP3ARP2*)

On-Line

RNC

PriorityforInteractiveTC
withTHP3andARP3

PriForIntTHP3ARP3*)

On-Line

RNC

ARPbasedweight

ARPWeight

On-Line

RNC

WeightforARP1

WeightForARP1**)

On-Line

RNC

WeightforARP2

WeightForARP2**)

On-Line

RNC

WeightforARP3

WeightForARP3**)

On-Line

RNC

HSPAQoSenabled

HSPAQoSEnabled

Requiresobjectlocking

WCEL

Table 123

RAN1689:CSVoiceoverHSPA

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

MaxbuffertimeoftheHS
CSvoiceinUE

MaxCSDelayUE

On-Line

RNC

HSDPAre-orderingreleasetimerT1fortheCS
voiceservice

T1HSCSVoice

On-Line

RNC

DCHinsteadofF-DPCH
basedonEstablishment
Cause

FDPCHSetupEC

On-Line

RNC

HSDPADiscardTimerfor
theCSvoice

DiscardTimerHSCSVoice On-Line

RNC

Priorityforconversational
onHSPA

PriForConvOnHSPA

On-Line

RNC

On-Line

WCEL

Maxnbrofconvusersper UsersPerHSSCCHCode
reservedHS-SCCHcode

Issue:06H

DN0638161

R: 393/396

393

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

Table 123

WCDMARANRRMHSDPA

RAN1689:CSVoiceoverHSPA(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

Minimumvaluefordynamictotaltxpower

PtxTargetTotMin

On-Line

WCEL

Maximumvaluefordynamictotaltxpower

PtxTargetTotMax

On-Line

WCEL

Table 124

*)

ChildparameteroftheQoSPriorityMappingparameterstructure

**)

ChildparameteroftheARPWeightparameterstructure

CelllevelparametersforbetterULLoadcontrol

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

WACIdentifier

WACId

Notmodifiable

WAC

WACChangeorigin

WACChangeOrigin

Notmodifiable

WAC

WACParameterSet
Identifier

WACSetIdentifier

On-Line

WCEL

WACParameterSet
Identifier

WACSetIdentifier

On-Line

VCEL

Table 125

RAN2509:ApplicationAwareRANparameters

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

ApplicationAwareRAN
Enabled

AppAwareRANEnabled

On-line

WCEL

ApplicationAwareRAN
Enabled

AppAwareRANEnabled

On-line

IUR

ApplicationAwareRAN
ConfigurationTable

AARConfigTable

On-line

RNHSPA

394

DN0638161

R: 394/396

Issue:06H

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

WCDMARANRRMHSDPA

Table 125

Managementdataforradioresourcemanagementof
HSDPAforWCDMA

RAN2509:ApplicationAwareRANparameters(Cont.)

Parametername

Abbreviatedname

Modifiable/systemdefined

Object

ApplicationGroupIdentifi- AppGrpId
er

On-line

RNHSPA

DSCPCode1

DSCPCode1

On-line

RNHSPA

DSCPCode2

DSCPCode2

On-line

RNHSPA

DSCPCode3

DSCPCode3

On-line

RNHSPA

DSCPCode4

DSCPCode4

On-line

RNHSPA

DSCPCode5

DSCPCode5

On-line

RNHSPA

Precedence

Precedence

On-line

RNHSPA

TargetSPIforSPI0

TargetSPIforSPI0

On-line

RNHSPA

TargetSPIforSPI1

TargetSPIforSPI1

On-line

RNHSPA

TargetSPIforSPI2

TargetSPIforSPI2

On-line

RNHSPA

TargetSPIforSPI3

TargetSPIforSPI3

On-line

RNHSPA

TargetSPIforSPI4

TargetSPIforSPI4

On-line

RNHSPA

TargetSPIforSPI5

TargetSPIforSPI5

On-line

RNHSPA

TargetSPIforSPI6

TargetSPIforSPI6

On-line

RNHSPA

TargetSPIforSPI7

TargetSPIforSPI7

On-line

RNHSPA

TargetSPIforSPI8

TargetSPIforSPI8

On-line

RNHSPA

TargetSPIforSPI9

TargetSPIforSPI9

On-line

RNHSPA

TargetSPIforSPI10

TargetSPIforSPI10

On-line

RNHSPA

TargetSPIforSPI11

TargetSPIforSPI11

On-line

RNHSPA

TargetSPIforSPI12

TargetSPIforSPI12

On-line

RNHSPA

Issue:06H

DN0638161

R: 395/396

395

03_ WCDMA RAN RRM HSDPA


D511004772

Draft
2
Confidential

ManagementdataofFlexiDirect

WCDMARANRRMHSDPA

18 ManagementdataofFlexiDirect
18.1 Alarms
Foralarmdescriptions,seethefollowingdocuments:

Flexi Direct RNC Notices (0-999)

Flexi Direct RNC Disturbances (1000-1999)

Flexi Direct RNC Failure Printouts (2000-3999)

Flexi Direct RNC Base Station Alarms (7000-7900)inMulticontrollerRNC,IPA-RNC


andFlexiDirectRNCBaseStationAlarms(7000-7900).

Flexi Direct RNC Alarms (70000-72000)

18.2 Counters
Forcountersandmeasurements,seesectionRadio Network (RNW) Measurementsin
Flexi Direct RNC Measurements and Counters.

18.3 Keyperformanceindicators
TheKPIsaredescribedindetailinFlexi Direct Key Performance Indicatorsdocument.

18.4 Parameters
ThemanagementparametersaredescribedinRadio Network Parameters in Flexi Direct
ExcelinWCDMARANOperatingDocumentation,ParametersinNOLSPIC.

396

DN0638161

R: 396/396

Issue:06H