1

Alkalmazásra került

FONTOSABB IPARI
MIKROBIOLÓGIAI
ELJÁRÁSOK
<Ipari mikrobiológia II-III.>
“Il n y a pas des sciences
appliquées. Mais il y a des
applications de la science”
Louis Pasteur

SZENTIRMAI ATTILA
Prof. Emeritus
DE-TTK Mikrobiológiai és
Biotechnológiai Tanszék
2000

Ipari mikrobiológia
Piacképes gyógyászati és élelmiszeripari termékek előállítása a
mikrovilág képviselőinek közreműködésével



2








The laws of applied microbiology



The microorganism is always right


The microorganism is your friend


The microorganism is a sensitiv partner


There are no stupid microorganisms


Microorganisms can do anything


Microorganisms are smarter, wiser and
more energetic than chemists, engineers
and biologists


If you take care of your microbial friends,
they will take care of your future



David Perlman 1960













3
KÜZDELEM A MIKROBIÁLIS KÓROKOZÓK ELLEN
Ipari Mikrobiológia III.Szekunder metabolitok előállítása
Tartalom:
4. A KEMOTERÁPIA TUDATOS ALKALMAZÁSA
9. AZ ANTIBIOTIKUMOK (SZEKUNDER METABOLITOK) BIOLÓGIAI-KÉMIÁJA
11. AZ ANTIBIOTIKUM KÉPZŐDÉS LEHETŐSÉGE ÉS FELTÉTELEI
14. FARMAKOLÓGIAILAG HATÁSOS ANYAGOK
16. A PENICILLIN KÉMIAI SZERKEZETE ÉS BOMLÁSI FOLYAMATAI
18. AZETIDINON SZERKEZETŰ VEGYÜLETEK HATÁSMÓDJA.
21. A PENICILLINÁZ
22. AZETIDINON SZERKEZETÚ VEGYÜLETEK ELŐÁLLÍTÁSA, TÖRZSFEJLESZTÉS
25. ß-LAKTÁM SZERKEZETŰ ANTIBIOTIKUMOK FELSZAPORODÁSA A TENYÉSZETBEN
28. PENICILLIN GYÁRTÁS
31. ÚJABB |-LAKTÁM SZERKEZETŰ BIOLÓGIAILAG AKTÍV METABOLITOK FELFEDEZÉSE
33. A |-LAKTÁM SZERKEZETŰ VEGYÜLETEK, A PENICILLIN BIOSZINTÉZISE
41 Gyűrű tágítás Ring expandáz (REX) Cephem váz képződés
47. A PENICILLIN KÉMIAI SZINTÉZISE.
48. PENICILLIN ANALÓGOK ELŐÁLLÍTÁSA FÉLSZINTÉZISSEL
55. PENICILLIN ÉRZÉKENYSÉG KIALAKULÁSA, ALLERGIÁS TÜNETEK.
56. GLYCOPEPTID antibiotikumok: VANCOMYCIN, TEICOPLANIN
57. D-CIKLOSZERIN
59. FOSZFONOMYCIN
60. PEPTID JELLEGŰ ANTIBIOTIKUMOK (DEPSZIPEPTIDEK)
61. GRAMICIDIN-S
63. BACITRACIN
66. VIRGINIAMYCIN
68. NISIN
69. BLEOMYCIN
71. ACTINOMYCIN-D
74. CYCLOSPORIN-A; IMMUNSZUPRESSZÍV ANYAG HATÁSMÓDJA
82. NOVOBIOCIN
83. ANSA-LÁNCÚ ANTIBIOTIKUMOK CSOPORTJA
86. RIBOSZÓMÁLIS FEHÉRJESZINTÉZIST GÁTLÓ METABOLITOK
86. Chloramphenicol
88. Aminoglikozid antibiotikumok
102. Makrolid antibiotikumok
105. Thiostrepton
106. POLIKETID KÖZTESTERMÉKBŐL KÉPZŐDŐ METABOLITOK CSOPORTJA
108. Tetraciklin tipusú antibiotikumok
114. Koleszterinszint csökkentő farmakonok; sztatinok
117. Poliéterkarbonsav szerkezetű antibiotikumok
118. Fungisztatikumok Poliének, Actidion
122.FUMAGILLIN
123.FUSIDINSAV
125.RÁKOS MEGBETEGEDÉSEK ELLEN HATÁSOS ANTIBIOTIKUMOK CSOPORTJA
129.ÚJ ANTIBIOTIKUM ELŐÁLLÍTÁS (KUTATÁS) MŰVELETEI
132 Primer metabolitok előállítására szolgáló eljárások Citromsav előállítása
144.Glutamin sav előállítása
150.Esszenciális aminosavak előállítása
161.Arómás aminosavak előállítása
170.Aspartam
173.Laktobacillusok hasznosítása
174.Clostridiumok
177. Alkoholos erjesztés
192. Ecetsavgyártás
197.Cianocobalamin B
12

205.Glükonsav előállítás
4

A KEMOTERÁPIA TUDATOS ALKALMAZÁSA

A kemoterápiai kutatások elméletének kialakítása és az első gyakorlati eredmények elérése Paul Ehrlich
nevéhez kötődik (1854-1915). Munkatársaival fáradhatatlanul és tudatosan kereste azokat a vegyületeket,
amelyek a mikroszervezetek szaporodását olyan koncentrációban gátolják, amelyet még a gazdaszervezet
károsodás nélkül elvisel. Felismerte a hatóanyag és a hatáshely közötti fizikai, illetve kémiai kapcsolat
szükségességét.
Corpora non agunt nisi fixata - A testek nem hatnak, hacsak nem kötődnek.

Iskolát teremtve kialakította a gyakorlati gyógyszerkutatás módszertanát, technikáját. A sikereken
felbuzdulva a gyógyszerészeti kutatás művelői úgy vélték, hogy kellő ötletgazdagsággal végzett kísérleti
munkával megtalálhatók azok a kémiai szintézissel előállítható vegyületek, amelyekkel az élő szervezetet fertőző
kórokozók leküzdhetőkké válnak. Kísérleti módszerük szerint a kórokozóval fertőzött állatokba juttatták a
hatásosnak vélt vegyület különböző mennyiségét, meghatározva a túlélés százalékát. Egészséges állatokba
juttatott hatóanyaggal pedig vizsgálták a vegyület toxicitását. Az eredmények mérhetősége, számszerűsítése a
biológiában bevezetett 50%-os hatás meghatározását jelenti. Ez a technika reprodukálható módszerként
lehetőséget ad a hatásos (effektív) dózis (ED
50
) és a gyilkos (letális) dózis (LD
50
) meghatározására, amely adott
időn belül a fertőzött állatok 50%-ának túlélését, illetve az egészséges állatok 50%-ának pusztulását okozza.

A kísérleti eredményeket mutató ábra a testsúly kilogrammra vonatkozó hatóanyag mennyiségének az
állatok pusztulási görbéjére kifejtett hatását mutatja. A statisztikailag értékelhető számban felhasznált kísérleti
állatot olyan mértékben fertőzték, hogy belátható időn belül közel azonos időpontban elpusztuljanak. Ennek
érdekében azonos érzékenységű, azonos korú, azonos tömegű állatok kerülnek felhasználásra. Gyógyászati
alkalmazásra az a vegyület számíthat, amelynek az ED
50
és az LD
50
értéke közötti érték (távolság) jelentős.
A hatásos anyag bevitele történhet a tápcsatornán keresztül (per os) a gyomorban és a vékonybélben,
illetve a véráramba juttatva vénába, (i.v.) vagy izomba (i.m.), illetve bőr alá (sub cutan) adva. Felszívódhat az
anyag a nyálkahártyán keresztül. Ez esetben elkerüli a máj méregtelenítő hatását.


A szervezetbe juttatott anyag a bevitel sebessége és a kiürülés , illetve bomlás függvényében kialakít egy
vérszintet amitől a hatás várható. A vese áteresztőképessége és a máj méregtelenítő hatása egyedi illetve faji
variációt mutat. Ezért az aktuális vérszint meghatározása feltétlenül indokolt
5
Az antibiotikum kezelés esetén a terápiás vérszint elérésére törekedve a meghatározó paraméterek
figyelembe vételével a terápiás hatáshoz szükséges küszöbérték felett kell tartani a hatóanyag koncentrációját.
Naponta többször adagolva, vagy pedig olyan származékot használva amelynek kémiai stabilitása akár egy
napon keresztül is képes a terápiás szintet biztosítani (lásd például az oxitetraciklin és vibramicin használatát)

Nemcsak tudománytörténeti, de szakmai szempontból is tanulságos röviden megismerkedni a
kemoterápiai kutatás jelentősebb eredményeivel. Az Ehrlich által vezetett kutatócsoportnak (1909-ben Nobel-
díj) az akkor népbetegségnek tekinthető igen súlyos következményekkel járó, Treponema pallidum okozta
vérbaj (syphilis, lues) gyógyítására sikerült gyógyszert találni. Az Ehrlich-O. Hata 606 jelzésű, később Salvarsan
néven forgalomba került vegyületük aromás arzénszármazék. A kevéssé toxikus készítmény csak in vivo mutat
biológiai aktivitást. A gazdaszervezetben végbemenő oxidációval felszabaduló biológiailag aktív aromás arzén
származék, a piroszőlő savból induló acetil-CoA szintézishez szükséges liponsavval reagál. A liponsav hiánya az
egész ciklust blokkolva akadályozza a Treponema életműködését-

Liponsav felesleggel egyébként a gátló hatás felfüggeszthető.

6
A kemoterápiás kutatás jelentős eredménye volt a harmincas
években a szulfonamidok felfedezése. A Mietzsch és Klarer
által szintetizált prontosil biológiai hatását Domagk 1935-ben
írta le. Ez a vegyület in vitro ugyancsak inaktív. A
gazdaszervezetben alakul olyan hatásos vegyületté (p-amino-
benzol-szulfonamid), amely a Streptococcus okozta fertőzések
gyors leküzdésére sikerrel használható.
A szulfonamidok vérszintjének alakulását, a vérminták
hatóanyagtartalmát analitikai méréssel vizsgálják. Kiürülésük a vesén keresztül egyrészt változatlan alakban,
másrészt acilezett formában vagy glükuronidként történhet. A metabolitok természetesen a kiürülés
szempontjából előnyösebb helyzetben vannak.
A képződő p-amino-benzolszulfonamid, mint p-amino-benzoesav (PAB) analóg, a fólsav szintézis gátlásán
keresztül zavart okoz a kórokozó anyagcseréjében, reagál a dihidrofólsav egyik alkotórészével, a
dihidropteridinnel. A képződő származék dihidropteridin-hiányt okozva végül is fólsav hiányt eredményez. Az
emlős szervezetben ez az enzimreakció nem fordul elő. A szulfonamid csak a baktériumok anyagcseréjében okoz
zavart, az emlős sejtet nem károsítja. A hazai gyógyszerpiacon a vegyület metiltiazol származéka ultraseptyl
néven terjedt el. Az antibiotikumok elterjedése előtt a bakteriális fertőzés elleni küzdelem egyetlen, de igen
hatásos fegyvereként tartották számon.
A klinikai gyakorlatban 20-25 szulfonamid készítményt
használnak. Ezek két csoportba sorolhatók. Az egyik csoportot alkotják a
bélből nehezen felszívódó származékok, amelyeket bélfertőtlenítésre
használnak. Ílyen a hazai piacon elterjedt sulfaguanidin. A másik csoportot
alkotják a vízben jól oldódó, bélből felszívódó, nyújtott hatású
készítmények. Ezek lassú kiürülésük miatt viszonylag tartósan hatásos
vérszintet biztosítanak még napi egyszeri per os adagolás esetén is. Ilyen a
több hazai szulfonamid készítményben alkalmazásra került 3-szulfa-5-
metil-izoxazol származék.
A szulfonamidok bakterium spektruma meglehetősen széles.
Gram-pozitív és Gram-negatív mikroorganizmusokon kívül az
Actinomyces, Toxoplasma és Coccidium fajok, valamint a Plasmodium
malariae ellen is felhasználhatók, sőt néhány Rickettsia szaporodását is
gátolja (Trachoma, Lymphogranuloma psittacosis, Lymphocyticus chorio-
meningitis). Gyenge hatású viszont az Escherichia, Pseudomonas, Proteus,
Klebsiella, Brucella, Aerobacter fajokkal szemben. A szulfonamidokkal
szemben is kialakulhat rezisztencia egyrészt a p-amino-benzoesav szintézis
fokozódása útján, de gyakoribb oka a rezisztenciának a permeabilitási
körülmények változása. Ezért nem előnyös alacsony dózisban adagolni a
szulfonamid készítményeket.
A forgalomba kerülő gyógyszerek hatásmechanizmusának részletes biokémiai vizsgálata, és a
céltudatos kemoterápiai kutatás szép eredményeket hozott.

Jó példa erre a trimetoprim, a 2,4-diamino-5(3,4,5-trimetoxi-benzil)-pirimidin előállítása és biológiai
hatásának a felismerése. Hasonló hatású rokon vegyület a pyrimetamin, a 2,4-diamino-5(p-klórfenil)-6-etil-
pirimidin. Mindkét pirimidin származék a szulfonamidokkal együtt adva azok hatását jelentősen fokozza
(potencirozza). Általában szulfonamidokkal kombinálva alkalmazzák. Ilyen készítmény a sumetrolim.
prontosil


7
Szerkezete bizonyos mértékig hasonlít a pteridin szerkezetéhez, így nem meglepő, hogy a szulfonamid fólsav
szintézist zavaró hatását fokozni tudja a szintézist végző enzimek működésének gátlásával. A dihidrofólsav
reduktázt gátolva megakadályozza a tetrahidrofólsav képződését. Ez az enzim nem csak a baktériumokban, de az
emlős szervezetben is fontos szerepet tölt be. A trimetoprim tehát a gazdaszervezetet is károsítja.


Századunk közepén két kemoterápiás szer vált népszerűvé hazánkban. Mindkettő a tuberkulózis elleni
küzdelemben került felhasználásra. Az egyik az 1946-ban felfedezett p-amino-szalicilsav (PAS) mint PAB
analóg. A másik pedig az 1951-ben felfedezett baktericid tulajdonságú izonikotinsav-hidrazid (INH), amelynek
szerkezete hasonlít a piridoxaminhoz, illetve a nikotinsavamidhoz. Feltételezhetően mindkét vitaminjellegű
vegyület élettani hatását zavarja.


Széles spektrumú kinolon származékok közül emlitésre érdemes a vízben jól oldódó pefloxacin (1-etil-6-fluoro-
7-/4-metil-1-piperazinil/4-oxo-1,4-dihidro-3-kinolinkarbonsav moltömege: 465.5), amely tabletta és injekciós
formában adagolható. Jellemző rá a posztantibiotikus hatás.Az antibiotikum /400 mg hatóanyagot tartalmazó
tabletta/ 8-10 óra alatt bekövetkező kiürülése után még néhány órán keresztül a kezelést esetleg túlélt
baktériumok sem képesek növekedni. A
hatóanyag a baktericid hatást az RNS magra
feltekeredett DNS fellazítását végző giráz
működését gátolva fejti ki. Szepszis,
szívbelhártya és agyhártya gyulladás esetén is
hatásos. A hatóanyagnak a szervekben illetve
a szövetekben kialakuló koncentrációját a
következő oldalon található ábra szemlélteti.
Hasonló hatású a nalidix-sav.






Pefloxacin

Nalidix sav
8

A piperazinil-kinolin-karbonsav hatóanyagnak a szervekben illetve a szövetekben kialakuló koncentrációja






9

AZ ANTIBIOTIKUMOK (SZEKUNDER METABOLITOK) BIOLÓGIAI-KÉMIÁJA
A PENICILLIN FELFEDEZÉSE
A penicillint felfedező orvos - Alexander Fleming - doktori disszertációját a magasabb rendűek által védekező
anyagként termelt lizozim tulajdonságait vizsgálva készítette. Ez az enzim folytonosan termelődve az élőlény
felületére került baktériumok sejtfalát feloldja, a sejtfal szénhidrát építőelemei közötti |-glikozidos kötést
hidrolizálja. A baktériumtenyészet penész hatására bekövetkező feloldódását látva, valamint a hatásos anyag hő
és pH érzékenységét tapasztalva, Fleming valami lizozimhoz hasonló anyagra gondolt.
A munkába kapcsolódó Dr. C. Thom mikológus rendszertanilag Penicillium notatum-mal, egy ritkán
előforduló fajjal azonosítja az antibakteriális hatást mutató anyagot termelő fonalas gombát. Az antibakteriális
tulajdonságú hatásos anyag kinyerése céljából végzett eredménytelen kísérleti munka után, 1932-ben
Clutterbuck csak annyit közölhetett, hogy a penicillinnek elnevezett hatásos anyag labilis, pH és hő érzékeny
gyenge sav. Az anyag hatásossága és elhanyagolhatóan csekély toxicitása azonban nem hagyta feledésbe merülni
Fleming felfedezését, bár a nehézségeket látva maga sem bízott a sikerben. Az 1930-as évek végén csupán a
tenyészet szűrletét javasolhatta külsődleges alkalmazásra. Az Oxfordban összekovácsolódott munkacsoport
kitartó munkája, Chain és Florey erőfeszítései végül eredményre vezettek. Felületi tenyészetből elkülönített
tenyészléből fagyasztva szárítva sikerült kielégítő stabilitású barna port nyerni, amellyel Abraham és
munkatársai már bizonyíthatták az anyagnak a szeptikus folyamatok leküzdésében elért fantasztikusnak tűnő
gyógyító hatását. Tiszta anyaggal nem rendelkezve, biológiai egységet használtak összehasonlítási alapként.
Oxford-egységnek (NE) tekintették azt a legkisebb penicillin mennyiséget, amely egy bizonyos Staphylococcus
törzs növekedését 50 ml táptalajban képes gátolni. Ez ma o.6 mg kristályos benzilpenicillin Na-sónak felel meg.
Fleming 1940 november 14.-én a Gyógyszerészeti Társaság tudományos űlésén számolt be az
eredményekről. Ezekkel az eredményekkel indult 1941 júliusában Florey és Heatley az Egyesült Államokba a
kormány anyagi támogatását kérni az eredmények továbbfejlesztéséhez. A kormányszervek felismerték a téma
katonai jelentőségét.(Az első világháborúban megsebesült katonák több mint 50%-a szepszisben halt meg!) A
Pentagon a Northern Regional Research Laboratory (Peoria Illinois) fermentációs osztályán R. D. Coghill és A.
N. Richards mikrobiológusokat bízta meg a téma vitelével.
A termelő törzsek kiválasztásában az USA lakosságának a segítségét is igénybe vették. Közhasznú
hazafias tevékenységgé vált a különböző helyekről származó gombatenyészetek eljuttatása a Mezőgazdasági
Minisztérium által fenntartott NRRL törzsgyűjteményébe, ahol szorgalmas munkával minden tenyészet biológiai
aktivitását megvizsgálták. Az összegyűjtött törzsek közül egy háziasszony által beküldött grép fruitról származó
Penicillium notatum chrysogenum néven leírt tenyészet - a Fleming által izoláltnál 10-szer nagyobb biológiai
aktivitást mutatott. Később (feltehetőleg szabadalmi okokból) a notatum előnév lemaradt. Ebből az izolátumból
fejlesztették ki a gyógyszeripar fermentációs üzemeiben felhasználásra kerülő törzseket.
Kezdetben négy gyógyszergyártó vállalat (Pfizer, Lederle, Merck, Squibb) és több kutató laboratórium,
(Carnegie Institute, University of Minnesota, University of Wisconsin) kapcsolódott a munkába. A katonai
titoktartás szabályait betartó együttműködés a különböző kutatóhelyek között tökéletes volt, A
hadügyminisztérium szakemberei ezt az életmentőnek tűnő anyagot minél előbb a szövetséges hatalmak
katonakórházaiba kívánták juttatni. Az anyagi és a szellemi erőfeszítés hamarosan eredményt hozott. 1943
májusában az új gyógyszert már 300 sebesült esetében alkalmazhatták teljes sikerrel a szepszis kialakulásának
akadályozására, illetve gyógyítására. A katonai költségvetés a háború utolsó éveiben 30 millió dollárral
támogatta a program sikerét.
A munkában résztvevő kutatóhelyek száma közben 20-ra növekedett. A heti penicillin termelés 1943
végére elérte a 100 grammot (100 ezer NE penicillin akkor 20 dollárba került, ez ma 1 milliárd NE ára). A
fejlődés ütemét jól mutatja, hogy 1944 végére a havi termelés meghaladta a 200 kg-ot, amely 1946-ban évi 32
tonnára emelkedett.
Az első felhasználásra került termék mindössze 1% hatóanyagot tartalmazott. A tisztításban való
előrehaladás a kémiai szerkezet felderítésének lehetőségét jelentette. Abban reménykedtek, hogy a kémiai
szerkezet ismeretében a hatóanyag kémiai szintézisére lehetőséget találnak. A szerkezetkutatásban l944-ben már
59 kutatóhely vett részt teljes katonai titoktartás mellett. Ma már köztudott, hogy kutató munkát az zavarta, hogy
a különböző laboratóriumokban előállított gombatenyészetek szűrletei több mint 20 különféle penicillin
keverékét tartalmazták, amelyeket az angol alphabet betüivel jelöltek..
Az USA laboratóriumaiban előállított penicillin készítményeknek a fizikai-kémiai adatai jelentős
mértékben eltértek az Angliában, szeszgyártási maradékon előállított készítmények vizsgálatakor nyert
adatoktól. Az egyik esetben G-penicillin (benzil-penicillin), a másik esetben F-penicillin (pentenil-penicillin)
volt a főtermék. Angliában a szeszgyártás maradékát (distillers solubl) használták táptalajként, az US kutatói
viszont a fenilecetsavat is tartalmazó kukorica áztató lé tejsavas erjesztéssel dúsított koncentrátumát alkalmazták
a táptalaj nitrogén forrásaként. A tenyésztő táptalaj kémiai összetételének meghatározó jelentőségét felismerve
javasolták a prekurzorok alkalmazását. A tápközeghez adott fenilecetsav jelenlétében a kutató
laboratóriumokban főleg benzil-penicillin képződött a tenyésztési ciklus második fázisában.
10
A második világháború után a penicillin előállításával a gyógyítás történetében új korszak kezdődött.
Az orvosi gyakorlatban, a fertőző betegségek elleni küzdelemben addig nem tapasztalt forradalmi fejlődést
jelentett az antibiotikumok megjelenése. Széleskörű gyógyászati alkalmazásuk az átlagéletkor
meghosszabbodását jelentette. A genetikailag megalapozott egyéni különbségek, az öröklött ellenálló képesség
szintjében jelentkező eltérés szelekciós hatása csökkent. Addig ritkábban előforduló halált okozó
megbetegedések ennek következtében előtérbe kerültek (rák, keringési problémák). A gyermekhalandóság
csökkenése, a szeptikus folyamatok kialakulásának megakadályozása, a fertőző betegségek leküzdése a lakosság
életkori összetételét jelentősen megváltoztatta. Nem csekély mértékben az antibiotikumok használatának
terjedése is hozzájárul a Föld népességének ugrásszerű növekedéséhez. Áttételesen a társadalmi átalakulásokra
is hatással van. Hagyománytiszteletből antibiotikumnak nevezzük azokat a mikro-organizmusok életműködését
gátló vegyületeket, amelyeket mikroorganizmusok termelnek. E vegyületek utáni kutatás és a kiválasztott
vegyületek nagyipari előállítása a gyógyszeripar legdinamikusabban fejlődő ágát teremtette meg.
Az antibiózis fogalma a biológiában régóta ismert, mint a szimbiózis ellentéte. A kifejezést először
Vuillemin használta 1889-ben megjelent dolgozatában. Évezredes hagyomány és gyakorlati tapasztalat a
tejsavas erjedés tartósító szerepének használata. A tejsav azonban nem tekinthető antibiotikumnak, mert
elsősorban a közeg hidrogén ion koncentrációjának megváltozása — a kialakított savanyú élettér — akadályozza
más mikroorganizmusok elszaporodását.
Időszámításunk előtt 5-600 évvel készült kínai feljegyzések említik, hogy szójababon nőtt gombák
nedvével furunkulusok, gennyes fertőzések leküzdhetők. A tudománytörténet Roberts 1870-ben közzétett
dolgozatát tekinti az első antibiózisra utaló híradásnak. Leírja, hogy Penicillium glaucum tenyészetében nem
növekednek a baktériumok. Később Tyndall közli, hogy bizonyos zöld színanyagot termelő baktériumok más
idegen mikroorganizmusok szaporodását gátolva, képesek leküzdeni azokat. Joubert és Pasteur 1877-ben
bejelenti, hogy apatogén mikroorganizmusokkal le tudják küzdeni a lépfene fertőzést. Pasteur dolgozatában a
jövőt sejtve megállapítja, hogy ez a jelenség nagy reményekre jogosítja a gyógyászat művelőit.
A szorgalmas kutatómunka ellenére több mint 50 év telik el Alexander Fleming (1881-1955) a St. Mary
kórház bakterológusának 1929-ben megjelent dolgozatáig, amelyben leírja, hogy a Staphylococcus növekedését
gátolva a tenyészet lízisét okozza egy levegőből származó penész által kiválasztott ismeretlen vegyület. Ilyen
jelenséget valószínűleg több klinikai laboratóriumban észleltek már ezt megelőzőleg is, sőt közlésre is került
több esetben mint figyelemreméltó tapasztalat, mégsem lett belőle piacképes termék. Több szerencsés
körülmény összjátéka indította el az antibiotikum ipar fejlődését.

A PENICILLIN GYÓGYÁSZATI SIKERE
AZ ANTIBIOTIKUMOK MEGJELENÉSE A TERÁPIÁBAN
Közel tíz év telik el a penész által termelt vegyület — a penicillin — első parenterális gyógyászati
alkalmazásáig. Ettől az időponttól ugrásszerű a fejlődés. Mi volt vajon a kezdeti sikertelenség oka? Nem más,
mint az, hogy a kémiai tevékenység modern módszerei, a kis mennyiségű anyagok ma már megoldott tisztítási
eljárásai az időben ismeretlenek voltak, illetve még gyermekcipőben jártak. Nem utolsó sorban éppen a
biológiailag aktív anyagok tisztítására való törekvés volt a serkentője e mikrokémiai módszerek fejlesztésének.
Ezen időszakban a kutató kapacitás jelentős részét világszerte a szép eredményekkel dicsekvő (salvarzán,
prontozil stb.) kemoterápia gyógyszeripar által támogatott fejlesztése vonta el. Ezek az évtizedek az antibiotikum
kutatás szempontjából is haszonnal jártak, amennyiben ebben az időszakban a kemoterápiai módszerek
tökéletesedésével egy új gondolkodásmód terjedt el a fertőzéses megbetegedések leküzdése területén. Tüneti
kezelés helyett a kórokozó elpusztítására törekedtek a gazdaszervezet károsítása nélkül. Az elmúlt félszázadban
felfedezett hatásos vegyületek száma meghaladja a tízezret, a gyógyászati alkalmazásra került antibiotikumok
száma azonban alig éri el a százat. Biológiai szempontból a rendszertani csoportokra kifejtett hatásuk szerint
oszthatjuk be őket baktérium ellenes, gomba ellenes, antivirális és citosztatikus hatású anyagokra.
Hatásmód szerint megkülönböztethetünk: baktérium sejtfalszintézist gátló,
membránkárosító,
fehérjeszintézist gátló,
DNS képződést gátló,
RNS szintézist akadályozó vegyületeket.
Kémiai szerkezet szerint megkülönböztethetők az azetidinon ( |-laktám) szerkezetű antibiotikumok,
aminoglikozidok, tetraciklinek, makrolidok, ansa-láncúak, oligopeptidek, antraciklinek, poliéterek,
spirolaktonok, ciklopentano-perhidrofenantrén vázúak, poliének, poliketid vázból épülők, antimetabolitok
(anyagcsere köztestermékek, nukleotidok és aminosavak analógjai), poliének, stb. A kémiailag jelentős
mértékben különböző vegyületek hatásmechanizmusa, de felhasználási módjuk is eltérő. Az antibiotikumokat
termelő mikroorganizmusok rendszertani helye sem segít a csoportosításban. Képződésüket nem tekinthetjük faji
jellegzetességnek, inkább anyagcseretípustól függő lehetőségnek. ß-laktám csoportot tartalmazó
antibiotikumokat termelnek a prokariota törzsek és az eukariota tömlős gombák.
11

A ß-LAKTÁM SZERKEZETŰ ANTIBIOTIKUMOK BIOLÓGIAI-KÉMIÁJA

A penicillin molekula krisztallográfiás analízissel igazolt szerkezete 1945-ben vált ismertté Crowfoot és
Low munkáiból. A benzil-penicillin, - más néven G-penicillin - D-valinból és L-ciszteinből álló penám alapvázát
fenilecetsav acilezi. A tiazolidin gyűrűvel anellált négytagú, igen labilis |-laktám szerkezet sav, lúg és oxigén
érzékenysége jelentette a szerkezet felderítés fő nehézségét. .A három királis szénatom (vastagítva) pedig a
gazdaságos totálszintézis reménytelenségét.

A PENICILLIN KÉMIAI SZERKEZETE ÉS BOMLÁSI FOLYAMATAI VIZES KÖZEGBEN

= R H H CH
3

: : |
R-CH
2
-CO-NH-C----C—S—C-CH
3
| | |
O=C----N--------C-H


:
COOH
H2O H2O
OH
--
H
+

H H CH3 CH3
R-CH2-CO-NH-C----C—S—C—CH3 R-CH2-CO-NH-CH-CHO HS-C-CH3
| | | COOH H-C-NH2
HOOC HN÷÷÷÷C-H COOH
COOH
Penicillo-sav Penald-sav Penicillamin
CO2 CO2

H CH3
R-CH2-CO-NH-CH2---C—S—C-CH3 R-CH2-CO-NH-CH2-CHO
| | Penilloaldehid
H-N------C-H
COOH
Penillo-sav H2O H
+

CH3
|
HOOC—CH----CH—S—C--CH3
| | | penill-sav
N N----------C-H
\\ / :
C COOH
|
R—CH2

Savanyú kémiai kezeléssel a penaldsav mellett az úgynevezett penicillamin (dimetil-cisztein) különíthető el mint
hidrolízis termék. Lúgos körülmények között penicillosav képződik. A penicillosav dekarboxilezésével
penillosavhoz, a penaldsav dekarboxilezésével pedig penilloaldehidhez jutunk. Savanyú körülmények között egy
intramolekuláris átrendeződéssel penillsav képződik. A laktám gyűrű felnyílása a biológiai hatás elvesztésével
jár. A molekulában található három királis (vastagítva) szénatom azidőtájt reménytelenné tette a gazdaságos
kémiai szintézist. A fejlesztési igény kielégítése elsősorban a mikológusok eredményes genetikai
tevékenységétől volt várható

A penicillin szerkezetének felderítése után a biológusok az acilező sav (prekurzor) változtatásával
igyekeztek a G-penicillinnél előnyösebb tulajdonságú származékot nyerni. Itt azonban a bioszintézist végző
Penicillium törzs enzimrendszerének specifitása behatárolta lehetőségeiket. A kipróbálásra került több mint ezer
acilező sav közül alig száz esetben igazolták a prekurzor beépülését. Az előállított új származékok
baktériumspektruma és penicillinázzal szembeni érzékenysége nem különbözött a gyógyszerként ma is
forgalomban levő fenilecetsav származéktól, a G-penicillintől. Kiemelkedő savstabilitására való tekintettel
csupán egyetlen új termék aratott sikert, a fenoxiecetsav származék, amely szabad savként a gyomorsav
hatásának ellenállva tabletta formájában tartósan adagolható gyógyszerként növelte a penicillin népszerűségét.


12
A fermentlében talált, addig betüvel jelölt Gram-pozitív mikroszervezetek ellen eltérő mértékben
hatásos fontosabb penicillinek kémiai szerkezete is közlésre került.

Penicillin BT penám-CO-CH
2
-S-CH
2
-CH
2
-CH
2
-CH
3

Penicillin O penám-CO-CH
2
-S-CH
2
-CH=CH
2

Penicillin F penám-CO-CH
2
-CH=CH-CH
2
-CH
3

Flavicidin penám-CO-CH
2
-CH
2
-CH=CH-CH
3

Penicillin K penám-CO-CH
2
-CH
2
-CH
2
-CH
2
-CH
2
-CH
2
-CH
3

Dihidro-penicillin F penám-CO-CH
2
-CH
2
-CH
2
-CH
2
-CH
3

Penicillin N penám-CO-CH
2
-CH
2
-CH
2
-CHNH
2
-COOH
H
Penicillin G penám-CO-C---
H
H
Penicillin X penám-CO-C--- ---OH
H
H
Penicillin V penám-CO-C—O—
H

CH
3
H H
| : :
H
3
C-C---S---C---C—NH
2

|

|

|
penám = 6-aminopenicillansav H-C-------N----C=O
:
COOH

A penicillin kémiai analitikai meghatározása is a laktám gyűrű labilitását hasznosítja. A jodometriás
módszer alapja az, hogy az ép penicillin molekula nem köt jódot, a lúgos hidrolízis termék, a penicillosav
viszont 7-8 atom jódot köt. Ez lehetőséget adott a penicillin jodometriás meghatározására. A hidrolízis nélkül
mért aspecifikus jód kötés és a lúgos kezeléssel hidrolizált minta jódkötése közötti érték arányos a |-laktám
szerkezetű vegyület mennyiségével.

A másik eljárás azt a tényt hasznosítja, hogy a penám váz jól reagál hidroxilaminnal. A képződő
hidroxamát vaskomplexe kolorimetriás meghatározásra ad lehetőséget.
H H CH
3


: : |
R—CO—HN--- C-------C----S-----C---CH
3

Penicillin + HO-NH
2
. HCl | | |
HO---HN----C=O HN----------C---H
:
COOH

ÚJABB |-LAKTÁM SZERKEZETŰ BIOLÓGIAILAG AKTÍV METABOLITOK FELFEDEZÉSE

Hamarosan új vegyületcsoportot a carbapenemeket fedezték fel egymástól függetlenül a Merck és a
Beecham kutatói, a Streptomyces fajok által termelt thienamycineket. Ez esetben a kén atom nem az anellált
gyűrűben, hanem tioetanolamin származékként tioéter kötésben található. (Streptomyces clavuligerus, S
olivaceus, Erwinia carotovora, Serratia sp.)
.
CH3 Tienamicinek szerkezeti képlete
|
HO-C-H H O CH3 H H
: : || | : :
H—C-------C ------- CH2 HO—S—O—C------C-----C---------CH2 H H
| | | || | | | | | |
O=C--------N---C== C—S—CH2--CH2--NH2 O H O=C-----N---C==C--S--C=C---N---C---CH3
| | | ||
COOH COOH H O




13
Ugyancsak Streptomyces törzsek termelik a. Merck és az Eli Lilly kutatói által felfedezett cefamicineket. A
Streptomyces clavuligerus, törzsek által termelt cefamicin származékok különlegessége a 7-o-metoxi csoport
megjelenése és az oximetil csoport hiánya, illetve karbamoilezettsége.

CH
3

|
NH
2
H H H O H O H
| | | | || |

: :
HOOC----C----C----C----C----C----N-----C------C-----S-----CH
2
O
| | |

| | | | ||
H H H H O= C------N-----C===C---CH
2
--O--C---NH
2

|
Cephamycin szerkezete O=C÷OH

A Beecham Laboratórium kutatói által vizsgált Streptomyces clavuligerus tenyészlevében egy
clavulansavnak elnevezett vegyületet izoláltak. Ez a vegyület a tiazolidin gyűrű helyett oxazolidin gyűrűt
tartalmaz. A kén helyett oxigént tartalmazó alapváz acilező aktivitása fokozott mértékű. A C
6
szubsztituens
hiánya miatt antibakteriális hatást ugyan nem mutat, de a penicillináz enzimet képes inaktíválni.
A |-laktam bontásáért felelős -SH csoportot a felnyíló laktám gyürű acilezi. Ezt követőleg az oxazol
gyürű felnyílása után a reaktív oldallánc stabil tioéter kötésbe lép az enzim másik SH csoportjával. Széles
spektrumú félszintetikus penicillin származékokkal együtt adagolva penicillin rezisztens fertőzések leküzdésére
használják.

.A |-laktám szerkezetű vegyületek sikere fokozta a kutató csoportok új hatásos anyagokat kereső tevékenységét.
Azetidinon gyűrűt tartalmaznak a monolactamok. Első képviselőjüket a nocardicint Fujisava laboratóriumának a
kutatói izolálták Nocardia uniformis tsuyamanensis tenyészlevéből. A molekula p-hidroxi-fenilglicinből, annak
oximino származékából, ciszteinből és homo-szerinből ill. cisztathioninból épül fel.


A hetvenes évek végén végzett kutatómunka N-szulfonil azetidinon gyürűt tartalmazó Gram-negatív
törzsekre ható |-laktám vegyületek felfedezéséhez vezetett. Az irodalom monobaktám gyűjtőnéven tárgyalja
őket, mert baktériumok (Pseudomonas acidophila, Gluconobacter, Acetobacter, Agrobacterium radiobacter)
tenyészlevéből izolálták őket. A 3-amino-baktámsav alapváz savanyú természetét az N-szulfonsav csoport
okozza. A |-helyzetű amino-csoportot különféle savak, illetve savszármazékok acilezik. Több esetben a 3-o-
helyzetű hidrogént metoxi csoport helyettesíti.

CH
3
H H H O H H
|

| : | || |

:
O=C-------N--------C------CH
2
--CH
2
----C-----C-----N------C-----CH
2

|

| | |

|
O=C-------N NH

O=C---- N
|
SO
3
K
+
O=C÷÷CH
3
SO
3
K
+




14
Az Agrobacterium radiobacter törzs termékében az acilező sav aromás gyűrűt tartalmaz. Ezek az utóbbi
azetidinon szerkezetű antibiotikumok gyógyászati felhasználásra nem kerültek, de a megszerzett biokémiai
ismeretek termékenyítőleg hatottak az új hatóanyagok előállítását célzó kutató munkában.
15
AZETIDINON SZERKEZETÚ VEGYÜLETEK ELŐÁLLÍTÁSA — TÖRZSFEJLESZTÉS
A penicillin kémiai szerkezetének felderítése után a tématerületen dolgozó kutató csoportok számára
nyilvánvalóvá vált, hogy a totálszintézis gazdaságos megoldására nem számíthatnak. Minden erejüket a biológiai
eljárás technológiájának fejlesztésére fordították. Minden mikrobiális eljárás alapja a kitűzött feladat
megoldására (sejt-tömeg termelés, enzim termelés, primer vagy szekunder metabolit termelés) kiválasztott illetve
genetikai munkával fejlesztett olyan baktérium vagy gomba törzs amely biokémiai tulajdonságát hosszabb időn
át képes megőrizni. Az eljárás kivitelezéséhez szükséges a környezettől elválasztott olyan aszeptikus
körülményeket biztosító reakciótér, amely hatékony hűtő és fűtő rendszerrel rendelkezve a sterilezés és a
hőmérséklet tartás feladatát biztonsággal megoldja. Változtatható hatékonysággal működő keverő elemei az
anyagátadást elősegítik. Műszerezettség szempontjából a belső nyomás a pH, az oldott oxigén és széndioxid
koncentráció beállított értéken való tartására alkalmas. A reakció elegy összetételében bekövetkező változások
mérése és az adatok rögzítése alapvető jelentőségű. A magas színvonalú technológia kialakítása igényli a
mikroszervezet anyagcsere rendszerének ismeretét, a mikrobiális feladat megoldásában szerepet játszó enzimek
közötti élettani, funkcionális kapcsolat felderítését.
A természeti környezetünk kialakulásának evolúciós szemlélete szerint a rendszer fennmaradásában a
természetes kiválogatódás érvényesül. A gazdaságosabb anyagcseréjű egyed győzedelmeskedik. Ennek
szellemében nem várható, hogy természetes élőhelyén bármely organizmus fölös mennyiségben állítson elő
valamilyen számunkra hasznos terméket. Nyilvánvaló, hogy a létért folytatott küzdelemben ez az improduktív
tevékenység hátrányos helyzetbe juttatná a kiválasztott törzset. Természetes élőhelyén az anyagcsere
szabályozott volta biztosítja a leggazdaságosabb életvitelt a mikroszervezet számára. Az ipari alkalmazáskor
kialakított technológia valójában az évmilliók alatt kialakult szabályozási mechanizmus félrevezetésével, adott
esetben kikapcsolásával éri el a gazdaságos termelés körülményeit.
A negyvenes évek elején a fonalas gombák által termelt anyagok nagyipari előállítása közismert volt a
biomérnökök előtt. Az Aspergillus niger tenyészlevéből elkülöníthető citromsav nagyipari méretben folyó
előállítása évtizedek óta évi több ezer tonnás tételt jelentett. Formalinnal és gőzzel sterilizálható helységekben
elhelyezett 2x5 méteres saválló acélból készített tálcákban töltött 10-15 cm-es folyékony táptalaj felszínén
növekedett a gomba micélium tömege. Aszeptikus körülmények között a tápközeg felületén fejlődő micélium
tömeg a táptalaj glükóz tartalmát 25-30%-os hatásfokkal alakította át citromsavvá. Ez a primer metabolit a
micéliumtömeg (réteg) alól elválasztott tenyészléből könnyen kinyerhető volt. Kezdetben a penicillin termelésre
is ezt a technológiát alkalmazták. Különbség volt a hasznos termék koncentrációjában. A citromsav 100 g/l
koncentrációban képződött savanyú körülmények között, a penicillin viszont alig haladta meg a 0,1 g/l értéket
semleges körüli környezetben. Ez lényeges különbséget jelentett. A citromsavat termelő felületi tenyészetet
bakteriális fertőzés ellen jól védte a savanyú kémhatás. A semleges körüli pH tartományban termelődő penicillin
viszont nem volt képes megvédeni a gombatenyészetet a gyakran jelentkező bakteriális eredetű fertőzésektől. A
megjelenő baktériumok a penicillint általában elbontották.
Nyilvánvaló volt mindenki számára, hogy a technológiai folyamatban alkalmazható döntő áttörés nélkül
a termék nem számíthat piaci sikerre. A fejlesztési munkákat a technológia jellegéből adódóan genetikai és
technológiai tevékenységre csoportosíthatjuk. A két irány egymással állandó kapcsolatban levő kutató-fejlesztő
munkát jelentett és jelent ma is. Egy-egy új jobban termelő mutáns fermentációs körülményeinek optimalizálása
az előállítási technológia módosítását igényelte. A felületi tenyésztést hamarosan felváltotta a sűlyesztett
körülmények között végzett eljárás. A keverővel ellátott sterilizálható edényekben elhelyezett tenyészet
oxigénellátását sterilre szűrt levegő befúvásával oldották meg. Ez nem csekély feladatot jelentett a habzás miatt,
amit habgátló anyagok adagolásával lehetett mérsékelni. Az oxigénellátást javító keverést a fonalas szerkezetű
micélium tömeg növekedésével járó viszkozitásváltozás nehezítette. A genetikai munkákban a szelekciós
tevékenység mellett a mutagén kezelés is korán alkalmazásra került. A törzsfejlesztéshez felhasznált mutagének
(diepoxibután, etilmetánszulfonát, etilénimin, metil-bis-(|-kloretil)amin, N-metil-N’-nitro-N-nitroso-guanidin,
UV-, X-, ¸-sugárzás.) hatására a törzs termelőképessége több százszorosra növekedett. A felületi kultúrában 200
E penicillint termelő törzs röntgen sugárral kezelt túlélői, amilyen például a Carnegie Intézetben előállított X-
1612 jelű mutáns már 450E penicillin termelésére volt képes. A Wisconsin egyetemen előállított Q 176 jelű
mutáns termelése elérte a 780 E értéket. 1946-ban a Wis-51-20 mutáns 1520 E termeléssel került az élre.
Egyébként ez a törzs került ipari felhasználásra hazánkban is az ötvenes évek elején. A táblázat néhány
fejlesztéssel foglalkozó laboratóriumban végzett tevékenység vázlatát mutatja megjelölve az alkalmazott
klasszikusnak tekinthető genetikai eljárást. A legjobb mutánsok termelési értéke ma meghaladja az 50000 E/ml
értéket. Ez a mennyiség a tenyészet száraz micélium tömegének többszöröse. Nyilvánvaló, hogy ez a gomba
számára haszontalan többlettermelés csak szigorúan meghatározott körülmények között valósul meg és ahhoz
sem férhet kétség, hogy ezzel a túltermeléssel terhelt mutáns a létért való küzdelemben alul marad a környezet
energiaforrásait gazdaságosabban hasznosító, penicillint alig termelő vad törzzsel szemben. Ezért nem kis feladat
a jól termelő törzs termelőképességét meghatározó biokémiai tulajdonságok megőrzése. Nagyipari termelésre
csak olyan mutáns alkalmas, amelyik változatlan körülmények között hosszú ideig képes termelőképességét
megőrizni. Az üzemek mikrobiológusainak fő feladata a magas termelőképességű oltóanyag előállítása.
16
A legjobban termelő törzs kiválasztása egyspóra tenyészet (klon) termelőképességének
meghatározásával kezdődik. A vizsgálandó, mutagén kezelést túlélő higitott spóra-szuszpenziót szélesztik agar
táptalajra, hogy a kifejlődő telepek egymástól elkülönülve növekedjenek. A kifejlett telepekről nyert spóra
szuszpenzióval rázó lombikban elkészített termelő táptalajt oltanak, illetve törzsfenntartásra szolgáló szaporító
felületet, például köles szemeket. Rázott tenyészetben vizsgálják az izolátumokra jellemző antibiotikum
képződés sebességét. A legjobban termelő változat biokémiai tulajdonságának stabilitását ismételt szélesztéssel
és termelőképesség vizsgálattal igazolják. A kísérleti eredmények a törzs specifikus termelőképességére jellemző
adatokat szolgáltatnajk a sejttömeg és az idő függvényében.

Négy fejlesztő laboratórium törzsnemesítő tevékenysége a törzsjelzés feltüntetésével.
Penicillium chrysogenum NRRL 1951
Peoria Illinois S
NRRL 1951-B-25
Carnegie Institute Univ.Minnesota X
X 1612
U
Wis Q 176
UV-1
Wis BL 3DIO
| S

47-636 47-650 47-638 47-762 47-911
S S S S
47-1327 47-1380 47-1564 47-1040
S S
S 48-701 48-7865
47-749 S UV-1
NM 48-1655 48-1372
49-2166 S UV-1
NM 49-482 49-901
50-25 S UV-1
NM 49-2695 49-2429
50-935 S UV-1
NM 50-529 50-724
51-70 S UV-1
NM 50-1247 50-1583
51-20 S UV-1
U S S 51-616 51-825
M-5 E-1 52-318 51-20 S UV-1
U X NG S S 51-1113 S 52-8
M-30 E-2 E-3 52-1087 F-3 53-533 UV-1
U NG S S 52-817
M-58 E-4 53-399 F-3-64 UV-1
U NG S 53-174
M-73 E-5 E-6 53-1162 UV-1 UV-1
DEB NG 54-1255 53-844
M-88 E-7 E-8 (AS-P-78 v. P-2) UV-1
NG | 54-912
E-9 V-116
NG |
E-10 C-59-314 (P-6)
NG |
NG E-12 4E-184
E-11 SA NG |
1639 E-13 29 5E-119
NG NG |
16534 E-14 6E-369 (P-9)
NG NG 29/163 |
15259 E-15 7E-408
S |
E-15-1 8E-10 (P-11)
|
9E-10 (P-14)
Wyeth Lab. Eli Lilly Indianapolis Panlabs Seattle Univ.Wisconsin Madison
West Chester
Alkalmazott módszerek: S= szelekció, X = röntgenbesugárzás, UV= ultraibolya kezelés,
M= metil-bis(|-kloretil)amin, NG = nitrozo-guanidin, NM = nitrogénmustár

Az egymást követő mutagén kezelés természetesen nem csak a termelőképesség megváltozásával jár. A
kezdetben fonalasan növekedő micélium tömegből célszerűségi okokból azokat a jól termelő variánsokat
választották ki, amelyek rövid lekerekedő formában - pelletet képezve - növekedtek. Ezek az alakok sűlyesztett
körülmények között 1-2 mm átmérőjű kompakt gömbszerű telepecskéket alkotnak. Ez a növekedési forma a
17
specifikus termelőképesség szempontjából is előnyös, mert a térfogategységben megjelenő micélium tömeg
mennyisége nagyobb. A golyócskákból álló tenyészet jól keverhető és levegőztethető. (A fonalas sűrű
micéliumtömeg oxigén-ellátása technikai okok miatt nem oldható meg.) Az ipari szempontból kinemesített
variánsok csak a növekedés kezdetén, a spórából csírázva jelennek meg laza, fonalas formában, de ez a
növekedési szakasz sem emlékeztet a vad törzs hosszú sima, enyhén elágazó micéliumára, hanem hajlott
göcsörtös, artrospóraszerű, néha elágazó formát mutat.
Fleming felfedezését követően hosszabb ideig úgy vélték, hogy a penám váz szintézisére csak a
Penicillium nemzetség néhány faja jöhet számításba. A század második felében végzett kiterjedt vizsgálatok
megerősítették, hogy a bioszintetizáló rendszer számos nemzetségben előfordul, sőt a molekuláris biológiai
vizsgálatok a gén prokariota eredetére utalnak Közel húsz év telik el Fleming emlékezetes bejelentése után a
második |-laktám típusú antibiotikum felfedezéséig. Brotzu 1948-ban közli, hogy egy Cephalosporium
acremonium törzs tenyészlevében igen erős széles spektrumú antibakteriális hatás észlelhető (J. Gen. Microbiol.
47:1952). A fermentlé több biológiailag aktív terméket tartalmaz. A Cepalosporin-C hatóanyagon és a 6-
aminopenicillansav D-o-aminoadipinsavval acilezett Gram-pozitív és Gram-negatív kórokozók ellen hatásos
származékán, a penicillin-N antibiotikumon kívül egy savanyú természetű szteroid vázat tartalmazó
kefalosporin-P-nek nevezett helvolinsav származék jelenlétét is bizonyították. A főtermékként megjelenő
Cephalosporin-C-nek elnevezett azetidinon származékot Abraham és Newton izolálta 1961-ben. Később a törzs
rendszertani hovatartozását végző mikológusok az antibiotikumot termelő törzset helyesen Acremonium
chrysogenum névvel különítették el a Cephalosporium fajoktól A termelő törzs nevének változása nem
befolyásolta az antibiotikum elnevezését.

NH
2
H H H O H H H
| | | |

| | | : :
HOOC----C----C----C----C----C---N----C-------C-----S-----CH
2
O
H H H H | | |



||
O=C-------N----C===C---CH
2
---O---C---CH
3

|
Cephalosporin-C szerkezeti képlete O=C÷OH

A kefém váz 7-amino csoportját D-o-aminoadipinsav acilezi. A hattagú tiazin gyűrűvel anellált |-
laktám gyűrű kémiai stabilitását a kvázi-delokalizált elektroneloszlás mezomer rendszere okozza. Ez a rendszer a
penicillináz rezisztencia magyarázata. A kémia szerkezet D-alaninhoz való hasonlósága miatt hatásmódja a
penicillinéhez hasonlóan a peptidoglükán sejtfal felépülését gátolja. A szélesebb baktérium spektrumát az acilező
sav aminocsoportja hozza. Kémiai stabilitása alkalmassá teszi különböző O-acil és 7 amino-acil származékainak
előállítására. Félszintetikus származékainak gyógyászati jelentősége az antibiotikum illetve kemoterápia sikeres
korszakát indította el.





A penicillin képződéséhez szükséges három enzim; az ACV tripeptid szintetáz (ACVS), az izopenicillin N
szintetáz (IPNS) és az izopenicillin aciltranszferáz, (IAT) jelenlétét igazolták a felsorolt gombanemzetségekben:

ASCOMYCETES (perfekt alak) DEUTEROMYCETES (imperfekt alak)
Emericella nidulans Aspergillus nidulans
Eurotium Penicillium notatum chrysogenum
Sartorya Epidermophyton
Eupenicillium Trichophyton
Talaromyces Microsporum
Carpenteles Malbranchea
Thermoascus Polypaecilum
Gymnoascus
Arthroderma
Nanizza

Az N penicillin képződéséhez szűkséges enzimek; ACV tripeptid szintetáz (ACVS), az izopenicillin N szintetáz
(IPNS), az izopenicillin epimeráz továbbá a gyűrűtágító rendszer, az expandáz, dezacetoxicephalosporin C
szintetáz valamint a befejező lépéseket katalizáló hidroxiláz, aciláz karbamoil transzferáz, és a metiltranszferáz
Jelenlétét a következő gomba törzsekben sikerült igazolni:
18

ASCOMYCETES DEUTEROMYCETES
Emericellopsis Cephalosporium acremonium
(Acremonium chrysogenum)
Byssochlamys Paecilomyces persicinus
Arachnomyces Scopulariopsis
Anixiopsis Diheterospora
Spiroidium

További vizsgálatokban több azetidinon származékot termelő pokariotát sikerült izolálni:
Streptomyces clavuligerus,
Nocardia lactamdurans,
Lysobacter lochenigenus,
Flavobacterium


A ß-laktám antibiotikumot termelő Penicillium chrysogenum törzs rendszertanilag az
Ascomycota tagozat
Euascomycia ágazat
Eurotiales rend
Eurotiaceae család
Talaromyces nemzetség
Asymetrica csoport
Velutina alcsoport
Chrysogenum sorozatba
illeszthető faj olyan nemesített
variánsa, melynek szexuális folyamata
ismeretlen.
(Önmegtermékenyítő is lehet).

Ugyanez vonatkozik a Penicillium csoportokra. 1950-óta több mint 150 új Penicillium faj került leírásra, amelyek
valójában valószinűleg az Eupenicillium és a Talaromyces fajok imperfekt alakjaiként tárgyalhatók.

A taxonómiai szempontok változását szemlélteti az Acremonium strictum esete amely a
Cephalosporium nemzetségből 1971-ben került át Gams
W munkája eredményeként az Acremonium nemzetségbe.
A konidiumok (c) csoportosan a vékony fialidok csúcsán
helyezkednek el. Az egyesével álló fialidok harántfallal
különülnek el a.konidiofórumokon (b). A konidiumok
általában egy a gomba által kiválasztott nyálkás anyag
hatásaként összetapadva maradnak. A fialidok átmérője a
konídiumnál 0,5 µm-re szűkül. Talajban, növények
maradványain gyakran előfordul.

A penám és cephem szerkezetű antibiotikumot termelő
fajuk Acremonium chrysogenum-ként ismert, holott a
Botzu által cephalosporin-C termelésre alkalmas
szervezetként izolált gombát a XX. század közepén
Cephalosporium acremonium-ként azonosították. Innen
ered az antibiotikum elnevezése.




Penicillium notatum Penicillium chrysogenum

Acremonium strictum
19

A PENÁM ÉS KEFÉM SZERKEZETŰ ANTIBIOTIKUMOK FELDÚSULÁSA A TENYÉSZETBEN

Az azetidinon szerkezetű antibiotikumok képződésének előfeltétele egyrészt, hogy a bioszintézisben
résztvevő enzimek aktív formában kellő mennyiségben jelen legyenek, másrészt, hogy az építőelemek, az L-o-
Aminoadipinsav, L-Cisztein és L-Valin az ACV-tripeptid szintetáz működéséhez szükséges koncentrációban
jelen legyenek. Ez nem elhanyagolható igény, mert egyetlen ml fermentlében felhalmozódó 100 mmol
antibiotikum (6x10
17
molekula) tömege meghaladja az őt termelő mikroszervezet száraz tömegét. A sejtben
normál esetben előforduló aminosavak mennyiségének 100-szorosa található a termelt antibiotikumban. Ezért
van jelentősége az eljárás szempontjából olyan optimális technológia kimunkálásának, amely a termelő törzs
igényeit szelektíven kielégítve, a genetikailag meghatározott potenciális lehetőséget maximális mértékben
kihasználja. (Lásd a három aminosav (A,C,V) képződését bemutató vázlatot a következő oldalon
A három aminosav közül az L-cisztein központi szerepet ellátva közvetlenül nem jelenthet limitáló
faktort az azetidinon képzésben. A glikolitikus út köztes termékéből (3-foszfoglicerát) NAD-függő redukcióval
képződő 2-keto-3-foszfoglicerát transzamináz segítségével alakul szerin foszfáttá. Ebből acetil-CoA
felhasználásával képződik az acetil-szerin, amely kénhidrogénnel reagálva alakul ciszteinné a szükséges
mennyiségben. Hiánya áttételesen jelentkezhet, ha a szulfát redukcióhoz szükséges NADPH formában
megjelenő redukáló aktivitás nem áll rendelkezésre.
Az L-valin képződése ugyan feedback kontrol alatt áll, de képződése ugyancsak központi szerepet
betöltő piroszőlősavból kielégítő aktivitással folyik. Különlegességként említhető a bioszintézis NADPH-t
igénylő reduktoizomeráz reakciója. A vízkilépést követően glutaminsavból származó amino csoportot hasznosít
a transzamináz a ketovalin valinná alakításához.
A harmadik építőelem az L-o-aminoadipinsav, a lizin szintézis köztes terméke. A Krebs-ciklusban
képződő o-ketoglutársav acetil-CoA-val reagálva alakul homocitráttá. Nem véletlen, hogy a reakciót a
végtermék, a lizin szabályozza. Ezt a lizinhez vezető reakció utat csapolja meg az izo-penicillin-N szintézis. A
homocitrátból képződő homoakonitin-sav dehidrogénezésével és egy transzamináz reakcióval jutunk az L-o-
aminoadipinsavhoz, amelynek o-karboxil csoportja ATP-vel reagálva adenilsav vegyes anhidridként hasznosul a
tiotempláton folyó ACV-tripeptid képződéséhez. Ez a vegyes anhidrid a lizin szintézis irányában lehetővé teszi
a karboxil csoport redukcióját, amely feltétele az c-aminocsoport kialakulásának. Mindent összevetve
végeredményben négy acetil-CoA felhasználásával képződik egy-egy aminoadipinsav, amely nélkülözhetetlen
építőeleme a cephalosporin-C antibiotikum képződésének is. (A prokariotákban a szacharopinen és a-
aminoadipinsav félaldehiden keresztül vezető lizin lebontási út szolgáltatja a kefém váz szintéziséhez szűkséges
köztes terméket.)
A bioszintézis egyes lépésének közvetlen energia és kofaktor igényét szemlélve, nyílvánvaló, hogy a
sejten belüli redukáló környezet szempontjából optimális NADPH szint fenntartása meghatározó jelentőségű. A
felhasználásra kerülő aminosavak előállítása a vázlaton bemutatott anyagcsere rendszert terheli. Az ammonia
felvételt katalizáló glutaminsav dehidrogenáz NADPH-t igényel. A valin szintézis redukciós lépése ugyancsak
NADPH-t igényel. Négy NADPH segíti a szulfátból származó kén redukcióját. Végül a NADPH poolt terheli a
tripeptidet redukált formában tartó specifikus tioredoxin rendszerhez hasonló széles spektrumú diszulfid-
reduktáz, amely felszámolja az átmenetileg esetleg megjelenő biszulfid alakot, amely nem azonos a glutationt
redukált formában tartó, NADPH igényes reduktázzal. A bioszintézis szempontjából tehát meghatározó
jelentőséget nyer a G-6-P dehidrogenáz és a 6-PG dehidrogenáz működésétől függő NADPH ellátottság.. Hexóz
szénforrásból a G-6-P szint természetesen kielégítené a szénváz felépítés igényét, ha a hexóz monofoszfát
(HMP) úton hasznosul. Ezt az irányítást hatásosan a fruktóz-2,6-biszfoszfát szint végzi. Ezért az antibiotikum
termelésre kidolgozott eljárások szénforrásként lassan bontható oligoszacharidot, a 60-as évekig előnyösen
laktózt, esetleg növényi zsiradékot használnak. A Penicillium chrysogenum a laktózt — nem lévén galaktózzal
indukálható ß-galaktozidáza — különösen lassan képes felhasználni. A növekedési fázist követő antibiotikumot
termelő szakaszban (idio fázis) a mérsékelt glükóz ellátottság a cAMP szint növekedését eredményezi, ami a
foszfatáz hatást növeli. A F-2,6-P
2
szint csökkenése megszünteti a biszfoszfát 6PG dehidrogenázt gátló hatását.

20

ACV tripeptid építőelemeinek (L-o-aminoadipinsav, L-cisztein, L-valin) képződése

A limitált glükóz szinttől függően emelkedő cAMP szint a négy alegységből álló inaktív protein foszokinázt
aktív monomerekké alakítja. (Lásd a F-2,6-P
2
szabályozó szerepét bemutató vázlatot) Ez a cAMP-t tartalmazó
21
protein foszforiláz a F-2,6-foszfokinázt foszforilezve 2,6-biszfoszfatázzá alakítja. Ez utóbbi enzimaktivitás
eltünteti a jelenlevő F-2,6-P
2
-ot. Ez a beavatkozás nemcsak a HMP út működését teszi szabaddá, de a fruktóz-
1,6-biszfoszfatáz működésével megnyitja az utat az acetil-CoA ból táplált glükóz képződés (glükóz neogenezis!)
irányába, elősegítve a HMP út működését, azaz a NADPH képződést. Ez a szabályozó melem különösen fontos
szerepet nyer a szénforrásként növényi olajat hasznosító cephalosporin képződés szempontjából


Fruktóz-2,6-biszfoszfát szabályozó szerepének a vázlata

Glükóz-limit estén kialakuló cAMP szint a szénforrás hasznosulást a hexózmonofoszfát útra tereli. A
tenyészethez adott fölös glükóz ugyanis a szénhidrát lebontást a fruktóz-1,6-biszfoszfát útra tereli, amely
NADPH hiányt eredményez. Ez esetben a lecsökkenő cAMP szint miatt inaktíválódik az a protein foszforiláz,
amelyik a F-2,6-foszfokinázt foszforilezve F-2,6-biszfoszfatázzá alakítja. Ez utóbbi enzim elbontja a képződő F-
2,6-P
2
-ot, amely egyrészt gátolva a 6-foszfoglükonát dehidrogenáz működését NADPH hiányt idézne elő,
másrészt a fruktóz-1,6-foszfokinázt aktiválva serkenti a fruktóz-1,6-P
2
képződést, amely végül az EMP útra tereli
a szénhidrát lebontást. Nem véletlen tehát, hogy a penicillint termelő tenyészethez adott glükóz leállítja a penám
váz képződését. A bonyolult szabályozó mechanizmust látva érthetővé válik, hogy az ipari termelésre
kinemesített törzsek miért vesztik el olyan könnyen kiemelkedő termelőképességüket. Az antibiotikum termelés
szintjét befolyásoló spontán mutáció ugyanis csökkenti az anyagcserére nehezedő szelekciós nyomást. A
populáció könnyebben, gyorsabban növekedő spontán megjelenő mutánsai, vagy a környezetből a tenyészetbe
kerülő vad törzsek a fermentációs ciklus végére elszaporodva sok esetben elnyomják a kinemesített variánst.
Az acetil-CoA-ból töténő bioszintézis esetében fontos szerepet nyer a Krebs ciklus és a glioxalát ciklus
működése, amely az olajsavból szabályozás nélkül képződő acetil-CoA gyors felhasználódását lehetővé teszi. A
zsírsav szénforrást hasznosító anyagcsere nagyobb mennyiségű redukált kofaktor (NADH és FADH
2
)
képződéssel jár. A FADH
2
képződés növekedését jelenti a cephem szerkezetű termékek képződése, az expandáz
és a dioxigenáz jellegű hidroxilezéssel együttjáró szukcinát képződés. Az anyagcsere teljesítőképességét ez
esetben a redukált kofaktorok visszaoxidálásának sebessége határozza meg. Nem meglepő, hogy fokozott
22
szerepet kap a szalicil-savval, illetve borostyánkősavval indukálható, de szalicilhidroxamáttal gátolható — CN
rezisztens — alternatív légző rendszer, amely ATP képződés nélkül képes az elektront az oxigénre mint
elektron-akceptorra juttatni.

NADH ox. < (cianidddal gátolható)
flavin - oxidatív foszforiláció e


1
/
2
O
2

enzim


NAD
+

<

>
red alternatív légzés e


(cianid-rezisztens szalicilhidroxamáttal gátolható) H
2
O
Az elektron útja az oxigénhez

Mivel a redukált kofaktor visszaoxidálása ATP képződés nélkül történik, az oxidáció közben felszabaduló
energia a tenyészet hőmérsékletét emeli. Ez a hőtermelésben megjelenő energia a rendszer fokozott hűtését
igényli (24-26
o
C-ra). Az alternatív légző rendszer fontos szerepet kap a mikroszervezet energia termelő és
bioszintetizáló rendszerének optimálisra szabályozásakor. A redukálódó kofaktorok regenerálása alapvető
feltétele a rendszer működőképességének, ezért sebességmeghatározó, tehát adott esetben limitáló faktorként
jelenik meg a biotechnikai folyamatokban. Az alternatív légzésnek nevezett elektronátvivő mechanizmus
kiegyensúlyozó szerepe a primer metabolitokat túltermelő eljárások esetében is jól megfigyelhető. (A NAD
+

hiány, illetve az ATP felszaporodása — a kulcs enzimek működését befolyásolva — egyaránt a szénhidrát
anyagcsere sebességét csökkentené, ami a célvegyület képződését zavarná.

A PENICILLIN GYÁRTÁS IPARI GYAKORLATA - 1945 UTÁN - VILÁGSZERTE MEGVALÓSULT
A fehérje oldatban szuszpendált spórák fagyasztva szárított
körülmények között (liofilizálás) hosszabb ideig biztonságosan tárolhatók.
Ma divatos a cseppfolyós nitrogénben, illetve -80 fokon való tárolás. Ezek a
törzskonzervek természetesen nem közvetlenül kerülnek felhasználásra,
hanem megfelelő előkezelés, felélesztés után előállított spóra tömeggel
történik a termelő fermentáció oltása. Virulens oltóanyagként felhastználható
spóratömeg nyerhető a nemsített törzs szuszuszpenziójával oltott sterilezett
rizs, vagy köles szemek felületén A spóratermelő fázis befejeztével a
rizskultúrát vákuum szárítószekrényben vízmentesíthető. Az aszeptikusan
lezárt spóratömeg –20 °C on 1-2 éven keresztül tárolható biológiai
aktivitásának csökkenése nélkül. A technológiai előírások pontosan
meghatározzák az oltófermentorba juttatandó élőcsiraszámot. Az optimális
spóraszám túllépése a mikrotelepek összefonódását eredményezi.
Alacsonyabb spóraszám esetében viszont a pelletek mérete lesz nagyobb.
Mindkét esetben az oxigénellátás kielégítetlensége miatt a termék képződése
károsodik.
Az oltóanyagot előállító laboratórium minőségileg ellenőrzött
spóratömegével oltják az előinokulumot. A törzsfenntartó laboratórium rutin feladata az oltóanyagok
termelőképességének és az élőcsiraszámnak az ellenőrzése.
A spóraszám a termelő táptalajban kialakítandó gömb alakú telepecskék (pellet) kívánatos számával
egyezik meg. A pellet kialakulása és mérete több szempontból fontos. A apró, 0.5-1 mm átmérőjű gömböcskék
nagyobb mennyiségű gomba tömeg jelenlétét és a gömb felületen elhelyezkedő nagy számú csúcsi sejt
működését teszi lehetővé a nagy viszkozitása miatt nehezen keverhető fonalas szerkezetű tenyészetnél
előnyösebb levegőztetési körülmények között. A penicillin képződés ugyanis a bioszintézis szempontjából
legaktívabb csúcssejtekben folyik.
Az inokulum gazdasági megfontolásból több lépcsőben készül szerves nitrogénforrást és könnyen
metabolizálható szénforrást tartalmazó táptalajon. A vegetatív inokulum táptalaj szerves nitrogénforrásaként a
kukorica áztatóléből készült tejsavbacillusokkal erjesztett koncentrátumot használták 2% mennyiségben. Ez az
50% szárazanyagot tartalmazó koncentrátum teljes értékű aminosavak és más növekedési faktorok, vitaminok
szempontjából előnyös, de jelentős a tejsav és foszfáttartalma is. Az oltóanyag energiaforrásaként általában a
csírázást és a növekedést segítő glükózt használnak ugyancsak 2-3% mennyiségben. Een a szénforráson jelentős
micélium tömeg fejlődik. A táptalajba adott 0,5-1% kalciumkarbonát a tenyészközeg savanyodását akadályozza.
A habgátló is az előkészített táptalajba kerül sterilizálás előtt. A fejlődő inokulum tenyészetbe való adagolást
kerülik a tenyészet — homogénitása, — idegen fertőzéstől való mentessége érdekében.
A méretnövelés céljából előnyös az oltóanyag előállítást két lépcsőben végezni, A végtértfogat
méretének megfelelő spóratömeggel 1000 L térfogatban előinokulumként indítják az első lépcsőt. A csírázás
ellenőrzése után — a primer fonalak megjelenésekor — célszerű átoltani a tenyészetet. Biztonsági okokból
általában két oltó reaktort indítanak az esetleg fellépő zavarok (fertőződés) elhárítása céljából. Az átoltások

23
idejét úgy határozzák meg, hogy a növekedés zavartalan legyen. Az elkészült inokulum 40-50 órás olyan
vegetatív tenyészet, amelyben a mikrokolónia kezdemények még függetlenek. Ez kerül át a főfermentáció
tápközegébe legkevesebb tízszeres higításra törekedve.
A termelő fermentáció táptalaja nitrogén- és kén-forrásként főleg ammónium-szulfátot tartalmaz. A szénforrás
felhasználásának az útja a penicillin termelés szempontjából meghatározó jelentőségű, ezért szénforrásként
kezdettől fogva a 60-as évekig tejcukrot használtak. A táptalajhoz adott glükóz ugyanis akadályozza a penicillin
képződést. A penicillin termelésre kiválasztott törzs ß-galaktozidáz aktivitását (laktáz) — a tömlós gombákban
(Aspergillus nidulans) tapasztaltakkal ellentétben — nem indukálja a galaktóz. Mégis a glükózaminidáz képes a
tejcukor lassú hidrolízisére. Ebből következően a tenyészetben a glükóz limitált mennyiségben van jelen. A
mérési és adagolási technológia fejlődésével — ipari méretben — folyamatosan adagolt répacukorral, illetve
keményítő hidrolízátummal a glükóz mennyisége a penicillin termelés szempontjából optimális alacsony szinten
tartható. Ez a technikai megoldás lehetőséget ad a szakaszos, ráadagolásos technológia alkalmazására, akár tíz
szakasz lefejtésére.
A penicillin kémia stabilitása megkívánja a tenyészlé közel semleges állapotát. Az első évtizedben a
táptalajhoz adott kálcium karbonát akadályozta a tápközeg savanyodását. Később, a mérési technika fejődése,
sterilezhető elektród alkalmazás, lehetővé tette a pH állandó ellenőrzését. Ma ammónia adagolásával 6,4-6,6 pH
tartására törekednek. Energia forrásként szolgálhat a tápközeghez adott növényi olaj, amely habgátló feladatot is
ellát. A tápközeg prerkurzor tartalma határozza meg a képződő penicillin minőségét. Fenilecetsav jelenlétében G
penicillin, fenoxiecetsavat adagolva V penicillin képződik főtermékként. Az arómás savak, és bomlástermékeik
toxikus volt miatt a prekurzor adagolásaa a termelő fázisban az igényeknek megfelelően folyamatosan történik.


24

A penicillin gyártás folyamatábrája
(1) termelőképesség szempontjából "nemesített ipari törzs"
(2) agar tenyészet, vagy rizs szemeken spórázó tenyészet
(3) termelőképesség szempontjából minősített spóra szuszpenzió
(4) oltóanyag tenyésztő bioreaktor, keverővel ellátott, aerob inokulum-fermentor
(5) pH szabályozott, kevert aerob termelő fermentor prekurzor [fenilecetsav] adagolással
(6) a semleges fermentlé szúrése vákuum dobszűrővel [ lásd a dobszűrőt bemutató ábrát]
(7) hűthető tároló tartály
(8,9,10) szeparátort igénylő extrakciós lépések [lásd a szeparátor ábrát]
(11) penicillin-só kristályosító (12) szűrőcentrifuga
(13) vákuum szárítószekrény (14) granuláló
(15) átkristályosító (16) szűrő
(17) prokain-só képzés (18) penicillin-nátrium-só steril átkristályosítása
(19) steril szűrők (20) vákuum szárító (liofilező)
(21) steril penicillin tároló (22) kiszerelés

A penicillin molekula kémiai érzékenysége miatt a feldolgozása egyes lépéseit hűtve végzik. Gyenge
sav lévén a szerves oldószeres extrakció járható útnak látszik, de savanyú körülmények között észlelhető
bomlása miatt a rendszer (pH 2) savanyítása célszerűen csak szerves oldószer jelenlétében végezhető. Az egyik
elterjedt módszer szerint a közel semleges pH-nál megszűrt (fermentlevet) tenyészlevet lehűtve amilacetáttal
extrahálják. A savanyítást közvetlenül a centrifugál-szeparátor beömlőnyílásánál végzik folyamatosan. A
megsavanyított vizes fázisból így a penicillin a szeparátorral elkülönített szerves fázisban dúsul fel. Ebből az
oldatból kálium acetáttal a penicillin kálium sója könnyen kristályosítható.

A fermentáció befejezése után a 2-4 °C-ra hűtött semleges pH-jú tenyészléből a micélium eltávolítását
vákuum dobszűrővel végzik. A hűtve tárolt üledékmentes szűrletből a hatóanyagot szerves oldószerrel különítik
el. Kezdetben előszeretettel használtak klórozott szénhidrogéneket (széntetrakloridot, kloroformot).
Egészségvédelmi okokból ma etilacetát, butilacetát, amilacetát illetve metilizobutilketon kerül felhasználásra. A
pH beállítására kénsavat, vagy foszforsavat használnak. A hűtött szűrlethez közvetlenül a szeparátor előtt
folyamatosan adják a savat számított mennyiségben. Így a savanyú pH=2-2,5 a rögvest szerves oldószerbe
kerülő hatóanyagot nem károsítja. A szerves fázisból a következő szeparátoron a szabad savat újra pufferbe
pH=7,5-8,2 viszik vissza. Az így nyert sót egy újabb szerves oldószeres extrakcióval tovább tisztítják és
koncentrálják A szerves oldószerből kálium-acetáttal a penicillin kálium sója közvetlenül kristályosítható. Ez
azonban még átkristályosításra szorul.
25
.


Igen előnyös a szerves oldószerben történő N-etilpiperidinnel végzett kicsapás. Ezt a piperidin sót
köztes termékként használva az igényeknek megfelelő formában lehet felhasználni a hatóanyagot kálium-só
képzésre. A piperidin sóból könnyenl előállítható a procain-penicillin, amely aluminium stearáttal stabil
szuszpenziót adva tartós vérszint biztosítására adott lehetőséget (Supracillin). Később védőkolloidnak polyvinil-
pirrolidont alkalmaztak (Retardillin). A piperidin só előnyösen használható a félszintézishez szűkséges 6-
aminopenicillinsav előállítására.
A vegyület érzékenysége miatt ioncserélő gyanta oszlopon nem oldható meg gazdaságosan a termék
kinyerése. Kiküszöbölhető azonban a bomlás, ha valamilyen folyékony ioncserélő felhasználásával végezzük a
kinyerést. Ezek az alifás természetű vegyületek olyan poláros csoportot (gyenge bázis) hordoznak, amely képes a
gyengén savanyú penicillinnel sót képezni. A benzilpenicillin extrakciója ílyen módon Amberlit LA-2 (375
moltömegű szekunder amin) n-butilacetát rendszerben 4,5 pH-nál gyakorlatilag bomlás nélkül folyamatosan
végezhető. Ez a módszer lehetőséget ad az ellenáramú extrakciós kolonnák használatára, amely a rendszer
természetéből következően az elméletileg kinyerhető mennyiség tetszőleges megközelítését jelenti.

A cefalosporin fermentációs úton történő előállítása lényegesen eltér a benzil-penicillin előállítására
szolgáló eljárástól. Értelemszerűen nincs szükség prekurzor adagolásra. Sőt a kísérleti eredmények szerint a
tenyészközeghez adott o-aminoadipinsav sem segíti a cefalosporin C képződését. A tenyészetben a főtermékként
képződő Cephalosporin C antibiotikumon kívül ennek dezacetil és dezacetoxi származéka is megjelenik, sőt kis
mennyiségben a vegyület 7-metoxi származékának képződését is kimutatták.
Szénforrásként használható a keményítő hidrolízátum, de a hatóanyag képződése szempontjából az
idio-fázisban előnyösebb növény olajat használni szénforrásként. A Penicillium esetében eklőnyösen
alkalmazható tejcukor itt nem használható, mert a galaktóz által indukálódó laktóz bontó aktivitás
reakcióterrméke katabolikusan gátolja a kefém váz képződését, de a glükóz szint emelkedése zavarja a NADPH
képződést is,
Nitrogénforrásként a kukorica-lekvár mellett az ammónia, kénforrásként szulfát jöhet számításba.
Előnyös hatású a táptalajhoz adott kis mennyiségű metionin. Feltünően nagy az eljárás oxigén igénye.
Elsősorban az alternativ oxidáció működtetése miatt. Nem kielégítő oxigénellátottság esetén először a képződő
termékek aránya eltolódik a dezacetil-cefalosporin C irányába. Tartós oxigénhiány esetén leáll az antibiotikum
képződés. Az oxigén ellátás visszaállása után csak néhány órányi aktív növekedés szükséges az enzimrendszer
kifejlődésdéhez.
A cefalosporin-C kémiai szerkezetéből következően a fermentléből való kinyerés módszere is eltér a
penicillinnél megismert eljárástól. Szerves oldószeres extrakció csak alkalmas karrier vegyület (szulfonsav
típusú folyékony ioncserélő) használatakor jöhet számításba. A szilárd ioncserélő gyanták alkalmazása helyett a
környezetbarát, erre a célra kifejlesztett makropórusos adszorbciós gyanták használata terjedt el világszerte.



AZETIDINON SZERKEZETŰ VEGYÜLETEK HATÁSMÓDJA.

A vegyület-típus gyógyászatban elért félévszázados sikerét a peptidoglükán sejtfal felépítésében szerepet játszó
reakció specifikus gátlásával magyarázhatjuk. Már Fleming észlelte, hogy a Penicillium által termelt anyag csak
a virulens, növekedő baktérium tenyészet osztódó sejtjeit pusztítja. Abnormális alakok, (protoplaszt,
szferoplaszt) átmeneti megjelenése mellett következik be a tenyészet lízise. Ezt a tulajdonságot a genetikusok a
populációban megjelenő hiánymutánsok szelektív dúsítására évtizedek óta jó eredménnyel használják. Minimál
táptalajra oltott baktériumok auxotróf variánsai nem osztódnak, a vad sejtek viszont jól növekednek. A penicillin
csak a növekedő sejteket pusztítja el. Az életben maradó auxotrófok penicillin mentes környezetben teljes

26
értékűvé tett táptalajon felszaporíthatók. Az antibiotikum eltávolítását penicillinázzal végzik. A baktériumsejtfal
murein rétegének, a peptidoglukán váznak a felépülését a D-alanin transzpeptidáz inaktiválásával akadályozza a
penicillin. A hatásmód ismeretében már nem meglepő az a tapasztalat, hogy a penicillin és a kefalosporin
származékai nem mutatnak toxikus hatást az emlős szervezetben. Az emlős sejtben ugyanis nem fordul elő olyan
enzim, amelynek működését a penicillin vagy a kefalosporin gátolni tudná.
A prokarioták alakját és méretét az N-acetil-glükózaminil-N-acetil-muramil egységekből felépülő
szénhidrát polimereknek a peptid láncok által összekötött háromdimenziós hálózatából kialakuló muropeptid
határozza meg. Az elnevezés a latin murus (fal) szóból származik. A sejtfal építőelemeit a baktérium
citoplazmájában működő enzimrendszerek építik fel. A citoplazma membránon kívül, a periplazmikus térben az
aktívált formában megjelenő N-acetil glükózaminil-N-acetil muramil oligopeptid egységek összeépülése folyik
minimális energiaveszeteséggel. Az muramil-peptid építőelemeknek a membránon való áthaladását az
izoprenilalkohol foszfát észtere segíti. A muropeptid aminocukor része a membránhoz rögzített foszfolipid
hordozóhoz kapcsolódik észterkötéssel. A periplazmikus térbrn működő különleges glikozilező enzim az
észterkötésben rejlő energiát hasznosítva kapcsolja a muraminsavat a már meglevő peptidoglükán vázban helyet
foglaló aminocukor szabad C
4
atomjához. A rekció közben szabadon maradó undekaizoprenil pirofoszfát
regenerálását, - egy anorganikus foszfát leválasztását, - membránhoz kötött foszfatáz végzi.
A transzglikozidáz az építőelem diszacharid komponensét a glükán polimer terminális hexóz C
4

atomjához. A sejtfal peptid vázának továbbépítését a membrán külső felületén működő transzpeptidáz és
transzglikozidáz végzi. Ez az enzim a muropeptid terminális D-alanin elemének eltávolításával felszabaduló
karboxil csoportot illeszti a már meglevő murein váz szabad aminocsoportjához. Az újabb építőelem két ponton
való kapcsolásával nő a térhálós szerkezetű sejtfal. A transzpeptidáz reakció végbemenetele közben a
szubsztrátum átmenetileg acilezi az enzimet és az acilezett enzimről kerül az acilező ágens a muropeptid sejtfal
N terminális amino csoportjára.


27

Az azetidinon molekula merevített szerkezete éppen a muropeptid építőelem D-alanin-D-alanin dipeptid
szerkezetéhez hasonlít. Nem meglepő tehát, hogy nagyfokú szerkezeti analógia miatt a penicillin a sejtfalépítő


transzpeptidáz aktív centrumába jut és a felnyíló ß-laktám kötés karbonil csoportja in statu nascendi
irreverzibilisen acilezi az enzimet. Ezért nevezték kezdetben ezt az enzimet penicillinkötő fehérjének.
A sejtfal felépítéséhez szükséges specifikus enzim inaktíválása akadályozza a sejtfal továbbépülését,
miközben a baktérium életfolyamatai zavartalanul tovább folynak. Először az egyre vékonyodó sejtfalon és
lazuló membránon keresztül a folyamatosan készülő sejtfal építőelemek köztes termékeiként, glükózamint,
foszforsavat és aminosavakat tartalmazó uridil-származékok, úgynevezett Park nukleotidok kerülnek a
tápközegbe. Végül a sejt tömegének, térfogatának további növekedése a sejtmembrán szétszakadásához, a
baktérium pusztulásához vezet.


28
A PEPTIDOGLÜKÁN SEJTFAL ÉPÍTŐELEMEINEK KÉPZŐDÉSE A CITOPLASZMÁBAN




Ez a felismerés a baktérium-sejtfal szintézisét gátló antibiotikumok kutatására irányította a figyelmet. Érdekessé
váltak mindazok a vegyületek, amelyek a prokariota sejtfal képződésében zavart okozhatnak. Ilyenek a
kefalosporinon kivül a cikloszerin, foszfonomicin, bacitracin, vankomycin, ristocetin antibiotikumok. Ezek a
vegyületek a baktériumsejtfal szintézis különböző reakcióit gátolva fejtik ki antibakteriális hatásukat. A D-
szerinből készülő cikloszerin mint D-alanin analóg gátolja D-Ala dipeptid képződést. A foszfonomicin
foszfoenolpiroszőlősav analógként gátolja a muraminsav képződését. A bacitracin az izoprenilpirofoszfát
hidrolízisét gátolva akadályozza a muramilpeptidek transzportját.



A ß-LAKTÁM GYŰRŰ FELNYÍLÁSÁT KATALIZÁLÓ ENZIM A PENICILLINÁZ


Abraham korán felhívta a figyelmet a prokariotákban jelenlevő penicillint inaktíváló enzim jelenlétére a
penicillináz (|-laktamáz) káros hatására. Erre az enzimre a penicillin széleskörű gyógyászati alkalmazása után
megjelenő penicillin rezisztencia hívta fel a figyelmet. A penicillint inaktíváló enzim génje plazmidhoz kötve a
rezisztencia gyors terjedését segíti. Ez a penicillin hatására felszaporodó mikrobiális enzim nagy valószínűséggel
a sejtmembránhoz kötődő, eredetileg transzpeptidáz, illetve transzaciláz feladatot ellátó, úgynevezett penicillin-
kötő fehérje biokémiailag módosult formájának tekinthető. Az aktív centrumában található szulfhidril csoport
reakciója a labilis laktám gyűrű felhasadását segíti elő. Az átmenetileg megjelenő acilezett enzim-komplex vizes
közegben penicillosavra hidrolizál. Több esetben a penicillináz a membránhoz kötő fehérjeláncról lehasadva
sejtmentes formában extracellulárisan is megjelenhet. Az enzim képződését általában a természetes penicillinek
serkentik, de induktív hatásúak lehetnek a félszintézissel előállított |-laktamáz (penicillináz) rezisztens
származékok is. Igen erős induktív hatású a penicillináznak ellenálló dimetoxibenzil-penicillin (penbritin).


29
A |-laktamáz (a reagáló penicillináz fragmentum kivastagítva) működése




Penicillináz, illetve ß-laktamáz

Enzimaktivitás nemzetközi egysége {IU} az az enzim-mennyiség, amely percenként 1 umol termék előállítására
képes. A sebesség mértéke 1 molekula tömeg átalakításához szükséges idő Specifikus aktivitás 1 mg
enzimfehérje nemzetközi egységben megadott teljesítménye. k
cat
(sec
-1
) 2 x 10
3


Szubsztrátummal való telítés esetén K
M
<<<[S] a turnover number
V
max
= k
cat
[E]
t

Enzim koncentráció [E] = 1 molekulatömeg/liter

A Bacillus cereus esetében a kezdetben membránhoz kötődő enzim a periplazmikus térben megjelenő proteáz
hatására extracelluláris penicillinázként megjelenik a környezetben


Limitált proteolízis Proteáz hatás

|apoláros szakasz| | ******extracelluláris penicillináz*******|
H
2
N–Met–(Xxx)
15
–Ser–(Xxx)
22
–Glu–Ser–Lys–Thr–Glu–(Xxx)
258–
Lys–COOH

|
O
| foszfatídsavval acilezett szerin-OH
HO–P=O
|
HO–CH–CH–CH
2
| | |
H O O

| |
O=C C=O
| |
R R R = páratlan szénatom számú alkil láncok (foszfolipid zsírsav)


A membránhoz kötődő penicillináz extracelluláris enzimmé válása
30
PENICILLIN ÉRZÉKENYSÉG KIALAKULÁSA, ALLERGIÁS TÜNETEK.


A penicillin-allergia jelensége a penicillin gyógyászati alkalmazásával egyidejű. A jelenséget kezdetben a termék
szennyezettségével magyarázták. A technológia fejlődésével előállítható legtisztább készítmény alkalmazása
sem szüntette meg a sokszor halálos kimenetelű reakciót. Kifejlődése egyéni érzékenységtől függ.
A jelenség magyarázata szerint az azetidinon gyürű felhasadásakor az élő szervezetben fellelhető
szabad aminocsoportok (pl. lizin c -aminocsoportja) acileződhetnek. Ezek a bomlástermékek potenciális
allergének, az emlős szervezetben viszonylag hosszabb ideig jelen vannak a bevitt antibiotikum kiürülése után is.
Ezért célszerűnek látszott a penicillin érzékenység vizsgálatakor az antibiotikumon kívül a bomlástermékek
allergén hatását is vizsgálni. A kifejlesztett készítmény D-benzilpenicillinen kívül benzilpenicillo savat, e sav
propilamidját és egy polilizin származékot tartalmaz. (8 Lizin + 8 Benzilpenicillosav)
Benzilpenicillo Na-só hűtött körülmények között nátriumhidroxiddal nyerhető. Penicillo-propilamid
könnyen készíthető benzilpenicillin vizes oldatához propilamint csepegtetve (pH=11,5-12). Az oktalizin
származékot Merrifield módszerével célszerű előállítani o-amino- tercier-butioloxikarbonil-c-amino-
benziloxikarbonil lizinből. A gyantáról a terméket hidrogémbromiddal telített trifluorecetsavval célszerű
leválasztani, mert az így kapott okta-o-L-lizin-nonahidrobromid könnyen reagáltatható benzilpenicillin kálium
sójával alkalikus (pH=11,5) körülmények között.
A bőrbe juttatott fiziológiás sóoldatban oldott keverék pozitív esetben 20 perc alatt kiváltja a bőr
érzékenységi reakcióját. A bevitel helye körül megjelenő pirosodás átmérője az érzékenység mértékéről
tájékoztat. Általában a fenti keverék hatását először a bőrre karcolva vizsgálják és csak azután végzik el a
kvantitatív eredményt szolgáltató bőrpróbát. Feltételezhető, hogy a vérfehérjékhez kötődő penicillin
származékok és ezek bomlástermékei mind szérumfehérjéhez kötődő haptének, érzékeny egyéneknél
ellenanyagképzést indukálnak. Ezt a hatást kis mennyiségű penicillin tartós jelenléte is előidézheti. Műhiba
esetén szerencsés esetben az anaphylaxiás sokk kialakulását penicillináz injektálásával (8.millió E neutrapen)
meg lehet akadályozni. Ez az enzim mennyiség kb. 1 óra alatt képes elbontani a szervezetbe került penicillináz
érzékeny azetidinon származékokat

HC == CH O H H H CH
3

| | || |

: : |
HC C÷÷CH
2
÷÷ C÷÷N ÷÷C------C------S-----C-CH
3

|| || | | |
HC — CH O=C H-N------------C-H
|

:
HOOC-CH-CH
2
-CH
2
-CH
2
-CH
2
-N-H COOH
|
N-H Benzilpenicillosav
| |
( O=C-CH-CH
2
-CH
2
-CH
2
-CH
2
-N-H )
6
[okta-c-(D-benzilpenicillo)-okta-o-L-lizin]
|
N-H Benzilpenicillosav
| |
O=C-CH-CH
2
-CH
2
-CH
2
-CH
2
-N-H
|
NH
2

HC == CH O H H H CH
3

| | || |

: : |
HC C ÷÷ CH
2
÷÷ C÷÷N÷÷C------C------S-----C-CH
3

|| || | | | benzil -penicillo-propilamid
HC — CH O=C H-N------------C-H
|

:
CH
3
-CH
2
-CH
2
-N-H COOH


31
32
A |-LAKTÁM SZERKEZETŰ VEGYÜLETEK BIOSZINTÉZISE

A fehérje szintézishez felhasználára kerülő L-cisztei és L-valin a nitrogén anyagcsere természetes terméke. A
harmadik az o-amino-asdipinsav a lizin szintézis köztes termékeként van jelen mégpedig adenilát formájában
vegyes anhidridként. A o-ketoadipinsav a prokariotákban a lizin lebontás köztes termékeként jelenik meg. Az
ábra a tömlősgombákban foklyó lizin szintézis vázlatát mutatja

A bioszintézis köztes terméke a o-adenilil-o-aminoadipát az ACV tripeptid képződéshez felhasználható aktivált
amionosav, amely a vezikulumban folyó tripeptid szintézis ideális alapanyaga.

33

A |-laktám antibiotikumot termelő prokariótákban a lizin bomlástermékei között fordul elő a ketoadipinsav,
amelyből a bioszintézishez szükséges aktivált aminosav ATP felhasználásával képződik



Az azetidinon gyűrűt tartalmazó penám, illetve kefém (cephem) vázat tartalmazó vegyületek bioszintézise
azonos kiindulási anyagokból, hasonló módon folyik a fonalas gombákban és a sugárgombákban.


34
Penicillin képződéséhez ACV tripeptid szintetáz (ACVS)
izopenicillin N szintetáz (IPNS) és
izopenicillin aciltranszferáz, (IAT) penicillinaciláz szükséges
Penicillint termelő gombákban az izopenicillin aciltranszferáz mikro testecskébe rögzítve működik
Ebből a testecskéből kerül a környezetbe a penicillin. A többi enzim a citoplazmában tevékenykedik.


35
Cephalosporin képződést katalizáló enzimek a citoplazmában működnek
Az első két enzimkomplexen (ACVS, és IPNS) kívül
izopenicillin epimeráz
és a gyűrűtágító rendszer expandáz, dezacetoxicephalosporin C szintetáz szükséges.
A befejező lépéseket négy enzim: a
hidroxiláz,
aciláz,
karbamoil transzferáz, és a
metil transzferáz katalizálja
A felsorolt enzimek génjeit az elmúlt évtizedben elkülönítették, szekvenálták, majd penicillint nem termelő
gombába telepítve azokat penicillin szintézisre késztették. A szekvencia analízis a gének nagyfokú hasonlóságát
igazolták. A változások vizsgálata alapján feltételezhető, hogy a bioszintézisben résztvevő gének a
prokariotákból kerültek a fonalas gombákba. A prokarioták számára viszont határozott szelekciós előnyt jelentett
a |-laktám szerkezetű széles spektrumú antibakteriális hatású anyagok megjelenése. Az izopenicillin N-ből
penicillin képződést csak a fonalas gombákban figyelték meg. A prokariotákban működő epimeráz és a
gyűrűtágító mechanizmus létrehozza a kefém (cephem) szerkezetet, amely magában hordozva a penicillináz
rezisztenciát, Gram
+
és Gram
÷
szervezetek növekedését is gátolja.

ACV tripeptid szintetáz
A primer anyagcserében nem szereplő első vegyület egy tripeptid a o-L-o-aminoadipil-L-ciszteinil-D-valin.
Képződését L konfigurációjú aminosavakból az acvA/pcbAB struktur-gén által kodolt ACV tripeptid szintetáz-
nak nevezett két fehérjéből épülő komplex katalizálja. A valin izomerizálását is a komplex végzi.
A peptid kötések kialakításához szükséges energiát az aminosavak aktíválásakor az ATP
szolgáltatja. Az antibiotikum képződése jelentős mértékben terheli a termelő törzs anyagcseréjét. A
nagyobbrészt klasszikus genetikai kezeléssel kifejlesztett - iparban használt - törzsek szárazanyag tartalmukat
meghaladó mennyiségben termelik az antibakteriális hatású vegyületeket. A hatásos vegyületek építőelemeit a
kinemesített mikroszervezetek saját anyagcseréjük terhére szintetizálják.

L-o-aminoadipinsav L-cisztein L-valin
| ATP ATP ATP
tripeptid (ACVS) szintetáz
O H H SH CH
3

|| | | | |
HOOC÷÷CH÷CH
2
÷CH
2
÷CH
2
÷÷C÷÷N—C—CH
2


H H÷C÷CH
3

| |

| |
NH
2
O=C ——— N ——— C÷H
|
L-o-aminoadipil- L-ciszteinil- D-valin COOH (ACV tripeptid)

Figyelemre méltó analógiát találunk a fenti tripeptid képződése és az élő sejtben fontos szerepet játszó hasonló
kémiai szerkezetű glutation a ¸-L-glutamil-L-ciszteinil-glicin bioszintézise között. Különbség, hogy az adipinsav
egy szénatommal hosszabb a glutaminsavnál. A D-valin pedig a glutationnal összehasonlítva lényegesen növeli a
kis peptid apoláros tulajdonságát.

H H H H

O H H H H H H O H H H
| | | | || | | | | |

| || | |

|
HOOC—C—C—C—C--C—N—C—C—SH HOOC—C—C—C—C—N—C—C–SH
| | | |



| H CH
3
| | | | H
H
2
N H H H H | |

H
2
N H H

H

|
O=C—— N—C—CH—CH
3
O=C—–N—C—H
| | | |




H COOH



H COOH
ACV tripeptid glutation tripeptid (G-SH)

A két tripeptid-szintetáz méretbeli eltérésén túl a két enzimkomplex kémiai szerkezete is alapvetően különbözik.
Az ACV-szintetáz a glutation-szintetáznál nyolcszor nagyobb.

36
A gombákban képződő több mint 11ezer bázispárt tartalmazó acvA gén több mint 3700 aminosavból épülő
fehérjét kodol. Az Acremonium chrysogenum-ból izolált ACV-szintetáz és a Penicillium chrysogenum-ban
működő ACV-szintetáz szekvenciája több mint 50%-os egyezést mutat. A kémiai szerkezetben három helyen
mintegy 600 aminosavra kiterjedő teljes homológia figyelhető meg

Különböző azetidinon származékot termelő törzsekből nyert ACVS összehasonlítása

Aspergillus. nidulans P. chrysogenum P.chrysogenum II Acremonium.chrysogeneum
Genom DNS bp Ll310 11376 11328 11136
Aminosav-szám 3770 3792 3776 3712
Molekulatömeg 422486 425971 423996 414791
* (The Mycota II. Genetics and Biotechnology Springer-Verlag Berlin 1995. 263-285)

A homológia nem csak a gombáknál, de a Streptomyces clavuligerus izolált ACVS-re is érvényes. Sőt hasonló
doment találtak a Gramicidin S szintézisre képes Bacillus brevis-ből nyert fehérje-komplex mindkét
alegységében. Az enzim közös szakasza a kiválasztott aminosav adenilezését végzi. Ez az aktiválás előfeltétele a
peptid kötés kialakulásának.
A gén eredetére utalhat az, hogy a tömlős gombában előforduló gén intront nem tartalmaz. Átíráskor az
RNS polimeráz közvetlenül az ACVS mRNS-t hozza létre. A vakuola membránhoz kötődő ACVS
enzimkomplex termékeként megjelenő oligopeptid (ACVtripeptid) ellenáll a sejten belül működő proteolitikus
hatású enzimeknek, mivel az egyik kötés egy o-karboxil csoport és egy L-aminosav amino-csoportja között, a
másik pedig az L cisztein és a D-valin között létesült. Ilyen kötéstípus a sejt fehérje frakciójában nem fordul elő.
Valójában a glutation szerkezete is stabil a proteázok aktivitásával szemben, mivel az L ciszteinhez ¸-karboxil
csoport kapcsolódik, a glicinnel alkotott peptid kötést pedig a protázok nehezen bontják.
Ez a tripeptid szintetáz (ACVS) in vitro különböző glutation analógok előállítására használható. A
szubsztrátum változtatásával a valin helyett aminovajsav, norleucin vagy izoleucin építhető a molekulába. Ezek a
glutation analógok in vivo zavarják a kisérleti alany normál anyagcseréjét, különös tekintettel a sejtben kialakuló
oxidoredukciós viszonyokra. Az élő sejt működése megkívánja a redukáló körülményeket. Ezt igazolja , a jól
mérhető G-SH : G-S-S-G arány alakulása.
A képződött oligopeptidet a környezet redoxviszonyaira érzékeny. NADPH-val táplált (tioredoxin
reduktázhoz hasonlóan) diszulfid-reduktáz rendszer tartja redukált formában. A diszulfid kötéssel kialakuló
tripeptid-dimer ugyanis nem képes további reakciókban részt vállalni. Amint az tudott a glutation is csak
redukáló körülmények között, monomer formában láthatja el feladatát, például aminosav-transzport folyamatot.



37
IZOPENICILLIN-N SZINTETÁZ — A CIKLÁZ KOMPLEX MŰKÖDÉSI MECHANIZMUSA

A bioszintézis következő lépésében a sejt ATP energiatartalmát használva egy ipnA/pcbC gén által
kodolt (nonhemeFe
II
függő oxidáz) enzimkomplex, az izopenicillin N szintetáz (IPNS) oxigén jelenlétében a
citoplazmában alakítja ki a lineáris tripeptidből az azetidinon gyürűt tartalmazó izopenicillin N vegyületet.

L-o-aminoadipil-L-ciszteinil-D-valin (ACV tripeptid)

Fe
++
O
2
Mg
++
ATP ditiotreitol
izopenicillin -N-szintetáz

H H H H O H

H

H CH
3

|

| |

| || |

: :

|
HOOC—C—C—C—C—C— N---C---C—S—C—CH
3

| | |

| |


| |
H
2
N H H H O=C---N--------C—H
:
izopenicillin-N COOH

Ez a 38 kDa mértű fehérje 4 hidrogén eltávolításával alakítja ki a hasznos terméket. In vivo az IPNS aktív
központját a növekedési szakaszban fölöslegben levő glutation foglalja el. Sejtmentes körülmények között a
reakció ditiotreitol jelenlétéhez kötött, mivel az ACV tripeptid SH-csoportját az oxidatív hatásokkal szemben
védeni kell a tiazol gyürű záródásáig. A képződött reakciótermék L-o-aminoadipinsavval acilezett penám váz,
(izopenicillin-N) a kefalosporin és a penicillin bioszintézis közös intermedierje.

Az enzimkomplex (izopenicillin-N szintetáz) teljes szekvenciáját összehasonlítva meglepően
nagymértékű egyezés található a penicillint termelő Penicillium chrysogenum, a cefalosporint termelő
Acremonium chrysogenum, a cefamicint termelő Streptomyces clavuligerus és S. lipmanii, valamint az
antibiotikumot alig termelő Aspergillus nidulans-ban képződő fehérjék kémiai szerkezete között.
Carr és munkatársai összehasonlították az AS-P-78 jelű P.chrysogenum törzsből nyert IPNS enzim
szerkezetét a belőle kapott (23x80-269-37-2) jól termelő mutánsból izolált enzim szerkezetével. Egyetlen
aminosavban találtak eltérést. A tirozint kodoló TAC triplet ATC-re változva izoleucint tartalmazó enzim
képződését írta elő. In vitro ez a különbség az enzim működésében érzékelhető eltérést nem okozott,

---MASTPKANVPKIDVSPLFGDNMEEKMKVARAIDAASRDTGFFYAVNHGVDV K ALSNKTREFHFS I T
MGSVPVPVANVPRIDVSPLFGDDKEK KLE VARAIDAASRDTGFFYAVNHGVDL PWLSRETNKFHNS I T
MPVLMPSAHVPTID ISPLFG TDAAAKKRVAEEIHGACRGSGFFYATNHGVDVQQLQDVVNEFHGAMT
MGSV----SKANVPKIDVSPLFGDDQAAKMRVAQQIDAASRDTGFFYAVNHG INVQRL SQKTKEFHMS IT

DEEKWDLAIRAYNKEHQDQIRAGYYLS I PEKKAVESFCYLNPNFKPDHPL IQSKTPT HEVN2VWPDEKK
DEEKWQLAIRAYNKEHE SQIRAGYYLP I PGKKAVESFCYLNPSFSPDHPR IKEPTPMHEVNVWP DEAK
DQEKHDLAIHAYNPDN P-HVRNGYYKAVPGRKAVESFCYLNPDFGEDHPMIAAGTPMHEVNLWPDEER
PEEKWDLAIRAYNKEHQDQVRAGYYLSI PGKKAVESFCYLNPNFT PDHPR IQAK TPTHEVNVWPDETK

HPGFREFAEQYYWDVFGLSSA LLRGYALALGKEEDFFSRHFKKEDALSSVV LIRYPYLNPYPPAAIKTAE
HPGFRAFAEKYYWDVFGLSSAVLRGYALALGRDEDFFTRHSRRDTTLSSVV LIRYPYLDPYPEPAIKTAD
HPRFRPFC EGYYRQMLKLSTVLMRGLALALGR PEHFFDAALAEQDSLS SVSLIRYPYLEEYP--P-VKTGP
HPGFQDFAEQYYWDVFGLSSALLKGYALALGKEENFFARHFKPDDTLASVVLIRYPYLDPYPEAAIKTAA

DGTKLSFEWHEDVSLITVLYQSDVANLQVEMPQGYLDIEADDNAYLVNCGSYMAHITNNYYPAPIHRVK
DGTKLSFEWHEDVSLITVLYQSDVQNLQVKTPQGWQDIQADDTGFLI NCGSYMAHITDDYYPAPIHRVK
DGQLLSFEDHLDVSMITVLFQTQVQNLQVETVDHWRDIPTSENDLVNCGTYMAHVTYDYFPAPNHRVK
DGTKLSFEWHEDVSLITVLYQSHVQNLQVETAAGYQDIEADDTGYLINCGSYMAHLTNNYYKAPIHRVK

WVNEERQSLPFFVNLG FNDTVQPWDPSKE- DG K -TD- QRP- --ISYGDYLQ NGLVSL NK- NGQT Pen.
WVNEERQSLPFFVNLGWEDT IQPWDPATAKDGAKDAAKDKPAI SYGEYLQ GGLRGLNKKNGQT Acr.
F VNAE RLSLPFFLNGGHE AV IE PFVP-- -- -- -EGASEEVR—NEAL SYGDYLQHGLRAL I VKNGQT Str.
WVNAERQSLPFFVNLGYD SV IDPF DP-REPNG- K - SD----- REPL SYGDYL QNGLVS L INKNGQT Asp.

Az enzim specificitását részletesen vizsgálták a Penicillium chrysogenum és Acremoniun chrysogenum
tenyészetekből nyert cikláz készítmények esetében. A kisérletekben nem csak a penicillin, a kefalosporinok és a
kefamicinek közös intermedierjeként elfogadott o-L-o-aminoadipil-L-ciszteinil-D-valin tripeptidet, hanem a
fenilacetil-L-ciszteinil-D-valin peptidet is felhasználták szubsztrátumként. A reakcióelegy 250 ml térfogatban
(összetétele 30 mM Tris-puffer /pH 8/ 0,1 mM ferroszulfát, 1 mM aszkorbinsav, 2 mM ditiotreitol, 0,2 mM - 2
mM tripeptid dimer formában) 0,3 mg enzimkivonatot tartalmazott. Mindkét faj genetikailag nemesített, ipari
38
termelésre kiválasztott törzseiből nyert enzimkivonat 25
o
C

-on képes volt
kialakítani az azetidinon szerkezetet. A bioszintézist azonos térfogatú metanol
hozzáadásával állították le. A benzilpenicillin képződés nagyságrendi eltérést
mutatott. Az Achremonium chrysogenum-ból kinyert szintetáz topológiai
felépítettsége is a penám szerkezetű vegyület képződésének kedvez. D-valin
tartalmú tripeptidből csak izopenicillin-N képződik. A D-valin helyett D-o-
aminovajsavat tartalmazó tripeptidből viszont kisebb mennyiségű cefám
szerkezetű termék képződése is megfigyelhető. D izoleucint tartalmazó
tripeptidből in vitro ugyancsak penám vázú és cefám vázú vegyületek
képződnek. A szintetáz topológiai felépítettsége a penám vegyület képződésének
kedvez.

Achremonium chrysogenum-ból izolált izopenicillin N szintetáz jelenlétében az L-o-aminoadipil-L-ciszteinil-D-
o-aminobutánsav sztereoszelektíven deuterált származékaiból normetil-penám és normetil-cefám szerkezetű
vegyületek képződnek. A képződés arányát a nyíl vastagsága jelzi. A cefám szerkezetű termék képződésekor
természetesen a C
3'
deuterium megőrzi térbeli helyzetét.





39
Izopenicillin aciltranszferáz (IAT)
Ez az enzim mikroszómában működik.Cephem szerkezetű antibiotikumot termelő törzsekben ez az enzim nem
képződik.A penicillint termelő mikroorganizmusokban az aatA/penDE gén által kodolt enzim az izopenicillin-N
hidrofil természetét fokozó L-a-aminoadipinsavat valamilyen aktívált formában (acil-S-CoA) jelenlevő hidrofób
természetet fokozó karbonsavra cseréli. Ha a tenyésztő közegben fenilecetsav van jelen, akkor benzil-penicillin
képződik. Fenoxiecetsav adagolás hatására V penicillin képződik.

H H CH3 G-penicillin KÉPZŐDÉS H H CH3
: : | : : |
HOOC-CH-CH2-CH2-CH2-CO-NH-C---C—S—C-CH3 (BENZIL)--CO-NH-C---C—S—C-CH3
| | | | |

| | +
NH2 O=C---N--------C-H penicillinaciláz O=C---N-------C-H
: :
COOH (BENZIL)-CO-S—CoA COOH
izopenicillin-N
Adenil-C=O
|
H H H H H H H-C-H
H–C— C—C–H NAD
+
NADH H–C—C—C–H |
H H ATP PP H-C-H
+ |
HO-C—N—C-H dehuidrogenáz O=C —N—C-H (oxoprolináz) H-C-H
H | | | | oxopiperidináz |
H COOH H COOH H-C-NH2
|
6-oxopiperidin-karbonsav COOH
Reakció közben az aminoadipinsav átmenetileg gyürűs formában, 6-oxopiperidin-2-karbonsav formájában
szabadul fel. A reakció a glutation által segített glutamil-acil transzferáz reakciókor észlelt oxoprolin
képződéssel analóg. A képződő gyűrűs forma ez esetben ATP felhasználásával oxoprolináz segítségével
aktiválódva vegyesanhidridként vesz részt a jól ismert glutation szintézisben. A penicillint termelő szervezetben
az oxopiperidin-karbonsav regenerálása is megtörténik és az ATP felhasználásával atíválódó L-o-
aminoadipinsav egy újabb tripeptid képződésében vehet részt. Veszteségként ipari körülmények között az a
hányad jelentkezik, amelyik a sejtből a környezetbe kerül. Méréseink szerint a fermetlében megjelenő
oxopiperidin karbonsavat már nem veszi fel a tenyészet. Ugyanígy - valószínűleg felvételi nehézségek miatt -
nem lehet fokozni az azetidinon képződést a táptalajhoz adott L-o-aminoadipinsavval.
A Penicillium chrysogenum-ban és az Aspergillus nidulans-ban képződő 357 aminosavat tartalmazó
izopenicillinaciltranszferáz (IAT) nagyfokú hasonlóságot mutat. Az 1275 illetve 1237 DNS bp -ból képződő
enzim moltömege 39943 illetve 39240. Ezzel szemben. a baktériumokban, például Escherichia coli ATCC
11105 törzsben előforduló —(a 6-aminopenicillansav előállításához is felhasznált)— hasonló funkciót betöltő
penicillin aciláz aminosavszekvenciája alig (11 %-ban) hasonlít a gombákban működő enzimekhez.

Izopenicillin epimeráz
Cephem szerkezetű antibiotikumot termelő törzsekben képződő penicillin az izopenicillinből képződik.
A cefD gén által kodolt izopenicillin-epimeráz, az L-o-aminoadipinsav építőelemet irreverzibilisen
enantiomerjévé alakítva katalizálja a D-o-aminoadipinsavat tartalmazó penám váz képződését. A gyűrűtágítást
végző enzim ugyanis csak N-penicillint fogad el szubsztrátumként.

NH
2
H

H

CH
3

| H H H

: :

|
H--C--C--C--C--C--N--C----C----S----C---CH
3
| H H H || |

| | | izopenicillin N
COOH O H C

----N---------C--H
L-o-amino adipinsav || :


O COOH
izopenicillin
COOH H H CH
3
epimeráz
| H H H

: :



|
H--C--C--C--C--C--N--C----C----S----C---CH
3
| H H H || |

| | | penicillin N
NH
2
O H

C----N----------C--H
D-o-amino adipinsav || :
O

COOH


40

Gyűrű tágítás Ring expandáz (REX) Cephem váz képződés


A cefém váz kialakítását gyűrűtágítással az expandáznak nevezett vasat tartalmazó dioxigenáz
enzimkomplex, a DAOC-szintetáz végzi. Molekuláris oxigén felhasználásával alakítja ki a telitetlen dezacetoxi
cefalosporin C (DAOcefC) vegyületet. Feltételezhető egy hidroxilezett származék átmeneti képződése (az ábrán
zárójelben ), amelyből víz távozásával jelenik meg a cephem szerkezet. Az expandáz által előállított vegyület, a
dezacetoxi cephalosporin-C még két helyen hidroxilezhető a cephem vázat kialakító törzsek enzimkészletével. A
kettős kötés mellett levő metil csoport és az amino csoportot hordozó C
7
atom hidroxilezése minden esetben
dioxigenáz működését igényli. A légköri oxigén egyik atomja a szénvázhoz; a másik oxigén atom pedig a
koreduktánshoz kapcsolódva, az o-ketoglutársav—>szukcinát átalakulást segíti CO
2
képződés közben. (Hasonló
rekció alakítja posztszintetikusan az élő sejtben működő fehérjékben levő prolint hidroxiprolinná, vagy a lizint
hidoxilizinné.) In vitro körülmények között aszkorbinsav is adandó a reakcióelegyhez. Az Acremonium
chrysogenum-ban a cefEF gén által kodolt gyürűtágitó és hidroxilező enzimkomplex a metilcsoportot
hidroxilezve a dezacetilcephalosporin C képződését segíti. A DAcefC acetilezését a cephalosporin C szintézis
befejező lépéseként — a cefG gén terméke — a dezacetilcephalosporin C acetil transzferáz (DACAT) végzi.
A Streptomyces clavuligerus-ban a cefE gén terméke a DAOcefC képződését segíti. A metil csoportot a
cefF gén terméke hidroxilezi. A dezacetilcephalosporin C hidroxil csoportját a cmcH gén által kodolt DAC
karbamoil transzferáz karbamoilezi. Az amino csoportot hordozó C
7
atomot a cmcI gén terméke hidroxilezi. A
hidroxil származék metilezését pedig a cephamycin C szintetáz végzi. Megjegyzendő, hogy az Acremonium
chrysogenum fermentlevében a 7-metoxi cephalosporin C származék alig kimutatható


COOH H H


| H H H : :


H—C—C—C—C—C—N—C—C—S—CH
2
|

H

H

H || |

| | | dezacetil-cefalosporin C
NH
2
O



H

C—N—C

=

C—CH
2
-OH
||

| CO
2
ATP Gln


O COOH



COOH

H H 3-hidroximetilceph-3-em


| H

H

H



: :

O-carbamoiltranszferáz


H—C—C—C—C—C—N—

C—C—S— CH
2
NH
2
|

H

H H || |

| | | |
NH
2
O H

C—N—C

= C÷CH
2
÷O÷C=O

PP Glu




|| |


O COOH (carbamoil-cefalosporin)


7-demetoxicephamycin
COOH CH
3
-O H


| H

H

H



: : 7-o-hidroxiláz


H—C—C—C—C—C—N—

C—C— S— CH
2
NH
2
(Fe
++
dioxigenáz)


| H

H H || |

| | | | cephamycin szsintetáz
NH
2
O H

C—N—C

== C÷CH
2
÷O÷C=O

metionin ATP B
12

|| |






O COOH cephamycin-C













41

A ß-laktám antibiotikumok szintézise a fonalas gombák fiziológiailag legaktívabb részében, a csúcssejtben
történik. A pellet képződés ebből a szempontból is hasznos, meert a néhány tized mm átmérőjű göbök felületéről
nagy számban rövid fonalak nyúlnak a környezetbe. Kis térfogatra sürítve nagy mennyiségben növekedő
fonalak, jól levegőztethető csúcs sejtjeiben történhet a hatóanyag képződése.





Penicillin szintézis a csúcs-sejtben
42
CEPHEM származékok képződése Acremonium chrysogenum tenyészetében

COOH H H CH
3

| H H H

: :



|
H--C--C--C--C--C--N--C----C----S----C---CH
3
| H H H || |

| | | penicillin N
NH
2


O H


C----N---------

C--H
|| : Fe
++
O
2



O

COOH pen N dioxigenáz
expandáz
COOH H H HO-CH
2

| H H H

:

:

| nemizolált
H--C--C--C--C--C--N--C----C----S----C---CH
3
feltételezhető

| H H H ||

|

| | | köztestermék
NH
2


O H C

----N---------C--H
|| :


O

COOH

COOH

H H
| H H H



: :


H--C--C--C--C--C--N--C----C----S----CH
2
| H H H || |

| | | dezacetoxicefalosporin C
NH
2
O

H

C

----N---C

==

C--CH
3

|| | Fe
++
O
2




O COOH DAOcefC dioxigenáz
DAC-hidroxiláz
COOH H H
| H H H :

:


H--C--C--C--C--C--N--C----C----S----CH
2
| H H H || |

| | | dezacetilcefalosporin C
NH
2
O

H

C

---N----C ==C--CH
2
-OH
|| | acetil-CoA
O COOH DAcefC cephalosporin
acetiltranszferázáz
COOH H H
| H H H

: : CoA-SH
H--C--C--C--C--C--N--C----C---- S----CH
2




O

| H H H || |

| | |

|| cefalosporin C
NH
2


O H

C----N- --C == C--CH
2
-O-C--CH
3

|| |
O COOH cef C Fe
++
O
2


COOH HO H (dioxigenáz )
| H H H

: : cephalosporin C
H--C--C--C--C--C--N--C----C----S ----CH
2
O hidroxiláz

| H H H || |

| | |

|| 7o-hidroxi-cefalosporin C
NH
2
O H C----N- --C == C--CH
2
-O-C--CH
3



|| |
O COOH




A gombákon kívül azetidinon szerkezetű hatóanyagot termelének a prokaroták. Lásd a jegyzet 24.-ik oldalon
feltüntetett eredményeket





43




Cephem származékok képződése a prokariotákban
44
A részletesen vizsgált Streptomyces clavuligerus a vázlaton bemutatott Cephamycin C termelése mellett erős
penicillinázt gátló hatóanyagot termel. Ez a vegyület a ß-laktamáz enzimek aktív centrumába hatolva inaktíválja
a penicillin rezisztenciát okozó fehérjét A hatűásos anyag bioszintézise arginin és slicerinaldehid-3-foszfát (GAP)


kondenzációjával indul, amit azetidinon gyürű kialakítása követ. A végterméken lívül a fermentlében néhány
köztes termék jelenlétét is igazolni lehet


Az ábrán bemutatott eddigi vizsgálatok szerint a clavulánsav képződést a cephamycin C bioszintézist szabályozó
( CcaR ) fehérje is képes befolyásolni. Ugyanakkor a clavulánsav bioszintézist egy az előzőtől különböző fehérje
( ClaR ) szabályozza (regulálja), mégpedig az ábrán jól látható három helyen. Ez a szabályozó fehérje nem
befolyásolja a cephamycin képződést.


A géncsoportok szabályozottságát bemutató ábrán az együtt átíródó csoportokat hullámvonal jelöli
45



A clavulansav hatásmódjának vázlata


46
A PENICILLIN KÉMIAI SZINTÉZISE.

A kémiai szerkezet ismeretében a korabeli technológiák ismeretét hasznosító peptidkémikusok megkisérelték a
penicillin totálszintézisét. A penicillamin szintézisére viszonylag könnyen adódott módszer. Az Erlenmeyer féle
azlakoton szintézissel acetonból és hippursavból nyerhető 2-fenil-4-izopropilidén-oxazol-5-on-ból
nátriummetilát jelenlétében a benzil-tioéter származék képződik. A lakton gyürű felnyitását a benzoesav
eltávolítása követte. A tioéter származékból a DL penicillamint De Vigneaud szerint végzett hidrogenolízissel
állították elő. Rezolválásra több lehetőség adódik. Az egyik előnyös módszer szerint a benziléterrel formilezhető
penicillamin brucin sójából az L-enantiomer jól kristályosodik. Az anyalúgban maradó D enantiomer
hidrogenolízisével nyerhető a D-penicillamin.

A penaldsav-etilésztert reagáltatva a D-penicillaminnal penicillosav etilészter képződik, amelyből dioxánban
foszfortriklorid és jégecet jelenlétében kialakítható a penám váz tiazol gyürűje. A termék 1-2%-os hatásfokkal
enantiomerek elegyét szolgáltatja. Ez nem tekinthető járható útnak.
A szerveskémiai szintézis módszereinek gyors fejlődése, különösen a peptidszintézis fejlesztése közben
kialakított új módszerek alkalmazása az ötvenes években már racionálisabb szintézis kidolgozását tette lehetővé.


A ftálimid védőcsoport irányító hatása, a tercierbutilészter csoport könnyű eltávolíthatósága és az N-
diciklohexil-karbodiimid alkalmazása jelenti az ugrásszerű fejlődést. Sheehan és munkatársai 1955-ben
47
ismertetik a benzil-penicillinnél lényegesen stabilabb V-penicillin szintézisére vezető eljárásukat. Az első
reakciólépésben a penicillamin hidroklorid nátriumacetáttal pufferolt vizes etanolban reagál a tercier-
butilftálimido-malonaldehiddel. A ftalil-csoport eltávolítását hidrazinkomplex képzésén keresztül sósavval
végezték ecetsavban szuszpendálva. A tercier-butiloxikarbonil-tiazolidin származék aminocsoportját
egyenértéksúlynyi fenoxi-ecetsavkloriddal acilezték két ekvivalens trietilamin jelenlétében. A tercier butiloxi
csoport eltávolítását metilénkloridban vízmentes sósavval végezték, amit átkristályosítás követett ekvivalens
piridint tatalmazó vizes acetonból. A gyürűzárást ekvivalens mennyiségű N-diciklohexil-karbodiimiddel
végezték vizes dioxán oldatban. A kapott termék aktivitása megegyezett a fermentációs úton nyert termékkel. A
tritil védőcsoport alkalmazása megadta a lehetőséget a penicillin mag, a 6-amino-penicillansav totálszintézisére.
A ftalil csoport eltávolítása elött a karboxil csoportot észterezték. A tercier-butiloxi védelem eltávolítása után
dietilamin jelenlétében tritilezték az aminocsoportot. Ezt követte a gyürűzárás, amit N,N’-diizopropil-
karbodiimiddel hajtottak végre dioxánban D-o-4-karbometoxi-5,5-dimetil-o-tritilamino-2-tiazolidin-ecetsavból.
Aluminium-oxidon végzett kromatografálással kristályos formában nyerték a 6-tritilamino penicillansav-
metilesztert. Ebből az észter hidrolízisével dietilamin sót nyertek, majd híg sósavval a tritilcsoport eltávolítása
következett.
A penicillin totálszintézise az enantiomerek előállítására is lehetőséget adott. Ezek a vegyületek
azonban érthető okokból biológiai aktivitást alig mutattak (0,7% a természetes származékkal összehasonlítva). A
totálszintézis területén elért tudományos eredmények gazdaságos gyártásra nem adtak lehetőséget. A ß-laktám
antibiotikumok előállítására ma is a fermentációs eljárást használják. Korszakalkotó jelentőségű viszont, hogy a
kutatók figyelmét a félszintézissel előállítható új penicillin származékok irányába mozdította.

PENICILLIN ANALÓGOK ELŐÁLLÍTÁSA FÉLSZINTÉZISSEL
Nagy áttörést jelentett Chain és munkatársainak az a felismerése az ötvenes évek végén, hogy a penicillin
alapváz 6-aminocsoportja tetszőleges reagenssel acilezve új
nagyhatású penicillin származékok előállítását teszi lehetővé. A
biológusok, már évekkel előbb (Kato 1953) közölték a
savkomponens nélküli, úgynevezett penicillin mag képződését. Sőt
japán szerzők már 1950-ben leírták a fenilecetsav mikrobiológiai
úton történő eltávolítását. Ezek a japán nyelven megjelent
közlemények elkerülték a kutatók figyelmét.A mikrobiológiailag
előállított alapmolekula kémiai acilezésének gondolatát talán
Sheehan és munkatársainak 1955-ben közzétett eredményei hívták
elő. Hamarosan mikrobiológiai eljárás született a félszintézishez
használható 6-amino-penicillansav előállítására.
Prekurzor nélkül végzett fermentációs eljárásokon
kívül sikerrel alkalmaztak biokonverziós módszereket a
félszintézishez szükséges alapanyag előállítására.
Hamarosan kiderült, hogy a prekurzor nélküli
direktfermentációs eljárás közel egy nagyságrenddel
alacsonyabb kihozatala miatt nem kerülhet ipari
alkalmazásra.
A gyógyszeriparban nagymennyiségben gyártott
mindkét penicillin féle (G, és V penicillin) felhasználható
kiindulási anyagként. A Gram-negatív baktérium
törzsekben (Escherichia coli) előfordul egy fenilecet-
savval indukálható enzim a penicillin-aciláz (penicillin
amidáz), amely képes reverzibilisen a G-penicillint
fenilecetsavvá és 6-amino- penicillansavvá bontani. Más
baktérium csoport tagjai - az Achromobacter és
Streptomyces fajok - a V-penicillint bontják 6-
aminopenicillansav és fenoxiecetsav képződése közben.
Ezek az enzimek eredetileg valamilyen transzacilezési
folyamatot katalizálnak. Lúgos pH a hidrolízisnek, a
savanyú pH a szintézisnek kedvez. A reverzibilis reakció teljessé tételét a hidrolízis termékek eltávolítása segíti.
Példaként említhető a képződő sav semlegesítése trietanolamin adagolásával. A reakció elegyben feldúsuló 6-


48
aminopenicillan sav az oldatban levő széndioxiddal reagálva inaktíválódhat. Semleges pufferben, széndioxid
jelenlétében 37 fokon három óra alatt akár 50%-a képes alkalmatlan termékké alakulni. Az először képződő
karboniloxi származékból a penillin átrendeződéshez hasonlóan imidazolon származék képződik. Ennek enol
alakja könnyen dekarboxileződve a 6-aminopenicillansav stabil, de inaktív izomérjét szolgáltatja. A másik
inaktiválódási lehetőség a polimerizáció, amit maga a reverzibilisen működő amidáz végez a termékkoncentráció
növekedésekor. Ezeket a zavarokat kiküszöbölendő általában rögzített enzimmel működő eljárást használ a
gyógyszeripar.
Az amfoter tulajdonságú végtermék kinyerésére előnyösen használható az adszorbciós gyanta, vagy az
ioncserélő módszer, de kellő nagy koncentráció esetében izoelektromos ponton (4,3 pH) történő kristályosítással
is elkülöníthető a reakcióelegyből az értékes termék (6-APS).
A félszintézishez használható alapanyag (6-APS) nagyvolumenű előállítására, illetve a fenoxiecetsav
tetszőleges csoporttal való kicserélésére kémiai megoldás is ismeretes. Első lépésként a penicillin karboxil
csoportjának a védelme alkil-szililészter képzésével oldható meg. A kapott reakcióterméket -30
o
C alatt
iminohalogenidet képző reagenssel, például foszforpentakloriddal hozzák össze. Az átmeneti termékként
képződő N-monoszubsztituált imino-kloridot alkohollal reagáltatva imino-éterré alakítják, amelyből az iminoéter
csoport és a védőcsoport hidrolízisével nyerhető 6-aminopenicillan sav.


Ezek az eljárások gazdaságos lehetőséget jelentettek félszintézissel előállítható új penicillin származékok
nagyipari előállítására.
Általában — így az oxacillin előállításakor is — savkloridokat használnak acilező szerként.

Egyes esetekben az enzimes szintézis is szerepet kap, kihasználva a penicillin- (aciláz) amidáz reakció
reverzibilis voltát. Különösen előnyös az enzim, ha ezzel elkerülhető a védőcsoport használata. Igy
gazdaságosan nyerhető az ampicillin
fenilglicin-tioglikolsav észterből és 6-
aminopenicillansavból penicillin-aciláz
enzimmel savanyú közegben végzett
reakcióval.
A hatvanas években előállított
sok ezer új vegyület között több száz
hatásos ter mék akadt. Ezek az új
származékok a fermentációs úton
előállítható két (G- és V-penicillin)
származéknál előnyösebb terápiás
hatásúak. A savamid kötés közelében
elhelyezett nagy térkitöltésű szubsztituens

Ampicillin előállítása Escherichia coli tenyészetével
49
(methicillin, penbritin) védelmet jelentett a penicillináz inaktíváló hatásával szemben. A savállóságot növelte a
savamid kötés közelében elhelyezkedő elektronszívó csoport (oxacillin, cloxacillin, flucloxacillin). A baktérium
spektrum szélesítése céljából előnyös volt az amino csoportot tartalmazó arómás savvakkal (fenilglicin, p-
hidroxi-fenilglicin) történő acilezés (ampicillin, amoxicillin). Szabad karboxil csoport jelenléte (fenilmalonsav) a
Pseudomonas fajok leküzdésére is alkalmassá teszi az új származékot (carbenicillin). A penámváz karboxil
csoportját érintő kémiai átalakítások (pl.G-penicillin acetoximetilésztere) az alkalmazhatóságot befolyásolhatják
(maripen). A félszintézissel előállított új származékok antibakteriális hatása (MIC érték) is kedvezően
megváltozhatott. Eltérést találtak a felszívódásban, a kiürülésben, a vérszint alakulásában.
A hetvenes években a félszintetikus penicillin származékok mellett egyre nagyobb jelentőséget nyernek
a cefalosporin származékok. Cephalosporin-C-ből induló félszintetikus termékekhez vezető út első feladata a D-
o-aminoadipinsav oldallánc eltávolítása. A D-o-aminoadipinsav egyetlen fermentációs lépésben való
eltávolítása nem könnyű feladat. Egyetlen meg nem erősített japán közlemény állítja a reakció végbemenetelét.
Ezzel szemben jó hatásfokkal távolítható el az oldallánc két független fermentációs lépésben. Először
Trigonopsis variabilis tenyészlevében az aminocsoport oxidatív eliminációja következik be hidrogénperoxid és
ammonia felszabadulásával. A második lépésben a ketosavat egy Pseudomonas törzs távolítja el. Az acetil
csoport hidrolízisét Bacillus subtilis tenyészetével végezve, igen jó hozammal lehet nyerni 7-amino-dezacetoxi-
kefém származékot, amely a félszintetikus kefém vázú antibiotikumok előállításához használható alapvegyület.
A kefém alapváz nagyobb stabilitása miatt 7-amino-kefalosporánsav (7-ACA) előállítása jó hatásfokkal
történhet kémiai úton a 6-APS előállítási eljárás analógiájára.
A nitrogén-tercier-butiloxikarbonillal védett kefalosporin-C dibenzil észterét piridinben foszfor-pentakloriddal
alacsony hőmérsékleten,(cseppfolyós nitrogén) iminokloriddá alakítják, amiből alkoholizissel imino-éter
nyerhető. Az ezt követő hidrolízis, valamint a védőcsoportok eltávolítása ma már a peptid szintézis rutin
feladata. A 7-aminocsoport ezután bármely savkloriddal ismert klasszikusnak tűnő módszerekkel acilezhető.

7-amino-kefalosporin C kémiai előállítása
A kefém váz, összehasonlítva a penám váz adta lehetőséggel, lényegesen nagyobb variációs lehetőséget biztosít,
mert a vázban jelenlevő elektronrendszer kvázi konjugált volta az alapváz |-laktamáz rezisztenciáját hozza. Ez
50
azt jelenti, hogy nem kell a rezisztenciát kikényszerítő szubsztitúcióra törekedni. Tovább bővíti a lehetőséget az
O-acil csoport változtatása. Az acetil csoport ugyanis nukleofil szubsztitúcióval könnyen cserélhető bármilyen
kéntartalmú vagy nitrogéntartalmú csoportra. Ezen az úton jó hozammal nyerhető a kefalotin és a kefaloridin

Több ezernyi félszintetikus kefalosporin származék között néhány igen hatásos készítmény akadt. A
származékok előállításakor a szerkezeti analógiára való tekintettel sikerrel használták az úgynevezett
félszintetikus penicillinszármazékok vizsgálata közben szerzett tapasztalatokat. Termékenyítőleg hatott az új
antibiotikumok utáni kutatás közben gyűjtött új ismeretanyag, a kémiai szerkezetek biológiai hatásmódjának
egyre részletesebb megismerése. A nocardicin-A antibiotikumban előforduló oximino szerkezet például
előfordul az igen hatásos kefotaxim nevű származékban.

A 7-ACA tercier-butilészterét klóracetil védőcsoportot tartalmazó metoximino-tiazol származék
savkloridjával acilezik piridin jelenlétében. A klóracetil védőcsoport tiokarbamiddal távolítható el, majd a
tercier-butilészterből trifluor-ecetsavval szabadítható fel a kefémsav származék. A biológiai hatás szempontjából
döntő jelentőségű, hogy a metoximino csoport a karbonilhoz képest szin helyzetű legyen. A |-laktamáz enzimet
ugyanis csak a szin izomer gátolja. A metoximino-tiazol származék szintézisekor ezért a gyűrűzárást vizes
közegben, szobahőmérsékleten végzik. Magasabb hőmérséklet és alkoholos közeg ugyanis az antiizomer
képződésének kedvez.

Széles spektrumú, savstabil és |-laktamáz rezisztens a kefoxitin, amelyik nemcsak az acetoxi-
metilcsoport helyett karbamoil-oximetilcsoportot, de a Streptomyces törzsek tenyészlevéből a Merck és az Eli
Lilly kutatói által izolált kefamicinekben felfedezett 7-o-metoxi csoportot is tartalmaz. A szintézis első
lépéseként a dezacetil-7-aminocefalosporánsav tercier-butiloxi-karbonillal védett származékát karbamoilezik,
majd a védőcsoport eltávolítása után a szililezést követi a tiophen-ecetsav-kloriddal végzendő reakció. A
befejező szakaszban bróm-szukcinilimiddel állítják elő a 7-o-bróm származékot, amelyből metanollal
reagáltatva ezüstoxid jelenlétében nyerik a kefoxitint.

Az Acremonium chrysogenum-ban természetes körülmények között végbemenő gyűrűtágítási reakció
kémiai megfelelője iparilag is végrehajtható. A cefém váz a viszonylag olcsó V-penicillinből oxidáló
reagensekkel előállítható szulfoxid köztiterméken keresztül könnyen kivitelezhető reakcióval nyerhető.



A tiazolidin gyűrű átrendeződése p-toluolszulfonsav jelenlétében refluxolva következik be. A fenoxiecetsav
eltávolítására kémiai illetve enzimológiai módszer használható. Az így nyert 7-amino-dezacetoxi
cefalosporánsavból készül a kefalexin, mégpedig tercier-butiloxi-karbonillel védett D-fenil-glicinnel való N-
acilezéssel, majd a védőcsoport eltávolításával.

Kémiai gyürütágítási reakcióval nyerhető a 6-aminopenicillansavból a moxalaktám. Ebben a
vegyületben a clavulánsav analógiájára a kén atom helyett oxigén található. Az anellált oxazol gyürű a |-laktám
gyürű biológiai aktivitását jelentős mértékben növeli. A 7-aminocsoportot p-hidroxi-fenilmalonsav acilezi, de
megtaláljuk a molekulában a 7-o-etoxi csoportot is. A C
3
atomhoz 2-merkapto-1-N-metil-tetrazol kapcsolódik.

Itt említhető a gyógyszerként sikeres monobactám, az azthreonam. Kezdetben félszintézissel 6-amino-
penicillan savból állították elő, ma több gazdaságosan kivitelezhető totálszintézise ismert. Első lépésként
elkészítik a treonin tercier-butiloxi-karbonillal védett származékát. Ehhez kapcsolják a metoxiamint 1-etil-3,3-
dimetilamino-propil-karbodiimidet használva kapcsoló ágensként. A gyürűzárást megelőzi a metán-szulfonil-
kloriddal végzett metilezés. A gyűrű kialakítása kálium-karbonátot tartalmazó acetonban refluxolva végezhető.
Az N-metoxi csoport eltávolítása reduktív hasítással történik. A szulfonilezést dimetilformamidban végzik, az
aminocsoportot hangyasavban melegítve szabadítják fel. Ezt követi a megfelelő oximino-savkloriddal való
acilezés. A szin állású oximino csoport biztosítja a |-laktamázzal szebeni védelmet

51

Azthreonam kémiai totálszintézise
Boc Boc
| | dmf
CH3 CH3 N-H H Na H-N H SO3
HO-C-H Boc2O H-C-O-SO2-CH3 H--C-----C---CH3 H—C----C—CH3
H-C-NH2 H-C-NH-Boc K2CO3 | | cseppfolyós NH3 | |
O=C CH3-O-NH2.HCl C=O O=C-----N—O-CH3 O=C----N-H N(Bu)3
HO CH3-SO2Cl H-N÷O÷CH3 reflux
acetonban

S ---- C-H O
| || ||
Boc
+
H3N÷C=N÷C ÷ C ÷÷ C ÷÷ N-H H
| + || | |
dmf N-H H H3N H O ÷ N H

C÷÷÷÷C

CH3
H—C----C---CH3 H---C----C---CH3 | | |
SO3 | | HCOOH | | H3C-C-CH3 O=C-------N
O=C----N O=C----N COOH SO3
N(Bu)4 SO3
-
SO3
-
AZTHREONAM


Gyógyászati felhasználásra került azetidinon szerkezetű antibiotikumok

G-penicillin kálium (Benzilpenicillin kálium só) Vízben jól
oldódó só. Mivel a gyomornedv inaktíválja, parenterá-lisan
adagolják. Rövid idő alatt magas vérszintet ad, majd a
vesetubulusokon keresztül a vizelettel 3-4 óra alatt távozik.
Ezért négy-hat óránként adagolva napi adagja 200000-
1000000 NE. Kristályos formában porampullá-ban hozzák
forgalomba. 1 mg kristály 1989 NE aktivitást képvisel

Prokain-penicillin (Retardillin) Benzil penicillin p-
aminobenzo-esav-N-dietilamino-etilészterrel alkotott
sója. Vízben nehezen (1 g 250 ml-ben) oldódik. Tartós
vérszint biztosítására használható, mert csak oldódás
után a disszociált szabad G-penicillin hatásos. Az injekció a prokain só szuszpenzióján kívül valamilyen
szuszpendáló anyagot és a kívánt vérszint gyors elérése céljából valamennyi benzil-penicillin kálium sót
(promtcillin) is tartalmaz. Adagolása 300000-600000 NE naponta két alkalommal. A készítmény hatásos
vérszintet tart 12-16 órán keresztül.
BED penicillin (Beacillin) N,N’-difenil-etiléndiamin-dipenicillin-G. Vízben savanyú és semleges körülmények
között alig oldódó só.(1g 5 liter vízben oldható fel). Ez a tulajdonság szájon keresztüli adagolását, (gyermekek
részére szirupos formában) teszi lehetővé.

V-penicillin (Vegacillin) Fenoximetil penicillin. 1948-ban fedezték fel, de
csak 1953-tól használják savtűrő penicillinként. Vízben a szabad sav
rosszul oldódik (1g 1.2 literben) A tablettákban 200000NE aktivitás
mérhető. Adagolása 3-4 tabletta naponta elosztva étkezés előtt fél órával. A
maximális vérszint egy órán belül érhető el.

Maripen. A benzil penicillin acetoxi-metilésztere. A vízben alig
oldódó anyag nagyobb hányada átvészeli a gyomorban töltött időt.
A bélbe kerülve az ott működő észterázok felszabadítják belőle az
oximetil-penicillint, amely spontán hidrolizál G-penicillinné. Ez
felszívódva rövid idő alatt hatásos vérszintet eredményez. A tabletta hatóanyag tartalma 500000 NE. Naponta
elosztva négy tablettát célszerű bevenni étkezés előtt fél órával.
Methicillin, (2,6-dimetoxi-fenil-penicillin nátrium só) 2,6-
dimetoxibenzoil-kloriddal acilezett 6-APS. Vízben igen jól oldódó fehér
kristály. Parenterálisan izomba vagy vénába adják. A vizelet változatlan
formában távolítja el a szervezetből. A feloldott antibiotikum hűtve sem
tárolható 24 óránál tovább. Életmentő gyógyszerként a penicillin
rezisztens törzsekre is hat annak ellenére, hogy a penicillináz képződését
indukálja. Ezért methicillin után nem célszerű G vagy V penicillinnel a
kezelést. Penicillináz rezisztenciáját a |-laktám gyűrűt árnyékoló két metoxi csoportnak köszönheti.





52
Oxacillin. (5-metil-3-fenil-4-izoxazolil-penicillin nátrium
monohidrát) A 3 fenil és az 5 metil csoport térbeli gátlása
akadályozza a molekula kapcsolódását a penicillináz aktív
központjához. Az elektron szerkezete savtűrést biztosít.
Ezért per os adagolva is alkalmas a penicillin rezisztens
fertőzések leküzdésére. A kapszulában forgalmazott adag (250 mg) hatóanyag a bélből felszívódva egy óra
múlva hatásos vérszintet ad6. Erősen kötődik a plazmafehérjékhez. A vesén keresztül változatlan formában ürül.
Adagolása 4-6 óránként 2 kapszula egy órával az étkezés előtt. A flukloxacillin. 3-(2-klór-6-fluor)fenil-5-metil-
4-izoxazolil-penicillin nátrium só. Az aromás gyürűn az izoxazol gyürűvel orto helyzetben levő halogén atomok
hatására emelkedik a vérplazma antibiotikum szintje. Penicillináz szintézist indukáló, savtűrő vegyület, amely
penicillin rezisztens kórokozók ellen hatásos. Kapszulában és injekciós formában alkalmazzák. Per os adagolás
után egy órával alakul ki a hatásos vérszint. Az izoxazol szerkezetű penicillinek közül ez kíméli leginkább az
érfalat, az endoteliumot.
Ampicillin (Pembritin, Semicillin) D-o-amino-benzilpenicillin.trihidrát.
Az aminocsoport az antibiotikum baktérium spektrumát kiterjeszti.
Eredményesen alkalmazható a Gram negatív kórokzók, így az enterococcus
okozta fertőzések esetében is. Különösen hatásos akut hugyuti fertőzések
(Escherichia coli, Proteus mirabilis, etc.) leküzdésére. Az ampicillin amino
csoportja savanyú körülmények között protonálva van, ami bizonyos mértékű savstabilitást biztosít. Kapszulában
adagolva általában két óra alatt érhető el a maximális vérszint. A vesén keresztül változatlan formában ürül. Egy
kapszula 250 mg hatóanyagot tartalmaz, amiből hat óránként kell egyet bevenni. Injekciós adagoláshoz nátrium
sóját használják (porampullában).
Amoxicillin 6-D-o-amino-p-hidroxi-fenilacetamido-
penicillansav, az ampi-cillin p-hidroxi analógja. Baktérium
spektruma és kémiai stabilitása hasonló, de jobban szívódik
fel a bélcsatornából, ezért magasabb vérszintet ad. A
gyorsabb felszívódás miatt kevésbbé hatásos disenteria
esetében. A vesén keresztül változatlan formában ürül, ezért hat óránként kell egy egy kapszulát (250 mg
hatóanyag) adni.
Karbenicillin (Geopen) Dinátrium-a-karboxi-benzilpenicillin.
Savérzékeny, a penicillináz is bontja. Oldatában lassan
dekarboxileződik. Széles spektrumu, különösen hatásos a
Pseudomona, Proteus, Providencia fertőzések esetében.
Injekciós formában intravénásan adagolják szisztémás
fertőzések, idült hugyúti és epeúti fertőzések leküzdésére.
Adagolása négyszer naponta 1-2 g hatóanyag.

Kémiailag stabil, penicillináznak ellenálló, széles spektrumú
antibiotikum. Aktivitása több mint egy nagyságrenddel felülmúlja a
többi kefalosporin származékét. 7-D-2-karboxi-2-(4-hidroxil-fenil)-
-acetamido-7-o-metoxi-3-(1-metil-1,2,3,4-tetrazolil)tiometil-1-oxa-
1-detia-3-kefém-4-karbonsav dinátrium só. A klavulánsav
analógiájára a kénatomot oxigénre cserélik. Ez a váltás a biológiai aktivitását nagyságrenddel növeli. A 7-amino
csoportot p-hidroxi-fenil malonsav acilezi. Megtaláljuk a molekulában a 7-metoxi csoportot is. A C-3 atomhoz
2-merkapto-1-N-metil tetrazol kapcsolódik. A szervezetben nem bomlik, nagyobb részt a vizelettel ürül, de
jelentős a széklettel távozó moxalaktám mennyisége. Az irodalmi adatok szerint allergiás tüneteket nem okoz.
Hosszabb ideig használva az érfal károsodása figyelhető meg, vérzékenységet okozhat!

Azthreonam A kefalosporináznak és a penicillináznak ellenálló
totálszintézissel előállítható új monobaktám, amelynek stabilitását a szin
állású oximinocsoport biztosítja. Kezdetben 6-amino-penicillansavból
állították elő. Ma már több gazdaságos szintézise ismeretes Gram-negatív
baktériumok ellen jól használható, de Pseudomonas ellen is sikerrel
alkalmazható. 0.5 g dózisban 6 óránként izomba adagolják, mert a
szervezetből a vesén keresztül 6-8 óra alatt ürül.






53

Kefém alapvázat tartalmazó származékok


Kefalotin (Keflin, Cephalothin) Az első forgalomba került kefalonsporin származék 7-(2-tienil-acetamido)-
kefalosporánsav nátrium só. Széles spektrumú, savtűrő, penicillináz rezisztens antibiotikum. Parenterálisan
adagolják, mert a bélcsatornából nehezen szívódik fel. Hat óra alatt a bevitt mennyiség 60%-a változatlan
formában ürül a vesén keresztül. A máj észteráz aktivitása az acetoxicsoport hidrolízisét katalizálja. Adagolása
izomba naponta 4-6-szor 0.5-1 g hatóanyag. Izomba adva az injekció helyén izomfájás, vénába adva
tromboflebitisz előfordulhat. Az adagolás után 1 órával 7 mg illetve 17 mg vérszint mérhető.
Kefalexin (Keflex) 7-D-o-amino-fenilacetamido-3-kefém-4-karbonsav. Az o-aminocsoport a savtűrést, a 3-
metil csoport az észterázokkal szembeni érzéketlenséget biztosítja. Fiziológiás körülmények között az
aminocsoport egyrészt a penicillinázzal szembeni védelmet, másrészt a spektrum szélesedését biztosítja.
Savanyú körülmények között jól oldódik és könnyen felszívódik. Szájon keresztül adagolható naponta négyszer
250 mg hatóanyag. Sikerrel használható felsőlégúti fertőzés esetén. Különösen előnyös a hugyúti fertőzések
leküzdésében, mert a hatóanyag nagyobb hányada változatlan formában a vizelettel ürül, illetve bomlás közben
reakcióba léphet a glükózzal.
Kefaloridin (Cephalomycin) A kefalotin továbbfejlesztett változata. 7-(2-tienil-acetamido)-3-piridil-metil-3-
kefém-4-karbonsav betain. Vízben enyhén savanyú körülmények között jól oldódik, a bélből rosszul szívódik
fel, ezért parenterálisan izomba adagolják naponta négyszer 0.25-1 g mennyiségben. Hugyúti kevert fertőzések
és légúti fertőzések esetén is hatásos. Vizelettel változatlan formában ürül.
Kefoxitin.7-o-metoxi-7|-(2-tienil)-acetamido-3-karbamoil-oximetil-3-kefém-4-karbonsav Széles spektrumú,
penicillináz rezisztens, savtűrő antibiotikum. A bélcsatornából nem szívódik fel. Izomba adva 20 perc alatt
elérhető a maximális vérszint, nem okoz olyan fájdalmat, mint a kefalotin. Gyorsan ürül, nagyobbrészt
változatlan formában, de néhány százaléka dekarbamoileződik, majd tovább bomlik.
Kefotaxim. 7-cisz-2-metoxiamino-2-(2-amino-4-tiazolil)-acetamido-3-acetoximetil-3-kefém-4-karbonsav. Kis
koncentrációban is hatásos széles spektrumú antibiotikum. Képes inaktíválni a |-laktamáz enzimeket.Nemcsak a
penicillináz, de a kefalosporináz ellen is védett vegyület. Az amino-tiazol gyürű és az amidin gyök együttes
jelenléte fokozza a sejtfal transzpeptidázhoz való affinitását. A metoximino csoport térállása a penicillináz
rezisztencia szempontjából fontos. A máj észterázaktivitása a dezacetil-kefotaxim lakton képződést segíti elő. Ez
tovább bomlik ismeretlen metabolitokká. A parenterálisan adott antibiotikum 90%-a nagyobb részt eredeti
formában ürül a vesén keresztül. A különböző mértékben lebomló hányad mennyiségének csökkentése céljából
újabban a nehezebben bomló 3-oximetil származékát forgalmazzák.
Kefsulodin. Pseudomonas ellen hatásos széles psektrumú szulfokefalosporin származék. 7-(7-szulfonil-2-fenil)-
acetamido-3-(4-karbamoil)-piridilmetil-3-kefém-4-karbonsav nátrium só. Csak parenterálisan használható.
Izomba adva a beadás helyén izomfájdalom léphet fel. 0.5g kefszulodin 30 perc alatt 20-21 mg/ml vérszint
alakul ki, amely 100 perc alatt a felére csökken. Bomlástermékeinek megjelenését eddig nem mutatták ki.

54

A BAKTÉRIUMSEJTFAL KÉPZŐDÉSÉT GÁTLÓ ANTIBIOTIKUMOK
Ebben a fejezetben kémiailag egymástól különböző vegyületekkel ismerkedünk. Tárgyalásukat a
peptidoglükán sejtfalszintézist zavaró ß-laktám antibiotikumokat követően az indokolja, hogy ezek a
vegyületek a sejtfalépítésben szerepet játszó enzimek működését gátolva fejtik ki antibakteriális hatásukat.

GLYCOPEPTID antibiotikumok: VANCOMYCIN, TEICOPLANIN és társai
A Lilly kutató központban McCormick és
munkatársai 1956-ban Indiából illetve Indoneziából
származó talajmintákból izolált Amycolatopsis
orientalis törzs termékeként izolálták az első hét
aminósavat — köztük öt arómás aminósavat —
tartalmazó glikopeptidet (molekulattömege 1500 kDa)
a vancomycint, amely.szénhidrát komponensként
glükózt és hozzá kapcsolva vancózamint tartalmaz.
Penicillin rezisztens törzsekre való hatása miatt már
két év múlva engedélyezték a klinikai kipróbálását.
Röntgen diffrakcióval igazolt szerkezetét Sheldrick
csak 1978-ban közölte. Hatásmódja a |÷laktám
szerkezetű antibiotikumokhoz hasonlít, amennyiben ez
a glikolipid nagy affinitással kötődve a peptidoglükán
sejtfal szintázisét katalizáló rendszerhez, nevezetesen a
muramil pentapeptid D-Ala–D-Ala végződéséhez
nemcsak a peptid kötés kialakulását, de a glikozidos
kötés létrejöttét is lehetetlenné teszi.
Közeli rokonszerkezetű hatóanyagot, a
teicoplanint Actinoplanes teichomyceticus
tenyészlevéből 1978-ban izolálták. Hatásmódja és
kémiai szerkezete hasonló a vancomycinhez. Ez utóbbi
antibiotikumot termelő törzs azonban a hatóanyag hat
változatát állítja elő egyidejűleg, ezért
forgalombahozatalát az USA-ban nem engedélyezték.
Azóta a szakirodalomból újabb glikopeptidek
felfedezéséről értesülhetünk. Jellemző erre az
antibiotikum csoportra az oxigénfunkciót hordozó,
arómás para-hidroxi-fenilglicint, illetve ß-hidroxi
tirozint tartalmazó oligomer és az oxigén funkcióhoz
kapcsolódó hexóz illetve aminocukor komponensek
jelenléte.

Az aglikon rész többnyire hét arómás aminosavat tartalmaz
kivéve a vancomycint, amalyben az első aminosav N-metil-
(R)-leucin, a harmadik pedig (S)-aszparagin. Az antibiotikum
a periplazmikus térben egyedül vagy dimerként
hidriogénhidakkal kötődhet a peptidoglükán képződés
izoprenil foszfáthoz kapcsolódó építőelemének (N-acetil
glükozaminil-muramil pentapeptid) D-Ala-D-Ala végéhez.


55
A peptídóglükán sejtfal felépítése és a képződés gátlása antibiotikumokkal


A peptidoglükán építőelemhez kötődő vancomycin akadályozza a glikozidos kötés kialakulását a periplazmában.

56
Az építőelemhez kapcsolódó antibiotikum teljes mértékben blokkolva a prokarióta sejtfal képződését, elsősorban
a Gram pozitív baktériumok pusztulását okozza. Hatásos a Staphylococcus, Streptococcus, Corynebacterium,
Streptomyces, Clostridium fajok ellen. (MIC= < 4 ug). A penicillin allergia esetén pedig életmentő hatású lehet.
Sőt a penicillin, streptomycin és erythromycin rezisztens Staphylococcus aureus (régebbi nevén Micrococcus
pyogenes) törzsek ellen is sikerrel alkalmazható. Az esetleg megjelenő ototoxicitása és vesekárosító
(nefrotoxicitása) hatása miatt hosszan tartó használata nem ajánlott. A Lactobacillus és Enterococcus fajok
között több rezisztens törzs akadt. Ezek sok esetben olyan enzimet termelnek, amely módosítja a vancomycin
kötődését, de az induktív, illetve konstitutív rezisztencia kifejlődésére is találunk példát.



A rezisztencia kialakulásának különleges formája, amikor a glikopentapeptid utolsó tagjaként szerepló D
alanin helyett észter kötéssel D tejsav fordul elő.Ez esetben az antibiotikumnak a sejtfal építőelemhez való
kötődése meggyengül. A D-Ala-D-Ala csoporthoz lazán kötődő antibiotikum, a gyengülő kölcsönhatás miatt
nem képes akadályozni a glikozidos kötés kialakulását, azaz a törzs rezisztensnek tekinthető. Az utolsó
aminosav kicserélődése tejsavra a prokarióta sejtfal képződést nem zavarja, mert a transzpeptidáz az észter
kötést hasítva reagál a pentapeptidből származó tetrapeptiddel.. A rezisztens törzsekben működő, plazmid
hordozta enzimek (vanH, vanA, vanX és a szignál transzdukciót vezérlő vanS és vanR) jól ismertek
VanH o-keto-reduktáz
Piruvát D Lactát VanA depsipeptid ligáz
VanX D-Ala-D-Ala dipeptidáz —DAla-D-Lactát
—D-Ala—D-Ala — D-Ala

A rezisztens törzsben sokszor a pentapeptid utolsó aminosav összetevője D szerin. A terminális szakasz
tehát —D-Ala-D-Ser, ami a sejtfal kiépülését nem zavarja, de akadályozza a vancomycin kötődését
Más esetben a vancomycin rezisztens Staphylococcus aureus elektornmikroszkópos felvételén feltűnően
vastag sejtfal megjelenése észlelhető.


57


Vancomycin bioszintézise
A hatásos anyag a növekedési fázisvégén képződik. Az aglikon rész tiotempláton szintetizálódik. A
pantetein lánchoz kapcsolódó aminósav építőelemek adenilezése az aktíváló egységen történik. Az adenilsav
származék tioészter formában kötődik a megfelelő sorrendben elhelyezkedő kondenzációt, illetve
epimerizációt katalizáló egységekhez. Itt készül a heptapeptid, amelynek térbeli szerkezetét az oxidatív
gyürűzárás merevíti. Ezt követi két hidroxilezés, továbbá két klórozási reakció. A befejező lépésben a
negyedik aminosav (tirozin) p-hidroxi csoportjához glikozidos kötéssel egy vancózamint tartalmazó glükóz
kapcsolódik.
A merev szerkezetű antibiotikumot a periplazmikus térben megjelenő muramil-pentapeptid D-Ala-D-Ala
végződéséhez hidrogén hidak rögzítik. Ez a nagy térkitöltésű komplex megakadűlyozva a peptiodoglükán
építőelem kapcsolódását a sejtfal glükán vázához, azaz a baktérium pusztulását okozza.


58
Új glükopeptid antibiotikumok izolálása

A peptidoglükán képződést specifikusan akadályozóhatásmód ismeretében világszerte megindult a kutatómunka —
amely mind a mai napig folyik — a prokarióta sejtfalszintézist gátló hatóanyagok izolálása érdekében. A mellékelt ábra
néhány érdekesebb glikopeptid iípus kémiai szerkezetét mutatja a termelő törzseknek, továbbá a leírásuk időpontjának a
feltüntetéséveé.
Vancomycin totálszintézise

Nem meglepő, hogy a glükopeptid antibiotikumok gyógyászati sikere a szerveskémiai
szintézissel foglalkozó kutató csoportok tevékenységét is aktíválta.


59

Vancomycin aglycon totálszintézise (Nicolson és munkatársai)
60





61
D-CIKLOSZERIN

Ezt az egyszerű szerkezetű, (D-4-amino-3-izoxazolidon) Gram-pozitív és Gram-negatív baktériumok
növekedését gátló, főleg antituberkulotikumként felhasználásra került antibiotikumot az ötvenes évek derekán,
négy egymástól független kutatócsoport, négy különböző Streptomyces törzs fermentlevében találta (Harned: S.
orchidaceus. Shull: S.lavendulae. Harris: S. garyphalus. Kuzikava: S. roseochromogenes ). Ez az amfoter
tulajdonságú savstabilis vegyület ketoenol tautomériát mutat, vizes oldatban hosszabb idő alatt dimerizálódik.

H
+

+


|
NH
3
NH
3
NH
2
NH
2


N N
| | | | / \ // \
H
2
C÷÷÷C÷H H
2
C÷÷÷C÷H H
2
C÷÷÷C÷H H
2
C÷÷÷C÷H H
2
C÷÷÷CH

C O
| | | | | | | | | | | |
O C-OH O C-O
÷
O C=O

O C-O
÷
O C

HC÷÷÷CH
2

\

// \ //

\ / \

// \

//

\ /
N



N  N  N

N N
|

|
H H
4,5 pH tautomer alakok 7,4 pH dimer forma


A cikloszerin gyűrűs formában merevített szerkezete a D-alanin térszerkezetéhez hasonlít. Kompetitív gátlással
akadályozza azokat a reakciókat, ahol az enzim szubsztrátuma, illetve terméke D-alanin. Gátolja a D-Ala-D-Ala
szintetáz működését, de nem akadályozza az aminosav aktíválását.


Gátolja a D-alanin és a D glutaminsav-transzamináz aktivitását és gátolja az alanin permeáz működését. Az
alanin racemáz működését az enzim kofaktorával a piridoxál-foszfáttal reagálva gátolja.



A cikloszerin a D-Ala-D-Ala peptid szintézisét gátolva a sejtfal alkotórészeként nélkülözhetetlen
muramil-pentapeptid képződését akadályozza. Mikroszkoppal vizsgálva - cikloszerin jelenlétében - a
baktériumokon a penicillin hatásához hasonló jelenség figyelhető meg. A sejtfalszintézis szelektív gátlása miatt
először szferoplaszt képződik, majd a sejtek szétszakadása a baktériumtenyészet feltisztulásához vezet.
Antibakteriálás hatását csökkenteni lehet in vivo D-alanin adagolásával. A D-cikloszerin például hatástalan a
TBC-vel fertőzött egereken, illetve a tengerimalacon, mivel ezen két állatfaj magas endogén D-alanin szintje
hatástalanítja az antibiotikumot. Humán TBC fertőzés leküzdésére izonikotinsav hidraziddal szokták
alkalmazni.

62
Egyszerű kémiai szerkezete miatt a szabadalmi bejelentésekben leírt bioreaktorban kivitelezhető
módszereket ipari méretben csak átmenetileg használták. Előnyösebb és gazdaságosabb a kémiai szintézis.



Kiindulási vegyületként etilimino-benzoátot és D-szerin-mezilészter hidrokloridot reagáltatva 2-fenil-4-
karbometoxi-2-oxazolint nyernek. Az oxamid csoport kialakítása nátrium-etilát jelenlétében történik. A 2-fenil-
4-karboxami-do-2-oxazolinból a gyűrű felnyitásával (ami dioxánban sósav hatására következik be) o-
benzamido-ß-klór-propion hidroxamát nyerhető. Az izoxazolidon gyűrű 1 n nátriumhidroxidban alakul ki.
Enyhén visszasavanyitva képződik belőle a 4-benzamido-3-izoxazo-lidon. A védőcsoport eltávolításával
sósavas etanolban képződik a ß-aminoxialanin-etilészter dihid-roklorid. Káliumhidroxiddal D-4-amino-3-
izoxazolidonná zárható a gyűrű.




63
FOSZFONOMYCIN


Ezt a szélesspektrumú antibiotikumot a Merck
kutatói több Streptomyces törzs (S. fradiae, S.
viridochromogenes, S. wedmorensis)
tenyészlevében is megtalálták.

Kémiailag (-) (1R,2S)-1,2-epoxipropil-foszfonsav.
Szerkezetileg egy foszfoenolpiroszölősav analóg.
Gátolja a PEP részvételét a bioszintézisben, mindent
összecvetve az UDP-N-acetil-muraminsav képződését.
Így fő támadáspontja a sejtfalszintézis gátlása. Mivel
szerkezete az o-glicerin-foszfáthoz hasonlít a glicerin-
foszfát transzportmechanizmusát megtévesztve
akadálytalanul jut át a sejtmembránon.

Ezt az antibiotikumot is egyszerűen kivitelezhető kémiai szintézissel állítják elő. Foszfor-trikloridból, tercier
butanolból és trietilaminból benzolban nyerik a klórfoszfit intermediert. Ezt propargilalkohollal reagáltatva
alakítják propionil-foszfáttá. A 45
o
C-on bekövetkező acetilén-allén átrendeződés eredményeként kapják az
alkadienil-foszfonátot, amit palládium-szén katalizátor mellett hidrogéneznek cis-propenil-foszfonáttá. Ezt
hidrolízálva nyerik a cis-propenil-foszforsavat.


Reszolválás után - amit + ( o ) -fenetilaminnal végeznek propanolban trietilamin jelenlétében - az epoxidálás
nátrium-wolframát jelenlétében, meleg oldatban, hidrogén-peroxiddal végezhető.




foszfoenol-piroszőlő sav
64
PEPTID JELLEGŰ ANTIBIOTIKUMOK (DEPSZIPEPTIDEK)

Kémiailag olyan viszonylag kis tagszámú gyűrűs depsipeptidek, amelyek a természetes aminosavakon
kívül különleges szerkezetű aminosavakat, zsírsavakat, illetve a természetes aminosavak enantiomerjeit
tartalmazzák. Főleg spórázó bacillusok termelik, de gombák tenyészlevében is találtak ilyen természetű
metabolitokat. A |-laktám antibiotikumok, noha 2 aminosavból álló gyűrüs peptidek, mégis kémiai
tulajdonságaikra és különleges hatásmódjukra tekintettel külön tárgyalandók.
Peptid töredékek megjelenése a tápközegben nem tekinthető ritka jelenségnek. Több esetben
rendszertani elkülönítésre is használták a tenyészlében megjelenő peptidek szerkezetét. Ezek a kisebb-nagyobb
peptidek azonban jelentősebb biológiai aktivitással nem rendelkeznek. A biológiailag aktív ciklo-peptidek
különleges merev szerkezetét másodlagos kötések, hidrogén hidak biztosítják. Erős baktericid hatásukkal
együttjáró toxikus tulajdonságaik miatt a klinikai gyakorlatban csak egyes speciális esetek gyógyítása
szempontjából van jelentőségük.
Ezek a vegyületek a bélcsatornából nem szívódnak fel, így csak közvetlenül a vérpályába juttatva,
parenterálisan alkalmazhatók. A gyomorsav nem károsítja, a különféle emésztő enzimek nem bontják őket, sőt
sokesetben a fehérjebontó enmzimekkel komplexet képezve proteázgátlóként alkalmazhatók. A velük kezelt
szervezet bélflóráját megváltoztatják, baktériumspektrumuk függvényében módosítják azt. Ebből következik,
hogy néhány ide sorolt antibiotikumot eredményesen használnak az állattenyésztők. Kis mennyiségben a
tápanyaghoz keverve a tápanyag hasznosítását javítva növelik a súlygyarapodást. Használatuk az élelmiszerek
fogyasztói számára veszélyt nem jelent, mivel a bélből nem szívódnak fel a húsban és a tejtermékekben nem
jelennek meg. Nem zárható ki a bélfalra, a bélfal áteresztőképességére gyakorolt olyan közvetlen hatásuk sem,
amely befolyásolhatja a tápanyagfelvételt.
A peptidjellegű antibiotikumok nem riboszómán szintetizálódnak, hanem tiotemplátnak nevezett
fehérjén. A tiotemplát felületi viszonyai szabják meg a rajta szintetizálódó oligomer kémiai szerkezetét.

Képződésükhöz, nem szükséges aminoacil-tRNS szintetáz, nincs szükség mRNS-re, sem specifikus tRNS-re.
Képződésüket klóramfenikol nem gátolja..Ebből következőleg a biológiailag aktív termék felépítésében a
variációs lehetőségek nagyobbak. Hasonló szerkezetű vegyületek, aminosavak egymást könnyen helyettesíthetik.
A rendelkezésre álló építőelemek mennyiségi viszonyai befolyásolhatják a képződő depsipeptid szerkezetét. A
tiotemplát egy multienzim rendszernek tekinthető. Az enzimkomplexhez tartoznak a nem természetes
aminosavak képződésében résztvevő enzimek. Az aminosav aktíváló enzimeken kívül izomerázok, epimerázok,
dehidrogenázok és gyűrűzárást végző alegység is a komplex alkotórésze. Természetesen a tiotemplát és a
kiszolgáló enzimek mRNS közvetítésével a DNS-ben rögzített információ alapján riboszómán képződnek.
Nyilvánvaló, hogy az antibiotikumot termelő törzs mutagén kezelése áttételesen a depsipeptid képződésében is
változást okozhat.

65
GRAMICIDIN-S

Gauze és Brazsnyikova 1944-ben egy Bacillus brevis törzs tenyészlevében találta ezt a semleges
kémhatású gyűrüs szerkezető dekapeptidet. A két azonos szerkezetű pentapeptid gyűrűvé zárásaval képződő
antibiotikum szerkezetét Ruttenberg és munkatársainak 1965-ben megjelent munkájából ismerjük.
CH
3

|
CH
3
H-C-CH
3
H-C==CH—C-H
| | | ||
H O H-C-CH
3
H H

O H-C-H H H C==CH—C-H
|

|| | |

|

|| | | : |
H
2
C÷÷÷÷C ÷÷C÷÷N÷÷C÷÷C ÷÷N÷÷÷÷÷C÷÷C÷÷N÷÷C÷÷÷C÷÷÷N÷÷÷C÷÷÷CH
2

| | | || | | | || |
H
2
C H

H O CH
2
H H



O C=O
| : : NH
2
CH
2
: :

|
H
2
C÷÷÷÷N : : CH
2
CH
2
:

:

N÷÷÷÷CH
2

|

: :

CH
2
NH
2


: : |


O=C O H H CH
2
O H H

CH
2

| || |

| | || | | |
CH
2
÷÷÷÷C÷÷N÷÷÷C÷÷÷C÷÷N÷÷C÷÷C÷÷÷÷N÷÷÷C÷÷÷C÷÷÷N÷÷C÷÷ C ÷÷÷÷ CH
2

| : | |

||

| | |

| | |
H

H H-C-H O H H H-C-CH
3
O H
| |
H-C-CH
3
CH
3

|
CH
3


Négyféle természetes aminosavból (L-prolin, L-valin, L-ornitin, L-leucin) és D-fenilalaninból felépülő
két pentapeptid záródik gyűrűvé. A molekula szerkezetét a térközelben levő imino- és karbonil-csoportok között
kialakuló hidrogénhidak merevítik. Ez a szerkezet a merev gyűrű egyik oldalán két ornitin o-aminocsoportját, az
ellentétes oldalon az aminosavak alifás láncait hordozza. Ez a detergensekre jellemző szerkezet károsítja a
prokarióta citoplazma membránját.
Az antibiotikum gyógyászati értéke csekély. Viszonylag egyszerű szerkezete azonban lehetőséget
teremtett a biotechnológusok számára a nemriboszómális peptidszintézis mechanizmusának a tanulmányozására,
sőt ezen vizsgálatok eredményeként az M.I.T. kutatói Wang professzor vezetésével elsőként oldották meg egy
antibiotikum szintézisét oszlopreaktorba rögzített enzimekkel.
A bioszintézist katalizáló pantetein foszfátot tartalmazó tiotemplát előállítására a gramicidin-S
termelésére előnyösen használható Bacillus brevis mutánst használták. Egy gram ép baktériumsejt glicerint és
ammóniát tartalmazó táptalajon 250 mg antibiotikum előállítására volt képes óránként. A tenyészléből
összegyüjtött baktérumsejtek roncsolásával nyerték a sejtmentes kivonatot, amelyből ammónium szulfáttal
kezelve két aktív frakciót különítettek el. A 100 kDa tömegű könnyű frakció a fenilalanin aktíválását és
izomerizálását végezte. A 280 kDa méretű nehéz frakció a négy másik aminósav aktíválását és
sorrendbehelyezését végzi. Az első feladat az aminosav aktiválása aminosav-adenilát formájában. Az enzim
felületén az aminosavból és ATP-ből pirofoszfát képződése mellett képződik a vegyesanhidrid, amely a
tiotemplát SH csoportját acilezi. A tioészter képzéssel egyidejüleg AMP szabadul fel. A tioészter átészterezéssel
juttatja az aminosavat a mozgékony pantetein lánc SH csoportjára, amely résztvesz a lánchosszabbításban.
Utolsó lépésként a két foszfopanteteinlánchoz kötött pentatpeptid gyűrűvé záródva válik le az enzimfelületről. A
tiotemplát pontos topográfiája még nem ismert. Nem sikerült felderíteni azokat a szerkezeti elemeket, amelyek
az aminosavak helyes sorrendben való lekötésére szolgálnak.


66

A folyamatos szintézis az antibiotikumot felépítő L-konfigurációjú aminosavakon kívül - (D-fenilalanin ugyanis
nem használható szubsztrátumnak!) - jelentős mennyiségű ATP állandó jelenlétét igényli. Az élő sejtben az
oxidatív-foszforiláció működése kielégíti az ATP igényt. A feladat elvégzése céljából az MIT (Mass.
Inst.Techn.) kutatói B.brevis-ből izolálták az adenilát-kinázt, amely az adenilsavat ATP jelenlétében
adenozindifoszfáttá alakítja. A következő lépéshez az Escherichia coli tenyészetéből kinyerték az acetil-kinázt,
amelyik ADP-ből acetilfoszfát jelenlétében ATP-t szintetizál. A nagy energiatartalmú acetil-foszfát egyszerűen
előállítható aceton pirolízisével. A két regeneráló enzimet cianogén-bromiddal Sepharose-hoz kötötték.
A rögzített regeneráló rendszert összekeverve a poliakril-amid gélbe rögzített gramicidin-S szintézisre
képes könnyű és nehéz frakció 1/1 arányú elegyével -oszlopreaktorba helyezték. Ezzel a módszerrel grammos
tételben, 80 %-os kihozatallal nyerték az antibiotikumot a reaktorba adagolt L-valin, L-prolin, L-ornitin, L-
leucin, L-fenilalanin keverékéből.

A reakció energiaigényét — az ATP ellátottságot — a fölöslegben adagolt acetil foszfát fedezute
(foszforsav ecetsav vegyesanhidrid) amit foszforsav jelenlétében aceton hőkezelésével állítottak elő.

67
BACITRACIN

Johnson és munkatársai 1945-ben fedezték fel ezt a gyűrűs depsipeptid szerkezetű vegyület csoportot. Az
antibiotikus hatást egy 7 éves kislány, Margaret Tracy csontfertőzéséből izolált egyik bacillus tenyészlevében
észlelték. Innen adódott az antibiotikum neve. A termelő törzset később Bacillus licheniformis fajjal
azonosították. A tenyészlében tíz közelrokon peptid képződik. A kereskedelmi forgalomba kerülő készítmény is
tartalmaz kis mennyíségben B, D, E és F komponenst a főterméknek tekinthető legaktívabb ―A‖ komponens
mellett. A bacitracin-B például az egyik izoleucin helyett valint tartalmaz
A bacitracin-A savanyú és semleges körülmények között stabil, lúgos közegben gyorsan inaktíválódik.
Vízben és rövid szénláncú alkoholban jól oldódik, más szerves oldószerben oldhatatlan. Nehézfém sók
inaktíválják, de EDTA hatására is elveszti antibakteriális hatását. A baktericid hatás kifejtéséhez ugyanis
kétértékű ionok, előnyösen cink ionok jelenléte szükséges.
Kémiai szerkezetének felderítése nem volt könnyű feladat. Megjegyzendő, hogy a ma elfogadott
szerkezetet eddig nem igazolták kémiai szintézissel. Az L illetve D aminosavakból felépülő undekapeptidből (L-
Asn, D-Asp, L-His, D-Phe, L-Ile, D-Orn, L-Lys, L-Ile, D-Glu, L-Leu, L-Cys, L-Ile) a gyűrűs szerkezetet nagy
valószínűséggel a lizin c-aminocso-portja és az L-aszparagin között kialakuló kötés biztosítja. Nem zárható ki
azonban az sem, hogy a lizin c-aminocsoportja és a D aszparaginsav ß-karboxil csoportja között kialakuló kötés
miatt az L-aszparagin nem tagja a gyűrűnek.

H
2
N-C=O HO-C=O

H
| |

|


O CH
2
CH
2
C
|| | | // \
H-N----C----C----N----C----C----N----C=O N N-H
| | | || : | | | |
H-C-H H H O H H H-C--CH
2
---C==C-H
| |
H-C-H H
2
N-CH
2
CH
3
N-H H-C==C-H
| | | | | |
H-C-H CH
2
CH
2
C=O H-C C-H
| | | | || ||
H-C-H CH
2
H
3
C-C-H H
. .
C---CH
2
—C—CH
| | | |
H-N÷÷CH---C---N---C----C----N---C----C----N H NH
2
CH
3

| || | :



|| | | || | |
H H C=O O H H O H H O H-C----CH---CH
2-
--CH
3

| | | |
H
3
C÷C----C---CH H H N == C ---S
| | | :

| | |
H H N-----C------C------N-----C-----C-----N-----C-----C----------CH
2

|

|| | | || | | || |
H O CH
2
H

O CH
2
H O H
| |
CH
2
H-C-CH
3

| | A- bacitracin szerkezete
HO-C=O CH
3


A kovalens kötések alkotta peptid gyürűn kívül a biológiai hatásért felelős második érzékeny gyűrűs szerkezet
kialakulását a D-fenilalanin és a láncvégi L-izoleucin közötti gyenge kötés stabilizálja. Ennek a szerkezetnek a
kialakulásához szükséges a cink ion jelenléte. Az antibiotikum bioszintézise a sejtmembránhoz kötődő bacitracin
szintetáz enzimkomplex felületén folyik. Ez az enzimkomplex elektroforézissel vagy gélszűréssel három olyan
fehérje alegységre (A, B, C domain) választható szét., amelyen a bacitracin molekula szintézisét katalizáló
enzimek (összesen 53 reakció) működnek. Egy antibiotikum képződéséhez 12 aminosav aktíválás, 12 tiolízis, 4
izomerizáció, a thiazol gyűrű kialakítása, lánckezdő reakció, 11 elongációs reakció, 9 transztiolízis, 2 peptidil
transzferáz és egy termináló rekció szűkséges. Az alegységeken az aminosav építőelemekre specifikus templátok
valamint tízféle enzimreakciót katalizáló aktív központ található. A lépésről-lépésre hosszabodó peptid láncot
egy-egy mozgékony foszfopantetein kar kapcsolja az enzimkomplex felületéhez.

Aminosav aktíválás indítja a bioszintézist magnézium ion jelenlétében.
aminosav + ATP ------------------> aminosav-adenilát + PP

Ez az aktívált aminosav közeledik a tiotempláthoz, ahol szűkság szerint az izomerizáció is megtörténik.
Tiolizáció kapcsolja az aktívált aminosavakat a komplex SH csoportjaihoz,
68
ahonnan az egyes építőelemekkel a transztiolizációs reakció,
illetve az elongációs reakció hosszabítja a növekedő peptidet.
A peptid lánc kialakulását követi a templáton megürülő
aminosav kötőhelyek folyamatos feltöltődése.
Az alegységek közötti átmenetet a peptidil transzferáz
katalizálja. A termináló reakció kapcsolja a peptid utolsó
tagját a lizin c-aminocsoport-jához. Ez a lépés a kész
antibiotikum leválásával jár. A bioszintézis korai szakaszában
eddig felderítetlen mechanizmus szerint alakul ki a tiazol
gyűrű az N-terminális izoleucin és a cisztein között játszódó
kondenzációval. A forgalomba hozott bacitracin készítmény
biológiai aktivitását, (lévén anyagkeverék) nemzetközi
egységben adják meg. Az egységnyi aktivitás (IU) 1/1024
higításban gátolja a Streptococcus haemoliticus szaporodását
húsleves táptalajon (1 mg bacitracin = 74 IU). Gram-pozitív
mikroorganizmusok közül főleg a Micrococcus,
Staphylococcus, Sarcina, Streptococcus, Corynebacterium,
Actinomyces törzsek ellen hatásos. Gram negativ törzsek
közül érzékenynek találták a Vibrio, Neisseria, Haemophylus, Bordetella törzseket. A bacitracin peptid
jellegéből következően a bélfalon keresztül nem szívódik fel. Hízlaló tápokhoz adva (4200 IU / kg táp) javítja a
tápanyag hasznosulását. Kedvező irányba módosítja a bélcsatorna mikroflóráját, de a bélfalra való közvetlen
hatása sem zárható ki (King 1976). A bacitracin használatának közöspiaci előírása szigorú feltételeket jelent.
Növendék állatfaj bacitracin tartalom használati időszak
pulyka 5-50 ppm 4.-ik hétig
5-20 ppm 5-26.-ik hétig
szárnyasok 5-50 ppm 4.-ik hétig
5-20 ppm 5-16.-ik hétig
tojó tyúk 15-100 ppm
borjú, bárány, kecske 20-50 ppm 16.-ik hétig
5.20 ppm 17-26.-ik hétig
kismalac 5-50 ppm 4.-ik hónapig
sertés 5-20 ppm 4-6-ik hónapig
A bacitracint kémiai felépítése miatt a proteázok nem bontják, sőt valójában proteáz gátlóként használható
vegyület. Makarova szerint jelenlétében az emésztőcsatornában magasabb proteáz szint mérhető. Ez a
depsipeptid a baktérium citoplazma membránját károsítja, specifikusan zavarja a sejtfalszintézist. Annak a lipid
jellegű (izoprenil-pirofoszfát) hordozó vegyületnek a defoszforilezését gátolja, amely a sejtfal építőelemeket a
citoplazmából a membrán külső felületére segíti. Az N-acetil-glükózaminil-N-acetil muramil nonapeptid
amidnak sejtfalba épülésekor a 10 izoprén egységből felépülő lipid jellegű hordozó molekula pirofoszforilezett
formában marad vissza. Csak egy foszforsav leválasztásával válik alkalmassá újabb muramil peptid felvételére.
Ezt a defoszforilezést akadályozza a bacitracin. Magnézium ion jelenlétében bacitracin hatására izoprenil-
pirofoszfát felhalmozódás észlelhető. Sejtfal károsodott baktériumok ellen az immunológiai védekező
mechanizmus is hatásosabban veszi fel a küzdelmet.
A Bacillus licheniformis ATCC 14580 neve a görög lichen és a forma szó összetételéből származik.
Weigmann a múlt század végén Clostridium licheniforme néven irta le ezeket a gyakran összetapadva, láncot
alkotva növekedő spórát képző pálcákat. Agar táptalaj felületén száraz ráncos felületű telepet alkotnak, amelyből
hajra emlékeztető kitüremlések formájában terjed a táptalaj felületén. Az idős tenyészet barnás szinűvé válik.
Glükóz szénforráson nyálka szerű viszkozitást fokozó ¸-glutamil polipeptidet választanak ki környezetükbe.
Szacharóz illetve raffinóz szénforrásból polifruktánt, levánt termelnek. Elegendő vas jelenlétében ezek a törzsek
pulcherrimin nevű vörös pigmentet választanak ki.A Johnson által izolált törzsön kívül ma több bacitracint
termelő törzsről tudósít az irodalom (ATCC 10716, 9945, 11945, 11946, 14580, 14593). Ezekből klasszikus és
modern genetikai módszerek alkalmazásával nagyüzemi alkalmazásba vett törzseket állítottak elő. A termelő
törzs húslé táptalajon fenntartva termelőképességét megtartja. A fokozott antibiotikum termelésre nemesített
törzs spóratermelő képességében sérült. Az antibiotikum termelő táptalaj állati eredetű fehérje hidrolizátumot
vagy szójalisztet tartalmaz nitrogénforrásként. Szénforrásként keményítő vagy glükóz használható. Az eljárás 30
o
C felett 30 óra alatt befejeződik. A tenyészlében ez idő alatt 8-10 g bacitracin képződik literenként. Az
antibiotikum képződése a tenyészet lúgosodásakor, a növekedési fázis végén észlelhető fokozott mértékben.
Ezért nem befolyásolja a termék képződését a termelő törzs növekedését gátló antibiotikum megjelenése. Az
elkészült antibiotikum a fermentlé szűrletéből kétértékű fémionokkal (cinkbacitracin ZB) vagy metilén
diszaliciláttal (BMD) könnyen leválasztható. Az így nyert nyers termék forrólevegős ciklonrendszerrel (niro)
könnyen kezelhető porrá szárítható. Ez a kémialag stabil termék közvetlenül keverhető a
tápszerekbe.Gyógyszerként használható terméket butanollal vonják ki a szűrt léből vagy ioncserélő gyantát
alkalmaznak a kinyert termék tisztítására.

69
POLYMYXIN-B
Polimixineket termelő mikroorganizmusokat egymástól függetlenül több kutatócsoport is izolált 1947-ben
(Lanlykke, Stansly, Ainsworth). Az antibiotikumok szerkezetének megismerése után az eredetileg eltérő névvel
leírt bacillusokat Bacillus polymyxa névvel (uuco nyálka) jelölték. Az antibiotikumot termelő törzsek a glükózt
élesztőkivonatot és ammónium-szulfátot tartalmazó táptalajon nagy mennyiségű nyálkás anyagot,
poliszacharidot választanak ki, amely megnehezíti a termelési szakasz befejeztével az aktív anyag kémiai
elkülönítését a tenyészléből. Az alapvegyület változatai közül gyógyszerként csak két termék, az 1947-ben
felfedezett polymyxin-B és a Kyoma által 1950-ben leírt polymyxin-E, másnéven colistin van forgalomba. A két
antibiotikum egyetlen aminosav alkotórészben különbözik egymástól. A polymyxin-E peptid gyürűje D-leucint
tartalmaz D fenilalanin helyett. Kémiai szerkezetüket Vogler és munkatársai igazolták 1964-ben
szerkezetbizonyító szintézissel.

CH3 HC—CH=CH NH2 CH3
| || | | |
H3C—C-H HC—C ==CH H-C-H H-C-H
| | | |
H-C-H H-C-H H-C-H H-C-CH3
| | | |
O=C÷÷÷C÷÷÷N÷÷÷C÷÷÷C÷÷÷N÷÷÷C÷÷÷C-H H-N-H H-N-H H-C-H
| | H | | | H || | | | |
H-N H O H O N-H H-C-H H-C-H H-C-H
| | | | |
H2N-CH2-CH2-C-H C=O H-C-H H H-C-H H-C-H
| | | | | |
O=C H-C÷÷N÷÷C÷÷C÷÷N÷÷C÷÷C÷÷N÷÷C÷÷C÷÷N÷÷C÷÷C÷H
| | H || | H || | H || | H || |
H÷N H CH2 O H O HC-OH O H O H
| | | |
H2N-CH2-CH2-C÷÷÷÷C÷÷÷÷N÷÷÷÷C÷÷÷÷C÷÷÷N÷÷÷C÷H CH3
| || | | || | |
H O H HO÷C÷H O H H
|
CH3 polymyxin B
1
szerkezeti képlete

A gyógyszerként forgalomba hozott termékben két, a zsírsav alkotórészben különböző vegyület fordul
elő. A B
1
komponens 6-metiloktánsavat (izopelargonsav), B
2
komponens viszont 6-metil heptánsavat
(izooktánsav) tartalmaz. Az előbbi savakkal acilezett depsipeptid láncban 3 természetes aminosavat (1 leucin és
2 treonin) 1 D-fenilalanint és 6 molekula L-o¸-diamino vajsavat találunk. Az acilezett dekapeptid negyedik
tagját alkotó diaminovajsav ¸-aminocsoportjával alakítja ki a gyürűs szerkezetet a láncvégi treonin. A
természetes fehérjétől eltérő szerkezete miatt a fehérjebontó enzimek a polimixint nem inaktíválják. Ugyanakkor
peptid jellege miatt a bélcsatornából nem szívódik fel. Ez azért előnyös mert Pseudomonas vagy Shigella okozta
bélfertőzések kezelésekor, bélfertőtlenítőként használva a vegyület vesetoxikus tulajdonsága nem jelentkezik.
Számos Gram negatív kórokozó ellen hatásos, de nem használható Gram-negatív kokkuszok és a Mycobacterium
törzsek ellen. Gram pozitív fertőzések leküzdésére más peptid jellegű antibiotikumokkal, például bacitracinnal
kombinálva használják. Különleges esetekben szisztémás fertőzések leküzdése céljából metánszulfonátját
intramuszkuláris injekcióként adják.
A polymyxin-B szulfát sója fehér szagtalan kristályos anyag. Vízben jól, alkoholban gyengén oldódik.
Vizes oldata enyhén savanyú, 6 pH-nál jól tárolható. alkalikus közegben bomlékony. Fizikai-kémiai
szempontból kationos detergensnek tekinthető. Alifás oldallánccal rendelkező bázikus peptid, amely a
megtámadott baktériumok membránját károsítja. Hatására purin és pirimidin bázisok, nukleozidok távoznak a
sejtből. Ebből következik, hogy a nemnövekedő baktériumokat is elpusztítja. Anionos természetű vegyületek
(szappanok, foszfolipid, cefalin) jelentősen csökkentik antibakteriális hatását.


VIRGINIAMYCIN

Az állattenyésztésben világszerte használatban levő sikeres antibiotikum készítmény, két szinergista hatású
peptid lakton természetes elegye. Poláros oldószerekben jól, vízben gyengén oldódik, hexánban, petroléterben
gyakorlatilag oldhatatlan. Permeábilitási különbségek miatt csak Gram pozitív mikroorganizmusok növekedését
gátolja, jóllehet sejtmentes körülmények között az M-faktor a Gram-negatív és a Gram pozitív
mikroorganizmusok riboszómájához azonos mértékben kötődik. A tenyészlében a két komponens - az M- és az
S-faktor - a fermentációs periódus befejeződésekor éppen a szinergista hatás szempontjából optimális arányban
fordul elő. Az S-faktor elősegíti a kálium ion felvételét a membránon keresztül, az M faktor kötődése a
riboszómához viszont éppen kálium iont igényel.
70

(4,6-metil-5-hidroxi-2-hepten-sav) CH
3

|
H H

O H H H

H-C-CH
3
O
| | || | | |

|

||
H--C÷÷ N ÷÷C ÷÷÷C==C÷÷÷C ÷÷÷ C ÷÷O÷÷÷ C
| |

| | (nor-valin)
H--C H
3
C H C==CH÷÷CH
2

Az M faktor ||



| |
szerkezete H--C H H H

N ÷÷÷÷÷÷ CH
2

| | | |

|
C== C ÷÷C÷÷ C÷÷ C÷÷C÷÷ C==N÷÷÷C÷÷÷ C==O
| | | |

||

| |

|| (szerin)
CH
3
H OH H O H O÷÷÷÷÷÷C-H
(2-keto-4-hidroxi-6-metil-10-amino-6,8-decen-sav)
Treonin O Fenilalanin O ( Lizin módosítva)


|| ||
O÷÷÷÷÷C÷÷÷CH ÷÷÷NH÷÷÷÷÷C÷÷÷÷÷CH÷÷÷CH
2
÷÷÷C==O
| | | |
H÷C÷÷CH
3
H÷C÷H N

÷÷÷÷CH
2
÷÷÷CH
2

| | |
O=C÷÷NH÷÷CH HC–C==CH C==O HC==CH
| | || | | | |
N=====C O==C HC–CH=CH H

O H÷C÷÷CH
2
—C CH
| | | | || | || ||
H÷C HO÷C H-N÷÷÷CH÷÷÷C÷÷÷÷N÷÷÷÷C÷÷÷÷÷C÷÷÷÷N ÷ CH
3
HC—CH
| || | || | |
H÷C÷÷÷÷÷C÷H CH
2
O CH
2
CH
2

| \ /
Az S-faktor szerkezete CH
3
CH
2

(Lizin módosítva)
Aminovajsav Prolin N-metil-fenilalanin

A két aminosavból és két elágazó zsírsavból felépülő, vízben alig oldódó M faktor képződése a glükolízis
sebességével arányos. A hét aminosavból felépülő S faktor képződését az aminosav-bioszintézist szabályozó
mechanizmusok befolyásolják. A fermentáció paramétereinek változtatása kölcsönhatásban áll az egész
fermentációs rendszer anyagcseréjével.A programtól való eltérés ezért jelentős mértékben befolyásolhatja a
képződött antibiotikum mennyiségét.
A virginiamycint termelő fonalas növekedésű prokarióta a Streptomyces virginiae 1954-ben került de
Somer és van Dijck laboratóriumába egy Leuven mellett gyüjtött talajmintából. Mivel az előállított termék a
penicillinre rezisztens Staphylococcus törzsek ellen is hatásosnak bizonyult, staphylomycinnek nevezték el.
Humán gyógyászetben viszonylag rövid ideig használták, mert az új félszintetikus penicillin származékok hamar
kiszorították a gyógyszerpiacról.. Ekkor kezdődött az állattenyésztésben való alkalmazása.
Sikerét nem utolsó sorban annak köszönhette, hogy az első tíz esztendőben, amikor gyógyászatban
használható igéretes új antibiotikumnak tekintették, jelentős kutató munkát fektettek fejlesztésébe. Több mint
90000 izolált mutáns antibiotikum termelését vizsgálták a törzs nemesítése céljából.
A jól termelő törzs ipari gyakorlatba vételét nehezítette a lizogén tulajdonsága, fágérzékenysége.
Szelekciós munkával az izolált fágra (S-1) rezisztens variánst állítottak elő. Ez a variáns 10
8
fág ml
-1
estén sem
lizált. Hamarosan kiderült, hogy a S-1 fágra rezisztens varáns érzékeny egy másik fágra. Hosszadalmas
munkával előállították az S-2 fággal szemben is rezisztens mutánst. A törzs élettani viszonyainak vizsgálata
feltárta, hogy a virginiamycinen kívül tremel egy bakteriocin szerű antibiotikumot is, amely zavart okoz a
termelő törzs anyagcseréjében, gátolja növekedését. Előállították tehát ezt az ismeretlen szerkezetű anyagot és
további genetikai munkával előállították az S-2 fágrezisztens törzsből annak antibiotikum rezisztens variánsát. A
következő lépés a virginiamycinnel szembeni rezisztencia kifejlesztése volt. Több mint 8000 mutáns közül
lehetett kiválasztani azt a törzset, amely elvesztette S faktor érzékenységét.Többszöri akriflavinnal és ethidium
bromiddal végzett kezelés után, limitált protein és széhidrát tartalom mellett kinőtt egyedek között sikerült találni
egy olyan törzset, amely virginiamycin rezisztenciában jelentősen felülmúlta az eddigi törzseket. A hetvenes
években azután rekombinánsok előállításával tovább javitották a fejlesztett törzs termelőképességét. A törzs
nemesítés utolsó szakaszában fenilalanin analógra és metionin analógra rezisztens mutánsok közül választották
ki a nagyipari eljárásban eredménnyel ma is használt variánst.
71
Az antibiotikumot termelő fermentációhoz az inokulum két lépésben készül. Az első 100 liter térfogatú
oltótenyészetet agar táptalajon kifejlődött légmicéliumon fejlődő spóratömeggel oltják. A táptalaj
kukoricalekvárt és csupán annyi glükózt tartalmaz, amennyi két nap alatt éppen elfogy. A jól levegőztetett
tenyészet a szénhidráthiány hatására vegetatív ‖arthrospóraszerű‖ tömeggé alakul erős pigment termelés és
jellegzetes talajillat képződése közben.

A második lépcsőben a 10 m
3
térfogatú oltóanyagot az előbbi előinokulumban kifejlődött vegetatív
spóratömeggel oltják. A tápközeg literenként 20 g kukoricalekvárt, 15 g mogyorólisztet, 5 g
élesztőhidrolizátumot, 10 g szójalisztet, 40 g glükózt és 5 g kalciumkarbonátot tartalmaz. A szén és
nitrogénforrásban gazdag táptalajt 25
o
C-on két napig levegőztetik. A keverő fordulatszáma és az átáramló
levegő mennyisége előre megállapított program szerint változik a pH, a cukorfogyás, valamint a tenyészet
növekedésének állandó ellenőrzése mellett.

A főfermentációs táptalaj (100-200 m
3
) literenként 20 g kukoricalekvárt, 10 g földimogyorólisztet,5 g
élesztő hidrolizátumot, 5 g glükózt, 25 g glicerint, 10 g lenolajat, 5 g kalcium karbonátot tartalmaz. Fél óra alatt
110 C
o
on végzett sterilezést követően a tápközeg 23
o
C-ra visszahűtve kerül oltásra.

A 100 m
3
hasznos térfogatú fermentor magasság:szélesség aránya 2,4. A keverő maximális
fordulatszáma 120/perc. (A keverő teljesítményfelvétele 2.3 kW/m
3
) A levegő mennyísége 0.3-0.6 térfogat/perc.
A tenyészet kémhatását pH = 6,8-7 között tartják. A készüléken 0,1 atm. túlnyomás mellett annyi levegőt
áramoltatnak át és a keverő fordulatszámát úgy változtatják, hogy az oldott oxigéntartalom 15-20% telítési
értéken maradjon.

Az első 6-10 órában virginiamycin termelés nem észlelhető. A tizedik és huszadik óra között a
logaritmikus növekedési fázisban már mikroszkópon jól látható a vizben nem oldódó M faktor kristályainak
megjelenése. Húsz és hatvan óra között az
antibiotikum termelés valamivel lassabban, de
egyenletesen emelkedik. Az utolsó 10-15 órában a
szénhidrát elfogy, az antibiotikum képződés lassan
leáll, a tenyészet DNS tartalma csökken (lÍzisre
utal!). Három nap elteltével az elmenő
gázelegyben az oxigén fogyás és a szén-dioxid
képződés csökkenése jelzi a fermentációs folyamat
befejeződését.
A képződött M-faktor mennyisége Ehrlich
reakcióval, koloriméterrel mérhető. Az S faktor
mennyisége spektrofluoriméterrel határozható
meg. A két komponens szinergista antibakteriális
aktivitása Staphylococcus aureus mérőtörzzsel
agardiffúziós módszerrel követhető. Ezt a
szinergista hatást mutatja a mellékelt ábra.
Helyesen vezetett fermentációs ciklus esetében a
képződött anyagkeverék aránya 100% körüli
antibakteriális hatást mutat.
Az antibiotikum elegy a megsavanyított
teljes fermentléből metilizobutilketonnal könnyen
kivonható. Az elválasztott szerves fázis
vákuumban történő töményítése után hexánnal
kicsapható a nyers virginiamycin, A hatóanyag
megszáritott por alakban száraz hüvős helységben
aktivitás vesztés nélkül évekig tárolható.
Állattápszerként a nyers por kerül felhasználásra.
A tápkeverékhez adva kedvező irányban módosítja
a bélflóra összetételét, csökkenti a tejsav és illósav
termelést, megőrzi a gazdaszervezet számára a
tápanyagok értékes aminosavtartalmát és az energiahordozó szénhidrátok jelentős részét. A bél mozgását
lassítva, több idő jut a tápanyagok felszívódására. Dierick (1980) vizsgálatai szerint kedvezően befolyásolja a
bélhámsejtek permeabilitási viszonyait. Alkalmazása a fehérje takarmány tized részének megtakarítását teszi
lehetővé.


72
NISIN

Élelmiszeripari jelentősége miatt évtizedek óta szerepel a Gram-pozitív mikroorganizmusok növekedésére ható
ható vegyületek között ez a 34 tagú peptid, amely tejgazdasági termékekben (sajt, tejföl, túró) természetes
körülmények között is előfordul. Rogers írta le először 1928-ban, mint a Streptococcus lactis által előállított
olyan terméket, amely más baktériumok életműködését gátolja. Whitehead 1933-ban megállapította peptid
jellegét, de tisztán először Meanwell izolálta 1943-ban. Ezt követőleg rövid idő alatt kiderült, hogy
gyógyszerként nem kerülhet forgalomba, élelmiszeripari jelentősége nem kétséges, mivel vitathatatlanul a
humán gyakorlatban folytonosan jelenlevő környezetbarát fertőtlenítőszer.
A hatóanyag biológiai aktívitása Streptococcus
cremoris mérőtörzset használva turbidimetriásan
mérhető. (0,4 IU/ml). Az agardiffúziós módszer
Micrococcus flavus mérő törzset használ a fehérje
diffúzióját gyorsító Tween-20 detergens
jelenlétében. A génen végzett beavatkozással több
nisin analógot állítottak elő. Ezek elméleti
érdekességük mellett élelmiszeripari
felhasználásra nem kerültek.
Kémiailag nem teljesen egységes. A
főkomponens mellett több rokon szerkezetű
vegyület található. A hőstabil, kémiailag ellenálló
nisinben előforduló építőelemek egy része
(aminovajsav, lantionin, dehidro-vajsav, dehidro-
alanin, metil-lantionin) nem fordul elő a
természetes fehérjékben. Ezért először úgy vélték,
hogy a bioszintézise nem riboszómán folyik. Ma
már köztudott, hogy a nisin előanyaga a pronisin a
természetes fehérjékhez hasonlóan mRNS által
irányítva riboszómán szintetizálódik. Ezt a 7000
moltömegű peptidet a membrán közelében
működő enzimek alakítják bioaktív termékké.
Éppen a poszt-transzlációs átalakítás természetéből
következően, egy-egy átalakítási reakció
elmaradása okozza a rokonszerkezetű termékek
megjelenését.
Nagyüzemi termelésekor anaerob
körülmények között kukoricalekvárt, kazein-
hidrolizátumot, glükózt, kálium-foszfátot és
magnézium-szulfátot tartalmazó táptalajt
használnak. A növekedő tenyészethez adott
nukleinsav-bázisok fokozzák a nisin képződést. A
tenyésztés 16-18 órán keresztül 28-30
o
C-on
enyhén savanyú (pH = 6.5-6.8) körülmények
között oxigénmentesen folyik. Keverés csak a pH
állítás miatt szükséges.

A termék kinyerésére több módszer használható.

Az egyik elterjedt eljárás szerint a pH = 2-re savanyított fermentlé sejtmentes szűrletét pH = 4,5 -re
állítva 5 % kloroform és 0,1% szekunder-oktilalkohol elegyével extrahálják. Az elkülönített gélszerű szerves
fázishoz hűtött körülmények között abszolút etanolt adnak. A kicsapódó nyers nisint 0,05 n sósavval oldják. Az
oldatból a kloroform nyomait forró levegő átbuborékoltatásával elűzik, majd nátrium-kloriddal kisózzák az
antibiotikumot. Átkristályosításkor fonalas szerkezetű kristályok nyerhetők, ha a forró etanolos oldatot lassan
engedjük lehülni.

Propanollal is extrahálható a nisin a fermentlé savanyú szűrletéből. Ez esetben konyhasó adagolásával
biztosítják a szerves (propanolos) fázis elkülönülését. A propanolos oldatból további nátrium-klorid adagolással,
kétfázisú kristályosítással állítható elő az élelmiszergazdaságban széleskörűen használt fertőtlenítőszer.

73
BLEOMYCIN

Ezt a glikopeptid antibiotikumot először Maeda írta le 1956-ban phleomycin néven. Ennek ellenére a
tudományos közvélemény Umezawa 1966-ban kiadott közleményét ismeri.



A Streptomyces verticillus fermentlevében előforduló citosztatikus hatású glikopeptid keverékben a hexózok és a
peptidszerkezetű alapváz, a bleomycin sav minden esetben azonos. Eltérést csak a savamid oldallánc
szerkezetében észlelhető. Az A
2
variánsban 3-amino-propil-dimetilszulfonium oldalláncot, a B
2

komponensben pedig guani-dino-butilamin oldalláncot találunk.

A peptidlánc felépülése

A gyógyszerként forgalmazott készítmény 50-60% A
2
komponenst és 25-32% B
2
komponenst
tartalmaz. A cukorrész diszacharid, 2-O-(3-O-karbamoil-o-D-mannozil)-L-glükóz. A peptidlánc felépítésében a
természetes aminosavakon kívül (L-szerin, L-aszparaginsav, L-treonin, L-|-alanin, L-cisztein) néhány
különleges aminosav is részt vesz, például L-eritro-|-hidroxi-hisztidin, 4-amino-3-hidroxi-2-metil-valeriánsav és
a 2-metil-2-karbimino-alanin. A különleges aminosavak jelenléte nehezíti a proteolitikus enzimek hidrolitikus
hatását. A láncvégi savamid hidrolízise azonban zavartalanul folyhat. Ez a hidrolízis (bleomicin hidroláz)
inaktiválja az antibiotikumot.
74
A rákellenes gyógyszerként forgalmazott
antibiotikum réz
II
-komplexe ellenáll a bleomicin-
hidroláz inaktíváló hatásának. A kétértékű réz
nem csak a molekula nitrogén atomjaival
kialakított koordinációs kötésekkel rögzíti a
másodlagos szerkezetet, de a diszacharid lánc
karbamoil csoportjával is kapcsolatba lép. A
szervezetben uralkodó redukáló környezet
hatására azonban a fémion redukálódik. Az
egyértékű (kupro) réz ion viszont alkalmatlan a
molekula szerkezetének stabilizálására. A réz
redukciója az előbbi stabil szerkezetet a komplex
teljes széteséséig lazítja. A biológiai környezetben
jelenlevő kétértékű (ferro) vas a teljes szétesést
megakadályozza. A réz ion helyére épülve a
nitrogén atomok helyzetét továbbra is koordinálja, a diszacharid lánc karbamoil csoportjához azonban nem
kapcsolódik, sőt a jelenlevő oxigénnel kapcsolatba lépve hamarosan oxidálódik (ferri).

A megkötött oxigén C-4 helyzetben támadja a DNS lánc
dezoxiribóz egységeit. A gyürüs szerkezetet felszakítva elősegíti a
DNS szál feldarabolódását.A fellazított DNS könnyen áldozatul
esik a lebontó hatású enzimaktivitásnak.A pankreász
dezoxiribonukleáz. hatását megnöveli a bleomicin hatására
bekövetkező fragmentáció.

Gyógyszerként a hatásos vegyület szulfát sója kerül
forgalomba. Krém színű, higroszkópos porként vízben jól oldódik.
Enyhén savas közegben (4.5-6 pH) tárolt oldata két hét alatt sem
veszít aktivitásából. In vitro inaktíválják a szulfhidril származékok,
az aszkorbinsav, hidrogénperoxid és a nehézfém ionok. Adagolása
kémiai szerkezetéből következően csak injekciós formában
lehetséges.

A legtöbb daganatellenes hatású antibiotikum
immunszupresszív hatást is mutat. A bleomycinnek ilyen hatása
nem jelentkezik, mert a lépben és a limfoid szövetekben viszonylag
gyorsan lebomlik. A szövetekben előforduló bleomycin hidroláz
ammónia felszabadulásával hidrolizálva a karboxamido csoportot
inaktíválja a molekulát. A gyógyszer és a szervezet között kialakuló bonyolult kölcsönhatás jól adagolhatóvá
teszi ezt a citosztatikumot.



75
ACTINOMYCIN-D

Waksman és Woodruff 1940-ben a Streptomyces parvulus fermentlevében egy igen hatásos antibakteriális
anyagot találtak. Hasonló kémiai szerkezetű és biológiai tuljasdonságú anyagokat később más sugárgombák
fermentlevében is kimutattak. Ezek a sárgásvörös fenoxazint tartalmazó peptidek toxikus voltuk miatt
antibiotikumként szóba sem jöhettek. A csoport egyik tagja, a vörös, enyhén higroszkopos, fény és hőérzékeny
kristályos actinomycin-D, amelynek kémiai szerkezetét Brockman és Johnson derítette fel, a rák-kemoterápiában
kapott fontos szerepet. Ez a vegyület vízben 10
o
C-on jobban oldódik mint 37 C
o
-on. Alkoholban jól oldódik,
éterben gyakorlatilag oldhatatlan. Biológiai hatása olyan erős, hogy bőrön keresztül vagy porának belégzése is
toxikus tüneteket okozhat. Főleg a vörös csontvelőt károsítja, zavarja a veseműködést, gyomor és bélpanaszokat
okoz. Ezek a panaszok a kezelés befejeztével megszűnnek.



A természetben előforduló aktinomicinekben a kromofor azonos: 2-amino-4,6-dimetil-3-oxofenoxazin-
1,9-dikarbonsav. Mindkét karboxil csoporthoz egy-egy gyürűs peptidlánc kapcsolódik. A fenoxazin gyürű
szintézise triptofánból indul. Kinureninen illetve hidroxikinureninen keresztül jutunk a hidroxiantranilsavhoz. Ez
utóbbi metilezett származéka kapcsolódik a pentapeptid laktonhoz. A hexapeptid tiotempláton szintetizálódik. A
bioszintézist végző enzimkomplexben valin racemáz és N-metiláz működik. A készülő peptidben az aminosav
sorrend 4-metil-3-hidroxi-antranilsav, L-treonin, D-valin, L-prolin, szarkozin, L-N-metil-valin. Utolsó lépésként
a valin tioészter hidrolízise vezeti be a treonin hidroxil csoportját hasznosító lakton gyürű kialakítását. Befejező
lépésként a két antranilsav-pentapeptid-lakton reduktív kondenzációjával jutunk el a kész actinomycin-D
molekulához. Az antibiotikum két peptid-laktonjának egymáshoz viszonyított helyzetét a D-valinhoz tartoztó
karbonil és amid csoportok között kialakuló hidrogénhidak rögzítik.
Egy ilyen kis peptid kémiai szintézise nem jelent sem elméleti sem gyakorlati problémát, szinte
rutinszerű feladat. A tercier butiloxi karbonillal védett L-treoninhoz kapcsolják a benziloxi-karbonillal védett L-
N-metil-valint, majd a védőcsoport eltávolítása után a szarkozint. A következő lépésben újra a treonin reagál.
Vegyesanhidrides módszerrel kapcsolják hozzá a D-valin-L-prolin-butilésztert. Az így kialakitott
fragmentumhoz kötik az aromás komponenst p-metil-2-nitro-3-benziloxi-benzoesav-kloridot használva. A lakton
gyűrű kialakítása az előbbi termék p-nitrofenil-szulfittal pridinben képzett észter-származékából hidrogén-
bromiddal történik dioxánban trietilamin jelenlétében. A pentatpeptid laktonból katalitikus hidrogénezéssel
76
nyerhető a 3-hidroxi-4-metil-antranil lakton, amelyből matanolos foszfát-pufferben káliumferricianiddal végzett
oxidációval készül el az actinomycin-D.



Ezt az utat természetesen nem a fermentációs útnál gazdaságosabb eljárás kidolgozása céljával járták
végig, hanem a hatás és szerkezet közötti összefüggéseket kívánták vizsgálni. Ezen az úton nagy variációs
lehetőség nyílott az aktinomicin analógok előállítására azon túlmenően, hogy már az alapmolekulán is szinte
minden elképzelhető és kémiailag lehetséges módosítást végrehajtottak. Ismertté vált, hogy a lakton gyűrű
felnyitása a biológiai hatás elvesztésével jár. A prolin kicserélése oxiprolinra két variációt jelent. Cisz helyzetű
hidroxil csoport növeli az aktivitást transz helyzetű hidroxil viszont az antibiotikus hatást jelentős mértékben
csökkenti. A hidroxil csoport acilezése ugyancsak csökkenti a biológiai hatást. A kromofor aminocsoportjának
az acilezése csökkenti az aktivitást. Az amino-csoport dialkilezése illetve hidroxil csoporttal vagy klórral való
helyettesítése inaktiválja a molekulát. A metil csoportok alkil homológjai az aktivitás csökkenését hozzák. Az
aromás gyűrű hidrogénjeinek klór, bróm, illetve nitro csoporttal való helyettesítése minden esetben növeli a
biológiai aktivitását.
77
Biológiai hatása a transzkripció gátlásában
jelentkezik. A bázispárok közé ékelődve a DNS-hez
kötődik. A kromofor poláros csoportjai hidrogén
híddal képesek a guanin csoporthoz kapcsolódni,
miközben a peptid-lakton a DNS cukorfoszfát
láncával képez hidrogénhidat. A DNS függő RNS-
polimeráz működését ez az antibiotikum jobban
gátolja, mint a DNS-replikázét. A riboszomális RNS
szintézisét olyan alacsony koncentráció gátolja, ami a
sejtmagban folyó DNS szintézist nem zavarja..

BIALAPHOS
Japán szerzők a hetvenes évek egyik leghatásosabb peptid jellegű herbicidjeként ismertetik a Streptomyces
hygroscopicus tenyészlevéből izolált oligopeptidet (J.Antibiot. 37:1505. 1984). Kémiailag foszfonotricil-alanil-
alanin L-2-amino-4-(hidroximetil-foszfinoil)-butiril-L-alanil-L-alanin.

H O

H H NH
2
O H H

O H H
|

|| | | | || | | || | |
H----C------P------C------C------C------C------N------C------C------N------C------COOH
| | | | | | |
H

OH H H H CH
3
CH
3


Jól használható az egy és kétszikű növények kiirtására, a kakaslábfű (Echinochloa crusgalli), a fehér
libatop (Chenopodium album), a palkafélék (Cyperus rotundus), a fodros lorum (Rumex crispus) és a vizi jácint
(Eichornia crassipes) elterjedésének meggátlására. A növényvilág peptidázai egymásután eltávolítják a C
terminálisról az alanin molekulákat és ezzel aktíválják a foszfonotricin metabolitot. Az L-2-amino-4-hidroxi-
metilfoszfinoil-vajsav (L-AMPB) a növényi nitrogénanyagcsere szempontjából kiemelkedő jelentőségű
glutamin szintetáznak az aktív gátlószere. Ezzel magyarázható a bialaphos herbicid tulajdonsága.
Pruess és munkatársai 1973-ban az előbbi rokonvegyületét, az L-(foszfono)-metionin-S-szulfoxinil-L-
alanil-L-alanint izolálták egy Streptomyces törzs tenyészlevéből.

O H

H H O H H O H H
|| | | | ||

| | ||

| |
HO---P===N-----S-----C-----C------C------C-----N-----C-----C-----N-----C-----COOH
| | | | |
CH
3
H NH
2
CH
3
CH
3


A bialaphoshoz hasonlóan az alanin molekulák lehasítása után visszamaradó glutamin-szintetázt gátló
L-N-foszfono-metionin-S-szulfoximin ugyancsak hatásos herbicid. Mindkét enzim-gátló a talajban tovább
bomlik, végül teljesen inaktiválódik. De amíg az alanin molekulák egy napon belül leszakadnak, az L-AMPB
inaktiválódása két hétig is eltarthat. Hővel sterilezett talajban, az üvegházakban intenzív növénytermesztési
technológiát alkalmazva az L-AMPB hatásos koncentrációja több mint egy hónapig változatlan aktivitással
megmarad.





A fenoxazin-gyűrű kapcsoló-
dása a guanincsoporthoz
78
A CYCLOSPORIN mint IMMUNSZUPRESSZÍV HATÓANYAG

A XX. század utolsó negyedében a Sandoz biológiailag hatásos új anyagok előállítása céljával 1970-
ben indított kutató programjának anyagilag is sikeres gyógyászati terméke az immunszupresszív hatású
cyclosporin vegyület család, amelynek első képviselőjét két különböző helyről, Wisconsin-ból (Cylindrocarpon
lucidum) és Norvégiából származó (Tolypocladium inflatum) törzsek fungisztatikus hatású termékeként fedeztek
fel. A két fonalas gombát a taxonomusok Trichoderma polysporum-ként nevezték meg az első vizsgálatok
alapján. Dreyfuss M. munkatársai 1976-ban közölték (Eur. J. Appl. Microbiol. 3:1125-133) hogy a Trichoderma
polysporum tenyészlevéből in vitro hatásos gombaellenes anyag nyerhető, amelyről később megállapították,
hogy a vérparaziták ellen is hatásos.
A Trichoderma polysporum 2 % malátakivonatot és 0,4 % élesztőkivonatot tartalmazó agar táptalajon
tenyésztve 27
o
C-on 10-12 nap alatt 5x10
8
konidiospórát fejleszt 1 cm
2
agarfelületen. Az így nyert konidiospóra
7 % malátakivonatot és 5 % glükózt tartalmazó tápközegbe szuszpendálva -40
o
C-on hosszabb ideig tárolható az
életképesség csökkenése nélkül. Az elő-inokulumként szolgáló táptalaj 4 g glükózt, 0,5 g peptont, 0,2 g kálium-
foszfátot, 0,3 g nátrium-nitrátot, 0,05 g kálium-kloridot, 0,05 g magnézium-szulfátot és 10 mg vas-szulfátot
tartalmaz literenként 5,2 pH-ra állítva sterilezve Rázott lombikban 16 óra inkubálás után indul meg a növekedés.
A micélium növekedése 72 órás korra éri el a literenkénti 7 g szárazanyag tartalmat, miközben minimális
ciklosporin képződése mellett kémhatása csökken. Jól levegőztetett fermentorban a növekedés gyorsabb. Az elő-
inokulumban literenként 8 g száraz micélium képződik 48 óra alatt, miközben a pH 5,2-ről 4,2-re csökken. Az
oltóanyag felszaporításához már a termelő táptalajt használják, amely nagyobb mennyiségű szerves nitrogént –
10 g peptont – tartalmaz literenként. Tíz százalék oltóanyaggal oltva, percenként a fermentlé térfogatával azonos
mennyiségű levegőt áramoltatnak át a készüléken 0,5 bar túlnyomás mellett, hat napon keresztül. A negyedik
naptól kezdve a tenyészet színe erősen
sárgul, miközben nagy mennyiségű
változatos alakú konidiumot tartalmaz.
A fermentáció második szakaszában,
7 napos korban a micélium töredezni
kezd és egyre nagyobb számban jelennek
meg a sárgásbarna konídiumok, a
fermentlé nyálkássá válik. A jólsikerült
fermentáció leálláskor 4-500 mg
butilacetáttal elkülöníthető hatóanyagot
tartalmaz literenként, amiből szilikagélen
végzett kromatográfiás tisztítással
acetonból átkristályosítva 150-200 mg
ciklosporin-A és 50-100 mg ciklosporin-
C nyerhető prizmás tűkristályok
formájában. A biológiailag aktív
hatóanyag mennyisége Aspergillus niger
növekedésének gátlásával jól meghatározható (MIC érték : 1-3 mg /ml). A gomba sejtfal képződését gátolja a
kitin szintézis akadályozásával. Ebből következően a Neurospora crassa sejtfalképzésben sérült mutánsának
növekedését nem gátolja. Hatás spektruma a polioxinénál lényegesen szűkebbnek tűnik.
A hetvenes években a vezető kutató helyeken jelentős farmakológiai kutató kapacitást építettek ki az
antibiotikus hatás miatt kiválasztott vegyületek közül valamilyen farmakológiailag hatásos új anyag kiszűrése
céljából. Ez a rendszer a szívkoszorúér, a központi idegrendszer, a sejtosztódás, a tumor növekedés és az immun
rendszer területén jelentkező biológiai hatás felismerésére volt kifejlesztve A fungisztatikus hatás alapján
megtisztított hatóanyagot ezért ebben a rendszerben is megvizsgálták. Az in vivo gyenge fungisztatikus hatást
mutató anyag jelentősége erősen növekedett, amikor egereken végzett kísérletekben gyulladásgátló és
immunszupresszív hatását észlelték. A készítmény hamarosan a századvég fontos terápiás szereként került a
szervátültetéssel foglalkozó klinikákra. A tiszta termék szelektíven hat a limfocitákra, mégpedig sokkal inkább a
T-sejtek induktív fázisában mint a sejtszaporodási ciklusban. Gátolja a T-segítő (helper) sejtek aktiválását.
Akadályozza a limfokinek, igy az interleukin-2 képződését. Nem zavarja viszont a leukocita o-interferon és a
(fibroblast) |-interferon képződését.
A legnagyobb mennyiségben, főtermékként képződő cyclosporin-A mellett közel 25 minor
komponensként képződő rokon vegyületet ismerünk, amelyeket a nyers extraktumból metanollal Sephadex LH-
20 oszlopon, illetve szilikagélen lehet elválasztani. Ezek a gyűrűs peptidek 11 aminosavból épülnek fel. A
főtermékként gyógyászati alkalmazásra került acetonból kristályosítható, vízben gyengén oldódó, lipofil anyag
UV spektruma végabszorpciót mutat. Apoláros természete - az aminosav építőelemek nagyfokban érvényesülő
N-metilezettségét ismerve - nem meglepő. Megjegyzendő, hogy a hatásos termékben a 9, és 10-ik helyen levő
leucin N-metilezettsége cisz helyzetű, a többi aminosav N-metilezettsége viszont transz.

Tizenkétnapos fermentációs ciklus paraméterei,
a termékképzés körülményei
79

A harminchárom tagú peptidgyűrű szerkezetét merevíti – a 2-ik és 5-ik aminosav – az aminovajsav és a valin
között kialakuló két hidrogénhíd, valamint a 7-ik helyen levő L-alanin és a 11-ik helyen levő metil-valin között
létrejövő hidrogénhíd. Vizes közegben a metil-butenil-treonin és a 6-ik helyen levő metil-leucin apoláris lánca
egymásfelé fordulva elősegíti egy újabb hidrogénhíd kialakulását a D-alanin és az előbbi metil-leucin karbonil
csoportja között. Ezt szemlélteti az ábra és a krisztállográfiai térszerkezeti model rajza
Sósavas hidrolízissel nyert építőelemei közül az egyetlen D-alaninon kívül a többi komponens L
konfigurációjú természetes aminosav. Egy o-aminovajsav, egy szarkozin, négy N-metil-leucin, egy alanin, egy
valin, egy N-metil-valin és egy kilenc szénatomot tartalmazó telítetlen aminosav (3-hidroxi-4-metil-2-
metilamino-6-okténsav, másnéven N-metil-¸-butenil-¸-metil-L-treonin) alkotja a hatásos molekulát. A
C
62
H
111
N
11
O
12
összegképletű anyag dihidrociklosporinná redukálható.
1 2 3 4 5 6 7 8 9 10 11
A Mbtre Abu Sar Meleu Val Meleu Ala D-Ala Meleu Meleu Meval
B Mbtre Ala Sar Meleu Val Meleu Ala D-Ala Meleu Meleu Meval
C Mbtre Tre Sar Meleu Val Meleu Ala D-Ala Meleu Meleu Meval
D Mbtre Val Sar Meleu Val Meleu Ala D-Ala Meleu Meleu Meval
E Mbtre Abu Sar Meleu Val Meleu Ala D-Ala Meleu Meleu Val
F DesoxiMbtre Abu Sar Meleu Val Meleu Ala D-Ala Meleu Meleu Meval
G Mbtre Norval Sar Meleu Val Meleu Ala D-Ala Meleu Meleu Meval
H Mbtre Abu Sar Meleu Val Meleu Ala D-Ala Meleu Meleu Dmeval
I Mbtre Val Sar Meleu Val Meleu Ala D-Ala Meleu Leu Meval
K DesoxiMbtre Val Sar Meleu Val Meleu Ala D-Ala Meleu Meleu Meval
L Btre Abu Sar Meleu Val Meleu Ala D-Ala Meleu Meleu Meval
M Mbtre Norval Sar Meleu Norval Meleu Ala D-Ala Meleu Meleu Meval
N Mbtre Norval Sar Meleu Val Meleu Ala D-Ala Meleu Leu Meval
O Meleu Norval Sar Meleu Val Meleu Ala D-Ala Meleu Meleu Meval
P Btre Tre Sar Meleu Val Meleu Ala D-Ala Meleu Meleu Meval
Q Mbtre Abu Sar Val Val Meleu Ala D-Ala Meleu Meleu Meval
R Mbtre Abu Sar Meleu Val Leu? Ala D-Ala Meleu Leu? Meval
S Mbtre Tre Sar Val Val Meleu Ala D-Ala Meleu Meleu Meval
T Mbtre Abu Sar Meleu Val Meleu Ala D-Ala Meleu Leu Meval
U Mbtre Abu Sar Meleu Val Leu Ala D-Ala Meleu Meleu Meval
V Mbtre Abu Sar Meleu Val Meleu Abu D-Ala Meleu Meleu Meval
W Mbtre Tre Sar Meleu Val Meleu Ala D-Ala Meleu Meleu Val
X Mbtre Norval Sar Meleu Val Meleu Ala D-Ala Leu Meleu Meval
Y Mbtre Norval Sar Meleu Val Leu Ala D-Ala Meleu Meleu Meval
Z Mamino-oktánsav Abu Sar Meleu Val Meleu Ala D-Ala Meleu Meleu Meval
A tenyészközeghez adott aminosavakkal a képződő ciklosporin kémiai szerkezetét befolyásolni lehet. A
táblázat a termelő törzsben kialakuló, illetve mesterségesen kialakított aminosav készlettől függő ciklosporin
változatokat mutatja be.
Tolypocladium inflatum-mal végzett kisérletek szerint 8 g/liter mennyiségben adott DL-o-aminovajsav
jelenlétében kizárólag ciklosporin-A képződik. Treonin jelenlétében a ciklosporin termelés megkétszereződik
ugyan, de 59 % ciklosporin-A mellett 41 % ciklosporin-C képződik. A C komponens immunszupresszív hatása
gyengébb mint a gyógyszerként fogalmazott ciklosporin-A (C
62
H
111
N
11
O
12
). L-norvalint adagolva a teremék 91
%-a ciklosporin-G ( C
63
H
113
N
11
O
12
) mindössze 9 % ciklosporin-A mellett. Immunszupresszív hatás
szempontjából az A illetve G komponens nem különböztethető meg.
80

81
Bioszintézise a gramicidin-S képződéséhez hasonlóan, tiotemplát enzim-komplexen folyik ATP-vel aktívált
természetes konfigurációjú aminosavak felhasználásával. Az izotóppal végzett kísérletek alapján feltételezhető,
hogy az okténsav a zsírsav szintézis analógiájára malonil-CoA felhasználásával képződik. A jelzett (metil-
13
C)metioninnal végzett kísérletek alapján feltételezhető, hogy a metil csoportok a bioszintézis második
szakaszában kerülnek a tizenegy tagú gyűrűs peptidre.



(a)
szilárd kristály konformációja
röntgenkrisztállografikus vizsgálat alapján.






(b)
apoláros oldószerben felvett NMR vizsgálat
eredményeiből komputerrel nyert szerkezet
rajza. Az ábrán látható, hogy az apoláros
oldallánc a molekulából kemelkedik az
apoláros oldószerben való kristálíyképződés
körülményei között.


Wenger R. és munkatársai a ciklosporin-A totálszintézisét is megvalósították. Előállították a metil-
okténsav származékot, majd tercier-butiloxi-karbonil védelmet alkalmazva létrehozták a tizenegytagú lineáris
peptidet, végül zárták a peptid láncot. Nem kevés problémát jelentett az N-metilált építőelemekből felépíteni a
lineáris peptid láncot. A totálszintézis gazdaságosság szempontjából nem vetekedhet a bioszintézissel, viszont
lehetőséget adott bizonyos - a természetben elő nem forduló - ciklosporin analógok előállítására. Ezek a kémiai
változatok azonban kivétel nélkül inaktív módosulatok voltak.


13
C eloszlása. *: [
13
C
1
] acetátból, : [
13
C
2
] acetátból, : [metil-
13
C] metioninb

Az élő szervezetbe etanol-polioxietilált castor olaj elegyeként intravénásan adagolható. Szájon át
zselatinkapszulában adva felszívódása bizonytalan (20-50 %), 3-4 óra alatt éri el a hatásos vérszintet. Lipofil
természete miatt egyenletesen oszlik el a szervezetben, a vér-agy gáton azonban nem hatol át. A felvett anyag
fele a vörös vértestekhez, 10-20 %-a a fehérvérsejtekhez, 30-40 % a vérplazma lipoprotein frakciójához kötődik.
A májba kerülve lassan lebomlik. Közel 30 ismert bomlásterméke, demetilezett, illetve hidroxilezett származéka
ürül elsősorban az epével. A bomlástermékek jelentős hányada még immunszupresszív hatást mutat. A bevitt
hatóanyag felezési ideje 15 óra. A vizelettel 96 óra alatt mindössze 4-6 %-a távozik.

82
A makrolid antibiotikumok között is akad néhány immunszupresszív aktivitású anyag. A felfedezésekor
FK506 ként kiemelt, később tacrolimusnak elnevezett intravénásan illetve szájon keresztül is adható vegyületet
Streptomyces tsukubaensis tenyészlevéből izolálták. A tacrolimus is gátolja a T-sejtek aktíválását. A citoszolban
kialakuló tacrolimus-fehérje komplex gátolja a calcineurin aktívitását, a kalcium-függő szerin/treonin foszfatáz
hatásos működését. A tacrolimus intracelluláris receptora azonban nem azonos a ciklosporint kötő fehérje
szakasszal, jóllehet mindegyik végeredményben a calcineurin hatását befolyásolva a defoszforilezést gátolva
akadályozza a lymphokin gének expresszióját és ezzel késlelteti az immunválasz megjelenését

Immunszupresszív hatású újabb bioaktív makrolidok


83
Az immunválaszt befolyásoló anyagok hatásmódja

A téma vizsgálata szempontjából célszerű végigtekinteni az immunválaszban résztvevő sejtek
kapcsolatrendszerét.


84
A vörös csontvelőben képződő pluripotens őssejtből képződik a prekurzor sejt, amiből egyrészt a vér
alakos elemei (vörös vértestek, a fehérvérsejtek és a vérlemezkék) másrészt az antigént bemutató sejtek (APC
antigen presenting cells) és a makrofágok jönnek létre.

Vörös csontvelõ Vörös vértest

Neutrofil fehés vérsejt
Bazofil fehés vérsejt
Eosinofil fehés vérsejt

Pluripotens
Õssejt


Prekurzor
Sejt
Vérlemezke
Antigén-
Bemutató sejt
APC

Makrofág



Prekurzor
nyiroksejt

T
h
y
m
u
s

T sejt

CD8 sejt


IL-2

CD8
Ölõsejt

Szuppresszor
Sejt CD8


CD4 sejt

IL-1
>>>>>>>>>>>>>
lymphokin
termelés IL

CD4
Segítõ sejt

.


CD4 immun sejt


Emlékezõ sejt




elõ-B sejt
(prekurzor)






IL-1, IL-4,
IL5, IL-6

B sejt

Plazma sejt
(antitest termelõ)


emlékezõ sejt

Az immunválaszban résztvevõ sejttípusokat bemutató vázlat

A pluripotens őssejtből képződik a prekurzor lymphocita, amiből a thymusban fejlődik ki a T sejt. A T
sejtből az antigén bemutató sejt közreműködésével jön létre az antigénre specifikus CD8 sejt, amiből a CD-4
segítő sejtből származó IL-2 fehérje által serkentett antigénre specifikus sejt lízist okozó CD-8 ölő sejt és CD-8
szuppresszor sejt képződik.
Ugyancsak a pluripotens sejtből képződik a prekurzor nyirok sejt, amiből a thymusban képződik a T sejt,
valamint az elő-B sejt, amely végül B-sejtté alakul. A T sejtből képződik a CD-4 sejt, amiből az általa termelt
IL-1 fehérje (lymphokin) közreműködésével képződik CD-4 segítő sejt. Ebből képződik az antigén specifikus
antitestet hordozó CD-4 immunsejt és az emlékező sejt. A segítő sejt különböző fehérjéket (lymphokineket)
termel. Ezek közül az IL-2 a CD-8 sejt továbbalakulását, az IL-1, IL-4, IL-5, és IL-6 fehérjék pedig a B-sejt
differenciálódását, extracelluláris antitestet termelő plazma sejtté, illetve antigén specifikus emlékező sejtté
fejlődését segítik.
Az APC sejthez kapcsolódó MHC (major histokompatibility complex) faktor exogén eredetű antigént
befogadva MHC-I komplexként indítja a CD8 sejt kialakulását serkentő folyamatot. Az immunválasz elsősorban
a T és B sejtekből származó emlékező sejtek képződési sebességétől függően általában 8-14 nap elteltével
várhat. A T-sejt képződési sebességétől függően azonban 1-3 napon belül is megjelenhet az antitest. — Az
endogén eredetű fehérjével kialakuló MHC-II komplex bekötődésének a hatására indul a lymphokinek
elválasztása, ami viszont a B sejtek fejlődését serkenti.

A T és B sejtek szaporodási ciklusát egy Ca
++
iont igénylő calcineurinnak nevezett szerin/treonin
foszfatáz a foszfát csoport eltávolításával a foszforilezett szabályozó fehérje (NFATc–P) aktiválását végzi. A
citoszolban képződő foszfátmentes NFATc fehérje (nuclear factor of activated T cells) a sejtmagi NFATn
fehérjével kapcsolódva nélkülözhetetlen átírást szabályozó faktor. Transzkripciós faktorként serkenti az
interleukin (lymphokin) IL1–IL12 gének átírását. Hiánya nem csak az interleukin géne átírásűát akadályozza, de
85
a megfelelő citokin receptorok képződést is gátolja. Az IL2 hiány miatt menő a TGF-| képződés (transforming
growth factor-|), ami hatásosan gátolja a T sejt osztódását, az antigén specifikus CD8 ölősejt képződést. Végül
is a TGF-| tevékenysége váltja ki a immunszuppressziót.
Ez az NFATc/NFATn komplex inditja el más fehérje gének (TNF-o tumor nrkrózis faktor, IFN-¸
interfgeron ¸, GM-CSF granulocyte macrophage colony-stimulating factor) átírását is. A calcineurin foszfatáz
gátlása tehát nagy számú fehérje képződésének az akadályozását okozza.
A lipofil tulajdonságú ciklosporin a sejtbe jutva az ott levő ciklofilin receptor fehérjével heterodimer
komplexet alkotva gátolja a calcineurin (szerin/treonin peptid foszfatáz) működését. A citoszolban levő
szabályzó fehérje defoszforilációját akadályozva nem jöhet létre az NFATc/NFATn komplex, ennek hiányában
pedig nem képződnek a B sejt differenciálódását segítő lymphokinek.

MHC-II
ciklosporin endogén
antigén



T sejt
T sejt receptor


Ciklofilin

Calcineurin
(foszfatáz)
Ca
++
/CaM

Ciklosporin
ciklofilin
SEJTPLAZMA
Inaktíváló komplex

NFATc—P
P
I

NFATc




NFATn



NFATc | NFATn


génátírás indukálása
SEJTMAG




Interleukin képzõdés

Interleukin
IL2



CaM = calmodulin (kalcium iont kötõ fehérje)
calcineuri = szerin/treonin peptid foszfatáz
ciklofilin =aktiváló fehérje
ciklosporin = immunszuppressziót okozó depsipeptid
(Ciklofilinhez kapcsolódva inaktíválja a calcineurint)

Az NFATc/NFATn komplex hiány miatt nem képződik IL2. Ennek következtében fokozódik a TGF-|
(transforming growth factor) képződése, ami hatásosan gátolja a T sejt szaporodását, azaz az antigén specifikus
CD8 ölősejt képződést. Végül is a TGF-| tevékenységének a fokozódása váltja ki az immunszuppressziót.
A ciklofilin fehérjével a tacrolimus (eredetileg FK506) is calcineurint inaktíváló stabil komplexet képez
A foszforilezett szabályozó fehérje (NFATc–P) nem indítja el a lymphociták továbbalakulását segítő fehérjék
génjeinek átírását, azaz specifikusan gátolja az immunválasz kiteljesedését.
A sejtosztódás és a differenciáció hatásosan gátolható kortikiszteroidokkal, a de novo purinszintézist gátló
mycophenol savval, rapamycinnel, cyclophosphamiddal, methotrexáttal, azathioprinnel.
Az immunszuppresszív anyagok hatása függ az antigén minőségétől. Általában könnyebben
akadályozható az immunválasz megjelenése, ha a terápia megelőzi az antigén bemutatását. A primer
immunválasz megjelenése sokkal hatásosabban akadályozható, mint a mérsékelten szuppresszálható szekunder
válasz. Mellékhatásként ezek a hatóanyagok gátolják a vörös csontvelő sejtjeinek az osztódását, továbbá a
gyomor-béltraktus sejtjeinek a szaporodását.

86
Lymphokinek (cytokinek) immun választ befolyásoló hatása

Interleukin-1 Serkenti a vörös csontvelő sejtek és prekurzor lymphocyták képződését
Interleukin-2 T sejt képződést és a citolízist okozó ölősejt képződését segíti
Interleukin-3 A vörös csontvelőben a B és T sejtek képződését serkenti
Interleukin-4 A B és T sejtek valamint a makrofágok aktiválódását segíti
Interleukin-5 Az eozinofil sejtek képződését segíti
Interleukin-6 A csontvelő képződést és a plazmasejtek osztódását segíti
Interleukin-7 Az IL-2-vel együttműködve serkenti a B és T sejtek képződését
Interleukin-8 A neutrofil sejtek, valamint a B és T sejtek képződését segíti
Interleukin-9 Az ős sejtek osztódását segíti
Interleukin-10 Gátolja a T sejtek működését
Interleukin-11 Az IL-3 hatását erősíti
Interleukin-12 Az IL-2 hatását erősíti
Alfainterferon Növeli a makrofágok, a T sejtek és a természetes ölő sejtek aktivitását
Interferon-¸ Aktiválja a makrofágok és a T sejteket, fokozza az MHC képződését
GM-CSF Serkenti a csontvelő sejtek osztódását, aktiválja az ACP sejteket
TNFo.| A tumor sejteket öli, fokozza a gyulladásos folyamatot

VIOMYCIN

Vörös kristályos, vízben jól oldódó erős bázis, amelyet 1951-54 között több kutatócsoport is izolált kölönböző
Streptomyces törzsek tenyészlevéből. Összegképlete C
25
H
43
N
13
O
10
. Legvalószinűbb kémiai szerkezetét eddig
szerkezetbizonyító szintézissel nem igazolták.


Gyógyszerként a szulfátsóját használják. Gyógyászati jelentősége a Mycobacterium tubercolosis elleni
alkalmazhatóságában rejlik. Mellékhatása nyolcadik agyi ideg károsításában és vesekárosító hatásában
jelentkezik. A riboszomához kötődve gátolja a fehérjeszintézist, de nem okoz hibás kódleolvasást. A vegyület
kémiai módosításával nem sikerült a biológiai tulajdonságát javítani. A hidroxilcsoportok kémiai acilezése nem
befolyásolja a biológiai aktivitását, viszont a terminális aminocsoportokat érintő kémiai reakciók teljesen
inaktíválják a molekulát.




87

NOVOBIOCIN

Gyógyászati használhatósága és az eddig megismert antibiotikumoktól eltérő különleges szerkezete indokolja a
bioaktív termék tárgyalását. Az ötvenes évek derekán egymástól függetlenül három kutatócsoport is megtalálta a
Streptomyces spheroides, illetve a S. niveus metabolitjaként, majd ezt követően egy S. griseoflavus és egy S.
griseus, valamint több nem azonosított Streptomyces törzs termékeként is leírták. Kémiai szerkezetének
tisztázása Shunk, Haecksema, valamint Spemcer nevéhez fűződik. Kémiai szintézisét Vaterlaus dolgozta ki
munkatársaival.
A molekula egy benzoesav származékkal szubsztituált kumarin származék, amihez egy L-lyxóz szerkezetéhez
hasonló novióz kapcsolódik. A vegyület mindkét aromás komponense shikiminsavból a cukor komponens pedig
UTP-glükózból képződik. A kristályos antibiotikum sárgás fényérzékeny anyag. Erős sav lévén vízben való
oldhatósága pH függő. A kumarin enolos hidroxilja sokkal erősebben savas karakterű, miont a fenolos hidroxil.
Injekcióként, vagy kapszulában forgalomba került dinátrium sója könnyen előállítható. Vízben nehezen oldódó
kalcium-sóját szuszpenzióként is adagolják. Erősen gátolja a Proteus vulgáris és a Klebsiella törzsek növekedét.
Fontos szerepet nyer a penicillin rezisztens Staphylococcus törzsek által okozott fertőzések leküzdésében.
Szokásos adagja 0.5-1 g 12 óránként. Antibakteriális hatását erős magnéziumkötő képességével magyarázzák. A
híg (0,01 M) novobiocin oldat enyhén sárgás színe 0,01 M MgCl
2
jelenlétében mély sárgává sötétedik. Más
kétérétékű ion – például kalcium – nem mutat hasonló hatást. A novobiocin mind azokat a reakciókat (közel 60)
zavarja, ahol a Mg
++
ionoknak különleges szerepük van. Így a DNS-girázhoz kötődve gátolja a DNS polimeráz
és az RNS polimeráz működését. Nagyobb koncentrációban gátolja az oxidatív foszforilezést és a transzport
rendszerek működését. Közismert, hogy a magnézium a biológiai membránok és a riboszómák szerkezetének a
stabilizálásában is fontos szerepet játszik. Ismeretes, hogy a Gram-pozitív mikroorganizmusok magnézium
igénye közel tízszer nagyobb a Gram-negatív mikroorganizmusokénál. Nem meglepő tehát, hogy a novobiocin
erősen gátolja a Gram-pozitív mkroorganizmusok növekedését, de alig hatásos a Gram negatív szervezetek által
okozott fertőzések leküzdésében.. Gátolja viszont a magnézium igényes gombák és protozoák növekedését, sőt
gátolja a. növények gyökércsúcsának növekedését. Az antibiotikum hatását potencirozza a magnézium hiányt
okozó Zn
++
ion jelenléte.
Streptomyces niveus-ból kinyertek egy enzimet, amely ATP jelenlétében a 3-amino-4,7-dighidroxi-8-
metil-kumarin és a 4-hidroxi-3-(3-metil-2-butenil)-benzoesav kapcsolódását katalizálja. In vivo valószínűleg a
cukor komponenssel szubsztituált kumarinhoz kapcsolódik a benzoesav származék. A cukor komponens
metilezése, továbbá karbamoilezése az antibiotikum képződés befejező lépése. A karbamoil csoport jelenléte
esszenciális a biológiai hatás szempontjából.
A tenyészethez adott prekuirzorokkal a novobiocin különböző analógjait lehet előállítani. A beépülés
feltétele, hogy a benzoesav para helyzetben oxigén, vagy nitrogén atomot tartalmazzon. Ezek a novobiocin
analógok azonban antibakteriális hatás szempontjából nem jelentettek előnyt.

88

ANSA-LÁNCÚ ANTIBIOTIKUMOK CSOPORTJA
A Prelog által ansamycinnek elnevezett antibiotikum csoport közös jellemzője az aromás, koplanáris helyzetű
alapsíkot alkotó magot kancsófülszerűen áthidaló makrociklus.


A csoportba sorolt hatásos vegyületek legismertebb tagját a rifamycin csoport vegyületeit Sensi és munkatársai
1958-ban izolálták egy Streptomyces mediterranea törzs fermentlevéből. A taxonomusok szerint a törzs a
Nocardia nemzetsséghez tartozik. Más szerzők sok rokon vegyületet írtak le, ilyenek például a streptovarycin,
tolypomycin, geldenamycin, de gyógyászati alkalmazásra csak a rifamycin származékok kerültek.
A Nocardia mediterranea
tenyészlevében ugyanis nemcsak az
eredetileg képződő vegyület, a
rifamycin-B található, hanem ennek
oxidált alakja a rifamycin-O illetve a
glikol-származék hidrolízisével
képződő rifamycin-S is. A rifamicin B-
ből oxigén felvétellel képződő Y mó-
dosulat teljesen inaktív.
A csoport tagjai egymásba könnyen
átalakulhatnak, illetve viszonylag
egyszerű kémiai reakcióval
átalakíthatók. A kromofort érintő
kémiai átalakulások az egyes
vegyületek spektrumában jól követhető
változást okoznak.
A rifamycin-B biológiai aktivitása
csekély, de a belőle nyerhető
rifamycin-S már parenterálisan
alkalmazható antibiotikum. Ez
utóbbiból enyhe redukcióval
előállítható az orálisan alkalmazható
rifamycin-SV. A vegyület stabilitását
kémiai átalakítással, a C-3 hidrogén
helyettesítésével fokozni lehet.. A
rifamycin-SV 3-metil-piperazinil-iminometil származéka a gyógyszerként forgalmazott rifampicin.


A rifamycinek biológiai aktivitásának összehasonlítása
MIC érték in vitro
Staphylococcus aureus Staphylococcus aureus fertőzés kivédése
mérőtörzs használatakor egérben in vivo végzett méréssel
mg.ml
-1
mg/kg i.m. adva mg/kg per os adagolva
rifamycin-B

0,026 305

500
rifamycin-O 0,01 500

500
rifamycin-S 0,005 65 172
rifamycin-SV 0,005 18 74
rifamp(ic)in

0,002 0,12 0,11



89
A rifampicin félszintézis első lépése a fermentációs úton előállított rifamycin-B salétromos savval végzett

oxidációja vizes metanolban. A második lépésben metanolos tetrahidrofuránban végzett sósavas hidrolízissel
nyerhető a rifamycin-S származék. Ezt tetrahidrofuránban formalinnal és tercier-butilaminnal reagáltatják
mangándioxid jelenlétében. A kapott t-butil-iminometil-rifamycin-S vegyületből tetrahidrofuránban végigvitt
savanyú hidrolízissel formil-rifamycin-S nyerhető. A befejező lépésben, ugyancsak tetrahidro-furánban 1-amino-
4-metil-piperazinnal reagáltatva jutunk a 3-(4-metil-1-piperazinil)-iminometil-rifamycin-SV-hez, a
rifamp(ic)inhez.
A félszintézissel előállított rifamycin S-szerkezetű
rifabutin előnyösen alkalmazható az utóbbi időben
különösen a HIV-fertőzött személyek esetében
gyakrabban előforduló Mycobacterium avium fertőzések
leküzdésében. Annak ellenére, hogy a két rifamicin
származék a Mycobacterium törzseknél
keresztrezisztenciát okozhat, mégis nagyszámú (225)
rifampin rezisztens (10 ug/ml) törzs 80 %-ának
növekedését 1 ug/ml rifabutin gátolja. A vegyület
lipofilitása miatt a szövetekben jelentős mértékben dúsul
fel. A biológiai aktivitás az ansa láncban található C
21

hidroxil csoport és környezetének érintetlenségéhez
kötődik. A rifamycin-SV 20-hidroxi-21-keto származéka
biológiailag teljesen inaktív. Ugyanakkor a 25 dezacetil-
származék, valamint a 27 demetil-származék biológiai aktivitása jól észlelhető.

90
A rifamycin váz szintézise tiotempláton folyik a zsírsavszintézishez hasonlóan, metilmalonil-CoA
elemekből. A bioszintézis az aromás mag képződésével indul.

A 2,5-dihidroxi-3-amino-benzoesav egy metilmalonil-CoA-ból származó propionsav |-szénatomjához
kapcsolódik. Ezt követi a malonil-CoA-ból származó ecetsav beépítése. A továbbiakban hat metilmalonil-CoA
felhasználásával épül tovább a szénlánc..Ezután ismét egy malonil-CoA-ból származó ecetsav hosszabítja a
molekulát A lánc utolsó építőeleme metilmalonil-CoA felhasználásával kerül a helyére. Az utolsó lépésben az
aromás mag aminocsoportját acilezi a tiotemplátról leváló metabolit és ezzel záródik a gyűrű. A bioszintézis
során hat esetben a dekarboxileződést követő kondenzáció után NADPH függő redukciós lépés következik, sőt
két esetben a zsísav szintézishez hasonlóan a vízkilépés is bekövetkezik. Az antibiotikum speciális
szer8kezetének a kialakítása még néhány oxidációs lépést igényel. A C
28
-on levő metilcsoport széndioxiddá
oxidálódik. A C
29
, C
30
közötti kötés oxidálását követi a FAD-enzim által katalizált gyűrűzárás - a naftalin váz
kialakulása - majd az ezzel anellált dihidrofurán gyűrű képződése. Az alapváz elkészültét követi a C
25
hidroxil
acilezése acetil-CoA felhasználásával és a C
27
hidroxil metilezése. A C
4
hidroxilon glikolsavval kialakított
fenoléter tartósan nem képes sabilizálni a molekulát. Könnyen oxidálódik rifamycin-O átmeneti terméken
keresztül rifamycin-S naftokinonná.
Az ansa-láncú antibiotikumok hatásos származékai specifikusan gátolják a bakteriális DNS függő RNS-
polimeráz működését, mégpedig azáltal, hogy az RNS-polimeráz |-alegységéhez egy antibiotikum molekula
kötődik. Ebből a kedvező tényből - egy enzimhez egy antibiotikum molekula kapcsolódik - adódik, hogy
viszonylag nagyon csekély, mindössze 0.0025
ug.ml
÷1
antibiotikum már gátolja a Gram-pozitív
baktériumok növekedését. Ugyanakkor az eukariota
sejtben a DNS függő RNS szintézis gátlása csak 1000
illetve 10000-szeres koncentrációban észlelhető. A
piperazin enyhe májkárosító mellékhatása miatt csak
állandó orvosi ellenőrzés javasolt. Sőt a májfunkció
zavarása miatt krónikus alkoholistáknál használata
ellenjavallt. Nem tanácsos együtt alkalmazni kifejezetten
májkárosító gyógyszerekkel, például izonikotinsav-
hidraziddal sem.
A hatásos anyag fő kiürülési útja ugyan az epén
keresztül vezet, de jelentős része távozik a vizelettel is.
Étkezés előtt adva nyolc órán keresztül hatásos vérszintet
eredményez. A központi idegrendszer kivételével a
testszövetekbe jól eloszlik. Az RNS szintézist gátló hatása
miatt kezdetben virusellenes hatását is feltételezték. A
hatvanas években végzett igen részletes kisérletek
bizonyították, hogy virusellenes hatása nincs, az onkogén
virus ellen hatástalan, a reverztranszkriptáz működését
nem befolyásolja, félszintézissel készült lipofil
származékai pedig már az emlős sejteket is károsítják.
Az említett kedvező adatokon kívül különleges tulajdonsága ennek az antibiotikum csoportnak, hogy
eredménnyel használható a tuberkulózis kórokozója ellen. Csekély májkárosító hatása ellenére sikerrel
alkalmazzák a Mycobacterium tuberculosis okozta fertőzés leküzdésére, de hatásos a Mycobacterium leprae
ellen is. A ferementációs eljárás fontos elemeként említendő a széndioxid koncentráció meghatározó
jelentősége. A bioszintézishez szükséges malonil, illetve metilmalonil-CoA képződés az átlagosnál nagyobb
parciális széndioxid koncentrációt igényel. Ezért a rifamicin képződését a reaktoron átfúvott levegő mennyisége
befolyásolja. A rendszerből távozó gázelegy nyomását, oxigén és szén-dioxid tartalmát - folyamatosan mérve -
optimális értéken kell tartani.

91
RIBOSZÓMÁLIS FEHÉRJESZINTÉZIST GÁTLÓ METABOLITOK

CHLORAMPHENICOL Klóramfenikol, Chloromycetin, Chlorocid

Az első szélesspektrumu antibiotikumot 1947-ben a Waksman vezette munkacsoport izolálta
Streptomyces venezuelae tenyészlevéből. A fonalas mikroorganizmust egy Venezuelából származó talajmintából
izolálták. Az első felfedezés után többször megtalálták ezt az anyagot különboző helyről származó Streptomyces
törzsek metabolitjaként. Ez az antibiotikum a természetes anyagokban ritkán előforduló csoportokat
(nitrocsoport és dikóracetil-csoport ) tartalmaz. Egyszerű kémiai szerkezetének [ (D-threo-N-)1,1'-dihidroxi-3-p-
nitrofenil-izopropil-diklóracetamid ] felderítése után hamarosan kidolgozták totálszintézisét. Ez a fermentációs
eljárásnál lényegesen olcsóbb utat jelentett. Ez volt az az antibiotikum, melyik kezdettől fogva kémiai
szintézissel előállítva került forgalomba.
Kiindulási anyagként általában p-nitro-
acetofenont használnak, amit
brómozás után hexametilén-
tetraminnal p-nitro-acetamido-
acetofenonná alakítanak. A
lánchosszabbítást formaldehiddel
végzik. A ketocsoportot Al-izo-
propilát jelenlétében Meerwin-Pandorf
szerint redukálják. Ezen az úton a DL-
threo származékhoz jutunk, amit D-
borkősavval lehet reszolválni. A nyert
D nitrofenil-szerinolt diklórecetsav-
kloriddal acilezik.A kémiai előállítás
lehetőséget adott az antibiotikum
kémiai analógjainak a szintézisére.
Ezek azonban egy kivételével
gyengébb hatásúak, illetve
hatástalanok. Az antibakteriális hatás
megkétszereződött, ha diklórecetsav-
klorid helyett trifluorecetsav-kloriddal acilezték a p-nitrofenil-szerinolt.


A klóramfenikol bioszintézise az aromás bioszintézis-úthoz kapcsolódik.

Az arilamin-szintetáz
közreműködésével képződik a p-
amino-fenil-piroszőlősav, amiből egy
transzamináz alakítja a p-amino-L-
fenilalanint. Ez a vegyület
alloszterikusan képes sza-bályozni az
arilamin-szintetáz működését, de az
enzim képződését is, represszálja.
Ezen enzim képződését a szerkezeti
hasonlóságból következően a
klóramfenikol is represszálja. Az L-p-
amino-fenilalanin hidroxilezése
közben az aminosav konfigurációja is
megváltozik, D-threo-p-amino-
fenilszerin képződik. Ennek a
vegyületnek a diklór-acetilezését
követi a karboxil csoport redukciója, majd az aminocsoport oxidációja.

A bioszintézist bemutató ábrán jól követhető, hogy p-aminofenil-szerinol természetes intermedierként
nem fordul elő. Sőt a tenyészethez adva sem acileződik, viszont in vitro és in vivo gátolja a p-aminofenilalanin
hidroxilezését. Fölös bromid jelenlétében fermentációs eljárással előállítható a dibrómacetil származék.
Halogenid hiányos táptalajon viszont rövidláncú zsírsavakkal acilezett származék képződik.


92
A szintelen tűkristályt képző antibiotikum alkoholban és szerves oldószerekben jól, vízben rosszul (2,5
mg ml
-1
) oldódik. A hőstabil vegyület sterilezhető. Mivel a bélcsatornából jól felszívódik szájon át adva is
hatásos vérszintet biztosít. Keserű ize miatt kapszulában, vagy palmitinsav észterét szirupban szuszpendálva
adagolják. Ez utóbbi származék vízben nem oldódik. Felszívódása csak a
bélcsatornában bekövetkező hidrolízis után várható. Parenterális
adagoláshoz általában a klóramfenikol borostyánkősav-észterének nátrium
sóját javasolják. Napi adagolása: 4 x 12,5 mg testsúly kg-ra számolva.
Helyi felhasználásra kenőcs és hintőpor formájában is forgalomba hozzák.
A huszadik század közepétől több mint 20 éven keresztül a Gram-
negatív kórokozók leküzdésére az egyik legnépszerűbb hatóanyagként
alkalmazták alacsony ára és széles spektuma miatt.
Az utóbbi időben a vérképző szervekben okozott zavarok miatt
(10 napnál hosszabb kezelés a vérképet megváltoztatja) alkalmazása
visszaszorulóban van. Először az USA egészségügyi szervezete (FDA)
tiltotta meg használatát. Alacsony piaci ára miatt azonban a szegényebb
országok ma is jelentős mennyiségű klorocidot használnak. A felszívódott
anyagot a gazdaszervezet észteráz aktivitása lassan inaktíválja. Rossz
vizoldékonysága miatt a szervezetből a májban képződő glükuronid
alakjában a vesén keresztül távozik. Májbetegek számára a klóramfenikol
használata különösen veszélyes, mert az aktív vegyület felhalmozódik. Az
aktuális vérszint meghatározására immunologiai módszert használnak.

Vizes oldatban egy hidrogénhíddal stabilizált formája némileg hasonlít a
tRNS aminoacilezett végéhez. A biokémiai vizsgálatok szerint a hatóanyag a
riboszóma 50 S alegységén az akceptor helyhez kötődik. Riboszómánként
0,7-0,8 kloramfenikol kapcsolódását lehet mérni. Makrolidok, puromycin,
linkomycin befolyásolják, az amino-glikozidok és tetraciklin nem zavarja a
riboszómához való kötődését. Az aminoacilezett tRNS kapcsolódását a
riboszómához nem gátolja, de a peptidil-transzferáz számára lehetetlenné
teszi az aminoacil-terminál felismerését, így végső soron gátolja a peptidil-
transzferáz reakciót. A tiotempláton folyó peptid szintézist nem befolyásolja.
A klóramfenikolt a biokémikusok az induktív de novo enzimszintézis
gátlószereként használják.
Nagy koncentrációban a NADH oxidációját mind a négy izomer (treo és
eritro valamint a D- és L-) közel azonos mértékben gátolja. Ez a hatás
azonban fiziológiai körülmények között nem érvényesül. A riboszómán csak
a D-threo származék kötődik.

A klóranfenikollal szembeni rtezisztencia viszonylag kevés gondot okozott a gyógyászatban. Az
irodalomban nem található rezisztens riboszómáról szóló közlés. A permeabilitási viszonyok megváltozása
viszont az érzékenység csökkenésével járhat. A klóramfenikol rezisztenciát a mikroorganizmus specifikus aciláz
aktivitása okozza. A klóramfenikol-acetil-transzferáz az antibiotikum mindkét hidroxilcsoportját acetilezve
inaktíválja azt. Ez az enzim a klóramfenikolt termelő Streptomyces törzsekből kerülhetett át plazmid hordozta
információként más mikroorganizmusokba.


















93
AMINOGLIKOZID ANTIBIOTIKUMOK

A Waksmann által 1939-ben szervezett kutatócsoport első sikeréről, a streptomycin felfedezéséről 1944-ben
értesülhetett a tudományos közvélemény. Waksmann eredményein fellelkesülve világszerte tökéletesítették az új
antibiotikumok utáni kutató munka technikáját. A kezdeti eredményeken felbuzdulva azidőtájt sugárgombának
nevezett, elsősorban Streptomyces törzsek biológiai aktivitását vizsgálták. A kiterjedt kutatómunka
eredményeként a különböző antibiotikum csoportok felfedezése közben nagy számban találtak a fentihez
hasonló - aminocukrokat tartalmazó - antibakteriális hatású termékeket. Megbizható szerkezetük csak a
hatvanas évekre tisztázódott. Kémiai stabilitásuk, széles spektrumú alkalmazhatóságuk, vizoldékonyságuk és
biológiai hatásuk és elviselhető toxicitásuk indokolta kemoterápiai hasznosításukat.
A kémiailag különböző származékok egyetlen fejezetbe való ismertetését indokolja, hogy az
aminocukor építőelemeik glikozidos kötéssel kapcsolódnak egy diamino-hexithez (sztreptaminhoz). Kémia
szerkezetük alapján két fő csoportban oligoszacharidokként és pszeudo-oligoszacharidokként tárgyalhatók. Az
oligoszacharidok csoportjában megkülönböztetjük a 4-O-monoglikozidok csoportját - ide tartoznak a
sztreptomicinek és a bluenzomicinek - a 4,5-O-biszglikozidok csoportjától, ahová a neomycin, paramomycin,
lividomycin és hibrimycin komplexek vegyületei sorolhatók. A pszeudo oligoszacharidok közé tartoznak a
monoglikozidok, vagy másnéven pszeudo-diszacharidok, amelyeknek legismertebb képviselője a kasugamycin-
és a pszeudo triszacharidok, amelyeknek legfontosabb képviselői a 4,6-O-biszglikozidok, amelyek között
találjuk a kanamycint, tobramycint, gentamicint, sisomicint. Az antibiotikumok angol nevében szereplő y illetve
i betű a termelő mikróba rendszertani besorolására utal (például Streptomyces, illetve Micromonospora).
Valamennyien vízben jól oldódó, bázikus, kémiailag stabil vegyületek. Gram-pozitív és Gram-negatív
törzsek ellen hatásos széles baktérium spektrumú gyógyszerek. A penicillinre és tetraciklinre rezisztens törzsek
leküzdésében közülük nem egy életmentő jelentőségű. A bélből nem szívódnak fel, ezért csak parenterálisan
adhatók. Idegrendszeri zavarokat okozó krónikus toxicitásuk, ototoxicitásuk, vesekárosító hatásuk miatt tartós
kezelésre nem használhatók. A halláskárosodás magyarázata lehet, hogy az endolim-phában feldúsulva nehezen
ürülnek ki. Tartós hatásuk a cochlearis és vestibularis receptor sejtek elfajzását, degenerálódását okozza.
Az aminoglikozid antibiotikumok előállításához jól levegőztethető saválló fermentorokat használnak. A
táptalaj nitrogénforrásaként általában hőkezelt (proteázgátlótól mentesített) szójalisztet, szénforrásként glükózt
illetve keményítőt, a fermentációs pH tartása céljából kalciumkarbonátot használnak adalékként. A jóltermelő
törzsek szárazanyagtartalmuk többszörösét képesek szekunder anyagcseretermékként a tápközegbe juttatni 5-7
nap fermentációs idő alatt. Az antibiotikumot termelő törzsek sűlyesztett tenyésztési körülmények között spórát
nem termelnek, de a letöredező fonaldarabokból új kolóniákat fejlesztenek. Ebből következően az egész
fermentációs folyamat alatt egyidejűleg különböző élettani állapotban levő öreg és fiatal koloniák vannak jelen a
tenyészetben. Ha a tenyészet egy részének szakaszos eltávolításával annak friss táptalajjal való kiegészítéséről is
gondoskodunk, akkor tartósan akár két hétre is megnyújthatjuk az antibiotikumot termelő szakaszt.
Az aminoglikozid antibiotikumokat termelő törzsek tenyészlevében a főtermék mellett - minor komponensként -
a bioszintézis köztes termékei illetve ezek kémiai módosulatai mindig megtalálhatók. A képződő termékek
arányát a tenyésztési körülmények befolyásolják. A mutagén kezelés és gondosan ellenőrzött szelekcióval egy-
egy minor komponens főtermékké válhat.
Az aminoglikozid-antibiotikumot termelő törzsek fejlesztése nem könnyű feladat, mert a cél minden
esetben a gyógyszerként eladható legértékesebb komponens termelésének a fokozását jelenti, miközben a
tenyészlében fellelhető egyéb rokon vegyületek képződésének a visszaszorítására kell törekedni. Ebből
következik, hogy általában nem elegendő a fermentlé összaktivitásának a mérése, hanem az elegy összetevőinek
a vizsgálata, sőt mennyiségi értékelése szükséges.
Az aminoglikozidok antibakteriális hatása elsősorban a riboszómális fehérjeszintézis zavarásában
jelentkezik. A 30S alegységhez kötődve gátolják az iniciáció folyamatát. Zavarják a kód helyes leolvasását, ami
a téves aminosav beépítés miatt abnormális fehérjék képződéséhez vezet. Nem lehetetlen, hogy ezen felderített
hatásmódon kívül még más módon is beavatkoznak a baktérium anyagcseréjébe. Ez abból következtethető, hogy
a fehérjeszintézis gátlása elvileg csak bakteriosztatikus hatást eredményezne, márpedig a streptomycin baktericid
hatása kétségtelen.

SZTREPTOMICIN

Waksman által 1944-ben felfedezett sztreptomicin volt az első neves képviselője a humán terápiában
alkalmazott széles spektrumú, a tuberkulózis elleni küzdelemben is hatásos - kémiailag stabil - antibiotikum
csoportnak. Az antibiotikumot egy Streptomyces griseus törzs tenyészlevéből izolálták. Az első években
alkalmazott felületi tenyésztési technikáról viszonylag hamar áttértek a penicillin előállítás céljára kidolgozott
sűlyesztett aerob technológia alkalmazására. A szójalisztet és glükózt tartalmazó táptalajon növekedő,
klasszikusnak tekintett genetikai módszerek alkalmazásával nemesített törzs micélium tömege ml-ként 10-20 mg
sztreptomicin termelésére képes. A vízben jól oldódó antibiotikum kinyerésére ioncserélő módszert alkalmaznak.
94
A tisztított terméket szulfát-só formában kristályosítják és parenterálisan adható formában, steril porampullában
hozzák forgalomba. Hatásos adagja napi 1 g injekciós formában. A kristályos termékként korlátlan iderig
tárolható készítményt használat előtt oldják fel steril vízben. A feloldott sztreptomicin néhány napon keresztül
hűtőszekrényben károsodás nélkül tartható.
Szerkezetének felderítése nem volt könnyű
feladat. Sztereokémiailag is megbízható
szerkezetét csak 1963-65 években ismertette
Dyer. Totálszintéziséről pedig csak 1974-ben
Umezawa és munkatársai közöltek adatokat. Az
antibiotikum N-metil-L-glükózamint, L-
sztreptózt és sztreptidint tartalmaz. A
glükózamint és sztreptózt tartalmazó rész neve
sztreptobiózamin, amely több aminoglikozid
antibiotikum alkotórésze. A fermentlében
előforduló mannozido-sztreptomicinben a
glükózamin 4‖ szénatomjához D-
mannopiranozil csoport kapcsolódik.
Törzsnemesítéskor a mannozido-sztreptomicin
képződés visszaszorítására törekednek.
A sztreptomicin bioszintézise glükóz-6-foszfátból indul. A glükózamin szintézise jól ismert módon
fruktóz-6-foszfáton keresztül glutamin terhére folyik. Az amino csoport metilezése megelőzi a foszfomutáz
reakciót, amely katalizálja az N-metil-L-glükózamin-1-foszfát képződését. Ez a foszfátészter reagál a
streptózzal, kialakul a streptobiózaminban levő glikozidos kötés. A streptóz szintézis egyes lépései még nem
tisztázottak.
Legérdekesebb a streptidin képződés reakciósorrendje. A bioszintézis a glükuronsavhoz vezető
szintézisútból ágazik el, mégpedig az inozitolból epimerizációval scilloinozitol képződik, amelyből a NAD-
függő dehidrogenáz állítja elő a scilloinozózt. Ezt egy glutaminnal működő transzamináz inózaminná, majd egy
foszforiláz inózamin-foszfáttá alakítja. A következő lépésben egy amidináz az inózamin-foszfátot amidin-
inózamin-foszfáttá alakítja, amiből egy foszfatáz hatására képződik az amidin-inózamin, amely már alkalmas
szubsztrátum a NAD-függő dehidrogenáz számára. Ezt követően megismétlődnek az előző reakció lépések: az
amidin-3-keto-inózamin az előbb szereplő transzamináz hatására glutamin terhére amidino-sztreptaminná alakul,
amely foszforiláz segítségével amidino-sztreptamin foszfáttá, az aminidáz szubsztrátumaként pedig diamidin-
sztreptamin-foszfáttá alakul, amely alkalmas a sztreptobiózaminnal glikozidos kötés

kialakítására, és ezzel a sztreptomicin termelésére. Jól követhető a reakciósoron, hogy a primer anyagcsere
szempontjából hasznavehetetlen köztestermék a scilloinozitol a mikroszervezet enzimkészletének
közreműködésével, két egymást követő folyamatbanban végül is egy addig ismeretlen olyan végtermék
(streptomycin) képződéséhez vezet, amely a termelő mikróba számára mai ismereteink szerint elvben némi
előnyt jelent a létért folyó küzdelemben.
A bioszintézis útjának felderítését követően Demain streptomycint nem termelő mutánsokat állított elő.
Ezek közül kiválasztotta a streptidin szintézisben sérült, úgynevezett idiotróf mutánsokat. Ezek a törzsek csak a

95
tenyészethez adott streptidin jelenlétében termeltek streptomycint. A következő kisérletsorozatban prekurzorként
különböző aminociklitol származékokat adagoltak. Ezek közül csak a 2-dezoxi-ciklitol volt hatásos. Egy addig
ismeretlen új antibiotikum, a streptomutin-A képződött. Az új antibiotikum biológiai hatása a sztreptomicinéval
egyezett. A guanidin csoportok között levő hidroxil léte vagy hiánya nem okozott zavart sem a bioszintézisben,
sem a biológiai hatásban. Úgy tűnik, hogy a fölösleges, adott esetben káros anyagcseretermék sejtből való
eltávolítása csak oligiszacharid formában lehetséges. A monoszacharidok, különösen a foszforilezett
köztestermékek számára a membrán gyakorlatilag átjárhatatalan.

A sztreptomicin hatásmódja
Az elmúlt évtizedek bőséges idevágó irodalma sem ad minden részletre vonatkozó ismeretet. A
biokémikusok régóta használják a streptomycin szulfát sóját a baktériumokból kinyert enzimek tisztításánál a
nukleoproteinek eltávolítására. Azt is korán megállapították, hogy a baktériumfehérje szintézisét riboszómához
kötődve gátolja. Sztreptomicin jelenlétében megváltozik a riboszóma frakció hidrogén cserélődésí sebessége,
ami önmagában konformáció változásra utal. Egyidejűleg bizonyos konformációs változások bekövetkezését
viszont késlelteti a sztreptomicin. Megakadályozza például az alacsony Mg
++
koncentráció esetén bekövetező
disszociációt, inaktíválódást. Sőt megakadályozza az inaktíválódott riboszóma reaktíválását. Ez a regenerálódási
folyamat enyhe melegítés hatására megfelelő pH mellett streptomycin távollétében reprodukálhatóan
bekövetkezik.
A hatásmód vizsgálat egyik gyümölcsöző módja a vizsgálandó érzékeny törzsből antibiotikum
rezisztens variáns előállítása és a két eltérő biokémiai tulajdonsággal rendelkező törzs részletes összehasonlító
vizsgálata. A rezisztens mutáns előállítása közben érdekes megfigyelésre jutottak a mikrobiológusok. A
streptomycin érzékeny Escherichia coli törzsből nemcsak rezisztens variánst, hanem olyan stabil mutánst is
izoláltak, amelyik csak streptomycin jelenlétében képes szaporodni, streptomycin dependessé vált.
A modern biokémiai módszerek a hatásmód molekuláris szintű vizsgálatára is lehetőséget adnak.
Ezekhez a vizsgálatokhoz fel lehetett használni a dihidrostreptomycint, amelyik nem csak a tenyészetben
képződik meléktermékkként, de kémiai redukcióval is előállítató. A molekulában levő streptóz aldehid csoportját
triciummal redukálva jelzett dihidrostreptomycinhez jutottak, amely biológiai hatás tekintetében nem tért el a
streptomycintől. Ezt a jelzett vegyületet használva megállapítható volt, hogy az antibiotikum direkt
kölcsönhatásba lép a riboszómával, a riboszóma 30S alegységében az S-12 fehérjéhez kötődik. Az 50S alegység
nem köti, de a nemdisszociált 70S riboszóma megint erősen köti a sztreptomicint.
A sztreptomicin-rezisztens törzsből nyert riboszóma nem köti és érdekes módon a szterptomicin-
dependens törzsből izolált riboszóma is igen gyengén köti a streptomycint. Ez azt valószínűsíti, hogy a függőség
nem kapcsolható ribosuómán bekövetkező változáshoz. Tovább vizsgálva a rezisztencia kialakulását
elkülönítették a 30S riboszóma alegység sztreptomicint kötő fehérje frakcióját, amely a ribonukleinsav
frakcióval való újraegyesítés után változatlan aktivitással kötötte a jelzett dihidro-sztreptomicint. Ha ez a
fehérjefrakció rezisztens baktérium riboszómájából származott, akkor akár érzékeny akár rezisztens törzs
riboszómájából származó ribonukleinsav frakcióval egyesítették, sztreptomicin kötést nem lehetett észlelni. Az
érzékeny baktériumból származó fehérje frakció viszont érzékeny illetve rezisztens törzsből származó
ribonukleinsav frakcióval egyesítve kötőképességét változatlanul megtartotta. Ez a genetikailag meghatározott
eltérés a fehérje molekula kis részét érinti csak, mert a fehérjefrakció fizikai és kémiai tulajdonságában változás
nem észlelhető. A rezisztens törzs riboszóma frakciójának fehérjeszintézisben mért aktivitása az érzékeny
törzsből származó készítmény aktivitásával megegyezett.
A streptomycin kötődése a riboszómához a fehérjeszintézist több szinten (több fázisban) zavarja. Az
egyes fázisok gátlásához más-más streptomycin koncentráció szükséges, sőt az aktuális koncentráció az egyes
baktérium törzsek esetében is eltérhet.
Igen kis mennyiségű streptomycin hatására a fehérjeszintézis nem áll le, csak lassúl. Kodleolvasási
hibák jelentkeznek nem csak szintetikus mRNS, de természetes eredetű mRNS alkalmazása esetében is. A
leolvasási hibák anomális fehérjék képződését okozzák. Növelve az antibiotikum koncentrációt a 70S riboszóma
mennyiségének felszaporodása tapasztalható. Valójában az antibiotikum akadályozza a 70S riboszóma szétesését
alegységeire. Gátolja ugyanis a termináló kod által kiválasztott faktor (relais factor) riboszómára kötődését, azaz
megakadályozza a mRNS elválását a riboszómától. Tovább emelve a reakció elegyhez adott sztreptomicin
mennyiségét az iniciáció kifejezett gátlása tapasztalható.
A riboszómális fehérjeszintézist zavaró antibiotikumok hatásmódjának tárgyalásával kapcsolatban
célszerű röviden összefoglalni az eddig végzett kutató munka eredményeiből felépített elképzeléseket. Indokolja
ezt az is, hogy a fehérjeszintézist gátló antibiotikumok felfedezése és hartásmódjuk vizsgálata segítette a
ribosszómális fehérjeszintézis biokémiai mechanizmusának feltárását. Legtöbb ismeretanyag az Escherichia
coli-val végzett kiséleti munkákból származik, ezért célszerűen ezt a területet választjuk ismertetésünk
modeljeként.

96


A mRNS-ba átírt információ a riboszómán folyó mechanokémiai reakciók eredményeként jelenik meg
fehérje formájában. A 70S riboszóma egy nagyobb 50S (1,8x10
6
dalton tömegű, 5300 nm
3
kiterjedésű) és egy
kisebb 30S (1x10
6
dalton tömegű, 2600 nm
3
kiterjedésű) méretű alegységből tevődik össze. Az 50S alegység egy
nagyobb 1904 nukleotidot tartalmazó és egy kisebb 120 nukleotidot tartalmazó ribonukleinsav molekulából,
valamint 34 fehérje molekulából áll. A 30S alegység egy 1542 nuleotidból álló (16S rRNS) ribonukleinsavat és
21 fehérje molekulát tartalmaz. A két alegység (30S + 50S) érett mRNS jelenlétében csak a fehérje szintézis
idejére kapcsolódik funkcionális egységbe, az úgynevezett 70S riboszómát alkotva.
Az ép riboszóma kötő szakasszal rendelkező mRNS kapcsolódását a 30S alegységhez egy 20.000
móltömegű IF-3 (iniciációs faktor) fehérje segíti. Ezt követi a 8000 móltömegű IF-1 fehérje kapcsoódása és a
115000 móltömegű formil-metionil-tRNS-GTP-IF-2 komplex bekötődése a mRNS-en levő antikodon irányítása
szerint. Az így kialakuló komplex az 50S alegységhez közeledve alakítja ki a működőképes 70S riboszómát,
miközben az iniciációs faktorok szabaddá válva egy újabb iniciációs komplex kialakításában vehetnek részt. A
formilmetionil-tRNS ekkor a riboszóma úgynevezett ferhérje kötő helyén található. A streptomycin ennek az
aktív riboszóma komplexnek a képződését akadályozza.
A következő lépés az elongációs szakasz, a peptid lánc hosszabbítása. Elsőként a riboszóma aminosav
kötőhelyéhez kapcsolódik a mRNS következő antikodonja által igényelt aminosavval acilezett tRNS. A
kapcsolódáshoz szükséges energiát az elongációs faktornak nevezett EF-Tu-GTP fehérje komplex szolgáltatja.
Ezt a folyamatot a riboszómához kötődő tetraciklinek gátolják! A tRNS 3’ végén levő ribóz 3’-OH-hoz
észterkötésben levő aminosav aminocsopor6tja nukleofilen a peptid kötőhelyen levő aminosavészter karbonil
csoportját támadja. A visszamaradó, most már üres tRNS egyidejűleg elhagyja a peptidkötő helyet. A peptid
kötés kialakítását az 50S alegység egyik fehérjéje, a transzferáz végzi.
A kémiai reakciót egy mechanikus (mechanokémiai) lépés követi. A transzlokáz enzim a másik
elongációs faktor, az EF-G-GTP komplexben levő energia felhasználásával a peptid láncot a mRNS-val együtt
átemeli a riboszóma peptid kötő helyére. Ezzel lehetővé válik egy újabb, mRNS által kodolt aminoacil-tRNS
kapcsolódása.
A peptid lánc hosszabítását jelentő ciklusok program szerint ismétlődnek. Amikor a mRNS termináló
kodonja kerül a riboszóma aminosav kötő helyéhez, akkor a kodnak megfelelő valamelyik RF (release factor)
97
fehérje kapcsolódik a riboszómához. Az aminoglikozid antibiotikumok éppen ennek a faktornak a kapcsolódását
akadályozzák. Ha a reakcióelegy nem tartalmaz aminoglikozid antibiotikumot akkor az RF fehérje hatására a
peptidil transzferáz hidrolizálja az utolsó tRNS és a peptid lánc közötti észterkötést. Szabaddá válik az új fehérje,
ezzel egyidejűleg leválik az üres tRNS, majd szétesik a mRNS-ből, valamint a 30S és 50S riboszómából álló
komplex. Ezek az alkatrészek ezután egy újabb iniciációs komplex képzésében vehetnek részt.
Escherichia coli-ban egy 4-500 aminosavat tartalmazó peptidlánc 15-20 másodperc alatt készül el. Egy
mRNS egyidőben 4-5 riboszómához kapcsolódhat egymástól 97 nukleotídnyi távolságra. A mRNS életidejét
működésben létének köszönheti. Általában átlagban 50 ciklust ér meg, ha folyamatosan szolgálatban van, azaz
működő riboszómákkal van kapcsolatban. A riboszómához kapcsolt mRNS-t a ribonukleáz nem képes bontani.

A sztreptomicin inaktíválása

Az antibiotikum rezisztencia kialakulása, a streptomycin tűrés több biológiai okra vezethető vissza.
Streptomycin rezisztencia oka lehet riboszómális, például a streptomycint kötő fehérje szerkezetében
bekövetkező változás, a kémia szerkezet
kismértékű, de a kötődést akadályozó
módosulása. Akadályozhatja az
antibiotikum felvételét a sejthártya
áteresztőképességének módosulása. Az
aminoglikozid antibiotikumok esetében a
rezisztencia oka sok esetben az enzimes
inaktíválás. Ezek az antibiotikumok sok,
kémiailag, illetve biológiai reakcióval
könnyen támadható hidroxil illetve
amino csoportot tartalmaznak. Az enzim
katalizálta átalakítások a riboszómához
való kötődést akadályozva
végeredményben rezisztenciát okoznak.
Ezek az inaktíváló enzimek sok esetben
extrakromoszómális eredetűek,
plazmidhoz kötött formában könnyen
terjednek a mikrovilágban.

A sztreptomicin glükózamin alkotórészének C-3 hidroxil csoportját a sztreptomicin-adenil-transzferáz
ATP és Mg
++
jelenlétében adenilezi és ezzel inaktíválja az antibiotikumot. Ugyanezt a hidroxil csoportot a
sztreptomicin-foszfo-transzferáz képes foszforilezni. Az így képződött sztreptomicin-foszfát ugyancsak inaktív.

A Pseudomonas aeruginosa TI-13 jelű törzsének enzimrendszere a sztreptomicin-3’6-biszfoszfát
képződését segítve inaktiválja az antibiotikumot. Streptomyces griseus-ból izoláltak és tisztítottak egy enzimet,
amelyik a sztreptomicin-6-foszfát képződését katalizálva okoz rezisztenciát. A sztreptomicint termelő
mikroorganizmusban az antibiotikum foszforilezett, tehát biológiailag inaktív formában képződik és csak a
kiválasztás folyamata közben távolítja el az inaktíváló csoportot egy alkalikus foszfatáz.

Az antibiotikumnak a környezetbe történő kiválasztása segíti az antibiotikumot termelő mikroszervezet
túlélését, hiszen elvben saját magát is mérgezhetné a képződő antibiotikum. A törzsfejlődés buktatói között csak
az az egyed maradhat túlélő, amelyik az általa termelt anyag káros hatását ki tudja védeni, akár úgy, hogy a
sejtfalon való áthaladást csak egy irányban, a külvilág felé biztosítja, vagy a hatáshely módosítása jelent
rezisztenciát a termelő egyed számára. Az antibiotikum termelés fokozását célzó genetikai munkát végzők, már
kezdettől fogva elsőrendű feladatuknak tekintették a termelt anyagra rezisztens mutánsok izolálását. Nyivánvaló,
hogy a termelt metabolitra valő érzékenység az elérhető termelési szintet limitálja. Nem véletlen, hogy éppen
Streptomyces griseus törzs fejlesztésekor jobban termelő mutánsok nyerése céljából először a sztreptomicin
rezisztenciát igyekeztek fokozni.

Ezek az enzimek nemcsak a streptomycint, de keresztrezisztenciát okozva minden streptobiózamint
tartalmazó antibiotikumot képesek inaktíválni. Az enzimek működését a glükózamin alkotórészen történő
szubsztitúció akadályozhatja. A mannozido-sztreptomicin pédául nem inaktiválható a 3‖-hidroxil csoportot
támadó reakcióval, mert a 4‖-helyhez kötődő mannóz térbelileg elnyomja a 3‖-hidroxil csoport
reakcióképességét.


98
NEOMYCIN
A széles spektrumú neomycint ugyancsak a Waksmann által vezetett kutatócsoport izolálta 1949-ben
Streptomyces fradiae tenyészlevéből Azóta különböző törzsek tenyészlevében is megtalálták ezt az anyagot.
A Streptomyces fradiae fermentlevéből valójában az
úgynevezett neomicin komplex, a neamin, a neomycin-B
és a neomycin-C vegyületek keveréke nyerhető jó
hozammal. Abszolut konfiguráció szempontjából is
megbízható szerkezeti képletét Hickens és Rinehart
közölte 1963-ban.
A D-ribóz 1-es szénatomjához kapcsolódik a C-
neózamint és 2-dezoxi-sztreptamint tartalmazó neamin. A
3-as szénatomhoz egy másik C-neózamin kapcsolódik. Az
antibiotikum ribózból és C-neózaminból felépülő részét
neobiózamin-C néven ismeri az irodalom. A neomycin
metanolízissel könnyen bontható neaminná és
neobiózaminná.
A neomycin-B antibiotikumban a D-ribóz 3-as
szénatomjához kapcsolódó cukor komponens 2,6-diamino-
2,6-didezoxi-idóz (neózamin-B), amelyben a 6-amino-metil csoport orientációja a D-glükózhoz viszonyítva
ellentétes szerkezetre utal.
A törzsfejlesztéssel foglalkozó mikrobiológusoknak fáradságos munkával sikerült olyan mutánst
előállítani és kiválasztani amelyik az értékesebb neomycin-C-t termeli főtermékként. Az allergiás tüneteket nem
okozó neomycin-C széles spektrumú aminoglikozid antibiotikum gyakorlatilag nem szívódik fel. A bélflóra
tartalmát fertőtlenítő tabletták formájában alkalmazva idegkárosító toxikus tünetek nem jelentkeznek. Kémiailag
stabil, autoklávban aktivitás veszteség nélkül sterilezhető
A termelési szint ma 15-20 mg bázis ml
-1
. Gyógyszerként a fermentlé szűrletéből ioncserélő oszlopon
végzett tisztítással könnyen előállítható C komponens szulfát sóját hozzák forgalomba. Felfedezése óta a
gyomor-bél traktus fertőzéseinek leküzdésére használják. Kiváló eredménnyel alkalmazzák akut hashártya
gyulladás esetében és műtétek előtt a bél baktériumflórájának csökkentésére. Ugyancsak elterjedt külsőleges
alkalmazása szemcseppben, kenőcsben, hintőporban, szaruhártya és bőrfertőzések leküzdésében.
A főleg plazmid hordozta inaktíváló enzimek
számára a neomycin kiváló terepet szolgáltat,
sok megtámadható hidroxil és amino csoportja
van. Így a 2-dezoxi-streptamin 3-as amino-
csoportjának acetilezése, vagy a neózamin C-6’
helyzetű amino-csoportjának acetilezése, vagy a
C-3’ helyzetű hidroxil foszforilezése inaktíválja
a molekulát. Ismeretes egy adenilező enzim,
amelyik a 4’-hidroxil csoport átalakításával
inaktíválja a molekulát. De inaktíválja a
molekulát a ribóz 5’-hidroxiljának
foszforilezése vagy a neózamin 2’-aminocsoport
acetilezése.


A neomycin hatását ugyancsak a 30S riboszóma alegységen fejti ki, de a kötődés helye különbözik a
sztreptomicinétől. Amig a sztreptomicinből riboszómánként specifikusan csak egy molekula kötődik, addig
neomycinből több molekula is kötődhet. A két antibiotikum egymás kötődését nem befolyásolja. Amig a
sztreptomicin az iniciáció gátlásával a riboszóma komplex kialakulását akadályozza, addig a neomycin csoportba
tartozó aminoglikozidok poliszóma felszaporodását eredményezik. Megjegyzendő, hogy a termináló hatású RF
fehérjék kötődését akadályozó neomycin jelenlétében, a 70S riboszóma szétesése nem következik be.



99
KANAMYCIN
A pszeudo-oligoszacharid aminoglikozid antibiotikumok első tagját a kanamycint Umezawa kutató csoportja
izolálta 1957-ben egy Streptomyces kanamyceticus tenyészlevéből. Az antibiotikum két szénhidrátmolekulát
tartalmaz a központi dezoxi-streptaminhoz kötve (ezért pszeudooligoszacha-rid). A fermentlében több
biológiailag aktív oligoszacharid képződik. Különbséget a
streptamin C-4 atomjához glikozidos kötéssel kapcsolódó
hexóz szerkezetében mutatkozik. Tadsuoka 1964-ben.
Gyógyszerként a legkevésbé toxikusa 6-amino-6-dezoxi-D-
glükózt tartalmazó Kanamycin A került forgalomba.
Umezawa az N-metánszulfonát sóját javasolja
gyógyszerként, amely kevésbé toxikus mint a szulfát sója.
Nem csak az emésztőcsatorna fertőtlenítésére használják,
de injekciós formában szisztémás fertőzések leküzdésére is
alkalmazzák.
Toxicitása miatt napi 1 g-os adagja nem léphető
túl. Izomba injektálás után egy órával 28 mg/ml szérum
szint mérhető, ugyanekkor a tüdőszövetben 7 mg/g
antibiotikum szint alakul ki. Streptomycinnel keresztrezisztenciát ad. A TBC kórokozói hamarabb rezisztenssé
válnak mint azt streptomycin kezelés esetében tapasztalták.
Az aminoglikozid antibiotikumok inaktíválódását
okozó enzimek a kanamycin inaktíválására is alkalmasak.
Hat enzim által támadható ponton eddig 7 enzim hatását
igazolták. A 2-dezoxi-sztreptamin C
3
aminocsoportját két
különböző aciláz támadhatja. A kanózamin C
2‖
hidroxilját
egy nukleotidil transzferáz adenilezi. A 6'-amino-6'-dezoxi-
D-glükóz részén pedig az amino csoport acilezését végzi
egy-egy acetil-transzferáz, mig a C
3’
-hidroxilt két
különböző foszfor-transzferáz képes foszforilezni.
Ismeretes egy nukleotidil transzferáz, amelyik a 4’-adenil
származékot állítja elő.
A tenyészlé kanamycin-B komponense amely
2',6'-diamino-2',6'-didezoxi-D-glükózt tartalmaz kémiai
eljárással alakítható tobramicinné, amely az eddig ismert aminoglikozid antibiotikumok egyik leghatásosabb
képviselője.
Ezt az antibiotikumot csak azután találták meg a Streptomyces tenebrarius fermentlevében a
nebramycin komplex tagjaként, miután kémiai módszerekkel már előállították a kanamycin-B 3’-dezoxi
származékaként. A gyógyászatban 1976 óta használják sok esetben életmentő antibiotikumként. Az eredeti
nebramycin komplexet termelő törzsből fáradságos genetikai munkával olyan mutánst sikerült izolálni, amelyik
főtermékként termeli a tobramycint illetve a karbamoilezett származékát. Terápiai értékét fokozza az, hogy a 2-
dezoxi-streptamin C
4
hidroxiljához kötődő nebrózamin nem tartalmazza a könnyen foszforilezhető a C
3’
-
hidroxil csoportot. Az amino csoport acilezésével, illetve a C
4’
-hidroxil csoport adenilezésével természetesen ez
az antibiotikum is inaktíválható. Ezek az enzimek azonban ritkábban fordulnak elő a patogén
mikroorganizmusokban

GENTAMICIN

Weinstein 1958-ban izolálta először egy Micromonospora purpurea törzs tenyészlevéből, de csak 1963-ban
ismertette eredményeit. Azóta más törzsek szekunder metabolitjaként is megtalálták ezt a széles spektrumú igen
hatásos antibiotikum keveréket. Kémiai szerkezetét Cooper 1969-ben, illetve 1971-ben ismertette végleges
formában. Az antibiotikum nevét a nemzetközi szakirodalom i-vel írja érzékeltetni akarva, hogy a termelő
mikroszervezet nem Streptomyces törzs. A gentamicint termelő törzsek tenyészlevében a főterméknek tekintett
2-3 közelrokon szerkezetű antibiotikum mellett úgynevezett minor komponensként nagyszámú, 15-20, vagy
ennél is több biológiai hatásában is különböző aminoglikozid antibiotikum képződik. Számuk az analitikai
módszerek felbontóképességének fejlődésével és az egyre tökéletesedő preparatív munka eredményeként még
tovább növekedhet.
A főterméknek tekintett és terápiás használatra került gentamicin komplex három rokon vegyület a
gentamicin-C
1
, -C
1a
, -C
2
meghatározott arányú keveréke, amelyek a purpurózamin C-6 szubsztituáltságában,
azaz metilezettségükben és ezzel összefüggésben toxicitási adataikban különböznek. A metioninból származó
metil-csoport beépüléséhez szűkséges cobal-amin (B
12
vitamin) koncentráció, a tápközegbe juttatott kobalt ion


100
mennyisége kedvezően befolyásolja. A 2-dezoxi-sztreptamin C
4
hidroxiljához kapcsolódik glikozid kötéssel a
pupurózamin (2',6'-diamino-2',3',4',6'-tetradez-oxi-hexóz), a C
6
hidroxilhoz pedig a garózamin.


A gemtamicin komplex különleges jelentőséget
nyert a Pseudomonas fajok okozta másodlagos fertőzések
leküzdésében. Injekciós formában a gentamicin szulfátot
életmentő antibiotikumként alkalmazzák különböző
szisztémás megbetegedések leküzdésére. Különösen
hatásos az urogenitális rendszer fertőzési gócainak
felszámolására. Sikerrel használják a makacs légúti
fertőzések leküzdésére, mert a tüdő szövetből igen lassan
ürül. Szokásos adagja 3mg/kg naponta izomba adva.
Különböző kórházi, úgynevezett jatrogén fertőzések elleni
küzdelemben is sikerrel alkalmazható, mivel a legtöbb
rezisztens kórokozó ellen hatásos vegyület. Szerkezeti
képlete mutatja, hogy nincs olyan szubsztituense, amelyet
a mikroorganizmusokban leginkább előforduló nagy
aktivitású foszfotranszferáz képes lenne megtámadni.
Gentamicinre rezisztens baktériumokban természetesen
sikerült plazmidhoz kötött inaktíváló enzimeket kimutatni, mert az élő világban semmi sem lehetetlen (Nil
mortalibus ardui est). A dezoxi streptamin C
3
aminocsoportja acetilezhető, a purpurózamin C
2’
-amino éa a C
6’

amino csoport acetilezése ugyancsak inaktíválja a molekulát. A garózamin C
2‖
hidroxilját pedig az adenil
transzferáz adenilezi. Ezek a ritkábban előfordul enzimek csekélyebb aktivitásuk miatt késve tudják inaktíválni a
terápiás célból adott hatóanyagot.
Részletesen vizsgálták az antibiotikum komplex képződéséért felelős aminociklitol minőségének a
hatását a képződött antibiotikumra. Rosi és munkatársai gentamicint termelő törzsből a nagy elődök
gondolatmenetét követve ugynevezett idiotróf mutánsokat állítottak elő. Ezek a mutánsok csak kívülről adagolt
2-dezoxi-streptamin jelenlétében termeltek gentamicint. A mutáns mikroszervezet tenyészetéhez adott különféle
szerkezetű ciklitolok beépültek. Ez azt jelenti, hogy a Micromonospora bioszintetizáló rendszere nem annyira
specifikus mint azt a streptomycint termelő Streptomyces griseus esetében tapasztalták. Sztreptamin adagolására
pédául új hatásos antibiotikumként 2-hidroxi-gentamicin-C
1
antibiotikum képződött.

SISOMICIN
Ugyancsak Micromonospora fajok termelik az 1964-
ben japán szerzők által leírt antibiotikumot. Szerkezete,
kémiai és biológiai tulajdonságai a gentamicin-C-hez
hasonló. Eltérés csak annyi, hogy a purpurózamin
csoport helyett egy 2,6-diamino-2,3,4,5-tetradezoxi-D-
glicero-4-hexenóz, a dehidropur-purózamin
kapcsolódik glikozidos kötéssel a 2-dezoxi-streptamin
C
4
hidroxil csoportjához. A vizsgálatok szerint a
sisomicin a gentamicin bioszintézis egyik köztes
anyaga. A gentamicint termelő törzs a tenyészethez
adott sisomicint gentamicinné telíti. Ezt igazolja az,
hogy a gentamicin termelő törzs tenyészlevében a
minor komponensek között a sisomicin mindíg
fellehető. Az enzimes inaktíválhatósága a gentamicin-
C
1a
-hoz hasonló. A telítetlenség alig befolyásolja az N-
acetilezést.

Aminoglikozid antibiotikumok inaktíválása és az inaktíválhatóság akadályozása
Az inaktíválásért felelős általában plazmid hordozta enzimek eredeti funkcióit nem ismerjük. A patogén
mikroorganizmusok anyagcsere rendszerében valamilyen eddig ismeretelen biokémiai feladatot látnak el, és
szubsztrátspecifitásuk teszi lehetővé a gyógyászati céllal adott antibiotikumok hatástalanítását.
Nem meglepő, hogy az ilyen aktivitást hordozó baktérium törzsek feldúsulnak a tenyészetben az
inaktíválható antibiotikum jelenlétében. Davis feltételezése szerint ezek az enzimek Streptomyces törzsekből
származnak és plazmidként kerültek mai gazdaszervezeteikbe. A plazmid hordozta rezisztencia faktor
végeredményben plazmid átvitellel az antibiotikum távollétében is lehetővé teszi újabb rezisztens törzsek
megjelenését, sőt ez az információ könnyen integrálódhat a baktérium kromoszóma-állományába.


101
Az eddig ismert különböző mikroorganizmusokban (Pseudomonas, Escherichia, Staphylococcus,
Streptomyces, Micromonospora) előforduló sok esetben izomer formában izolálható enzimek különböző
specifikus aktivitással támadnak az antibiotikum megtámadható csoportjaira.
A sztreptomicin N-acetil-glükózamin részének C
3
helyzetű ekvatoriális hidroxil csoportjával két enzim
képes reagálni. az adenil transzferáz adenilezi, a foszfor-transzferáz foszforsavval észterezi ezt a csoportot és
ezzel az antibiotikum riboszómához kötődését lehetetlenné teszi.
A neomycin tíz olyan funkciós csoportot tartalmaz, amelyek az eddig ismert inaktíváló enzimekkel
acilezhető. Az enzimek specifitására mutat, hogy általában a funkciós csoportokat más-más enzim acilezi. Sok
esetben viszont egy-egy funkciós csoportot több enzim (esetleg izoenzim) képes acilezni. A 4,6-O-
biszglikozidok enzimes inaktíválásával kapcsolatban eddig nyolc enzim működését vizsgálták részletesen.
A táblázat a leggyakrabban előforduló amino csoportot acilező, hidroxil csoportot foszforilező illetve
adenilező enzimek legismertebbjeit foglalja össze, megjelölve néhány gyógyászatban alkalmazott aminoglikozid
antibiotikumon kimutatott hatáshelyeket.

(A Pseudomonas, Staphylococcus, Escherichia, Streptomyces, Micromonospora nemzetség
törzseiből izolált aminoglikozid antibiotikumokat inaktíváló enzimek speciftása)
A táblázat a funkciós csoport helyzetét mutatja az egyes antibiotikumokban
Izoenzimek Streptomycin Neomycin Kanamycin Tobramycin Gentamicin Sisomicin
Amino-acetil-transzferáz (I)
Amino-acetil-transzfer (II)
Amino-acetil-transzferáz (III)
Amino-acetil-transzferáz (I)
Amino-acetil-transzferáz (II)
Amino-acetil-transzferáz (I)
Amino-acetil-transzferáz (II)
Hidroxifoszfor-transzferáz.....
Hidroxifoszfor-transzferáz
Foszfor-transzferáz
Hidroxifoszfor-transzferáz(I).
Hidroxifoszfor-transzferáz(II)
Hidroxifoszfor-transzferáz(III)
Nukleotidil-transzferáz
Nukleotidil-transzferáz
Nukleotidil-transzferáz
Nukleotidil-transzferáz









3’’



6


3’’

3

2’

6’
6’



3’5’’
3’
3’

4’

3
3

2’
6’
6’



3’
3’
3’

4’
2’’


3
2’

6’
6’







4’
2’’
3
3
3
2’

6’
6’
2’’







2’’
3
3


2’
6
6’
2’’







2’’
A mikroszervezetekben mérhető enzim szintek jelentős eltérést mutatnak, de az egyes antibiotikumon
mérhető aktivtásuk is különbözhet a kémiai szekezetből adódó hatások miatt.
Nem meglepő az eredmény, hogy közülük öt enzim azonosan viselkedik a különböző antibiotikumok
esetében, mert a dezoxi-sztereptaminhoz kapcsolódó cukor komponens szerkezete azonos. Az a tény, hogy
egyetlen enzim többféle aminoglikozid antibiotikum inaktíválására képes, azzal jár, hogy az egyik
antibiotikummal szemben kialakuló rezisztencia (keresztrezisztenciát okozva) más a táblázatban fel nem sorolt
rokon antibiotikumokkal szemben is védelmet biztosít. A 2-dezoxi-streptamin C
3
aminocsoportjának acilezésére
több enzim alkalmas. Ezeknek a működését a funkciós csoporttól távolabb levő molekularészek is
befolyásolhatják. A 2-dezoxi streptamin C
6
hidroxiljához kapcsolódó aminocukor C
2
ekvatoriális helyzetű
hidroxilját egy nukleotidil transzferáz adenilezi.
A Staphylococcus aureus-ban olyan foszfor transzferáz található, amelyik primer aminok és szekunder
hidroxilok acilezésére is képes, attól függően,hogy kofaktorként ATP vagy pedig acetil-S-CoA helyezkedik el
az enzim aktív központjában.

A bemutatott aminoglikozid-antibiotikumok szerkezetét figyelmesen tanulmányozva megállapítható,
hogy bizonyos funkciós csoportok eliminálásával, vagy kémiai védelmével megakadályozható az
inaktíválódásuk. Ezt a lehetőséget a természet változatossága és az antibiotikumok kémiai módosításával
foglalkozó kutatócsoportok tevékenysége hasznosítja.


102
AMINOGLIKOZID ANTIBIOTIKUMOK KÉMIAI MÓDOSÍTÁSA

Az antibiotikumok kémiai átalakításakor nem csak az inaktíválódás megakadályozása, hanem a
toxicitás csökkentése, esetleg a baktérium spektrum szélesítése is célként tűzhető. Ezek a feladatok, sokáig
megoldhatatlannak tüntek. Nem rendelkeztek a gazdaságosság elvét is kielégítő specifikus reakciók elvégzésére
aalkalmas szelektív kémiai módszerekkel. Sok esetben a kezdetben csak elméleti jelentőségű eredmények a
gazdaságosság követelményeit is kielégítve végül gyakorlati hasznot hoztak.

Ilyen eredmény volt a 3’,4’-didezoxi-kanamycin-B (dibekacin) előállítása. Első lépés az
aminocsoportok védelme etoxi-karbonil-kloriddal vizes acetonban. A második feladat a 3’- és 4’- hidroxil
csoportokból, valamint a 4‖- és 6‖ hidroxil csoportokból acetonid képzés dimetil-formamidban p-toluol-
szulfonsav jelenlétében. Ezt követi a 2‖ hidroxil csoport karbobenzoxilezése karbobenzil-oxi-kloriddal, majd a
vicinális 3’,4’ hidroxilok mezilezése pyridinben az acetonid bontása közben. A 3’4’-hidroxilok eltávolítására a
Tipson-Cohen módszer jól használható, amikor is a dimezilátot nátrium-jodiddal Zn jelenlétében raegáltatják
N,N-dimetilformamidban. A telítés után a védőcsoportok reduktív eltávolítása következik. Az ábrán jól látható,
hogy a C
5
-hidroxil térszerkezeti gátoltsága miatt nem vehet részt a reakcióban.


Japán szerzők,- Okutami
és munkatársai - különböző
aminoglikozid antibiotikumok
könnyen foszforilezhető 3’-
hidroxilcsoportjának racionális
eltávolítását oldották meg.
Szellemesen felhasználták a
mikrobiológiai inaktí-válás
specifikusságát. A kanamycin-B
3’-hidroxil csoportját egy
Pseudo-monas törzsben
előforduló transz-foszforiláz
segítségével foszforilez-ték, majd
ezt a foszforsavésztert
trimetilszililklorid-dal halogénre
cserélték, a halogént pedig
hidrogénezéssel távolították el. Ez a kombinált módszer jó kihozatallal ipari méretben az egyik leghatásosabb
aminoglikozid antibiotikum előállítására ad lehetőséget. Ez az eljárás más antibiotikumok esetében is sikerrel
alkalmazható. Igy előállították többek között a 3’-dezoxi neomicin-B származékot is.


103
A másik elgondolás a guanidino csoport védelmére a természettől ellesett ötlet alapján ugyancsak japán
szerzőktől származik. A dezoxi-streptamin csoport C-1 aminocsoportjának acilezése megakadályozza az
inaktíváló enzimek működését. Acilező ágensként a butirozin antibiotikumban előforduló L-(÷)-4-amino-2-
hidroxi-vajsavat használták. Ezzel a savval való acilezés ugyanis nem változtat lényegesen a hatás
szempontjából alapvető jelentőségű vízoldhatóságon, a molekula bázikus voltán. Ugyanakkor az acilezett termék
toxicitása lényegesen csökkent.


Kavaguchi és munkatársai gazdaságos eljárást kidolgozva a kanamycin-A acilezésével egy szélesebb spektrumú,
rezisztens törzsekre is ható, kevésbé toxikus antibiotikumhoz az amicamycinhez jutottak. Mivel a kanamycin A
négy aminocsoportjának reakcióképessége különböző (C
6
>C
1
>C
3
>C
3‖
) A C
6
atomhoz kapcsolódó
legreakcióképesebb aminocsoportot védeni kellett karboxibenzoxilezéssel. Az így előállított 6’N-benziloxi-
karbonil-kanamycin-A-t acilezték a karbobenziloxi-L-(÷)-hidroxi-4-amino vajsav szukcinil 2-iminészterével. A
védőcsoportok eltávolítása után egy új fészintetikus antibiotikumhoz, az 1-N-(S)-4-amino-2-hidroxi-butiril-
kanamycin-A-hoz, az amikamycinhez jutottak. Ezt az antibiotikumot már csak egyetlen enzim, a viszonylag
ritkábban előforduló 6’-acetil-transzferáz képes inaktíválni. Az l-N-szubsztituens jelenléte nem csak a dezoxi
streptamin C
3
aminocsoportjának az acilezését akadályozza, de a C
3’
hidroxil csoport foszforilezését és a C
2‖

hidroxil adenilezését is zavarja. később az acilcsoport útólag végzett redukciójával előállították az alkil analógot,
az L-N-(S)-4-amino-2-hidroxibutil-kanamycin-A-t is, amelynek biológiai hatása megegyezett az
amikamycinével.

A streptamin C
1
aminocsoportjának szelektív acilezésével, majd az acil csoport redukciójával több
antibiotikum N-alkil analógját is elkészítették. Igy a gentamycin és a sisomycin toxicitását csökkenteni lehetett,
miközben a rezisztens baktériumokra való hatását a dezoxi-streptamin C
1
csoportjának acilezésével növelték.



Előállítása egyszerűen,gazdaságosan megoldható, mivel nátrium-cián-bórhidrid és feleslegben adott acetaldehid
jelenlétében pH 5-nél a sisomycin szulfátból C
1
-N-etil-sisomicin állítható elő. A pH változtatásával más
aminocsoport alkileződik.


104
Aminoglikozid vérszint mérése immunológiai módszerrel

Az aminoglikozid antibiotikumot erős halláskárosító és vese károsító hatása miatt csak súlyosabb fertőzések
leküzdése céljából alkalmazzák, amikor már más, kevésbé toxikus antibiotikum hatástalannak bizonyult

Megjegyzendő, hogy az emberi szervezetnek a szakirodalomból ismert szűk aminoglikozid tűréshatára
ép, egészséges szervezeten kimért adatokra vonatkozik. Leromlott állapotban, szepszisben, sokkos állapotban,
vizelethajtók egyidejű adagolása mellett könnyen bekövetkezhet a túladagolás, amely veszélyes károsodást
okozhat. Ez indokolja kezelés közben a szérumban az antibiotikumszint állandó ellenőrzését. Ez a mérés a
szérum viszonylag alacsony antibiotikum szintje, valamint a biológiai mérés időigénye miatt agardiffúziós
módszerrel nem végezhető el. Erre a célra gyors, nagy pontosságú, specifikus immunológiai mérőmódszereket
dolgoztak ki.

Az aminoglikozid antibiotikumok jól kötődnek a szérum fehérjékhez. Így hapténként szerepelve a saját
fehérjét az immúnrendszer idegen testnek érzékeli. E tény hasznosítása céljából a mérendő antibiotikumot
valamilyen homogén, ismert fehérje frakcióhoz (például szérumglobulin) rögzítik kémiailag. Optimális
mennyiségnek tekinthető 50 antibiotikum molekula egy-egy fehérje molekulán. Ezt adagolják az antiszérum
termelésre kiválasztott állatba. Az ellenanyag kifejlődése után a szérumot elkülönítik a vértestektől és ezt
használják mérőoldatként. Az antitest ugyanis a reakcióelegyben levő mérő fehérjéhez csak az esetben
kapcsolódik, ha időlegesen kellő számú haptén molekula (antibiotikum) kötődött a mérő fehérjéhez, esetünkben
a szérum globulinhoz.

A szerológiai módszer gyorsan és nagy pontossággal adja meg a szérum antibiotikum tartalmát. A
módszer specifikus volta miatt minden antibiotikumra külön-külön kell előállítani az arra specifikus antitestet.

105
MAKROLID ANTIBIOTIKUMOK

A makrolid tipusú antibiotikumok első képviselőjét, a pikromycint 1950-ben izolálták. Azóta a csoportnak több
mint 40 képviselőjét írták le. Gyógyszerként azonban csak két rokon vegyületet, az eritromycint és az
oleandomycint, az állathízlalásban pedig a tylozint használják.
A makrolid antibiotikumokra jellemző a nagy lakton gyűrű (12, 14, 16, 18 atom alkothatja), amely lehet
részben telítetlen is egy-egy csoportra jellemző szubsztituenssel, az oxo csoporttal konjugálva. Minden makrolid
antibiotikum tartalmaz egy aminocukrot is, amely glikozidos kötéssel kötődik a laktongyűrűhöz. Sok esetben egy
semleges karakterű cukorkomponens is kapcsolódik glikozidos kötéssel a laktongyűrűhöz. Az antibiotikum erős
bázikus tulajdonságát az aminocukor sóképzésre lehetőséget adó dimetilamino csoportja okozza. A szabad bázis
vízben kevéssé oldódik, jól oldódik viszont poláros szerves oldószerekben, alkoholban. Közel semleges vízes
oldata hűtve stabil, savanyítva, lugosítva, vagy melegítve könnyen inaktíválódik. A makrolidok főleg Gram-
pozitív mikroorganizmusok okozta fertőzések leküzdésére használhatók. Többször alkalmazzák más
antibiotikumokkal, kombinálva.

ERITROMYCIN

McGuire és munkatársai 1952-ben közölték a Streptomyces erythreus fermentlevéből izolált Streptococcus,
Staphylococcus és Pneumococcus fertőzések ellen hatásos új antibiotikum tulajdonságait. Jól használható
amöbiázis kezelésére és hatásos számos penicillin, streptomycin és tetraciklin rezisztens baktérium ellen. Kémiai
szerkezetét Wiley 1957-ben közölt munkáiból ismerjük ugyan, pontos sztereokémiailag helyes szerkezetének
felderítése azonban Celmer érdeme, aki 1965-ben közölte munkájának eredményeit.
A lakton gyűrű bioszintézise a zsísavszinté-zishez
hasonló módon egy savhordozó fehérje komplex
felületén folyik. Első megközelítésben enzimhiányos,
enzimhibás zsírsavszintetizáló komplexnek tűnik.
Cerulamin a zsírsavszintézis ismert gátlószere gátolja
a makrolid képződést. Az indítás propionil-CoA-val,
a lánc hosszabbítás metilmalonil-CoA egységekkel
történik. A hordozó fehérje komplexhez átmenetileg
tioészterként rögzített ketozsírsavlánc kapcsolódik,
amely a lánchosszabításban következő és
dekarboxileződő matilmalonil fragmentum o-
szénatomját acilezi.. A tápközeghez adott jelzett
propionsav jó hatásfokkal jelenik meg az eritrolid
gyűrűben.
A makrolidszintézis szempontjából esszenciális metilmalonil-CoA szint a propionsav karboxilezésével is
feltölthető, a mikrobiális-élettani
vizsgálatok szerint azonban a
metilmalonil-CoA elsősorban
szukcinil-CoA epimerizációjával
képződik, amely átrendezési folyamat
cobalamin (B
12
) igényes. A
táptalajhoz adott propanol ez utóbbi
folyamatot elősegítve jelentősen
serkenti az eritromycin képződést A
hetedik propionil egység beépülését követi a gyűrűzárás a proeritrolid gyűrű kialakulása. A bioszintézis során a
zsírsav szintézisben szerepet játszó NADPH-függő dehidrogenáz működését ez esetben nem követi minden
esetben a dehidratálási és telítési reakció, bár lehetséges, hogy az oxigén funkció vándorlása C-7-ről C-6-ra egy
dehidratált átmeneti termék képződésén keresztül történik.



106
Az eritrolidnek nevezett 14 tagú laktongyűrű 5-ös szénatomjához kapcsolódik a makrolidokra jellemző
aminocukor, a 3,4,6-tridezoxi-3-dimetil-amino-D-xilohexóz. A dezózamin tercier aminocsoportja adja az
eritromycin erős bázikus tulajdonságát, amely lehetőséget ad a gyógyszerként forgalmazott sztearát, laktobionát,
stb sóinak képzésére.
A másik cukorkomponens, az L-cladinóz, a 2,3,6-tridezoxi-3-metoxi-3-metil-L-ribohexóz ugyancsak
glikozidos kötéssel kapcsolódik a lakton gyűrűhöz, annak 3-as szénatomjához.
A szénhidrátkomponensek bioszintézise glükóz-6-foszfátból indul. A dehidratálást követő izomerizáció
termékeként kapott D-6-dezoxi-hexóz valójában két különböző 4-oxo-6-dezoxi-hexóz enol formája. Azt a
köztes terméket, amelyikben a 6-metil csoport megtartotta eredeti sztereokémiai helyzetét, egy NAD-függő
dehidrogenáz sztereospecifikusan redukálja. A redukált termék dehidratálás után egy átmeneti enolizációval 3-
oxo-4,6-dezoxi glükózzá alakul. A ketocsoport glutamin segítségével történő iminálásával, majd ismételt
metilezésével eljutnk az eritromycin egyik cukorkomponenséhez a dezózaminhoz, amelynek foszfát észtere
alkalmas köztes termék az eritrolid gyűrű C-5 helyzetben történő glikozilezésére.
A szénhidrát alkotórész képződésének elágazásánál a másik cukorkomponensben a 6-metil csoport
sztereokémiai helyzete az eredeti konfigurációval ellentétes. Az előző reakciósorban szereplő dehidrogenáz
számára alkalmatlan szubsztrátum, viszont fölöttébb alkalmas a dehidratáz számára. A telítetlen cukor kémiai
stabilitását a ketonnal való konjugáció fokozza. A C-3 metilezését és a kettős kötés telítését követi az oxo
csoport redukciója,mivel ez már alkalmas szubsztrátum a dehidrogenáz számára. Ezzel a reakcióval eljutottunk
az eritromycin-C semleges szénhidrát komponenséhez a mikarózhoz. A C-3 hidroxilcsoport metilezésével készül
az eritromycin-A és az eritromycin-B szénhidrát alkotórésze az L-kladinóz.
Amint látható az enol-keto tautomeria a kétféle oxo származék képződését közel azonos mértékben
teszi lehetővé. Nem meglepő tehát, hogy az eritrolid gyűrűn mindíg ezt a két cukorkomponenst találjuk. A
fermentációhoz adott más cukrok adagolásával nem lehet befolyásolni a képződő antibiotikum szerkezetét.
A S. erythreus fermentlevében az alapmolekula több változata található. Az A komponens a 12-es
szénatomon o-helyzetű hidroxil csoportot tartalmaz, a B komponens ugyanitt csak hidrogént. A B-komponens
savstabilitása nagyobb, biológiai aktivitása azonban 20%-kal kisebb. A C komponens a cukorkomponens
szerkezetében különbözik a másik két variánstól, mert a mikarózban a kladinóz molekula metoxicsoportja
helyett hidroxilt találunk. Ez a kis kémiai különbség a biológiai aktivitásban nem okoz eltérést.
A mikrobiális genetikai technológia (géntechnológia) fejlődése az antibiotikum kutatásban is éreztette
hatását. Ilyen jellegű kutatásra különösen előnyös terület a makrolid antibiotikumok bioszintézise, mivel
egyrészt sok olyan elemet tartalmaz amelyen módosításokat lehet végrehajtani, másrészt az antibiotikum csoport
termelésére alkalmas törzsek enzimrendszerei általában működőképesek maradnak a rokon törzsekbe jutatva. A
megfelelően megválasztott partnerek protoplasztfúziójával létrehozott hibrid által termelt antibiotikum
szerkezete sok estben többé-kevésbbé előre sejthető.
Az eritromcin bioszintézisében résztvevő 27 enzim génjét a Genentech és az Eli Lilly géntechnológusai
sikerrel klónozták. A 35 kilobázis méretű DNS darabot pKC462 vektorba építve először Streptomyces lividans-
ba juttatták. Ez a sugárgomba nyomokban sem termel makrolid típusú antibiotikumot. A plazmid felvétele után
viszont mérhető mennyiségű eritromycin képződött. Ugyanezt a plazmidot ezután tylozint termelő Streptomyces
fradiae-ba vitték. Ez esetben ugyan eritromycin nem képződött, viszont megjelent egy eddig ismeretlen új
makrolid antibiotikum.
Hatásmechnizmusuk kevéssé tisztázódott. A de novo fehérjeszintézist gátolják. Az eritromycin az 50S
riboszómához, valószinüleg a 8-P fehérjéhez kötődve gátolja a fehérje szintézist. Elsősorban a transzlokációt
gátolja, annak is az utolsó fázisát. A peptidil-tRNS elhelyezkedését akadályozza a peptidkötő helyen. Kisebb
mértékben zavarja a transzferáz reakciót is. Eritromycin rezisztens törzsben ez a 8-P fehérje megváltozott
formában fordul elő. Az eritromycin viszonylag kevéssé toxikus, mert az eukarióta sejtek citoszolban folyó
fehérjeszintézisét nem zavarja, de gátolja a mitokondriumokban folyó riboszómális peptidszintézist. Érdekes
módon a tetraciklin típusú antibiotikumok megakadályozzák az eritromycin kötődését a riboszómához, az
eritromycin kötődése viszont gátolja a klóramfenikol (klorocid) kapcsolódását.
Az eritromycin nem tekinthető széles spektrumú antibiotikumnak. Eőszeretettel használják Gram-
pozitív penicillin rezisztens kórokozók ellen, illetve penicillin allergia kifejlődésekor. Vízben rosszul oldódik, a
bélből könnyen felszívódik. Mivel a gyomorsav elbontja enteroszolvens tablettában forgalmazzák, vagy saválló
származékát javallják szirup formában szájon át. Kiürülése nem túl gyors. Hatóránként adagolva a megfelelő
vérszint könnyen biztosítható.

107
OLEANDOMYCIN
A másik világszerte használt makrolid típusú antibiotikumot 1955-ben izolálta Sabin a Streptomyces antibioticus
fermentlevéből. Szerkezetét 1960-ban Hochstein
ismertette. Sztereokémiáját pedig 1965-ben az
eritromycinével együtt ismertette Celmer. Később egy
Streptomyces ambofaciens törzs tenyészlevében is
megtalálták.
A 14 tagú oleandolidnak nevezett lakton gyűrű
szerkezete hasomlít az eritromycin szerkezetéhez.
Különbség a C
6
, C
8
helyen található. Nevezetesen a C
6

hidroxil helyett az oxigénfunkció a C
8
helyen oxirán
gyűrűben található. A C
5
atomhoz glikozidos kötéssel
az eritromycinhez hasonlóan kapcsolódik a dezózamin.
A C
3
atomhoz L-oleandróz kapcsolódik glikozidos
kötéssel.
Gyógyászati felhasználáskor vízben oldódó
foszfátsóját adagolják. A molekulában levő három hidroxil csoport acilezésével kapott triacetil származék
előnyösen kapszulában vagy szuszpenzióban adagolva rövid idő alatt magas vérszinet ad. hatásmódja
megegyezik az eritromycinével, sőt legtöbb esetben keresztrezisztenciát okoz.

TYLOSIN

McGuir és munkatársai 1961-ben izolálták ezt a
makrolid antibiotikumot a Streptomyces
hygroscopicus tenyészlevéből. Később S. fradiae
és S.rimosus törzsek fermentlevében is
8megtalálták. Kémiai szerkezetét Morin és
Gorman 1964-ben írták le. A 16 tagú tilakton
alapváz oxidált származékához kapcsolódik a D-
mikaminóz és ezen keresztül mikaróz, valamint a
tilakton hidroxil-csoportjához kapcsolódó D-
micinóz.

A makrolid bioszintézis a zsírsav
szintézis tiotemplátjához hasonló enzimkomplex
felületen folyik. Az enzimkomplex egyes enzimei
azonban kölönböző mértékben vesznek részt a
bioszintézisben. Nem ismeretes az a
mechanizmus, amely a programot adja, a
bioszintézist irányítja. A szénlánc 2-2
szénatommal való meghosszabítása esetén
ugyanis nem működik minden esetben a
zsírsavszintézisnél megismert négy enzim. A
nyolc acil-CoA-ból felépülő 16 tagú makrolid
gyűrű kialakításában a |-ketoacil szintetáz
hétszer, a NADPH függő |-ketoacil reduktáz
hatszor, a hidroxi-dehidráz háromszor, a NADPH
igényes enoil-reduktáz pedig csak egyszer jut
szerephez. A bioszintézis propionil-CoA-val
indul, négy metilmalonil-CoA, egy etilmalonil-
CoA, és két malonil-CoA vesz részt a reakcióban.
Minden malonil-CoA származék képződéséhez
(széndioxid felvételéhez) egy-egy ATP
szükséges. A tilanolid gyűrűn végrehajtandó
oxidációs reakciók és a cukorkomponenseknek a
laktongyűrűhöz való kapcsolása is energiát
igényel. A tilakton bioszintézis végül is a
templátról való leválással, illetve a lakton gyűrű
kialakulásával fejeződik be.



108
Az ezt követő első reakció a
mikaminóz kapcsolódása a C-5 hidroxilon
keresztül. Ezt követi a C-20 metil
oxidációja, majd a hidroximetil tovább
alakulása formil származékká. A
cukorkomponensek beépülése timidil-
difoszfát származékaikon keresztül történik.
A C-23 oxidációját követi a 6-dezoxi-D-
allóz megjelenése. A következő lépésben
vagy egy újabb cukor, a mikaróz
kapcsolódik a mikaminóz
4’hidroxilcsoportjához és ezt követi a D-
allóz 2’’’ és 3’’’ helyzetben levő
hidroxilcsoportjainak a metilezése.
Lehetőség van arra, hogy előbb következzen
be a hidroxilcsoportok metilezése és csak
azután a mikaróz belépése. Ezekkel a
lépésekkel eljutottunk a főkomponensként
megjelenő tylosin-hoz, amely a fermentációs
periódus utolsó szakaszában a formil csoport
redukciójával továbbalakulhat (relomycin).
A tenyészlé a fent említett
főkomponenseken kívül a bioszintézis több-
kevesebb köztes termékét (lactenocin,
desmycosin, macrocin) is tartalmazhatja
változó mennyiségben.
A fermentlében található tilakton
származékok közül antibakteriális hatásával
a tylosin kiemelkedik. Húsleves agaron a
Bacillus subtilis növekedését 0,4 mg tylosin,
0,8 mg macrocin, 1,5 mg relomycin, 6,25
mg lactenocin illetve desmycosin képes
megakadályozni. Megjegyzendő, hogy Corcoran és munkatársai szerint sejtmentes körülmények között a
riboszóma 50S alegységéhez a desmycosin kötődik legerősebben. Teljes mértékben megakadályozza az
aminoacil-tRNS kötődését a riboszómához. A gátló hatásnak az érvényesülése a stacioner fázisban levő
tenyészetben a fehérje szintézis csökkent volta miatt már jelentéktelen.
A képződő tylosin a termelő törzs saját riboszómájának a működését is zavarja. A saját fehérjeszintézis
zavarásával így végeredményben az antibiotikum képződés csökkenése észlelhető. Első megközelítésben
fenotipusosan ez végtermék gátlásnak (feed-back) tűnik. Jó példa ez arra, hogy az in vivo nyert kisérleti
eredményekből nem tanácsos meggondolatlan következtetéseket tenni (A feed-back gátlás alatt a végterméknek
a bioszintézisben közvetlenül szerepet vállaló enzimre való gátló hatását értjük!). A törzsfejlesztés
szempontjából ezért tylosin rezisztens mutáns kiválasztása előnyös volt. Géntechnológiai munkával a
bioszintézis egyes enzimeinek klonozását, kópiaszámának növelését meg lehetett oldani. Ilyen módszerekkel az
O-metil transzferáz termékképződést limitáló hatását fel lehetett függeszteni.
A tylosin előállítására kialakított eljárások megegyeznek abban, hogy nitrogén forrásként állati eredetű,
vagy növényi fehérje azonosan jó eredménnyel használható. Szénforrásként a szénhidrát mellett jelentős szerepet
kap sőt a nagytermelőképességű törzsek esetében előnyösebb a növényolaj szénforrás használata. A fermentáció
első szakasza, az úgynevezett növekedési szakasz oxigénigénye jelentős (1.5 mmol O
2
. g sejt
-1
óra
-1
), mintegy
háromszorosa a termelő szakaszban fogyasztott oxigén mennyiségének. Egyes szerzők kérdőjelezik az eljárás
növekedő és termelő szakaszra osztásának létjogosultságát. Egyre több adatra hivatkozva - éppen a tylosin
esetében - állítják, hogy az antibiotikum a növekedési szakaszban is képződhet, ha az ugynevezett ‖katabolikus
represszió‖ azt nem akadályozza. Glükóz adagolása, illetve a foszfátkoncentráció emelése egyaránt csökkenti az
antibiotikum termelést. Az újabban alkalmazott növényolaj rátáplálással kivitelezett (feed-batch) technológia
kialakítása ebből a szempontból különös figyelmet érdemel, mert a represszív hatás kizárásával a hasznos termék
képződés jelentősen növelhető.. Ammónia a növekedést serkentve az idiofázis elérését későbbre tólja, csökkenti
az antibiotikum képződését. A táptalajhoz adott zeolit pozitív hatása az ammónia megkötésében jelentkezik.

109

A szűrt fermentléből vízzel nem elegyedő szerves oldószerrel (dikóretán, butilacetát, metil-etil-keton) jó
hatásfokkal különíthető el a tylosin rokon vegyületeivel együtt, de sikerrel alkalmazhatók a környezetkímélő
ioncserélő vagy abszorpciós eljárások is. Kémiailag a pH 5-nél nyert kloroformos extraktum 283 nm-nél mért
fényelnyeléséből következtethetünk a tenyészlé tylosin tartalmára. A nyers szűrlet biológiai értékének
meghatározására turbidimetriás, vagy agardiffúziós módszerek használhatók. Mérő törzsként a Staphylococcus
aureus (ATCC 9114) vagy a Sarcina lutea (ATCC 9341) hasznlhatók. A kinyert tylosin kevéssé toxikus, Gram-
pozitív baktériumok és Mycoplasma törzsek ellen hatásos makrolid antibiotikum. Humán gyógyszerként nem
kerül forgalomba éppen a köztestermékek jelenléte miatt. Állattápszerben (szárnyasok, választási malacok,
borjak esetében) és az állatgyógyászatban azonban használata terjedőben van. Tápkeverékben való alkalmazása
különös gondosságot igényel, mivel a bélcsatornából felszívódik és a kiürülése sem túl gyors. A tylosin
készítményt tartalmazó tápot fogyasztó állat csak meglehetősen hosszú várakozási idő után kerülhet vágóhídra,
mert az FDA szigorú szabályait egyre inkább követő nemzetközi előírások szerint a forgalomba került élelmiszer
antibiotikumot nem tartalmazhat.

110

THIOSTREPTON

Az antibiotikum elnevezése is utal jelentős kéntartalmára. A peptidjellegű antibiotikumok külön csoportját
képviselő bioaktív vegyület a tiazol gyűrűkben tartalmazza a kénatomokat. A csoportra jellemző, hogy az
emésztőenzimek inaktíválják. Ez a kutatólaboratoriumok számára előnyös, mert a biológia hatás kiváltása után
egyszerűen eltávolítható a reakcióelegyből. Az állatgyógyászatban kerül felhasználásra.


A csoport első képviselőjét az 1600 molekulatömegű thiostreptont Pagano és munkatársai 1956-ban
izolálták Streptomyces azureus fermentlevéből. Kémiai szerkezetét Anderson és munkatársai 1970-ben
ismertették. Kémiailag egy kvinaldinsav származék. Izoleucin, treonin, alanin és cisztein aminosavakon kívül
tiostrepton-savat és tiostreptint tartalmaz.
A vízben rosszul oldódó kémiailag stabil vegyület a kiszűrt sejttömegről kloroformmal oldható le.
Biológiailag különösen a Gram-pozitív baktériumok ellen hatásos. A Diplococcus pneumoniae,
Corynebacterium diphteriae, és a Streptococcus haemolyticus szaporodását már 0.01 mg ml
-1
koncentrációban is
akadályozza. A Gram-negatív baktériumok külső membránján nem képes áthatolni. Sejtmentes körülmények
között mind a Gram-pozitív, mind a Gram-negatív baktériumokban az 50 S riboszóma alegységhez kötődve a
GTP hidrolízisének akadályozásával a lánchosszabítást gátolja. A tiostrepton-rezisztens Bacillus megaterium
riboszómájából hiányzik az L-
11
fehérje. Az antibiotikum a gazdaszervezet számára nem toxikus, mert az
eukariota riboszómához nem kötődik. Az antibiotikumot termelő S. azureus riboszómáját felépítő rRNS jelentős
mértékben metilezett. Vélhetően ezért zavartalan a sajátfehérje bioszintézise.
111
POLIKETID KÖZTESTERMÉKBŐL KÉPZŐDŐ METABOLITOK CSOPORTJA

A poliketid bioszintézis építőeleme a malonil-CoA. Ugyanez a köztes terméket használja fel a zsírsav szintézis.
A zsírsav bioszintézishez felhasználásra kerülő malonil-CoA acetil-CoA karboxilezésével képződik. A poliketid
szintézis építőeleme viszont oxálecetsav oxidativ dekarboxilezésével képződik. A két bioszintézist végző
enzimkomplexhez lazán kapcsolódik a malonil-CoA képződésért felelős fehérje A zsírsavszintézist végző
enzimkomplexhez a transzkarboxiláz kapcsolódik, aminek a működését a végtermék, a hosszabb szénláncú
zsírsav gátolja. A karboxi-biotin képződést az átmenetileg megjelenő szénsav-foszforsav vegyesanhidrid segíti.

[HO–CO–O–PO
3
H
2
]
Biotin + CO
2
+ ATP ADP + Pi + karboxibiotin
Az Escherichia coli-ban működő enzimkomplex mérete 277 kd, amely két alegységből álló 45 kd méretű
hordozó fehérjét (BCCP biotin carboxil carrier protein), két alegységből álló 102 kd méretű biotin karboxilázt és
négy alegységet tartalmazó 130 kd méretű transzkarboxilázt tartalmaz. (dalton = 1 hidrogénatom tömege
1,67x10
–24g
) A poliketid szintézis működését az oxidatív dekarboxilezésért felelős fehérjét (oxálecetsav

112
dekarboxiláz) és piroszőlősav karboxilázt tartalmazó együttes segíti. A gyürüs szerkezet kialakulása víz
kilépésével következik be. (Lásd a tetraciklin szerkezetű antibiotikumok kialakulását mutató ábrát




113
TETRACIKLIN TIPUSÚ ANTIBIOTIKUMOK

Közel félszáz éves múltra tekintve emlékezhetünk meg a széles spektrumú antibiotikumok minőségileg jól
elkülönülő négy anellált gyűrűt tartalmazó oktahidronaftacén (4-dimetilamino-1,4,4a,5,5a,6,11,12a-oktahidro-
3,6,10,12,12a,-pentahidroxi-1,11-dioxo-2-naftacén karboxamid) származékairól, amelyek fehérjeszintézist gátló
vegyületként, szájon át adható formában őrzik népszerűségüket.
Gyógyszerként a Streptomyces törzsek által előállított valamelyik természetes képviselőjük
(aureomycin, terramycin, tetracyclin, demeclocyclin), illetve az utóbbi évtizedben a terramycin kémiai
átalakításával nyert stabil hatásos származék a doxycyclin kerül felhasználásra. A hatásos anyag sztereokémiai
szerkezetének felderítése röntgendiffrakciós analízis segítségével igen nagy munkát jelentett. Szerkezetükben
közös az amfoter tulajdonság. Valamennyien savakkal illetve bázisokkal sót képeznek. Semleges oldatban
zwitterionként léteznek. Stabil komplexet alkotnak a kettő és több értékű fémionokkal (Ca, Mg, Fe). Mivel ezek
a komplexek vízben alig oldódnak, az antibiotikummal együtt fogyasztott tej iontartalma rontja a tetraciklinek
felszívódását. Nátrium-hidrokarbonát ugyancsak gátolja a felszívódást. Antibakteriális hatásukat kezdetben a
teraciklinek erős fémion megkötőképességével, a baktériumok számára esszenciális fémionok elvonásával
magyarázták.

A hatásmód részletes vizsgálata azonban igazolta, hogy ez a hatás nem jelentős. A tetraciklin ugyanis a
30 S ribószóma egység akceptor részéhez kötődve akadályozza az aminoacil tRNS kötődését a mRNS-riboszóma
komplexhez. Az is feltételezhető, hogy a riboszóma szerkezeti alkotórészeként szereplő Mg
++
ionhoz kötődve
kapcsolódik az antibiotikum a riboszómához.

X Y Z moltömege
klórtetraciklin aureomycin Cl CH
3
H 479,9
tetraciklin tetracyclin H CH
3
H 445,4
oxitetraciklin terramycin H CH
3
OH 461,4
demetilklórtetraciklin demeclocyclin Cl H H 465,9

Semlegeshez közeli pH-nál a C
4
atomon bekövetkező epimerizáció (a dimetilamino csoport térhelyzetében
bekövetkező változás) a biológiai aktivitás csökkenését okozza. Ugyancsak csökkenti a biológiai hatást a
dimetilamino csoport kvaternerizációja. Savval képzett sóik képződését a C
2
enolcsoport protonálódása segíti elő
(mezomer átrenedeződés lehetősége). Sóik vízben jól oldódó kristályos vegyületek. Szájon át adagolva
hidrokloridjaikat használják. Hidrokloridjaik három disszociációs állandója a három protonálódó molekularész
következménye.
A disszociációs állandók értékét a kémiai szerkezetük határozza meg
Hidrokloridjaik pKa értékei vízben 25 C
o
hőmérsékleten
pKa
1
pKa
2
pKa
3
Tetracyclin 3.3 7.7 9.5
Aureomycin 3.3 7.4 9.3
Oxytetracyclin 3.3 7.2 9.3

Vízoldható kálium és nátrium sóik bomlékonyak. A tetraciklin kálcium-ortofoszfát komplexe olyan stabil, hogy
a fejlődő csontokba, fogakba kerülve és olyan sárga elszineződést okoz, amely később fotokémiai reakció
eredményeként megsötétül. Különösen fontos ez a szoptató anyák illetve a terhes nők szempontjából, mivel az
antibiotikum egyrészt megtalálható az anyatejben, másrészt akadálytalanul hatol át a méhlepény gátján és így
feldúsulhat a magzat csontrendszerében. Ugyanezen okok miatt 8 éves kor alatt tetraciklinek használata csak
feltétlenül indokolt esetben javasolható.
114
Erős sav, vagy bázis hatására a C
6

atom hidroxilcsoportja inaktíválódási
folyamatot indít. A gyomorsav
hatására dehidra-tálódás indul a C
6

hidroxil és az C
5a
hidrogén
kilépésével. Az így kialakuló
kettőskötés indukálja a C
11a
-C
12

kettőskötés vándorlását C
11
-C
11a

helyzetbe. A termodinamikailag
stabilabb naftalin vázat tartalmazó
anhidro-TC biológiailag inaktív.
Lúgos körülmények között a
bélcsatornában a C
6
hidroxil csoport
és a C
11
ketocsoport reakciója
inaktíválja a molekulát. A C
11
és C
11a

közötti kötés felszakadásával egy
lakton gyűrűt tartalmazó inaktív
izotetraciklin alakul ki.
Ezzel a két reakcióval per os
adva feltétlenül számolni kell. A hatás szempontjából kivánatos vérszint elérése érdekében a hatóanyagot
gyakran (6 óránként), viszonylag nagy mennyiségben kell adni. Kezdettől fogva ez a szempont indokolta a
kémiai módosítását. Kiderült azonban, hogy minden kémiai átalakítás, amely a molekula gyürűrendszeréhez
közvetlenül kapcsolt szubsztituensek térszerkezetét érintette az aktivitás jelentős csökkenésével járt. Ez nem
meglepő, ha megfigyeljük, hogy a négy gyürű sikjának felső oldala apoláros, az ellenkező felszin pedig poláros
tulajdonságú. A C
2
kvázi ekvatoriális helyzetű karboxamid csoport kivétel ez alól. Az amid-csoport
hidrogénjének szubsztituálása nem változtatja a biológiai hatást. Ezt ki is használják a gyakorlatban.
Az 1958-tól forgalmazott N-pirrolidino metil származék (Rolitetracyclin) vizes oldatban
szobahőmérsékleten is stabil. Molekula tömege 527.3. Alkoholban is jól oldódik. Vízben való oldhatósága
több mint 2000-szeresére növekszik a bázishoz
viszonyítva. 28 C
o
-on 1250 ug oldható 1 ml 1.5-8.5
pH tartományban. Ez előnyös az injekciós
adagolhatóság szempontjából. 275 mg RTC
intravénás bevitelét követően 10 perc mulva 16-20
ug szérumszint mérhető, amely 20 perc mulva 7-
Fiziológiás sóoldatban oldható rolitetracyclin 13 ug
értékre csökken. Az első óra
végén 5-8, a harmadik órában 3-4.5, a hatodik
órában 2.5-3.5, a nyolcadik órában 1.8-2.6, de tizenkét óra mlva is 1.-1.7 ug.ml
-1
vérszint mérhető. 12 óránként
ismételten adott i.v adagolással 2.5-5.5 ug.ml
-1
átlag vérszint érhető el. Folytonos infúzióval (0.5 mg/6 óra) 4-10
ug.ml
-1
vérszint tartható. A tetraciklinek széles baktériumspektruma miatt használata erősen megváltoztatja a bél
természetes flóráját. Ez lehetővé teszi a gombás fertőzések megjelenését, például a patogén Candida albicans
elszaporodását. Parenterális adagolás esetén előtérbe kerül a májkárosító hatása, különösen akkor, ha a
vesefunkció zavara miatt a kiürülés természetes útja gátolt.
A tetraciklin antibiotikumok bioszintézisének felderítése McCormic, az egyes antibiotikum-
származékok egymással összefüggő szintézisútjainak ismertetése Vanek és munkatársainak érdeme. A
bioszintézis SH csoportokat tartalmazó hordozó fehérje felületén történik malonil-CoA egységekből. Az indító
vegyület (malonamid) karboxamido-acetil-CoA, majd ezt követi nyolc malonil-CoA mlekula részvétele a
lánchosszabbítási reakcióban. A reakció hasonlít a zsírsav bioszintézis lánchosszabító első lépéséhez. Az indító
karbamoil építőelem végeredményben a malonát amidálásával is képződhet, mégis a vizsgálatok más képződési
mechanizmust sugallnak. Két lehetőség adódik vagy az acetil-CoA lép reakcióba a karbamoil foszfáttal, vagy
pedig az aszparagin keto analógja lép reakcióba a CoA-SH-val NAD kofaktort igénylő oxidatív dekarboxilezés
közben. A vizsgálati eredmények szerint az oligoketid váz felépítéséhez szükséges malonil-CoA építőelemek
nem az acetil-CoA karboxilezésével, hanem az oxálecetsav oxidatív dekarboxilezésével képződnek. Behál
vizsgálatai szerint a jól termelő törzsekben az általában jelentéktelen szerepet játszó foszfenolpiruvát karboxiláz
kiemelkedő szerepet kap az oxálecetsav pool feltöltésében. Ez az út kikerüli a vad törzsekben jól működő
alloszterikus szabályozó mechanizmust, nem igényel ATP-t, hanem a PEP nagyenergiájú foszfátkötésének a
terhére anorganikus foszfát képződése közben jut el az oxálecetsavig. A tiotempláthoz kapcsolódó ketosav-
tioészter kötésének esetenkénti átészterezését a malonil-CoA szénatomjának reakciókészsége, a dekarboxilezési
folyamat könnyíti..


Rolitetraciklin (N-pirrolidino-metil tetraciklin)
115
A régebbi elképzelést, amely a poliketidszintézisben az acetil-CoA karboxiláznak tulajdonított kulcs
szerepet, szabályozási és élettani szempontból elvi ellentmondások terhelték. A biotint tartalmazó és
működéséhez ATP-t igénylő acetil-CoA karboxiláz enzimkomplex az élővilágban a zsírsav szintézis első
reakcióját katalizálja. Nem meglepő tehát működésének szigorú szabályozottsága. Az alloszterikus 410 kd
molekulatömegű inaktív monomer csak citrát jelenlétében alakul aktív dimerré. Szabályozás hiányában ugyanis
képes lenne elszívni a szénhidrátlebontás termékeként megjelenő acetil-CoA jelentős részét. Nem csekély
élettani problémát jelentene, ha az oligoketid szintézis is ide csatlakozna, versengve a sejtmembrán foszfolipid
építőelemének (zsírsav) szintézisével.
A kerülő út érvényesülése két ugyancsak jól szabályozott mechanizmust is kikapcsol a poliketid
szintézis ellenőrzéséből. Nevezetesen az ATP, citrát és acetil-CoA által szabályozott piruvát kinázt, valamint a
liponsavat és tiamint tartalmazó NAD kofaktorrral működő piruvát dehidrogenáz enzimkomplexet, amelynek
működését ATP és GTP gátolja, ADP viszont aktíválja. A tetraciklin antibiotikumok képződését glükózból íly
módon a primer metabolizmus szintjén csak a fruktóz-1,6-biszfoszfát szintézis sebessége befolyásolja. A
fruktózfoszfát kináz a glikolízis szabályozása szempontjából kulcshelyzetben van, működését a sejt aktuális
energiaellátottsága befolyásolja. Az ATP és a citrát gátolja, az ADP és az AMP koncentrációnövekedése viszont
serkenti a működését. Ez a multivalens szabályozás a mindenkori körülményeknek megfelelő gazdaságos
anyagcsere sebességet állít be a mikroba számára.
. A tetraciklin bioszintézis reakciólépéseit elemezve jól észlelhető, hogy a hexóz bontás netto ATP
termelése nulla, mivel a PEP energia-gazdag foszfátja a kerülő úton anorganikus foszfátként távozik. A
bioszintézishez szükséges trióz-foszfátot és redukáló aktivitást NADPH formájában a TC termelő törzsek a HMP
úton nyerik. A fruktóz-1,6-biszfoszfát képződés fokozódása lényegesen csökkenti a tetraciklin bioszintézist.
Egy-egy tetramid molekula szintéziséhez szükséges három ATP és négy NADPH nem terheli különösebben az
anyagcserét, mivel a hexózok átalakítása közben képződő redukált kofaktorok (NADH) visszaoxidálása az ATP
igényt bőven fedezi, sőt túltermelése is bekövetkezik. Vanek és Hostalek már 1972-ben kimutatták, hogy az ipari
szempontból értékes jól termelő Streptomyces törzsekben mérhető ATP szint több mint egy nagyságrenddel
meghaladja a gyengén termelő vad törzsekben mért értékeket.
A kiemelkedő termelés előfeltétele többek között a fokozott adenilsav szintézis. A NADPH igény
szempontjából nem hagyható figyelmen kívül a bioszintézis szempontjából utolsó reakció, amely az addig
képződött biológiailag hatástalan köztes terméket antibiotikummá alakítja.
Az ábra a zsírsav szintézishez szükséges malonil-CoA képződését mutatja acetil CoA-ból. Ezt a
reakciót telített zsirsav alloszterikusan szabályozza. A poliketid szintézishez szűkséges malonil CoA viszont
oxálsavból oxidativ dekarboxilezéssel képződik. Az oxálsav piroszőlősav karboxilezésével elégíti ki a poliketid
szintézis épírtőelem igényét. Az ábra a két reakció lefolyását szemlélteti.
A jól termelő mutánsokban a citrát szintetáz működését is magasabb ATP szint szabályozza. A túlzottan
magas ATP szint kialakulását a fokozott mértékű polifoszfát képződés akadályozza a jól termelő variánsokban.
Ezekben a törzsekben sok esetben nemcsak az ATP, de már a glicerinsav-1,3-biszfoszfát is szubsztrátuma a
polifoszfát szintetáznak.
A szabályozó mechanizmus teljes kikapcsolását jelenti, ha szénforrásként zsírokat vagy növényi olajat
használunk. Ez esetben a zsírsav | lebontása szolgáltatja a szükséges építőelemet. Két acetil-CoA-ból a glioxalát
cikluson keresztül képződik az oxálecetsav.
Amikor a képződő poliketid lánc hossza eléri a templát szempontjából optimális méretet, akkor
kezdődik három víz kilépésével a gyürűs szerkezet kialakulása, a három lineárisan anellált gyürűt tartalmazó
pretetramid közti termék képződése. Ezt követi a C
6
metilcsoport beépítése metioninból egy ATP
felhasználásával. Metiláz hiányában demetilklórtetraciklin képződik. Metiláz hiányos mutáns viszonylag
könnyen nyerhető. a klasszikus genetika módszereivel mutagén kezeléssel. A bioszintézis következő lépésében
kialakul a negyedik gyürű, amit közvetlenül megelőz a köztes terméket a templát felületéhez rögzítő tioészter
kötés felhasítása. A reakció előrehaladását elősegíti az energetikailag előnyösebb anellált aromás rendszer
kialakulása. A gyürűzárást követi a C
8
-ketocsoport NADPH-t igénylő reduktív eltávolítása.
A C
4
oxigénfunkciót az így képződőtt pretetramidba egy NADPH-t igénylő oxigenáz vezeti be, amit az
oxitetraciklint termelő törzsekben a C
5
oxigénfunkció hasonló módon történő kiépítése követ. Az aromás
rendszer felszámolását egy FAD dehidrogenáz indítja. Ezt követi egy víz felvételével a C
12a
hidroxil csoport
megjelenése. A következő lépésben a C
4
oxo csoportot egy transzamináz glutaminsavból származó amino
csoportra cseréli. A nitrogén metilezését metioninnal működő ATP-t és B
12
vitamint igénylő N-metiláz végzi. Az
eddig kialakult anhiderotetraciklin biológiailag hatástalan. A biológiai aktivitás megjelenéséhez az aromás
rendszer kiterjedésének a csökkentése szükséges. Ennek bevezető lépése egy újabb NADPH-t igénylő oxigenáz
reakció, amely bevezeti a C
6
hidroxil csoportot. Ezt követőleg NADPH-ról származó hidrogén felvételével
fejeződik be a tetraciklin molekula szintézise. A bioszintézis NADPH igénye egyértelműen meghatározza a
nagytermelőképességű törzsek szabályozó mechanizmusát befolyásoló élettani beavatkozások irányát.
116
A tetramid szintézis utolsó két reakciólépését katalizáló enzimek képződéséről tudjuk, hogy
katabolikusan represszáltak, különösen a gyengébben termelő törzsekben. Az anyagcsere sebességének
fokozódásakor csökken az oxigenáz képződése, de gátolja az enzim képződését a táptalajhoz adott nagyobb
mennyiségű foszfát ion is. Ha menet közben a foszfátot eltávolítjuk a rendszerből, akkor egy órányi látens fázis
után újra megindul az enzim szintézise. A kiemelkedően jól termelő variánsokban ez a katabolikus
represszálhatóság alig kimutatható. Régóta ismeretes, hogy a tetracklint termelő törzsek bioszintetizáló
aktivitását jelentősen fokozni lehet benzil-tio-cianáttal. A termelés fokozódásakor a pentóz-foszfát ciklus
aktivitása megnő és fokozódik az anhidro-tetraciklin oxigenáz szint. Általában megállapítható, hogy minden
beavatkozás a növekedés kezdeti szakaszában, ami a szénhidrát felhasználás sebességét csökkenti (fruktóz,

117
répacukor szénforrás, oxigén limit) előnyös a tetramid váz képződése szempontjából, tehát a tetraciklin tipusú
antibiotikumok képződését fokozza.
Kérdés, hogy a biológiailag aktív fehérjeszintézist gátló tetraciklin feldúsulása a tenyészlében milyen
hatással van magára a termelő törzsre? Mikulik megállapította hogy az antibiotikumot termelő törzsből izolált
70 S riboszóma 320 tetraciklin tipusú antibiotikumot képes megkötni, irreverzibilisen azonban mindössze
egyetlen kötődik. Ludvik és munkatársai tetraciklin hatására a citoplazmában a riboszómák aggregálódását
figyelték meg. A vizsgálatokból később kiderült, hogy a jól termelő törzs adott idő alatt lényegesen kevesebb
tetraciklint vesz fel mint a gyengén termelő vad törzs. A jól termelő törzs antibiotikum érzékenysége a tenyészet
korától függ, különösen érzékeny a növekedő fázisban levő fiatal vegetatív sejt. A négy órás tenyészethez adott
500 ng/ml tetraciklin a fehérjeszintézist harmadára csökkenti és teljes mértékben megakadályozza az
antibiotikum termelését. A 16 órás tenyészethez adott tetraciklin már nem befolyásolja az antibiotikum
képződését, sőt jól megfigyelhető egy alapszintű fehérjeszintézis. A kétnapos tenyészetben a fehérjeszintézis a
fiatal tenyészet ötödére csökken. Az antibiotikum szintézis fokozódásakor a fehérje szintézis csökken, ezt
megelőzően a guanozin-pentafoszfát (ppp-G-pp) megjelenése mellett az RNS szintézis csökkenése tapasztalható.
Kívülről adott ppp-G-pp az RNS polimeráz működését gátolja, a kívülről adott tetraciklin viszont a ppp-G-pp
szintézist akadályozza. Ezt az igen érzékeny bonyolult szabályozási mechanizmust zavarja meg a korai fázisban
adott tetraciklin. A TC-t termelő törzsekben csak a növekedési fázis végén indul meg az antibiotikum képződése.
Az aminocsoport bevezetése előtt a bioszintézis útból két elágazás lehetőségét használja ki a természet.
Az egyik változatként a C
6
oxigénfunkció kiépítése után az oxigenáz a C-5 hidroxil csoport kiépítésével elindítja
az oxitetraciklin képződését. A másik lehetőséget kihasználó fajokban működő klórozó enzimrendszer kiépíti a
C
7
klór származékot. Klórozó enzim nélküli mutánsokat könnyen lehet nyerni. Eddig nem találtak olyan variánst,
amely a C
5
hidroxil csoport kiépítésre és a klór bevitelére egyaránt képes lett volna.
Kémiai szintézisére több módszert dolgoztak ki. A sok (5-6) királis szénatom miatt ez a munka nem a
fermentációs eljárás kiváltását, hanem olyan új tetraciklinek előállítását célozta, amelyek fermentációs úton nem
állíthatók elő. Az egyik eljárás szerint a dimetoxi-benzoesav metilészter redukciójával nyert alkoholt
foszfortribromiddal bromozzák. A brómszármazékot karbetoxiszukcinát dietilészterrel reagáltatják. Az észter
hidrolízisével nyert trikarbonsav dekarboxilezése után polifoszforsav hatására bekövetkezik a gyürűzárás
A nyert karbonsavat észteresítik, majd az oxocsoportot etiléntioketállá alakítják. Ezt követi a LiAlH
4
-es
redukció. Az alkoholt meziláton keresztül cianidra cserélik, amit Raney-Ni katalizátor mellett aldehiddé
redukálnak. Ez lehetőséget ad a feniltiazolonnal való reakcióra. Az alapváz még hiányzó szénatomjait tartalmazó
3-oxoglutaramát metiészterét Michael addicióval kapcsolják a molekulához, végül észterkondenzációval zárják a
gyürűrendszert. A tioamid csoport aminocsoporttá alakítása a kénatom alkilezésén keresztül végezhető
trietiloxonium tetrafluoroboráttal. Az így kapott iminoéter híg savval könnyen hidrolizálható. Az aminocsoport
metilezése metiljodiddal is végezhető, de a képződött mono-, di és trimetilszármazékokat nehéz szétválasztani.
Sokkal előnyösebb a reduktív alkilezési módszer alkalmazása, amikor is a metanolos oldathoz vizes
formaldehidet és nátriuncián-bórhidridet adnak pH=7.5-8-nál. A metoxi csoport eltávolítására bórtribromidot
előnyös használni. A védőcsoportok eltávolíthatók koncentrált jód-hidrogénnel 100
o
C-on.
.


118
Aureomycin-t az antibiotikum csoport első forgalomba kerülő hatásos képviselőjét a 7-klór-4-
(dimetilamino)-1,4,4a,5,5a,6,11,12a-oktahidro-3,6,12,12a-pentahidroxi-6-metil-1,11-dioxo-2-naftacén-
karbonsavamidot Streptomyces aureofaciens fermentlevéből 1948-ban izolálta Duggar. Hidrokloridjának fénylő
sárga kristályos formáját látva aureomycinnek nevezték el. Ez a kissé fotoszenzitív, de levegőn stabil, szagtalan,
keserű anyag vízben jól, alkoholban gyengén oldódik. Hidrokloridjának 1%-os vizes oldata savas (pH 3).
Kapszulában hozzák forgalomba A táptalaj klorid tartalmát csökkentve, fölös mennyiségű bromid jelenlétében
fermentációs eljárással előállítható a brómtetraciklin. A klór brómra cserélése a kémiai és biológiai
tulajdonságában változást nem okoz. Az új antibiotikumok kutatása céljából végzett törzsizolálási program
keretében több kutatóhelyen találtak aureomycint termelő törzseket (S.alboflavus, S.flavus, S lusitanus,
S.sayamaensis). Közöttük olyan törzseket is izoláltak amely demetilklórtetraciklint és tetraciklint is termeltek.

Tertraciklint először 1955-ben az aureomycin kémiai módosításával állították elő. Katalitikus
hidrogénezéssel ugyanis könnyen eltávolítható a C-7 klórszubsztituens. A dioxán-metanol elegyben oldott
aureomycint 10% palládium tartalmú szénkatalizátor és 1 mol trietilamin jelenlétében hidrogénezik. A redukció
befejezése után a katalizátort kiszűrik, a szűrlethez vizet adva a terméket kristályosítják, szükség esetén vizes
metanolból átkristályosítják.
Aureomycint termelő törzs alkalmazásával is előállítható tetraciklin olyan kloridban szegény táptalajon
amely a klórbeépítést szelektíven gátló vegyületet, például rodanidot (KSCN) tartalmaz. Ezzel egyidőben
izoláltak olyan enzimhiányos mutánsokat, amelyek a klórozó mechanizmus hibája miatt csak tetraciklin
szintézisére voltak képesek. Később más törzsek (S.alboflavus, S.antibioticus, S.aureus, S.californicus, S
feofaciens, S.flareolus, S.flarus, S.lusitanus, S.parvus, S.rimosus, S.sayamaensis) fermentlevében is találtak
tetraciklint, önállóan illetve oxyteracyclin, vagy chlortetracyclin
mellett. A tetraciklin stabilabb és magasabb vérszintet ad mint a
klórtetracyclin vagy az oxytetracyclin. A liquorban is jól
mérhető antibiotikum szintet érhetünk el használatával. Hosszú
ideig a humán terápiában a csoport legnépszerűbb tagja volt.

Félszintetikus termékként ismert a minociklin (7-
dimethylamino-6-deoxy-6-demethyltetracyclin C
23
H
27
O
7
N
3
.HCl
457.5 Moltömeg) származék, amelyben a klór szubsztituenst
dimetilamino csoport helyettesíti.

Terramycin-t Finlay izolálta Streptomyces rimosus
fermentlevéből 1950-ben. Hamarosan igazolódott, hogy
szerkezete és hatásmódja hasonló az aureomycinéhez. Kémiai
különbség, hogy a C-7 klórszubsztituens helyett a C-5
pozicióban egy hidroxil található. Később több törzs
fermentlevéből is sikerült előállítani (S. alboflavus, S.
antibioticus, S. cellulosal, S. platensis, S. flarus, S. flareolus S.
fuscofaciens, S. parvus, S. vandergensis) . Pontos szerkezetét
Hochstein igazolta 1953-ban.
Az antibiotikum sűlyesztett fermentációs
technológiával szójalisztet és keményítőt tartalmazó táptalajon
előállítható. A kinőtt tenyészet antibiotikum termelésfokozása érdekében glükóz helyett előnyösebb pálma olajat
adni szénforráskéntagolásával. A zsírsav jelenléte a glükóz neogenezis által táplált HMP út fokozott működésén
keresztül a tetraciklinképződés szempontjából optimális NADPH szint kialakulását segíti. Az ellenőrzés nélkül
képződő acetil-CoA pedig a bioszintézis szempontjából meghatározó jrelentőségű malonil-CoA ellátottságot
biztosítja.
Az oxytetracyclin (OTC) fermentléből való kinyerésére gazdaságos csapadékos eljárást használnak. Az
oxálsavval savanyított fermentlé (kalcium mentes!) szűrletéből az antibiotikumot cetil-piridinium-bromiddal
(sterogenol) kvaterner só formájában csapják ki. A kiszűrt csapadékot újra oldva sósavas metanolból
klórhidrátként kristályosítják. Hidrokloridja vízben jól oldódik (500 mg.ml
÷1
). pH=2 alatt és pH=8 felett azonban
gyorsan bomlik. Vizes közegben való bomlása a tetraciklinhez hasonló inaktív termékek képződéséhez vezet.
Kémiai szerkezetéből következően a sav hatására kialakuló anhidro származéka folyamatosan tovább alakul
apovegyületté.
Az oxytetracyclin szolgál kiinduló anyagként a Stephens 1958-ban megjelent közleményében leírt
félszintetikus származék, a doxycyclin, mésnéven vibramycin (o-6-desoxy-5-hydroxytetracyclin, C
22
H
24
O
8
N
2
,
513 Moltömeg) előállítására. A kémiai félszintézis az oxitetraciklin 4N-klór-szukcinimiddel végzett klórozásával
indul. A kapott klórhemiketálból vizelvonással hidrogén-fluoridban (H
2
F
2
) nyerjük az ugynevezett
klórmetaciklint.

oxitetraciklin spontán inaktiválódása
119

Nátrium-ditionittal végzett dehalogénezés vezet a kiindulási vegyületnél stabilabb metaciklinhez (6-methylen-5-
hydroxytetracyclin C
22
H
22
O
8
N
2
.HCl 478,5 moltömeg), amit gyógyszerként is forgalomba hoztak. A C
6

hidroxilcsoport hiánya ugyanis stabilizálja a molekulát. A metaciklint ezután mérgezett palládiumkatalizátor
jelenlétében hidrogénezik. A reakcióelegyből sósavas etanollal az o-doxycyclin hemihidrát-hemialkoholát
(hiklát) izolálható csekély víz jelenlétében. Ez a termék savanyú pH-nál stabil. A termék biológiai aktivitása a C
6

metilcsoport helyzetétől függ. Az o helyzetben szubsztituált származék háromszor aktívabb az epimerjénél.
Rhodium katalizátorral végzett hidrogénezés a hasznos termék képződése szempontjából előnyösebb.
Ez a viszonylag savstabil vegyület szobahőmérsékleten hetekig megőrzi biológiai aktivitását a
vérszérum körülményei között. Egy százalékos kalciumfoszfát oldatban 24 óra alatt mindössze 20-25 %-a
inaktíválódik. Gram pozitív és negatív baktériumok, Spirochaeta, Rickettsia, Leptospira, Chlamydia,
Actinomycetes fajok ellen kiemelten hatásos bakteriosztatikum. Nehezebben küzdhetők le a Proteus,
Pseudomonas, Klebsiella, Aerobacter, Providencia fajok által okozott fertőzések. Keresztrezisztencia
megjelenését tapasztalták az Escherichia coli, Staphylococcus, Pneumococcus fajoknál.
A béltraktusból való felszívódása gyors,
a szövetekben magas antibiotikum szint érhető el,
sőt a szérumszint 20%-a mérhető a gerincvízben
(liquor cerebrospinalis). Adagolásánál figyelembe
veendő, hogy a placentában és az anyatejben is
megjelenik. Igen hatásos a vizeletkiválasztó
rendszer fertőzéseinek leküzdésére. Kémia
stabilitása miatt lényegesen kisebb mennyiséggel
lehet a bakteriosztatikus hatást elérni. A
kapszulában forgalmazott termékből napi
adagként 100-200 mg elegendő a hatásos vérszint
eléréséhez. Tapasztalat szerint 96 óra alatt a
bevitt hatóanyag az egészséges szervezetből
kiürül. Az ábra a ―vibramycin‖ (o÷doxycyclin)
adagolás utáni vérszint alakulását mutatja





120
KOLESZTERINSZINT CSÖKKENTŐ FARMAKONOK
LOVASTATIN - Mevinolin- MEVACOR
A heterozigótaként hordozott magas koleszterinszint (hiperkoleszterimémia 200-400 mg liter
÷1
LDL koleszterin)
tragikus következményének elhárítására gomdolva évtizedek óta javasolja az orvostudomány a koleszterinszint
radikális csökkentését. Homozigótaként magas koleszterin szintet öröklő egyedekben ez a kezelés aligha hozhat
eredményt.
A problematikus helyzet oldására az utóbbi évtizedek kutató munkája hatásos fiziológiai terápiás
eljárást talált. A koleszterin szintézis nélkülözhetetlen építőelemének a mevalonsavnak a képződését gátolva
gyakorlatilag a koleszterin képződést lehet akadályozni. A régebben kifejlesztett módszer a képződött szetrin
epesav formájában történő eltávolítása csupán tüneti kezelés, mert a szervezetet genetikailag meghatározott szint
elérésére - a hiány pótlására - több koleszterin képzésre ingerli. A magasabb rendű szervezetekben a szterin
bioszintézist a mevalonsavképződést befolyásolva a koleszterin alloszterikus gátlószerként szabályozza.
A XX. század utolsó negyedében Merck Sharp and Dohme gondozásában került a piacra a lovastatin
hatásos népszerű koleszterin szint csökkentőként. A kutatócsoport (A. Endo és munkatársai) a hetvenes években
elméleti meggondolásból a fungisztatikus hatású mikroorganizmusok között célzottan szterin-szintézist gátló
mikrobiális eredetű vegyületet kerestek. Közel 8000 törzs biológiai aktivitását vizsgálták patkány máj enzim
rendszerén in vitro.
A Penicillium által termelt compactinról - későbbi néven mevastatinról - 1976-ban jelent meg az első
közlemény. Később a compactin metilezett származékát az Aspergillus fajok tenyészlevében is megtalálták. Az
első összefoglaló dolgozat a hetvenes évek végén jelent meg. (J. Antibiot. 32:852-54 1979) a Monascus ruber
tenyészlevéből kinyerhető hatásos vegyületekről.
A következő évben l980-ban A.V. Alberts és munkatársai Aspergillus terreus tenyészlevében találtak hasonló
hatású hexahidro naftalénhez kapcsolódó heptánsavakat. (Proc. Natl. Acad. Sci. USA, 77: 3957-61). A
pravastatin savként kerül kiszerelésre. A többi "statin" lakton alakja a májban felnyílik és így létrjön a gátlás
szempontjából fontos o-hidroxisav.
Jól tudott, hogy a mevalon-sav a szterinszintézis korai köztesanyaga. A lovastatin és rokonvegyületei,
mint intracelluláris enzim-gátlók a mevalonsav képződés akadályozásával a magasabb-rendűekben a szterin
képződést, a koleszterin szintézist gátolják. Szimultán megnő a sejtmembrán LDL-receptorainak száma ami
viszont megköti a vérben keringő LDL-koleszterint. A bonyolult folyamat eredményeként csökken a vérplazma
koleszterinszintje. Ezek a vegyületek az izeltlábúakban akadályozzák a juvenilis (fejlődési) hormon képződést, a
növényekben és gombákban a szterin képződését. Valójában először ez a vegyületcsoport mint ismeretlen
szerkezetű antifungális anyag került izolálásra. Később magyar szerzők Aspergillus obscurus nevű törzset
izoláltak, amely tenyészlevében a lovastatint { |.o-dihidroxi -7- [1,2,6,7,8,8a-hexahidro-2,6-dimetil-8-(2-metil-
butiriloxi)-naftalén-1-il] -heptán-sav } o-lakton formában, illetve szabad-savként tartalmazta. (US. Patent:
5,403,728. 1995).

mevalon-sav NADPH-reduktáz (Szterin szintézis: 144 oldalon)
Ez a vegyületcsoport a 3-hidroxi-3-metil-glutaril-CoA redukcióját kompetitíven gátolva akadályozza a
mevalon-sav képződését, a mevalon-sav hiány viszont akadál2yozza a szterin szintézist. A kompetitív gátló hatás
már 1 nM tartományban jelentkezik. Ez három negyságrenddel alacsonyabb mint a HMG-CoA diasszociációs
állandója.
Kémiai szintézissel készült a lovastatinnál gyengébb hatású fluvastatin,
amely p-fluoro-benzoesavval szubsztituált N-izpropil-indolhoz
kapcsolódó |.o-dihidroxiheptánsav. Koleszterinszintet csökkentő hatása a
lovastatinnál gyengébb (kb 50 %).
A lovastatin kúra az esti étkezéshez kapcsolva 10-20 mg-os
adaggal kezdhető, ami felemelhető 80 mg/nap dózisig. Közismert, hogy a
koleszterin szintézis fokozott az éjszakai órákban. Lovastatin hatásaként
ilyenkor 25-45 %-os csökkentés várható. Tovább csökkenthető 20-25 %-
kal az LDL koleszterinszint epesavkötő bázikus gyanták például trimetil
benzilammónium csoportot hordozó stirén-divinil-benzol (cholestyramin)
kopolimer, vagy dietiléntriamin és klór-2,3-epoxi-propánból készült
vizoldékony kopolimer (colestipol) fogyasztásával.


121



De 15-20 % csökkentő hatás remélheő a nikotinsav (niacin)
használatától. kedvező esetben mindent összevetve a genetikailag
szabályozott LDL koleszterinszint 70 %-os csökkenése érhető el az
élettani probléma három irányból történő megközelítéséval
A mevalonsav oxidoreduktázt gátló "-vastatin" vegyületek
bioszintézise a zsírsavszintézis feladatára kialakult enzimkomplexhez
hasonló felületen történik. A savhordozó SH csoportban végződő
oldalláncához kötődve malonil-CoA építőelemekből a zsírsav
szintézisben résztvevő enzimek építik fel a sztearinsav méretű A
8,14,16
-
trienil-|.o÷dihidroxi-oktadecén-savat, amelynek telítetlen vége a templát
erre szolgáló felületén naftilin származékká záródik. A hatásos
biológiailag aktív termék a tioészter kötés hidrolízisével a szabad
|.o÷dihidroxi-sav illetve |-hidroxi-lakton alakban hagyja el az
enzimkomplexet. A bioszintézis befejező lépései a naftalin gyürűn
hidroxil csoport kialakítása, illetve metil csoport felvétele. A légköri
oxigén felhasználásával kiépített C
8
szénatomra helyezett hidroxil
csoportot a 2'-o-metil-butánsav

acilezi. Ez a sav ugyancsak a zsírsav-színtézisben megismert reakciólépések
felhasználásával készül acetil-CoA- és malonil-CoA építöelemekből.

Acetil-CoA pedig szénhidrátból, nevezetesen glükózból képződhet a glikolízis reakciólépéseit használva. Ez az
út azonban katabolikus represszió alatt áll. Ezért a képződés növelése céljából a fermentációs szakasz
megnyújtására törekedve további szénforrás adagolása szükséges. A katabolikus represszió kiiktatása céljából a
szabályozó pont kikerülése szükséges. Az egyik lehetőség glükóz helyett glicerint illetve növényi olajat
használni szénforrásként.


122

GRIZEOFULVIN

Széles körben használt, sejtfalalkotórészként kitint tartalmazó fonalas gombák növekedését gátló hatóanyag..
Először Oxford és munkatársai izolálták 1939-ben a Penicillium griseofulvum ferment levéből. Néhány év múlv,
1946-ban Brian és munkatársai újból felfedezték Penicillium janczewskii tenyészetében. Kémiai szerkezetét csak
1952-ben ismerteti Grove. [7-klór-4,6,2’-trimetoxi-6’-metil-2’-grizén-3,4’-dion]
Penicillium patulum,illetve P. griseofulvum jóllevegőztetett tenyészetében literenként 10-12 g hatásos termék
képződik.. Egy molekula acetil-CoA és 6 mol malonil-CoA kondenzációjával képződő poliketid a zsírsav
szintézishez hasonló tiotempláthoz kötődik. Itt folyik vizkilépéssel az aromatizáció, a grzeofenon C képződés.
Az aromás gyürű klórozását peroxidativ mechanizmus segíti, amihez a hidrogénperoxidot a glükózoxidáz
szolgáltatja. Az oxigénfunkciók metilezése S-adenozilmetioninon segítségével történik. Az aromatizáció és a
klórozás után különleges átmeneti gyök képződés segíti a két aromás gyürű kapcsolódását, a dehidrogrizeofulvin
képződését. Az utolsó redukciós lépés aktíválja a molekulát grizeofulvinná. A tenyészetben melléktermékként
megjelenik a 6-metilszalicil sav.
123



124
Megállapították, hogy a grizeofulvin a gombafonalak rendellenes fodrozódását okozza. Biológiai
aktivitásának mérésére gyenge vízoldhatósága miatt agardiffúziós módszer nem használható. A fermentlé
griseofulvin tartalmát jellegzetes UV spektruma alapján mérik (UV maximum:324, 291, 252, 236 nm-nél
Erősen kötődik a gomba ribonukleinsav frakciójához, de 4 °C-on a riboszómákhoz.. A komplexet melegítve a
grizeofulvin felszabadulása észlelhető. Növekedő tenyészethez adott grizeofulvin leállítja a nukleinsav szintézist
és a fehérje szintézist. A mitótikus sejtosztódáskor az orsó kialakulását zavarja. A hatás koncentrációtól függő:
10
–5
mol esetén a mikrotubulusok még normális szerkezetűek, de 5x10
–5
mol koncentrációnál már
dezorganizálódnak.
A grizeofulvin gyógyászati felhasználása Gentles 1958-ban közölt észlelésével kezdődött: nevezetesen
a tápcsatornába került hatásos anyag az epidermiszben feldúsul. A felszívódást elősegítendő a hatóanyag
különleges eljárással előállított mikrokristályos formában kerül a tablettába. Adagolás után 4-6 órával a stratum
corneumban jól mérhető a felszívódása.. A dermatofitonok jelentősebb képviselőinek a növekedését 0.1-0.2
ug/ml koncentrációban gátolja. A terápiás hatás
céljából viszonylag hosszú időn keresztül kell a
gátló koncentrációt fenntartani. Egy egyszerű
bőrgombás fertőzés visszaszorítása céljából
legalább három héten keresztül napi 500 mg
hatóanyag bevitelét javasolják. A lábujjköröm
gombás fertőzésének felszámolása 12 hónapig tartó
kezelést igényel. Májkárosító hatása miatt
alkalmazása csak az esetben javasolható, ha nincs
más mód a fertőzés felszámolására. Az emberi
szervezet enzimrendszere a grizeofulvint egy
csökkent hatású 6-demetil-cszármazékká alakítja,
majd vízben jobban oldódó glükuronid
származékként választja ki a vesén keresztül.



POLIÉTERKARBONSAV SZERKEZETŰ ANTIBIOTIKUMOK

Ezek a Gram-pozitiv mikroorganizmusok ellen hatásos vegyületek kokcidiosztatikus hatásukkal tünnek ki.
Toxicitásuk miatt a humán terápiában nem kerültek alkalmazásra, viszont annál inkább jelentős a szerepük az
állattenyésztésben. Acsoport elsőként leírt képviselőjét, a nigericint Herned és munkatársai izolálták 1951-ben. A
csoport másik népszerű tagját monensin néven a Streptomyces cinnamonensis ferment-levéből izolálták
Amint az ábra mutatja a hatásos
termék kémiailag egy poliketidből
redukálódó polihidroxi-
monokarbonsav, amelyben a
hidroxilcsoportok belső éterek
képzésével alakítják ki a
vegyületcsoportot jellemző poliéter
gyűrűk kialakításában. A monension
és a rokon szerkezetű salinomycin
valójában vízben alig oldódnak.
A fermentlé általában több poliéter
homológot tartalmaz. A változatok elsősorban a C gyürű melletti alkil-lánc méretében különböznek. Valójában a
molekula kristályos formában gyűrűs szerkezetű. A terminális tetrahidropirán gyűrűn levő tercier hidroxil
csoport hidrogén kötéssel kapcsolódik a karbonsav csoporthoz. Az így kialakuló gyűrű külső fele hidrofób, a
belső rész viszont hidrofil az ott elhelyezkedő oxigén atomok jelenléte miatt.
Az antibiotikus hatást viszont éppen ez a szerkezet biztosítja azáltal, hogy a lipofil membránba egy
hidrofil alagutat alkotva növeli a membrán átjárhatóságát mindkét irányban. Nem csak a fémionok (Na
+
, K
+
), de
a proton számára is szabad utat bitztosít azáltal, hogy az ionokkal lipidoldékony komplexet alkot. Ez a kétirányú
működés nem ad lehetőséget az ionáramlás mértékének elektromos mérési adatokkal való jellemzésére.


125
POLIÉN FUNGISZTATIKUMOK

A szakirodalom több mint kilencven hatásos antibiotikumot tart számon ebben a csoportban. Gyógyászati
alkalmazásra azonban közülük csak néhány került. Kémiai szerkezetükben megegyeznek. Konjugált
kettőskötéseket tartalmazó nagytagszámú (26-38 szénatom) makrolid laktongyűrűhöz egy aminocukor
kapcsolódik. Ez a szerkezet a jellemző infravörös spektruma és karakterisztikus UV spektruma (200-400 nm)
alapján könnyen felismerhető. A konjugált kötések miatt viszonylag merev molekula poláros oldalát a nagy
számban található hidroxilok alkotják. Az aminocukor, a mikozamin (3-amino-3,6-didezoxi-D-mannopiranóz)
glikozid kötéssel kapcsolódik az aglükon poláros és apoláros részének határán levő hidroxilhoz.
Az antibiotikum kémiai szerkezetéből következik a gyenge vízoldékonysága, a fényérzékenysége és a
biológiai membránok szerkezetére kifejtett károsító hatása. A poliénnek a membrán szterin építőelemeivel való
kölcsönhatása lazítja fel a plazmalemma szerkezetét. A membrán polién érzékenysége a szterin és a foszfolipid
alkotórészek moláris arányától függ. A permeablitás megváltozása a sejt iontartalmának kiáramlását okozza,
amit az RNS szintézis és a fehérjeszintézis leállása követ. A permeábilitás változása két irányú. Bizonyos
gyógyszerek felvétele elősegíthető egyidejű polién adagolással.

Polién antibiotikumok gombaellenes hatása (MIC mg/ml) és toxicitása
Saccharomyces cerevisiae Candida albicans Aspergillus niger Fehér egér(LD50)

Amphotericin B 0,09-0,5 mg/ml 0,15-3,7mg/ml 0,09 mg/ml 8000 mg/kg
Nystatin 0,80-3,1 mg/m 1,20-3,1 mg/ml 2,00 mg/ml 8000 mg/kg
Candicidin 0,03 mg/ml 0,04 mg/ml 0,83 mg/ml 400 mg/kg
Primaricin(natamycin)0,9-15,0 mg/ml 3,00-6,0 mg/ml 1,8 mg/ml 1500 mg/kg
Flavofungin 3,0-20 mg/ml 4,00-5,0 mg/ml

31,0 mg/ml 250 mg/kg

A kedvező toxicitási adatokat az anyagok rossz felszívódása magyarázza. A táblázatban felsorolt
gombás fertőzések leküzdése céljából forgalomba hozott vegyülete6k éppen rossz felszívódásuk miatt a
szisztémás gombás fertőzések ellen gyakorlatilag használhatatlanok.
Hasen és Braun 1951-ben izolálta a nystatinnnak elnevezett fungisztatikus hatású anyagot egy
talajmintából származó Streptomyces noursey tenyészlevéből. Kémiai szerkezetét Chong és Richards közölte
1970-ben. A nystatin A összegképlete: C
47
H
75
O
17
N.
A kromofor egy konjugált tetraén és egy
különálló dién rendszert tartalmaz. A 38
tagú makrolídgyűrűn nyolc hidroxil és
két oxo csoport, valamint egy karboxil
csoport található. A fermentlében
található 10%-nyi B komponens egy
szénatommal és két hidrogénnel nagyobb
molekula. Kémiai szerkezetéből
következik gyenge vízoldhatósága, hő, fény és oxigén érzékenysége, valamint a sárga szine.
A bioszintézist bemutató vázlat szerint a makrolid
(nisztatinolid) gyűrű három propionát és 16 acetát
egységből épül fel.
A bioszintézis a zsírsavzintézis templátjához hasonló
enzimkomplex felültén folyik malonil-CoA
építőelemekből (lásd: Bioszintézis ábra) Az itt
képződő polién-lánc indító tagja általában valamilyen
acil-CoA (acetil-CoA, propionil-CoA, candicidin
esetében p-amino-benzoil-CoA). A Zsírsav szintézis és a polién szintézis közötti hasonlóságra mutat az a
tapasztalat, hogy mindkét bioszintézist gátolja a cörulamin [ 2(S),3(R)-epoxi-4oxo-7,10-dodekadienoil-amid ],
ez a 12 szénatomos szírsavamid azáltal, hogy a |-ketosavhordozó-fehérje szintetáz alegységé-hez kötődve
akadályozza a lánchosszabbító lépést katalizáló enzim működését.
A 38 tagú nisztatinolid gyűrű bioszintéziséhez egyetlen molekula képződésekor a |-ketoacil-szintetáz
18, a |-ketoacil reduktáz 17, a hidroxiacil dehidráz 7, a NADPH-függő A
2
-reduktáz pedig mindössze egyetlen
esetben lép működésbe. A bioszintézis befejező lépése minden esetben a laktonizáció, amely az elkészült
gyűrűnek a bioszintézist végző enzimkomplexről való leválását is jelenti.
Bioszintéziséhez intenzív szénhidrátanyagcsere és jó oxigénellátottság szükséges, nemcsak a molekula
építőelemeiként szereplő acetil-CoA képződése szempontjából, hanem az acetil-CoA karboxilezéséhez
szükséges 16 ATP, valamint a makrolid karbonilcso-portjainak redukciójához szükséges 18 NADPH biztosítása
céljából is.


126


127
A kromoforon található karboxil csoport az egyik propionátból származó metilcsoport utólagos
oxidációjának az eredménye. A karboxil közelében levő keto csoport nagy valószínűséggel egy belső
éterkötésben van elrejtve. Nystatin B esetében az indító építőegység az acetil-CoA helyett propionil-CoA.
A kész aglükon valószinüleg egy lipofil hordozó molekula segítségével jut el a plazmalemmához, ahol
megtörténik a mikozaminnal való kapcsolódás |-glikozid kötéssel.
A mikózamin bioszintézise a már eddig megismert makrolid antibiotikumok szénhidrát komponenseinek
képződéséhez hasonló módon folyik.
Glükóz-1-foszfátból kiindulva
timidintrifoszfáttal reagálva
pirofoszfát felszabadulása mel-
lett képződik a timidil-
difoszfoglükóz, amit egy NAD-
függő oxido2reduktáz egy víz
kilépése mellett TDP-4-oxo-6-
dezoxi-D-glükózzá oxidál. Ezt
a reakciólépést egy
enolizációval összekapcsolt
epimerizáció követi. A képződő
TDP-3-oxo-6-dezoxi-D-glükózt
egy piridoxál foszfátot
tartalmazó amináz TDP-3-
amino-3,6-didezoxi-D-glükózzá
alakítja. A befejező lépés egy
epimerizáció, ami a C
2
hidroxil
térállását érinti. A
képződött.TDP-3-amino-3,6-didezoxi-D-mannopira-nóz egy membránhoz kötött glikozilező enzim segítségével
reagál a makrolid gyűrű polién szakasza után következő első hidroxillal. Ez a reakció segíti a membránon való
áthaladást.
A gazdaságos nystatin fermentációs eljárások jól levegőztetett körülmények között folyamatos
glükózadagolással biztosítják az antibiotikum szintézishez szükséges optimális körülményeket. A képződő
termék a fermentlében alig oldódva kristályosan kiválik, elsősorban a termelő mikroorganizmus felületére.
Mennyisége a mikroorganizmus szárazsúlyának többszörösét teheti ki. A fermentáció befejeztével a fermentlé
szűrésével 70-80% hatóanyagot tartalmazó nyers termék különíthető el, amiből szárítás után kalcium-kloridos
metanollal oldható ki a nystatin.
A tenyészlé nystatin tartalmának meghatározására is a metanolban való oldhatóságát használják. A
centrifugált üledék metanolos szuszpenziójából nyert szűrlet hatóanyag tartalmát UV elnyelése alapján
spektrofotométerrel, vagy biológiailag - mérőtörzsként Candida albicans oltóanyagot használva - agardiffúziós
módszerrel határozzák meg.
A nystatin világszerte elterjedt népszerű fungisztatikum. A gyógyszerpiacon elfoglalt előkelő helyét az
magyarázza, hogy elsőként került forgalomba és azóta sem sikerült sokkal jobbat találni nála. Több évtizedes
alkalmazása ellenére rezisztencia csak szórványosan jelentkezett. A kisérleti eredmények több esetben a
membránban a foszfo-lipid:szterin arány megváltozását valoszínüsítik a rezisztencia okaként. Park és
munkatársai egy rezisztens élesztő törzs membránjában ergoszterin helyett 8,22-ergosztadién-3|-ol jelenlétét
igazolták.
Gyógyszerként egyrészt tablettában kerül forgalomba a bélben normál körülmények között is létező
gombák fokozott szaporodásának gátlása céljából, másrészt kenőcs formájában a bőrfelületen jelentkező
fertőzések leküzdésére használják.

Amphotericin B
Venezuelából származó talajmintából izolált Streptomyces nodosus tenyészlevéből Gold és munkatársai
izolálzák 1956-ban ezt a fungisztatikus hatású anyagot. A fermentlében található két rokonvegyület közül a B
komponens az aktívabb. Baktériumokra, virusokra, protozoákra hatástalan, gomba spektruma viszonylag széles.
Szisztémás gombás fertőzések leküzdésére is alkalmazzák mérsékelt eredménnyel.
Az amphotericin B, amint a neve is mutatja amfoter tulajdonságú, 50%-os izopropanolban oldva semleges
körülmények között stabil. Lúgos és savanyú körülmények között inaktíválódik. Metanolos oldata 363, 382, és
406 nm-nél nyeli el a fényt. Izoelektromos pontján vízben oldhatatalan. A bélcsatornából gyakorlatilag nem
szívódik fel. Szisztémás fertőzések leküzdésére intravénás adagoláskor dezoxikólsavas kolloid szuszpenzió
formájában alkalmazzák. Parenterális alkalmazása vesekárosító hatású. Kémiai szerkezetét Mechlinski és
Borowski ismertette 1970-ben. Összegképlete : C
47
H
75
O
17
N. A nystatin szerkezetétől való eltérés egy kettős

128
kötésben jelentkezik (heptaén). A C-13 és C-17
között kialakuló belső éterkötés fokozza a
molekula merevségét és vízoldhatatlanságát.

Poliének hatásmódja

A polién fungisztatikumok az eukarióta
citoplazma szterin építőelemeihez kötődve a
membrán áteresztőképességét növelve
akadályozzák a gomba növekedését. A sejt
beltartalmának kiáramlása egyszerűen, elektromos
vezetőképességmérővel is jól észlelhető. A
szterin-polién asszociátum képződése in vitro is
észlelhető. Koleszterint tartalmazó tápközegben a
polién hatástalan.

A fungisztatikum két funkciós csoportján
hajtottak végre kémiai átalakítást. A karboxil
csoport észteresítése nem befolyásolta a biológiai
aktivitást, a mikózamin aminocsoportjának
acilezése viszont inaktíválta a molekulát. A
metilészterből képzett hidroklorid vízben jól
oldódik, de ez nem befolyásolja a bélből való
felszívódását, mert az észter könnyen hidrolizál..

PRIMARICIN, NATAMYCIN

A Streptomyces natalensis által termelt fungisztatikus hatású anyagot Struyk és munkatársai izolálták 1957-ben.
Ugyanez évben Arcamone és munkatársai egy homológját nyerték ki Streptomyces lucensis tenyészlevéből.
1960-ban tetrin néven Gottlieb is leírta egy Streptomyces törzs termékeként.
Az antibiotikum aglükonja viszonylag kisebb az előbbiekkel összehasonlítva, mindössze 26 tagú, négy konjugált
kötést tartalmazó makrolid, amelyben tetraén szakasztól távol még egy telitetlen kötés fordul elő. Összegképlete:
C
33
H
47
O
13
N . Különlegessége az oxirán gyűrű.

A fényre és levegőre érzékeny anyagot kálium-nátrium klorofillin stabilizálja. Bioszintézise során 12
acetát és egy propionát egységből épül fel az aglükon a megfelelő malonil- illetve metilmalonil-CoA kiindulási
termékekből. A cukor komponens ez esetben is mikózamin.
Élesztők, szaprofita gombák és humán patogén gombák ellen hatásos. Különösen a Trichophyton
violaceum és Aspergillus fumigatus fertőzés leküzdésére használják. Intraperitoneálisan a hasüregbe juttatva
tízszer toxikusabb a nystatinnál, per os adva csak háromszor annyira toxikus. Szisztémás fertőzés esetén nem
használják. Dermatomikózisokon kívül, különösen Trichomonas vaginalis fertőzés kúrálására sikerrel
alkalmazható. Ennek megfelelően kenőcsökben, plietilénglikolt tartalmazó szuszpenziókban vagy hüvelybe
helyezhető készítmény formájában hozzák forgalomba. Sok előnyös kombinációban szerepel fontos
alkatrészként kortikoidokkal, vagy más szélesebb spektrumú antibiotikumokkal együtt.

CANDICIDIN

Az aromás csoportot tartalmazó poliént Lechavalier találta 1953-ban egy Streptomyces griseus tenyészlevében.
Később mások is leírták ezt az aromás heptaen makrolidot (Hosoya 1953, Umezawa 1954) trichomycon, illetve
hamycin néven. Antifungális gyógyszerként 1964 óta használják. Különösen hatásos a moniliázis leküzdésére.
Toxicitása miatt csak lokálisan alkalmazzák.

Amphotericin hatásmódjának vázlata

129
Az amphotericinhez hasonló szerkezetét megnyugtató módon ezideig még nem igazolták.
Összegképlete: C
63
H
85
O
19
N
2
. Metanolos oldata 364, 384 és 406 nm-nél nyeli el a fényt. A cukorkomponens itt is
mikózamin, az aromás alkotórész pedig p-amino-acetofenon. Bioszintézise p-aminobenzoesavval indul.

FLAVOFUNGIN

Tárgyalását elsősorban magyar vonatkozása indokolja. Uri és Békési találták a Streptomyces flavofungini
tenyészlevében l958-ban. Fényre és a levegő oxigénjére különösen érzékeny vegyület.


Kémiai szerkezetét Bognár és munkatársai deritették fel. A fermentlében található két komponens összetétele
egy metilén csoportban tér el. Összegképlete: C
66-67
H
58-60
O
10
. A hosszabb láncú homológ kb 10%-ban képződik.
A 31 tagú makrolid gyűrűben egy konjugált pentaén szakasztól függetlenül még egy telitetlen kötés található.
Különlegessége, hogy sok esetben — így az ábrán szereplő aglükon — nem tartalmaz mikarózt. Ez.esetben nem
csak a gombák szaporodását, de néhány megvizsgált baktérium, így a Bacillus subtilis és a Micrococcus
pyogenes növekedését is gátolja.



A Streptomyces törzsek által termelt, gombák
növekedését gátló 281,4 moltömegű C
15
H
23
NO
4

vegyületet először a sztreptomycint termelő
Streptomyces griseus fermentlevéből izolálták.
Később több törzs termékeként, eltérő néven
(cikloheximid, actidion, naramycin A) izolálták.ezt
az alkoholban jól oldódó ciklohexil származékot
{3–[2–(3,5--dimetil–2–oxociklohexil)–2–hidroxi-
etil]–glutárimid} . Actidiont termel a Squibb
kutatói által izolált nystatint termelő Streptomyces
noursey
Az eukarióták riboszómán folyó
fehérjeszintézisét gátló hatása miatt a
mikrobiológiai kutatómunka fontos szereplőjeként
ismert vegyület..(Obrig,T.G et al. J.Biol.Chem 246:174 (1971)



130
TERPÉNEK AZ EUKARIÓTA SZERVEZETEKBEN

Az eukarióta sejtek lipidfrakciójában fontos szerepet töltenek be a terpének, különböző szterin származékok,
mint a membrán rendszer nélkülözhetetlen alkatrészei. Nem meglepő, hogy szekunder metabolitként több
bilógiailag aktív termék került közülük a gyógyszerpiacra.

A szterin képződés vázlata
Acetil-CoA
Acetil-CoA Szintetáz
CoA-SH



Acetoacetil-CoA

Acetil-CoA GlutarilCoA szintetáz

CoA-SH

ß-hidroxi-ß-metil-glutaril-CoA
2 NADPH Reduktáz

2 NADP
+
+ CoA-SH

L-mevalonát
ATP Kináz

ADP

5-foszfo-mevalonát
ATP Kináz
ADP
5-pirofoszfo-mevalonát
CO
2
Dekarboxiláz
IzopentenilPP Izomeráz DimetilallilPP



Transzferáz


PP

Geranil foszfát
IzopentenilPP Transzferáz

PP

Farnezil-pirofoszfát
Farnezil-PP Preszkvalén-szintetáz


PP

Preszkvalén-pirofoszfát
NADPH Szkvalén szintetáz
NADP
+
+ PP
Szkvalén
(NADPH) O
2
Monooxigenáz
H
2
O
Szkvalén-2,3-epoxid
Cikláz

Lanoszterol
131


FUMAGILLIN


Ezt a vegyületet1951-ben izolálták Eble és Hanson
Aspergillus fumigatus fermentlevéből.

A savanyú karakterű telitetlen vegyület szerkezetét
csak 1960-ban közölték Tarbell és munkatársai.
A molekula egy terpenoid mag dekatetraén-
dikarbonsav észtere. Az etilacetátban jól oldódó,
fényérzékeny, mérgező anyag; –18 °C-on bomlás
nélkül tárolható. Kémiailag {3R-[3o,4o(2R
o
,3R
o
)
7
-
5|,6|(a11-E)]}-mono (-5-metoxi-4-[2-metil-3-(3-
metil-2-butenil) oxiranil]-1-oxaspiro[2,5]oktán-6-il
2,4,6,8-deka-tetraéndion sav. N,N-diciklohexilamin
sója. Móltömege 639.88. A terpén mag három
mevalonsavból képződő farnezil-pirifoszfátból – a
szterin szintézis köztes termékéből – alakul ki
intramolekuláris átrendeződéssel több oxidációs
lépésben. Az utolsó lépsben a dikarbonsav
kapcsolódik észterkötéssel a terpén szabad
hidroxiljához

A vegyület erős amöbicid hatásáról ismert. Az
Entamoeba hystolytica elpusztítására már 0,01
ug/ml koncdentrációban is hatásos. Kevéssé
toxikus. LD
50
=

800 mg/kg subcutan (bőr alá)
adagolva. Krónikus amőbiázis esetén per os
adagolva naponta kétszer 10 mg a hatásos adag.

Méhészek a méh-nozéma kezelése céljából a kaptár
elé tett cukor sziruphoz keverik.


132
FUSIDINSAV

Godfredsen izolálta 1960-ban egy Fusidium coccineum gomba fermentlevéből. Már az első közlemények
kiemelték a Gram pozitív rezisztens mikroszervezetek elleni hatásosságát és kedvező toxicitási adatait. A
Staphylococcus elleni küzdelem fontos
antibiotikumként tartja számon
Kémiailag négy gyűrűs triterpénsav. A
szteroid váz B gyűrűje kád formáju, a
gyűrűk pedig transz-cisz-transz
kapcsolódást mutatnak. Az oldallánc
telítetlensége a molekula merevségét
okozza.l

Kémiai szerkezete a 2,3-
oxidoszkvalénből induló szteroid
bioszintézis korai fázisát rögzít,
amennyiben a gyűrűzárási reakció után
csak egy metil csoport eltávolítása
történik meg. A 21 metil oxidációját a
17,20 kettőskötés stabilizáló szerepe
miatt nem követi dekarboxilezés. A
bioszintézis a 11 és 16 helyzetben
hidroxilezéssel, majd ez utóbbi csoport
acetilezésével fejeződik be.

Szteroid antibiotikumot már ez előtt is
találtak. Chain 1943-ban írja le az
Aspergillus fumigatus fer,mentlevéből
izolálható helvolinsav antibakteriális
hatását. Burton és Abraham 1951-ben a
Cephalosporium acremonium
tenyészetében előforduló szteroid
antibiotikumot írja le cephalospori-P
1

néven. Ezek a fehérjeszintézist gátló
vegyületek az oxigénfunkció helyében,
illetve a telitetlenség mértékében
különböznek a fusidinsav szerkezetétől.
A fusidinsav in vivo és in vitro a riboszóma–EF–G–GDP komplex disszociációját akadályozva zavarja a
fehérjeszintézis transzlokációs lépését. A biológiai hatás szempontjából esszenciális az o.|-telitetlen karboxil
csoport és a C-16 helyzetben levő |-helyzetű acetoxi csoport. A molekula a vegyészek számára hálás model volt.
A szteroid kémiából jól ismert módszereket alkalmazva több száz fusidinsav származékot állítottak elő. Kémiai
labilitásuk miatt csak elméleti érdekességűek voltak. A kémiailag előállított |-16 acetiltio fusidinsav a
természetes fusidinsav antibiotikus hatását jelentősen meghaladja.
A fusidinsavval szemben kialakuló rezisztencia egyik módja az elongációs faktor szerkezetének megváltozása.
Ez esetben az antibiotikum nem kötődik a fehérje szintetizáló rendszerhez. Több közlés említi. hogy a
Staphylococcus plazmid nem inaktíválja a molekulát, hanem hatására az antibiotikum kizáródik a
baktériumsejtből.


A fusidinsav kémiai szerkezete
133
GIBERELLINSAV KÉPZŐDÉS

Az egyik hatásos terpén származék a Giberella fujikuroi (imperfekt alakja Fusarium moniliforme) által termelt
növényi hormon, a giberellin sav, amely ugyancsak a szterin szintézis fő vonalából ágazik ki de végeredményben
terpén származéknak tekinthetők a Claviceps nemzetség által előállított anyarozs alkaloidok




Claviceps purpurea alkaloida termelése

134

135
RÁKOS MEGBETEGEDÉSEK ELLEN HATÁSOS ANTIBIOTIKUMOK CSOPORTJA

A rák elleni küzdelemben a kemoterápia meglehetősen későn jelent meg a küzdőtéren.. 1954-ben az
amerikai rákterápiával foglalkozó intézet (National Cancer Institute) kezdeményezésére széleskörű, költséget és
fáradtságot nem kímélő program indult. Kutató csoportok, egyetemi intézetek, ipari kutatóhelyek kapcsolódtak a
munkába. Hamarosan nemzetközivé fejlődött a rák elleni küzdelem. Vegyületek tízezreit próbálták ki először
állati tumorok ellen, majd siker esetén szigorú toxicitási vizsgálatok után embergyógyászati alkalmazásukat is
megkisérelték. A program keretében nem csak jól ismert, illetve kémiai szintézissel nyert vegyületeket próbáltak
ki, de a legkülönfélébb forrásból származó természetes eredetű anyagok tumorgátló hatását is megvizsgálták. Így
a növényi kivonatok mellett a mikrobiológiai eredetű anyagok, köztük az antibiotikumok is sorra kerültek. Az
aktinomycinek és a bleomycinek részletes tárgyalására a depsi-peptid jellegű termékek között sor került.

A kiválasztott vegyületcsoportok kémiai szerkezete egymástól jelentősen eltér. Közös jellemzőjük a kémiai
szerkezetükből következő élénk vörös színük és az erősen citotoxikus tulajdonságuk. Terápiás indexük alacsony.
Mindegyikük valami módon a DNS molekulával lép kölcsönhatásba. A rákterápiában felhasznált vegyületek
közös hibája, hogy a hormonanalógok kivételével nincs szelektív hatásuk. Emiatt a rákellenes küzdelemben nem
kerültek az orvosi praktikum élvonalába. Ma is a felismert tumor sebészi eltávolítása és a sugárterápia amit
136
széleskörűen alkalmaznak.. A kemoteerápia csak ezzel párhuzamosan, utókezelésként, inoperábilis esetben,
metasztázis jelentkezésekor jut szerephez. A rákellenes antibiotikumok alkalmazása sok esetben a daganat
átmeneti visszafejlődését eredményezve, a tünetek enyhülését, mindenképen az élet megnyújtását jelenti.
Citotoxikus hatá suk elsősorban a gyorsan növekedő és osztódó ráksejteket pusztítja, de jelentős mértékben
károsítják a szervezet immunrendszerét is.
Ezek a vegyületek azokat az egészséges szöveteket is károsítják, amelyekbn a fehérjeszintézis, illetve a
sejtosztódás funkcionális okokból fokozott mértékű. Így a vérképző szervek, a nemi szervek, a hajhagyma, a
bélnyálkahártya sejtjei károsodnak leginkább ezen vegyületek alkalmazásakor.
A chromomycinek csoportjába sorolt mithramycint a Streptomycesargillaceus és a Streptomyces
tanashiensis tenyészlevéből mutatták ki Rao és munkatársaio 1962-ben. A klinikumban 1970 óta használják. Ide
sorolható a Gause által S olivorecticuli tenyészetéből 1962 ben izolált olivomycin.. Szerkezetüket 1968-ban
Bakhaeva közölte. A két antibiotikum az aglükon réstben is különbözik egymástól. Amennyiben az olivin
metilezett homológjának tekinthatő a mithramycin aglükonja a chromomycin. A cukorkomponernsben
olivomikoz helyett D mikarózt találunk.
A mithramycin a DNS-el alakít komplexet. Magnézium jel0enlétében a guanin bázishoz kötődik. A
cukor rész is résztvesz a kapcsolat erősítésében. A cukor komponens méretének a csökkentése növeli a
disszociáció lehetőségét és ezzel gyengül a biológiai hatása. A DNS vírus irányított RNS szintézist akadályozza.
Különösen gátolja az uracil beépülését a kismolekulájú RNS-be (5sRNS). Hatással van a DNS replikációra, azaz
gátolja a vírus szaporodásdát, de nem befolyásolja az RNS vírus szaporodását és nem zavarjaa reverz
transzkriptáz működését.
A poliketid vázból kialakuló rákellenes antibiotikumok közül az antraciklin tipusú kromomicinek
gyógyászati alkalmazása világszerte ismert. Az 1974-től klinikai kipróbálásra került daunomycint (daunorubicin)
Di Marco 1963-ban izolálta Streptomyces peuceuticus tenyészlevéből. A daunorubicin kémiai szerkezetének
felderítését Arcamone és munkatársai 1968-ban közölték. Az antibiotikum savas hidrolízisével a vörös színű
vízben oldhatatlan aglikonhoz (daunomycinon) jutottak. amelyhez a vízoldható cukorkomponens, a daunózamin
— 2,3,6-tridezoxi-3-amino-L-lixohexóz — kapcsolódik glikozidos kötéssel. Az aglikon illetve a
cukorkomponens kémiai módosítása gyengíti a biológiai hatást. Ugyancsak ők izolálták 1969-ben a daunomicin
14
C hidroxi származékát, az adriamicint az előbbi törzs caesius nevű variánsának fermentlevéből. A két vegyület
közötti különbség mndössze egy hidroxi csoport, mégis a hatás szempiontjábol ez nem elhanyagolható.
A daunomycin fő indikációs területe a
"fehérvérűség". Különösen a gyermekekben kifejlődő limfoid
leukémia esetén,de a Hodkin-kór, a lymphosarcoma és a
retikuléris rendszer szarkomás eseteiben is alkalmazzák. A
szívre való toxikus hatása miatt más citosztatikumokkal
kombinálva használják. A kevésbé toxikus hidroxilezett
származék a doxorubicin az acut leukémia gyógyításán kívül
az Ewing szarkoma, a neublastoma, a Wilms tumor és
osteogén szarkomák esetében is hatásosnak bizonyult, sőt
mell- és tüdőrák esetében is eredményesen használják.
Gyógyszerként a vörös, kristályos hatóanyag, jól
felszívódó vízoldható hidrokloridját általában infúzióban
adagolják. Könnyen jut át a sejthártyán és a sejtmagban
feldúsulva fejti ki hatását. Terápiás indexe alacsony.
Mellékhatásként nem csak a szívizomra hatva, alacsony
vérnyomást , digitálisszal nem enyhíthető szívelégtelenséget, aritmiát, tachicardiát okoz, de a csontvelőt is
károsítja.
Az antraciklinek a DNS bázisok közé ékelődnek, miközben a cukorkomponens aminocsoportja ionosan
kapcsolódik a dezoxiribózfoszfátlánchoz. A DNS-hez való kötődése olyan erős, hogy in vitro a DNS bontó
enzimek hatását is akadályozza. A 60-100 nukleotidonként kötődő egy-egy daunorubicin molekula in vitro az
RNS polimeráz működését is akadályozza. Különösen erősen gátolja in vivo a riboszómális RNS szintézisét.
Természetesen nem csak a DNS-függő RNS szintézist, de a DNS replikációt is akadályozza.
A mitramicint a Streptomyces argillaceus és a S. tanashiensis tenyészlevéből mutatták ki Rao és
munkatársai 1962-ben. A klinikumban 1970 óta használják a malignus hypercalcaemia kezelésére. A
gyógyszerként felhasználásra kerülő sárga kristályos hatóanyag mannittal és nátriumfoszfáttal pufferolva
infúziós formában kerül felhasználásra. Terápiás indexe igen alacsony. Mellékhatásként a kialakuló
hypocalcaemia a véralvadás kalcium igényét érinti, de kárositja a vese, a máj és a vörös csontvelő működését
A mitramicin a DNS-val alkot komplexet. Kétértékű kationok, előnyösen magnézium jelenlété-ben a guanin
bázishoz kötődik. Általában négy bázispáronként kötődik egy antibiotikum. A kapcsolat stabilizálásában a
cukorkomponens is résztvesz. A cukorkomponens méretének csökkenése gyengíti a biológiai hatást. A DNS
virus irányította RNS szintézisrt erősen gátolja, de hatással van a DNS szintézisre is, gátolja a DNSvirus

137
szaporodását. Kifejezetten gátolja az uracil beépülését a kismolekulájú RNS-be (5sRNS). Nem befolyásolja
viszont az RNS virusok fejlődését, nem zavarja a reverztranszkriptáz működését.
A mitramycin fémionokkal (Fe
++
) oldhatatlan chelátot képez. Savas közegben pH=4 alatt a cukorkomponens
könnyen hidrolizál az aglükonról, amely inaktív.
Ugyanekkor 1962-ben izolálta Gause a S. olivorecticuli által termelt olivomicint, amelynek aglikonja a
mitramicin demetilezett változata. A cukorkomponens is eltérő, mert a mitramicin olivomikóz helyett D-
mikarózt tartalmaz.
A citosztatikus mitozánok legismertebb képviselőjét a mitomycint Streptomyces caespitosus
fermentlevéből Hata és munkatársai izlálták 1956-ban. A kereskedelmi forgalomba került mitomycin-C 1965-óta
Japánban 1974-től pedig az USA-ban is engedályezett rákellenes gyógyszer. Alkoholban jól, vízben gyengén
oldódó vörös kristályos anyag. Intravénás injekció formájában használják. Különösen a gyomor, bél, végbél és
hasnyálmirigy adenokarcinoma kezelésére használják. Toxikus mellékhatása a csontvelő működését és az
immunrendszert károsítja, bőrkiütést, gyakran az emésztőrendszer zavarát okozza A hatóanyag az aziridin
szerkezetű színes mitozánok csoprtjába tartozik. Gátolja a DNS függő RNS polimeráz működését. Citosztatikus
hatása valószinüleg a DNS-val való kovalens kötéssel kialakított kölcsönhatás eredménye.

A hatóanyag kinoidális szerkezetének az átrendeződése a sejt redukáló belső körülményei között egy
szemikinon szerkezeten keresztül történik egy metanol felszabadulása közben. A reakciótermékben, (egy
szubsztituált indolszármazék) a C
10
metilénkarbamát aktivált állapotba kerül, amely lehetőséget ad egy aktív
karbonium ion képződésére, azaz a DNS-val való kovalens kötés kialakítására. Ezt az elképzelést megerősíti,
hogy a metoxi csoport hidrogénre cserélése inaktiválja a molekulát. Az amino csoport eltávolítása is csökkenti a
hatást








138
AZ ANTIBIOTIKUM KÉPZŐDÉS LEHETŐSÉGE ÉS FELTÉTELEI

Az antibiotikumokat a szakirodalom az un. szekunder metabolizmus termékeinek tekinti. Bu'Lock, a
termékek névadója, a szekunder metabolitokat az öregedő tenyészet által termelt anyagoknak tekintette. Amíg a
primer metabolitok az élő sejt működéséhez szükséges kis molekulák, vagy életfontosságú makromolekulák
építőkövei, esetleg enzimek faktorai, addig a szekunder metabolitok termelésének célja ismeretlen. Elvileg más
szervezetek ellen felhasználható anyagcsereterméknek is tekinthetjük. A természetre jellemző gazdaságosságra
törekvés, és a létért való küzdelem körülményei között feltételezhetjük, hogy maga a történés - adott
körülmények között - ezen anyagok termelése esszenciális az őket termelő szervezetek számára.
Kémiailag különféle vegyületek sorolhatók ide, sok esetben egy-egy primer metabolit karikatúrájának
tekinthetők. Éppen az antimetabolitok (az izoszterikus enzimgátlók) képződése mossa el az éles határt a primer
és szekunder metabolitok között. Milyen alapon tekintsünk például szekunder metabolitnak egy nukleotid
analógot, amely egy-egy anyagcsere zavar eredményeként jelenik meg a normál metabolitok között: Ennek a
hibás metabolitnak a biotranszformációjával és a környezetbe való kiválasztásával a termelő mikroorganizmus
az esetleg végzetes genetikai hiba következményét fiziológiai úton számolja fel.
Ezeknek a vegyületeknek a képződése általában a növekedési fázis (trofo-fázis) végén indul meg és a
stacioner fázis (idio-fázis) első szakaszára terjed, amikor a ·sejtosztódás sebességének a csökkenése, sok esetben
a spóraképzés megindulása, ill. az erre való előkészület az intermedier anyagcsere addig jól szabályozott
rendszerében némi zavart okozhat. Egyes spontán mutánsokban, illetve életképes variánsokban az átprogramozás
okozta zavar — bizonyos enzimreakciók leállása — egy egy intermedier felhalmozódását okozhatja, sőt addig
nem képződött vegyületek megjelenését is eredményezheti. Az éppen jelenlevő intermedierek a még működni
képes enzimek hatására új vegyületekké alakulva kerülhetnek a környezetbe, oldott, vagy kristályos formában. A
törzsfejlődés folyamán, a szelekciós nyomás hatására általában azok a variánsok maradnak fenn, amelyek a
leggazdaságosabban oldják meg az adott körülmények között fellépő élettani zavar problémáit.
A szekunder metabolitok fiziológiai hatásossága nem szükségszerű, de ismerve az élővilág egységes
felépítési elveit nem is meglepő. Nem véletlen, hogy ezek a primer metabolitoktól kisebb-nagyobb mértékben
különböző vegyületek egy másik szervezet anyagcsere rendszerében zavart okoznak. Csupán módszertani oka
van annak, hogy látszólag nagyszámú biológiailag aktív szekunder metabolitot ismerünk. Ezek ugyanis éppen a
feltűnő, könnyen mérhető antibiotikus aktivitásukkal irányítják magukra a kutatók figyelmét.
Sok vitára adott okot a szekunder metabolitok, ezen belül is az antibiotikumok biológiai jelentősége.
Roberts Pratt 1949-ben megjelent könyvében mottóként Pasteurt idézve ―life destroys life" az antibiotikumot a
létért való küzdelem hatásos fegyvereként említette. Herbert Golberger 10 évvel később már azt kérdezi, vajon
okozhat-e az antibiotikum valamilyen biológiai szabályozást a környezetében. Ezzel kapcsolatban
megjegyzendő, hogy az antibiotikum termelés általában a növekedés késői szakaszában figyelhető meg, akkor
amikor a kedvezőtlen környezeti körülményeket legyőzve már jól fejlett kolóniákat hozott létre a termelő
mikroorganizmus.
Mások az anyagcsere szabályozásban vélik meglelni az antibiotikumok élettani szerepét. Ez esetben
nem érthető, hogy miért választják ki nagy mennyiségben a környezetbe azt a jelentős anyag- és energia-
befektetéssel létrehozott vegyületet, amelynek a szabályozásban való szerepét kevés számú molekula is
megoldja. Ezt az ellentmondást feloldhatjuk, ha feltételezzük, hogy ilyen és hasonló szabályozó vegyületeket
minden mikroorganizmus termel, de mi csak az esetben vesszük észre jelenlétüket, ha valamilyen regulációs
hiba folytán nagy mennyiségben képződnek és ezt a környezetbe kiválasztják.
Egyesek szerint ezeknek az anyagoknak a törzsfejlődés bizonyos szakaszában szabályozó szerepük
volt, és ma csupán valami régmúlt idő élő kövületeként képződnek.
Az antibiotikum képződése egy izgalmas élettani kérdést vet fel. Hogyan védi magát az antibiotikumot
termelő mikroszervezet a saját metabolitjának toxikus hatása ellen. Nem kielégítő az a magyarázat, hogy az
antibiotikum termelés a növekedési fázis befejeződése után, az un. Idio-fázisban, azaz egy csökkent
érzékenységű életszakaszban indul meg. Ezek a vegyületek ugyanis a növekedési fázisban is képződhetnek, sőt
több esetben sikerült előállítani szekunder metabolitokat folytonosan növekedő tenyészetben (kemosztátban) is.
Más esetben szoros kapcsolatot találtak a szekunder metabolit képződése és a tenyészet növekedése között.
Ezekben az esetekben az antibiotikumot termelő mikroorganizmusnak szükségképpen rendelkeznie kell olyan
mechanizmussal, olyan lehetőséggel, ami megvédi a saját antimetabolitjával szemben. A törzsnemesítő munka
tapasztalatai bizonyítják, hogy az antibiotikum termelés szintjének jelentősebb növelése csak az esetben
lehetséges, ha a transzkripció és a transzláció az antibiotikum termelés ideje alatt is zavartalanul folyhat.
Hosszú idő óta keresik az antibiotikum termelés fokozásában érdekelt kutatók azt a szabályozó
mechanizmust, amely a képződő antibiotikum szintet meghatározza. A befektetett. munka és az elért csekély
eredmény aránytalansága logikailag érthető. Mi ugyanis csak akkor vesszük észre ezen vegyületek képződését,
amikor bioszintézisüket a túltermelés jellemzi. Azaz, ha volt is valami szabályozó mechanizmus, az éppen a
túltermelés érdekében nem működik. Nem tekinthetjük szabályozásnak azt az esetet, amikor a képződött anyag
mennyisége a termelő mikroorganizmus számára toxikus koncentrációt érve el a metabolizmus leállításával
139
együtt a szekunder metabolitnak tekinthető antibiotikum termelését is leállítja. A törzsnemesítő munka során
éppen ezt az érzékenységet csökkentve, azaz a rezisztenciát fokozva igyekeznek több-kevesebb sikerrel
magasabb antibiotikum szintet elérő variánsokat előállítani. Az antibiotikum termelés szabályozásáról lehetetlen
valami egységes képet adni, mert genetikailag eltérő, rendszertanilag távolálló fajok azonos antibiotikumot
szintetizálnak, ugyanakkor azonos fajba tartozó törzsek által termelt antibiotikumok kémiai szerkezete
nagymértékben eltérhet egymástól.

Különböző antibiotikumokat termelő mikroorganizmusok rendszertani csoportjai
Antibiotikum Gombák Streptomyces Micromonospora Nocardia Baktériumok
Aminoglikozidok +++ +++ ++ +
Anthraciklink +++ ++
Ansa-láncuak +++ ++ +++
Bleomycinek +++ ++
Chloramphenicol +++ ++ +++
Cycloserin +++ ++
|-laktám típusúak +++ ++ +
Makrolidok +++ ++ ++ +
Tetraciklinek +++
Poliének +++ ++ ++.
Fungisztatikumok +++


A |-laktám típusú antibiotikumokat például Penicillium, Streptomyces, Cephalosporium, Dermatophyta,
Aspergillus és Nocardia fajok termelik: Ezek a rendszertanilag távol álló fajok megegyeznek abban, hogy az
intermedier-anyagcseréjükben a lizin szintézise vagy lebontása o-aminoadipinsavon keresztül vezet.
Az általános megállapítások a törzsnemesítéssel foglalkozók számára kevés támpontot nyújtanak.
Minden antibiotikum típus túltermelési körülményeit külön-külön kell kialakítani. Sok esetben az egyes termelő
törzsek .között is olyan nagy a variáció, hogy az optimálisnak mutatkozó technológia törzsenként is
nagymértékben eltérhet. Sok esetben a gyakorlati adatok alapján kialakított eljárás elméleti alapjait sem sikerül
felderíteni. A szekunder metabolit termelés szabályozásával foglalkozó összefoglalók ezért inkább vezérelveket
tárgyalnak. Kivételt képeznek azok az esetek, amikor az antibiotikum kémiai szerkezete még erősen hasonlít
valamely primer metabolithoz (pL. a chloramphenicol). Ez esetben az antibiotikum mennyisége a természetes
analóg klasszikusnak tekinthető szabályozó rendszerén keresztül befolyásolja képződésének sebességét. Egyre
inkább elfogadható az a nézet, hogy az antibiotikumok szintézisében a primer anyagcsere enzimei vesznek részt
és csak egy-egy kulcsenzim működése, egy kulcs intermedier túltermelése segíti elő az antibiotikum képződését.
Ez a kulcsenzim lehet plazmidhoz kötött. A kanamycint termelő S. kanamyceticus-ból a plazmid
törlésre használható flavin származék alkalmazásával reprodukálhatóan lehet olyan mutánst nyerni, amely nem
termel kanamycint. Ha e mutáns tenyészetéhez dezoxistreptamint (kulcsintermediert) adtak, akkor a kanamycin
szintézise megindult. A plazmid törlése a kulcs intermedier szintézisének a felfüggesztésével járt. Plazmidhoz
kötöttek az aminoglikozid antibiotikumok inaktiválásában szerepet játszó foszforilező, adenilező és acetilező
enzimek génjei, amelyek a termelő mikroorganizmus antibiotikum tűrését is képesek biztosítani.

Az antibiotikumok alkalmazásának egészségügyi következményei
A gyógyászatban vezető helyet foglalnak el a penicillin és származékai, a |-laktám típusú
antibiotikumok. Nem vitatható, hogy az ideális antibiotikummal szemben támasztott követelményeknek (legyen
széles spektrumú, kémiailag stabil és a gazdaszervezetre ne fejtsen ki káros hatást) az azetidinon csoportba
sorolt antibiotikumok és származékaik megfelelnek. Az új félszintetikus antibiotikumok — bár előállításuk
költségigényes — sok valamikor nagyjelentőségű antibintikumot szorítottak ki a gyógyszerpiacról. Ilyen a
chloramphenicol, foszfonomicin, fusidinsav, sőt egyes országokban az aminoglikozidok forgalma is megérzi
jelenlétüket.A tetraciklin csoport alig éri el a penicillin felhasználás 20 %-át. A makrolid és az aminoglikozid
típus még ennél is kisebb jelentőségű. A rifamicin csnoport a tuberkolózis elleni alkalmazhatósága miatt
nélkülözhetetlen. Mennyiségi szempontból elhanyagolható a rákellenes hatású anyagok termelése. A
chloramphenicol évi felhasználása ezer tonnás nagyságrendű. A szegényebb országok gyógyszer ellátásában
azonban ezek a viszonylag olcsó antibiotikumok (chloramphenicol, aminoglikozidok) még jelentős szerepet
töltenek be.
Az antibiotikumok eredményes alkalmazása megváltoztatta a népegészségügy helyzetét. Megváltoztatta
a társadalom életkori összetételét. Az elöregedést segíti. A halálozás okát feltüntető statisztikai adatok mutatják,
hogy a múlt században 90 év alatt a fertőző kórokozók helyett a szervi megbetegedés, a keringési rendellenesség,
a rák, a máj kórformái kerültek előtérbe. A gyermekhalandóság visszaszorulásával a genetikai okok miatt
gyengébb ellenálló képességgel rendelkezők is elérik az ivarérettséget. Végeredményben a születés szám
140
csökkenése és az életkörülmények javulása, a környezet szelektáló hatását kikapcsolva a populáció genetikai
állományának leromlását idézi elő
Az átlag popüláció halálőzásának oka (az első tíz ok 100000 lélekre számolva)
1900 1990
Influenza tüdőgyulladás
Tuberkulózis
Hashártyagyulladás
Szívbaj
Agyvérzés
Veseelégtelenség
Baleset
Rákos daganat
Gyermekhalandóság
Diftéria
200
192
150
142
102
82
70
52
50
30
Szívbaj
Rákos daganat
Agyvérzés
Baleset
Influenza, tüdőgyulladás
Diabetes
Máj cirrhozis
Öngyilkosság
Érelmeszesedés
Gyilkosság
310
199
80
50
30
28
25
18
16
11



AZ ANTIBIOTIKUMOK GYÓGYÁSZATI ÉS GYÓGYSZERIPARI JELENTŐSÉGE

Nehéz feladat ezen kérdésekre minden szempontból kielégítő feleletet adni. Nagyon változatos a kép, ha
országonként szemléljük ezeket a kérdéseket, mivel a vizsgált ország anyagi és gazdasági helyzete, ipari
potenciálja, a nagy nemzetközi jelentőségű gyógyszeripari vállalatokkal való kapcsolata torzítja a valós képet.
Szélsőségesen eltérő adatokat kapunk, ha például az USA antibiotikum felhasználását egy fejlődő ország
gyógyszerfelhasználásával hasonlítjuk össze. Ezt nemcsak az illető ország anyagi ereje, de a fóldrajzi fekvése,
civilizációs szintje és ezzel összefüggő terápiás problémái is döntő módon befolyásolja. Az USA-ban nem kell a
TBC ellen vagy a kolera leküzdése érdekében gyógyszerelni, ugyanakkor Egyiptomban vagy Dél-Amerikában ez
népbetegségnek tekinthető. Egészségügyi jelentésekből, közgazdasági értesítőkből, iparpolitikai tájékoztat6kból
összeállítható egy táblázat a fontosabb antibiotikum csoportokról.

Gyógyászati felhasználás Termelt mennyiség (tonna/év)
Antibiotikumok
|-laktám csoport

25-30000
Tetraciklin csoport 4-5000
Makrolidok 2-3000
Aminoglikozidok 2-4000
Rifampicin csoport 1000
Chloramphenicol 1000
Cikloszerin 200
Antifungális humán célra 100-200
Rákellenes antibiotikum néhány kg
Állattápkiegészítők 20000
Bacitracin 1000
Monensin 1-2000
Tylosin 1000
Virginiamycin 1-3000
Antifungális növényvédőszerek 30000

141
Mikroszervezetek által termelt FARMAKOLÓGIAILAG HATÁSOS ANYAGOK
Prokariota sejtfal képződését gátló
hatóanyagok
ß-laktám
antibiotikumok
Penicillinek
Kefalosporinok
Foszfonomicin
Cikloszerin
Prokariota membránt károsító
anyagok
(Glüko-peptid)
Depsipeptidek
Vankomicin
Bacitracin
Gramicidin
Polimyxin
Virginiamycin
Immunszupressziv Ciklosporin
Természetes hatóanyag Nisin
DNS-re ható antibiotikumok (Pefloxacin) Növöbiocin
Bleomycin
Actinomycin D
Gyomirtó enzim-gátlók (Glutamin szintetázgátló) Bialafos
Prokarióta fehérje szintézist gátló Klóramfenikol
Aminoglikozidok Streptomycin
Neomycin
Gentamicin
Sisomicin
Makrolidok Erithromycin
Ansa lámcuak Rifampicin
Poliketidből
képződők
Tetraciklinek Aureomycin,
Terramycin
Doxaciklin
Poliéterek Monensin
Fungicid Griseofulvin
Eukariota membránt károsítók Poliének Amphotericin
Natamycin
Eukariota fehérjeszintézist gátlók Cikloheximid
Eukariota szterin csökkentők Sztatinok Lovastatin




HOGYAN VALÓSUL MEG A TOXIKUS ANYAG TŰRÉSE AZ ANTIBIOTIKUM KÉPZŐDÉSEKOR?

A gombák által termelt |-laktám típusú antibiotikumok, a baktérium sejtfalban előforduló peptidoglükán
szintézisben szerepet játszó karboxipeptidáz (transzpeptidáz) működését gátolva, megakadályozzák a baktérium
sejtfal továbbépítését.
A Streptomyces törzsek által termelt — |-laktám típusba tartozó — cefémsav származékok zavarják
ugyan a Streptomyces sejtfalban megtalálható peptidoglükán szintézisét, ez a hatás azonban nem észlelhető, mert
a csekély mennyiségű antibiotikus hatású termék megjelenésekor a tenyészet növekedése már befejeződött
A polién makrolidok ugyancsak nem károsítják a termelő mikroszervezeteket. Ezek a vegyületek a
sejtmembránban helyet foglaló szteroidokkal lépnek kölcsönhatásba, ezáltal lazítják a membrán szerkezetét,
megváltoztatják permeábilitását, szétroncsolják azt. Ebből a megfigyelésből következik, hogy elsősorban olyan
organizmusok növekedését gátolják, amelyeknek membránja számottevő mennyiségben tartalmaz szteroineket.
Az eddig végzett biokémiai vizsgálatokkal a polién fungisztatikumokat termelő mikro-organizmusokban
szteroidok jelenlétét nem lehetett bizonyítani.
A riboszómán folyó fehérjeszintézist gátló antibiotikumokat termelő mikroorganizmusok esetében több
lehetőség kínálkozik a gátló hatás kivédésére. A peptid jellegű thiostreptont termelő S. azureus riboszómája
például nem köti az antibiotikumot. A thiostreptonra érzékeny sejtekben a riboszóma RNS alkotórésze felelős a
kötésért. A thiostreptont termelő törzsben sikerült kimutatni egy metilázt, amelyik S-adenozil-metionin
jelenlétében metilezi a 23S-rRNS-t, még a riboszóma fehérje alkotórészével való egyesülés előtt. Az így
kialakuló fehérjeszintézisre alkalmas riboszóma viszont nem köti a thiostreptont. Hasonló oka van az
erythromycint termelő S. erythreus antibiotikum türésének. A metilezett 23S-rRNS-t tartalmazó 50S
riboszómához nem kötődik a makrolid csoportba sorolt antibiotikum.
Bonyolultabb a helyzet a tetraciklin antibiotikumokat termelő törzsek esetében. Kétségtelen tény, hogy
az antibiotikumot termelő törzsek tetraciklin tűrése nagyobb, mint a nem termelő törzseké. Megbízhatóan
142
igazolták, hogy a tetraciklin a prokariota riboszóma 30S alegységéhez kötődve akadályozza meg az aminoacil-
tRNS kapcsolódását az aminosav kötő helyhez. Fiatal S. aureofaciens fehérjeszintézisét a tetraciklin képződés
megindulása előtt adott tetraciklin gátolja, de az idősebb tenyészetből izolált fehérjeszintetizáló rendszer is
gátolható tetraciklinnel. A fiatal és öreg tenyészet permeabilitásában fellelhető különbség olyan csekély, hogy fel
kell tételeznünk a kötőhely olyan jellegű változását, amit ez ideig in vitro nem sikerült kimutatni. Megjegyzendő,
hogy a tetraciklin bioszintézis utolsó lépéseként, a NADPH függő redukció aktíválja a környezetbe
kiválasztandó addig inaktív köztea terméket.
A chloramphenicol az 50S riboszómára kötődve gátolja a peptidil-transzferáz működését. Gondos
vizsgálatokkal sikerült kimutatni, hogy a termelő törzs riboszómája ugyanúgy köti az antibiotikumot, mint a nem
termelő variáns, illetve mint a más mikroorganizmusokból kinyert riboszóma. A vizsgálatok egy kiválasztó
mechanizmus működését valószínűsítik, ami a képződő antibiotikumot valami módon távol tartja a működő
riboszómáktól. Ez a kiválasztó mechanizmus nemcsak az antibiotikumot termelő törzs életben maradását
biztosítja, de egyben megvédi a chloramphenicolt az enzimes inaktiválástól. A S. venezuelae-ban ugyanis
kimutatható egy enzim, amely képes a chloramphenicolt acilezni (inaktiválni).
A streptomycin baktericid hatásának kivédése az őt termelő S.griseus-ban még ma is vizsgálandó
probléma, annak ellenére, hogy már több mint harminc évvel ezelőtt úgy igyekeztek jobban termelő törzset
nyerni, hogy fokozták a termelő törzs streptomycin türését. A részletes vizsgálatok kimutatták, hogy a növekedő
fázisban, az un. trofofázisban levő S.griseus igen érzékeny a tápközeghez adott streptomycinre, ugyanakkor az
antibiotikum termelő fázisban, az un. Idio-fázisban levő organizmus rezisztensnek mutatkozik. Kimutatható egy
ATP-dependens foszforilező enzim, ami képes inaktiválni a streptomycint. Feltételezhető, hogy a sejten belül a
streptomycin foszforilezett formában van és csak a tápközegbe történő kiválasztáskor hidrolizálja egy alkalikus
foszfatáz az inaktív vegyületet aktív antibiotikummá.
Az actinomycinek a DNS templáton a guanozin-citozin bázispárhoz kapcsolódva fejtik ki hatásukat,
megakadályozva az RNS-polimeráz müködését. Ezt a hatást az actinomycint termelő S. antibioticus-bó1 izolált
rendszerben in vitro is kimutatták. Találtak viszont ebben a mikroorganizmusban egy olyan fehérjét, amelyik
képes specifikusan megkötni az actinomycint, és ezzel a szabad antibiotikum sejten belüli koncentrációját
elviselhető szintre csökkenti. Ez a fehérje a trofo-fázisban alig kimutatható, az idio-fázisban viszont mennyisége
megnő. Más szerzők kimutatták, hogy az actinomycin képződés megindulásával a sejtfa1 permeabilitása
csökken.
Antibiotikumot termelő törzsek tehát bármikor képződhetnek, sőt ezek laboratóriumban való
felépítésének sincs elvi akadálya. Csupán a kulcs intermedier szintézisét biztosító enzim információját, valamint
a képződő antibiotikum tűrését biztosító információt kell egyetlen mikroorganizmusba juttatni. Ez természetes
körülmények között is bekövetkezhet plazmid felvételével. Az igaz, hogy két plazmid egyidejű átvitelének a
valószínűsége meglehetősen csekély, azonban számításba kell vennünk azt, hogy egy antibiotikum termelésért
felelős információ megjelenése még nem jelenti magát az antibiotikum képződését. Ez csak meghatározott
környezeti feltételek érvényesülése esetén valósul meg. Ily módon meg van annak a lehetősége, hogy valamikor
a kérdéses antibiotikum tűrését biztosító információt is felvegye az antibiotikum szintézisére képes
mikroorganizmus. Ezzel az így létrejött variáns életképessége fokozódott, a környezeti feltételekre vonatkozó
megkötöttségei pedig az antibiotikum termelés szempontjából előnyösen csökkentek.

143
Miért éppen a Streptomycesek termékei között találtak antibiotikumként hasznosítható metabolitokat?

Több mint száz éve ismerik sugárgomba néven ezeket a baktérium- és gombatulajdonságokat magukban
egyesítő mikroszkopikus talajlakókat. A csoport neve az oktivoc sugár és uukoc gomba szavak összetétele. A nyári
zivatarok után érezhető jellegzetes talajillat tőlük ered. Az Actinomycetales rend Gram-pozitívan festődő, mor-
fológiai alapon megkülönböztethető családjai a Micrococcus nemzetségtől az elágazó fonalas szerkezetű, differen-
ciált telepet képező Streptoverticillium fajokig változatos képet mutatnak. DNS-tartalmukban a G+C mennyisége 55
% felett van. Sejtfalszerkezetük azonossága mellett lipidtartalmuk is hasonló. Filogenetikai kapcsolatukat a
nukleinsav-hibridizációs kísérletek és a 16S rRNS azonosságuk igazolja. Spóraképzésük a szaporodást szolgálja.
Hőtűrő tartós spórát csak a Thermoactinomyces nemzetség tagjai fejlesztenek. Nagy morfológiai változatosságuk,
színes telepeik, valamint a környezetbe kiválasztott színanyagaik változatossága miatt a törzsek elkülönítésére csak
azonos körülmények között végzett, párhuzamos kísérletek eredményeit értékelve vállalkozhatunk. Az irodalmi
adatok összehasonlítása sok esetben félrevezető.Részletes megismerésüket indokolja változatos morfológiájuk,
differenciálódási jelenségeik, a környezetre gyakorolt hatásuk, az ipari alkalmazhatóságuk és ezzel összefüggő
bonyolultan szabályozott anyagcsere hálózatuk. A DNS replikációt ritkán követi válaszfal képződés. Ebből
következika látszólag ―többmagvú‖ prokariota jellegük, A fonalak elágazása azonban mindig szeptum közelében
indul növekedésnek. Az elágazó fonal csúcsi részében intenziv az anyagcsere. A növekedő szakasz mögötti
szubapikális szakaszban folyó replikációt nem követi a válaszfal képződés. Lineáris szerkezetű kromoszomájuk
feltűnően nagy 8Mb 8x10
5
bázispár

Elkülönítésük céljából elvégzendő morfológiai vizsgálatok:
1.) Adott hőmérsékleten és táptalajon fejődő telepeik változásának egfigy4elése és összehasonlítása rendszertnni
besorolásuk szempontjából fontos
2.) A pigmentképzésük vizsgálata a tápközeg, az életkor és a pH függvényében.
3.) A légmicélium-képzés vizsgálata.
4.) A konídiumképzés vizsgálata a légmicéliumon és a szubsztrátmicéliumon.
5.) A spórahordozó hifa alaki jellegzetességeinek vizsgálata.
6.) A spórák száma, elhelyezkedése, mozgó vagy nem mozgó voltuk.
7.) A sporangium alakja (ha van).
8.) A spórák küllemének változása — elektronmikroszkópos összehasonlítása.
9.) A fonalas alak fragmentálódási tendenciája.

Taxonómiai szempontból kiemelendő a kémiai és élettani vizsgálatok jelentősége, ezen belül a
sejtfal-összetétel vizsgálata, a lipid tartalom vizsgálata, az optimális tenyésztési hőmérséklet meghatározása, a
levegőigény mérése és a szénhidrát-hasznosítás vizsgálata (D-glükóz, L-arabinóz, D-xilóz, D-mannit, D-fruktóz,
szacharóz, inozit, glicerin, keményítő)


Fonalas szerkezetű prokariota típusok fejlődési ciklusai, a légmicélium és a szubsztrátmicélium elkülönülésének
továbbá a spóraképzésének vázlatos rajza.

Morfológiai vizsgálatuk — az idesorolt fajok fizikai-kémiai és fiziológiai körülmények által befolyásoltan
változó tulajdonságai miatt — különleges gondossággal végzendő. Az agar-táptalajon növekedő kolónia fonalas
szerkezetű képletekkel a tápközeg mélyebb rétegébe hatolva veszi fel a növekedéséhez szükséges tápanyagot. A
144
táptalaj felszínén viszont kompakt telepet képez, amelyről némi lízisset követően tautolízis mellwettlegtöbb esetben
finom fonalakból álló légmicélium- tömeg emelkedik fel. A fonalak vékonysága miatt felületi mikroszkóppal
általában nem vizsgálható a jelenség. Áteső fényben való vizsgálat céljából viszont különleges technikát kell
alkalmazni.
A fonalas prokarionták különlegessége az elterjedést szolgáló szaporító sejt képzése. Spóra képződése sok
esetben nem csak a légmicéliumon figyelhető meg, de a differeciálódási folyamat a tápközegbe hatoló fonalakon is
elősegíti a spóraképződést. Gyakorta a fonalak feltöredezése is a szaporítást szolgáló, artrospóraszerű képletek meg-
jelenésével jár.
A rendszertani helyükre vonatkozó adatokat szolgáltató biokémiai analitikai technika csak a XX. század
közepén erősödött meghatározó jellegűvé. Biokémiai rokonságra hivatkozva sorolják közéjük a spórát nem képző
Mycobacterium család tagjait, a Coryneform alcsoport családjait, és a Nocardia-féléket. Az elkövetkezőkben a
csoport jelentősebb nemzetségeinek típustörzsei szerepelnek. A név után zárójelben található az ATCC gyűj-
teményben megadott katalógusszám. A felsorolást néhány patológiai vagy biotechnológiai szempontból kiemelt
család részletesebb tárgyalása egészíti ki. Megjegyzendő, hogy ipari jelentőségük és szabadalmaztathatóságuk miatt a
rendszertani besorolásuk nem minden esetben állja a tudományos kritikát. (Williams et al. J. Gen. Microbiol.
129:1815-30. 1983)

A Streptomyces fajokra jellemző bonyolultan differenciálódó anyagcsererendszer működése a talajbiológia
fontos tagjává avatja őket. A szubsztrátmicélium és a légmicélium funkcionálisan eltérő feladatot látnak el. A
spóraképzésben kiteljesedő differenciálódási folyamat különleges szabályozási mechanizmusok működését igényli.
Természetes élőhelyük változatos fizikai és kémiai körülményei, csak nagy ellenállóképességgel, kellő
adaptációs készséggel, azaz gazdag génállománnyal rendelkező törzsek fennmaradását tette lehetővé. Amíg az
eubaktériumok magállománya általában 4 Mb körüli értéket mutat, az idesorolt fonalas szerkezetű prokarioták
magállománya eléri a 8 Mb méretettartományt. Halofil fajaikról is tudunk.
A telepekben egyidejűleg van jelen a spórából kihajtott, még életképes legidősebb primer fonal és az egyre
gyarapodó fiatal micéliumtömeg. A kolónia sok maganyagot, kevés válaszfalat tartalmazó óriás sejtnek tekinthető. A
telep körkörös elszíneződése és morfológiai elkülönülése élettani különbséget takar.
A Bergey's Manual VIII. kiadása 463 Streptomyces faj leírását tartalmazza. Az irodalom ennél jóval több
törzsről tud. Sok fajuk antibiotikumot termel. Ezek a szekunder metabolitnak tekintett biológiai aktivitást hordozó
vegyületek a létért folytatott küzdelemben hatásos fegyvernek tekinthetők. A felfedezők vizsgálati módszereiket
általában addig "finomítják", amíg az iparilag hasznosítható törzs szabadalmaztathatóság szempontjából új fajként
szerepelhet. A fajon belül nem minden izolált példány termel kimutatható mennyiségben antibiotikumot. Ezért az
ipari gyakorlatban törzsnek nevezik a gyakorlati felhasználásra kiválasztott, adott esetben kinemesített és törzs
gyüjteményben deponált mikroszervezetet

Ipari szempontból jelentősebb törzsek neve A hatásos anyag neve
Streptomyces rimosus
Streptomyces griseus
Streptomyces aureofaciens
Streptomyces venezuelae
Streptomyces noursei
Streptomyces kanamyceticus
Streptomyces fradiae
Streptomyces erythreus
Streptomyces cinnamonensis
Oxitetraciklin
Sztreptomicin
Aureomicin
Klóramfenikol
Nisztatin
Kanamicin
Neomicin
Eritromicin
Monensin


A családba sorolt különböző fajnévvel rendelkező törzsek nagy számát a rendszertan szakemberei nem
kevés kétkedéssel fogadják. Williams 400 független fajnévvel deponált ―törzs‖ 139 karakterét vizsgálva
tulajdonságaikat a numerikus taxonómia módszereit használva kritikus taxonomusként értékelte. Ennek alapján
közülük 394-et ismert csoportba sorolhatónak itélt (J. Gen. Microbiol. 129:1815-30. 1983). A 400 közül mindössze 6
megkülönböztethető fajt állapított meg.
A modern törzsfejlesztési eljárások modellként használt kísérleti alanyai is a nermzetség (genus) képviselői.
A Sermonti és Hopwood által részletesen vizsgált Streptomyces coelicolor géntérképének felderítettsége miatt került
a kutató laboratóriumok asztalára. Mai típustörzse S. violaceoruber (ATCC 14980).
A Streptomyces lividans pedig vektorgazdaként került Hopwood laboratóriumába. A modern genetikai
módszerek alkalmazását az Escherichia coli-ban és a Streptomyces lividans-ban is jól működő, bifunkcionális
plazmidjaik megalkotása tette lehetővé.
145

Streptomyces lividans légmicélium átalakulása
spóralánccá



A Streptomyces-plazmid restrikciós térképe. Az ábra bemutatja a restrikciós enzimek hasítóhelyeit. Ez a
kifejlesztett plazmid a Streptomyces coelicolor A3, a Streptomyces lividans 66 és a Streptomyces parvulus ATCC
12434 törzsekben képes replikálódni.


Az idesorolt mikroszervezetek pótolhatatlan szerepet játszanak a komposztálás folyamatában a növényi
poliszacharidok ( cellulóz, hemicellulóz, lignocellulóz) lebontásával. A növényi lignocellulóz felépítettségéből
következően nehezen lebontható. A szorosan kötegekbe rendezett cellulóz láncokhoz rövidebb hemicellulóz
egységek tapadnak. Ehhez kapcsolódnak extenzinek közvetítésével a savas karakterű pektin láncok. Az egész
képződményt a lignin (fenilpropán egységekből álló polimer) szilárdítja az egyes növénycsoportokra jellemző
lignocellulózzá.
Lignocellulózt bontó mikroszervezetek természetes élőhelyükről különleges dúsító eljárással izolálhatók.
Ilyen dúsító táptalaj összetétele lehet 100 ml desztillált vízben oldva
0.1 g NaNO
3
;
0.1g K
2
HPO
4
;
0.03g KCl;
0.05g MgSO
4
.7H
2
O;
0.05 g élesztőkivonat;
0.05g pepton; 1g Macherey Nagel 300-as kristályos cellulózpor; 2 g agar-agar
A mikroelem igény kiegészítése céljából 0.1 ml baktérium mentesre szűrt nyomelem oldat adagolása (1000
ml desztillált vízben oldva 100mg MnCl
2
.4H
2
O; 100mg CoCl
2
; 10mg CuSO
4
; 10mg Na
2
MoO
4
.2H
2
O;
20mg ZnCl
2
; 5mg LiCl; 5mg SnCl
2
.2H
2
O; 10mg H
3
BO
3
; 20mg KBr; 20 mg EGTA, 8mg NaFe
3+
-trihidrát)
szükséges.
Ha a tenyésztést 44–60°C tartományban végezzük, akkor a cellulózt hasznosító törzsek kiemelésére van lehetőség. A
8-10 nap után izolálható telepek közül hatásos törzsek izolálhatók. Ezek tisztasága többszöri hígítás után
karboximetil-cellulózt tartalmazó táptalajra szélesztve igazolható. A telep körüli képződő kráter a CMC bontó
aktivitásról tudósít.



146
Ipari mikrobiológia II OKTATÁSI SEGÉDLET Primer metabolitok előállítása

CITROMSAV TERMELÉS MIKROBIOLÓGIAI ELJÁRÁSSAL

Történeti bevezetés.Az élelmiszeripar számára nélkülözhetetlen citromsav üzemi termelése volt az első
részletesen vizsgált és nagy méretben bevezetésre került aerob biotechnológiai eljárás. Bár Wehmer alapvető
felismerése több mint száz esztendős, mégsem állítható, hogy a citromsav előállítására szolgáló eljárások
fejlesztése befejeződött. Wehmer 1893-ban egy kálcium-oxalátot előállító Penicillium glaucum tenyészlevében
melléktermékként észlelte a citromsav megjelenését. Felfedezésének gyakorlati jelentőségét felismerve később
főtermékként citromsavat termelő gombákat keresett és talált, majd ezeket a mikroszkopos gombákat új genus-
ként, a Citromyces nemzetség tagjaiként írta le 1903-ban. A részletes rendszertani vizsgálatok később
kideritették, hogy a törzsek a Penicillium nemzetségbe sorolandók.

A század elején a citromsavgyártásban az olasz termelők monopol helyzetben voltak. Termelésük
meghaladta az évi 10000 tonnát. Egy tonna citromsavat kálcium-só formájában 40 tonna citrom préslevéből
nyertek. (Megjegyzendő, hogy most évenként közel félmillió tonna citromsavat használ fel az élelmiszer- a
mosószer- és szerves vegyipar.) Wehmer érezte felfedezésének ipari jelentőségét, a gyakorlati megvalósításban
azonban nem volt eredményes.

Az első Aspergillus niger-rel végzett citromsavtermelésre vonatkozó szabadalmat Zahorsky B.
jelentette be ( US. Pat. 1065358) 1913-ban. A citromsav termelés ipari megvalósíthatóságát biztosító felfedezés
Currie J. M. nevéhez kapcsolódik (1917 J. Biol. Chem. 32:15). Thom C. és Currie J. M. az Aspergillus
nemzetség savtermelő képességét vizsgálva (J. Agric. Res. 7:1) megállapították, hogy ezek a gombák savanyú
kémhatású táptalajon (pH=2,5-3,5) is növekednek, és ez a savanyú környezet a citromsavképződésnek is kedvez.
Ílyen savanyú (pH=1,5-2) körülmények között a baktériumos fertőzés már nem zavarhatja a folyamatot, sőt
pH=2 alatt, a növekedés részleges gátlása fokozza a citromsav képződést. A felismert és nagyipari méretben is
biztonságosan megvalósítható körülmények viszonylag rövid (1-2 hét) idő alatt a szénhidrát tartalomra számolva
60 % feletti citromsav képződést hoztak.
Az első citromsavat termelő üzem 1919-ben készült el Belgiumban. Ezt követte a Chas. Pfizer & Co.
üzemének a felépítése az USA-ban. Angliában a Rowntree & Co Ltd. - saját szabadalmát használva (Brit.Pat.
266414, 266415) - 1927-ben indította meg a citromsavtermelést. Csehországban a citromsav teremelés - 1928-
ban - a Kaznejovban épült üzemben indult meg felületi tenyésztéssel, melaszt hasznosító német szabadalom
(Montan und Industriewerke 1924 Ger. Pat. 461356) alapján. Később nagy kapacitású citromsav üzemek épültek
Németországban, a Szovjetunióban és más európai országokban. Ezek az üzemek mind felületi tenyésztéssel
termelték a citromsavat, mégpedig olyan olcsón, hogy a citromléből folyó citromsav előállítás elsorvadt. Az
olcsó ipari termék már nem csak az élelmiszeriparban, de a vegyipar más területén is felhasználásra került.
A második világháború után fokozódott az érdeklődés a citromsav iránt. A piac igényeit csak újabb
üzemek építésével lehetett kielégíteni. Ezek az üzemek azonban már új technológiát alkalmaztak, a sűllyesztett,
levegőztetett, ú.n. mélyfermentációs eljárást.
A szakirodalomban a század első felében is számos közlemény foglalkozott a zárt kevert fermentorban
megvalósítható citromsavtermelés lehetőségével (Bleyer B. 1924 Ger. Pat. 434729, Kluyver A.J. et al. 1925.
Biochem. Z. 161:361). Sőt a Kluyver laboratórium (Perquin. L.H. C. 1938 Dissertation. Techn. Univ. Delft) és a
Johnson laboratórium (Shu és Johnson J. J. 1947, J. Bact 54:161, 1948, J. Bact. 56:577) kutatási ertedményei a
termelés biztonságát is megalapozták, mégis csak az ötvenes évektől észlelhetjük az ugrásszerű változást.

Citromsav termelésre használható mikroszervezetek viszonylag szűk körét jelöli meg a szakirodalom. Nem
ismeretes azonban, hogy ez a széleskörű vizsgálatok hiányából, vagy az anyagcsereút néhány nemzetségre
jellemző öröklött hibájából következik. A fonalas gombák közül a Penicillium ( P. glaucum, P. janthinellum
var. kaensanii, P. restrictum var. kuensanii, P. citrinum.) és Aspergillus ( A. niger, A. avamori, A. clavatus, A.
fenecis, A. fonsecaens, A. fumaricus, A. luchensis, A. saitoi, A. usumi, A. ventii) nemzetségen kívül a Botrytis
cinerea, a Mucor piriformis, az Ustulina vulgaris és a Trichoderma viride, egy-egy törzse képes számottevő
citromsav termelésre. Ez utóbbi törzs érdekessége, hogy cellulózból is képes citromsavat termelni. A törzsek
rendszertani vizsgálatát és az irodalomban megadott termelési adatokat szabadalmi érdekek befolyásolják. Tény
azonban, hogy nagyipari alkalmazásra világszerte mindezideig csak az Aspergillus niger ATCC-1015 jelű
törzsből nyert Wisconsin 72-4 (ATCC 11414) törzs leszármazottai kerültek. Mivel az előállítási eljárás
szabadalmilag nem védhető, ezért a törzsszelekciós és törzsnemesítő tevékenység mindmáig az egyes üzemek
féltve őrzött titka maradt és csak az árviszonyok alakulásából következtethetünk az elérhető termelési szintekre.
A megjelent csekély számú irodalmi adat szerint a nagyüzemi termelés alapját képező oltóanyag előállítása
állandó szelekciós tevékenységet igényel.
147
A citromsavtermelés élettani, biokémiai háttere. Az Aspergillus niger fonalas gombában a glükóz
metabolizmusa glükóz-6-foszfátból két úton folyhat: egyrészt a jól ismert Empden-Meyerhof-Parnas (EMP)
szekvenciát követve, másrészt a pentóz-foszfát ciklus irányában a hexóz-monofoszfát (HMP) úton. Nem
hagyhatjuk figyelmen kívül a glükóz oxidáz működését, amely a glükózból pH=2,5-4 tartományban glükonsavat
készítve a szénforrás jelentős hányadát képes elvonni a citrát ciklus működését tápláló glikolízistől.
A G-6-P képződést a hexokináz katalizálja PEP vagy ATP energiatartalmának terhére. A G-6-P és F-
1,6-P
2
képződéshez szükséges ATP a foszfoenolpiroszőlősav piruváttá alakulásakor képződik a piruvát-kináz
segítségével. A HMP irányba történő reakció teljesítőképessége az elágazásnál működő glükóz-6-foszfát
dehidrogenáz aktivitásától és a NADP
+
aktuális koncentrációjától függ. Ezért növekedő tenyészetben (trofo-
fázis) a bioszintetikus folyamatok NADPH igénye miatt az EMP/HMP arány akár 2:1-re módosulhat, miközben
a citromsavat termelő törzsekben az idio-fázis-ban az EMP/HMP út aránya 4:1. Jelentősebb szabályozó szerepe
van a fruktózfoszfát-1-kináz-nak, amelyik az ATP energiatartalmát használva a F-6-P—> F-1,6-P
2
átalakulást
katalizálja. A glikolitikus út működése és teljesítőképessége szempontjából kulcshelyzetben levő alloszterikus
tulajdonságú enzimnek – a fruktóz-6-foszfát-1-kináz-nak – a működését a vad törzsek esetében gátolja a
citromsav, de gátló hatású a sejt energia tartalékát képviselő ATP is. Ez utóbbi egyébként az enzim
szubsztrátuma. Az enzim aktivitását fokozza az AMP, ADP, éa a szervetlen foszfát.

Fruktóz-2,6-biszfoszfát szabályozó szerepét bemutató vázlat

A citromsavat termelő mutánsban éppen itt észlelhető döntő különbség, mégpedig azért, mert a
magasabb glükóz koncentráció jelenlétében a fruktózfoszfát-2-kináz hatására képződő szabályozó szerepet
betöltő F-2,6-P
2
által aktívált fruktóz-6-foszfát-1-kináz működését nem, vagy alig befolyásolja a citromsav.
Ammónia jelenlétében nyomnyi gátlást sem lehet megfigyelni. Ebből következőleg nem áll le a glikolízis
citromsav túltermelés esetében.
A fruktóz-6-foszfát és a fruktóz-1,6-biszfoszfát aktuális koncentrációját finoman szabályozza a fruktóz-
2,6-biszfoszfát, amely a hexóz lebontást az EMP útra irányítva segíti elő a citromsav képződést. Az alloszterikus
hatás a szétroncsolt gombafonalakból kinyert sejtmentes fehérjekivonatban is jól észlelhető.
A szabályozó szerepet betöltő vegyület (fruktóz-2,6-biszfoszfát) eltünése lecsökkenti a glikolízis
működése szempontjából nélkülözhetetelen fruktóz-1,6-biszfoszfát képződést. Ez a bonyolult szabályozó
mechanizmus a szénhidrát leggazdaságosabb felhasználását biztosítja. Ezért a vad törzsnél csak annyi
energiagazdag hexóz-foszfát kerül felhasználásra amennyi szűkséges a citrát kör táplálására, illetve a
bioszintetikus folyamatok NADPH igényének a kielégítésére.
A szabályozó szerepet betöltő F-2,6-P
2
szintézisét és lebontását egyetlen fehérje katalizálja, mégpedig
foszforilezett szeril-oldalláncot tartalmazó fehérje formájában (F-2,6-biszfoszfatázként) lebontja a szabályozó
szerepet betöltő F-2,6-P
2
-ot; Defoszforilezve viszont F-6-P-2-kináz-ként viselkedve éppen a szabályozó hatású
F-2,6-P
2
képződését katalizálja. Ezt a kettős rendeltetésű Janus arcú fehérjét egy protein-kináz foszforilezi, a
foszfát eltávolítását pedig egy protein-foszfatáz végzi. A protein-kináz működését a metabolikus aktivitástól
148
függő cAMP szint serkenti. A protein-kináz cAMP jelenlétében aktíválódva a F-6-P-2-kinázt F-2,6-
biszfiszfatázzá alakítja, aminek következményeként visszaszorul a glükolízis, sőt előtérbe kerül a glükóz
neogenezis. Nem véletlen, hogy jelentősebb citromsavképzés csak nagyobb koncentrációban adott szénhidrát
jelenlétében várható, amikor a növekvő metabolikus aktivitás csökkenti a cAMP szintet. Nyilvánvaló, hogy a
glükóz felvételét segítő hexokináz aktivitása határozza meg a citrát képződés sebességét. (A 2-dezoxiglükóz
rezisztencia kifejlesztése, a glükóz hasznosítását lassítva csökkenti a citrát képződést.)

H-C=O COOH A CITROMSAV bioszintézise
GLÜKÓZ H-C-OH H-C-OH Aspergillus niger tenyészetében
HO-C-H HO-C-H
H-C-OH FAD FADH2 H-C-OH
Hexokináz H-C-OH H-C-OH
ATP------> H2C-OH H2C-OH
GLÜKONSAV
ADP<------- H-C=O melléktermék
H-C-OH
HO-C-H
G-6-P H-C-OH


H-C-OH
H2C-OPO3H2
izomeráz
H2C-OH
C=O
HO-C-H
F-6-P H-C-OH
H-C-OH
ATP--------> H2C-OPO3H2
fruktózfoszfát (÷ATP, ÷citrát, +ADP, +AMP, +NH3, + F-2,6-P2 , Pi)
1-kináz H2C-OPO3H2
ADP<-------- C=O
HO-C-H
H-C-OH
F-1,6-P2 H-C-OH
H2C- OPO3H2
aldoláz
D-A-P + G-A-P

H-C=O H2C- OPO3H2
H-C-OH izomeráz C=O (D-A-P)
2Pi és 2 NAD
+
------> H2C-OPO3H2 H2C-OH
GAP dehidrogenáz
2 NADH<----- O=C-OPO3H2
2 Gs-1,3-P2 H-C-OH
2 ADP---> H2C-OPO3H2
glicerinsav-3- A CITOPLAZMÁBAN FOLYÓ GLÜKÓZ BONTÁS
-foszfát-kináz HO-C=O
2 ATP<---- H-C-OH
2 Gs-3-P H2C-OPO3H2
glicerinfoszfát
mutáz HO-C=O
H-C-OPO3H2
2 Gs-2-P H2C-OH
enoláz
HO-C=O
2 P-E-P H-C-OPO3H2
PEP- ADP>>>>>>ATP H-C-H
karboxi- piruvát-- kináz (
÷
ATP
,+
F DP
, +
Mg
, +
Mn
, +
NH3
, +
K)
kináz PIRUVÁT

HO-C=O TPP CO2 NAD
+
NADH
ADP< CO2 C=O O=C÷S--CoA
<<<<<ATP CH3 piruvát- dehidrogenáz |
CO2 piruvát—karboxiláz CH3

>>>>>
ADP HO-C=O CoA-SH
C=O O=C-OH
OXÁLACETÁT NADH NAD+ H-C=H H-C-H
ATP H2O malátdehidrogenáz HO-C=O HO-C-COOH
hidratáz citrát szintetá

H-C-H
COOH O=C-OH
COOH H3C–COOH MALÁT MALÁT
OXALÁT

ACETÁT
CITRÁT csere
diffuzió

CITRÁT
melléktermékek citrát permeáz MITOKONDRIUMban folyó reakciók
________________plazma lemma______________________________________plazmalemma_______________________________
CITRÁT
A környezet (alloszterikus szabályozó elemek zárójelben szerepelnek; a serkentő +, illetve gátló ÷ hatás jelölésével)

149
A glikolízist katalizáló enzimek termodinamikailag meghatározott irányban működve, szabályozás
nélkül – önfenntartó módon – a hexózból két molekula piroszőlősavat hoznak létre. Közben a glükóz
felvételéhez és a F-1,6-biszfoszfát képződéséhez szűkséges ATP szubsztrátszintű foszforilezéssel készülhet a
Gs-1,3-biszfoszfát glicerinsav-3 foszfáttá alakulásakor, illetve a foszfoenolpiruvátból való piroszőlősav
képződés közben.

A folyamat szempotjából kritikus pontot jelent a glicerinaldehid-3-foszfát-dehidrogenáz kofaktor
ellátottsága. A NAD
+
hiány ugyanis áttételesen a citromsavképződést csökkentheti. A citokróm rendszer
működése (a terminális oxidáció) az ATP szint emelésével jár ami viszont a fruktóz-1,6-biszfoszfát képződését
alloszterikusan gátolná. Megoldást jelent az alternatív oxidáz működése, amely ATP képződés nélkül vezeti át az
elektront az oxigénre, miközben az energia hő formájában szabadul fel, ami a rendszer hűtésével távolítható el.

A reakciósor másik jól szabályozott pontja az eukariota sejtekben az acetil-CoA-t szolgáltató
tiaminpirofoszfátot igénylő enzimkomplex a piroszőlősav-dehidrogenáz. Az enzim működését gátolja az ATP és
a citrát, de növeli az aktivitását a F-1,6-P
2
, valamint néhány egy-, illetve kétértékű ion (K
+
, NH
3
, Mg
2+
, Mn
2+
).
Az Aspergillus niger törzsekből kinyert piruvát-dehidrogenáz készítményekben a citrát alloszterikus szabályozó
szerepét nem csak a citromsavat termelő mutánsból, de néhány citromsavtermelésre alkalmatlan vad törzsből
készült enzimkészítményben sem sikerült kimutatni, viszont a F-1,6-P
2
aktiváló hatása minden
enzimkészítménynél jelentkezett.

A fentiek ismeretében nem meglepő, hogy az Aspergillus-ok közül került ki a citromsavtermelésre
alkalmas mutáns, mert a képződő citromsav csupán egy ponton, a fruktóz-6-foszfát-1-kináz alloszterikus
szabályozásánál fejthet ki gátló hatást. Ennek a szabályozási pontnak a kikapcsolásával létrehozható a
citromsavat túltermelő mutáns.

A citromsav képződését oxálecetsavból acetil-CoA felhasználásával a mitokondriumban működő citrát
szintetáz katalizálja. Ezt az enzimet vad és mutáns Aspergillus törzsekből izolálták, tisztították és igen alaposan
megvizsgálták, különös tekintettel a szabályozottságára. Ezek a munkák, csak a CoA-SH szabályozó szerepét
igazolták, ami élettanilag várható is volt, hiszen az acetil-CoA elszívása más esszenciális bioszintetikus
folyamatok leállásához vezetne. A piroszőlősav-dehidrogenáz komplex zavartalanul biztosítja a CoA-SH
feltöltését. Az eddig megbeszélt enzimrendszer a citromsavtermelés szakaszában (idio-fázis) szinte teljes
mértékben - a micélium növekedése nélkül - a citrát képződést szolgálja.

A citromsavképződéshez nélkülözhetetlen acetil-CoA a mitokondriumban jön létre a
tiaminpirofoszfátot igénylő piroszőlősav-dehidrogenáz komplex által. Képződését a sejten belüli ATP szint
szabályozza.

Piruvát + CoA-SH + NAD
+
acetil-CoA + CO
2
+ NADH + H
+

A reakció a szabadenergia csökkenés (G
o
=÷33,5 kJ) miatt gyakorlatilag irreverzibilis.
Az oxálecetsav képződését az Aspergillus-okban a konstitutív piruvát-karboxiláz katalizálja
piroszőlősavból és szén-dioxidból egy ATP energiatartalmát hasznosítva.

Piruvát + CO
2
+ ATP oxál-acetát + ADP + P

A szabadenergia változás csekély volta miatt (2,1 kJ) a reakció reverzibilis. Az enzim működését más
mikroorganizmusokban a feldúsuló acetil-CoA kapcsolja be.

A foszfoenolpiroszőlősav —> oxálecetsav átalakulást katalizáló foszfoenolpiruvát-karboxi-kináz
jelenlétét is sikerült bizonyítani (Bloom S. J., Johnson M. J. 1962 J. Biol. Chem. 237:2718). Az enzim ADP
jelenlétében szén-dioxid felvételét segíti elő.

foszfoenol-piruvát + CO
2
+ ADP oxál-acetát + ATP

A citoplazmában működő malát dehidrogenáz a NADH jelentős részét visszaoxidálja, a képződő
almasav pedig koszubsztrátumként a mátrixban képződő citrát transzportját segíti elő a mitokondriumból a
citoplazmába..
oxál-acetát + NADH malát + NAD
+



150
Összefoglalva a fentieket megállapítható, hogy citromsav termelésre használható Aspergillus niger törzs
genetikailag meghatározott képességei lehetőséget adnak olyan technológia kidolgozására, amelynek előírásait
betartva gazdaságos üzemi eljárás keretében nyerhető az élelmiszeripar és a mosószeripar szempontjából is
fontos vegyület.

1) aktív citrát-szintetáz működése 2)gátolt izocitrát-dehidrogenáz aktivitás
3)fokozott oxál-acetát képzés a citoplazmában 4) aktív izocitrát-liáz működés
5)fokozott malát képzés a citoplazmában 6)F-1,6-P
2
által serkentett piruvát-kináz
7)A fruktóz foszfokináz citrát érzékenységének F-2,6-P
2
általi felfüggeszthetősége

8) a mitokondriumban képződő citromsav az almasavval cserediffundálva kerül a citoplazmába,
9)a citoplazmából az energiaigényes citrát permeáz juttatja a tápközegbe a főterméket a CITROMSAVAT.

Kérdés, hogy mennyiben befolyásolják a citrát feldúsulást a ciklus enzimei, amelyek a
továbbalakulásáról gondoskodhatnak. Elfogadhatónak látszott az az elmélet, hogy a feldúsulás oka az akonitáz és
az izocitrát-dehidrogenáz csökkent működése. A kísérleti adatok ezt megerősíteni látszottak. Később kiderült,
hogy ezek az enzimek rendkívül érzékenyek, és a kísérleti módszerek alkalmatlanok voltak a kimutatásukra.
Mattey igen gondos munkával bizonyította, hogy a mitokondriumokban található egy akonitáz, amely 90:3:7
citrát : cisz-akonitát : izocitrát egyensúlyt állít be (Mattey M. 1977 FEMS Microbiol. Lett. 2:71). Az Aspergillus
niger törzsekben több izocitrát dehidrogenáz működik Ezek az enzimek katalizálják az izocitromsav
átalakulását o-ketoglutársavvá egy szén-dioxid felszabadulása mellett. A NAD
+
függő izocitrát-dehidrogenáz
aktivitása alacsony, alig kimutatható. A NADP
+
függő izocitrát-dehidrogenáz-ból viszont kettő található a
mitokondriumban a citrát ciklus tagjaként. Mindkét enzim működését azonban gátolja a citromsav. A harmadik
NADP
+
függő izocitrát-dehidrogenáz a sejtplazmában található, működését azonban nem befolyásolja a
citromsav. Az idio-fázisra jellemző NADP
+
hiány esetén természetesen ez az enzim sem működik.
A citrát ciklus enzimeinek a jelenlétére vonatkozólag meglehetősen eltérő adatok találhatók az
irodalomban. Sok szerző szerint a termelő törzsben nem található meg az o-ketoglutársav dehidrogenáz., viszont
működik az izocitrát-liáz által elindított glioxalát ciklus. Sőt ez a ciklus nem csak acetát jelenlétében aktív, de
különlegessége, hogy a glükóz nem represszálja, sőt glükóz szénforráson is aktív. Ez az izocitrat-liáz talán
gyenge volt a Wehmer által izolált Penicillium glaucum törzsben, ahol először figyeltek meg citrát képződést
glükózból az oxalát képződés melléktermékeként. Az o-ketoglutársav-dehidrogenáz hiánya egyébként nem
jelent problémát, mert a citrát ciklus többi tagja oxálecetsavból reduktív folyamat keretében is képződhet
elegendő mennyiségben, sőt a malát-dehidrogenáz esetében ez az út termodinamikailag előnyösebb (Kubicek C.
P., Rőhr M. 1977 Eur. J. Appl. Microbiol. 4:167) A fumaráz enzim által katalizált reakcióban a szabadenergia
változás olyan csekély, hogy a reakció teljesen reverzibilis. A borostyánkősav-dehidrogenáz működését az
oxálecetsav befolyásolja.
Az eddig tárgyaltakból látható, hogy az alloszterikus enzimek hibás működése, a konstitutív
piroszőlősav karboxiláz nagy aktivitása, valamint a NADP
+
függő mitokondriális izocitrát dehidrogenázok
citráttal való gátolhatósága lehetőséget ad a citromsav képződésére és a környezetbe való felszaporodására.
Kérdés hogyan oldja fel a jóltermelő törzs anyagcsere rendszere az ATP (gátló) szabályozó hatását. A
reakciósorban szereplő alloszterikus enzimek (fruktózfoszfát-kináz, a piruvát-kináz, a piroszőlősav dehidrogenáz
és a citrát-szintetáz) ATP érzékenysége ugyanis a citromsavat termelő mutánsokban is változatlanul jól mérhető.

A citromsav képződés glükózból nem igényel ATP-t, sőt némi felesleg marad (egy ATP) minden
citromsav molekula képződésénél. A glicerinaldehid-3-foszfát dehidro-génezésekor, valamint az actil-CoA
képződésekor megjelenő NADH visszaoxidálása viszont az oxidatív foszforilezés eredményeként az ATP szintet
a kritikus érték fölé emelné, ami a citromsav képződés drasztikus csökkenésében jelentkezne.

NADH ox. < (cianidddal gátolható)
flavin e e

oxidatív foszforiláció

e


1
/
2
O
2

enzim e


NAD
+

<

>
red e–

alternatív légzés
>
H
2
O
(cianid-rezisztens szalicilhidroxamáttal gátolható)
Az elektron útja az oxigénhez
Röhr és Kubicek vizsgálatai szerint a citromsavat termelő törzsekben a NADH visszaoxidálására szolgáló
alternatív légzésnek nevezett út egy flavin enzim segítségével ATP képződés nélkül juttatja az elektront a légköri
oxigénre víz képződés közben (Kubicek C. P., Rőhr M. 1978 Eur. J. Appl. Microbiol. 5:263). A NADH hordozta
energia ez esetben hőtermelés formájában jelentkezik. Ezért a technológiai folyamatban a hőelvezetés — a
rendszer hűtése — fontos szerepet nyer. Ennek a hőmennyiségnek a hasznosítása üzemi szinten a termék árát is
kedvezően befolyásolhatja. Ez a cianid rezisztens, de szalicil-hidroxamáttal gátolható elektron transzport
151
mechanizmus magasabb oxigén szintet igényel mint a terminális oxidációban működő citokróm-oxidáz. Ebből
következően nem meglepő, hogy az oldott oxigén szint átmeneti csökkenése a citromsav képződés leállásával
jár, miközben a növekedésben, szárazanyag tartalom változásában megfigyelhető károsító hatás nem
jelentkezik. Batti vizsgálatai szerint a citrát képződés sebessége könnyen visszaállítható, ha a levegőztetés
újraindítása előtt a tenyészet pH-ját nátrium-hidroxiddal pH=4 körüli értékre emeljük. Néhány órai növekedés
után újra indul a citromsav termelés. Fokozni lehet a citromsav képződést az oxigén parciális nyomásának a
növelésével, a levegő oxigéntartalmának emelésével. Döntő jelentőségű az eljárás eredményessége
szempontjából a táptalaj alacsony foszfát tartalma. Ez nem könnyű feladat a gazdasági szempontból előnyös
természetes eredetű tápanyagok felhasználásakor. A foszfát szint emelése a növekedést serkenti, ez igényli a
NADPH képződés fokozását, és előnyben részesíti a cukorsavak képződését.
Sok problémát jelentett a nyomelemek szerepének a tisztázása. Jelenlétük általában káros, ezért a
technológiai folyamatban gondoskodni kell a természetes eredetű anyagokat tartalmazó táptalaj előzetes
ionmentesítéséről. A Clark D.S. és munkatársai által összeállított táblázat (Biotechnol. Bioeng. 8:463 1966)
bemutatja az Aspergillus niger számára a citromsavtermelés szempontjából még elviselhető fémion mennyiséget.

Fémion Mennyisége -mg/L Citrát képződés g/L

Aluminium
Kalcium
Kobalt
réz (cupri )
vas (ferro)
Magnézium
Nikkel
Cink
Mangán
Összes ion
Össz. ion kivéve Mn

Al
III
Ca
II
Co
II
Cu
II
Fe
II
Mg
II
Ni
II
Zn
II
Mn
II


5
80
0,1
3
100
20
0.1
5
1
adott koncentrációban
adott koncentrációban
88
73
90
90
86
75
88
86
75
15
14
74


A fémionok között a mangán szerepének a biokémiai magyarázata nem könnyű feladat, mivel a
szénhidrát anyagcsere hálózatában tárgyalt néhány enzim stabilitását, aktiválását éppen a mangán ion segíti elő.
Mégis mindent összevetve a citromsav termelés szempontjából előnyös a mangán hiány. Ez esetben a tenyészet
mikroszkópi képe megváltozik, abnormális göcsörtös hifák alkotják a mikro-kolóniákat, mikro-pelleteket.
Mangán hiány hatására a pentózfoszfát ciklus aktivitása általában emelkedik, a trikarbonsav ciklus enzimeinek a
szintje pedig lényegesen alacsonyabb értéket mutat. Ugyanakkor nagyobb mennyiségben találjuk a
gombasejtben (pool) az aminosavakat, a piroszőlősavat, oxálecetsavat és az ammónium iont. Alacsony a sejt
fehérje és nukleinsav tartalma, csökken a triglicerid és a foszfolipid szint. Szignifikánsan emelkedik viszont a
sejtfal kitin tartalma, miközben a sejtfal ß-glukán és galaktomannán tartalma határozottan csökken.
Az ionmentesítés egyik előnyös módjaként komplexképző káliumferro-cianidot adnak a táptalajhoz. Ez
a komplexképző vegyület a növekedési aktivitás visszafogása, tehát az idiofázis fenntartása szempontjából is
előnyös. A mangán citromsav termelést csökkentő hatása cikloheximiddel jelentősen csökkenthető. A
környezetbe kiválasztott citromsav mennyiségét 0,001 mM mangán (55ug/L) 45 %-ra 0,01 mM (0,55 mg/L)
mangán 28 %-ra csökkenti. 20 ug/ml cikloheximid jelenlétében a gátló hatás alig jelentkezik, 10-15 %-ot sem ér
el. Ugyanakkor a mitokondriumban folyó fehérjeszintézist gátló klóramfenikol nem befolyásolja a mangán
citromsavképzést befolyásoló hatását. Megjegyzendő, hogy az utóbbi időben előállították a jól termelő törzs
mangán rezisztens variánsát. Az ipari alkalmazására a gyártási titok fátyla borul.
Érdekes eredményeket hozott a rövidszénláncú alkoholok hatása. Mayer vizsgálatai szerint, különösen a
metanol 1-3 %-ban a tenyészethez adva jelentősen képes növelni a képződő citromsav mennyiségét, valószínűleg
a plazmalemma szerkezetében okozott változás előidézésével. A szénlánc növelésével (etanol, propanol) az
előnyös hatás csökken.
A citromsav termelés szempontjából meghatározó jelentőségű az oltóanyagot előállító laboratórium
szerepe. A termelő üzemek piaci aktivitása olyan alacsonyra szorította a termék árát, hogy csak a legjobban
termelő törzsekre kimunkált technológiát alkalmazó cégek maradhatnak versenyben. A sikeres cégek központi
törzsfejlesztő laboratóriumai monopol helyzetük megőrzése céljából nem hozzák nyilvánosságra eredményeiket.
A termelő üzemek minden esetben a központi laboratóriumból kapják az oltóanyagot, amelyből a gyártási eljárás
végén csak csökkent termelő képességű törzs nyerhető vissza.

Az oltóspóra előállítása, az állandó ellenőrző mérések alapján kiválasztott kiváló képességű mutáns
felszaporítása (egészségi szempontból a légúti fertőzés megakadályozása érdekében) különleges biztonságot
jelentő körülmények között, hermetikusan zárt légkondicionált gumikesztyűs boxokban folyik. Ezekből a zárt
152
termosztátokból az oltásra használható spóratömeg aszeptikusan zárt formában kerül a felhasználó üzembe. Az
oltóanyag előállítására szolgáló zárt rendszer kizárja annak a lehetőségét, hogy az oltóanyag a környezetünkben
nagy gyakorisággal előforduló vad Aspergillus törzzsel fertőződjön. A gyártás szempontjából ez annál
veszélyesebb minél korábbi lépésben kerül a vad törzs az oltóanyagba. A vad törzsek ugyanis rövid idő alatt,
könnyen túlnövik a magas termelőképesség miatt hátrányos helyzetben levő nemesített varánst, és ezzel a fő
fermentációban a citromsavtermelés jelentősen csökkenhet. Az oltó-spóratermelés utolsó fázisát már az üzem
végzi, mivel az itt bekerülő egy-két idegen spóra már nem okoz végzetes tragédiát.
A citromsav képződést hátrányosan befolyásolhatja az oxálecetsav hasadásával járó oxálsav képződés,
amely reakciót a vas ionok serkentik. Ezért az ionmentesítés a citromsavtermelésre kifejlesztett eljárás
szempontjából előnyös.

COOH COOH
| Fe
++
|
C=O COOH
|
H-C-H CH
3



|

H
2
O |
COOH COOH

oxálsav képződés CaCO
3
jelenlétében

A másik glükózt fogyasztó reakció a fonalas gombák glükóz-oxidáz aktivitása. Ez az enzim közvetlenül
képes glükonsavvá oxidálni a tápközegbe adott glükózt. A citromsavtermelés szempontjából optimális savanyú
körülmények között (pH=3,5 alatt) azonban ez a specifikus glükóz-oxidáz nem működik. A fonalas gombák
glükonsav termelő képességét Currie és munkatársainak gyakorlati eredményeire támaszkodva nagyipari
méretben is hasznosítják. A Penicillium luteum és az Aspergillus niger törzsekkel optimális körülmények között
50-60 óra alatt 90 %-nál jobb hatásfokkal folyik a glükóz oxidációja. 1937-ben Moyer és munkatársai olyan
aktív Aspergillus niger törzset izolált, amely egy nap alatt literenként 200 g glükózt oxidált 95 % elméleti
hatásfokkal, ha a reakcióelegy kalcium-karbonátot is tartalmazott. A glükóz átalakítását glükonsav-o-laktonná
egy flavin enzim a glükózoxidáz katalizálja


OH O O
' '' ''
H-C C C-OH
| | |
H-C-OH O H-C-OH H2O H-C-OH
| glükózoxidáz | O |
HO-C-H

HO-C-H

HO-C-H
| | |
H-C-OH H-C-OH H-C-OH
| FAD FADH2 | |
H-C H-C H-C-OH
|

| |
H-C-OH H-C-OH H-C-OH
| | |
H H H
A kofaktor visszaoxidálása hidrogénperoxid képződése közben egy oxigén molekulát fogyaszt. Ezt a toxikus
terméket a mikroorganizmusban működő kataláz azonnal bontja.

O
2
+

FADH
2
FAD + H
2
O
2


H
2
O
2
H
2
O +
1
/
2
O
2

A glükonsav÷o÷lakton ugyan spontán hidrolizálhat glükonáttá, az Aspergiullus-ban azonban egy specifikus
laktont hidrolizáló enzim működése észlelhető. A glükóz-oxidázt az Aspergillus niger sejtmentes kivonatából D.
Müller izolálta 1928-ban (Biochem Z. 199: 136). Később Franke W. és munkatársai (Zbl Bakt. I. 191-94, 1963),
valamint Keilin D. és Hartree E. F. (Biochem. J. 42:221, 1948) megállapították, hogy ez a FAD tartalmú
flavoprotein a D-glükóz ß-anomerjét 150-szer gyorsabban képes oxidálni, mint az o -D-glükózt. Lehet, hogy a
rendszer egy mutarotáz aktivitással rendelkező fehérjét is tartalmaz.
Van Dijken J. P. és Veenhuis M. vizsgálatai szerint a glükóz-oxidáz (Eur. J. Appl. Microbiol. 9:275,
1980) az Aspergillus niger sejtplazma peroxiszómáiban található. Nem ismert azonban sem az enzim, sem az
általa előállított glükonsav élettani szerepe. Az enzim 10,5 % szénhidrátot tartalmazó 186000 moltömegű
153
glükoprotein. Prosztetikus csoportként két szorosan kötött FAD-ot tartalmaz. A hőérzékeny (50
o
C) enzim
pH=5,5.-nél működik optimálisan.
A glükóz-oxidáz egyes gombatenyészet szűrt levében is megjelenik. Néhány szerző köztük Kecholaty
W. "Penatin" néven (Arch. Biochem 273, 1943), Coulthard és munkatársai "Notatin" néven (Nature 150:634,
1942) Roberts és munkatársai "Penicillin-B" néven (J. Biol. Chem. 147:47,1943) a negyvenes évek elején
antibiotikumként írták le ezt az enzimet. Megtévesztette a szerzőket a glükózt tartalmazó táptalajon felszabaduló
hidrogénperoxid dezinficiáló hatása. Azóta ezt a hatást az élelmiszeripar a tojásfehérjepor előállításánál a
készítményben levő 0,5 % glükóz eloxidálására használja. Az enzim specifikus volta miatt a glükóz kvantitatív
mérésére is használható. Gyorsasága, megbízhatósága miatt ez a tapasztalat analitikai módszerré fejlesztve
bevonult a klinikai gyakorlatba. A glükonsav képződés szempontjából előnyös az 1-1,5 M glükóz koncentráció,
a tápközeg csekély foszfát tartalma (80-90 mM) és a nitrogén éhezés (20-30 mM). A fémionok közül a mangán
jelenléte (1-10 mM) kritikus. A reakció oxigénigénye igen nagy.A reakcióelegy hidrogén-ion koncentrációja
meghatározó jelentőségű (pH=4,5-6,5). Savanyú körülmények között (pH=3) az enzim nem működik.


CITROMSAVGYÁRTÁSI FOLYAMATOK

FELÜLETI TENYÉSZETBEN

A század első felében épült üzemek a termelés klasszikus módszerével az Aspergillus niger mutáns
felületi tenyészetével nyerik a citromsavat. Az évi citromsav szükséglet 30 %-át még ezzel az elavult,
élőmunkaerő igényes, de még működőképes technológiával állítják elő.

Nagyméretű termosztálható és csiramentesen levegőz-tethető helyiségekben állnak egymás fölött a
nagytisztaságú aluminiumból, vagy saválló acélból készült tálcák. Az egymás felett elhelyezett tálcákat erős
szerkezetű építmény tartja, hiszen egy-egy tálca tartalma meghaladhatja az egy tonnát. Egy-egy tálca 5-10 m
2

felületet biztosít, mélysége 15 cm. A 9-10 naponként ismétlődő tisztítási, takarítási folyamat megkívánja, hogy a
tálcákat tartó egység körüljárható legyen. Az eljárás nem nélkülözheti az élőmunkaerőt, a takarító személyzetet.
A vízszintezett tálcák megfelelő töltő és ürítő csőrendszerrel és 12 cm magasságban túlfolyóval vannak
felszerelve. A tálcában oltáskor a táptalaj 10-12 cm mélységű réteget alkot. A csíramentesre szűrt levegő
bevezetését úgy oldják meg, hogy minden tálca szigorúan azonos mennyiségű levegőt kapjon. A levegő ugyanis
nem csak az oxigénellátást biztosítja, de fontos szerepe van a tenyésztés közben képződő hő elvezetésében is. A
folyadék felszínen történő párolgás a táptalaj keveredését, homogén eloszlását is segíti.

A munkamenet első feladata a fermentáló helyiség és az eszközök kitisztítása és sterilezése. Az eljárást
idegen penészek, tejsavbaktérium és élesztő elszaporodása veszélyezteti. Szódás lemosás után az egész rendszert
kéndioxiddal, vagy formalin gázzal fertőtlenítik, majd ammóniával való közömbösítés után steril levegő fúvással
kiszellőztetik. A hermetikusan zárt helyiségekbe menet közben nem lehet belépni.

Az eljárás legkényesebb része a táptalaj előkészítése. Szénforrásként a szacharóz, glükóz, fruktóz
egyformán jól használható. Gyakran használják a cukorgyári mellékterméket (melasz) szénforrásként, de
épültek üzemek a lebontott keményítő hasznosítására is. Mindenekelőtt a szénhidráttartalmú koncentrátumot
annyira hígítják csapvízzel, hogy a hasznosítható cukor koncentrációja 20 % körül legyen. Annyi ammónium-
szulfátot, vagy ammónium-nitrátot kevernek el benne, hogy az ammónium ion tartalma 0,5-1,5 g legyen
literenként. A pH-t foszforsavval 6-6,5 értékre állítják, majd 45 percig 120
o
C-on sterilezik. A még meleg
oldathoz adják a káliumferro-cianidot (10-100 mg/liter), amely egyrészt a nemkívánatos fémionok komplexbe
vitelével a citromsav termelés szempontjából kedvező körülményt teremt, másrészt mint egy metabolizmust
gátló szer, a gomba növekedését visszafogva elősegíti a citromsav termelést.
Az eljárás érzékeny pontja a komplexképző szükséges mennyiségének a megállapítása. Ezt a
felhasználásra kerülő nyersanyaggal végzett kísérletekben kell meghatározni. Az így előkészített steril táptalajt
40
o
C-ra hűtik, hozzákeverik az oltóanyagot, majd a csővezetéken keresztül a csiramentesített helyiségben levő
tálcákra vezetik. Az oltóspóra mennyiségét úgy állítják be, hogy a tálcákra m
2
-ként legalább 100-150 ug
konídium kerüljön. A konídiumok — lévén hidrofóbok — lassan a táptalaj felszínére gyűlve kezdenek csírázni.
Egy nap alatt a tápoldat felszínén egy vékony micélium hártya képződik. A 30-ik órától számítható az idiofázis.
A teljesen kifejlődött micélium gyűrött fehéres rétegként úszik a tápoldat felületén.

Az oltóanyagot általában az üzem területén készítik a központi laboratóriumból kapott
spóraszuszpenzióval oltva. Szilárd táptalajként jól használható a sterilezett nedves kukoricaőrlemény, esetleg
korpa, amelyen 3-7 napos korára fejeződik be a spóraképződés. Ezt összegyűjtve, homogén szuszpenzió
formájában használják a termelő szakasz oltására.
154

A citromsav termelésre szolgáló tálcák feltöltése után megindítják a levegőztetést. Kezdetben az átfújt
levegő mennyisége csekély, szerepe inkább a hőmérséklet tartásban van. A levegőt kezdetben annyira kell
előmelegíteni, hogy a táptalaj hőmérsékletének a csökkenése kevesebb legyen mint
1
/
2

o
C óránként. A tálcán
levő beoltott táptalaj 30-40 óra alatt érheti el a citromsav termelés szempontjából optimális 30
o
C-os
hőmérsékletet. A csírázást és a növekedést a magasabb hőmérséklet elősegíti. A micéliumtömeg kifejlődése után
a levegő mennyiségét növelni kell. Percenként a táptalaj térfogat négyszeresének megfelelő steril levegőt fújnak
át a tenyésztő helyiségeken.
A termelő szakaszt az alternatív légzés működése miatt jelentős hőmennyiség felszabadulása jellemzi
(óránként 600-1100 kJ/m
2
; citromsavra számolva 12500 kJ/kg termék), aminek az elvezetéséről az átfújt levegő
mennyiségének és hőmérsékletének a változtatásával feltétlenül gondoskodni kell. A táptalaj keveredését az a
hőmérséklet különbség biztosítja ami a párolgás miatt a tálcák felszíne és a mélyebb rétegek között kialakul. 6-8
napi levegőztetés alatt a szubsztrátum elfogy. A citromsavképződés megindulásakor a kémhatás pH=2 alá
csökken. Átlagban 0,2-0,4 kg m
2
óra citromsav képződésre számíthatunk. A citromsav termelés legintenzívebb
szakaszában óránként és m
2
-ként 1 kg citromsav képződik.
Az erős levegőztetés miatt a táptalaj víztartalma tíz nap alatt 30-40 %-kal csökken. A termelési ciklus
befejeződésekor a leválasztott szűrlet literenként 200-250 g citromsavat tartalmaz. (100 g glükózból 75 g
citromsav remélhető) Ez az oldat a leeresztő vezetéken keresztül könnyen elkülöníthető. A visszamaradó
szivacsos szerkezetű micélium tömeget ezután vízben homogenizálják majd szűrőprésen szűrik. Ezzel a
mosóvízzel a megtermelt citromsav 15 %-át még ki lehet nyerni. A visszamaradt micélium tömeget
állattakarmányozási célra megszárítják. Ez a szárított micélium tonnánként 150-200 kg tápanyagként hasznosuló
citromsavat tartalmaz.





























Citromsav elõállítása melaszból felületi tenyésztéssel
1:Tisztított melasz tartály;— 2:Melaszmérleg;—3:Táptalajfõzõ-tartály;—4:K
4
Fe(CN)
6 oldat
—5:Nitrogénforrás
(célszerûen mûtrágya);—6:Sterilezhetõ tenyésztõ kamra;—7:Levegõszûrõ;–8:Páratartalom szabályzó;—9:
Levegõelõmelegítõ,—10.Fermentlé gyüjtõ tartály;— 11:Micéliumaprító;— 12:Szûrésre elõkészített tenyészet
gyüjtõ-tartálya;—13: vákuum dobszûrõ a micelium elkülönítésére;—14:a szûrt micélium mosó tartálya;—
15:Micélium mentes fermentlé gyüjtõtartûlya;—16:kalcium oxalát kicsapására szolgáló tartály;—17Mésztejet
tároló tartály;—18:kalcium-oxalát – elválasztása – kiszûrése a reakció elegybõl,—19: kénsav tartály;—
20:Gipszkiválást segítõ tartály;—21:A csapadék vákuum szûrõvel történõ elkülönítése;—22:Nyers-sav
összegyüjtésére szolgûló tartály;—23:ioncserélő a CaSO
4
nyomok eltávolítása;—24:bepárló készség;—
25:kristályosító tartály

155
CITROMSAV TERMELÉS KEMÉNYÍTŐ TARTALMÚ IPARI MELLÉKTERMÉKBŐL
Igen egyszerű tradicionális japán módszert használnak különféle keményítőt tartalmazó ipari
melléktermék hasznosítására. Ez az eljárás az Aspergillus niger poliszacharidbontó képességét is hasznosítja.
Kihozatalban ezek az eljárások nem közelítik meg a nagyipari eredményeket. Ismertetését indokolja, hogy
élelmiszeripari mellékterméket hasznosít olyan egyszerű módon, amely egy iparilag elmaradott területen is
megvalósítható. A keményítőt tartalmazó hulladékot vízben áztatják úgy, hogy a víztartalma elérje a 70 %-ot.
A massza pH-ját 5,5-re állítva sterilezik, majd tálcákra szétterítve Aspergillus niger konídiummal lefújják a
felületét. 30
o
C-on hagyják fejlődni. A gomba amiláz először elcukrosítja a poliszacharidot. A következő
fázisban kezdődik a savtermelés. Néhány napos fejlődés után az összemorzsolt tenyészetből a képződött
citromsavat ellenáramú módszerrel meleg vízzel extrahálják. A vizes extraktumból kalcium-citrát formában
leválasztott hasznos termék azután tovább tisztítható.


CITROMSAVTERMELÉS LEVEGŐZTETETT, KEVERT REAKTORBAN

A század második felében elindított citromsavtermelő üzemek már a modernebb süllyesztett tenyésztési
technológiát használják, annak ellenére, hogy ez az eljárás sokkal érzékenyebb és igényesebb a technológiai
fegyelem szempontjából. A technikai berendezések fejlesztése a penicillin gyártás üzemi méretben történő
megvalósítása céljából elkerülhetetlen volt. A mélyfermentációs folyamat a felületi tenyésztési módnál
érzékenyebb a fémionokra és a komplexképző káliumferro-cianid mennyiségére. Nagyobb a beruházási igénye,
de előnyösebb az élőmunkaerő igény szempontjából. Lehetőséget ad a technológia dinamikus fejlesztésére,
amitől a termelési költségek további csökkenése várható.

Az ipari gyakorlatban kétféle bioreaktort használnak: az 50-150 m
3
hasznos térfogatú keverős
fermentort, illetve a 200-1000 m
3
térfogatú csőfermentort, amelyben a keverést a levegőáramlás biztosítja.
Ezekből a nagytérfogatú fermentorokból a hő elvezetését csak jól kialakított belső hőcserélőkkel lehet
elfogadhatóan megoldani. Az eljárás nagyon kényes az alkalmazott szerkezeti anyagra. A technológia igénye
szerinti savas közeg miatt jó minőségű saválló acélból készülnek a bioreaktorok.
A szakaszos eljárás (batch process)
táptalajában a hasznosítható szénhidrát 20-25
%. A termék önköltségi árának csökkentése
céljából természetes anyagokat (melasz,
hidrolizált kukoricaliszt,
keményítőhidrolizátum) használnak
szénforrásként. Ebből következően az
ionmentesítés az eljárás fontos elemét jelenti.
Erre a feladatra előnyösen használható a
kationcserélő gyanta. Az ionmentesítés után
nyert szűrt savanyú oldatot ammónium-
szulfáttal kiegészítve folyamatosan működő
hőcserélőben szűkség esetén az
előkisérletekben meghatározott mennyiségű
káliumferro-cianiddal kiegészítve sterilezik,
majd 50
o
C -ra visszahűtve az előre
kisterilezett fermentorba vezetik. Kémhatását
ammónia gázzal pH=2,5-3 közé állítják,
figyelve arra, hogy a táptalaj ammónia-
nitrogéntartalma nem haladhatja meg 1-1,5
ezreléket. A fermentáció oltásához kis térfogatú inokulum készüléket használnak, amelyben csökkentett
szénhidrát tartalmú táptalajon tenyésztik az oltóanyagot. A kedvező pellet méret kialakulása miatt fontos, hogy
oltáskor a főfermentációban az élőcsíraszám 5-15 x 10
6
legyen literenként. Ez a pelletesedés meghatározó
jelentőségű. A laza szerkezetű, szálas kolóniák nagy nedves térfogatot jelentenek. A keverő nem képes az
oxigénellátást megoldani a sűrű micélium szövedékbe. A kompakt kis labdacsokból (1 mm-nél kisebb pellet)
álló tenyészet száraz tömege nagyobb. Egységnyi fermentor térfogatban nagyobb mennyiségű gomba jól
keverhető és levegőztethető formában termeli a citromsavat.

A nagyméretű csőfermentorokban a légbuborékok miatt csekélyebb térfogattömegű tenyészet folytonos
felfelé áramlása tartja fenn a termelés szempontjából optimális anyagáramlást. A bevezetett levegő mennyisége
kezdetben 0,1 térfogat percenként amit az igény szerint 0,4 tf %-ra emelnek. A citromsav termelés
szempontjából ennél nagyobb mennyiségű levegő kedvezőbb lenne, gyakorlati okoból azonban ezt az értéken

Citromsavtermelés melaszból
156
nem szokták túlhaladni. A probléma gazdaságosan megoldható a szén-dioxid mentesített, oxigénnel dúsított
levegő visszaforgatásával. A tenyészet hőmérsékletét 28-32
o
C-on a tenyésztési körülményeket pedig pH= 2,2-
2,6 között tartják.

A tenyészet növekedéséhez 2-3 nap szükséges. Ezután indul a citromsavtermelés, amelynek sebessége
az ötödik napon éri el a csúcsot, majd ellaposodva 10-12 nap alatt fejeződik be. A termelés kinetikáját vizsgálva
jól elkülöníthető a növekedési fázistól (trofofázis) a termelő (idiofázis) szakasz. A növekedési fázisban nincs
citromsavtermelés, az idiofázisban viszont nincs növekedés. Jó eredmény érhető el a tápanyag folytonos
adagolásával (feed batch process). Ez esetben oltáskor a fermentor a hasznos térfogat 60 %-ra van töltve és
induláskor a cukortartalom nem éri el a 10 %-ot. Így hamarabb éri el a tenyészet a citromsavtermelés
szempontjából előnyös idiofázist Az alacsonyabb szénhidrátartalmú fermentlében jobb a pellet képződés. A
savtermelés megindulásakor kezdik adagolni a hiányzó táptalajt, mégpedig úgy, hogy az eredetileg bevitt és az
adgolt táptalaj összes szénhidrát-tartalma k.b. 18 %-ot érjen el. 15 nap fermentációs idő alatt 130 kg / m
3
citromsav szintet lehet ezzel a módszerrel elérni.

A mélyfermentáció leállásakor a micélium elválasztása nem könnyú feladat. A szűrési segédanyag
megválasztásakor figyelembe kell venni, hogy a kiszűrt micélium takarmányként kerül hasznosításra. Ezért
előszeretettel használnak cellulóz tartalmú növényi vagdalékot a szűrés meggyorsítás céljából, amit a
tenyészettel összekeverve juttatnak a vákuum dobszűrőn szűrendő elegy számára szolgáló tárolóedényébe.

A sejtmentes szűrletből az
oxálsavat még savanyú pH-nál kis
fölöslegben adott mésszel kálcium-oxalát
formájában lecsapják. A kalcium-oxalát
csapadékot újabb szűréssel eltávolítják.
Eközben a citromsav monokalcium-citrát
alakban oldatban marad. Az
oxálsavmentesített fermentléből a sok
szennyező anyag jelenléte miatt a
citromsav közvetlen kristályosítása nem
gazdaságos.
Előnyösebb a monokalciumcitrátot
trikalciumcitrát.tetrahidrát formájában
leválasztani, majd a csapadékból
kénsavval nyerni a szabad savat. Ez
utóbbi oldatból ioncserélő gyantán való
tisztítás és aktív szenes derítés után
bepárlással nyerhető a tiszta kristályos
termék. Kényes feladat a trikalciumcitrát
leválasztása. A hőmérséklet, a pH és a
mészadagolás sebességének az optimalizálása vezet eredményre. Legjobb, ha nagy kristályok képződnek, mert
az apró kristályok sok szennyezést zárhatnak magukba. Előnyösen 90
o
C-on, semleges körülmények között 180-
200 kg kálciumoxidot adnak m
3
-ként a monokalcium-citrátot tartalmazó szűrlethez, amelyből a trialcium-só
melegen kristályosodik. A kristályosítási anyalúg betöményítve állattápszerbe keverhető Ca tartalmú maradék.

A kiszűrt trikalcium-citrát.tetrahidrátból kis feleslegben adott 60 %-os kénsavval 50
o
C-on szabadítható
fel a citromsav. A kalciumszulfát zömét dobszűrőn elkülönítik, a csekély szerves színező anyagot aktívszenes
szűréssel távolítják el. A maradék kalciumszulfát eltávolításához egy erős kation cserélő (Dowex-50) és egy
közepes erősségű anion cserélő (Dowex-2) gyantát használnak. Az így nyert oldat 200-250 g citromsavat
tartalmaz literenként, amit vákuumban 40
o
C-on karamellizálódás nélkül töményítenek. A végső kristályosítást
monohidrát formában 20-25
o
C-on végzik. A kiszűrt kristályokat 36.5
o
C alatt szárítják. (40
o
C felett a citromsav
vízmentes savként kristályosodik). Az anyalúgot az utolsó aktívszenes tisztítási lépésbe töltik. Ismeretes az
irodalomba más kinyerési módszer is. Ilyen amikor a nyers terméket dikálcium só alakjában választják le. Mások
szerves oldószerrel extrahálják. Ezeknek előnyösebb volta nem ítélhető meg.


157
Citromsav monohidrát kinyerése a tenyészlé szűrletéből


Citromsavtartalmú szűrlet


Mésztej
Kálcium-oxalát
(szűrhető cspadék)



Kalciumcitrát (oldatban)


Kálcium-oxid


90°C-on kristályosítás

Trikalcium citrát
(kristályos alakban)



60%-os kénsav
50°C-on

KálKálcium szulfát
Csapadék

Citromsav (oldatban)



40°C-on vákuumban töményítve

Derítés, tisztítás
(aktív szén, ioncserélő)

20°C-on kristályosítás




Citromsav monohidrát
(kristályos termék)

Szárítás 36 °C-on

158

L- GLUTAMINSAV ELŐÁLLÍTÁSA

Japánban népélelmezési cikként fogyasztott tengeri barna moszat - a Konbu - (Laminaria japonica)
ízanyagát keresve az L-glutaminsav nátrium sóját találták meghatározó jelentőségűnek (Ikeda K. 1908 J. Tokyo
Chem. Soc. 30:820. ) Ez a vegyület a konzerv-ipar fontos alapanyagaként került használatba. Az acetilénből
vagy akrilonitrilből kiinduló kémiai (Strecker) szintézissel nyert DL glutaminsav csak reszolválás után
kerülhetne élelmiszeripari felhasználásra, amely művelet a termék piaci helyzetét rontja. Tudvalevő, hogy csak
az L-enantiomer stimulálja az izlelőbimbókban elhelyezkedő receptorokat, a D enantiomer teljesen íztelen. Ezért
a századunk első felében, főleg konzervipari felhasználásra gabona csírából állították elő ipari méretben a
glutaminsavat. A csírázó növényben meginduló fehérjeszintézishez szükséges aminosavak képződésekor ugyanis
a glutaminsav amino donorként nagy mennyiségben kerül felhasználásra a transzaminációs folyamatokban. A
szétroncsolt csíra vizes szuszpenziójából a glutaminsav - lévén amino dikarbonsav - könnyen kinyerhető. A
nyomokban megtalálható természetes eredetű szennyezés nem zavarja az élelmiszeripari felhasználókat.
Az antibotikum termelés céljára kifejlesztett bioreaktor az ötvenes években lehetőséget adott viszonylag
elfogadható áron élelmiszeripari alapanyagok előállítására. Az antibiotikum termelő törzsek termelőképességét
növelő genetikai, törzsnemesítési munkák eredményeként ugyanis szabad fermentációs kapacitás jelentkezett.
(Ekkor került a citromsav termelés is kevert, levegőztetett fermentorokba). Japán kutatók eredményei
irányították a figyelmet az aminosavak mikrobiológiai előállíthatóságára. Szorgalmas munka eredményeként,
mintegy 2000 átvizsgált prokariota és eukariota között több olyan törzs is akadt amelyik glükózt hasznosítva
nagy mennyiségben választott ki glutaminsavat a tápközegbe. Az átvizsgált baktériumok 20 %-a, a
Streptomyces-ek 30 %-a, az élesztők 30 %-a és a fonalas gombák 10 %-a volt képes jelentősebb mennyiségű
glutaminsav kiválasztására.
A mikroszervezetekről szerzett élettani ismeretek alapján várható volt, hogy ammónia jelenlétében a
képződő glutaminsav felszaporodik a környezetben, ha az o-ketoglutársav dekarboxilezésének a lehetősége
csökken. Escherichia coli-ból mutagén kezelésssel előállítottak a glutaminsavat termelő o-ketoglutarát-
dehidrogenáz hiányos törzset. Az élelmiszeripar azonban az E. coli alkalmazásától tartózkodik
Kiemelkedő termelő képességet mutatott egy Gram-pozitívan festhető baktérium csoport néhány
variánsa. Kinoshita és munkatársai által izolált baktérium törzset a termelőképességére utalva Micrococcus
glutamicus néven írták le (J. Gen. Appl. Microbiol. 3:276) Megjegyzendő, hogy az ipari hasznosíthatóság
céljából végzett kutató nem rendszertani szempiontból vizsgálják a számukra elérhető mikroorganizmusokat.
Ezért a fajnév általában szoros kapcsolatban van a törzs gyakorlati értékével. A nemzetség név pedig a
mikroszkópi látvány alapján adatik. Ebből következik, hogy az első felfedezést követően a txonomus a törzs
rendszertani helyét a kornak megfelelő vizsgálatok alapján illeszti a rendszertani helyére. Ezt a 30 g/liter
glutaminsav termelésére képes törzset a Kiova & Hakko Kogyo Co. Ltd. hamarosan ipari termelő törzsként
hasznosította Corynebacterium glutamicum néven. Mások Brevibacterum, Microbacterium, illetve Arthrobacter
néven izoláltak glutaminsav termelésre alkalmas egymástól alig megkülönböztethető törzseket. A vegyipar által
előállított mikrobiális eredetű nátrium-glutamát évi mennyisége a század-forduló idején már meghaladja a 350
ezer tonnát.
Ezek a Gram-pozitív, nem spórázó, nem mozgó baktériumok a növekedésükhöz biotint igényelnek,
amit a természetes élőhelyükön a környezetben kellő mennyiségben megtalálnak. A törzsekre jellemző, hogy az
o-ketoglutarát-dehidrogenáz aktivitásuk nem mutatható ki, illetve elhanyagolhatóan csekély, viszont a glutamát-
dehidrogenáz aktivitásuk feltűnően magas értéket ér el. A törzsek glutamát termelő képességét az izocitrát-liáz
aktivitás genetikai módszerrel történő csökkentésével fokozni lehet.
A glükózt mint szénforrást a Corynebacterium glutamicum törzs köztes anyagcseréje az Embden-
Meyerhof-Parnas úton, valamint a pentózfoszfát cikluson keresztül, a trikarbonsav ciklusba táplálja, ahol a
szénváz citromsavon, izocitráton keresztül oxidatív dekarboxilezéssel o-keto-glutársavvá alakul. Ebből a glutarát
dehidrogenáz hiány miatt felszaporodó termékből reduktív aminálással képződik a glutaminsav. Egy önálló kis
ciklusként, a NADP-függő glutamát dehidrogenáz működéséhez a NAPH szintet az izocitrát-dehidrogenáz
ekvivalens mennyiségben szolgáltatja. Az oxidatív dekarboxilezéskor képződő redukált kofaktort használja fel a
szervezet az ammónium ion beépítéséhez. A glutaminsavat termelő szervezetekben az izocitrát dehidrogenáz és
a glutaminsav dehidrogenáz aktivitás lényegesen meghaladja az átlagot. Az enzim működését a felgyülemlő
glutaminsav ugyan gátolja, de ha ennek a terméknek az eltávolítása megoldódik, akkor a glutaminsav termelés
akadálytalanná válik.
A ciklus működésének a feltétele a rendszer anaplerotikus feltöltése. Ezt a piruvát karboxiláz és a malát
enzim végzi. A karboxiláz szerepét igazolja, hogy jelzett szén-dioxid jelenlétében a glutaminsav karboxil
csoportja mindig radioaktív. A piruvát karboxiláz egy nagy moltömegű, négy alegységből álló alloszterikusan
szabályozott enzim komplex, amelynek működését az acetil-CoA serkenti. Az enzim lizin oldalláncához biotin
kapcsolódik. Az ATP segítségével aktíválódó szén-dioxid (adenilsav-szénsav vegyesanhidrid) kapcsolódik a
biotin nitrogénatomjához. A kialakuló karboxibio-citin fölöttébb aktív karboxilező ágensként reagálva a
159



160
Ez az aktiv állapotban levő szénsav származék ideális karboxilező ágens, amely piroszőlősavval
reagálva oxálecetsavat képez. Az oxálecetsav feldúsulása nem fenyeget, mert acetil-CoA-val reagálva
citráttá alakul, amelyből az igen aktív NADP függő izocitrát dehidrogenáz működésének eredményeként o-
ketoglutarát képződik. Ammónium ion hiányában azonban a környezetben megjelenik az o÷ketoglutarát.

161

GLÜKÓZ Corinebacterium glutamicum tenyészetben a
ATP AG
o

GLUTAMINSAV BIOSZINTÉZIS VÁZLATA
hexokináz -16 kJ
ADP

NADP
+
NADPH
G-6-P 6-PG
G6P dehidrogenáz (-NADPH)
G6P-izomeráz +1,6 kJ NADP
+

6-PG dehidrogenáz CO2
F-6-P NADPH
(÷ATP, ÷citrát)
ATP Pi
F6P-kináz bisz-foszfatáz Ru-5-P
(+ADP,+AMP)
epimeráz |
-14.2 kJ ADP Xu-5--P
F-1,6-P2
aldoláz +23,98 kJ foszfoketoláz Pi

DHAP GAP
+7.6 kJ izomeráz Acetil-P
NAD
+
Pi
GAP dehidrogenáz + 6,279 kJ
NADH
1,3-PG
ADP


PG kináz -18,84 kJ
ATP CoA-SH Pi
3-PG


PG mutáz | + 4,43 kJ foszfotranszacetiláz


2-PG
PG enoláz |÷÷>H2O + 1,8 kJ
P-E-P ADP
-31,39 kJ


PEP- piruvát kináz
(+FDP ÷citrát)

karboxiláz ATP CoA-SH
GDP TPP CO2 NAD
+
NADH
Pi CO2 PIRUVÁT ÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷>Acetil-S-CoA
PEP CO2 ATP piruvát dehidrogenáz (
÷ATP
)
karboxi piruvát karboxiláz (+acetil-CoA)
CO2 kináz
GTP ADP citrát szintetáz (
÷ATP
)
OXÁLACETÁT
NADH CIT--RÁT
almasav dehidogenáz ÷

28,046 kJ akonitát hidratáz
NAD
+

ALMASAV IZOCITRÁT
malát szintetáz

Acetil-CoA NAD(P)
+

izocitrát-
(+ADP)

H2O (gyenge) izocitrát liáz dehidrogenáz
fumaráz NAD(P)H
GLIOXALÁT CO2
FUMARÁT SZUKCINÁT o-ketoGLUTARÁT
FADH2 FAD (+ADP) NADPH
szukcinát dehidrogenáz glutamát dehidrogenáz

NH3

(-ATP)
NADP
+

Net: 3 NADH + ATP (zárojelben) a szabályozó metabolitok L-GLUTAMINSAV


A foszfoenol-piroszőlősav megjelenéséig a reakciósor önfenntartó az energiagazdag foszfátkötések
szempontjából, sőt NADH és NADPH felesleg mutatkozik a G6P- és GAP-dehidrogenáz valamint a piruvát-
dehidrogenáz működésének az eredményeként. A glioxalát ciklus részvétele az oxálecetsav képződésben glükóz
szénforrás használatakor jelentéktelen, különösen az izocitrát-liáz aktivitásban sérült nemesített törzs esetében.
Elvileg 1 mol glükózból 1 mol glutaminsav nyerhető.

C
6
H
12
O
6
+ NH
3
+ 1,5 O
2
= C
5
H
9
O
4
N + CO
2
+ 3 H
2
O

162
Ecetsav szénforrásból indulva – mert ilyen eljárás is szerepel a szakirodalomba – természetesen a feltöltést a
glioxalát ciklus végzi.

3 HOOC-CH
3
+ NH
3
+

1,5 O
2
= HOOC-CH
2
-CH
2
-HCNH
2
-COOH + CO
2
+ 3 H
2
O

Az ipari technológia kialakításakor az elméletileg leggazdaságosabb ideális állapotot kifejező fenti
egyenletek megközelítésére kell törekednünk annak ellenére hogy ezt az elméleti értéket az ipari gyakorlatban
nem lehet elérni. A 60 %-os átalakítás már elfogadható értéknek tekinthető. A termelés szintjét valójában a
szénforrás koncentrációja és a glutaminsav környezetbe való kiválasztásának a sebessége határozza meg. A
reakcióterméknek a környezetbe való megjelenése végeredményben természetellenes folyamat, hiszen a
köztesanyagcsere értékes termékéről van szó. Ennek ellenére a glutaminsav kiválasztást a membrán
áteresztőképességének a megváltozása teszi lehetővé. Tween 60 detergens adagolásával például fokozható az
aminosav kiválasztása. A glutaminsavat termelő törzsek csekély szukcinát szükségletét egyrészt a viszonylag
gyenge izocitrát-liáz aktivitás, másrészt az oxálecetsavból induló reduktív folyamatok elégítik ki. A glioxilsav
pedig acetil-CoA felhasználásával a ciklus feltöltését segíti.
A kutatómunka eredményeként kiválasztott természetes biotin igényes mutáns tiszta tenyészete a
kialakított üzemi körülmények között csak fellazult membrán szintézisére képes. A biotin-szint ugyanis az acetil-
CoA karboxiláz aktivitást befolyásolva a membrán minőségét befolyásoló zsírsav bioszintézisben okoz zavart. A
foszfolipidszintézis zavara az L- glutaminsav spontán kiáramlását segíti elő. Természetes élőhelyén a mutáns
biotin igénye nem jelent élettani problémát, mert ezt a vitamint a környezetből felveheti. Olajsav auxotrófok
esetében kis mennyiségben adott telített zsírsavval is gátolni lehet a membránépítőelemként nélkülözhetetlen
foszfolipid képződését, mivel a zsírsav fölösleg gátolja az acetil-CoA karboxilezését.
A membrán áteresztőképességét a biotin szinttől függetlenül penicillin adagolásával is növelni lehet. A
sejtfal szintézis zavara ugyanis a sejt hosszanti növekedését segíti elő. A membránszintézis nem követi a sejt
térfogatának növekedését, a fellazult membrán pedig átengedi a képződő glutaminsavat. A penicillin szintet ez
esetben úgy kell megválasztani, hogy a tenyészet növekedése a biotinszegény körülményekre jellemző
növekedést ne haladja meg. Ez a felismerés lehetővé tette a gazdaságos glutaminsav termelést biotinban gazdag
olcsó szénforrás felhasználásával. Ennek felismerése a cukorgyártás melléktermékeként képződő biotinban
gazdag melasz is felhasználhatóvá vált az ipar szá,ára.
Nakao izolált egy L-glicerin-3-foszfát NADP
+
-oxidoreduktáz hiányos glicerin igényes mutánst (1970
Agric. Biol. Chem. 34:1875), amely penicillin nélkül képes volt normál paraffinből is glutaminsavat kiválasztani
a környezetbe (1972 Agric. Biol. Chem. 36:809). A 0,01 % glicerint tartalmazó táptalajon a membránhoz
szükséges foszfolipid szintet ez esetben a glicerin tartalom, az o-glicerinfoszfát képződés limitálta.
Egy Corynebacterum glutamicum 541 jelű törzsével vezetett eljárás adatait bemutató ábra szemlélteti,
hogy a növekedés kezdeti szakaszában az átmenetileg felszaporodó NADH miatt megjelenik a tejsav, az öregedő
tenyészetben viszont az o-ketoglutársav.

szénforrás % glutaminsav
termék %
5 _ 10 sejttömeg

glükóz
4 _ 8


3 _ 6


2 _ 4


1 _ 2 o÷ketoglutarát
tejsav

| | | | | | | | |
24 48 72 96 óra
Táptalajösszetétel: 100 g glükóz, 5 g karbamid (ammónia bevezetés esetenként a pH 8 szint tartása céljából), 2,5
ug biotin, 1 g káliumfoszfát, 0,25 g magnéziumszulfát, 0,01 g vasszulfát, 0,01 g mangánszulfát literenként. 28
o
C
hőmérsékleten
163
Az iparban használt termelő törzs limitált biotin jelenlétében (2,5-3 ug/liter) nagy mennyiségű
glutaminsavat választ ki a környezetbe. A baktérium növekedése szempontjából ez nem előnyös. A termelés
szempontjából viszont hasznos a visszafogott növekedés. Ipari méretben szénforrásként 10-20 % szacharózt
tartalmazó táptalajt, melaszt, vagy keményítő hidrolizátumot használnak. A glutaminsav szintézishez szűkséges
ammóniát vagy gázalakban levegővel elegyítve vagy karbamid formájában adagolják. Az eljárást pH=8 körüli
értéken tartva vezetik. A széforrás hasznosítás általában meghaladja az 50 %-ot
A tápközeg biotin tartalmának növelése ÷ 5 ug felett ÷ a prolinképződést serkenti. A biotin mennyiségét
tizszeresre emelve glutaminsav helyett a glükózból képződő tejsav és szukcinát jelenik meg a tenyészlében.
Oxigén hiány a redukált kofaktorok feldúsulása miatt a tejsav és borostyánkősav képződésnek kedvez,
túllevegőztetés hatására viszont az ammónium ion kiűzése miatt a glutaminsav helyett o-ketoglutarát szaporodik
fel a tenyészlében.
A termék kinyerése szempontjából ipari körülmények között 10 %-ot meghaladó glutaminsav szint
elérésére törekednek. Ezt a termelési szakaszban adott glükózzal érik el. A tenyésztés hőmérsékletének emelése
rontja az oxigén beoldódását, azaz a tenyészet oxigénellátását. Általában 28-35
o
C-on vezetett 5-6 napos
fermentációs lépés végén, a beadott szénforrás felhasználása után nyert sejtmentes szűrletből történik a
glutaminsav elkülönítése. A táptalajban maradó cukor zavarja a glutaminsav kristályosodását. A sejtmentes
szűrletet hevítve besűrítik, a képződő csapadékot forrón kiszűrik. A nyert éles szűrletet hagyják lehűlni. 90
o
C-
ról induló kristályosodáskor apró ß formának nevezett tűkristályokat nyerünk, amely sok esetben az anyalúg
szennyezését is magába hordozza. 70
o
C-on vezetett kristályosodás körülményei között az o-formát, prizma
alakú kristályokat nyerhetünk.
Nagyipari méretben kémiai úton előállítható ecetsavból is gazdaságosan nyerhető glutaminsav. Egy 1975-ben
bejelentett US szabadalom (3929575) szerint a
Brevibacterium divaricatum NRRL B-231 törzs
inokulum táptalaja literenként 40 g glükózt, 1 g
K
2
HPO
4
-ot, 0,5 g MgSO
4
.7 H
2
O-t, 1 g
élesztőkivonatot és 8 g karbamidot tartalmazott A
tenyésztés 16 órán keresztül 35
o
C-on folyt. A 6 %
oltóanyaggal oltott főfermentáció tápközege
literenként 121 g glükózt, 5 g ammónium acetátot,
6 g keményítőhidrolizátumot, 1,2 g kálium-
foszfátot, 1,2 g kálium szulfátot, 6 g
magnéziumszulfátot kevés vasat és mangánt
tartalmazott. A tenyésztés megindításakor 0,65 ml
olajsavat adagolnak literenként. A pH-t ammónia
adagolással 7,8 értéken tartják. A sejtszaporodási
szakasz végén – általában a 14-ik órában – a
tenyésztés hőfokát 32
o
C-ról 38
o
C-ra emelik. A
glükóz szint 1 %-ra csökkenésekor kezdik a
glükóz adagolást ami általában literenként 160 g
glükóz adagolását jelenti. A levegőztetést úgy
szabályozzák, hogy az elmenő levegő széndioxid
tartalma ne haladja meg a 4.5 térfogat % értéket. A
tenyészlé glutaminsav tartalma általában 35 órás
korban éri el a 100 g/liter értéket.

Glutaminsav teremelés ecetsavból
164
ESSZENCIÁLIS AMINOSAVAK IPARI ELŐÁLLÍTÁSA

A növényi fehérje aminosav összetétele lényegesen különbözik az állati szervezetben előforduló
fehérje aminosav tartalmától. (kukorica: 0,2%, zab:0,5%, árpa: 0,4%, búza: 0,6%, szója 2,3%, élesztő 3,4%,
tejpor:2,5%, húsliszt: 2,6% lizint tartalmaz) Ezért a növényi fehérje jobb hasznosulása takarmányként
elősegíthető megfelelő arányban adott esszenciális aminosavakkal. A nem teljes értékű növényi fehérjét az állati
szervezet csak saját aminosav igényének megfelelő mértékben, a saját fehérjére jellemző aminosav arányban
képes hasznosítani. A tenyészállatok a számukra fölösleges aminosavakat az anyagcsere enzimrendszerének
segítségével lebontják, átalakítják, a fölös szénvázat pedig elégetik.
A takarmány kukorica 0,11% metionint 0.21% lizint 0,36% treonint tartalmaz
a takarmány búza 0,23% metionint 0,61% lizint 0,50% treonint tartalmaz
a takarmány árpa 0,17% metionint 0,41% lizint 0,36% treonint tartalmaz
a szójaliszt 0,53% metionint 2,31% lizint 1,41% treonint tartalmaz.
Az ideális takarmányban a lizin hiány kielégítése után a treonin és a metionin igény kielégítése szükséges. A
mikrobiológiai eljárással nyerhető aminosavak közül általában a lizin, a triptofán és a treonin kerül
felhasználásra tápanyagkiegészítőként. A világ évi lizintermelése 250 ezer tonna. A treoninból 10 ezer tonna
kerül felhasználásra. Az évi triptofán termelés mindössze 200-300 tonna. Az állattápszerben évenként
felhasznált 300 ezer tonna DL metionin kémiai szintézissel készül, mert a sertések és a szárnyasok racemáza a
DL-metionin 100%-os hasznosulását biztosítja. Cél a fehérjeszintézis szempontjából ideális aminosav készlethez
megközelítése. Ha a kukorica lisztet 0.2% lizinnel kiegészítjük, akkor a fehérje hasznosíthatósági hányadosa
0.85-ről 1.05-re emelkedik, de ha 0.2% lizinen kívül még 0.07% triptofánt is adagolunk akkor a
hasznosíthatósági hányados 2.55-re emelkedik. A rizs fehérjetartalmának kiegészítése 0.2% lizinnel és
ugyanennyi treoninnal a hasznosíthatósági hányadost 0.5-ről 2.61-re növeli. Még a szójaliszt is kiegészítésre
szorul. Kémiai szintézissel nyerhető metioninnal válik teljes értékűvé.
A létért folyó küzdelemben kialakulult szabályozó mechanizmusok működése az eredeti vad törzsekben
a bioszintézis egyes végtermékeinek a túltermelődését eredményesen gátolva biztosítja az élő szervezet számára
a gazdaságos létfenntartást.
A szabályozási mechanizmus az élő világban azonos elvek szerint működik, de nemek, fajok sőt törzsek
esetében, a szabályozás kivitelezésében eltérések lehetnek. A szakember éppen ezeket a kivitelben jelentkező
különbségeket hasznosítja. Az esszenciális aminosavak fermentációs úton folyó előállítása nem más, mint a
modern mikrobiológiai alapkutatás eredményeinek gyakorlati alkalmazása; nem kevesebb, mint az aminosav-
bioszintézis szabályozó mechanizmusainak megismerését követő tudatos genetikai munka eredményeinek ipari
gyakorlatba való használata.
A citoplazmában folyó nitrogén anyagcsere didaktikai szempontból anabolikus és katabolikus folyamatra
különíthető. Valójában a két folyamat egymáshoz kötődve, egymást kiegészítve működik szoros kapcsolatban a
szénhidrát anyagcserével. A mikrovilág ide sorolt anabolikus folyamatai életfontosságúak az egész élővilág
fennmaradása szempontjából, mert az esszenciális aminosavak bioszintézisére, a légköri nitrogén megkötésére,
bizonyos vitaminok, cobalamin származékok előállítására csak a mikrovilág, ezen belül a prokariota flóra képes.
Az aminosav anyagcsere részletes megismerése, az aminosav képződés szabályozó mechanizmusainak
felderítése a mikrobiológiai biokémia művelőinek kiemelkedő teljesítménye volt az ötvenes években. Ezek az
eredmények ma tankönyvi adatnak számítanak.
Az aminosavakat aktiváló enzimek csekély mérvű szubsztrát-specifitása csak meghatározott összetételű
aminosav készlet [pool] esetén tudja biztosítani a tRNS állomány helyes feltöltését. A fölösleges aminosavak
eltávolítása tehát létkérdés a mikróba számára. A koncentráció viszonyok, az arányok bármilyen okból bekövetkező
eltolódása, hibás tRNS feltöltést és ennek következményeként hibás, működésképtelen fehérjék szintézisét
okozhatja. Nem meglepő tehát, hogy a bioszintézis és a lebontás szabályozottságának bonyolultan, de eredményesen
működő mechanizmusa alakult ki az evolúció eredményeként. A gazdaságos életvitel érdekében a citoplazmában ta-
lálható peptidázok azokat a fehérjéket, amelyek már nem kerülnek felhasználásra lebontják vagy azért, mert hibásan
készülve működésképtelenek, vagy pedig jelenlétük szükségtelen, építőelemeik más irányú felhasználásra
kerülhetnek.A fehérjeszintézishez szükséges aminosavak előállítására az úgynevezett vad törzsek általában képesek.
Ez a bioszintézis a citoplazmában, -a szénhidrát anyagcsere köztestermékeit hasznosítva,- nem csekély energia
befektetéssel illetve anyagfelhasználással szigorúan szabályozott körülmények között folyik. Az aminosav készlet
optimális minőségi és mennyiségi összetételét a bioszintézis első reakcióját katalizáló enzimre ható visszacsatoló
(feed-back) mechanizmus szabályozza, szükség szerint gátolva vagy serkentve működését. Egy-egy aminosav
túlzott feldúsulása a túlélés érdekében a lebontására specifikus enzimrendszerek képződését indukálhatja.
A körülményektől függő mértékben a mikroba a bioszintézisben érdekelt enzimek mennyiségét a represszor
eltávolításával - azaz a struktúrgének átírásának engedélyezésével - a szükségletnek megfelelő mértékre növelheti
(derepresszió). Mivel a fehérjeszintézis anyag és energiaigényes folyamat, a gazdaságos életvitelt szolgálja a
szabályozást finomító második rendszer (attenuator) működése, amely végül is a feltöltött tRNS mennyiségének
függvényében engedélyezi a bioszintézisben érdekelt gének átírását.
165

LIZIN bioszintézis
Vizsgáljuk tehát az Escherichia coli-ban kialakult mechanizmust, amely aszparaginsavból indulva nem
csak a lizin finoman szabályozott képződését, de más esszenciális aminosavak treonin, metionin és az elágazó
szénláncú valin, izoleucin és leucin bioszintézisét katalizálja. Az összetett rendszer gazdaságos működtetését
egyrészt izoenzimek működése biztosítja, másrészt a kritikus elágazási pontokon a végteremék okozta visszacsatolás
(feed-back mechanizmus) hatása érvényesül. Megjegyzendő, hogy a diaminosav a peptidoglükán sejtfal felépítés
nélkülözhetetlen eleme A sejtfal felépítés bifunkcionális építőelemként szerepel az L-lizin, az L,L-
diaminopimelinsav illetve a mezo-diaminopimelinsav.

Esszenciális aminósavak szabályozott szintézise ASZPARTÁT aszparaginsavból (Escherichia coli)
[HomTre] [Liz]
{strukturgén NEVE} ATP
[1] izoenzim képződését [Tre és Ile] gátolja {lysC} aszpartát-kináz
[2] izoenzim képződését [Met] gátolja [1] [2] [3]
[3] izoenzim képződését [Liz] gátolja ADP
[1a] izoenzim képződését [Tre] gátolja ASZPARTIL FOSZFÁT
[2a] izoenzim képződését [Met] gátolja
NADPH
feed-back gátlás jelzése: |Tre] |Liz] |Hom] |Ile] |Val] |Leu] {asd} aszpartátfélaldehid-dehidrogenáz
NADP
+


ASZPARTÁT-ß-FÉLALDEHID
= |Liz] [Tre] [Met] NADH

{dapA} dihidrodipikolinát-szintetáz {thrA} {hom} homoszerin-dehidrogenáz
piruvát
[1a]- [2a] NAD
+

2,3-DIHIDROXI-DIPIKOLINÁT HOMOSZERIN
|Tre]=
NADPH ATP
{dapB} dehidrogenáz {thrB} homoszerin-kináz
NADP
+
ADP = |Met]
A
1
-PIPERIDIN-2,6-DIKARBOXILÁT HOMOSZERIN-FOSZFÁT szukcinilCoA

szukcinil-CoA H2O aciltranszferáz
{dapC} acil transzferáz {thrC}treonin-szintetáz CoA-SH
Pi
N-SZUKCINIL- TREONIN O-SZUKCINIL
2-AMINO-6-KETO- |Ile] = HOMOSZERIN
L-PIMELÁT { ilvA} treonin-dezamináz
piruvát NH3
o-KETOIZOVALERÁT o÷KETOBUTIRÁT cisztein
Glutamát =|Leu] /\
{dapD}transzamináz ipm.szintáz [Val]= { ilvBN} AHS szintetáz cisztation ¸-szintetáz
o-ketoglutarát acetil-CoA <-------piruvát--------->
szukcinát
N-SZUKCINIL-L,L-2,6- o-IZOPROPIL- o-ACETO- CO2 o-ACETO-
DIAMINOPIMELÁT MALÁT LAKTÁT o-HIDROXI- CISZTATION
BUTIRÁT
(dapE)deszukciniláz NADPH NH3
ipm.izomeráz {ilvC} reduktáz,mutáz cisztation ß-liáz
szukcinát NADP
+
piruvát
L,L -2,6- ß-IZOPROPIL- o.|÷DIHIDROXI- o.|÷DIHIDROXI- HOMOCISZTEIN
DIAMINO- MALÁT IZOVALERÁT ß-METILVALERÁT
PIMELÁT NAD
+

{ilvD}dihidroxisav-dehidráz N
5
-metil-FH4
{dapF} epimeráz ipm.dehidrogenáz metil-transzferáz
H2O FH4
NADH
mezo-2,6- o÷KETO- o÷KETO o÷KETO-ß-
DIAMINO- IZOKAPROÁT IZOVALERÁT METILVALERÁT
PIMELÁT
glutamát glutamát
( lysA}dekarboxiláz transzamináz-B {ilvE} transzamináz-B
CO2 o-ketoglutarát o-ketoglutarát

LIZIN LEUCIN VALIN IZOLEUCIN METIONIN

A felsorolt esszenciális aminosavak finoman szabályozott bioszintézise aszparaginsavból indul. Az igényeknek
megfelelő mértékben oxálecetsavból képződő aszparaginsav foszforilezését első lépésként három represszálható
izoenzim végzi. Az izoenzimek képződését szelektíven az összekapcsolódó bioszintézis út végtermékei (az egyiket
166
lizin, a másikat metionin, a harmadikat pedig az izoleucin) represszálják. Ez indokolt, mert az aszpartilfoszfátból
(aszparaginsav-foszforsav vegyesanhidrid) NADPH igényes reduktív hidrolízissel képződő aszparaginsav-ß-aldehid
valójában olyan közös köztes termék, amely kiindulási anyag az említett aminosavak bioszintéziséhez.
A szabályozás enzimszinten is érvényesül. A lizinnel represszálható izoenzim működését a lizin - mint
végtermék - alloszterikusan is gátolja. Az izoleucinnal és treoninnal represszálható izoenzim működését pedig két
végtermék, a treonin és a homoszerin befolyásolja. A metioninnal represszálható izoenzim alloszterikus
szabályozottságáról nincs adat. Ez az izoenzim tehát biztosítja a teljes rendszer működéséhez szükséges aszpartát-ß-
félaldehid alapszintet.
Az aszpartát |-félaldehid piruváttal reagálva dihidrodipikolinát-szintetáz (dapA) jelenlétében 2,3-
dihidrodipikolináttá kondenzálódik. Az enzimszint a termékképzést befolyásolja. A kondenzációt végző enzimnek a
specifikus aktivitása a végtermék képződését meghatározza, működését a lizin felszaporodása alloszterikusan
szabályozza.
Az aszparaginsav-ß-félaldehidből két NADPH függő homoszerin-dehidrogenáz izoenzim végzi a többi
esszenciális aminosav képződéséhez szükséges homoszerin szintézisét. Az egyik képződését metionin represszálja, a
másik dehidrogenáz képződését pedig a treonin és az izoleucin felszaporodása befolyásolja. Ez utóbbi működését a
treonin, mint végtermék alloszterikusan is gátolja
A homoszerinből indul a cisztationon és homociszteinen keresztül vezető metionin szintézis. Az első
enzim aktivitását - a homoszerinszukcinil-transzferáz működését - a metionin, mint végtermék alloszterikusan
gátolja. A homoszerinből induló treonin szintézis első enzimének, a homoszerin-kináznak a működését
természetszerűleg a treonin szabályozza alloszterikusan. Az izoleucin a treoninból induló bioszintézis első
enzimének a treonin dezamináznak a működését gátolja alloszterikusan, ugyanakkor represszálni képes a
bioszintézisben résztvevő enzimek képződését. Az izoleucin szintézisút második enzimének, az acetohidroxisav
szintetáznak a működését a valin gátolja alloszterikusan, mivel a valin szintézis szempontjából ez szerepel első
enzimként. Az enzim közös használata miatt az ebből adódó veszélyt úgy oldja fel a rendszer, hogy a treonin
dezamináz által szolgáltatott o -ketovajsav előnyt élvez a piruváttal összehasonlítva a kondenzációt katalizáló
enzim aktív felületén. A leucin szintézishez a valin szintézis köztesterméke az o -ketoizovaleriánsav szolgál
kiindulásul. A négy reakciólépést igénylő bioszintézis első enzimének az acetil-CoA-t igénylő izopropilmalát
szintetáznak a működését a leucin gátolja alloszterikusan.
Az elágazó szénláncú aminosavak bioszintézisének bonyolult szabályozottsága külön figyelmet érdemel
a közösen használt enzimekre való tekintettel. A zavartalan fehérjeszintézishez ugyanis a három aminosav
optimális aránya szükséges. Erre való tekintettel bármelyik aminosav feldúsulása, vagy a környezetben való
megjelenése esetén indukálódik a lebontást végző enzimrendszer, amely azután kiegyenlíti az eltérést.
A lizin ipari előállítását célzó kutató-fejlesztő munka az ismeretek bősége miatt kezdetben a Gram-
negatív baktérium törzsekre vonatkozó ismeretekre támaszkodva igyekezett eredményt felmutatni. A lizin
előállításának első ipari méretben alkalmazott biotechnológiai módszere ma csak tudománytörténeti érdekessége
miatt említendő. Davis már 1952-ben észlelte, hogy az Escherichia coli-ból nyert lizinigényes auxotróf a
bioszintézis út utolsó lépését katalizáló enzim {lysA} hiánya, illetve működésképtelensége miatt limitáló
mennyiségű lizint tartalmazó táptalajon jelentős mennyiségben halmozza fel a mezo-diamino-pimelinsavat (9g /
liter). A lizin hiány egyrészt a bioszintézisben szereplő enzimek derepresszióját okozza, másrészt lizin hiányában
a feed-back szabályozó mechanizmus sem működhet. Az akkor kidolgozott eljárással a E. coli (ATCC 13024)
mutáns felhasználásával literenként 24 g diamino-pimelinsavat termeltek, amit egy második biokonverziós
lépésben az Aerobacter aerogenes (ATCC 12409) diamono-pimelinsav dekarboxiláz aktivitását hasznosítva
alakították lizinné. Ez utóbbi enzim - esetleg az enzimet termelő mikroorganizmus - reaktorba rögzítve,
hosszabb ideig használható a lizin igényes Escherichia coli tenyészlében felhalmozódó mezo-diamino-pimelát
dekarboxilezésére, lizinné alakítására.
Gazdaságosabbnak látszott azonban olyan eljárás kifejlesztése, amelyik közvetlenül lizint szolgáltat.
Ennek érdekében nagy számban vizsgálták meg a természetes forrásból izolált mikroorganizmusokat abban
bízva, hogy sikerül olyan törzseket találni, amelyek az esszenciális aminosavak gazdaságos termelésére
lehetőséget adnak.

Lizin képződés az élesztőkben
Lizin termelés szempontjából az élesztőket is megvizsgálták, mivel a takarmányélesztő gyártása és
felhasználása világszerte a közegészségügyi hatóságok által elfogadott gyakorlat volt. A gombákban a
prokariotáktól és a növényektől eltérően nem aszparaginsavból indulva képződik a lizin, hanem glutaminsavból.
A bioszintézis útja o-ketoglutársavból aminoadipinsav-félaldehiden keresztül vezet.
Az élesztőben folyó lizin bioszintézis genetikai hátterét részletesen vizsgálva a lizin képződés fokozását
célzó genetikai beavatkozás eredménytelensége némi magyarázatot lelt, mert Lindegren és Mortimer
eredményei szerint a bioszintézisben résztvevő enzimek struktúrgénjei szétszórva más-más kromoszómán
találhatók.

167
HOOC-CH-CH2-CH2-COOH GLUTAMÁT L-lizin bioszintézis Saccharomyces cerevisiae
| ill. Neurospora crassa tömlős gombában
NH2 transzamináz

HOOC-C-CH2-CH2-COOH o-KETOGLUTARÁT
|| acetil-CoA
O
homocitrát-szintetáz
COOH CoA-SH
|
HOOC-CH2-C-CH2 -CH2-COOH HOMOCITRÁT
|
OH
homocitrát-dehidráz
COOH H2O
|
HOOC–CH=C–CH2 –CH2–COOH cis-HOMOAKONITÁT
H2O
homocitrát-hidráz
COOH
|
HOOC-CH-CH -CH2 -CH2-COOH HOMOIZOCITRÁT
|
OH NAD
+

CO2 homoizocitrát-dehidrogenáz
NADH
HOOC-C-CH2-CH2 -CH2-COOH o-KETOADIPÁT
||
O Glu
o-aminoadipát-transzamináz
o -ketoglutarát
HOOC-CH-CH2 -CH2 -CH2-COOH o-AMINOADIPÁT
|
NH2 ATP
o-aminoadipát-adenililtranszferáz
PPi
HOOC-CH-CH2 -CH2 -CH2-C-O-PO2 -Ado o-ADENILIL-o-AMINOADIPÁT
| || |
NH2 O OH
NADPH
o-adenilil-o-aminoadipát-reduktáz
NADP
+

HOOC-CH-CH2 -CH2 -CH2-CH-O-PO2 -Ado o-ADENIL-o-AMINOADIPÁT-o-FÉLALDEHID
| | |
NH2 OH OH
o-adenil-o-aminoadipát-o-félaldehid hidroláz
AMP
HOOC-CH-CH2 -CH2 -CH2-CHO o-AMINOADIPÁT-o-FÉLALDEHID
| NH2
NH2 |
HOOC-CH-CH2-CH2-COOH
o-aminoadipát-o-félaldehidglutamát-reduktáz
HOOC-CH-CH2 -CH2 -CH2-CH2 -NH
| | SZACHAROPIN
NH2 HOOC-CH-CH2-CH2-COOH
NAD
+

szacharopin-dehidrogenáz
o -ketoglutarát NADH

HOOC-CH-CH2 -CH2 -CH2-CH2 -NH2 L- LIZIN
|
NH2

A szacharopin dehidrogenáz IX
a o-adenil-o-aminoadipát-o-félaldehid hidroláz II és VII.
A homocitrát-dehidrogenáz XII,
az o-aminoadipát-o-félaldehidglutamát-reduktáz XII, (II-L), VII
a homoizocitrát-dehidrogenáz V kromoszómán található R irányban leolvasható formában

Nem véletlenül – az ipar képviselői – minden energiát a lizin termelésre alkalmas prokariota
kiválasztására illetve előállítására (nemesítésére) forditották. A természetben előforduló törzseket kereső
kutatómunka eredménytelenségét tapasztalva részletesen vizsgálták, hogy milyen előfeltételei vannak egy
168
bioszintetikus termék túltermelésének és a tenyészközegben való feldúsulásának? Elvileg a szintézisút
visszacsatoló-szabályozó mechanizmusát (feed-back) hatástalanítva a bioszintézishez szükséges építőelemek és
kofaktorok jelenlétében akadálytalanná nemesedik a termékképződés. Fokozható a termékképződés a
bioszintézisben résztvevő enzimek mennyiségének összehangolt növelésével, a represszált állapot
felfüggesztésével. A represszív hatást kifejtő vegyület analógjával szemben megjelelnő rezisztencia sok esetben
az eredeti vegyület bioszintézisét végző enzimek derepressziójával jár. A végtermék analógokra kifejlesztett
rezisztencia nemcsak a bioszintézisben résztvevő enzimek képződésének a represszióját függeszti fel, de a feed-
back szabályozás felfüggesztése a hasznos-termék képződésének a növekedéséhez vezet. A kiválasztott termék
feldúsulását biztosítja a továbbalakításért felelős enzim inaktiválása. Amennyiben a továbbalakuló termék
valamilyen esszenciális vegyület képződését segíti, akkor előnyös erre az anyagra hiánymutánst keresni a
mutagén kezelést túlélő egyedek között.
Hatásos módszer lehet a bioszintézisért felelő enzimek mennyiségének a fokozása az enzimek
génjeinek a gazdasejtbe juttatásával, illetve a kópia szám többszörözésével. A működőképes enzimek
mennyiségének a növelése csak az esetben szolgálja a kiválasztott termék mennyiségének a növelését, ha a
szintézishez szüksége építőelemek, valamint a kofaktorok kellő mennyiségben és minőségben rendelkezésre
állnak.
A genetikailag adott lehetőségek kihasználását segíti a termékképződés szempontjából optimális
fermentációs paraméterek meghatározása és a technológiai követelmények szigorú teljesítése. A lizint
túltermelő törzs nyerése céljából első feladatként mutagén kezeléssel S-ß-amino-etil-ciszteinre (lizin analóg)
rezisztens törzset állítottak elő. A lizin rezisztencia kifejlesztésére az S-amino-etil-ciszteinen kívül sikerrel
használják L-lizin analógként az amino-etil-O-szerint, a ¸-metil-lizint és az o-klór-c-amino-kaprolaktámot,
valamint az o-amino-o-hidroxi-lizint, lizin-hidroxamátot
.
H-N-H H-N-H H-N-H H-N-H H-N —– H-N-H H-N-H
H-C-H H-C-H H-C-H H-C-H H-C-H H-C-H H-C-H c
H-C-H H-C-H H-C-H H-C-H H-C-H H-C–OH H-C-H o
H-C-H S O H-C-CH
3
H-C-H

H-C-H H-C-H ¸
H-C-H H-C-H H-C-H H-C-H H-C-H H-C-H H-C-H |
H-C-NH
2
H-C-NH
2
H-C-NH
2
H-C-NH
2
H-C–Cl H-C-NH
2
H-CNH
2
o
O=C–OH O=C–OH O=C–OH O=C–OH O=C —– O/=C–OH

O=C


H–N–OH
L-lizin SAE-Cys AEO-Cys ¸-Me-lizin Kaprolakt. o-OH-lizin Lizin hidroxamát

Ezek a vegyületek versengve a lizinnel nemcsak alloszterikusan gátolják a lizin bioszintézis kulcsenzimeinek a
működését, de zavarják a fehérje szintézist, mégpedig olyan mértékben ahogy a lizin-tRNS aciláz működését
zavarva az analóg verseng a jelenlevő lizinnel. A tRNS hibás feltöltése ugyanis letális hatásúvá válhat. Az S-ß-
amino-etil-ciszteinnel töltött lizil-tRNS-t ugyanis a riboszóma felületén folyó fehérjeszintézis akadálytalanul
felhasználja. Az analóg jelenlétében csak azok a mutánsok maradnak életben, amelyek olyan mennyiségben
termelnek lizint, amely már képes ellensúlyozni az aminosav-analóg káros hatását. A feladatot a biszintézisben
résztvevő enzimek derepressziója és a végtermék szabályozó hatásának a felfüggesztése oldhatja meg. Elvben
elképzelhető egy nagyobb szubsztrát-specifitású aminoacil-tRNS acilázt működtető törzs megjelenése. Erre
azonban példa a szakirodalomban nem ismeretes. Sokkal könnyebb olyan törzset izolálni, amelyben a represszor,
illetve a feed-back szabályozás nem működik. A feed-back érzékeny kulcsenzimek szabályozó szerepének a
kikapcsolása a hagyományos klasszikus genetikai módszerek alkalmazásával könnyebben megoldható. A
kritikus helyen levő egyetlen aminosavat kodoló triplet megváltozása már a feed-back hatás elvesztésével járhat.
A lizin analógok felvételét a lizin-permeáz segíti. A mikrobába került analóg az aszpartát-kináz
működését a lizinnel azonos nagyságrendben gátolja, sőt az Escherichia coli-ban az aszparaginsavfélaldehid-
dehidrogenáz és a dihidropimelát-reduktáz aktivitását is befolyásolja. A corineformokban ilyen gátló hatás nem
jelentkezik. A lizin termelés serkentése céljából előállított hiánymutánsokat (Leu
÷
Hom
÷
Met
÷)
használva limitált
mennyiségben adott homoszerin, izoleucin, leucin, metionin és alanin jelenlétében érték el a legmagasabb
termelési szintet. A leucin függőség kifejlesztését indokolja, hogy a leucin fölösleg sok esetben represszálja a
dihidro-dipikolinát képződést.
Aminosav függő mutánsok előállítása céljából különböző mutagén ágens használható. Kiindulásként a
kezelendő sejtszuszpenziót logaritmikusan növekedő tenyésztből célszerű elkülöníteni. Az élősejt mennyiségét
kazamint és élesztőkivonatot tartalmazó agar táptalajra szélesztve határozzák meg. A higítást minden esetben
úgy választják, hogy egy lemez 25-100 megkülönböztethető koloniát tartalmazzon. Egyszerűsége miatt a 90-99
%-os pusztulást okozó 200-300 nm hullámhosszú besugárzást követően a kezelt baktériumszuszpenziót 10-20
egység G-penicillint tartalmazó minimál táptalajba szuszpendálva inkubálják 30 °C-on egy éjszakán keresztül.
Ilyen körülmények között nem csak a túlélők, de a helyreállító mechanizmus gátlástalan működéséből
bekövetkező visszarendeződés miatt növekedő baktérium sejtek is elpusztulnak.
169
A fotoreaktíválás hatásának a csökkentése miatt a tenyészetet célszerű fénytől elzárva tartani. Az
irodalom több visszarendeződést gátló vegyület – például koffein – használatát javasolja. A G-penicillin
hatásáról a penicillin mentes kontrol csőben a besugárzást túlélő, illetve regenerálódó sejtek növekedése
számszerűen tudósít, mivel nefelométerrel mérhető a denzitásnövekedés. A penicillint tartalmazó
szuszpenzióhoz adott penicillinázzal az eddig növekedésnek nem indult mutánsokat kazamint tartalmazó,
valamint minimál táptalajra kell széleszteni. Olyan higítást kell készíteni amelyből lemezenként 100-100 kolónia
nem jelenik meg néhány napig tartó inkubálás után sem.
A kazaminos táptalajon kinőtt telepeket minimál táptalajra replikázva a kazaminos lemezen meglevő
kolóniák közül kiválaszthatjuk azokat, amelyek még auxotrófok maradtak. Ha a minimál táptalajra való
átmásolás után olyan minimál lemezre is másolatot készítünk, amely azt az aminosavat tartalmazza, amelyre
való függöséget kívánjuk kialakítani. Szerencsés esetben a megjelenő kolóniák közül kiválaszthatók azok a
mutánsok, amelyeket célszerű tovább vizsgálni. A kiválasztott kolóniáról minimál táptalajra és a célzott
aminosavval kiegászített minimál táptalajra átoltást készítünk. Ez utóbb műveletet többször megismételve a törzs
stabil aminosav függősége bizonyítható. Lizin termelő törzs kiválasztása céljából. homoszerin, izoleucin és
metionin, esetleg treonin igényes törzs előállítása céljából a kapott mutánssal ismételve a mutagén kezelést
lehetőségünk van a megfelelő aminosavaktól függő mutánsok előállítására. Ez esetben a penicillinnel kezelendő
minimál táptalaj természetesen tartalmazza azt az aminósavat is, amelyet a besugárzott mutáns igényel.
A homoszerin

és leucin

függő törzsekből
ezután rezisztens variánsok nyerése a cél. Ilyen
törzset aminoetilciszteint és az igényelt
aminosavakat tartalmazó táptalajon lehet nyerni
többször ismételt kezeléssel. A nyert mutáns
stabilitásának ellenőrzése után az előállított
mutánsok fenntsrtása olyan táptalajon történik,
amely minden esetben tartalmazza a megfelelő
lizinanalógot. A rezisztencia kialakításához
egymást követően több lizinanalógot célszerű
felhasználni és ezzel a rezisztencia mértékét
fokozni. Az ábra az aminoetilciszteinnel
szemben kialakuló (FA 1-30 és FA 3-115
mutánsok) rezisztencia követekezményeként
megjelenő aszpartokináz aktivitás előnyös változását mutatja a táptalajhoz adott lizin és treonin függvényében.
Az FA1-30 mutáns aszparto-kináz aktivitása 10 mmol/L lizin és treonin jelenlétében sem csökken.
A bioszintézis induló szubsztrátuma, az aszpartát a trikarboxilsav ciklusban szereplő oxálecetsavból
transzamináz segitségével a glutaminsav terhére képződik.
glutamát o-ketoglutarát
ATP ADP+ P
i
transzamináz
piruvát + CO
2
oxálacetát
aszpartát

[ biotin ] piruvát karboxiláz

Az alanin függőség kifejlesztése azért előnyös, mert az alanin főleg az aszpartát-ß-dekarboxiláz
működésével képződik. Az alanin képzés tehát csökkenti az aszpartát szintet, amelyból a lizin szintézise indul.
Az alanin dependens törzsben viszont éppen ennek az enzimnek a működése sérült, tehát több aszparaginsav
használható lizin szintézisre..
Oxálecetsav képződhet a piruvát karboxilezésével, ha a piruvát dehidrogenáz nem fogyasztja el a
glikolitikus út termékét. A ß-fluoropiruvát szinergizmus révén stimulálja a lizin képződést azáltal, hogy
akadályozza a piruvát dehidrogenáz működését. A felhalmozódó piruvát biotin jelenlétében ATP
felhasználásával oxálecetsavvá alakul, de. oxálecetsav képződhet foszfoenol-piruvátból is szén-dioxid
felvételével.
A hatvanas években - a lizin nagyüzemi előállítása érdekében - a rendelkezésre álló ismeretek
birtokában genetikailag megőrizhető módon a lizin termelés szabályozásába kellett beavatkozni. Olyan
mutánsok előállítása volt a cél, amelyek a bioszintézisben résztvevő enzimeket nagy mennyiségben állítják elő és
a feed-back mechanizmus kulcsenzimének a módosításával, a végtermék-gátlás felfüggesztésének
következményeként a kiválasztott célvegyületet, a lizint gátlástalanul termelik. El nem hanyagolandó feltétel,
hogy az ipari szempontból hasznos termék továbbalakulása ne csökkentse az eljárás kifejlesztésével nyert
gazdasági hasznot. Nem elhanyagolható szelekciós szempont szerint olyan mutánst kell nyerni, amelyik a
megtermelt metabolitot, ez esetben lizint képes kiválasztani környezetébe.
Miért éppen a Corynebacterium glutamicum alkalmazása mellett döntöttek az ipari felhasználók, annak
ellenére, hogy a coliformokról szerzett ismeret bőségesebb volt.? Nem csak az vezette őket, hogy ez a faj a
glutaminsav termelésben a nagyüzemi gyakorlatban is jól vizsgázott, de az aszparaginsavból induló esszenciális

170
aminosavak bioszintézisének a szabályozási mechanizmusa is egyszerűbb, összehasonlítva az Escherichia coli
izoenzimek szelektív szabályozásával működő rendszerével. A C. glutmicum-ban a kulcsenzim, az aszparto-
kináz amelynek az aktivitását multivalens szabályozással a lizin és a treonin állítja be. Ezzel alapvetően
meghatározza a baktérium beltartalmában (pool) az optimális aminosav szintet. Az aszpartilfoszfát képződés
80%-kal csökken 1 mM lizin és 5 mM treonin jelenlétében.

Lizin bioszintézise Corynebacterium glutamicum-ban

ASZPARAGINSAV

ATP
HOOC–HC–CH2–COOH
|
NH2


ADP
(lysC)aszparto-kináz
Végtermék szabályozás:[liz– tre–]
HOOC–HC–CH2–CO–OPO3
|
NH2

NADPH

NADP
+
(asd)Aszpartil-ß-félaldehid-
dehidrogenáz


H3C–CO–COOH
HOOC–HC–CH2–HC=O
|
NH2
Homoszerin Metionin
Treonin Izoleucin

(dapA)Dihidro-dipikolinát-szintetáz
H2C— CH=CH
| |
HOOC–CH—N==C–COOH

NADPH

NADP
+

(dapB)Dihidro-dipikolinát-reduktáz


CoA-CO-CH2-CH2-COOH
H2C— CH2–CH2 PIPERIDIN-2,6-
| | DIKARBOXILÁT
HOOC–CH—N==C–COOH

(dapD)Szukcinil-ketoaminopimelát-
szintetáz
HOOC–HC–CH2–CH2–CH2–CO–COOH
|
HN–CO–CH2–CH2–COOH

Glu Glu

o-ketoglutarát

(ddh)Diaminopimelát-dehidrogenáz

o-ketoglutarát
(dapC)Szukcinil-diaminopimelát-
aminotranszferáz



H2O
NH2
|
HOOC–HC–CH2–CH2–CH2–CH–COOH
|
HN–CO–CH2–CH2–COOH


HO-CO-CH2-CH2-COOH
(dapE)Szukcinil-diaminopimelát-
deszukciniláz
NH2
|
HOOC–HC–CH2–CH2–CH2–CH–COOH
|
HNH

(dapF)L,Ldiaminopimelát-epimeráz

Mezo-DIAMINOPIMELÁT
NH2 NH2
| |
HOOC–HC–CH2–CH2–CH2–CH–COOH


CO2
(lysA) D,L(mezo)Diaminopimelát-
dekarboxiláz

L-LIZIN
NH2 NH2
| |
HOOC–HC–CH2–CH2–CH2–CH2

(lysE)L-lizin-permeá0z

L-lizin megjelenése a környezetben

Ezek a nem spórázó, nem mozgó, kezdetben Gram-pozitív rövid pálcaként fejlődő (0,7 x 1-3 um), a
logaritmikus fázis végére kissé ellipszoid alakú, toxint nem termelő, a sejtfal összetétel szempontjából jól
jellemezhető mikolsavat (C
28
-C
38
) és arabinogalaktánt tartalmazó szervezetek üzemi, valamint biztonsági
szempontból és - nem elhanyagolható érvként – közegészségügyi szempontból is megfeleltek a
171
követelményeknek. Glükózt, fruktózt, mannózt, maltózt, szacharózt, trehalózt 28-30
o
C-on jól hasznosító, nitrát
redukciójára képes szervezetek. (Jellemző G+C Mol% 51-60). Membránjuk C
16
és C
18
tagú telített és egyszer
telítetlen zsírsavat, foszfatidil-inozitot és foszfatidilinozitol-mannozidot tartalmaz. A menaquinon tartalmukat
főleg 9 tagú izoprén lánc rögzíti a citoplazmamembránba. Tudvalevő, hogy ezeknek a mikroszervezeteknek a
sejtfala nagy mennyiségben tartalmaz mezo-diaminopimelinsavat, növekedésükhöz pedig biotint igényelnek. Az
aminosav környezetbe való kiválasztása szempontjából kedvező állapotot teremthet az állandó biotin limitáltság,
amely tapasztalat szerint a citoplazma membrán képződésében okoz nehézséget.


Első leírója különleges képességére utalva Micrococcus glutamicus néven vezette be a szakirodalomba
ezt a halványsárga, folyékony táptalajon összecsapódva kiűlepedő mikroszervezetet. A típus törzset
Corynebacterium glutamicum néven ATCC 13032 számon helyezték el a gyűjteményben.
Nagy számban előállított, UV kezeléssel, valamint alkilezőszerek alternált alkalmazásával nyert
mutánsok közül előnyösen használható treonin auxotrófot sikerült kiválasztani. A mutánsban
működésképtelenné vált a homoszerin dehidrogenáz. Ez azt jelenti, hogy a treonin szint limitáltsága miatt a
bioszintézisben szereplő enzimek képződése maximális szintre emelkedik. A tragikusan sérült anyagcsere
rendszer a treonin hiányt szeretné felszámolni, de a kulcsenzim működésképtelensége miatt erre képtelen. Ebből
következően a természetellenesen feldúsuló aszpartát-ß-félaldehid zömében a lizin szintézis irányában
hasznosul. Ezzel a termelő aktivitás 0,1 g/l értékről 16 g/l értékre növekedett. Az bioszintézis enzimeinek
képződését represszáló hatást különböző lizinanalogokkal (o-aminoetilcisztein, o-aminoetilszerin) szemben
kialakuló rezisztencia fokozásával érték el. Az előállított rezisztens törzsek termelőképessége 79 g/l értékre
emelkedett, amely 100 g glükózból 44 g lizin termelést jelentett. Ez az érték meghaladja az ipari gyakorlatban
elfogadhatónak tekintett 35%-os konverziót.

Az emelt szintű lizinképződés fiziológiai feltétele.
A glikolízis, a pentózfoszfát ciklus és a citrát ciklus jól szabályozott működése nem biztosítja az emelt
szintű lizintermeléshez szűkséges - szén-dioxid vesztés nélküli - aszpartátellátást. Ezt a feladatot nem csak a
Corynebacterium.glutamicum-ban működő - O'Regan és munkatársai által izolált és szekvenált (1989. Gene.
77:237-257) - foszfoenolpiruvát-karboziláz, hanem az izocitrát liáz működésével induló glioxalát ciklus és a
piruvát-karboxiláz fokozott összműködése teljesíti, amint azt Peters-Wendisch és munkatársainak eredményei
bizonyítják (FEMS Microbiol. Lett. 114:243. Arch. Microbiol. 185:387-396. Microbiology 143:1095-1103) Az

172
AMP, ADP és acetil-CoA által ellenőrzött biotint igénylő piruvát-karboxiláz fokozottan működik tejsav és
piroszőlősav fölösleg esetében.
A magas termelési szint elérése szempontjából a bioszintézis gazdaságos voltát a szén ellátás (carbon
flux) befolyásolja. Marx és munkatársainak 1997-ben közölt adatai szerint (Biotechnol. Bioeng. 56:188-190)
amíg a glutaminsav termelés közben a pentózfoszfát út 30 %-ban vesz részt a szénváz szállításban, a
lizintermelő mutánsban 70 %-ot ér el a részesedése. Ez a bioszintézis NADPH igényének a kielégítését szolgálja.
Az anaplerotikus karboxilezés szerepe is közel kétszeres a lizin termelő Corynebacterium glutamicum esetében
összehasonlítva a glutaminsavat termelő törzs aktivitásával.
A DAP enzimek által katalizált változat szerint a 2,3-dihidrodipikolinát egy NADPH igényes reduktáz
{dapB} hatására A
1
-piperiden-dikarbonsavvá telítődik. Ez spontán vízfelvétellel c-oxo-o-aminopimeláttá hidrolizál.
A ketocsoport aminocsoporttá alakítása szukcinil-CoA felhasználásával az N-szukcinil-transzferáz {dapC} hatására
képződő N-szukcinil-származékon keresztül szukcinildiaminopimelát-transzamináz {dapD} segítségével történik.
Az N-szukcinil-L,L-o.c-diaminopimelát specifikus szukciniláz {dapE} hatására alakul LL,-o.c-diaminopimeláttá.,
amely a továbbiakban mezo-o.c÷diaminopimeláttá epimerizálódik (dapF). Ez a mezo-alak a diaminopimelát-
dekarboxiláz {lyzA} segítségével L-lizinné alakul. A felszaporodó lizin az egyik izoenzimmel koordinálva
génszinten szabályozza (represszálja) a felsorolt enzimek képződését.
Tovább vizsgálva a DAP képződést találtak egy alternatív utat, amelyik szerint szukcinilezés helyett
egy acetil-transzferáz az L-2,3-dihidrodipikolinátot használva szubsztrátumként N-acetil-2-amino-6-keto-L-
pimelátot képez Ezt egy NADPH igényes aminotranszferáz N-acetil-L,L-diamino-pimeláttá alakítja, amiből egy
dezacetiláz távolítja el a védő acil-csoportot. A szintézis után a klasszikusnak nevezhető lépéseket (epimeráz,
dekarboxiláz) alkalmazva képződik végtermékként az L-lizin.
A DAP enzimek aktivitását több lizint termelő mutánsban vizsgálva kiderült, hogy a termék képződését
lényegesen előnyösebb út működése is segítheti. Az L-2,3-dihidrodipikolinát egy specifikus NADPH függő D-
diaminopimelát-dehidrogenáz hatására ammónia felvételével egy lépésben alakul mezo-diaminopimeláttá.
Ennek az enzimnek a működése meghatározó jelentőségű a termékképzésben.
A bioszintézis gyakorlati ipari hasznosítását befejező lépésként a terméknek a környezetbe való
kiválasztása határozza meg. A jól termelő, de a kiválasztásban sérült mutáns baktériumban a lizin koncentráció
meghaladhatja a 170 mM szintet. Ez az érték már a legyöngített szabályozó mechanizmusban is zavart okoz.
Vrjlic és munkatársainak (Mol. Microbiol. 22:815-826. J. Bacteriol. 177:4021-4027) sikerült izolálni a lysE
gén által kódolt 236 aminosavból felépülő transzport fehérjét. Ezért a lizin kiválasztást nem befolyásolja a
tápközeg biotin tartalma. Ha viszont a táptalaj ammóniumszulfát tartalmát szerves nitrogénforrásra (glutamin,
glutaminsav, aszparagin, protein) cserélik, akkor a lizintermelő képesség 30-40%-ra csökken.
A fejlesztő munka melléktermékeként Bethe és munkatársai nyilvánosságra hozták az ATCC 13032
számon letétbe helyezett Corynebacterium glutamicum genetikai térképét (Mol. Gen. Genet. 252:255-265).
Ipari körülmények között szénforrásként a répacukor gyártás melléktermékeként megjelenő melaszt
hasznosítják. Nitrogénforrásként a kénsavval készült szójahidrolízátumot ammónium-hidroxiddal semlegesítik.
Az ebben levő aminosavak az auxotróf törzs homoszerin, treonin, metionin és leucin igényét szuboptimális
szinten kielégítik. A lizinképződés szempontjából lényeges, hogy a táptalaj biotin koncentrációja meghaladja a
literenkénti 30 ug szintet, amely a piruvát-karboxiláz aktivtás optimális szinten tartásához szükséges. A
szénhidrátot menetközben adagolják az optimálisnak tekintett szint fenntartása érdekében. Ez azt jelenti, hogy a
tenyésztés a fermentor térfogatának 50%-nál indul és folyamatosan adagolva a szénforrást a teljes hasznos
térfogatot 100 órás korban éri el. Az adagolt szénhidrát hasznosítása után a tenyészlé alakos elemeit kiszűrve a
szűrlet lizin tartalmát ioncserélő oszlopon megkötik. Átmosás után ammóniával eluálják, kondenzálják majd
sósavval semlgesítve a lizint hidroklorid formában kristályosítják. A végtermék általában 97%-os tisztaságú
lizin.HCl, amely állattápszerekbe kerül felhasználásra.
Az eljárás nem tekinthető környezetbarátnak az ioncserélő oszlopról távozó, illetve az anyalúg szerves
anyagban és ammónium sókban gazdag szennyvize miatt. A mikrobiális eljárásban termelt lizin 3-4 %-át
tartalmazó szennyvíz szerves anyag tartalmának csökkentése költséges aerob kezelést igényel.
Célszerűbbnek látszik a teljes fermentlé koncentrálása és a megtermelt aminosavat, valamint az
elpusztított baktérium sejteket tartalmazó biomassza tápanyag kiegészítőként való felhasználása. A
Corynebacterium glutamicum tartalmú biomassza felhasználása nem ellenkezik az élelmiszeripari minőségi
követelményekkel. A technológia különlegessége a kondenzálás és a porlasztva szárítás közben alkalmazott
adalék anyag minősége, amely a végtermék nem higroszkópos, könnyen kezelhető formában való forgalmazását
lehetővé teszi. Ilyen végtermék például a Degussa A.G. szabadalmilag védett Biolys®60 tereméke, amely
legkevesebb 48.8 % L-lizint 1 % L-arginint, 0,5 % L-treonint és 0,2 % L-metionint tartalmaz.
A hetvenes években kialakult szemlélet követői a szénhidrogén élelmiszeripari hasznosítása céljából a
széhidrát helyett petrokémiai úton előállított szénforrás alkalmazhatóságát vizsgálták. Előtérbe került a
petrokémiai úton gazdaságosan előállítható ecetsav hasznosítása. Erre a célra a Corynebacterium
tulajdonságaiban rokon Brevibacterium flavum törzset találták megfelelőnek. A táptalaj induláskor literenként 35
g hidrolízált szőját, 30 g glükózt, 7 g ecetsavat, 50 ug biotint és 40 ug tiamint tartalmazott. Az ecetsavszint
173
fenntartása céljából 4:1 arányban kevert ecetsav ammónium acetát elegyet adagoltak folyamatosan arra
ügyelve, hogy az ecetsav szint végig 1 % alatt maradjon.
L-lizin előállítására mikrobiális eredetű enzimtechnológiai módszerek is ipari megvalósításra kerültek.
Alapanyagul a műszálgyártás céljára viszonylag olcsó kémiai szintézissel előállított kaprolaktám szolgál. Az
első nyilvánosságra került eljárásban Aspergillus ustus által termelt enzim aktivitását hasznosítva a DL-o-
amino-c-kaprolaktámból L-lizin és D-o-amino-c-kaprolaktám elegyét nyerték. A valóban gazdaságos nagyipari
eljárás kidolgozása Fukumura nevéhez kötődik. A kiindulási anyag teljes átalakítását két enzim által katalizált
rerakció kombinálásával oldotta meg. A DL-o-amino-c-kaprolaktám hidrolízisét Cryptococcus laurentii
élesztővel végzik. Az L-lizin mellett visszamaradó D-o-amino-c-kaprolaktám racemizálását egy baktérium áltat
termelt enzim hajtja végre
NH
2

H H |
| | H-C-H
H÷C—— N —— C = O |
| | L ÷ hidroláz L-lizin H-C-H
H÷C÷H H÷C÷NH
2
|

| | Criptococcus laurentii H-C-H
H ÷ C————— C÷H |
| | H-C-H
H H |
racemáz H-C-NH
2

DL-o-amino-c-kaprolaktám D-o-amino-c-kaprolaktám |
Achromobacter obae COOH

A biokonverziós technológia literenként 100 g szubsztrátunból egy teljes ciklusban 1 g Criptococcus laurentii és
1 g Achromobacter obae acetonnal szárított sejtjeivel 40
o
C-on 1 nap alatt 99,8 % nyeredékkel biztosítja az L-
lizin képződést. A hidrolízist végző enzim az c-kaprolaktámot nem hidrolizálja csak az o-amino-c-kaprolaktám
felnyitására képes. Az enzinet mangán és magnézium aktiválja, molekula tömege 185.000. A racemizálást
végző 50,000 moltömegű enzim molekulánként egy piridoxálfoszfátot tartalmaz kofaktorként.

L-TREONIN előállítása.
A glutaminsav termelésre használt Corynebacterium glutamicum törzsből treonin termelésre alkalmas
mutáns állítható elő. Ez esetben első lépésként metionin igényes törzset célszerű előállítani, A metionin ugyanis
represszálja a homoszerin-dehidrogenáz képződését. Metionin hiány esetében viszont ez a treonin termelés
szempontjából nélkülözhetetlen emzim akadálytalanul képződhet.
A következő feladat a treoninra érzékeny enzimek szabályozó szerepének a felfüggesztése. Ez
különböző treonin analógokkal szembeni rezisztencia, például o -amino-ß-hidroxivaleriánsav tűrés
kifejlesztésével érhető el. Tovább fokozható a törzs termelőképessége, ha lizin analógra is rezisztenssé tesszük a
fejlesztendő mutánsunkat. Az aszpartát-kináz működését ugyanis a treonin és a lizin közösen képesek
alloszterikusan befolyásolni. A két aminosav-analógra rezisztens mutánsban ez az enzim maximális aktivitással
működik. Ezért a treonin mellett gyakorta képződik valamennyi lizin is.
A treonin-dezamináz működésének akadályozása, azaz a treonin tovább alakulásának gátlása elősegíti a
treonin feldúsulását a tápközegben. Ezt a célt szolgálva a törzsnemesítés érdekében izoleucin igényes auxotrófot
állítottak elő.
A Corynebacterium glutamicum-ból klasszikus genetikai módszerekkel, mutagénekkel való ismételt
kezelés és megfelelő szelekció alkalmazásával aminosav termelésre alkalmas mutánsokban az egyes
kulcsenzimek aktivitása és érzékenysége változó értéket mutat. Az aszpartokináz teronin és lizin érzékenysége
az egyes mutánsokban eltérő mértékben csökkenhet. Az o -amino-|-hidroxivaleriánsavval szemben kialakuló
rezisztencia sok esetben a lizin érzékenység fokozódását okozta. Ezek az eltérő adatok nem meglepőek, hiszen
sokféle oka lehet egy aminosav igény megjelenésének, vagy a feed-back érzékenység elvesztésének. Az ipari
gyakorlat viszont csak a termék mennyiségében és az előállítási költségben érdekelt.
Irodalmi adatok szerint a treonin termelésben szerepet játszó enzimek szintjét sikerrel tudták
befolyásolni az egyes kulcsenzimek információját tartalmazó génnek a gazdasejtbe juttatásával.
A treonint termelő eljárások a felhasználásra kerülő szénforrás szerint két csoportra oszthatók; a glükózt
hasznosító és az ecetsavat alkalmazó eljárásokra. Mindkét eljárásban fontos tápanyag a szójahidrolizátum, amely
a felhasználásra kerülő auxotróf törzsek tápanyag igényének a kielégítését szolgálja. A maximális termelési szint
elérésének a feltétele a genetikailag meghatározott aminosav igényüknek a céltermék szempontjából optimálisan
limitált kielégítése.
Shioi és Nahamori (1970) adatai szerint a Brevibacterium flavum alkalmasan fejlesztett mutánsával 18 g
L-treonint termeltek literenként 100 g glükózt, 30 g ammoniumszulfátot, 50 g kálciumkarbonátot 15 g
174
káliumfoszfátot, 0,4 g magnézium-, vas és mangán ionokat 200 ug biotint és 300 ug tiamint, valamint 2 g
szójahidrolizátumot tartalmazó táptalajon. A tenyészetet lúg adagolással semleges pH-n tartották.


ATP
HOOC–HC–CH2–COOH
|
NH2
IZOLEUCIN bioszintézis
Corynebacterium glutamicum-ban

ADP
(lysC)aszparto-kináz
Végtermék szabályozás: [lizin– treonin–]

NADPH
HOOC–HC–CH2–CO–OPO3
|
NH2


NADP
+
(asd)Aszpartil-ß-félaldehid-
dehidrogenáz


NADPH
HOOC–HC–CH2–HC=O
|
NH2
Metionin
Végtermék szabályozás [Thr–] {Met repr}
NADP+


(hom) homoszern dehidrogenáz
NH2-
|
HOOC–CH—CH2–CH2—OH

ATP


(thrB)homoszerin-kináz
ADP NH2-
|
HOOC–CH—CH2–CH2—OPO3

H2O

Pi


(thrC)treonin-szintetáz
NH2 OH
| |
HOOC–CH—CH2–CH3

NH4
+


(ilvA)treonin-dezamináz

H3C–CO–COOH

HOOC–C–CH2–CH3
||
O


(ilvBN)acetohidroxisav-szintetáz
CO2



NADPH

O=C–CH3
|
HOOC–C–CH2–CH3
|
OH

NADP+ (ilvC)Acetohidroxisav-izomeroreduktáz
CH3
|
HOOC–CH—C–CH2–CH3
| |
OH OH

H20 (ilvD)dihidroxisav-dehidratáz


Glu
CH3
|
HOOC–C—C–CH2–CH3
||
O


o-ketoglutarát

(ilvE)Transzamináz-B
CH3
|
HOOC–CH—C–CH2–CH3
|
NH2


Ennél lényegesen jobb eredményekről tudósít Tanaka. (1971) Ugyancsak a Brevibacterium flavum
alkalmas mutánsát használva két nap alatt 27 g treonint termelt literenként 4 g ammónium acetátot, 4,1 g
nátrium-acetátot, 1 g ammónium-szulfátot, 2 g karbamidot, 3 g káliumdihidrogén-foszfátot, 0,4 g magnézium-
szulfátot, vas és mangán ionokat, 5 mg tiamint és 50 mg biotint, 3 g glükózt és 8 g szójahidrolízátumot
tartalmazó táptalajon. A fermentáció optimális hőmérséklete 39
o
C. Az optimálisnak talált enyhén lúgos
kémhatást (7,7 pH) olyan ecetsav-ammoniumacetát elegy adagolásával biztosították, amelyben a két vegyület
molaránya 100:17 volt.
175
AZ AROMÁS AMINOSAV BIOSZINTÉZIS SZABÁLYOZOTTSÁGA
L-TRIPTOFÁN ELŐÁLLÍTÁSA

A triptofán bioszintézisének és a szintézisút szabályozottságának felderítése az ötvenes évek alapkutató
tevékenységének az eredménye. A mikrobiális bioszintézis a foszfo-2-keto-3-dezoxi-heptonát-aldoláz által
katalizált reakcióval indul. Escherichia coli-ban ezt a feladatot három alloszterikusan szabályozott izoenzim látja
el. Az egyik fenilalaninra és prefénsavra, a másik triptofánra és korizminsavra érzékeny, a harmadik működését
pedig tirozin és prefénsav gátolja. A második polivalensen szabályozott alloszterikus enzim a shikiminsav-
dehidrogenáz, amelynek működését fenilalanin, tirozin, prefénsav és korizminsav befolyásolja.

Az aromás aminosavak bioszintézise és a szintézis szabályozása Escherichia coli-ban

FOSZFO-ENOLPIRUVÁT + ERITRÓZ-4-FOSZFÁT

foszfo-2-keto-3-dezoxiheptonát-aldoláz [Phe -] [Tir -] [ Tri -]
[prefenát] [korizmát] [prefenát]

3-DEZOXI-D-ARABINO-HEPTULONSAV-7-FOSZFÁT
dehidrokvinát szintetáz Pi
5-DEHIDROKVINÁT
5-dehidrokvinát-dehidrastáz | H
2
O
3-DEHIDROSHIKIMINSAV
NADPH
shikimát dehidrogenáz (Phe- Tir- prefenát- korizmát-)
NADP
+

D-SHIKIMINSAV
ATP
shikimát-kináz
ADP
SHIKIMINSAV --FOSZFÁT
P-E-P | piruvil-shikimát-foszfát szintetá
5-ENOLPIRUVIL--SHIKIMINSAV-3-FOSZFÁT
korizmát-szintetáz | Pi
KORIZMINSAV

Glutamin
korizmát mutáz antranilát szintetáz
(Phe-) (Tir -) Glutaminsav
Piruvát

ANTRANILÁT
P-R-PP
antranilát-foszforibozil-transzferáz

PREFENSAV PP
N-(RIBOZIL-5'-FOSZFÁT-ANTRANILÁT
NAD
+
foszforibozil-antranilát izomeráz
H
2
O ENOL-1-o-KARBOXIFENILAMINO-1-
DEZOXIRIBULÓZ-FOSZFÁT
CO
2
NADH H
2
O
indol-3-glicerin-foszfát szintetáz
CO
2
CO
2
INDOL-3-GLICERIN-FOSZFÁT
FENIL-PIRUVÁT p-HO-FENIL-PIRUVÁT L-SZERIN
Glu triptofán szintetáz
transzamináz GAP
o-ketoglutársav
L-FENILALANIN L-TIROZIN L-TRIPTOFÁN

176
Néhány zavartalanul folyó enzimreakció után a bioszintézis a korizminsavnál ágazik el. A triptofán
szintézis felé vezető út első enzime a két alegységből álló antranilát szintetáz, amely asszociátumot képez az
ugyancsak két alegységből álló antranilát-foszforibozil-transzferáz-zal. A triptofán alloszterikus (feedback)
inhibitorként ezen aktív asszociátum szétesését okozza. Az antranilsav szintézishez szükséges glutaminkötőhely
csak az ép asszociátumon alakul ki. A működőképes komplexen képződő foszforibozil-antranilátot egy izomeráz
alakítja tovább, majd az indolglicerinfoszfát-szintetáz működésének a hatására egy szén-dioxid és egy molekula
víz távozásával alakul ki az indolváz. Az utolsó enzimkatalizálta történést a négy alegységből álló triptofán-
szintetáz katalizálja, amely az indolt a szerin harmadik szénatomjához kapcsolja egy glicerinaldehid-3-foszfát
felszabadításával.
A másik két arómás aminosav szintézise irányába két korizmát-mutáz izoenzim katalizálja a prefénsav
képződést. Az egyik izoenzim fenilalalninra, a másik tirozinra érzékeny. Mindegyik asszociátumot képez a
megfelelő aminosav szintézisét katalizáló következő enzimmel: a fenilalaninra érzékeny izoenzim a prefenát-
dehidratázzal, a tirozinra érzékeny pedig a prefenát-dehidrogenázzal alkot komplexet. Az asszociátumok
működését triptofán serkenti. Ez a hatás a két aminosavnak a fehérjeszintézis szempontjából kedvező arányban
való képződését elősegíti. A fenilalanin és a tirozin szintézis utolsó lépését azonos enzim, egy transzamináz
katalizálja. Az aromás aminosavak szintézisét végző enzimrendszer a három aminosav hiányában nagy
mennyiségben képződik. Csak az általuk termelt aminosavak felszaporodása csökkenti ezen enzimek
képződését. A fölös mennyiségben jelenlevő aminosav, esetünkben a triptofán a represszor fehérjéhez, az pedig a
triptofán operon promoter régiójához kötődve megakadályozza az RNS-polimeráz működését. Ezzel az triptofán
operonbsn kodolt enzimek szintézisét represszálja.
Yanofsky és munkatársai a triptofán szintézisért felelős enzimek képződésének szabályozási
mechanizmusát molekuláris biológiai szinten vizsgálva egy olyan új általános jellegű felismerésre jutottak,
amely az aminosavval töltött tRNS addig csak sejtett szabályozó szerepének módjára magyarázatot adott. A
triptofán szintetáz mRNS információ előtt egy 160 bázis terjedelmű szabályozási feladatot ellátó attenuátor
régiónak elnevezett szakasz található. Ennek a szakasznak az a feladata, hogy a promoter régiónak a represszor
fehérje távoztával bekövetkező felszabadulása után meginduló RNS-polimeráz működését megszakítsa az
esetben, ha a triptofánnal töltött tRNS a fehérjeszintézis szempontjából még kielégítő koncentrációban jelen van
a rendszerben.
A mRNS esetében a kódolt fehérjére vonatkozó információ előtt minden esetben a riboszómához kötődést
biztosító szakasz található. A fehérje szintézise az eubaktériumoknál AUG kodonnal (formilmetioninnal) indul.
A DNS-szálon akár egy génen belül is egyidejűleg több RNS-polimeráz is működhet, sőt az enzimről
folyamatosan letekeredve képződő mRNS-fonalakon körülbelül 40 bázisnyi távolságban már megindul a
fehérjeszintézis. Ebből az következik, hogy meglehetősen kis területen egyidejűleg.változatos biokémiai reakciók
(RNS ill. fehérje-szintézis) tömege folyik.
Ezt a lehetőséget használja ki az élő szervezet az aminoacilezett tRNS szabályozó szerepének a
megjelenítésére. Ennek keretében a promoter régión kötődő RNS-polimeráz, az operátorhoz kötődő represszor
fehérje távoztával elindulhat a struktúrgén irányába. Az RNS-polimeráz működése azonban megszakad akkor, ha a
megfelelő aminoacil-tRNS a fehérjeszintézis szempontjából szükséges koncentrációban jelen van a mikrobasejtben.
Az első vázlat a triptofán represszáló hatását ábrázolja. A triptofánnal terhelt represszor az operátor
régióhoz kötődve akadályozza az RNSpolimeráz működését.
______________________________________________________________________
I promoter I operátor I attenuátor I trpE gén I trpD gén I trpC gén I trpB gén I trpA gén I
|----------------represszor --------------|-------------|-------------|------------| ------------|------------|-
RNS > triptofán
polimeráz (korepresszor)

A második vázlat a derepresszió jelenségét ábrázolja. Triptofán hiányában a korepresszor (esetünkben triptofán)
nélküli represszor fehérje lemozdul az operátorról. Ennek következtében elindulhat a transzlációs folyamat. Az RNS
polimeráz elindul a struktúrgének felé.
__________________________________________________________________________
I promoter I operátor I attenuátor I trpE gén I trpD gén I trpC gén I trpB gén I trpA gén I
-|----------------|------------|--------------|------------ |-------------|------------|------------|-------------|--
RNS
polimeráz ---->


represszor Struktúrgének:
E = antranilát-szintetáz
D = antranilát-transzferáz
C = IGP-transzferáz
B = triptofán-szintetáz B
A = triptofán-szintetáz A
177
A triptofán operon átírását befolyásoló attenuátor régió szabályozó szerepe

Met Lys Ala Ile Phe Val Leu Lys
pppAAGUUCACGUAAAAAGGGUAUCGACAAUGAAAGCAAUUUUCGUACUGAAA
riboszómakötő szakasz G G
G

l
U y
AUAAGAGAUUAAACAAGUUUUUUUU - ACCCAUAGACUAACGAAAUGCGUA - U T
A C - G C - G r
C G - C C - G p
A G - C A - U T
A G - C C - G r
U C - G U-U G p
G G - C A C A
C G - C U G r
A

A U G - C g
A U-A-A U - A

T
A ez a komplementer bázisok által stabilizált termináló G - C h
C hurok leszorítja a o faktor nélküli RNS-polimerázt a templátról A - U r
A C

U

S
CAAAAACCGACUCUCUCGAACUGCUG...... G - C e
ezért a triptofán-szintetáz struktúrfehérje génjei nem íródnak át G - C

r
G U
C G
A-A-A

Met Lys Ala Ile Phe Val Leu Lys Gly
pppAAGUUCACGUAAAAAGGGUAUCGACAAUGAAAGCAAUUUUCGUACUGAAAGGU
riboszómakötő szakasz U
ACGAAAUGCGU G
A A G
UCAGA - UUCACC U
U - A G
Trp-tRNS hiány miatt a vezérpeptid képződése az UGG kódnál A - U G
leáll, a polimeráz a komplementer kötések átrendeződése miatt C - G C
zavartalanul tovább haladva megkezdheti a triptofán-szintetáz C U G
struktúrgén átírását C - G C
A A A
G - C C
C - G U
C - G

U
C - G C
AAUAAGAGAUUAAACAAGUUUUUUUUCGGGCGAGUAAUCCG - C -A-A-A-G-U-C
C
A Met Gln Thr ....
AAUGCAAACACAAAAACCGACUCUCUCGAACUGCUG......

Elkezdődik a struktúrgének információja előtt elhelyezkedő attenuátor szakaszon kódolt rövid vezérfehérje
szintézise. A vezérpeptid információja a promoter régiót követő rövid riboszómakötő szakasz után, a szokásos AUG
kodonnal kezdődik és UGA kóddal végződik. Az RNS-polimeráz által szintetizált mRNS-láncon, amelynek szekven-
ciája több komplementer szakaszt is tartalmaz, a polimerázt 40 bázisnyira követve folyik a vezérfehérje képződése.
A két szintézis (mRNS-képződés és peptidszintézis) közel azonos sebességgel folyik. A vezérpeptidtől 30 bázisnyi
távolságra, jóval a struktúrgéneket iniciáló kodon elött található az a termináló hurok, amely képes lenyomni a o-
faktor nélküli, lazán kötődő polimerázt a templátjáról. A termináló hurok azonban, csak az esetben alakulhat ki, ha a
vezérpeptid szintézise zavartalanul megtörténik. Az RNS-polimeráz tehát leválik az operonról és o-faktorral
kiegészülve újra kezdi működését a promoter szakasznál. Az anyagveszteség csekély, mert a jelenlevő proteázok a
funkció nélküli vezérpeptidet lebontják, és az aminosavak visszakerülnek a bioszintetikus folyamatba. Triptofán
esetében ez a vezérpeptid mindössze 14 aminosavból épül fel, de szekvenciájában közvetlenül egymás után két trip-
tofánt tartalmaz, amely százalékos arányban különösen nagy gyakoriságot jelent, mivel a prokariotákban általában
100 aminosavra esik egy triptofán.
Ha azonban triptofánnal töltött tRNS hiányában megakad a vezérfehérje képződése, akkor a
vezérszekvencia bázissorrendjében levő komplementer szakaszok által létrehívott új párkapcsolat kialakulása (73-84
és 108-119 bázisok között) nem engedi kialakulni a termináló hurkot. Ennek következményeként a polimeráz a
kritikus szakaszon tovább haladhat a struktúrgének AUG kezdő kodonja felé. Hamarosan megkezdi az illetékes
aminosav képződését katalizáló enzimek, ez esetben a triptofán-operonba szerveződött struktúrgének átírását, a
178
mRNS szintézisét. Amikor a végtermék által (feed-back) szabályozott, triptofánt szintetizáló rendszer aktív
tevékenysége a vezérpeptid szintéziséhez elegendő triptofanil-tRNS szintet állít be, a struktúrgének további átírása
megszűnik.

Hasonló szabályozó rendszer irányítja a többi aminosav szintézisét katalizáló enzimek struktúrgénjeinek átírását is.
Az egyes vezérpeptidek kémiai szerkezetében az illetékes

Met-Lys-Ala- Ile-Phe-Val-Leu--Lys-Gly-Trp-Trp-Arg-Thr-Ser
Met-Thr-Arg-Val-Gln-Phe-Lys-His-His-His-His-His-His-His-Pro-Asp
Met-Lys-His-Ile-Pro-Phe-Phe-Phe-Ala-Phe-Phe-Phe-Thr-Phe-Pro
Met-Lys-Arg-Ile-Ser-Thr-Thr-Ile-Thr-Thr-Thr-Ile-Thr-Ile-Thr-Thr-Gly-Asn-Gly-Ala-Gly

aminosav egymás közelében több példányban szerepel. A hisztidin esetében 7 szomszédos kodon igényel
feltöltött hisztidil-tRNS-t. A fenilalanin-szintézis enzimeinek képződését szabályozó vezérfehérje 7 fenilalanil-
tRNS jelenlétét igényli az RNS-polimeráz leválasztásához. Figyelemre méltó a treonin és az izoleucin
struktúrgénjeinek átírását szabályozó vezérpeptid szerkezete, amely alternáltan 8 treonin és 4 izoleucinal
feltöltött tRNS-t igényel. Ez azt jelenti, hogy értelemszerűen a két aminosav bioszintézisét végző enzimek
struktúrgénjeinek átírása csak akkor akadályoztatik, ha mindkét aminosavval feltöltött tRNS jelen van a
rendszerben.


ELJÁRÁSOK TRIPTOFÁN ELŐÁLLÍTÁSÁRA

Triptofán szintézis L-szerinből és indolból.
L-szertinből és indolból a triptofán szintetáz aktivitást hasznosítva gazdaságosan lehet nyerni ezt az esszenciális
aminosavat
Triptofán-szintetáz (EC. 4.2.1.20)
minden prototróf mikroorganizmusban
előfordul a triptofán bioszintézist végző
reakciósor utolsó tagjaként. Az
Escherichia coli-ban ez az enzim
140.000 móltömegű piridoxálfoszfát
kofaktorral működő tetramer. Két o
alegységből és egy |
2
dimerből épül fel.
Az érintetlen tetramer komplex in vivo
az indol-3-glicerol-foszfátból és az L-
szerinből L-triptofánt és glicerinaldehid-
3-foszfátot alakít. A tetramerből könnyen
kiszakadó o alegység az indol-3-
glicerol-foszfát szétesését katalizálja
indolra és glicerinaldehid-3-foszfátra. A
|
2
dimer az indolból és L szerinből
történő triptofán szintézist katalizálja, de
elősegíti a szerin bomlását piruvátra és
ammóniára. A tetramer enzim
előállítására alkalmas törzset a
triptofánigényes mutánsok közül
célszerű kiválasztani. Triptofán limitált
tenyésztés esetén várható a
bioszintézisben érdekelt enzimrendszer
derepressziója. Miles Escherichia coli -B
-ből előállított mutánsában az oldható
fehérje 16 %-át tette ki ez a fehérje. A
sejtekben képződött enzim nem csak
triptofán előállítására, de különböző
triptofán analógok szintézisére is sikerrel
használható. Az enzimkomplex az elölt coli sejtbe glutárdialdehiddel rögzíthető és bioreaktorba helyezve két hét
felezési idővel használható. Az enzimkomplex stabilitása és aktivitása nagyobb mint a tisztított formában kinyert
|
2
dimeré. Ez utóbbi esetben piridoxál-5-foszfát kofaktor jelenléte a reakcióelegyben növeli az enzim aktivitását.

179
A triptofán szintetázt nagy mértékben termelő, de triptofán közvetlen előállítására szolgáló törzs olyan
fenilalanin

és tirozin

igényes mutáns, amely 5-metiltriptofán, 6 fluor triptofán, 4-metil-triptofán, p-fluor-
fenilalanin, p-amino-fenilalanin és triptofán-hidroxamát jelenlétében is képes növekedni, tehát a felsoroltakra
rezisztens. A mutáns előállításakor a lizintermelére alkalmas törzs előállításakor ismertetett gyakorlatot
alkalmazták.
Triptofán szintézisre használható a reverzbilisen működő triptofanáz (EC. 4.1.99.1.) amely természetes
körülmények között – egyes baktériumokra jellemzően – a triptofán lebontására szolgál. (E. coli
indol+
, Klebsiella

ndol–
, Salmonella
indol–,
Edwardsiella
indol+
, Providencia
indol+
viszont a Proteus és a Shigella lehet
indol+
, illetve
ndol–
is)

indol + piruvát + ammónia ——> triptofán + víz

Ez a reakció végeredményben a baktériumokban
előforduló jól ismert katabolikus o.|-eliminációs
reakció visszafordítása. Nakazawa (1972) Proteus
rettgeri tenyészetét használta enzimforrásként. A
katabolikus enzim képződését nem csak a könnyen
metabolizálható szénforrás, de a nitrogénforrás is
represszálja. A promoter régióhoz kötődő aktív
glutamin szintetáz és egy speciális fehérje
komplexe serkenti az RNS polimeráz aktivitását az
esetben, ha egyidejűleg a cAMP-CAP komplex is
jelen van. A glutamin-szintetáz 12 alegységből álló
óriás enzimkomplex, amelynek működését
glikokoll, alanin, triptofán, hisztidin, karbamoil-
foszfát, glükózamin, citidil-trifoszfát, és adenilsav
multivalensen gátolja. Teljesen inaktív állapotban
minden alegységének tirozil oldallánca
adenilsavval van acilezve. A fenti aminonitrogént
tartalmazó vegyületek limitált mennyiségben való
jelenléte a tápközegben előnyösen hat a
nitrogénkatabolikus enzim képződésére. Szénhidrátban és egyéb nitrogénforrásban szegény táptalajon az enzim
képződését triptofánnal indukálni lehet. A
rekció közben felszabaduló indol azonban
gátolja a baktérium növekedését. A gátló
hatás polyoxietilén-alkil-fenoléter
adagolásával védhető ki. Ez a detergens
mikrocseppekbe zárva megköti a
felszabaduló indolt. Ílyen körülmények
között növekedő baktérium oldható
fehérjetartalmának 6 %-a triptofanáz.
A kifejlődött tenyészetből elkülönített
sejtekhez literenként 80 g nátrium-
piruvátot, 80 g ammónium-acetátot, 10 mg
piridoxál-5-foszfátot, 1 g nátrium-szulfátot
és 100 ml metanolban oldott 60 g indolt
adva enyhén alkalikus (8,8 pH)
körülmények között, 34
o
C-on keverve,
két nap alatt 75 g triptofán képződik. Az egyensúlyi reakciót teljessé lehet tenni, ha a reakcióelegyből a triptofánt
kivonjuk, például inozinnal, ami a képződő triptofánnal vízoldhatatlan komplexet ad. Az eljárást sikerrel
használják triptofán analógok, például 5-hidroxitriptofán előállításra.


L-triptofán nyerése racém hidantoin származékból

A teljességre törekedve nem hagyható figyelmen kívül egy bakteriális enzim a hidantoináz ipari
alkalmazása L-triptofán előállítására. Ez az 5-hidroximetil-hidantoinnal indukálható enzim (Sano. 1977. Agric.
Biol.Chem. 41:819) a racém indolil-metil-hidantoinból első lépésben az L-triptofán N-karbamoil származékát
állítja elő, majd második lépésként távolítja el a karbamoil csoportot. Az átalakítandó szubsztrátum gyakorlatilag
teljes mértékben eladható termékké alakítható, mert az indolil-metil-hidantoin 8-9 pH tartományban spontán
racemizálódik. Az indukált baktériumsejtek membránjának átjárhatóságát a reakcióelegyhez adott toluol
fokozza, de az elegy baktériumos fertőződését is megakadályozza.


180


H H

O H H
| | || | |
H–C=C–C——C– CH
2
÷ C– C – N-H H–C=C–C——C—CH
2
—C— COOH
| || || | | | || || |
H–C=C–C–N–C-H H-N —– C=O H–C=C–C–N– C–H H–N—C=O
| | | | |
H H H
2
O H H NH
2

hidantoináz N-karbamoil-L-triptofán
rac-indolilmetil-hidantoin
formamid
pH = 9 D-indolilmetil-hidantoin L-triptofán


Bioszintézis prekurzorok felhasználásával.
Az egyik jól ismert módszer antranilsav adagolással valósítható meg. Ez esetben az antranilsav adagolás a
triptofánra érzékeny alloszterikusan feed-back szabályozott reakciót kerüli meg, ha a másik szubsztrátum az 5-
foszforibozil-1-pirofoszfát kellő mennyiségben rendelkezésre áll. Ilyen eljárásokat dolgoztak ki Hansenula
anomala, Candida utilis, Bacillus subtilis antranilsav auxotróf törzseit használva. A növekedő szakasz után
kezdődik az antranilsavat tartalmazó tápoldat adagolás vigyázva arra, hogy az antranilsav szint 0,5 % alatt
maradjon.
sejt tömeg L-triptofán

+

o

Táptalajösszetétele (H. anomala)
o

5 % glükóz
o

0,3 % ammónium-nitrát 50g
--

o
5g
--

0,05 % káliumdihidrogén-foszfát
o

0,2 % dinátriumhidro-foszfát
+

o

+ +

0,1 % nátriumdihidrogén-foszfát
+

o

0.05 % magnézium-szulfát
+

o

0,01 % nátrium-klorid
+

o

o

0,001 % ferro-szulfát
+

o

0,1 % élesztőkivonat
+

o

2 % kalcium-karbonát
+

o

0,2 % antranilsav induláskor,
+

o

majd naponta adagolva
24 48 72 96 120 h

L-triptofán előállítása indol adagolással

Ismeretes olyan módszer is, amelyben indolt adagolnak a baktérium tenyészethez. Ez esetben nem vitás,
hogy a triptofán szintézis utolsó enzimét hasznosítja az eljárás, miközben a reakcióhoz szükséges szerint a
mikroba állítja elő. A törzs kiválasztásakor fontos szempont a szerin szintézis színvonala. Szénforrásként a
megvalósított eljárásokban glükózon kívül glicerin, alkohol, növényi olaj azaz zsírsav is számításba jöhet. A
különbség a regenerálandó kofaktorok mennyiségében szembetűnő. A technológiai paraméterek optimálása
éppen ezt az élettani feladatot van hivatva megoldani.

1
/
2
glükóz +NH
3
+ 2 NAD
+
szerin + 2 NADH + 2 H
+

glicerin + NH
3
+ 2 NAD
+
szerin + 2 NADH + 2 H
+

zsírsav + NH
3
+ 3 FAD + 3 NAD
+
szerin + 3 FADH + 3 NADH + 3 H
+

2etanol + NH
3
+ATP+FAD+3NAD
+
+2NADP
+
szerin+ADP+FADH
2
+3NADH+2NADPH

A szerin bioszintézis látszólag szabályozatlanul folyik, mivel élettani szempontból ez az aminosav
központi szerepet tölt be. Bioszintézise a glikolízis köztes termékéből a glicerinsav-3-foszfátból indul 2-keto-3-
foszfo-glicerinsavon és foszfo-szerinen keresztül, de képződhet C
1
töredék felhasználásával glycinből is. A
glicerinsav-3-foszfát vagy hexózból, pentózból, triózból származik, de Krebs-ciklusban fontos szerepet játszó
oxálecetsavból a glükoneogenezis lépéseit hasznosítva is képződhet.
Prekurzorok alkalmazásával vezetett triptofán szintézis esetében célszerű 5-metiltriptofánra, illetve 5-
fluor-triptofánra rezisztens derepresszált mutánsokat használni. A derepresszált törzsekben a bioszintézisben
szerepet nyerő enzimszint a vad törzsben mért érték 200-szorosát is elérheti. A magasabb enzimszint azután a
181
céltermék túltermelését, főtermékként való megjelenését eredményezheti. A derepresszált mutáns előállítására
egyszerű lehetőség adódik, mert a tRNS aciláz szubsztrátspecifitásának függvényében téveszthet és a sejten belül
kialakuló koncentrációviszonyok függvényében az aminosav analóggal tölti fel a tRNS-t. Ennek az a
következménye, hogy a sejtfehérje olyan arányban tartalmazza az aminosav analógot, amilyen arányban a tRNS
aciláz tévedett. Élettani következményként az elkészült hibás fehérjék arányában csökken az egyed
életképessége akár a teljes életképtelenségig. Nagyszámú egyed között - mutagénekkel való kezeléssel fokozható
mértékben - előfordulhatnak olyan változatok (variánsok), amelyek nagyobb mennyiségben termelve a
természetes aminosavat, kompetitiven kiszorítják az analógot az acilezési reakcióból, azaz a növekedést gátló
aminosav analóg jelenlétében is képesek növekedni.


Szerin szintézis glükóz
<------ATP
------->ADP
glükóz-6-foszfát

fruktóz-6-foszfát
<-------ATP
------->ADP
glicerin fruktóz-1,6-biszfoszfát

<<<<<<
ATP

>>>>>>
ADP NAD
+
NADH
o-glicerinfoszfát dihidroxi-aceton-foszfát Glicerinaldehid-3-foszfát
NAD
+ >>>>>> P
i
NADH
<<<<<<

Glicerinsav-1,3-biszfoszfát
glioxalát szukcinát
<<<<<<
ADP

>>>>>>
ATP

<<<<<
FAD H
2
C-O-PO
3
H
2


>>>>>
FADH
2
H-C-OH
2-P-G COOH 3-P-G
fumarát


<<<<<<
NAD
+

izocitrát
>>>>>>
NADH
H
2
O H
2
C-O-PO
3
H
2

C=O
malát ac.CoA 2-keto-3-P-G COOH
citrát Glu

<<<<<
NAD
+
o-ketoglutarát

>>>>>
NADH

H
2
C-O-PO
3
H
2

GTP GDP H-C-NH
2
ac.-CoA

oxálacetát P-E-P 3-foszfo-szerin COOH

>>>>>>
NADPH CO
2
Pi

<<<<<
NADP
+
acetil-CoA

>>>>>>
NADH H
2
C-OH
acetaldehid
<<<<<<<<
NAD
+
zsírsav | lebontás H-C-NH
2


>>>>
NADH
>>>>>>>>
FADH
2
COOH

<<<<<
NAD
+
<<<<<<<

FAD SZERIN
etanol
zsírsav


Ennek a túltermelésnek különböző oka lehet. Adott esetben a bioszintézisben érdekelt enzimek
képződnek nagyobb mennyiségben, tehát konstitutívan derepresszált mutánsokká váltak. Más esetben a
szabályozási mechanizmus hibájával, a feed-back érzékenység elvesztésével találkozunk. Mindkét eset a
természetes aminosav túltermelésével járhat

182
Triptofán bioszintézis szénhidrátból és ammóniából.

Leggazdaságosabb előállítási módja a teljes bioszitézis mutánsok felhasználásával. Az iparilag
használható mutáns előállításához az eddigi tapasztalatok alalpján a Corynebacterium glutamicum vad törzsből
indultak.. Először fenilalanint és tirozint igénylő, kétszeresen auxotróf korizmát-mutáz hiányos törzset izoláltak.
Ez a törzs limitált fenilalanin és tirozin jelenlétében tenyésztve képes volt csekély mértékben triptofánt termelni.
A felszaporodó korizminsav továbbalakulását nem tudta megakadályozni a triptofánra érzékeny, alloszterikusan
szabályozható antranilát szintetáz. A következő feladat éppen a feed-back mechaniuzmus hatástalanítása volt.
Ennek a feladatnak a teljesítése érdekében egymás után végzett műveletekben 5-metil-triptofánnal, 5 fluor-
triptofánnal, 4-metil-triptofánnal és triptofán-hidroxamáttal szemben rezisztens mutánsokat izoláltak. Ezek közül
választották ki mindig a legjobban termelőket és azokkal végezték tovább a klasszikus genetikai tevékenységet, a
nagy számban előállított mutáns vizsgálatát.
Ezek között a triptofán analógra rezisztens Tir
÷
Phe
÷
mutánsok legjobbjai már 0,5% triptofánt termeltek
mélyfermentációs körülmények között. Logikailag várható, hogy fokozódik a triptofán termelés, ha a fenilalanin
és tirozin érzékeny alloszterikus enzimek feed-back érzékenységét is sikerül megszüntetni. A további genetikai
beavatkozásokban p-fluor-fenilalaninra, majd p-amino-fenilalaninra rezisztens mutánsokat állítottak elő. Végül
tirozin-hidroxamátra, illetve fenilalanin-hidroxamátra rezisztens módosulatokat választottak ki. Szisztematikusan
mindíg a legjobbnak látszó mutánssal végezték a következő genetikai módosítást.
A munka eredményeként olyan genetikailag stabilnak tekinthető törzshöz jutottak, amelyik 12 g
triptofán termelésére volt képes literenként. A táptalaj 10 % redukáló cukrot, 2 % ammónium-szulfátot, 1 %
kukoricalekvárt és 2 % kalcium-karbonátot tartalmazott. A mutáns triptofán termelőképessége ezen kezelések
ellenére sem vesztette el teljesen a fenilalanin és tirozin érzékenységét. A technológia kialakításakor ezen két
aminosav aktuális koncentrációját a táptalajban gondosan végzett analitikai mérésekkel limitáló szintre kell
beállítani.

Aminosav forrásként előnyösen használható a szójafehérje hidrolízátuma fenilalanin kiegészítéssel. A
két aromás aminosav egymáshoz viszonyított arányának meg kell egyezni a mutáns fehérje-összetételében mért
aránnyal. A táptalaj szuboptimális aromás aminosav tartalma meghatározó jelentőségű. Ettől való eltérés lefelé
elmaradást okoz a növekedésben, felfelé pedig a triptofán termelés csökkenésével jár. A beállított táptalaj
összetétel csak a fermentációs paraméterek szigorú állandósága esetében hozhat eredményt. A hőmérsékletben, a
levegőzésben és a keverésben, vagy az induló sejtszámban való változtatás az aminosavak felhasználását is
változtatja, ami végül a triptofán termelésben való eltérés okozója lehet. Meghatározó jelentősége van a
technológiai előírások betartásának és a fermentációs berendezés, műszaki színvonalának.
A glükózból folyó triptofán szintézis oxigén igényéről fogalmat alkothatunk a mellékelt vázlat alapján.
A szintézis energia és anyagigénye független a törzstől, ezért az Escherichi coli adatai nem különböznek a C.
glutamicum -étól. Egyetlen triptofán képződéséhez 3 glükóz és 2 ammónia szükséges, miközben 1 piruvát, 4
szén-dioxid és nyolc redukált kofaktor és öt ADP regenerálása terheli az anyagcserét. A piruvát elégetés is az
anyagcsere feladata. Mindent összevetve triptofán molekulánként 11 NAD(P)H visszaoxidálása szükséges.
183

PEP + eritrózfoszfát Deox.arabino.hept.7-P Dehidrokvinát
COOH O=C-H DAHP
| | szintetáz
C–OPO3 H-C-OH
|| |
CH2 H-C-OH
+ |
CH2-OPO3




PI
CH2–OPO3
|
H-C-OH O COOH
| /
H-C OH CH
| |
CH—CH2
Dehidrokvinát
Szintetáz



NAD
+
NADH
HO COOH
\ /
H2C—C––CH2
| |
O=CH–CH–CH–OH
|
OH
[Phe–, tir–, triptofán–]
(végtermék szabályozás)

Enolpiruvinilsikimátszintetáz



3-P



Sikimát-kináz



Sikimát



dehid-
Dehidrokvinát
-dehidráz
H2O
Rogenáz
COOH
|
HC==C––CH PI
| |
O3PO–CH–CH–CH-O-C–COOH
| ||
OH CH2
COOH
|
PEP HC==C––CH
| |
O3PO–CH–CH–CH–OH
|
OH
COOH
|
HC==C––CH
| |
HO–CH–CH–CH–OH
|
OH
COOH
|
HC==C––CH
| |
O=CH–CH–CH–OH
|
OH
Korizmát-szintetáz pI
KORIZMÁT ANTRANILÁT FOSZFORIBOZILANTRANILÁT
COOH
|
HC–C==CH CH2
|| | ||
HC–CH–CH–O–C–COOH
|
OH [Phe–] [Tir–]

Gln
Antranil szintetáz COOH
Glu OH |
HC–C==C—NH2
|| |
HC–CH=CH
H3C–CO–COOH
Antranilát-
foszforibozil
transzferáz


PRPP PPI
HOOC ÖH OH
| | |
HC=CH–C CH——CH
| || | |
HC=CH–C–NH–CH–O–CH
|
CH2OPO3

Korizmát-mutáz [Triptofán–] (végtermékgátló) Foszforibozil-antranilát-izomeráz
HOOC CH2–CO–COOH
\ /
HC—C— CH
|| ||
HC—CH–CH
|
OH


Prefenát-dehidrogenáz



NAD
+

HOOC ÖH OH OH
| | | |
HC=CH–C C—–CH—CH
| || || |
HC=CH–C–NH– CH CH2OPO3



Prefenát-dehidráz
H2O

CO2


CO2


NADH
Indolglicerofoszfát szintetáz


CO2 H2O

HC-CH=C-CH2-CO-COOH
|| |
HC–CH=CH


HC–CH=C–CH2–CO–COOH
|| |
C–CH=CH
|
OH
OH OH
| |
HC–CH–C——–C—–CH—CH
| || || |
HC=CH–C–NH–CH CH2OPO3

Fenilalanin-transzamináz
Glu
o-ketoglutarát
Tirozin-transzamináz
Glu

o-ketoglutarát

Triptofán-szintetáz
NH2
|
HOCH2–CH-COOH

HC-CH=C-CH2-CO-COOH
|| |
HC–CH=CH
FENILALANIN
HC–CH=C–CH2–CO–COOH
|| |
C–CH=CH
|
OH TIROZIN
HC=O
|
H-C-OH
|
H2-C-OPO3
SZERIN
GAP TRIPTOFÁN NH2
|
HC–CH–C——–C—–CH2—CH
| || || |
HC=CH–C–NH–CH COOH




184
ASPARTAM Aszpartil-fenilalanin metilészter édesítőszer biotechnikai előállítása

Az utóbbi húsz év divatos édesítőszere a természetes alapanyagú L-aszpartil-L-fenilalanil-metilészter. Az
"aszpartám" édesítőszerként való alkalmazhatósága egy véletlen hanyagság (a laboratóriumi kézmosás
elhagyása) következményeként derült ki.. A felfedezést a fenilalanin előállítására szolgáló eljárások gyors
fejlődése követte. Az 1981 évi, főleg gyógyszeripari célt szolgáló évi 50 tonna termelés 1984-re 2000 tonnára
emelkedett. A kilencvenes évekre ez elérte a 10000 to/év szintet.
H
|
O = C ÷ OH HC—C==CH
| || |
H ÷ C ÷ H HC—C== CH
| |
H ÷ C ÷ NH
2
H H ÷ C ÷ H
| | |
O = C ——— NH ———— C ÷ H
|
O = C ÷ O ÷ CH
3


A szénhidrátból kiinduló fenilalanin szintézisre a Brevibacterium, Arthrobacter, Bacillus, Candida
nemzetségből származó mutánsok előnyösen használhatók. A fenilalanin túltermelés érdekében első feladat a
szabályozó mechanizmus felfüggesztése. Lásd a triptofán előállításával kapcsolatos fejezetet. A p-fluor-
fenilalaninnal és p-amino-fenilalaninnal szemben rezisztens törzsek fenilalanin termelése szignifikáns
emelkedést mutat. Tovább emelkedik a termelés ha az előbbi mutánsokból nyert tirozin-auxotrófot használjuk
az eljárásban. Ez érthető mert a fenilalanin képződés a korizminsavnál ágazik le a triptofán szintézisnél
megismert bioszintézis útból. Ezért előnyös az aromás aminosav képződés szempontjából az 5-fluoro-
triptofánnal szembeni rezisztencia kifejlesztése.
Az ipari eljárásban alkalmazott táptalaj 10 % melaszt, 2 % ammónium-szulfátot, 0,1 % foszfátot,
magnéziumsót és enzimesen bontott kazeint tartalmaz. A tápközeghez adott triptofán előnyös hatást mutat.
Akashi az oldott oxigénszint csökkentésével fokozta a fenilalanin képződést.
Az aszparaginsav ugyancsak előállítható biotechnikai eljárással. Az Escherichia coli, Pseudomonas
fluorescens és más baktériumokban működő aszpartáz aszparaginsavból ammónia felszabadításával fumársavat
állít elő. Eredeti szerepe az aszparaginsav hasznosítása szénforrásként. Ebből következik, hogy az enzim
képződését a glükóz katabolikusan represszálja, de az enzimszint alakulását a tenyészet oxigénellátottsága is
befolyásolja. (oxigénlimit esetén nem érvényesül a represszív hatás).

Az enzimmel in vitro körülmények között ammónium-fumarátból magnézium jelenlétében
gazdaságosan nyerhető az aszparaginsav. A reakciót az oldhatósági viszonyok kedvezően befolyásolják. A
diammónium-fumarát vizes szuszpenziója 20 %-os oldattal tart egyensúlyt, az ammónium aszpartátból viszont
60 %-os oldat készíthető. Ebből a tömény oldatból az izoelektromos ponton (pH = 2,8) az aszparaginsav
kristályosítható. Az azpartát enzimet tartalmazó E. coli sejtek bifunkcionális reagensekkel (glutárdialdehid)
bioreaktorba rögzítve – folyamatos üzemben – hónapokig használhatók aszparaginsav termelésre.


O=C÷O÷NH
4
O=C÷O÷NH
4
O=C÷OH
| | |
C÷H aszpartáz H÷C÷H HCl H÷C÷H
| |
÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷>
|
÷÷÷÷÷÷÷÷÷÷÷÷÷÷>
|
C÷H H÷C÷NH
2
H÷C÷NH
2
' pH = 8,5 ' pH = 2.8 '
O=C÷O÷NH
4


O=C÷OH O=C÷OH

Aszparaginsav előállítása diammónium-fumarátból

185

Hasonló módon működő rektorban a baktérium sejtbe rögzített fenilalanin-ammónia-liáz
felhasználásával a petrokémiai úton nyert cinnamonsav ammóniumsójából állítják elő a fenilalanint a GENEX
Co által ipari eljárássá fejlesztett technológiával.

HC==CH NH
3
HC== CH
| | | |
H–C C÷CH=CH÷COONH
4


H–C C÷CH
2
÷CHNH
2
÷COOH
|| || || ||
HC— CH fenilalanin ammónia-liáz HC— CH

Fenilalanin nyerhető cinnamonsav ammónium sójából

A két aminosavból általában kémiai eljárással állítják elő az egyre népszerűbbé váló édesítőszert, de elvégezhető
a szintézis enzimtechnikai módszerrel is. Sikerrel használhatók peptidkötések kialakítására a kereskedelmi
forgalomban beszerezhető proteázok, például a thermolysin (Daiwa Kasei K. K. Osaka), amely alkalmas
enzimhordozóra rögzítve tartósan használható. A poliészter alapanyagú, hidrofób és hidrofil kötőhelyekkel
rendelkező, 900 nm pórusméretű Amberlit XAD-7 (Dow Chemical Co.) használata különösen előnyös, mert a
hozzákötött enzimmel vízzel nem elegyedő szerves oldószerben (etilacetát, diklóretán, kloroform) is
lefolytatható a reakció.
Az etilacetátban oldott N-benziloxikarbonil-L-aszparaginsav és az L-fenilalalnin-metilészter elegyéből
kalcium-klorid jelenlétében az XAD-7 gyantán glutárdialdehiddel rögzített thermolysin segítségével N-
benziloxikarbonil-L-aszpartil-L-fenilalanin.metilészter, majd a védőcsoport eltávolításával az édesítőszer
nyerhető.



N-benziloxikarbonil-L-aszpartát L-fenilalalnin-metilészter



Thermolysint tartalmazó reaktor




N-benziloxikarbonil-L-aszparaginil-L-fenilalalnil-metilészter



hidrogénezés



L-aszpartil-L-fenilalanil-metilészter ASZPARTÁM

186










187
A LAKTOBACILLUSOK BIOLÓGIAI AKTIVITÁSÁNAK HASZNOSÍTÁSA

A tejsavbaktériumok egészségügyi és élelmiszeripari szempontból igen értékes mikroaerofil fakultatív
anaerob szervezetek. Savtűrésüknek köszönhetően kiszorítják az életterükről a környezetükben előforduló,
potenciálisan patogén Streptococcus fajokat. A G/C arányuk széles határok között változik, de az értékek bizonyos
élettani tulajdonságaikkal összefüggést mutatnak. Az emlős szervezet testüregeiben élve (szájüreg, bélcsatorna,
hüvely) és a körülményekhez tökéletesen alkalmazkodva, puszta jelenlétükkel és létszámukkal a gazdaszervezet
számára előnyös élettani körülményeket alakítanak ki. Antibiotikus hatású peptidek termelésével is befolyásolják a
környezetükben kialakuló flóra összetételét. Egyes fajaik poliszacharidot választanak ki.
A laktobacillusok nem képesek a hemin szintézisére. Az oxidációt különleges flavoproteinek végzik. Az
oxigén számukra azért nem toxikus, mert egy speciális flavintartalmú peroxidázuk van, ami a képződő peroxidokat
azonnal lebontja. A táptalajhoz adott hemin hatására viszont megjelenik bennük a kataláz, ami a hemszintézis
utólagos elvesztését igazolja.
Az anyagcsererendszer szempontjából a prokarioták két csoportba sorolhatók.
HOMOFERMENTÁLÓ törzsek és HETEROFERMENTÁLÓ törzsek aktivitása
Glükóz Glükóz
<<<<<< ATP <<<<<ATP
Hexokináz Hexokináz

>>>>>>
ADP >>>>>ADP
G-6-P G-6-P
<<<<<<<<<<< NADP
+

Izomeráz G6Pdehidrogená

>>>>>>>>>>
NADPH
F-6-P 6-P-G
<<<<<< ATP <<<<<<<<<< NADP
+

F-6-P-1-kináz 5Pgdehidrogená ----——> CO2

>>>>>>
ADP
> yyyy>>>>>
NADPH
F-1,6-P2 Ru-5-P
Aldoláz+izomeráz Epimeráz
Xu-5-P Pi
PentózP-ketoláz
2 GAP GAP Acetil-P
<<<<<< 2 NAD
+
NAD
+
>>> <<< ADP
GAPdehidrogenáz <<<<<< 2 ADP ADP >>> NADH >>>>>>

>>>>>>
2 ATP ATP
<<<
NAD
+
<<<<<<

<< ATP

>>>>>>
2 NADH NADH
<<<

2 P-E-P P-E-P
<<<<<< 2 ADP <<<<<ADP
Piruvát kináz Piruvát kináz >>>>>ATP

>>>>>>
2-ATP
2 piruvát Piruvát Ac.ald.
<<<<<< 2 NADH NADH >>> NADH >>>>>
Tejsavdehidr.---áz
>>>>>>
2 NAD
+
NAD
+

<<<
NAD
+

<<<<<


2 Tejsav

Tejsav

Etanol

Ecetsav

A homofermentáló törzsekben a glikolitikus út ép, ezért glükózból az EMP-úton főtermékként (90 %)
tejsavat fermentálnak és csak. kis mennyiségben képződik ecetsav, etanol és szén-dioxid. A heterofermentáló
törzsekben az aldoláz enzim hiánya miatt tejsav mellett számottevő mennyiségben etanol és ecetsav is képződik.
Ez esetben a glükóz a pentózfoszfát-úton hasznosul, és különös jelentőséget nyer a xilulóz-5-foszfát
foszforoklasztikus bomlása. A fermentlében a kialakuló etanol / ecetsav arányt a tenyészet fiziológiai igénye
határozza meg. A tejsavbaktériumok élőhelye tápanyagban gazdag, ezért nem meglepő, hogy az elmúlt évmilliárdok
alatt az anyagcsererendszerük zavara miatt különböző anyagcsere termékekre (metabolitokra) vitaminokra
hiánymutánsokká váltak. Az enzimhiányos génállományuk – az aminosav szintetizáló enzimrendszerükben levő
hiányosság – .természetesen egyértelműen meghatározza a számukra előnyös életteret, mivel ezeket a számukra
esszenciális vegyületeket, néhány vitamint a környezetükből kénytelenek felvenni. A klasszikus biokémiai analitika
területén ezek a törzsek aminosavak illetve vitaminok mennyiségének a mérésére használhatók.
A tejsavbaktériumok a történelem előtti idők rítusaiban rögzítve széleskörű felhasználásra kerültek. A
sütőiparban használt kovászban a Lactobacillus plantarum, a L. bulgaricus, L. brevis, a Leuconostoc mesenteroides
fordul elő az élesztő mellett. Starterkultúrák formájában a húsiparban, a tejiparban és a tartósítóiparban
nélkülözhetetlenek. Jelentős gazdasági szerepük van évezredek óta a növényi tápanyagok tartósításában (savanyú
káposzta, kovászos uborka). Az állattenyésztő gazdaságok a silótakarmányok előállításakor is a tejsavbaktériumok
aktivitását hasznosítják.
Olyan egyszerű, minden háztartásban végrehajtható folyamat, mint a savanyú káposzta készítés, ha
nagy mennyiségben, üzemi méretben valósul meg, a biztonság érdekében részleteiben kidolgozott technológiai
188
előírások betartása mellett végezhető. Ugyanez vonatkozik a többi, a történelem előtti idők óta folytatott
―biotechnológiai‖ tevékenységre
Káposzta savanyítás nagyüzemi méretben

Nyersanyag beszerzése
A nyersanyag tárolása
A káposzta feldarabolása
Levéltelenítés
Torzsa eltávolítása
Utótisztítás Melléktermék darabolása Feldolgozása
(Starter) oltótenyészet Bevágás
Darabolás Fűszer, cukor, só adagolás
Előkészítés sólével Melegítés
Oltóadagolás Betömködés
Egészségügyi ellenőrzés
Készre érlelés
Sóslé eltávolítás Készétel gyártás
Sóslé + bor keverése Keverés fűszerrel sóval
Eladható ivólé Kiszerelés üvegbe
Lezárás
Utóérlelés Kimosás Pasztőrizálás
Kiszerelés Kiszerelés Utóhűtés
Hűtés Hűtés Címkézés
Kiszállítás Kiszállítás Raktározás
Eladható friss
savanyúkáposzta
Eladható kimosott
savanyúkáposzta
Eladható pasztörizált
savanyúkáposzta


A savanyítási eljárás folyamán jól megfigyelhető az élettérért folyó küzdelem, jól elkülöníthetők annak egyes ál-
lomásai. A nedves növényi részeken először az aerob baktériumok szaporodnak. Elhasználják az oxigént, majd
átadják helyüket a fakultatív anaerob Aerogenes és Erwinia fajoknak. Ezeket a homofermentáló Streptococcus-ok és
a heterofermentáló Leuconostoc törzsek szorítják ki. A közben megjelenő 0,5-0,8 % tejsav már savtűrőképesség
szerint szelektál; megjelennek a Pediococcus fajok. Végül a tenyésztés körülményeinek változásával a savtűrő tejsav-
baktériumok válnak uralkodóvá, főleg a Lactobacillus plantarum.

A tejsavbaktériumok biokémiai aktivitását összefoglaló táblázat

Triviális név (Taxonomia)Rendszertani név
G/C
erjesztés 15°C optimáklis Hőfok 45°C


Thermobacterium Lactobacillus jugurti 39 homo dl +
Lactobacillus acidophilus 36 homo dl +
Lactobacillus salivarius 35 homo L +
Lactobacillus bulgaricus 50 homo D +
Lactobacillus leichmannii 51 homo D +


Streptobacterium Lactobacillus casei 46 homo L +
Lactobacillus plantarum 45 homo dl +


Betabacterium Lactobacillus büchneri 45 hetero dl +
Lactobacillus brevis 43 homo dl +
Lactobacillus fermenti 53 hetero dl +
Lactobacillus cellobiosus 53 hetero dl +

A tejsavtermelő képességük és a tejiparban betöltött szerepükre való tekintettel ide soroljuk a Streptococcus lactis, S.
cremoris, S. thermophilus, S. durens, S. diacetilactis, Leuconostoc citrovorum, Lactobacillus casei és a Pediococcus
fajokat A savanyú tej, az iró fermentálója a Lactobacillus acidophilus. A 40 °C-on erjedő joghurt készítésénél a
Lactobacillus bulgaricus és a Streptococcus thermophilus aktivitását hasznosítják. Az alkoholt tartalmazó kefír a
Streptococcus lactis, a Lactobacillus bulgaricus és az élesztő együttműködésének a fermentációs terméke. A sajtok
készítésénél is minden esetben jelen vannak. a jellegzetes íz-anyagot szolgáltató fonalas gombák mellett. A svájci
sajtok fermentálásában jelentős szerepet visznek a Propionibacterium shermanii és a P. freudenreichi törzsek. Az
ipari tejsav gyártásához a Lactobacillus delbrueckii-t használják.

189

CLOSTRIDIUM TÖRZSEK IPARI HASZNOSÍTHATÓSÁGA

A triviálisan vajsavas baktériumnak nevezett obligát anaerob Clostridium fajok már Pasteur figyelmét is felkeltették.
A szénhidrátból képződő redukált termékek iránt később a fejlődő vegyipar is érdeklődést mutatott. A századforduló
körül a háborúra készülő nagyhatalmak szerves vegyipari alapanyagigénye (robbanószer gyártás) gyorsította a
nagyipari technológia kifejlesztését. Ezek a baktériumok glükózból fruktóz-biszfoszfáton keresztül különböző
savakat, alkoholokat, szén-dioxidot és hidrogént termelnek.

Fehérje erjesztésekor anaerob körülmények között végbemenő aminosav dehidrogénezési, oxidatív
dekarboxilezési és az aminosavak reduktív deaminálási folyamatait összekapcsolva (Stickland-reakció 1934) a
megfelelő savakon kívül ammónia és ATP is képződik.


Oxidatív
Hatás
COOH
H-C-NH2
H-C-H
H
Stickland
reakció
COOH
2 CH2
NH 2
Reduktív hatás
H2O
NH3
NAD
+

NADH

COOH
C=O NAD
+
2 NH3
CH3
CO2

CoA-SH
CoA
S
C=O Pi
CH3.
NADH

P-O3H2
P-O3H2
O
C=O
CH3



2 ADP
2 O
C=O
CH3

ADP
ATP

2 ATP

HOOC-CH3 2 HOOC-CH3

Alanin + 2 glicin + 3 ADP +3 P
i +
+ H
2
O 3 ecetsav + 3 Ammónia + 3 ATP + CO
2


A Clostridium acetobutylicum (ATCC 824) talajban élő, peritrich ostoros (0,8 x 4 um) pálcika, amely a
légköri nitrogén megkötésére is képes. Ipari eljárásban aceton és butanol előállítására használják. A butanol, mint
membránkárosító oldószer limitálja az elérhető koncentrációt; 2 % felett már toxikus tünetek jelentkeznek.

A fermentációs eljárás közben először a megfelelő sav képződik, ami a fermentáció második szakaszában –
a sejtek növekedése nélkül – a trióz-foszfát dehidrogénezése közben képződött NADH hasznosításával redukálódik
alkohollá. A reakcióelegyhez adott kálcium-karbonát hatására ez az átalakulás nem következik be, felszaporodik a
vajsav és az ecetsav Ca sója.

Kétnapos Clostridium fermentáció termékösszetétele (mg / liter ):
Kalciumkarbonát nélkül Kálciumkarbonát jelentétében
vajsav 32,2 630,0
butanol 411,5 45,7
ecetsav 102,1 230,7
etanol 44,5 22,4
aceton 222,3 13,2










190
Clostridium fajok fermentációs aktivitása

Piruvát
NAD
+

>>>>>>>
TPP
CO
2
Dehidrogenáz
NADH NAD
+
NADH
<<<<<<<<
liponsav
Etanol Acetald. Acetil-CoA Acetil-P
CoA-SH Acetil-CoA
Aciltranszferáz
acetecetsav Acetoacetil-CoA ecetsav
Dekarboxiláz NADH
>>>>>>>>

CO
2
Acetoacetil-CoA
aceton NAD
+

<<<<<<<<
Dehidrogenáz

<<<<<<<
NADH ß-hidroxibutiril-CoA
Dehidrogenáz

>>>>>>>>
NAD
+
H
2
O Krotonáz
Krotonil-CoA
izopropanol NADH
>>>>>>>>

Butiril-CoA
NAD
+

<<<<<<<<
Dehidrogenáz
Butiril-CoA
NADH
>>>>>>>>

CoA-SH Dehidrogenáz
NAD
+

<<<<<<<<

Butiraldehid


Butanol

Vajsav


Az ipari gyakorlatba vett törzsből céltudatos szelekcióval nyert Clostridium butylicum butanol és izopropanol
előállítására használható. Az elkülönített Clostridium butyricum stabil variánsként vajsav- és ecetsavképzésre
alkalmas.

Keverővel felszerelt fekvő bioreaktor
1) gázelegy bevezető 2)mintaveveő csonk 3) hűtőköpeny 4) keverő lapátok 5)Gázelegy elvezető
6) Keverő mototr 7) fermentor test 8) Reakcióelegy 9) keverőtengely

Táptalajként kukoricalekvárt (a keményítőgyártás melléktermékeként felgyűlő növényi fehérjét tartalmazó
oldat tejsavas erjesztésével nyert termék koncentrátuma) és melaszt (a répacukor kristályosításakor visszamaradó
anyalúg) sterilizálnak az anerob bioreaktorban. A táptalajt aszeptikus körülmények között a termelőképességre
szelektált törzs spóráival oltják. Az Clostridium törzsek obligát anaerob voltára tekintettel órákon keresztül szén-
dioxidot áramoltatnak át a rendszeren a növekedés megindulásának segítése céljából.
191

ALKOHOLOS ERJESZTÉS

A történelmi idők előtt kialakult alkoholos erjesztési technológiák fő szereplője az élesztő. Ez a tömlős-
gomba néhány különleges biokémiai tulajdonsága miatt került a törzsfejlődés kegyetlenül szelektáló
körülményei között erre a helyre. Ezek a környezet károsító hatásait is jól tűrő, genetikailag stabil szervezetek a
növényi eredetű természetes táptalajokon jól növekednek. Az élesztők a természetben viszonylag nagy
koncentrációban előforduló cukrok (glükóz, maltóz, maltotrióz, trehalóz, galaktóz, mannóz, fruktóz, szacharóz,
raffinóz) hasznosítására, erjesztésére is képesek. Erjesztő tevékenységük főterméke az etanol.
A csoport elnevezése tudománytörténeti. Az alkoholos erjedés enzimeinek hordozóiként megismert
élesztőgombákat (zymomycota) a görög erjesztő .uueuo (kovász) szóval különböztették meg a szénhidrátot nem
erjesztő aerob gombáktól. Rendszertanilag a tömlősgombák közé sorolva Hemiascomycetes-ként különítették el őket
az Euascomycetes csoporttól.
Az élesztősejtfal külső mannán-fehérje rétegét diszulfid-hidak merevítik. Még több a diszulfidkötés a
pszeudohifát képző sejtek falában. Ez a rögzített szerkezet megakadályozza a falban működő enzimek eltávozását, de
védi a sejtfalat a közegben előforduló sejtfalbontó enzimek roncsoló hatásától is. Polarizációs mikroszkópi tech-
nikával nyert adatok szerint az élesztő külső mannán rétegének elemei radiálisan, a belső rétegek viszont a
sejtfelszínnel párhuzamosan, kötegekbe rendeződve helyezkednek el.
A Saccharomycetaceae családba egysejtű, sarjadzással szaporodó, de a tenyésztési körülményektől függően
álmicéliumot (pseudo) képző gombák tartoznak. Ivaros szaporodásuk a vegetatív sejtek összeolvadása. Az idetartozó
nemzetségeket zimospóráik alakja és kialakulásuk módja alapján különíthetjük el. A talajtól a melegvérűek
bélcsatornájáig mindenütt találkozhatunk velük. Erjesztő képességüket a borászat, a söripar, a szeszipar és a sütőipar
hasznosítja; a vegyipar enzimforrásként alkalmazza; az állattenyésztők pedig takarmányként ismerik. A
Saccharomyces carlsbergensis-t — amelyet a rendszertan Saccharomyces uvarum-nak nevez — például a hazai
sörgyárainkban a mélyerjesztésnek nevezett technológiában használják. Az idesorolt fajok imperfekt alakjait sok
esetben a szabályokat szigorúan követő szerzők műveiben a Deuteromycota tagozat Candida nemzetségébe sorolva
találjuk.
Saccharomyces cerevisiae (szin.: Candida robusta). Első leíróik (Megen és Hansen) 1883-ban Saccharomyces
ellipsoideus néven vezették be az irodalomba. Pszeudomicéliumot képez, alakja és mérete változó. Gyümölcslében,
talajban és Drosophilán igazolták jelenlétét.
Felsőerjesztésű technológiában alkalmazott
sörélesztő. Borélesztő néven sok variánsa ismert.
Hidegtűrő, melegtűrő, alkoholtűrő, kénsavtűrő,
aroma anyagokat termelő változatait fajélesztőként
tartják számon és a borászatban használják. A
pékélesztő főtömegét is ez alkotja. Az élesztő-félék
közül a Saccharomyces cerevisiae szaporodási
folyamatairól rendelkezünk a legtöbb ismerettel.
Az élesztőkben a kromoszómák mitózisos
osztódása a maghártya felszakadása nélkül a
sejtmagban folyik. A görög latin eredetű elnevezése (uuuoo. mythicus) a sejtosztódás valamikor ismeretlen
folyamatáea utal. A sarjadzással egy időben a nukleolusz is kettéosztódik és az egyik az új sarjsejtbe húzódva
irányítja a megkettőződő kromoszómák szétválását. A maghártya - eltérően a magasabbrendűektől - a kromoszóma
kettőződésekor is fennmarad, megakadályozandó a magtartalom szétáramlását a citoplazmában. Ezért a
gombamitózist kariokorízisnek (;opiov magzatburok) nevezzük.
Az S288C törzs óvatosan nyert lizátumának pulzáló mezejű gélelektroforetogramja (PFGE) is igazolja
kromoszómáinak számát. Sőt, a 16 kromoszóma méretére vonatkozólag is megbízható adattal rendelkezünk.
S288C törzs Kromoszómái
I. 240 kb IX. 440 kb
II. 840 kb X. 755 kb
III. 350 kb XI. 680 kb
IV. 1640 kb XII. * 1095 kb
V. 590 kb XIII. 950 kb
VI. 280 kb XIV 810 kb
VII. 1120 kb XV. 1130 kb
VIII. 590 kb XVI. 980 kb
- Megemlítendő, hogy a riboszomális DNS még hozzáadandó a XII. kromoszóma méretéhez.




192



Élesztősejtben lejátszódó mitózis elekteronmikroaszkópos képe



A kromoszómák szétválását minden esetben mikrotubulusokból felépülő osztódási orsó kialakulása segíti. Ez a
húzófonalként szolgáló fehérje a kromoszóma belső részén található, centromernek nevezett, konzervatív szekvenciát
tartalmazó szakaszához kötődik. A csövecskéket felépítő fehérje a tubulin, amelyhez specifikusan kötődnek a fungi-
sztatikus hatású benzimidazol származékok, amilyen például a karbendazim. (A magasabb rendűek mikrotubulusait a
kolchicin képes inaktíválni, amelyre a gombák viszont érzéketlenek!). Az eukariota kromoszóma mindkét végén
többször ismétlődő konzervatív szekvenciát tartalmazó záró szakasz, a kromoszóma információtartalmát őrző
telomer régió helyezkedik el. Természetesen minden kromoszómán megtalálható a megkettőződést irányító (ARS
regio, autonom repetitív szekvencia) szakasz. Ezen ismeretlen szerkezetű alkotórészek birtokában olyan, tetszőleges
információt tartalmazó mesterséges kromoszóma is előállítható, amely az utódokban változatlan formában
megjelenve, adott esetben kifejeződik.
Ha ellentétes ivarú törzs nincs jelen, akkor a sarjadzó sejtek génállománya mitózisos osztódással a
sejtmagban a maghártya felszakadása nélkül kettőződik. A maghártya csupán az ivaros folyamatban bekövetkező
kariogámia folyamatában a két mag összeolvadásakor válik átjárhatóvá. A folyamatot az interfázis G-1 (gap)
szakaszában a cdc28-gén (cell division cycle) működése indítja el. Mindenekelőtt a maghártyán levő, centriolum
szerű képlet kettőződve az osztódásban irányító szerepet tölt be. Az egyik mukleolusz az új sarjsejtebe húzódva
irányítja a megkettőződő kromoszómák szétválását. A következő lépés (S fázis) a DNS-replikáció, amit a
mikrotubulusokból szerveződő osztódási orsó kialakulása követ. A kromoszómák szétválását az M fázisban (mitózis)
ez a szerkezet segíti elő. A folyamat általában 90-120 percet igényel. Ez a szétválás már sarjadzás közben történik. A
szülő sejt és a leánysejt között csupán a szaporodási heg számában van különbség. A sarjadzó gombák

Élesztőkromoszómák (Sfi –
|
– és Not –
|
– enzimekkel nyert) restrikciós térképe
193
szaporodásakor ugyanis nem reped fel a fal külső rétege, hanem a sarjsejt növekedésekor a régihez szervesen
kapcsolódva képződik az új teljes sejtfal. A képződő leánysejtmag, valamint egy-két mitokondrium kerül azután a
sarjsejtbe, amely kezdetben sokkal kisebb, mint az anyasejt. Az intenzív növekedési szakaszban az új sarj képződése
a leánysejten még az anyasejtről való leválás előtt, az
összekötő szakasz eltömődése közben már
megindulhat. Egy ciklus ilyenkor 70-100 percig tart,
később ez a folyamat 6 órára nyúlik.
A sarjsejt képződését a fonalas gombák
mikrociklusos konídiogeneziséhez hasonlítva, a
fialidból kisarjadó vegetatív spórának tekinthetjük. Az
élesztősejtek felületén a leváló sejt helyén kitinben
gazdag heg képződik, amelyből az utódok számára
következtethetünk. Sarjképződés ugyanis csak
érintetlen sejtfalon indulhat meg. Specifikus festéssel,
illetve elektronmikroszkópos felvételeken a leválás
helye jól látható.
A valódi élesztők sarjadzó képességének
meghatározása céljából a tápanyag folyamatos
kiegészítése mellett a sarjsejteket is eltávolították a
tenyészetből. Ez esetben 43 sarjsejt képződését
igazolták az átlagos 24 leánysejt képződése helyett. Az
ipari gyakorlatban optimális körülmények között 6-8
sarjnál nem képződik több, mert a tenyészet sűrűsége
(élősejtszám) gátat vet a szaporodásnak. A
vizsgálathoz szükséges érintetlen kiindulási sejtet csak
a szexuális szaporodással képződő zimospórákból
nyerhetünk.
A Saccharomyces cerevisiae genetikailag tiszta állományú törzsei vagy a-ivarúak (MATa-gén) vagy
o-ivarúak (MATo-gén). Az ivaros szaporodásban szerepet játszó gének közül eddig 32 működését ismerjük. Az
idesorolt családok közös ismérve az ellentétes polaritású sejtek összeolvadásával képződő, régebben aszkusznak
nevezett zimosporangiumban fejlődő zimospóra. A zimosporangium néhány kivételtől eltekintve négy zimospórát
tartalmaz. Amennyiben a tenyészetben kellő számban heterotallikus tulajdonságú ellentétes ivarú — a MATa gén,
illetve o alléljét tartalmazó — sejt van, akkor megindulhat a szexuális szaporodási ciklus, amely több mint 5 óra alatt
fejeződik be. Első lépésként az általuk kiválasztott feromonszerű (S = substantia) vegyületek kölcsönösen leállítják a
cdc28-gén működését. Az o-ivarú sejtek az o
I
-S, az a ivarú sejtek pedig a feromon a
I
-S változatát állítják elő. A
feromonok dodeka- és tridekapeptidből és ezek oxidált formájából álló fehérjék.

o÷faktor H
2
N-Trp-His-Trp-Leu-Gln-Leu-Lys-Pro-Gly-Gln-Pro-Met-Tyr-COOH
(o
I
-S feromon)

CH
3
CH
3
CH
3



| | |
CH
2
C CH
2
C CH
2
C
/ \ // \ / \ // \ / \ // \


S CH CH
2
CH CH
2
CH CH
3

(a
I
-S feromon) |
a-faktor H
2
N-Tyr-Ile-Ile-Lys-Gly-Val-Phe-Trp-Asp-Pro-Ala-Cys-COO-CH
3



Egyidejűleg mindkét ivari ciklusra készülő sejt feromont kötő fehérjét (Guanin nukleotidot kötő
o. | és ¸ fehérjét tartalmazó hetero-trimer) termel. A feromon hatására az élesztősejtek megkezdik az agglutinációs
faktorok (a-AF=hőstabil glükopeptid, illetve az o-AF=hőérzékeny glükopeptid) termelését. Az ellentétes
agglutinációs faktort termelő törzsek ezután páronként összetapadva élettani folyamataikat szinkronizálják. Az o
I
-S
hatására az a-ivarú sejtek, az a
I
-S feromon hatására pedig az o-ivarú sejtek a citoszkeleton átrendeződésével
nyúlványt fejlesztenek, gametangiummá alakulnak. (Természetesen a sejtek saját feromonjaikkal szemben érzéket-
lenek.) A gametangiummá alakuló sejtek összeérő sejtfala feloldódik, majd a két sejt plazmája összefolyik,
bekövetkezik a plazmogámia. A két sejtmag a KAR-gén hatására egymás felé úszik, majd összeolvadva (kariogámia)
a sejt valódi zigótává (2n gonatokonta) úgynevezett blasztozigótává alakul. Elegendő tápanyag jelenlétében a zigóta
sarjadzása diploid sejttenyészet (diplofázis) kialakulását teszi lehetővé. A diploid sarjadzással készülő sejtekben a
MAT gén a és o allélja is jelen van, ezért szexuálisan inaktív, ivaros szaporodásra képtelen.

Az élesztő mitózisos osztódása
194


A tápközeg széntartalékának kimerülésekor, vagy nitrogén éhezés estében, a belső redukáló erő
csökkenésekor (oxidatív sztressz) a diploid sejtek meiospóra anyasejtté alakulnak. Ez az átalakulás egyedüli
szénforrásként acetátot tartalmazó táptalajon már 4 órán belül bekövetkezik..
A meiózisos folyamat első lépéseként az I-profázis keretében a DNS-állomány megkettőződik, létrejön a 4n
állapot. Ezt követi a II-profázis, amelyben a kromoszóma állomány két leánymagra különül. További szétválással
alakul ki a négy haploid prospóra génkészlete. Ezzel egyidejűleg megindul a többrétegű spórafal képződése, valamint
a spóraplazma sűrűsödése. A II-telofázis végére mind a négy haploid zimospóra (két a ivarú és két o ivarú) érése
befejeződik. A kiszabaduló spórák megkezdhetik vegetatív szaporodásukat (sarjadzás).
Sok esetben a szexuális folyamat zavartalan lefolyásának előfeltétele az ölő (MAK killer) tulajdonság
jelenléte. Az úgynevezett "killer-gén" egy olyan toxikus fehérje képződését segíti, amely a környezetben levő idegen
élesztő törzseket elpusztítja. Az ölő toxin elleni védelmet, a saját toxinnal szembeni rezisztenciát három működőké-

195
pes kromoszómális gén biztosítja. Az ölő anyagot termelő sejtekben két nem szegmentált kettős szálú RNS vírus
— a V-1 és a V-2 — található. Azonban nem csak ez a két virion szükséges az ölő toxin képződéséhez, hanem magi
kromoszómális gének aktív tevékenysége is nélkülözhetetlen.
A MAK gének többsége a V-2, néhány pedig a V-1 RNS fonal képződését segíti elő. Megjegyzendő
továbbá, hogy a V-2 öröklődése a fentieken kívül még néhány kromoszómán kódolt gén jelenlétét igényli.
Bármelyikük hiánya a virion-RNS széttörését okozza. AV-1 virion 4,6 kb méretű dsRNS fonala kódolja a kapszid
fehérjét és az RNS-függő polimerázt. A V-1 virionból kizáródó +RNS szálról a gazda riboszómáin képződik a tok
fehérje és a RNS függő fúziós fehérje, amit a V-2 vírus csomagoló anyagként használ. Az RNS fonalak aszinkron
módon a fejlődési folyamat különböző periódusában a virionon belül szintetizálódnak a magi gének által kódolt
fehérjék aktív közreműködésével. A V-2 virionban levő kisebb méretű 1,8 kb méretű dsRNS fonal +RNS szála
kódolja a preprotoxin fehérjét, amit a gazdasejt magi DNS (KEX gének, killer expression) által kódolt fehérjék által
irányított érési folyamat aktivál. A környezetbe való kiválasztást (secession) a SEC gének segítik. Az aktív toxin
(killer faktor) az idegen gomba glükán sejtfalán levő receptorhoz kötődve kálium és proton kiáramlást okozó pórust
képez.
A spórázás folyamatában érdekelt gének sérülése esetén a folyamat megrekedve különleges sejtvonalak
kialakulására vezet. A KAR-gén sérülése esetén a folyamat a prozigóta állapotig jut el. Az így létrejövő dikarion
sejtvonal vegetatív úton sarjadzással szaporodhat. Az is előfordul, hogy a diploid sejtek (blasztozigóta) tovább
alakulásának gátlása a kedvezőtlenné váló környezeti hatás ellenére a diploid élesztő vonal fennmaradását okozza.
Más esetben, ha az elindult ivaros folyamat valamilyen okból nem végződik zigótaképzéssel, akkor adaptálódásnak
nevezett folyamat keretében visszaalakulhat haploid sarjadzó sejtté.

Élesztőfélék diploid sejtciklusának indulása

Néhány élesztőfaj esetében magi kromoszómában rögzített killer tulajdonság is ismeretes. A
Kluyveromyces marxianus var. lactis killer fenotipusát két plazmid, a citoplazmában található 8,9 kb méretű pGKL1
és a 13,4 kb méretű pGKL2 plazmid hordozza. Az 1-es plazmid kódolja a toxint és az immunitást jelentő fehérjét; a
2-es plazmid pedig a DNS polimerázt és az DNS függő RNS polimerázt. Maga a toxin – amely idegen törzs esetében
a sejtciklust a G1 fázisban állítja meg – heterotrimer glükoprotein. Az o-alegység S-S hidakkal merevített
glükoprotein. A | ás a ¸ alegységet is S-S hidak kapcsolják egymáshoz. Megjegyzendő, hogy a Killer fenotipust
eredményező RNS vírusok, illetve plazmidok hatása sok esetben a tömlős és bazídiumos gombáknál is jelentkezik.
A Saccharomyces cerevisiae homotallikus törzsei a genom programozott átrendeződése miatt a párosodási
típusuk megcserélésére, a III. kromoszómán lokalizált MATa és MATo allélok egymásba alakulására képesek. A
homotallikus törzsekből képződő telep — mivel a sarjadzás közben képződő a illetve o sejtek zömmel konjugálnak

196
— a/o sejteket tartalmaz . Az átalakulást a IV. kromoszómán lokalizált endonukleázt kódoló homotallia gén (HO
gén) irányítja. Párosodási típus váltásra csak a többször próbált anyasejt képes. A sarjadzást közvetlenül megelőzve
játszódik le az allélcserélődés folyamata.
A genetikai tulajdonságok megőrzésén és tovább adásán kívül a DNS-ben rögzített tulajdonságok
leolvasása is a sejtmagban játszódik le. Itt megy végbe a sejtmagban működő RNS-polimeráz által létrehozott
premessenger-RNS érési folyamata. Bonyolult lépésekben a szükségtelen (intron) szakaszok eltávolításával és az
exon szakaszok összekapcsolásával készül a citoplazmában folyó riboszómás fehérjeszintézis irányítására alkalmas
érett mRNS. Az így készült mRNS a maghártya pórusain keresztül kerül a citoplazmába, ahol a 80S méretű
riboszómákon a fehérjeszintézis folyamata végbemegy. Ezeken a pórusokon keresztül jut a sejtmagba az RNS-
szintézishez és a DNS-replikációhoz szükséges összes építőelem (nukleotid-trifoszfátok), de ezeken a pórusokon
jutnak a sejtmagba a citoplazmában képződő enzimek és szabályozó fehérjék (represszorok) is.
Az élesztők ammóniából és szénhidrátból a sarjadzó sejt felépítéséhez szükséges vegyületek teljes
választékát képesek előállítani. A szénhidrát hasznosításban az Embden, Meyerhof, Parnas nevével jegyzett
enzimrendszerük sejtmentes formában is képes a glükózt alkohollá alakítani, amint azt Büchner 1897-ben
közreadott dolgozatában leírta. Az EMP út kulcsintermedierjét - a Harden és Young által izolált (1908-ban)
fruktóz-1,6-biszfoszfátot - az ATP szint által szabályozott fruktózfoszfát-1-kináz állítja elő fruktóz-6-foszfátból.
A növekedés ütemét a NADH regenerálásának mértéke, az alkohol képződés befolyásolja.
A növekedéshez szükséges egyéb vegyületek (aromás aminosavak, pentózok) képződése a jól ismert
HMP (hexózmonofoszfát) úthoz kapcsolódva folyik. A HMP út teljesítményét, a bevezető reakciókat katalizáló
enzimek (glükóz-6-foszfát-dehidrogenáz és glükonát-6-foszfát-dehidrogenáz) működését a kofaktor
ellátottságuk, a NADP
+
szint alakulása szabályozza.
A fakultatív anaerob szervezetek szénhidrát anyagcseréjének szabályozására vonatkozó első
tudományos megállapítás Pasteur nevéhez kötődik 1860 óta. Kisérleti eredményei az oxigén szabályozó
szerepére hívta fel a figyelmet. Oxigén jelenlétében az élesztők növekedése jelentősen fokozódik. A légzés
fokozódása, az oxidatív foszforilációhoz vezető elektronlánc működése, a tápközeg (szénhidrát)
energiatartalmának gazdaságosabb hasznosítását teszi lehetővé. Oxigén jelenlétében az anaerob anyagcserét
kiszolgáló EMP úttal szemben előtérbe kerül a HMP út működése, amely a növekedéshez szükséges építőelemek
képződése szempontjából meghatározó jelentőségű. Az oxigén közvetlen hatását kísérletileg ugyan nem
igazolták, bár számos olyan enzim ismert, ilyen például az o-ketoglutarát dehidrogenáz is, amely csak oxigén
jelenlétében képződik.
Valójában az élesztők nem tekinthetők fakultatív anaerob szervezeteknek, mert a növekedésük
szigorúan anaerob körülmények között leáll. Oxigénmentes körülmények között ugyanis nem képesek a
sejtmembrán nélkülözhetetlen építőelemeként ismert szterinek (ergoszterin) és bizonyos esszenciális telítetlen
zsírsavak szintézisére. Néhány metil csoport eltávolítása molekuláris oldott oxigén jelenlétét igényli. Az ipari
gyakorlatban ezért csekély levegőt mindig juttatnak a tenyésztő reaktorba. Az élesztők különleges szabályozási
mechanizmusa miatt az alkoholos erjedés hatásfokát a jelenlevő oxigén nem rontja.
197
.
Az ábra bemutatja az élesztő és az ipari alkohol gyártáshoz előnyösen használható anaerob baktérium
erjesztő tevékenységét. A Zymomonas mobilis az élesztőnél lényegesen nagyobb szénhidrát koncentrációt és
etanol tartalmat képes elviselni. Magasabb hőmérsékleten erjeszt. 36 °C-on az elméletileg lehetséges alkohol
hozam 97 %-át teljesíti. Mivel a szénhidrát lebontás az Entner-Doudoroff úton folyik, csak 1 ATP képződik,
amiből következően a képződő sejttömeg csekélyebb. (A folyamatosan üzemeltethető reaktorban állítják elő a
motorhajtóanyagként forgalmazott alkoholt.)
Az élesztőben az oxigán jelenléte, az aerob anyagcsere működése morfológiai változást jelent. Az
energia nyerés feladatát a továbbiakban a mitokondriumok látják el. Gyorsul a sejtszaporodás, miközben
csökken a szénhidrát felhasználása. Megjelennek a légzést szolgáló mitokondriumok, amelyek anaerob
körülmények között, oxigén hiány esetén újra sorvadásnak indulnak. Anaerob viszonyok között az oxidatív
foszforilációt kiszolgáló elektronlánc működésképtelen. A mikroba növekedő szénhidrát felhasználással —
alkoholos erjedéssel — az EMP úton szubsztrátszintű foszforilációval próbálja kielégíteni a mikroszervezet
energiaigényét. Ennek az útnak a rossz hatásfoka az aerob körülményekhez viszonyítva lényegesen lassúbb
növekedést képes kielégíteni.
Azt, hogy ezt a váltást nem közvetlenül az oxigén okozza jól demonstrálja - a Crabtree által 1929-ben
leírt jelenség - a glükóz fogyasztásnak a megnövekedése. A tápközeghez adott glükóz mennyiségétől függően az
élesztő aerob körülmények között is képes az alkoholos erjedés irányába terelni az anyagcserét. Glükóz
adagolásakor a citokrómok képződése ugyanúgy leáll, mintha oxigén hiányában következne be a gátló hatás. A
légzőenzimek kiesése érzékenyen érinti a sejt ATP szintjét. Az ATP szint csökkenése pedig feloldja az
alloszterikusan szabályozott fruktózfoszfát-1-kináz gátoltságát és ezzel utat enged az EMP út szubsztrát-szintű
foszforilációjának. Ennek az enzimnek a működését az aktuális ATP szint szabályozza. A légzés csökkenése a
redukált kofaktorok NADH, NADPH feldúsulásához vezet. A NAD
+
hiány gátolja a piruvát-dehidrogenáz
működését, amiből következően a Krebs ciklus leáll. Az ATP szint alakulása a permeáz működésére hatva,
befolyásolja a glükóz felvételét. Végeredményben a légköri oxigén jelenlétében anaerob anyagcserére jellemző
egyensúly alakul ki, amely a fokozott glükóz felvétel mellett csupán a növekedés lassú voltában jelentkezik. A
glikolitikus út önfenntartó módon képes a glükózt két etanollá alakítani, miközben két ATP marad további
felhasználásra. Az elméleti konverziós értéket (1 g glükóz --> 0,51 g etanol) csak 95%-ra lehet megközelíteni.
Melléktermékként a táblázatban feltüntetett glicerin és szerves savak jelennek meg, amelyek a NADH
dehidrogénezése közben képződnek.
198

100 mmol glükózból képződő fermentációs termék Saccharomycas cerevisiae tenyészetben
Vajsav 0,21 mmol Etanol 129,9 mmol
Tejsav 1,37 mmol Butándiol 0,7 mmol
Ecetsav 15,15 mmol Glicerin 32,3 mmol
Hangyasav 0,49 mmol Szén-dioxid 148,5 mmol
Borostyánkősav 0,68 mmol

A glicerin képződés főtermékké tehető, ha az alkohol-dehidrogenáz működését helyettesítve az o-
glicerinfoszfát-dehidrogenáz regenerálja a redukált kofaktorokat. Az alkohol-dehidrogenáz leállását okozza, ha a
reakciótermékét - az acetaldehidet - keletkezése pillanatában nátrium-szulfittal reagáltatjuk. Ezért az EMP úton
képződött NADH a dihidroxiaceton-foszfát redukciójára használódik fel. A képződő o-glicerinfoszfátot végül
egy foszfatáz alakítja glicerinné.


Dihidroxiaceton-foszfát + NADH ———————> o-glicerin-foszfát + NAD
+

o-glicerinfoszfát-dehidrogenáz


o-glicerin-foszfát ————> glicerin + Pi
foszfatáz


Az alkoholos erjedés gyakorlati hasznosítása: BORTERMELÉS

Az emberi civilizáció az alkoholos erjedési folyamatot világszerte élvezeti cikkek előállítására hasznosította.
Kezdetben természetes eredetű szénhidráttartalmú növényi kivonatok, gyümölcsök présleve szolgált
alapanyagul, később gabonamagvak szénhidráttartalmát erjesztették.
Az egyik legnagyobb mennyiségben fogyasztott alkohol tartalmú termék a szőlőből préselt mustból
anaerob fermentációval nyert bor. A must szénhidrát tartalmának jelentős hányadát a mustba került élesztők
biokémiai aktivitása alakítja alkohollá. A világ évi bortermelése 300 millió hektoliter, amelynek 80 %-át
Európában termelik. A piaci adatok szerint Dél-Amerika a világ termelésének 10%-át az USA pedig 6 %-át
állítja elő, bár az utóbbi évtizedben az amerikai kontinens bortermelése évről évre emelkedik.
A kipréselt szőlőlé enyhén savanyú kémhatású (pH=3,3-3,9), 6-10 % glükózt és 8-12 % fruktózt, 0,2-
0,6 % asszimilálható nitrogént valamint kolloid méretű növényi részeket tartalmazó enyhén zavaros tápközeg.
Savanyúságát a mustban előforduló 0,5-1 % szerves sav okozza, amely gátolja a baktériumos fertőzést okozó
csírák elszaporodását. A must könnyen metabolizálható nitrogén tartalma, amely az élesztők elszaporodása
szempontjából létfontosságú, főleg aminosav formájában van jelen. Ha valamilyen okból a must nitrogén
tartalma nem éri el a 0,2 %-ot akkor - például a szőlőfürtök Botrytis cinerea fertőzöttsége miatt - célszerű
literenként 200-300 mg ammónium-foszfátot, illetve ammónium-szulfátot adni a reakció elegyhez.
A természetes körülmények között nyert préselt szőlőlé a környezetből származó, méhek, darazsak és
muslicák által közvetített különböző élesztősejteket tartalmazhat (600-6000 sejt/ml). Ezek a sejtek alkotják a
három jól elkülöníthető fermentációs szakasz aktív résztvevőit.
A bortermelés élettanilag jól elkülönülő elsô szakaszában főleg az alacsonyabb erjesztő aktivitású
Klockera apiculata, Metschnokowia pulherrima, Torulopsis stellata, Klockera corticis, Candida crusei, Candida
vini, Hansenula anomala, Pichia fermentans tevékenykednek. A főfermentációs szakaszban az egy
Kluyveromyces veronae-n kívül, a többi törzs a Saccharomyces nemzetséget képviseli (S. cerevisiae, S. uvarum,
S. bayanus, S chevalieri, S. delbruecckii, S. fermentati, S. rosei, S. rouxii). Az utófermentációs szakaszban
általában csak Saccharomyces cerevisiae és S. bayanus törzsekkel találkozunk.
A borkészítés első lépése a szőlőlé nyerése. Az összetört szőlőszemek gyors kipréselése csökkenti a
baktériumos fertőzés lehetőségét. A kipréselés halasztása viszont előnyös a lényerés szepontjából, mert a
pektinázok működése növeli a lékihozatalt. Egyes technológiai leírások mikrobiális eredetű pektináz adagolását
javasolják.
Bonyolult szabályozási szerepet tölt be a borképzôdésben a kéndioxid, amelyet az élesztők jelentős
része szulfátból képes előállítani. Az egyes törzsek szulfátredukáló képességétől függően jelentős mennyiségű,
50-150 mg szulfit képződhet literenként. Ezt a vegyületet a borászok a technológiai folyamat különböző
szakaszában alkalmazzák. A musthoz adott 100 mg acetaldehiddel reagáló kénessav 3 napra leállítja a
fermentációt, 200 mg viszont 20 napig gátolja az erjedési folyamatot. Az élesztő szabályozási
mechanizmusában fontos szerepet játszó Pasteur effektust felfüggesztve az etanol képződést oxigén jelenlétében
is lehetővé teszi. A folyamatosan változó reakcióelegy kéndioxid, hidroszulfit és szulfit ion mennyiségi
199
viszonyaiban a közeg pH-ja által befolyásolt dinamikus egyensúly alakul ki. A szabad kéndioxid toxikusabb
mint a kötött.
Fontos szerepet játszanak a borászati folyamatban a tejsavbaktériumok. Ezek részben homofermentálók
részben heterofermentáló anaerob, illetve mikroaerofil prokarioták. Tevékenységük a szőlőlé savtartalmának a
csökkentésében, különösen az almasav-mentesítésben jelentős.

NAD
+
>>>>>NADH
HOOC÷CH
2
÷CHOH÷COOH >>>>>>>>>>>>>>>>>>>> HOOC÷CH
2
÷CO÷COOH
almasav-dehidrogenáz
NAD
+

malát enzim CO
2
oxálecetsav-dekarboxiláz
NADH CO
2



―önfenntartó H
3
C÷CO÷COOH
ciklus!‖
NADH
tejsav-dehidrogenáz
NAD
+


H
3
C-HCOH-COO
Tejsavbaktériumok szerepe a bor savtartalmának csökkentésében

A tejsavbaktériumok közül különösen fontos szerepet vállalnak a Leuconostoc fajok. Ezeknek az elszaporodását
a széndioxid tenzió segíti. Az alkoholos erjedés közben a növekvő etanolkoncentráció a tejsavbaktériumok
szaporodását, mind az almasav fermentáló aktivitásukat határozottan gátolja. A heterofermentáló Lactobacillus
törzsek növekedését 6 % etanol 20 %-kal csökkenti, ugyanakkor az almasav bontó aktivitásuk csak 10 %-os
károsodást szenved, 10 % etanol tartalom a növekedést közel felére, az almasav bontást viszont csak 20 %-kal
csökkenti. Sőt az almasavbontó képességük a környezet savanyodásával fokozódik.

A baktériumok elszaporodását kénessavas kezeléssel akadályozzák már a szőlőszemek megtörésekor.
Különösen indokolt a használata az alacsony savtartalmú szőlőkből induló borkészítéskor. A nemkivánatos
mikroszervezetek számának csökkentése szempontjából előnyös a rövid időtartamú 85
o
C -ra melegítés és az
erjesztés szempontjából optimális 10-15
o
C -ra való visszahűtés.
Az erjedés befejeztekor az új bor 8-10 % etanolt tartalmaz. Az elszaporodott élesztőt, még az autolízis
bekövetkezése előtt el kell távolítani. A vörös bor készítése némileg eltér a fehérbor előállításakor követett
módszertől. Ennek oka az, hogy fontos szerepet kap a vörös színanyagok, az anthocyanok optimális kinyerése és
a tannin tartalom limitálása. A színanyagot ugyanis a képződő alkohol vonja ki a növénybôl. Ezért célszerű ezt a
folyamatot már az ép szőlőszemekben elindítani. Egyes technológiai leírások szerint az érintetlen szőlőszemeket
8-10 napig széndioxid túlnyomás alatt tartják. Az alkoholos erjedés már a szőlőszemekben indul, az etanol
tartalom 1,5-2 %-ra emelkedik, sőt bakteriális hatásra az almasav tartalom a felére csökken. Az ekkor kipréselt
200
szőlőlében 20-30
o
C -on két nap alatt befejeződik az alkoholos erjedés viszonylag alacsony polifenol tartalom
mellett. A másik megoldandó probléma a tannin tartalom beállítása. A tannin a szőlőszemek héjából nyerhető. A
szőlőszemekben felszaporodó széndioxid miatt a szőlőszem roncsok az erjedő elegy felszínére emelkednek,
ahonnan csak mechanikus módszerrel meríthetők a folyadékszint alá. Kellő mennyiségű tannin kioldódása után
viszont az alakos elemeket maradéktalanul el kell távolítani az erjedő léből. Nem véletlen, hogy a boripar a vörös
bor elôállítására előszeretettel használ nagy méretű saválló fermentorokat, amelyben a legbonyolultabb
technológiai előírásokat is be lehet tartani. Ezekben a készülékekben recirkulációs elven alapuló eljárások
kialakítására is lehetőség adódik.
A fajélesztővel készült borok érzékszervi vizsgálatát a pincegazdaságok analitikai laboratóriumaiban
nyert adatok egészítik ki. Példaként egy Bordeaux-i vörös bor (pH=3,49) ideális esetben 12,5 V/V % alkoholt,
4,8 g/L cukrot, 6 g/L savat, 126 mg/L antocianint, 900 mg/L leukoantocianint, 371 mg/L katechint tartalmaz. Az
összes polifenol tartalma 880 mg/L. Ezt kiegészíti a színintenzitás és a színárnyalat mérés.
Az aszú bor képződése egy második fermentációs lépés eredménye. A külön gyűjtött — a tőkén
megaszalódott — nagy cukortartalmú szőlőszemekből származó koncentrátummal kiegészített bor a második
fermentációs ciklusban nyeri el különleges ízét.
Kedvező időjárás esetén a megtelepedő Botrytis fajok különleges izanyagokat juttatnak az aszusodó
szőlőszemekbe amely az aszubor élvezeti értékét gazdagítja
A spanyol eredetű sherry meglehetősen nagy alkohol tartalmú (19-21 %), úgynevezett desszert ital.
Erjesztését magas alkohol tartalmat tűrő élesztővel végzik. Ez az élesztő az erjedő reakcióelegy felszínén
bevonatot képez. Neve - Mycoderma vini - is erre a képességére utal. Mai rendszertani besorolása szerint
Saccharomyces bayanus néven szerepel a szakirodalomban. A magas alkohol tartalom elérése céljából a
kipréselt szőlőléhez szacharózt adagolnak a kívánt szint eléréséig. Eredetileg a szőlőszemeket napsugárral
aszalták a kívánt cukortartalom eléréséig és akkor került a présbe. Az így nyert erjesztésre szánt koncentrált
szőlőléből kalcium-szulfáttal való kezelés hatására borkősav szabadul fel, amely visszaszorítja a Lactobacillus
törzsek elszaporodását. A koncentrált cukoroldat erjesztését a fermentlé felületén elszaporodó élesztő végzi. Az
egyszerű borpincében történő sherry előállítás technológiája szerint a 14-15 % alkoholt tartalmazó alap borba
oldják a répacukrot, majd félig töltött 500 literes hordóban végzik az erjesztést oly módon, hogy az élesztő réteg
felett levegő legyen. Az erjedés befejeződése után az élesztőréteg alól leeresztett fermentlevet újabb erjesztendő
lével töltik fel. Ezt a cserét az élesztőréteg roncsolása nélkül többször végre lehet hajtani.
A pezsgőgyártás ugyancsak egy második fermentációs lépéssel a viszonylag gyengébb minőségű borból
piacképes terméket állít elô. Literenklént 25 g szacharóz adagolása után a cukrozott bort jól ülepedő tiszta
élesztő tenyészettel oltják, majd ledugaszolva 9-12
o
C -os helységben — többszöri felrázással elősegítve a
folyamatot — néhány hónapig érlelik. Ezután hosszabb-rövidebb ideig mozdulatlanul hagyják, esetleg óvatos
mozgatással elősegítve az élesztő kiülepedését (az üvegnyakban való összetömörödését), végül a dugó
kicserélésével az összegyűlt élesztőt hűtött körülmények között eltávolítják.
Nagyipari méretben a termék cukorszintjének beállítása után a második erjesztési lépést speciális
erjesztő tartályokban végzik, majd speciális zárt rendszerben széndioxid-atmoszférában végzik a szűrés,
palackozás és lezárás műveletét.
Ugyancsak borból készülnek a különböző borpárlatok (Brandy félék). A világ termelésének közel felét
Kelet-Európa állítja elő. A desztillációhoz szükséges hőkezelés gazdagítja a borpárlat aroma tartalmát. Olyan új
vegyületek mutathatók ki az íz-anyagok között, amelyek az eredeti borban nem fordultak elő. Az élvezeti cikk
szerepét betöltő italok aroma anyagainak egy része a szőlő préslevében is fellelhető, de jelentős mértékben
gazdagodik az íz-anyagok változatossága az élesztő enzimeinek hatására. Rapp és munkatársainak 1973-ban
közölt adatai (Chem. Ztg. 97:29-36) az analitikai eljárások által kimutatható aroma anyagok gazdag választékát
tárja az olvasó elé.

SÖRGYÁRTÁS

Gabonafélékből, árpából előállított alkoholos ital készítése az ember ősi tevékenysége, a
történelemelőtti idők homályába vész. Hatezer-éves leletek bizonyítják a ma is használt technológia gyakorlati
alkalmazását. Ezt igazolják babiloni és sumer írásos emlékek. Csíráztatott árpából készített lisztből kenyérféle
tésztát gyúrtak, gyengén megsütötték, apródarabokra törve vízben áztatták, majd erjedni hagyták, amíg egy
savanyú, alkoholt tartalmazó italt nyertek. Középkori írásos emlékek a bajor sörfőzdék technológiájáról
tartalmaznak adatokat. Az árpacsírából készült őrleményből erjesztették az italt, amit növényekkel, fűszerekkel
ízesítettek. A technológia Bajorországból a 17. században kezdett terjedni. 1842-ben Csehországban alapítottak
sörgyárat. Néhány évvel később Dániában, Észak-Németországban, Skóciában épültek üzemek. A század
második felében a tengerentúlon is meghonosodik a sörfogyasztás, de Európa még tartja vezető szerepét a
fogyasztásban és a gyártásban.


201
A nagyüzemi termelés biztonságának fokozása a mikrobiológiai kutatásokat indokolttá tette. A várható
haszon reményében a sörgyárak anyagilag is támogatták az alapkutató munkát, amitől a sör ‖betegségeinek‖
elkerülését remélték.

Berzelius az élesztősejteket komplex katalizátorok hordozóinak tekinti. Pasteur az élő sejt szerepét
tisztázza Liebig kémiai elméletével szemben. Eduard Büchner olyan sejtmentes kivonatot készít az élesztőből,
amely képes a glükózt alkohollá erjeszteni, majd a zymáz felfedezésével az enzimelmélet alapjait rakta le.
Pasteur 1876-ban könyvet írt a sörgyártásról ‖bacilles des bieres tournées‖, amelyben a sör betegségeiről, a
sörgyártás bacillusairól ír. A század végén 1892-ben van Laer Saccharobacillus pastorianus-ként írja le ezeket a
sörgyártást veszélyeztető, jelentős gazdasági kárt okozó heterofermentáló rövid pálcikákat, amelyeket Beijerinck
1930-ban Lactobacillus-ként helyez el a baktériumok rendszerében.

A söriparban a mikrobiológiai kutatások eredményeként hamarosan igyekeztek tiszta élesztő kultúrák
használatával hatékonyabbá tenni a gyártást. Sörgyári mintából Clausen N.H. izolált egy élesztőt, amit
Brettanomyces néven vezetett be a szakirodalomba, utalva a brit sörgyártásban betöltött szerepére. A sörélesztő
tápigényének felderítése vezetett el a biosz anyagok, a vitaminok jelentőségének felismerésére. Kruis és Stava
1918-ban fedezi fel az élesztő ivaros ciklusát. Winge 1935-ben írja le az élesztő fejlődési ciklusait. A haploid
endospórás és a diploid vegetatív fázis felismerése az élesztő-genetika fejlődését indította el. A század közepén.
Gertrud Lindegren alapvető biológiai munkáival indul el az élesztő-genetika fejlődése. A géntechnológiai
módszerek gyakorlatba vétele századunk utolsó negyedében a modern genetikai kutatómunka kísérleti alanyává,
az eukariota genetika típusélőlényévé emelte a sörélesztőt.

Első feladat a főleg sörárpából készülő (Hordeum distichum, H.hexastichum) maláta előállítása. A
kiválogatott ép gabonaszemeket 2-3 napig 12-15 fokos vízben áztatják. Az áztató levet naponta legalább kétszer
cserélik az esetleg elszaporodó mikróbatömeg eltávolítása céljából. Ezek ugyanis nem csak nem kívánt íz-
anyagok forrásai lehetnek, de nagyobb kárt okoznak a vízben oldott oxigén elhasználásával, amire a csírázó
árpának nagy szűksége van. A csírázó embrió enzimkészlete fellazítja az endospermium falát, így a
zöldmalátának nevezett árpaszem könnyen morzsolhatóvá válik. Hét-nyolc nap múlva a csíráztatást szárítással
(50
o
C alatt) leállítják. A nedvességtartalmat 5%-ra csökkentik. Ha sötét malátát akarnak akkor magasabb
hőfokra melegítik. A Berlin környékén elterjedt Weissbier árpa helyett csírázott búzából készül. A Brüsszel
környékén ismert Lambic bier 40% búza és 60% csírázó árpa őrleményéből készül.


A száraz malátát felhasználásig úgynevezett malátasilóban tárolják. A technológia következő szakasza a száraz
maláta őrlésével kezdődik. Járulékos anyagként nem malátásított gabonafélét, kukoricaőrleményt, esetleg
cukorszirupot adnak a malátához. A segédanyag a maláta magas nitrogén tartalmát hígítja az optimális N:C
aránynak megfelelő szintre. A sörgyártás fontos alapanyagát képezi a felhasznált víz, amelyet általában a
sörgyárak saját kútrendszerükből nyernek. Az egyes sörfélék vízminősége, kémiai összetétele lényeges eltérést
mutat.

a felhasznált víz
Keménységi foka és Karbonát tartalma
Pilseni 25 15 mg/L
Dortmundi 745 450 mg/L
Müncheni 280 275 mg/L


A friss őrleményt vízzel elkeverve péppé gyúrják, majd rézedényben a vizes szuszpenzió hőmérsékletét lassan
emelik 50
o
C-ra. Ez a maláta proteázok hő-optimuma. A keményítőt tartalmazó segédanyagok bontása céljából a
reakcióelegy hőmérsékletét 65 fokra, a maláta amiláz optimális hőmérsékletére emelik. A cukrosodás
202
befejeztével (3-4 óra) a hőmérsékletet 75 fokra emelve leállítják az enzimes folyamatot és a fermentlé
takarmányként hasznosítható alakos elemeit szűréssel könnyen elkülönítik.


Oltás előtt álló sterilezett édes-cefre összetétele 1 kg malátakivonatra számított adat
Maltóz 430-460 g tiamin 200-600 ug
Maltotrióz 100-130 g Riboflavin 100-500 ug
Glükóz 40-80 g Pantoténsav 200-500 ug
Szacharóz 20-30 g Niacin 1,5-2,5 mg
Fruktóz 10-20 g Piridoxin 200-500 ug
Nemfermentálható meso-inozit 50-150 ug
Szénhidrát 150-220 g p-amino-benzoát 20-30 ug
Aminosavak 10-15 g Kalcium 160-800 mg
Peptidek 10-30 g Kálium 1-2 g
Nukleotidok 5-2 g Nátrium 50-400 mg
Polifenolok 1-2 g Magnézium 150-600 mg
komló maradék 1 g foszfát 1,5-3 g
Biotin 5-10 ug Klorid 5-10 g

A szűrletet nevezik édes sörcefrének, amit valamikor vörösrézből készült sörfőző üstben, ma saválló tartályban
gyűjtenek majd komlóval együtt sterilezik. A cefre cukortartalma 12%, ami a sterilezés hőfokán némileg
karamellizálódik, bekövetkezik a lupulon és a humulon izomerizációja. A hőkezelés általában egy órát vesz
igénybe. Barna sör készítésekor nem a főzés idejét nyújtják, hanem külön karamellizált cukoroldatot adagolnak.
A növényi maradékot és a főzés hatására kicsapódó anyagot szűréssel eltávolítják.

A sörkészítés fontos fűszernövénye a komló (Humulus lupulus). A növény mindössze egy százalékát
kitevő esszenciális olaj frakciója a sör aromáját adóértékes terpéneket (1:|-myrcen, 2:| farnesen, 3:
humulen, 4: |-caryophyllen) tartalmaz.



A komlóban előforduló gyantasavak okozzák a sör jellegzetes keserű ízét. Hexánban oldhatatlan, úgynevezett
kemény gyanták csoportja az aroma alakításában nem vesz részt, csak a hexánban oldható úgynevezett lágy
gyanták két csoportja tölt be fontos szerepet. Amint az ábrán jól látható a könnyen izomerizálódó vegyületek
savanyú kémhatása az enolos hidroxil csoporttól származik.

Az o-savak csoportját alkotják a humulon, cohumulon és az adhumulon származékok. A |-savak
csoportjában a lupulon, colupulon és adlupulon származékok fordulnak elő. Ezek a természetes építőelemek
tárolás közben változhatnak, különösen a |-savak érzékenyek, oxidálódhatnak. Az o-savak könnyen alakulnak
hexánban oldhatatlan kemény gyantává. Ezért a komlót begyűjtés után gyorsan szárítják, összepréselve
légmentesen hűtve tárolják. Egyes technológiák az egész növényt felhasználják, mások csak a növény kivonatát
alkalmazzák.
203

A steril édes cefrét ezután 10-15 °C-ra hűtik és
steril levegővel telítik (8-10 mg O
2
/L), majd jól kifejlődött
élesztőtenyészettel oltják. Oltóanyagot egy-egy jól sikerült
sörgyártási folyamat primer fermentációs lépéséből izolált
tiszta tenyészetből készítik. A modern technológia fontos
eleme az élesztő-oltóanyag. Az ipari üzemek nem
hagyatkozhatnak a spontán kialakuló erjesztő populációra. A
gyártási technológia két fő típusát különböztetjük meg attól
függően, hogy melyik élesztővel végzik az erjesztést.
A kádakban folyó fenékerjesztésű sörgyártásban az
összecsapódó, kiülepedő Saccharomyces uvarum kerül
felhasználásra. Ezen belül egyes városok nevéhez
kapcsolódóan ízben, zamatban, színben, alkohol tartalomban
különböző sörfélék telítik a piacot (Pilsen, Dortmund,
München).
A másik technológia, a felsőerjesztésű, egyedi
sejteket tartalmazó Saccharomyces cerevisiae biokémiai
aktivitását hasznosítja. Ez a törzs világos és barna sörfélék
előállítására egyaránt alkalmas. Az oltóanyag több lépésben
felszaporított virulens tenyészetet jelent. Két-három
naponként 10-szeres térfogatba történő átoltással érik el a
kívánt oltóanyag mennyiséget.
Felsőerjesztési technológia alkalmazásakor a főfermentációt kis térfogatnyi oltóanyaggal is el lehet
indítani, azonban az ilyenkor szükséges hosszabb fermentációs idő a készülék kihasználása szempontjából
gazdaságtalanná teszi az üzemet. Az erjesztő kádak illetve fermentorok levegőztetése, ami a növekedéshez
feltétlenül szükséges, nem csökkenti lényegesen az alkoholos erjedést. Az úgynevezett Crabtree effektus ugyanis
nagyobb szénhidrát koncentráció esetében oxigén jelenlétében is az alkoholos erjedésnek kedvez.
A fermentációs folyamat közben gondosan ügyelni kell a baktériumos fertőzés elkerülésére. A
folyamatot rendszeresen ellenőrzik. A kivett mintát cikloheximidet tartalmazó táptalajra oltva napokig
termosztátba helyezve vizsgálják. Ez az antibiotikum az élesztő növekedését gátolja, a baktériumok
növekedésére viszont nem hat. A sterilitás vizsgálata céljából oltott szilárd táptalajra oltott anyagot részben 28
°C-on aerob körülmények között, más részüket széndioxid atmoszférában tartják egy héten keresztül. Ilyen
módon a fakultatív anaerob fertőző csírákon kívül a szigorúan (obligát) anaerob fertőzés, például a Zymomonas
faj is kimutathatóvá válik.
Nehezen észlelhető a vad élesztőtörzsekkel való fertőződés. Ezeknek az elszaporodása az erjesztő
képesség leromlásában jelentkezhet. A vad élesztők kimutatásához a legmodernebb rendszertani módszereket
kell alkalmazni. Molekuláris biológiai és szerológiai eljárások használata indokolt.
Modern genetikai módszerek alkalmazásával a meglevőnél előnyösebb törzseket állítottak elő a kutató
laboratóriumok. A tradiciókhoz való merev ragaszkodás miatt azonban ezek a törzsek csak elvétve kerülnek ipari
felhasználásra.
A törzstenyészetet klasszikus módszer szerint 10%-os szacharóz oldatban, vagy szilárd táptalajon
tartják fenn. A folyékony közegben fenntartott tenyészetet két évenként átoltják és közben ellenőrzik az
életképességét. Szilárd táptalajra oltott tenyészetet paraffin olajjal fedve 4
o
C-on, hűtve tárolják, félévenként
ellenőrizve életképességét. Hosszabb időtartamra fagyasztva szárított formában őrzik a törzsanyagot.


Az élesztő oltás után erős növekedésbe kezd, a tenyészet felszínén vastag habréteg alakul ki erős
széndioxid fejlődés mellett. Az élesztő a fermentáció közben gyakorlatilag feléli a tápanyagként jelenlevő

204
fehérje és szénhidrát jelentős részét. A közben képződő szén-dioxidot összegyűjtve, az eljárás befejező fázisában
felhasználják. A primer fermentációs ciklus befejeződésekor a fermentáció hőmérsékletét 0 fokra csökkentik és a
lé alakos elemeit szeparátorral eltávolítják. Az élesre szűrt ―sör-lé‖ sterilre szűrése vagy pasztőrőzése teszi
piacképessé, fogyaszthatóvá az élvezeti cikként forgalmazható terméket. Sok esetben az ászokpincében második
fermentációs lépést folytatnak le saválló tartályban, széndioxid túlnyomás alatt. A sörgyártás utolsó fázisában az
íz kialakítása folyik, mégpedig szűkség esetén cukor, tannin, illetve más íz-anyagok kerülhetnek felhasználásra.
Sok esetben előnyös hatású különböző proteolitikus enzimek alkalmazása (papain, ficin, bromelain) a
fehérjetermészetű szennyezés oldása szempontjából. Ezek az enzimek az alacsony hőmérséklet miatt
meglehetősen lassan dolgoznak, a fogyasztóhoz nem kerülnek mert a pasztőrözés hőmérsékletén aktivitásukat
elvesztik. Regionális íz-anyagokat az előállítás helyén elterjedt mikroflóra szolgáltatja. Ennek a felderítése ipari
megoldást ugyan nem, de nagy számú tudományos közleményt eredményezett. Oltóanyaggal ugyanis nem lehet
megoldani a környezet által kialakított mikroflóra különleges szerepét.
Az alkoholos erjesztéshez felhasználható élesztősejteket az utóbbi évtizedekben gyakran rögzítik
porózus üveghálózatba. Ilyen például a Schott Glaswerke által gyártott Siran

Pórusos üvegbe rögzitett élesztősejtek
Ez az alkalmazás tette lehetővé az alkoholmentes sör előállítását. Ebben az esetben az élesztő nem szaporodik az
erjesztő tartályban. Ezért az átalakítandó cefre minimális szénhidrátot tartalmaz. A rögzített sejteket tartalmazó
reaktoron addig áramoltatják át az alapanyagot alacsony hőmérsékleten, amíg a megfelelő iz kialakul minimális
(0,04-0,35 %) alkohol képződése mellett


Alkoholmentes sör előállítására szolgáló berendezés vázlata
205
SZESZGYÁRTÁS

A finomszesz gyártás alapanyaga kezdetben a cukorgyártás melléktermékeként megjelenő melasz volt
A piaci igényekhez alkalmazkodva, adott esetben a cukorkihozatal növelése a melasz mennyiségét csökkentette,
ellenkező esetben növelte, ami a szeszgyártásban bizonytalanságot okozott. A szesz iránt növekedő kereslet
hatására a keményítő gyárak mellé is szeszgyárak települtek. Először a keményítő és glükóz gyártás hulladékát
hasznosították. Később az igényeknek megfelelően adott esetben a keményítő jelentős része alkoholként került a
piacra. Az alkohol gyártás a mezőgazdasági termelésben jelentkező időjárás okozta hullámzásokat pufferként fel
tudta felfogni. Az esetenként bekövetkező túltermelés nem vezetett az eladhatatlan termékek felszaporodására,
azaz nem csökkentette a termelési kedvet. A szénhidrát tartalmú termékeket túltermelés esetén (burgonya,
kukorica) alkohollá alakítva értékállóan lehetett tárolni. Az alkoholgyártás gazdaságosságát vizsgálva össze kell
vetnünk a cukorgyártásban hasznosított mezőgazdasági termékek előállítási költségeit és a belőlük nyerhető
hasznos termékek mennyiségét.
Egy tonna 73% víztartalmú cukornád átlag 769 kg cukortartalmú nádszár mellett 231 kg levél és
szárcsúcsi részt tartalmaz. A nádszárból felaprítás után 174 kg szárazanyagot tartalmazó vizes oldatot lehet
kipréselni. A visszamaradt növényi maradék száraz súlya 97,4 kg, amelyből elégetve 3,3 kg hamu marad vissza.
A víz-oldható frakcióban 122,5 kg fermentálható szénhidrát és 51,9 kg nem fermentálható anyag (19,5 kg
nitrogén tartalmú vegyület, 5-6 kg lipid, 13 kg hamu) található.
Egy tonna cukorrépából 515 kg szénhidrátot tartalmazó gyökér és 485 takarmányként hasznosítható
répafej és levél különíthető el. A répa több mint 81% vizet tartalmaz. A lefejezett gyökérből 84,8 kg szárazanyag
tartalmú víz-oldható anyag és 26,2 kg szárazmaradékot tartalmazó, takarmányként hasznosítható extrahált
gyökér maradvány képződik. A víz-oldható anyag 66,4 kg fermentálható szénhidrátot és 18,4 kg nem
fermentálható maradékot tartalmaz.
Ha ezeket az adatokat az egy hektáron termelhető ipari növény mennyiségével összevetjük, akkor
nyilvánvalóvá válik a cukornád termelésére alkalmas klimatikus viszonyokkal rendelkező államok gazdasági
előnye. Ez az előny fokozódik, ha a két alapanyagból nyert melléktermék a nádmelasz és a répamelasz
fermentálhatóságát összehasonlítjuk. A cukornád melasz nagyobb cukor, biotin és foszfor tartama előnyösen
befolyásolja az alkohol termelést. Üzemanyagként való használatát az árviszonyok, a gazdasági meggondolások
egyértelműen meghatározzák,
A 70-es években bekövetkező olajár-robbanás a gazdasági szakértők figyelmét az etanolra fordította. Ez
a környezetvédők igényeit kielégítő energiahordozó vegyipari alapanyagként petrokémiai termékek előállítására
is használható. A mezőgazdasági termelésbe fogható területek limitált volta és az előállítási költségek azonban
óvatosságra intenek. Nem véletlen, hogy csak azokban az államokban került gyakorlati megvalósításra ez a
program, ahol a mezőgazdasági termelés túltermelési válsággal küzd, illetve jelentős mennyiségű nyersolajat
importál. Braziliában a ―proalcool‖ program keretében az 1976-ban 700 millió literes etanol termelést négy év
alatt 4 milliárd literre emelték. Ez 450 ezer autó átállítását jelentette etanol üzemre. Az olajimport csökkentése
miatt növelték az etanol termelést Dél-Afrikában is. Az USA ―Gasohol‖ programja évi 400 millió liter etanol
üzemanyagként való hasznosítását teszi lehetővé. Az etanol nagyipari előállításának energia igénye: cukornádból
18 MJ/kg etanol, kukoricából 19,4 MJ/kg etanol. Az etanol energia tartalma (26,6 MJ.kg
-1
) alacsonyabb a
motorbenzinénél (43,8 MJ kg
-1
), oktánszáma viszont 90-100 között van.
Tanulságos megismerni az 1 tonna alapanyagból előállítható etanol mennyiségét.
Cukornád 70 liter Nyárfa 160 liter
Répagyökér 95 liter Burgonya 100 liter
Melasz 280 liter Kukorica 370 liter

Az 1 hektáron termelhető alapanyag és a belőle nyerhető alkohol mennyiségét
Átlag Kiemelkedő Átlag Kiemelkedő
Cukornád 60 tonna 12,5 tonna 4200 liter 8750 liter
Cukorrépa 30 tonna 56 tonna 2850 liter 5320 liter
Nyárfa 15 tonna 30 tonna 2700 liter 5400 liter
Kukorica 5 tonna 7 tonna 1850 liter 2590 liter

A teljesség kedvéért az alapanyag előállítás energia igényét is számításba kell venni
Cukornád Brazilia 16 GJ/ha 4,0 MJ/kg etanol
Cukorrépa Új-Zéland 16 GJ/ha 5,3 MJ/kg etanol
Kukorica USA 21,8 GJ/ha 12,3 MJ/kg etanol
A cukornádból nyert etanol 20%-kal a kukoricából nyert 50%-kal drágább, mint a cukoripari
melléktermékből, a melaszból nyerhető etanol. A melasz mennyiségét viszont a cukorgyárak kapacitása
egyértelműen meghatározza.
206
Az ipari szesztermelés jelentős hányada ma a gabonafélék szénhidrát tartalmának a hasznosításával
készül. A keményítő savas hidrolízise ugyan könnyen kivitelezhető, azonban toxikus melléktermékek
(levulinsav, 5-hidroxmetilfurfurol, hangyasav) képződnek. A sav koncentráció optimálásával és a hőmérséklet
megválasztásával javítani lehet a helyzeten, mégis az utóbbi időben az enzimes bontást alkalmazzák világszerte.
o÷AMILÁZ (o-1,4-glukan-4-glukano hidroláz) random bontja a keményítő o-1,4 kötéseit. A
mikroorganizmusokban előforduló 60 kd méretű enzim nem bontja az o÷1,6 kötést, de az o÷1,6 kötés
szomszédságában levő o÷1,4 kötést sem. Ezért a reakció termékben jelentős mennyiségben fordulnak elő
oligomerek. Az Aspergillus oryzae által termelt enzim például keményítőből 4 % glükózt, 56 % maltózt, 28 %
maltotriózt és egyéb oligoszacharidot tartalmazó maltóz szirupot készít:
|÷AMILÁZ (o-1,4-glukán maltohidroláz) a Bacillus genusban előforduló enzim a keményítő redukáló
végén kezdve maltóz egységeket hasít le. Nem bontja az 1,6 kötéseket.
GLUKOAMILÁZ. Széles spektrumú, a poliszacharid nem redukáló végétől indulva az 1,3, 1,4, és 1,6
kötéseket bontja. Főleg gombákban Aspergillus awamori, Aspergillus niger, Rhizopus fajokban fordul elő.
Keményítőből 97 % glükózt, 1,5 % maltozt és valamennyi egyéb oligoszacharidot tartalmazó elegyet készít. Az
o÷amiláz jelenléte gyorsítja a reakciót, fokozza az eljárás teljesítményét.
A fenti enzimek keveréke jó hatásfokkal, de az egyes növényfajokból származó keményítőt eltérő
sebességgel glükózig bontja. A gabona keményítő például könnyebben bontható mint a burgonya keményítő.
Sok helyen a kukorica teljes feldolgozására törekedve az egyes termékek, például csíraolaj, áztató-lé, keményítő,
glükóz-szörp, izomeróz stb. árában jelentkező gazdasági haszon javítja az alkohol termelői árának alakulását

ECETSAVGYÁRTÁS

Az ipari gyakorlatot követve célszerű itt tárgyalni az alkoholból történő ecetgyártást.annak ellenére
hogy ez szigorúan aerob folyamat. Gazdasági szempontból az erjesztéssel nyert alkohol, így közvetlenül
alakítható esetsavvá.
A XVIII század végén jelentek meg az első ecetgyárak. Hazánkban Pozsonyban 1787-ben létesítették az
első üzemet a szesz gyár mellett. 1843-ban a honi iparvédegylet iparműkiállítására beküldött ecet minőségét
elismerő okiratot Batthyány és Kossuth aláírása fémjelezte. A Leipziger-féle ecetgyár 1898-ben kezdte meg
működését az 1867-ben alapított Óbudai Szeszégető és Finomító Rt. Telephelyén. Az 1990-ben a még működő 5
ecetgyár 3100000 hL szeszecetet 2000 hL borecetet 14000 hL almaecetet készített
A szeszgyárban 180000 hL finom szesz, 60000 hL abszolút alkohol és 10000 hL denaturált szesz
készült évente. A szesztermelés mellett 21000 tonna friss élesztő kerül a piacra. A fennmaradó élesztő
takarmányként haszmnosul
Az ecetkészítés és annak a táplálkozásban való hasznosítása a történelem előtti időkből származó
ismeret gyakorlati hasznosítása. A bor ecetesedésének - a környezetünkben megtalálható ecetsav baktériumok
tevékenységének következményeként - naponta tanui lehetünk. Élelmezési célra évente 2-3 millió m
3
ecet
készül, ami 150-200 ezer tonna ecetsavat jelent. Ez a mennyiség az aerob biotechnológiai eljárással gyártott
primer metabolit termelésben az első helyre emeli.
Vegyipari alapanyagként jelentős mennyiségű ecetsavat állít elő a petrokémia, mégis élelmiszeripari
célra csak az ecetsav baktériumokban jelenlevő enzimek katalitikus hatására alkoholból képződő, tehát biológiai
úton nyert, ecetet használják. Az átalakítás gyakorlatilag melléktermék képződése nélkül megy végbe. Az
ecetsavtermelésre használt baktériumok a képződő ecetsavat - az adott technológiai körülmények között - sem
energiaforrásként, sem szénforrásként nem hasznosítják. Ebből következik, hogy igen jó kihozatallal, 95-98 %-
os hatásfokkal valósítható meg az alkohol oxidációja. Veszteséget csak az átáramló levegővel eltávozó
szubsztrátum és az ugyancsak illékony termék távozása okoz.

HO-CH
2
-CH
3
+ O
2
HOOC-CH
3
+ H
2
O A G
o
= ÷ 455 kJ / mol

A reakció lefolyásával járó nagy szabadenergia változás a folyamatot gyakorlatilag megfordíthatatlanná teszi.
Az ecetsav termelésre alkalmas mikroorganizmusok évezredek alatt az emberi tevékenységgel szoros
kapcsolatban választódtak ki. Valójában szélsőséges viszonyokhoz alkalmazkodva specializálódtak. Évezredek
alatt néhány olyan fajuk választódott ki, amelyek elvesztve a különleges körülmények között fölösleges
enzimeiket éppen az ember közelében találják meg életterüket. Az alkoholosan erjesztő élesztők mellett az
alkoholból ecetsavat termelő baktériumok az ember korai háziasított élőlényeinek tekinthetők
Az átalakításra használt mikrobákat gyűjtőnéven ecetsav baktériumoknak nevezzük, bár rendszertanilag
elkülöníthető fajok illetve nemzetségek egyedei alkalmasak ennek a folyamatnak a katalizálására. A múlt század
végén Beijerinck az Acetobacter nemzetségbe sorolta őket. Ellipszoid, illetve rövid pálca formájú alak mellett
előfordulnak egyenes vagy enyhén hajlott formában is (0,5-0,8 u vastagok és 1-4 u hosszúak) . Előfordulhatnak
egyedül, párosan vagy láncba rendeződve. Mozgó alakjaik peritrich vagy poláros ostorral rendelkeznek. Obligát
aerob fajaik jellegzetes tevékenysége a cellulóz mikrofibrillum képzés. A bor felületén bevonatot képeznek.
207
Rendszertani vizsgálatuk mind a mai napig folyik és tökéletesedik. Ezt a munkát nehezíti a nemzetségre
jellemző rendkívül nagy változékonyság. Luis Pasteur (1864) Mycoderma aceti néven szerepelteti a "Mémoire
sur la fermentation acétique" című alapvető munkájában (Ann. Sci. Ec. norm. sup. 1:113-158). Ma Acetobacter
aceti néven 7 törzset sorol ide a rendszertan. Később Pasteur egyik tanítványa Hansen 1879-ben mesterét
tisztelve Mycoderma pasteurianus néven irta le az előbbitől némileg különböző baktériumot, amelynek
jellegzetessége volt, hogy az előbbivel szemben glicerinből nem képezett acetont. Az idesorolt törzseket ma
Acetobacter pasteurianus néven tárgyalja a szakirodalom.
Amikor a baktériumokat biokémiai tulajdonságaik alapján igyekeztek rendszerezni - Asai és
munkatársai 1934-ben - az Acetobacter nemzetségből elkülönítették a Gluconobacter genus-t, amelynek tagjai
csak glükózból képeznek ecetsavat, alkoholból nem (J. Agr. Chem. Soc. Jap. 10:621-29, 932-41). Frateur 1950-
ben az Acetobacter fajokat oxidálóképességük alapján négy csoportra; A. peroxidans, A. oxidans, A.
mesoxidans, A. suboxidans osztva tárgyalta (Cellule 53: 287-92). Leifson 1954-ben elkülönítette a peritrich
ostorral mozgó ecetsavat továbboxidálni képes Acetobacter törzseket a poláros ostorral rendelkező Acetomonas
törzsektől, amelyek nem képesek az ecetsav továbboxidálására (Antonie van Leeuwenhoek 20:102-10).
Az 1984-ben kiadott Bergey's Manual of Systematic Bacteriology a Gram-negatív aerob pálcák és
kokkuszok közé VI. családként (ACETOBACTERACEAE) két nemzetségbe Acetobacter és Gluconobacter
nemzetségekbe sorolva tárgyalja őket.
Az iparilag alkalmazott törzs olyan ecetsav baktérium, amely 13,5 % ecetsavat tartalmazó tápközegben
még életben marad, az alkoholt gyakorlatilag teljes mértékben ecetsavvá alakítja és az ecetsavat tovább nem
oxidálja, ugyanakkor a glükózt vagy más hexózt széndioxidra és vízre bontja. Ez a nagy ecetsavképző aktivitást
mutató törzs fágrezisztens. E tulajdonság megőrzése a technológia körülményei között alapvető jelentőségű. A
törzsek liofilezett formában, illetve cseppfolyós nitrogénben jól tárolhatók.

Az ecetsavképződés biológiai alapjai
Lavoisier 1793-ban bizonyította, hogy az alkohol ecetsavvá oxidálásához oxigénre van szükség. Person
1822-ben az ecetesedő alkohol tartalmú oldat felületén kialakuló hártyában található baktériumot Mycoderma
aceti néven írta le. Liebig 1851-be feltételezte, hogy az etanol ecetsavvá alakulásánál köztes anyaga az
acetaldehid. Pasteur, aki 1962-ben kezdte vizsgálni az általa ecetvirágnak nevezett felületi hártya tulajdonságait,
feltételezte egy dehiodrogenáz működését (Compt. Rend. 54: 265, 55:28). Brown 1886-ban Bacterium xylinum
nevet adta az ecetsavképző mikroorganizmusnak (J. Chem. Soc. 49:172). Neuberg csak 1919-ben azonosította a
reakcióelegyből az acetaldehidet (Biochem Z. 96: 158-74).
Végül Nakayama 1959-60-ban izolálta az átalakítást katalizáló enzimeket (J. Biochem 46:1217-25, 48:812-30,
49:158-63, 49:240-51)
E
1
enzim néven az alkohol-citokróm
553
reduktázt
E
2
enzimnek nevezve a koenzim nélkül működő aldehid dehidrogenázt és az
E
3
enzimet a NADP
+
függő aldehid-dehidrogenázt

CH
3
÷ CH
2
÷ OH
1
/
2
O
2


-------- E
1
enzim
>>>>>>>>
e
÷
>>>>>>

Citokróm oxidáz
:
CH
3
÷ CHO e
÷
H
2
O
NADP
+
:
E
3
enzim ---------------- -------- E
2
enzim
NADPH
CH
3
÷ COOH Ecetsavképződés alkoholból a baktériumban

Az etanol dehidrogénezését végző E
1
enzim hemfehérje. UV spektruma a citokrómhoz hasonlít, az
abszorpciós maximuma 553 nm-nél van és 3,5 pH-n működik optimálisan. Etanol jelenlétében ez az enzim nem
redukálja a NAD
+
illetve NADP
+
koenzimeket. Kálium ferricianidot használva elektron akceptorként különböző
lánchosszúságú telített és telítetlen alkoholok dehidrogénezését végzi.
Az acetaldehid dehidrogénezését két enzim végzi az ecetsavbaktériumokban. A kofaktor nélkül
működő E
2
enzim az acetaldehidről leválasztott elektront az E
1
hemfehérje vasatomjának adja át. Az így
redukálódó hemproteint azután a citokróm-oxidáz regenerálja. Nem zárható ki az acetaldehid
diszproporcionálódása
Az E
3
enzim fontos szabályozó szerepet tölt be a NADP redukálásával. A NADPH felesleg ugyanis
gátolja a trikarbonsav ciklus működését és ezzel megakadályozza az ecetsav oxidációját- Az enzim működését p-
klórmerkuri benzoát és hidroxilamin gátolja.
Az ecetsavbaktériumok csak a hexózok hasznosítására képesek. Megtalálhatók bennük a glikolízis
(EMP), a pentóz-foszfát út (HMP) és az úgynevezett Entner-Doudoroff lebontási út enzimei. Ez azonban nem
208
jelenti azt, hogy mindezek az enzimek teljes aktivitással működnek. Kitos és munkatársai szerint az Acetobacter
suboxidans-ban a glükózlebontás főleg a HMP úton folyik, de jelentős a ketoglükonsav út aktivitása is. Ez a
direktoxidáció 2,5-diketo-glükonáton keresztül egy transzfoszforiláz segítségével kapcsolódik a HMP ciklushoz.
Az egyes lebontási folyamatok egymáshoz viszonyított aránya az oldott oxigéntartalommal, azaz a
gázfázis parciális oxigén-nyomásával szoros összefüggést mutat. Tiszta oxigénben a glükóz 63 %-a a HMP úton,
28 %-a a ketoglükosav úton oxidálódott. A szén-dioxid fő tömege normál körülmények között is a HMP úton
képződik. Ha a reakcióelegyen átáramló gáz oxigéntartalma 4 % alá csökken, akkor a szénhidrátanyagcsere leáll.
Egyébként a szén-dioxid jelenléte nélkülözhetetlen az ecetsavbaktériumok életműködéséhez.
Razumovszkaya és Belausova 1952-ben észlelték, hogy az Acetobacter schützenbachii növekedése leáll
ha az átáramló levegőből eltávolítják a szén-dioxidot (Mikrobiology 21:403-07). Hromatka és Gsur (1962)
Acetobacter suboxidans esetében
14
CO
2
-vel igazolta a szén-dioxid beépülését (Enzymologia 25:81-86).
Izotóppal jelzett ecetsavval végzett kísérletek igazolják, hogy az A. suboxidans nem hasznosítja az ecetsavat, de
aktív glükóz anyagcsere esetén, valamennyi megtalálható a C
14
aktivitásból a sejtburok lipid alkotórészeként.
Ezért az ecetsav baktérium életben tartása céljából a folyamat elindításakor némi szénhidrátot kell adni a
tápközeghez.
Az Acatobacter peroxidans képes oxidálni az ecetsavat, hasznosítani a tejsavat a működőképes
trikarbonsav ciklus és a glioxilsav ciklus segítségével.
Nitrogénforrás tekintetében az ecetsav baktériumok általában igénytelenek, jól hasznosítják az
ammóniát. Laboratóriumi kísérleti körülmények között - homogén tiszta tenyészetet használva - több szerző
ismertette vitamin igényüket (p-amino-benzoesav, tiamin, pantoténsav), több esetben észlelték egyes aminosavak
és purin-bázisok jelenlétének előnyös hatását. Ipari körülmények között ilyen igényt nem észleltek, mivel a
természetes szubsztrátum, valamint a keverék tenyészet elfedi ezt az igényt.
Különösen érzékeny a tenyészet az oxigénellátottságra. Az érzékenység fokozódik a tápközeg alkohol
és ecetsav tartalmának növelésekor. Az oxigén parciális nyomásának gyors növelése általában károsítja a
mikroszervezetet, de az alkohol elfogyása is okozhatja a baktérium pusztulását. Két százalék alkohol és két
százalék ecetsav jelenlétében 2-3 perc levegő kimaradás csak 30-40 %-os pusztulást okoz. Ennél hosszabb
kimaradás viszont elpusztítja a tenyészetet, 3 % ecetsav és 4 % alkohol jelenlétében már egy perces levegőhiány
is a tenyészet pusztulását okozza. Mori és Terui vizsgálatai szerint (J. Ferment. Technol. 50: 70-78, 510-17) az
eljárás az elméleti értékhez közeli oxigénmennyiséget igényel. Más mikroorganizmussal mért értékekkel
összevetve a sejtek saját légzésre fordított oxigénigénye meglehetősen csekély. 1 g baktérium 3-6 liter oxigént
fogyaszt óránként. A tenyészeten átvezetett levegő 30-40 %-át képes hasznosítani. Az átvezetett levegő
mennyisége nem növelhető minden határ nélkül, mert a távozó levegő jelentős mennyiségű etanolt és ecetsavat
vihet magával.

Az ecetsavgyártás technológiája
A gazdaságos ecetsavgyártás szempontjából a folyamatos, műszaki zavarok nélküli üzemeltetés
alapvető jelentőségű, mivel a fermentlé összetételében bekövetkező hirtelen változásokra érzékeny a sejt. A
magas ecetsavtartalmú és alacsony etanol tartalmú közeg átcserélése kevés ecetsavat és sok alkoholt tartalmazó
reakció elegyre a sejtek közel 90 %-ának pusztulását okozhatja. ezért minden esetben alacsonyabb alkohol
koncentrációval indítják az eljárást és menetközben adagolják az átalakítandó szubsztrátumot. Az eljárás
eredményességét és gazdaságosságát ronthatja az ecetsav oxidációra alkalmas idegen baktérium megjelenése,
illetve túloxidációra hajlamos mutáns elszaporodása. Általában átalakítható szubsztrátum jelenlétében nem
következik be túloxidáció.
Az ecetsavgyártás alapanyaga az élesztővel erjesztett fermentlé szűrlete vagy annak desztillálással
dúsított koncentrátuma. Az erjesztett fermentlé mint kiindulási anyag általában tartalmaz annyi hasznosítható
szerves anyagot, amely a baktérium szaporodásához szükséges szén-, nitrogén- és vitaminforrás igényt kielégíti.
Desztillációval nyert termékhez viszont.az igénynek megfelelően 100-400 g ammónium-foszfátot adnak az
oxidálandó elegyhez m
3
-ként. Sok esetben előnyös m
3
-ként 200 g élesztőkivonat adagolása.
Borecet készítésekor az ammónium-só hozzáadása feltétlenül szükséges, mert a szőlőlé nitrogéntartalma
alacsony.

Ecetsav előállítása hagyományos csepegtető eljárással
Nemcsak ipartörténeti érdekessége miatt foglalkozunk a régi csepegtető ecetsavgyártó technológia
ismertetésével, de azért is mert a világ ecetsavtermelésének közel egyharmada az úgynevezett Frings
generátorokban készül. Sőt néhány ilyen üzem még századunk második felében is üzembe helyeztetett.
A történelemelőtti idők óta az ecetesedő bort feneketlen hordóba gyömöszölt faforgácson öntögették át
mindaddig amíg az elérte a kellő savanyúságot. A levegővel érintkező bükkfaforgácson, nyírfa ágacskákon
megtapadó ecetsav baktériumok az átcsepegő erjesztett gyümölcslé alkoholtartalmát ecetsavvá oxidálták,
miközben a lé megőrizte a gyümölcsből származó aroma tartalmának jelentős hányadát

209
A Frings generátorok 20-60 m
3
hasznos térfogató henger alakú fatartályok, amelyekben nyírfavesszőt,
bükkfaforgácsot helyeznek el. A tartály alsó részén gyűlik össze a faforgácson átszivárgó reakcióelegy. A
faforgácsra tapadva találjuk az ecetsav baktériumokat. Ma divatos kifejezéssel az egész tartályt rögzített sejteket
tartalmazó bioreaktornak nevezhetjük. A laza hálózatot alkotó faforgácstömegen alulról felfelé levegőt fúvatnak.
A tartály alsó részén található
gyűjtő edényből az alkoholos-ecet
elegyét egy vízszivattyú az
alkoholoxidáció közben szabaddá
váló hőenergia elvezetését szolgáló
hűtőrendszeren át a tartály tetején
elhelyezett túlfolyóval ellátott
gyűjtőtartályba továbbítja. A hűtés
mértékét a reaktorban elhelyezett
hőmérők adatai által vezérelt
automata rendszer szabályozza,
mégpedig a hőcserélőkbe juttatott
hűtővíz mennyiségének a
változtatásával. A gyűjtőtartályból
egy folyamatosan működő
permetező rendszer juttatja az egyre
savanyodó reakcióelegyet a
forgácstömeg tetejére. Az eljárás
gyenge pontja az egyenletes
eloszlás biztosítása. Gyakran
előfordul, hogy a reaktor egyik-
másik részén az alkohol
koncentráció átmenetileg az
optimális érték alá csökken.
Egy-egy oxidációs periódus a forgács minőségétől, a levegőellátottságtól és a generátor méretétől
függően 4-10 napig tart. A végtermék általában 11 % ecetsavat és 0,3 % alkoholt tartalmaz. Ennek egy részét
használják az újabb folyamat indításához 4 % alkoholt és 8 % ecetsavat tartalmazó kiindulási elegy készítéséhez.
Újrainduláskor az első szakaszban az elpusztult baktériumok pótlása miatt az oxidációs teljesítmény csökken,
majd beáll az üzemi teljesítmény, amely 5 liter ecetsav termelését jelenti m
3
-ként.
A nyers ecetet néhány hónapig érlelik az íz anyagok és a különleges aroma kialakulása céljából. Kellő
ideig tartó érlelés után a nyers ecetet bentonit jelenlétében perlitből, vagy diatomea földből kialakított
szűrőágyon élesre, majd membrán szűrőn baktérium mentesre szűrik. A termék ecetsavtartalmának a növelése
egyszerű és kíméletes módon a víz kifagyasztásával oldható meg. Desztillálással az aroma anyagokat
elvesztenénk. A kevés ecetsavat tartalmazó vizet fel lehet használni az alkoholt tartalmazó fermentlé higítására
az acetátor újraindításakor.

Ecetsavgyártás Frings acetátorban
Az ecetsavgyártás technológiai fejlődését századunk második felében a keverővel ellátott saválló
rektorokban folyó alkoholoxidáció jelentette. Ez a félfolyamatos technológia 12 % ecetsavat tartalmazó
végterméket szolgáltat. Egy-egy ciklus literenként 75 g ecetsavat és 5,5 térfogat % alkoholt tartalmaz. Az eljárás
az Enkel és Maurer által szabadalmaztatott és Heinrich Frings üzemében kifejlesztett úgynevezett Frings
acetátort használja világszerte. Az eszköz lényege a hűtőköpennyel ellátott saválló tartályban elhelyezett 6
lapátos turbina test, amely percenként 1500 fordulattal működtetve a lapátok mögött elhelyezkedő nyílásokon
keresztül igen finom eloszlásban juttatja a levegőt a reakcióelegybe. A levegő beszívását az üreges
keverőtengelyen keresztül a turbina lapátok mögött kialakuló kavitációs hatás teszi lehetővé. A levegőbuborékok
finom elosztásában fontos szerepe van a turbina állórészében elhelyezett terelőlapoknak. A keverő és a reaktor
méretét úgy kell megválasztani, hogy a reakcióelegy teljes térfogatában azonos legyen a levegőellátottság 1 mm
átmérőjű buborékok mellett. Az intenzív levegőztetés természetesen habképződéssel jár, amit az étkezési célra
felhasználandó végtermékre tekintettel nem szabad habgátló anyagok alkalmazásával csökkenteni. Az elmenő
gázelegyből a habot egy erre a célra kifejlesztett Ebner által szabadalmaztatott mechanikus habtörővel
visszajuttatják a rekció-elegybe. A percenként 1500 fordulattal működő rendszerben a folyadék a centrifugális
erő hatására a centrifuga külső álló részébe kerülve visszajut a reaktorba. A habmentesített gázelegy pedig a
rotor tengelye mellett távozik a rendszerből. Az acetátor hőmérsékletét megfelelő hűtőrendszer tartja a
generációs idő beállása szempontjából optimális értéken. Fontos tartozéka a készüléknek az Ebner és Enenkel
által szabadalmaztatott alkográf, amely folyamatosan méri az analizátoron átfolyó reakcióelegy alkohol
tartalmát. Az itt nyert adat vezérli a feltöltő és leszívó berendezést.

210
Egy-egy ciklus hossza 36 óra. 1 m
3
fermentor térfogat napi termelése 40-50 kg ecetsav. 1 liter alkohol
átalakítása ecetsavvá 1260 kJ energiát igényel. Az eddig épített legnagyobb méretű acetátorok naponta 1200-
1800 liter alkohol oxidálására képesek. A világgazdaság ecetsav igényének közel felét ilyen készülékekben
termelik.

Jégecet előállítása vegyipari felhasználásra.
A mindenkori nyersolajár függvényében a biotechnikai úton előállítható ecetsav vegyipari felhasználására is
lehetőség adódik a kémiai szintézissel előállított jégecet kiváltására. Az olajárrobbanás időszakában 1962-ben
napi 2 tonna jégecetet termelő melaszt hasznosító üzemet építettek először Törökországban. A gyártási folyamat
a melasz alkoholos erjesztésével kezdődik. A desztillálással kinyert alkohol oxidációja Frings acetátorban folyik.
A képződött ecetsavat a fermentléből etilacetáttal extrahálják, majd az extraktumból desztillálással vízmentes
ecetsavat nyernek.

Ecetsavtermelésre vonatkozó szabadalmi bejelentések: Ebner H. (1966) U.S. Pat. 3262252 (1969) U.S.Pat.
3445245. Ebner H., Enenkel A. (1978) U.S.Pat. 4076844. Frings H.(1974) Ger.Pat. 1517898 Austrian.Pat.
6274/80/.
A XVIII század végén jelentek meg az első ecetgyárak. Hazánkban Pozsonyban1787-ben létesítették az első
üzemet a szesz gyár mellett. 1843-ban a honi iparvédegylet iparműkiállítására beküldött ecet minőségét elismerő
okiratot Batthyány és Kossuth aláírása fémjelezte. A Leipziger-féle ecetgyár 1898-ben kezdte meg működését az
1867-ben alapított Óbudai Szeszégető és Finomító Rt. telephelyén
1990-ben a még működő 5 ecetgyár 3100 e hL szeszecetet 2000 hL borecetet 14000 hL almaecetezt készített
A szeszgyárban 180000 hL finom szesz, 60000 hL abszolút alkohol és 10000 hL denaturált szesz készül
A szesztermelés mellett 21000 tonna friss élesztő kerül a piacra. A fennmaradó élesztő takarmányként
haszmnosul




211
CIANOCOBALAMIN (B
12
vitamin) és a RIBOFLAVIN (B
2
vitamin) előállítása mikrobiológiai eljárással.

Századunk első harmadában még rettegett gyógyíthatatlan betegség volt a vészes vérszegénység. A
betegséget Addison írta le a XIX. században, Biermertől származik az elnevezés ―anaemia perniciosa‖, melyről
még a XX. század első évtizedében is arról folyt a vita, hogy vajon fertőző betegség, vagy valamilyen toxikus
eredetű kórral küszködik az orvostudomány. Georg H. Whipple kaliforniai professzor elvéreztetett kutyákon a
vészes vérszegénységhez hasonló tüneteket észlelt, amit máj etetésével sikerült kedvezően befolyásolnia. Minot
és Murphy 1926-ban megállapította, hogy máj etetéssel a vészes vérszegénységben szenvedőkön segíteni lehet
( J. Amer. Med. Assoc. 86:470.1926). Az általuk javasolt terápia — nagy mennyiségű máj elfogyasztása —
kétségtelenül sok esetben hatásosnak bizonyult. Az igazsághoz hozzátartozik, hogy Hippokratész, később
Galenos és Avicenna is alkalmazta a májetetést a vérszegénység tüneteinek az enyhítésére.
A terápia bizonytalanságát egy angol klinikus Castle 1929-ben közölt elmélete magyarázta. A
csontvelőben folyó vörösvértest képződéshez a táplálékban megtalálható ―extrinsic‖ faktoron kívül egy másik
komponens az ―intrinsic‖ tényező is szükséges. Ez a gyomornedvben jelenlevő hipotetikus faktor segíti a májban
található vitamin felszívódását és a szérumban az o-globulin frakcióhoz való kötődését. A tragikus
következményekkel járó vitaminhiány következménye valójában a gyomorban termelődő és a felszívódást segítő
speciális glikoprotein, az ―intrinsic faktor‖ hiányával magyarázható. Normál esetben a ―cobalamin-intrinsic‖
komplexet az ileumban található receptorok kötik meg, majd az itt termelődő disszociáló faktor segítségével a
vitamin aktív transzport útján kerül a bélhámsejteken keresztül a véráramba. A bélbaktériumok által termelt
vitamin a gazdaszervezet számára általában nem hozzáférhető. Biztos hatás csak az extrinsic faktornak (B
12
) a
véráramba juttatásától remélhető. A cobalamin a magasabb rendű szervezetek életműködése szempontjából
nélkülözhetetlen termék. Minden olyan intramolekuláris átrendeződésben nélkülözhetetlen a szerepe, amelyben
egy H atom és valamilyen szubsztituens helyet cserél, de a metil-csoport átvitelére szolgáló biokémiai reakciók
végbemeneteléhez is szükséges.

a a
| |
H ÷ C ÷ b X ÷ C ÷ b
| |
X ÷ C ÷ c H ÷ C ÷ c
| |
d d

metilmalonil-CoA: CoA-karbonil mutáz (B.B.R.C- 2:1. 1960)
metilmalonil-CoA: szukcinil CoA izomeráz
acetohidroxisav-izomeroreduktáz
dioldehidráz (J.Biol.Chem. 236: 1199 .1961)
homoszerin-metiláz (Nature 195:340 1962)
methionint hasznosító metilezési reakciók
CDP : dCDP átalakulás (J. Biol. Chem. 236:1199 1961)
L-treo-3-metil-aszpartát karboxiaminometil mutáz (Proc Nat. Acad. Sci. 44:1093. 1958)

Ez a prokarioták által előállított kémiailag stabil vitamin az alapvető életfolyamatokban betöltött kulcsszerepe
miatt a környezetből felvett faktorként az élő világban mindenütt előfordul. A magasabb rendű szervezetek
táplálkozás közben szerzik be ezt a számukra esszenciális vegyületet, amely kis mennyiségben minden emlős
szövetben ug/kg nagyságrendben megtalálható. A pillangós növények a szimbióta baktériumaiktól veszik fel. Az
emberi szervezet napi szükségletét néhány ug vitamin fedezi.

Természetes anyagok cianocobalaminként meghatározható vitamin tartalma

Tyúk máj 80 ng/g Tyúktojás sárgája 120-1200 ng/tojás
Tojás fehérje 0 Tyúkürülék 13 ng/g
Marha máj 1300 ng/g Tej 3 ng/g
Tehén ürülék 460 ng/g Bendőbaktérium 1200 ng/g
Bendő protozoa 80 ng/g Ehető gomba 0,5-1 ng/g
Élesztő 0,6-1,1 ng/g Halliszt 64 ng/g
Földimogyoró liszt 23 ng/g Lucerna gyökérgümő 310 ng/g

212
A világpiacon évenként 10 tonna B
12
vitamin kerül eladásra, amelynek 30 %-át sertés és baromfi tápszer
alkotórészeként forgalmazzák.
A tématerület élettani jelentőségére utalva Murphy, Minot és Whipple felfedezésükért 1938-ban Nobel-
díjat kaptak. Hamarosan világszerte megindult a verseny a májban található hatásos anyag előállítása céljából.
Végül is néhány hónap eltéréssel 1948-ban három cég kutatócsoportja jelentette be a keresett, B
12
-nek nevezett
vörös színű kristályos hatóanyagnak az izolálását marhamájból illetve (Streptomyces griseus)-ból.
Rickesés munkatársai (Merck Science 107:396)
Wijmenga és munkatársai, az Organon kutatói s
Lester Smith és munkatársai a Glaxo kutatói
(Biochem. J. Proc VIII 43/1948)
A korrinoid váz kémiai mérésére a
látható fényben és az ultraibolya tartományban
észlelhető fényelnyelésük jó lehetőséget ad, a
probléma azonban az eredmények biológia
értékelésekor jelentkezik. A magasabb rendű
élőlények ugyanis csak a dimetilbenzimidazolt,
illetve hidroxibenzimidazolt tartalmazó
cobinamid származékot képesek hasznosítani.
A téma fejlődése szempontjából nagy
jelentősége volt Shorb bakteriológus
felfedezésének. Megállapította, hogy bizonyos
enzimhiányos baktériumok nem képesek a B
12

vitamin szintézisére, számukra ez a vitamin
növekedési faktornak számított. Ez a felismerés
a bonyolult klinikai kipróbálás helyett a vitamin
mennyiségének a mérését agardiffúziós
módszerré egyszerűsítette, ami felgyorsította a
kutató munkát. Az Escherichia coli 113-3-58
jelű mutáns ellenőrzötten tiszta tioglikolsavat és
aszparagint tartalmazó táptalajon nem
szaporodik, de ha ezzel a mutánssal fertőzött
agar lemezbe fúrt lyukakba cobinamid
származékot cseppentünk, akkor a baktérium az
agarban diffundáló vitamin hatására osztódni
kezd. A növekedési gyűrű átmérője a vitamin
koncentráció függvénye. Ha a mutánsban csak a
cobinamid váz szintézise sérült, akkor a
tápközegbe adott hatástalan korrin köztes terméket maradék enzimkészletével hatásos származékká képes
alakítani. Ennek a lehetőségével számolnunk kell! A növekedési sebességet az elvégzendő enzimes lépések
száma befolyásolja. Az agardiffúziós módszer 5-20 pg/mL B
12
koncentráció tartományban használható. Biológiai
mérőtörzsnek használták a Lactobacillus leichmannii ATCC 4797 számú és az ATCC 7830 számú mutánsokat
is. Fokozható a módszer érzékenysége, ha növekedést serkentő hatás mérését nem agar táptalajon, hanem
kémcsőben végezzük. A mutáns maradék enzimkészletének zavaró hatását kiváltandó a törzs növekedésének
mérésével nyert számszerű adatokat célszerű kromatográfiás módszerekkel ellenőrizni, illetve olyan megbízható
mérőtörzset alkalmazni, amelyik nem képes a köztes terméket aktiválni. A klasszikusnak tekintett
papírkromatográfiás eljárással —nátrium cianidot és kálium-perklorátot tartalmazó szekunder butanolos
futtatószerrel — jól elkülöníthető a B
12
vitamin, a cobinamid, a cobirsav és a cianokobalamin 5-
hidroxibenzimidazol származéka. A komponensek mennyiségi viszonyairól a kivágott foltokból kioldott anyag
spektrofotometriás vizsgálata tájékoztat.
Később kiderült, hogy a magasabb rendűekhez hasonlóan a protisták sem képesek a vitamin
szintézisére, így a vitamin biológiai mérésére jól használhatók. A Euglena gracilis már ng nagyságrendben
érzékeli a vitamin jelenlétét Lényegesen javult a biológiai meghatározás értékelhetősége azzal, hogy
mérőtörzsként az Ochromonas malhamensis használata vált általánossá (Analyst 80:132. 1956) Ezek a
mikroszervezet csak B
12
vitamin jelenlétében képesek növekedni. Hátrányuk, hogy lassan szaporodnak, négy öt
nap szükséges a méréshez.
A HPLC elterjedésével a korrinvázas komponensek aránya és abszolút mennyisége könnyen
meghatározható. A nyers kivonat B
12
tartalmának közvetlen meghatározása azonban a szennyező termékek miatt
nem végezhető. Ezért a cianid-származékká alakítást követő fenolos extrakcióval nyert vitamin-koncentrátumot
elektroforézissel előtisztítják. Ez az előtisztított termék kerül a HPLC oszlopra.


213
A B
12
vitamin röntgen-diffrakciós eljárással igazolt kémiai szerkezetét Dorothi Hodgkin csak 1955-ben közölte.
A gyógyszerpiacon forgalmazott B
12
vitamin, a
cianocobalamin összegképlete C
63
H
88
O
14
N
14
PCo,
móltömege:1355,5 Szerves oldószerekben rosszul,
vízben jól oldódó, acetonban, éterben, kloroformban
oldhatatlan sötétvörös kristályos termék. A lúgos és
savas körülményeket jól tűri, de az erős oxidáló és
redukáló szerek károsítják. Ez az eddig ismert
egyetlen biomolekula ahol kovalens fém-szén kötés
kialakul. Különlegessége a kobalt két illetve három
értékű alakban való jelenléte. Több mint 70 lépést
igénylő totálszintézisét Woodward irányításával
1973-ban fejezték be. Ez a szintézis azonban csak
elméleti érdekességű. A B
12
vitamint ma is
természetes forrásból nyerik.
A vitamin korrinoid alapváza a porfirinek jól ismert
tetrapirrol szerkezetétől abban különbözik, hogy az
A és D pirrol gyürű közvetlenül metin híd nélkül
kapcsolódik. Összehasonlíthatóság céljából az ábrán
bemutatott hem szerkezetét, amelyekben a pirrol gyűrűkhöz vas atom, vagy a klorofillban magnézium
kapcsolódik. A cobalamin pirrolgyűrűin metil, acetamid,
propilamid csoportok találhatók, a pirrolgyűrűk N atomjai
pedig egy kobalt atomot kötnek. Ehhez a fématomhoz
kötődik egy különleges bázis, amelyhez o-glikozidos
kötéssel kapcsolódik egy D-ribóz-3-foszfát. Ez utóbbi a D
gyűrű propionsav oldalláncát amidáló amino-
izopropanolhoz kötődik foszfátészter kötéssel. A
különleges heterociklusos bázis általában 5,6-dimetil-
benzimidazol. A gyógyszerként forgalmazott B
12
vitamin
valójában egy műtermék. A korrinoid gyűrűnek a
különleges bázissal ellentétes térfelén egy cianid gyök kötődik a kobalt atomhoz. A cianocobalamin a
természetes vitamin olyan átmeneti alakja, amely az élő szervezetben könnyen alakulhat aktív vegyületté,
például 5-dezoxi-adenozil-cobalaminná, amelyben az ionos kötéssel rögzült cianid gyök helyett a kovalensen
kötődő 5-dezoxi-adenozint találjuk.
ALS PBGS
Szukcinil-CoA
Glikokoll
|| ||

o÷aminolevulinsav || || Porfobilinogén

F
430
koenzin
ALLOSZTERI
KUS
SZABÁLYOZÁS Ni
++
Uroporfirin III. Tetrapirrol-metán Shirohidroklorin
Metilezés, Co
+++

Koprogén III Cobirinsav

6
Glutamin


Cobirsav

Aminopropanol

Protoporfirin IX
Cobinamid
5-dezoxiadenozin
Fe
++
Mg
++
5’dezoxiadenozilkobinamid
Hem GTP
Klorofill 5’dezoxi-adenozil-
cobinamid-GDP
Hemoglobin
Citokrómok
Kataláz
Riboflavin
5,6-dimetil-benzimidazol

o-ribazol--5foszfát

PORFIRINBŐL KÉPZŐDŐ
VEGYÜLETEK
5’dezoxi-adenozil-
cobalamin-foszfát

(vázlat) 5’dezoxiadenozilcobalamin
B
12
–koenzim


214

A cobalamin bioszintézise — amint az előző
vázlat mutatja — a porfirin szintézisútból ágazik
el. Ebből következik, hogy a képződésében a o-
aminolevulinsav szintetáz (ALS) aktivitása
meghatározó jelentőségű. Ennek az enzimnek a
működését alloszterikusan szabályozza a
protoporfirin-IX. Várható tehát, hogy az ALS
enzimszint géntechnológiai módszerrel történő
növelése fokozza a cobalamin képződést.
Protaminobacter és Rhodopseudomonas
törzsekből sikerült egy olyan életképes hibridet
előállítani, amelyben nem működik az
alloszterikus szabályozási mechanizmus.
Az eredeti Protaminobacter ruber IFO
3708 jelü törzsben az amino-levulinsav szintézis
szabályozása jól működik, ezért a tenyészet alig
éri el a néhány ug/ml cobalamin szintet. A
másik mikrobában, a fototróf
Rhodopseudomonas spheroides IFO 12203
törzsben viszont az aminolevulinsav-szintetáz
szabályozás nélkül működött. Ennek a
következményeként ebben a törzsben
természetes élőhelyén nagy mennyiségű
klorofill képződhet. A Rhodopseudomonas
protamicus névre keresztelt életképes hibrid
tenyészet B
12
tartalma (prekurzor adagolás
nélkül) meghaladta a 100 ug/ml értéket.
Végeredményben nem meglepő, hogy a két
törzsből előállított hibridben a szabályozás
nélkül termelődő o-aminolevulinsav a B
12

vitamin képződését jelentős mértékben
megnöveli (Eur. Pat. 131456. 1985), hiszen a
korrinoid váz szintézise és a klorofill képződése
közös köztesanyagot hasznosít.
A bioszintézis út következő lépésében
— a porfobilinogén szintetáz (PGFS) felületén — két o-aminolevulinsav kondenzál, porfobilinogén képződik,
ami nem más mint egy aminometil csoporttal, ecetsavval és propion savval szubsztituált pirrol származék. A
szintézisért felelős enzimkomplex ugyancsak alloszterikusan szabályozott. Az aminolevulinsav szintetázhoz
hasonlóan ennek a komplexnek a működését is a sejten belüli hem koncentráció, nevezetesen a protoporfirin-IX
szint befolyásolja.
A porfobilinogének összekapcsolása bonyolult enzimkomplex felületén következik be. Egy NADP
kofaktort igénylő deaminációs reakcióban egy csupán átmenetileg megjelenő, igen reakcióképes
hidroximetilbilán képződik. Megjegyzendő, hogy végül a kialakult tetrapirrol származék nem szimmetrikus. A
tetrapirrol D gyürűjében az ecetsav- és a propionsav-oldallánc sorrendje ellentétes a többihez viszonyítva. Ez az
eltérés a bioszintézis folyamán irányító szerepet tölt be.
A négy porfobilinogénből kialakult uroporfirin-III (uroporfirinogén III) az utolsó közös intermedier az
alapvetően fontos élettani feladatokat ellátó porfirin származékok képződésében. Ebből a vegyületből képződik a
fényhasznosító klorofill, de itt ágazik el a citokromok, a hemoglobin, a kataláz valamint más pirrol származékok
között a B
12
szintézis útja is.
Az uroporfirinből meghatározott sorrendben bekövetkező metilezési reakciókkal alakul ki a korrin váz.
A második metilezési reakció terméke a dimetilkorriferin, illetve dihidroizobakterioklorinként ismert
shirohidroklorin, egy újabb elágazási pontot jelent. Innen indul ugyanis az F-430 dehidrogenáz nikkelt
tartalmazó kofaktorának a szintézise.
A metionin segítségével folyó metilezési reakciókat követően a tetrapirrol szerkezetben a B
12
szintézis
irányába mutató döntő átalakulás következik be. Nevezetesen a trimetil-korriferin C gyűrűjén található ecetsav
oldallánc dekarboxilezését követően, az előző reakciósorban metilezett C
20
szénatom ecetsav formájában kiválik.
Ez az eliminációs reakció az A és D gyűrű közvetlen kapcsolódását teszi lehetővé. A kialakult szerkezeti
változás segíti a kobalt atom bekötődését és a cobirinsav képződését.


215
cobirinsav

A cobirinsav továbbalakulását — a B
12
koenzim bioszintézisének történéseit — szemlélteti a következő vázlat

216


217
A kialakult erősen savas jellegű cobirinsav hét karboxil csoportja közül hat vesz részt a további
átalakulásban. A cobirinsav hat glutamin felhasználásával hat amid csoport kialkításával alakul cobirsavvá. A
cobirsav csupán egyetlen savas jellegű csoportot, egy propionsav oldalláncot tartalmaz, amely hamarosan egy
treoninból származó amino-izopropanollal peptid kötést kialakítva reagál. A szabad hidroxil csoport ezután egy
ATP-ből származó foszforsav-maradékkal képez észtert.
Ez az észter a továbbiakban egy GTP-bôl származó guanozin-monofoszfáttal reagál pirofoszfát
felszabadulása mellett. A GMP-cobirsav származék pirofoszfát kötése lehetőséget ad az o-ribazol-foszfáttal
való reakcióra is. A reakcióban a ribóz C
3
hidroxil csoportja reagál guanilsav felszabadulása közben. A képződő
vegyület a B
12
foszfát. Ezt követőleg a ribóz C
5
hidroxil csoportját acilező foszforsav maradékot (foszfátészter)
az utolsó lépésben egy foszfatáz eltávolítja.
A ribazol imidazol csoportja lazán kötődik a korrin vázba rögzített kobalt atomhoz. Ez a komplex képző
tulajdonságáról jól ismert atom a hozzá lazán kötött imidazol gyűrű elektronszerkezetét is felhasználja a B
12

vitamin által katalizált reakciók bonyolításához. A kobalamin képződés közben figyelemre méltó kémiai
reakciók zajlanak a kobalt-szén kötés kialakulása érdekében. A B
12
koenzimben 5’-dezoxi-adenozin kapcsolódik
közvetlenül az imidazol elektronszerkezetével kapcsolatban levő kobalt atomhoz. A kobalt körül kialakuló
reakcióképes elektronrendszer miatt az 5’-dezoxi-adenozin könnyen lecserélhető. Ez történik a B
12
vitamin ipari
előállításakor, amelyben a műterméknek tekinthető cianid származékot nyerjük. Ezt a vegyületet a
gyógyászatban azért alkalmazhatjuk sikerrel, mert az élő szervezetben a felhasználás helyén a cianid csoport
ugyanilyen könnyen cserélődik az adott reakcióban szereplő gyökkel, 5’-dezoxi-adenozinnal illetve a
metioninból származó metil gyökkel.
A vitamin nukleotid jellegű építőelemeiként ismeretes benzimidazol származékok az elektrontranszport
folyamatokban szereplő, különböző dehidrogenázok kofaktoraiként ismert izoalloxazin vegyületekből
képződnek. Jól szemlélteti ez a folyamat azt, hogy az élő szervezet bonyolult anyagcsere-rendszerében még a
bomlástermékek is szerepet kaphatnak. Sőt - amint látható - a szelekciós nyomás hatására biológiai jelentőséget
nyerve, végül is esszenciális élettani faktorrá válhatnak.

218
A különböző flavin enzimek kofaktorainak szintézise guanozin-trifoszfátból (GTP) indul, amit a GTP-
ciklohidroláz egy hangyasav eltávolításával 2,5-diamino-6-keto-4-(5'-foszforibozilamino)-pirimidinné alakít.
Ebből egy reduktív deaminációs reakcióban 5-amino-2,6-diketo-4-(5’-foszforibozilamino)-pirimidin képződik.
A következő reakcióban két molekula vesz részt. Az előbbi diketo-pirimidin származék egy másik
molekula ribitil csoportjával reagálva 6-metil-7-(1’, 2’-dihidroxi-etil)-8-foszforibitil lumazinná kondenzál. Ez a
lumazin származék a flavin nukleotídok közös köztesterméke.
Riboflavin képződéskor egy szénatom eltávolításával 6,7-dimetil-8-foszforibitil lumazin képződik,
amiből ugyancsak két molekula vesz részt a riboflavin szintetáz által katalizált reakcióban. Az egyik
reakciópartnerrel leszakadó négy szénatomot tartalmazó fragmentum felhasználásával fejeződik be a riboflavin
szintézis, miközben az előbbi reakcióban megismert 5-amino-2,6-diketo-4-(5’-foszforibitilamino)-pirimidin
képződik. Ez a ―mellék-termék‖ a bioszintézis reakciósorában köztes termékként természetesen újra
felhasználásra kerül.
Az F-420 dehidrogenáz koenzime ugyancsak a 6-metil-7-dihidroxietil-8-foszforibitil lumazinból
képződik, mégpedig célszerűen a riboflavin képződéskor eltávolított C
1
töredék felvételével a lumazin 7-hidroxi-
9-D-5’-foszforibitil-izoalloxazinná alakul. (Az ábrán az utolsó sor első szerkezeti képlete) A cobalamin
csoportba tartozó vegyületek benzimidazol építőelemei ezekből az izoalloxazin származékokból képződnek. Az
izoalloxazin-gyűrű felnyílása után egy molekula alloxán képződése mellett a megfelelő benzimidazol származék
képződik (5,6-dimetil-benzimidazol, 5-hidroxi-benzimidazol, 5-metoxi-benzimidazol, stb.)
A NAD
+
-ból nukleotidil pirofoszfatáz hatására képződő nikotinsavamid-mononukleotid egy transz-
glikozidáz katalizálta reakcióban ribazol-5-foszfáttá alakul. Ez utóbbi vegyület az 5'-dezoxiadenozil-cobinamid-
guanizin difoszfáttal reagál. A ribazol-5-foszfát pedig egy transz-glikozidáz katalizálta reakcióban GMP
lehasadása mellett a cobinamid vázhoz kapcsolódik. A képződő vitamin-foszfát azután egy foszfatáz
segítségével alakul B
12
-koenzimmé. Az 5 dezoxiadenozin mobilitását előnyösen befolyásolja a korrinoid vázban
elhelyezkedő kobalthoz kapcsolódó imidazol jelenléte. A korrin váz által meghatározott sík egyik oldalán
helyezkedik el a dimetilbenzimidazol gyűrű, a másikon a kobalthoz kapcsolódó 5'-dezoxiadenozil, illetve
esetenként a metil, vagy hidroxil csoport, valamint az életmentő gyógyszerként forgalmazott cianocobalamin
előállításakor ott elhelyezkedő CN csoport. (lásd a cianocobalamin szerkezetzét bemutató ábrát) A B
12
vitamin
bioszintézisének az utolsó fokozottan energiaigényes lépéseiben a NAD
+
, az ATP és a GTP energiatartalma
használódik fel.

A B
12
vitamin nagyüzemi előállítására aerob, illetve anaerob fermentációs eljárásokat dolgoztak ki.
Kisebb mennyiségben antibiotikum fermentációs eljárások melléktermékeként felszaporodó megsemmisítésre
ítélt biomasszából nyerték ki. A múlt század közepén — a Merck kutatói — Rickes és munkatársai a
streptomycint termelő Streptomyces griseus kiszűrt micéliumtömegéből állította elő. Az ötvenes években a
kristályos vitamin piaci értéke 1200 $/g volt, ami minden költséget elviselt. Később direktfermentációs
eljárásokat dolgoztak ki az előállítására. A termelő mikroorganizmus számára is életfontosságú vitamin a
növekedési fázisban képződik. Ez a megállapítás a genetikai beavatkozással saját szükségletén túl termelő
törzsekre is érvényes.
Miller és Rosenblum 1960-ban Pseudomonas denitrificans törzset izoláltak, amely literenként 600 ug
vitamint termelt. A Merck cég kutatói 10 éves törzsnemesítő munkával 60 mg literenkénti termelésre képes
mutánst állítottak elő. A vitaminképződés magas szintjét a táptalajba jelenlevő betain (trimetil-glicin) előnyösen
befolyásolja. Nem mint metil donor, hanem glicin analógként a o-aminolevulinsav szintetáz aktivitását fokozva
növeli a vitamin képződését. A tápközegben szénforrásként használt répamelasz bőségesen tartalmaz betaint.
Prekurzorként 5,6-dimetilbenzimidazolt kell juttatni a tenyészethez, mivel a nemesített törzs anyagcsere
rendszere nem képes annyi benzimidazolt előállítani, amennyit a képződő cobinamid aktíválása igényel.
219
Az eljárás oxigén igényének kielégítése céljából a tenyészeten térfogatával egyező levegő átáramoltatása
szűkséges.
A termelő táptalaj összetétele L
–1
pH=7.4 90 óra 29 °C 420 ford.perc
–1

100,0 g cukorrépa melasz 0,025 g 5,6-dimetil-benzimidazol
2,0 g élesztőkivonat 0,005 g Na
2
MoO
4
.H
2
o
5,0 g (NH
4
)
2
HPO
4
0,188 g Co(NO
3
)
2
.6 H
2
O
0,3 g MgSO
4
.7 H
2
O 0,020 g ZnSO
4
.7 H
2
O
0,2 g MnSO
4
.H
2
O

A fermentációs folyamat végén a tenyészetet 30 percig 120
o
C-on tartják. Ezzel kiszabadítják a vitamint és
rokonvegyületeit a baktérium sejtből. A lehűtött feltárt sejttömeget pH=8,5-re állítva 16 órán keresztül kálium-
cianiddal keverik. Literenként 60 g cinkkloriddal kiegészítve pH=8-ra állítva szűrik. A szűrletet 1/10-ed
térfogatnyi krezol:széntetraklorid 1:2 arányú elegyével háromszor extrahálják. Az összegyűjtött szerves fázishoz
fél térfogat butanolt adva vízzel extrahálják (1/10 térfogat). A vizes fázist 1/100-adnyi krezol-széntetraklorid
eleggyel extrahálva töményítik. A szerves fázisból a vitamin aceton:éter 2:1 arányú elegyével kicsapható.A
csapadék minimális metanolban oldva aktivált alumínium oxidon tisztítható 2 % ecetsavat tartalmazó metanollal.

Gazdaságos fermentációs eljárást fejlesztettek ki a fakultatív anaerob Propionibacterium fajokkal.
(Propionibacterium freudenreichii ATCC 6207— P. shermannii ATCC 13673) Az eljárás első szakaszában
kukoricalekvárt és 10 % glükózt tartalmazó táptalajon anaerob körülmények között propionsavas erjedés folyik.
Ez az anyagcsere korrinoid vitamint igényel a szukcinil-CoA metilmalonil-CoA átalakításhoz. Nem csoda tehát,
hogy a fermentációs szakaszban a B
12
vitamin 5'-dezoxiadenozil származéka túltermelődik. A glükóz mennyiség
négy napi anaerob fermentációja után kezdődik az aerob szakaszra való áttérés. Az aerob szakaszban a
baktérium a fermentációs szakaszban képződött propionsavat hasznosítja. Ez az élettani reakciósor fokozottan
igényli a cobalamin vitamin jelenlétét. Az aerob anyagcsere elősegíti a dimetilbenzimidazol képződését a
feleslegessé váló riboflavinból. Ezért a folyamat nem igényel prekurzor adagolást.

A B
12
vitamin előállításának ipari megvalósításában a magyar gyógyszeripar is figyelemreméltó
eredményeket ért el. A negyvenes évek végén a Kőbányai Gyógyszergyár (Richter Gedeon R.T.) májkivonata
"Perhepár" néven került forgalomba. Ezt 1951-ben egy tisztított készítmény a "Neo-perhepár" váltotta fel. A
gyár vegyészei heroikus munkával hat tonna májból 2 gramm kristályos vitamint állítottak elő. A teljesítmény
egyértelművé tette a gazdasági vezetők számára, hogy kiindulási anyagként valamilyen olcsóbb vitamin-forrást
kell keresni. Szabadalmi okokból a direkt-fermentációs eljárás bevezetése nem jöhetett számításba. Az
antibiotikum termelés melléktermékeként való előállítását is megvizsgálták. A Chionoinban folytatott
sztreptomicin termelés azonban a kiindulási anyag mennyiségét meghatározta, azaz a gyártás felfuttatását az
alapanyag mennyisége limitálta. A gyár kutatóinak figyelme a rothasztó baktériumok jelentős B
12

vitamintartalmára irányult. 1954-ben a soroksári szennyvíztisztító baktériumflórájából 16,8 g kristályos terméket
állítottak elő. 1958-ban a kezdeti mennyiség 100-szorosára emelték az évi termelést. A hetvenes évekre a
vitamin termelés meghaladta a fél tonnát. Ezt azonban már nem a csatorna iszap, hanem fermentációs eljárással
nyert baktériumtömeg feldolgozása tette lehetővé. Az első 10 m
3
térfogatú anaerob fermentor 1956-ban kezdte
meg a termelést a szennyvíztisztítóból nyert vegyes baktériumpopulációval
A vizsgálatok szerint a csatornaiszapból származó populáció vitamintermelő tagja a Methanobacter
omelianskii volt. A Svéd Királyi Akadémia mikrobiológusának, Halina Menjahl dolgozatában talált utalás
alapján sikerült az eljárást iparilag hasznosíthatóvá tenni. A hatvanas években az eljárást fél-folytonos
technológia bevezetésével fejlesztették. Elhagyták a szennyvíziszapot. A belőle elkülönített, metanol
hasznosításra szelektált baktérium tömeg folytonos fenntartásával biztosították a folyamatos termelést
A nyolcvanas években a B
12
koenzim fermentációs előállításával bővült a készítmények száma. A
termelési eredmények javulása és a piaci verseny radikális árcsökkenést okozott.
A kinyerési technológia is jelentősen változott. Mivel a hatóanyag az élő sejtben található az első lépés
a sejtek feltárása, amit követ a cian származék előállítása. A fermentléhez NaCN-ot adva és acetonnal hígítva 30
percig keverik 50
o
C-on, miközben a cianocobalamin oldatba megy, a sejtből kiszabaduló fehérje pedig
kicsapódva az alakos elemekkel együtt szűrhetővé válik. A vizes-acetonos oldathoz kloroformot adva a
korrinoidok a vizes fázisba szoríthatók. és kromatografálással tisztíthatók.
A környezet szennyezését elkerülendő a hőkezeléssel kiszabadított cianocobalamint XAD-2 gyantán
kötik. Csapvízzel való mosása után a szelektíven megkötött vitamint vizes alkohollal mossák le, majd töményítés
után kristályosítják.
Mai élettani ismereteink alapján nem meglepő, hogy a metanolt hasznosító mikroorganizmusok
különösen alkalmasak a B
12
vitamin nagyipari előállítására. A metil hasznosítás első lépéseként a
metiltranszferázhoz kapcsolódó B
12
-koenzim kobalt atomján indul a reakció. A metilcobalamin képződése segíti
a metanolból származó szén hasznosulását. Ebből a szénből építi fel a Methanobacterium a szénhidrátokat,
220
fehérjéket, lipideket, az egész szervezetét. Ugyanakkor a dehidrogénezési folyamatokban eltávolított elektron és
felszabaduló proton számára a metil csoport elektronakceptorként is hasznosul. A CoM-SH-hoz kötődő
metilcsoport az F
430
és az F
420
fehérjéket tartalmazó metilreduktáz enzimkomplex működésének eredményeként
végül is metánként távozik az enzimfelületről. A szénlánc felépüléséhez szükséges acetil-CoA a CO-
dehidrogenáz felületén képződik. Mint látható az Ősbaktérium csoportba sorolható baktériumtömeg
szénforrásként és energiaforrásként (elektronakceptorként) hasznosítja a metanolt

B
2
vitamin (laktoflavin)

A riboflavint tejből 1933-ban izolálta Kuhn György, szerkezetét 1933-ban határozta meg

6,7-dimetil-9-(D-1’-ribitil)-izoalloxazin

Az élő világban a flavoprotein alkotórészeként fordul elő. A kémiai szintézissel vetélkedő mikrobiológiai
előállítási eljárást a XX. század közepén fejlesztették ki. Évtizedeken keresztül hazánkban is alkalmazták.
Az NNRL Y-1056 jelű Ashbya gossypii tömlős gomba komplett táptalajon fejlődött 7 napos tenyészete
literenként 7-10 g riboflavint tartalmaz. A táptalaj 2,25 % kukorica-lekvárt, 3,5 % peptont és 4.5 % szója olajat
tartalmazott. Habgátlóként is előnyös a szója olaj.használata.

221
D-GLÜKONSAV ELŐÁLLÍTÁSA
A glükóz mikrobiális oxidációját - a "cukorsav" képződését - ecetsav baktériumok jelenlétében L.
Boutroux írta le 1880-ban (C.R.Acad.Sci. 91: 236). Pseudomonas glükonsav termelését Alsberg írta le 1911-ben.
Gombatenyészettel történő előállítását M. Molliard közölte először 1922-ben (C. R. Acad. Sci. 17:881). 1928-
ban már működött az első üzem felületi tenyésztéssel Penicillim luteum-pupurogenum aktivitását hasznosítva
80-85 %-os hatásfokkal. Azóta végzett kutatások eredményeként számos mikroszervezet, köztük Aspergillus,
Penicillium, Scopulariopsis, Gonatobotrys, Endomycopsis Pullularia, Pseudomons, Gluconobacter fajok
glükózoxidáló képességéről tudunk.
A glükóz baktériumokban folyó direkt oxidációja általában NAD
+
illetve NADP
+
kofaktort igényel.
Sok esetben ezek a baktériumok a glükonsavat tovább oxidálva 2-keto-glükonsavat illetve 2,5-diketo-
glükonsavat képeznek. Az oxidált termék végül egy-egy foszfotranszferáz aktivitását hasznosítva kerül az
anyagcserébe a pentózfoszfát ciklus köztesanyagaként.

ATP ADP
GLÜKÓZ
÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷>
Glükóz-6-foszfát
NAD
+
glükokináz NADP
+

glükóz-dehidrogenáz G-6-P dehidrogenáz
NADH NADPH
glükonsav-o-lakton

H
2
O glükonát foszotranszferáz
glükonsav
÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷>
Glükonsav-6-foszfát
NAD
+
ATP ADP NADP
+

glükonát-2-oxidoreduktáz 6-PG-dehidrogenáz
NADH ATP ADP NADPH
2-keto-glükonát
÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷>
2-keto-6-foszfo-glükonát
NAD
+
2-keto-glükonát-foszfotranszferáz
2-oxo-glükonát-
-5-oxidoreduktáz
NADH
2,5-diketo-glükonát ribóz-5-foszfát

Az eljárás ipari jelentőségét éppen a megjelenő különböző keto-származékok csökkentik, kivéve a főtermékként
felhalmozódó 2,5-diketo-glükonátot, amely a C-vitamin gyártás előnyösen továbbalakítható értékes
köztesterméke. A ma is használatos (glükonát) gyártási eljárást Bernhauer K. és Schalhof L. kutatómunkája
alapozta meg (1932.U.S.Pat. 1849053). Ettől függetlenül Currie és munkatársainak gyakorlati eredményeire
támaszkodva a Chaz. Pfizer & Co. üzemében 1923-ban indult a glükonsav gyártás nagyipari méretben. (1933
U.S.Pat. 1893819). A Penicillium luteum és az Aspergillus niger törzsekkel 50-60 óra alatt 90 %-nál jobb
hatásfokkal folyt a glükóz oxidációja. 1937-ben Moyer és munkatársai olyan aktív Aspergillus niger törzset
izolált, amely egy nap alatt literenként 200 g glükózt oxidált 95 % elméleti hatásfokkal (Ind. Eng. Chem. 29:777
és 44:435, 1952), ha a reakcióelegy kalcium karbonátot is tartalmazott. Glükonsav előállítására ezt a törzset és
eljárást hasznosított hazánkban a Richter Gedeon Rt elsőként hazánkban.
A glükóz átalakítását glükonsav-o-laktonná a gombákban egy FAD enzim a glükózoxidáz katalizálja

OH O O
'

'' ''
H-C C C-OH
| | |
H-C-OH H-C-OH H
2
O H-C-OH
| glükózoxidáz | |
HO-C-H HO-C-H

HO-C-H
| | |
H-C-OH H-C-OH H-C-OH
| FAD FADH
2
| |
H-C H-C H-C-OH
|

| |
H-C-OH H-C-OH H-C-OH
| | |
H H H

222
A kofaktor visszaoxidálása hidrogén peroxid képződése közben egy oxigén molekulát fogyaszt. Ezt a toxikus
terméket a mikroorganizmusban működő kataláz azonnal bontja.

O
2
+

FADH
2 ÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷>
FAD + H
2
O
2


H
2
O
2 ÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷÷>
H
2
O +
1
/
2
O
2

A glükonsav÷o÷lakton ugyan spontán hidrolizálhat glükonáttá, az Aspergiullus-ban azonban egy specifikus
laktont hidrolizáló enzim működése észlelhető. A glükóz-oxidázt az Aspergillus niger sejtmentes kivonatából D.
Müller izolálta 1928-ban (Biochem Z. 199: 136). Később Franke W. és munkatársai (Zbl Bakt. I. 191-94, 1963),
valamint Keilin D. és Hartree E. F. (Biochem. J. 42:221, 1948) megállapították, hogy ez a FAD tartalmú
flavoprotein a D-glükóz ß-anomerjét 150-szer gyorsabban képes oxidálni, mint az o -D-glükózt. Lehet, hogy a
rendszer egy mutarotáz aktivitással rendelkező fehérjét is tartalmaz.
A glükóz-oxidáz egyes gombák szűrt tápközegében is megjelenik. Néhány szerző köztük Kecholaty W.
"Penatin" néven (Arch. Biochem 273, 1943), Coulthard és munkatársai "Notatin" néven (Nature 150:634, 1942)
Roberts és munkatársai "Penicillin-B" néven (J. Biol. Chem. 147: 47 ,1943) a negyvenes évek elején
antibiotikumként írták le ezt az enzimet. Megtévesztette a szerzőket a glükózt tartalmazó táptalajon felszabaduló
hidrogénperoxid dezinficiáló hatása. Azóta ezt a hatást az élelmiszeripar hasznosítja. A tojásfehérjepor
előállításánál a készítményben levő 0,5 % glükóz eloxidálására használják. Az enzim specifikus működése miatt
a glükóz kvantitatív mérésére is használható. Gyorsasága, megbízhatósága miatt ez a tapasztalat analitikai
módszerré fejlesztve bevonult a klinikai gyakorlatba.
Van Dijken J. P. és Veenhuis M. vizsgálatai szerint a glükóz-oxidáz (Eur. J. Appl. Microbiol. 9:275,
1980) az Aspergillus niger sejtplazma peroxiszómáiban található. Nem ismert azonban sem az enzim, sem az
általa előállított glükonsav élettani szerepe. Az enzim 10,5 % szénhidrátot tartalmazó 186000 moltömegű
glükoprotein. Prosztetikus csoportként két szorosan kötött FAD-ot tartalmaz. A hőérzékeny (50
o
C) enzim
optimális reakciókörülménye pH=5,5.-nál található.
A glükonsav képződés szempontjából előnyös az 1-1,5 M glükóz koncentráció, a tápközeg csekély
foszfát tartalma (80-90 mM) és a nitrogén éhezés (20-30 mM). A fémionok közül a mangán jelenléte (1-10 mM)
szükséges. A reakció oxigénigénye igen nagy. A reakcióelegy hidrogén-ion koncentrációja meghatározó
jelentőségű (pH=4,5-6,5). Savanyú körülmények között (pH=3) az enzim bomlik. Az átalakítást végző
gombatömeg (micélium) többször is felhasználható aktivitásvesztés nélkül.
Moyer 1944-ben felfedezte, hogy bórax jelenlétében az átalakítandó glükóz koncentrációja tovább
növelhető akár 350 g/liter értékig. A bór ugyanis akadályozza a kalciumglükonát kiválását. A világszerte
használt eljárást Moyer és munkatársai fejlesztették ki (US.Pat. 2351500). Az ipari gyakorlatban használt
Aspergillus niger törzset agar táptalajon tartják fenn. A tenyészetről lemosott spóra-szuszpenzióval oltják az
ammónium-foszfátot és glükózt tartalmazó táptalajt. A tenyésztést 30
o
C-on erősen levegőztetve végzik. A
logaritmikus növekedési fázisban levő tenyészettel oltják a főfermentációt, amely 15 % glükóz (keményítő
hidrolizátum) mellett 0,4 % ammóniumfoszfátot, 0,2 % kálium-foszfátot, 0,16 % magnézium-szsulfátot és 2,5
% kálcium-karbonátot tartalmaz. Ez utóbbi anyagot külön sterilezve adják oltás előtt a táptalajhoz. A keverővel
ellátott raktorban levő tenyészeten percemként 1 térfogatnyi levegőt préselnek át 4 bar túlnyomás mellett. Az
oxidáció közben felszabaduló hő elvonása hatásos hűtést igényel. 15-20 órás kortól az átalakuló glükózt pótolva
steril tömény glükóz oldatot, a kálcium-glükonát kiválását akadályozandó pedig literenként 1,5-2,5 g bóraxot
adagoltak. A glükóz összmennyisége nem haladja meg a 35 %-ot. Élelmiszeripari hasznosításra készülő termék
esetében azonban a bórsav-észter toxicitása miatt bórax nem használható, ezért általában 15 % glükóz
átalakítását végzik 20 óra alatt. 1952-ben a Blom által kifejlesztett automatikus pH szabályozással azután bór
alkalmazása nélkül is sikerült növelni a termékkoncentrációt.
Az átalakítás befejeződésekor kiszűrt micélium tömeg ismételten felhasználható a folyamat
katalizálására. A szűrletet kalcium-hidroxiddal semlegesítik, majd forralva 20 % kálcium-glükonát tartalomig
töményítik. A kristályosítást oltókristállyal elősegítve 20
o
C -ra hűtve végzik. A kristályos terméket hűtött vízzel
mossák. Az anyalúgot és a mosóvizet aktív szénnel tisztítják, majd újra töményítve kristályosítják. A kristályt 80
o
C hőmérsékleten szárítják. A kristályok tömény vizes szuszpenziójához adott számított mennyiségű kénsavval
a glükonsav felszabadítható. A szabad sav vízben jól oldódik, akár 50 %-os oldat is készíthető belőle. Ebben a
vizes oldatban a hőmérséklettől függő arányban egyidejűleg jelen van a szabad sav mellett a o÷illetve a ¸÷lakton
is. A túltelített oldatból 30
o
C alatt a szabad sav kristályosodik, 30-70
o
C között a o÷lakton kristályosítható, 70
o
C felett pedig a ¸÷lakton válik ki. A termék tisztítása ismételt kálcium-glükonát képzéssel, majd aktív szenes
derítést követő kristályosítással történik. Vizes (50 %-os) oldatát a tejipar használja a tároló edények, alumínium
eszközök és a rendszer tisztítására. A o÷laktont, mint lassan ható savanyító szert az élelmiszeripar illetve a
húsipar használja. Japánban évente 3000 tonna laktont használnak fel csak a szójafehérje kicsapására. Évente 50
ezer tonna 99.5 % tisztaságú nátrium sója kerül forgalomba. Fémsóit (Ca, Fe, Mg) állattápszerbe keverve
használják.
223
KÖRNYEZETET SZENNYEZŐ ANYAGOK BIOLÓGIAI HASZNOSÍTÁSA

Szerves anyagok anaerob lebontása évmilliárdok óta nélkülözhetetlen részfolyamata a Föld felszín
anyagforgalmának. A tudomány ezzel az érdekes és még ma is sok nyitott kérdést tartalmazó problémakörrel a tavak
fenekén felszaporodó üledék rothadási folyamatainak vizsgálatakor, a tőzegmocsarak különleges biológiai
jelenségeinek vagy a kérődzők bendőjében végbemenő átalakulásoknak a magyarázatakor találkozott.
A szemétgödrökben, illetve trágyatárolókban folyó anaerob folyamatok alapjelenségei hosszú ideig
senkit sem érdekeltek, annak ellenére, hogy ugyanakkor a jelenség gyakorlati hasznát közösen élvezte az
emberiség. Amikor Franciaországban Louis H. Mouras de Vesoul 1860-ban zárt emésztőgödröt épített a
birtokán, valószínűleg csak a kellemetlen illatanyagok kiszabadulását akarta megakadályozni. Később az
emésztőgödörben végbemenő folyamatot figyelve megállapította, hogy a szilárd növényi hulladékok egy idő
után teljesen elfolyósodnak. A képződő gáz (biogáz) hasznosítására azonban nem gondolt. Az irodalmi adatok
szerint először 1895-ben Donald Cameron használta a kiáramló gázelegyet fűtőanyagként. Az Exeter-ben épített,
nagy emésztőtartályai körül ezzel a gázzal világítottak.
A század első felében a szennyvíztisztítást energiaigényes aerob módszerrel próbálták megoldani. Az
eljárás valójában a biológiailag eloxidálható szervesanyag-tartalom (AOX) lebontásához szükséges levegő
mennyiségének a meghatározására szolgáló analitikai módszer megnövelt méretű változatának tekinthető. A
szennyvizet ugyanis a szervesanyag-tartalmának a biológiai lebontásához szükséges oxigén mennyiségével lehet
minősíteni. Az aerob bomlást elősegítő levegőztetés azonban nagy felületet és nem kevés energiát igényelt.
A levegőztetett szakasz után elhelyezett ülepítő medencék biológiai folyamatait nem vizsgálták. A felhasznált
felület csökkentése és a levegőbuborékok oxigén tartalmának jobb kihasználása érdekében 30 méternél
magasabb toronyreaktorokat építve igyekeztek gazdaságosabbá tenni az eljárást. Megfelelő fúvókák
alkalmazásával a 8-10%-os oxigén kihasználás 40-60%-ra emelhető A túlfolyó tölcsérben felgyűlő biomassza
egy részét szükség esetén visszavezetik a kezelőtérbe.

Az aerob szennyvíz tisztítónak — a beruházási költségen túl — jelentős az energiaigénye, a közösséget
terhelő költségigénye. Tovább fokozható a tisztítás hatásfoka tiszta oxigén bevitelével.
Ugrásszerű fejlődést hozott a hetvenes években jelentkező energiakrízis, a nyersolaj árának emelkedése.
a szakemberek figyelmét az energetikailag kedvezőbb anaerob módszerekre irányította. Az aerob eljárással
történő tisztításkor a szennyvíz eloxidálható széntartalmának 45 %-a széndioxid alakjában távozik; a bevitt
anyag fele a szennyvíziszapban dúsul fel (ez később elégethető); 5 % pedig az elfolyó tisztított vízben marad
oldva. Anaerob módszerrel viszont ugyanebből a szennyvízből a metabolizálható széntartalom 80 %-a metán és


224
széndioxid formájában gázfázisba vihető, miközben a szennyvíziszapban l0 %, az elfolyó tisztított vízben
ugyancsak l0 % széntartalom van jelen. Ez utóbbi érték közel felére csökkenthető, ha az anaerob rendszer után
egy kisméretű aerob reaktort működtetünk.
Az anaerob reaktorból távozó biogáz összetételét a szennyvíz kémiai összetétele jelentős mértékben
befolyásolja: Szénhidrátból 50 % metán és ugyanennyi széndioxid képződik. A fehérje tartalmú
szennyvízből képződő széndioxid és metán aránya 3:7, de jelentős az ammóniaképződés. Lipidekből 67 %
metántartalom mellett 33 % széndioxid képződik. Természetesen különböző technológiai fogásokkal -
hidrogén bevitellel vagy a széndioxid és az ammónia eltávolításával - a gázelegy (biogáz) metántartalma
lényegesen növelhető. A gazdasági haszon számottevő, hiszen a hexóz aerob lebontásakor 2803 kJ/mol
energiát szolgáltat, anaerob körülmények között viszont mindössze l32 kJ/mol szabadul fel. A különbség
jelentős hányadát a fűtőanyagként használható metán tartalmazza. A szeméttelepeken folyó
metánképződésről Jones és Owen már 1934-ben beszámolt. Az energiabőség miatt azonban erre a felfe-
dezésre senki sem figyelt fel. Csupán a 60-as években kezdtek német és amerikai mérnökök e felismerés
gyakorlati hasznosításával foglalkozni. Az első gáztermelő üzem a Palos Verdes Landfillnél 1975-ben
indult. A szeméttelepről nyert gázt elektromos energia termelésére hasznosították. Ezt követőleg egyre több
hasonló üzem épült szerte a világon. Egy1988-ban megjelent statisztikai adat szerint addig 15 országban 146
üzem kezdte meg a működését. Az így nyert gáz általában 55 % metánt tartalmazott. A termelt gáz
mennyisége évenként 825.000 tonna szénnel egyenértékű fűtő teljesítményt jelent. A metánképződést mint
általános jelenséget a Föld különböző pontjain végzett vizsgálatok igazolják. A mérhető csekély kon-
centráció ellenére a Föld évi metántermelése meghaladja a gigatonna mértéket. Ez a metánmennyiség
különböző mikroorganizmusok egymást segítő és kiegészítő tevékenységének eredményeként kerül a
légkörbe. A szerves anyagból folyó biológiai metánképződés négy, biokémiailag jól megkülönböztethető
szakaszra osztható, mivel az egyes szakaszok mikroflórája számára az optimális fizikai-kémiai körülmények
jelentős mértékben eltérnek..
Az első lépésben nagyméretű szerves molekulák, polimerek, fehérjék, poliszacharidok lebontása folyik. Ezt
a feladatot különböző mikroaerofil és fakultatív anaerob szervezetek extracelluláris enzimei végzik nagyon
hatásosan.—A második lépésben nagyobb molekulák lebontása folyik, miközben C-1 töredékek, szerves savak,
alkoholok, széndioxid és hidrogén képződik. Ezt a szakaszt a reakcióelegy savanyodása miatt acidogén fázisnak
nevezik. Az itt működő gyors növekedésű mikrobák ezt a savanyodást jól tűrik.—A harmadik lépésben a fenti
vegyületekből a szerves savak és alkoholok továbbalakulása közben főleg ecetsav képződik. Acetogén fázisnek
nevezik ezt a szakaszt (Acetil-S-CoA), mert mikrobiális úton ecetsav képződhet közvetlenül széndioxidból és
hidrogénből is.— A befejező szakasz a metánképződés, amely molekulánként legalább egy ATP képződésével jár.
Ebben a fázisban az ecetsav, valamint a C-1 töredékek: metanol, formaldehid, formiát, metilamin szolgáltatják az
alapanyagot a metánképződéshez, de a jelenlevő széndioxid és hidrogén is metánná alakul. Innen származik a
metanogén fázis elnevezés.
A négy szakasz természetes körülmények között térbelileg nem különül el, ezért a metánképződés sohasem
éri el a célüzemekben, illetve laboratóriumokban megvalósítható teljesítményt. Itt ugyanis a négy szakaszt térben
elkülönítve, két reaktorban folytatják le, ami az optimális rekciókörülmények biztosítását lehetővé teszi. Az
ősbaktériumok és az eubaktériumok biokémiai és élettani különbségeit ismerve nem csodálkozhatunk azon, hogy az
anaerob szennyvíztisztítás technológiájának kialakításakor a két szakasz térbeli szétválasztására törekedtek. Ezzel a
lebontandó szerves anyag összetételétől többé-kevésbbé függetlenné vált a metánképződés. A rendszert tovább
fejlesztve a lassan szaporodó metanogének porózus üveggyűrűre rögzítésével olyan sejttömeget lehet a biogázt
termelő reaktorban felhalmozni, amely a térfogategységre vonatkoztatott aktivitást a gazdaságosság szintjére emeli.
A képződő metán a rendszer működtetéséhez szükséges energiaigényt bőven fedezi.
Az első reaktorban egymás tevékenységét segítő mikroaerofil, fakultatív anaerob és szigorúan anaerob
baktériumk konzorciuma működik. Ezek széles pH tartományban képesek osztódni, mégpedig a baktériumokra
jellemző 30 perces generációs idővel. Zömmel mezofilek, optimális hőmérsékletük 35
o
C. A jelenlevő oxigéntűrő
szervezetek rövid idő alatt felhasználják a kezdetben jelenlevő oxigén nyomait is. Az első reaktor konzorciuma a
nagy molekulák (polimerek) hidrolízisét, szerves savak, alkoholok akár C-1 töredékekig való lebomlását, széndioxid
és hidrogén képződését teszi lehetővé. Ezzel előkészítik a fermentációs körülményeket az acetogén és metanogén
fázis számára. A hidrogén az anaerob, illetve fakultatív anaerob szervezetekben folyó fermentáció végtermékeként
jelenik meg. Fontos szerepet kap a bélbaktériumokban működő hangyasav dehidrogenáz és a piruvát-formiát liáz

H
3
C-CO-COOH + CoA-SH —> acetil-S-CoA + HCOOH
HCOOH —> H
2
+ CO
2

A Clostridium-okban a foszforoklasztikus reakciót segíti a ferredoxin hidrogenáz

ferredoxin-hidrogenáz
piruvát + szervetlen-foszfát ———————————> acetilfoszfát + H
2
+ CO
2


red
ferredoxin
ox

225
A Clostridiumon kívül hidrogént termelnek még többek között az Eubacterium, a Peptococcus és az Aerobacter
fajok. Az itt tevékenykedő mikroorganizmusok gyorsan szaporodva hatásosan képesek alkalmazkodni a
szubsztrátum minőségében bekövetkező változáshoz. Ezt az alkalmazkodóképességet a technológiai paraméterek
szabályozásával segíteni lehet. Nyilvánvaló, hogy a szennyvíz kémiai összetételének állandó volta nagy mértékben
képes fokozni a rendszer működésének biztonságát és gazdaságosságát. Ezért ezeket a szennyező anyagra opti-
malizált technológia szerint működő reaktorokat közvetlenül a szennyvizet termelő üzem mellé telepítik, és ezzel a
kommunális szennyvíztisztító berendezéseket tehermentesítik.

A vázlatrajzon követhetően az Uhde/Schwarting anaerob szennyvíztisztító eljárás egy fakultatív anaerob
mikroorganizmusok hatásos savanyító tevékenységét biztosító BO1 jelű fermentorban bontja le a szennyvíz
szervesanyagtartalmát. A fermentlé hőmérsékletét 35 °C-on tartja a beépített WTO1 hőcserélő, amelynek
hatásfokát a TIC szabályzó ellenőrzése alatt működő VO2 szelep befolyásolja. Az optimális pH (4,5-5,5)
beállítását az LI szabályzó végzi. A szennyvíz betáplálása a PO1 szivattyú feladata. A fermentlé a VO1 szelep
állásától függő ütembe kerül át az obligát anaerob ősbaktériumokat foglalkoztató BO2 fermentorba, amelynek
optimális hőmérsékletét (55 °C) a VO3 szelep által ellenőrzött WTO3 hőcserélő állítja. A második reaktorban az
ősbaktériumok az előbbiből származó elegyet ecetsavvá, végül pedig metánná és széndioxiddá alakítják. Az acetogén
és a metanogén funkciót végző szigorúan anaerob, termofil baktériumok közössége különleges tulajdonságú, lassú
növekedésű fajokból áll össze. A generációs idő harminc órától harminc napig változhat, amit az itt működő
(Archaeobacteria) baktériumfajok biológiai tulajdonságai határoznak meg. Legismertebb rendszertani csoportként a
Methanobacteriales rend említhető. A rendszer optimalizálásával és egy kisméretű aerob utóreaktor működtetésével,
a tisztított szennyvíz az üzemen belül újra felhasználhatóvá válik. A tisztítás hatásfokának látványos bizonyítékaként
Japánban aranyhalakat tenyésztenek a tisztított szennyvízben. A két fermentor között szűkség esetén a PO2
szivattyú teremt kapcsolatot, amely a perforált lemezzel szétválasztott BO3 fermentorból nyert sejtmentes lével
képes higítani a BO1 fermentor tartalmát. A BO2 fermentorban képződő tisztított szennyvíz a WTO2 hőcserélőn
keresztül hagyja el a rendszert, amely a BO1-ből a BO2 fermentorba átfolyó fermentlevet előmelegíti. Mindkét
fermentorból a komposztálásra kerülő leülepedő mikroorganizmusokat egy-egy csavarszivattyú távolítja el. A
fermentorokban képződő biogáz metántartalma gázmotor működtetésével megtermeli a rendszer működtetéséhez
szűkséges elektromos energiát. Mindkét fermentorból a kiülepedő, komposztálandó mikroorganizmusokat egy-
egy csavarszivattyú távolítja el.
A tápanyagokként hasznosuló nitrogéntartalmú vegyületek lebontása - a sejt anyagainak felépítéséhez
szükséges szerves nitrogénigényen felül - jelentős ammóniaképződéssel jár. Ezért a biogázban a lebontandó szerves
anyag összetételétől függően mindig találunk több-kevesebb ammóniát. Ammóniában dús szennyvíz tisztítása erre a
célra kialakított nirtrifikációt és denitrifikációt végző sorba kapcsolt egységek működtetését igényli.
A nitrifikáció során aerob körülmények között a Nitrosomonas törzsek az ammóniát nitritig, a Nitrobacter
nemzetség pedig nitrátig oxidálja.
NH
4
+
+ 1,5 O
2
2 H
+
+ H
2
O + NO
2

AH = –301-től –352 kJ
NO
2
-
+ 0,5 O
2
NO
3

AH = –65 –től – 88 kJ
226
Anaerob körülmények között a két faj asszociátuma egymást segítve a nitrátlégzés terhére végzi az ammónia
oxidációját
5 NH
3
+ 3 NO
3

4 N
2
+9 H
2
O + 2 H
+
AG° = –1483 kJ


A denitrifikáció szigorúan anaerob körülményeket igényeL. Elektronforrásként a szennyvíz dehidrogénezhető
szénforrása szolgál. A folyamatábrán metanol szerepel oxidálható szubsztrátumként

NO
3

+ 6H
+
+ 5 e

0,5N
2
+ 3 H
2
O NO
3

+ 0,33 CH
3
OH NO
2

+ 0,67H
2
O
NO
2

+ 0,5 CH
3
OH 0,5 N
2
+ 0,5 CO
2
+ 0,5 H
2
O + OH

némi lugosodással.

A denitrifikáló egységben Thiobacillus denitrificans, Micrococcus denitrificans, Pseudomonas, Serratia,
Achromobacter nemzetség elektron akceptorként nitrátot használó törzsei végzik.

2 NO
3
> 4 e
-
> 2 NO
2
> 4 e
-
> 2 NO > 2 e
-
> N
2
O > 2 e
-
> N
2

Az anaerob folyamat közben jelentős energia szabadul fel, amely a műveletet végző szervezetek számára a
szénforrás gazdaságos hasznosítását jelenti.


A nitrifikáló egységekben a levegőztetés hatékonyságát toronyreaktorok kifejlesztésével és megfelelő
levegőztető fúvókák alkalmazásával lehet fokozni. A levegőztetett reaktor általában 15-20 méteres toronyként
magasodik a felszín fölé, de gyakran süllyesztik a felszín alá. A Ilyen berendezésben a finom eloszlásban
bejuttatott levegő oxigéntartalmának 70-80 %-a a légbuborék úthosszával arányosan felhasználásra kerül A
levegőztetett reaktor után elhelyezett ülepítőből távozik a kezelt szennyvíz. A kiülepedett aktív biomassza egy
része a levegőztetett reaktorba visszatáplálva növeli annak a teljesítményét. Az ülepítő hatásfokát mechanikai
úton (végtelenített szalaggal) lehet javítani.
A tápközeg kéntartalma is redukált formában van jelen a reakciótérben. A sejttömeg kifejlődéséhez
szükséges mennyiségen felül a kénhidrogén egyrészt a gázfázisban a biogáztelepek jól ismert illataként
jelentkezik, másrészt a jelenlevő fémekkel reagálva fémszulfidok alakjában kicsapódik, ami a szennyvíziszap
(zagy) fekete színét okozza. A kénhidrogén toxikus hatása zavarhatja a rendszer működését, amit mésztej
adagolásával lehet kivédeni

Ammóniában gazdag szennyvíz denirifikálását végzõ eljárás folyamatábrája

nitrifikáló egységek vázlatrajzai

227
Megoldandó kérdés még, mi történjék a feleslegben képződő sejttömeggel? Az első reaktor
eubaktérium sejtjei - inaktiválás után - állattápszerként jól hasznosíthatók. A második reaktor baktériumtömege
azonban zömmel az ősbaktériumok csoportját képviseli. A bennük nagy mennyiségben előforduló fitanil-éter
származékok miatt inkább talajerő pótlóként célszerű hasznosítani. Ez a vegyületcsoport ugyanis a talaj
mikrobaközössége számára jól használható, a magasabb rendűek viszont szerény enzimkészletükkel nem
képesek hasznosítani.
A városi (kommunális) szennyvíz korszerű tisztítására példaként szerepeltethető a FARE segélyből
Debrecenben épített tisztítómű, amely a város teljes szennyvíz mennyiségének (50000 m
3
/nap) tisztítását a
szigorú EU szabványnak megfelelően végzi. A kialakított rendszer a levegőztetett aerob és fakultatív anaerob
tisztítási műveletet, valamint a metanogéneket foglalkoztató szigorúan anaerob reaktorok tevékenységét
egységes rendszerben önfenntartó módon működteti.

A Debrecenben megépített szennyvíztisztító vázlatos rajza


A szennyvíztisztító mikroflórája és faunája változatos.
Az ősbaktériumok és az eubaktériumok mellett
egysejtűek, gombák és algák konzorciumának
tekinthetők. Az aerob körülmények között szaporodó
szervezetek nagyobb hányada elpusztulva az anaerob
szakasz tápanyagforrásaként hasznosul. A képződött
metán gázmotorokkal működő áramfejlesztői a
centrifugák, a légkompresszorok, a rendszert mozgató
átemelő szivattyúk, és szárító berendezések energia
igényét bőven fedezi. A vázlatrajzon látható, hogy az
anaerob fázis után a tisztított szennyvízzel a városból
bejutó szennyet optimális értékre hígítják. A tisztított lé
csak a levegőztető medence után található utóülepítőn
keresztül hagyhatja el a telepet.A biogázt termelő
reaktor térfogatra számított teljesítménye jelentősen
növelhető, ha a mikroszervezetek konzorciuma porózus
üvegágyra .(Siran; Schott, Mainz) telepedve fejtik ki
metanogén aktivitásukat. A térfogategységben levő aktív
baktérium tömeg mennyisége egy nagyságrenddel
növelhető. A tisztítóműben képződő mikroorganizmusok az anaerob szakasz után elhelyezett
iszapvíztelenítő berendezésen keresztül kerülnek komposztálásra.
Az actinomycesek közé sorolt mikroszervezetek pótolhatatlan szerepet játszanak a komposztálás
folyamatában a növényi poliszacharidok ( cellulóz, hemicellulóz, lignocellulóz) lebontásával. A növényi

porozus Siran üvegfelületen fejlõdõ
Methanobacterium és Methanosarcina tenyészet
228
lignocellulóz felépítettségéből következően nehezen lebontható. A szorosan kötegekbe rendezett cellulóz láncokhoz
rövidebb hemicellulóz egységek tapadnak. Ehhez kapcsolódnak extenzinek közvetítésével a savas karakterű pektin
láncok. Az egész képződményt a lignin (fenilpropán egységekből álló polimer) szilárdítja az egyes
növénycsoportokra jellemző lignocellulózzá.
Lignocellulózt bontó mikroszervezetek természetes élőhelyükről különleges dúsító eljárással izolálhatók.
Ilyen dúsító táptalaj összetétele lehet 100 ml desztillált vízben oldva 0.1 g NaNO
3
; 0.1g K
2
HPO
4
; 0.03g KCl; 0.05g
MgSO
4
.7H
2
O; 0.05 g élesztőkivonat; 0.05g pepton; 1 g Macherey Nagel 300-as kristályos cellulózpor; 2 g agar-agar
A mikroelem igény kiegészítése céljából 0.1 ml baktérium mentesre szűrt nyomelem oldat adagolása (1000 ml
desztillált vízben oldva 100mg MnCl
2
.4H
2
O; 100mg CoCl
2
; 10mg CuSO
4
; 10mg Na
2
MoO
4
.2H
2
O; 20mg ZnCl
2
;
5mg LiCl; 5mg SnCl
2
.2H
2
O; 10mg H
3
BO
3
; 20mg KBr; 20 mg EGTA, 8mg NaFe
3+
-trihidrát) szükséges. Ha a
tenyésztést 44–60°C tartományban végezzük, akkor a cellulózt hasznosító törzsek kiemelésére van lehetőség. A 8-10
nap után izolálható telepek közül hatásos törzsek izolálhatók. Ezek tisztasága többszöri hígítás után karboximetil-
cellulózt tartalmazó táptalajra szélesztve igazolható. A telep körül képződő kráter a CMC bontó aktivitásról tudósít.

Gyakorlati példaként vizsgáljuk meg a Lehrter Zucker AG (D-3160 Lehrte) szenny-víztisztító rendszerének
a működési adatait. Ez az üzem naponta 2000 m
3
szennyvizet termel amely átlagban 7000 mg/l (BOI) biológiailag
oxidálható szerves anyagot tartalmaz. A nagy szervesanyagtartalmú szennyvízet (1) két hőcserélőn (2) átvezetve a
metántermeklő szakasz
optimális hőmérsékletére
melegítik fel részben az
üzemből származó ipari
vizzel (3), illetve a
bepárlóból származó (4)
kondenzátummal. A
vasbetonból készült 3 kamrás
összesen több mint 5000 m
3

hasznos térfogatú anaerob
reaktor (5) némi
denitrifikáció mellett naponta
7500 m
3
gázt termel (80%
metán tartalommal),
miközben az oxidálható
szerves-anyag tartalom 1500
BOI-értékre csökken. A
nitrtifikációt is végző aerob
szakasz (11) céljára szolgáló,
3500 m
3
térfogatú, levegő-
ztetett reaktorban 1000
m
3
/óra levegő átfúvásával a
tisztított szennyvíz
oxidálható szervesanyag
tartalmát 80-100 BOI-
egységre csökkentik. Az
aerob szakasz után egy végső denitrifikáló térben (10) találkozik az anaerob köztesülepítőből származó előtisztított
szennyvíz és az utóülepítőből származó (8) eleveniszap, valamint a nyerscukor sűrítőből származó, a hőcserélőn
átvezetett még meleg kondenzátum (4). A metánt fermentáló reaktorban a biomassza leülepedését a gáztartályból
visszavezetett biogázzal (16) akadályozzák meg. A metánreaktorból egy köztes gázmentesítő kamrán (6) átvezetve
kerül a részben tisztított szennyvíz a köztes ülepítőbe (7). Az itt felgyűlő eleven iszap nagy része (8) visszakerül a
metántermelő (5) reaktorba. A fölösleg (9) szárításra kerül. Az anaerob fázisban képződő biogáz egy részét a
gáztartály (15) gyűjti, a gáz nagyobbik hányada (18) teljes mértékben fedezi a 850 m
3
térfogatú utótisztítóban (13)
felhalmozódó, illetve a köztes ülepítőből származó mikroszervezetek (9) szárításához szükséges energiát. A biogáz
rendszert az elmaradhatatlan biztonsági fáklya (17) zárja. A tisztított szennyvíz, mely a kiindulási szerves anyag
tartalom alig két százalékát tartalmazza az utóülepítőből kerül (14) a környezetbe. (D betü jelzi a rendszer azon
szakaszait ahol denitrifikációt igénylő szennyezés még előfordul.)







Folyamatábra a répacukorgyárból származó denitrifikálandó szennyvíz
tisztítására
229
Mit nevezünk antibiotikumnak?
Mi az antibiotikumok szerepe? Miért képződnek?

Az azetidinon antibiotikum miért képződik az idio fázisban,
és miért nem a növekedési fázisban?
Mi a hasonlóság, ill. a különbség az ACV tripeptid és a glutation között?

Milyen penicillin építőelemek képződéséhez szükséges a NADPH ?
A cephalosporin-C bioszintézist katalizáló enzimek felsorolása
Milyen módszert ismer a 6-aminopenicillansav előállítására?
Milyen Gram

baktérium növekedését gátló penicillin származékot ismer?

Mit tud a penicillin hatásmódjáról?
A penicillin rezisztencia megjelenése, hogyan sikerült a rezisztencia leküzdése?
Mit tud a vancomycin hatásmódjáról?
Mit tud a vancomycin rezisztencia megjelenéséről?

A peptidoglükán sejtfal képződést a periplazmikus térben katalizáló enzimek
működését hatásosan befolyásoló hatóanyagok:
UDP-glükózamint hasznosító glükozidáz működését gátló ramoplanin
transzglikozidázt gátló moenomycin
transzpeptidázt gátló azetidinon származékok
izoprenil-PP foszfatázt gátló bacitracin
Milyen kötést hidrolizál a lizozim?
Milyen kötést hidrolizál a penicillináz, (ß-laktamáz)?
Milyen kötést hidrolizál a penicillin-amidáz, (penicillin-aciláz)?

Hogyan befolyásolja a baktérium szaporodást a ciklo-szerinamid (cikloszerin)?
Hogyan befolyásolja a baktérium szaporodást a foszfonomycin?

Milyen perorálisan alkalmazható penicillin származékot ismer?
7-amino-dezacetoxi-cephemsav származék előállításának lehetősége?

A penicillin előállítás szolgáló eljárás vázlata:[fermentációs lépés és kinyerés]
Miért előnyös szénforrás a Penicillium chrysogenum esetében a tejcukor?
Miért előnyös szénforrás az Acremonium chrysogenum esetében a növényolaj?
Miért előnyös nitrogénforrás a kukoricalekvár (cornsteepliquor)?
Miért előnyös a termelő (idio) fázisban az ammoniumszulfát
A prekurzor használatának jelentősége?
230
Iparimik
„Il n y a pas des sciences appliquées…Mais il y a des applications de la sciences.”
Luis Pasteur (1822-95)Strasbourg kémia tanár (dl borkősav 1842)
1857 tejsav fermentáció
1864 pasztörözés
1865 selyemhernyóvész
1866 bortermelés
1868 ecetsavgyártás
1876 sörgyártás
1877 a lépfene leküzdhető más mikroorganizmussal Joubert, Pasteur
1880 immunológiai védelem lépfene, baromfi-kolera ellen

Fred Griffith 1929 Streptococcus pneumoniae
Smooth (virulens) Rough (szőrös) egérben Oswald Avery 1944

Kórokozó, fertőző csírák elleni küzdelem
Marcus Terentius Varro Ad 116—30
Titus Laurentius Carus Ad 96—55
Középkor: Ellenőrizhetetlen ősnemződés, titokzatos miazmák feltételezése,
Füstölés, elkülönítés, varázslás, csodatévők, csodavárók
Istencsapás ellen; közös ima, fogadalmi építmény, hála szobor,
Athanasius Kircher 1602—1680 mikróbák járványokat okozhatnak
Carolus Linnaeus 1707—1778 „Chaos‖-ba sorolt hat faj
Christian Gottfried Ehrenberg 1785—1876 (Az 1838-as Atlas-ban 600 typus)
Robert Koch 1843—1910 B. anthracis patogenitásának igazolása 1876
Paul Ehrlich 1854—1915 haematologia; immunitás; chemotherapia
„Corpora non agunt, nisi fixata‖
Hatásos vérszint kialakulása: Felszívódás
>>>>>>>>>>>
Kiválasztás, Bomlás
Hatásos dózis: ED
50 —
Toxikus dózis LD
50
MIC érték

Alexander Fleming 1929

231
Antibiotikumok kora

Zsoltárok könyve 51,4—51,9
Kinai feljegyzések Szóján növekedő penész furunkulusa ellen hatásos.
1870—Roberts: Penicillium glaucum tenyészlevében nem nő a baktérium
1896— B.Gosio: Penicillium által termelt Mycophenol gátolja a B. anthracis
növekedését
1899—R.Emmerich, O. Low: Pyocyanase gátolja az Anthrax bacillus
növekedését
1929—Alexander Fleming: Penicillium notatum gátolja a Staphylococcus
növekedését
1932—Clotterbuck: labilis pH és hőérzékeny anyag
1939—Chain, Florey: savanyú extrakció Sóképzés, liofilezés,
Oxford egység 0.6 ug Na-só gátolja 50 mL Staphylococcus növekedését
Abraham: a gyógyító hatás igazolása, enzimes inaktiválás (penicillináz?)
A. E. Oxford: Penicillium griseofulvum fungistatikumot termel
R. J. Dubos: Tyrocidin (gramicidin) Bacillus brevis tenyészlevében
1940—S. A. Waksman Actinomycin Streptomyces antibioticus
1944—S. A. Waksman Streptomycin Streptomyces griseus
1943—Wisconsin Univ. (David Perlman) kristályos termék
1945—Crowfoot & Low: kémiai szerkezet
Mit nevezünk antibiotikumnak?
Mi az antibiotikumok szerepe? Miért képződnek?

Az azetidinon antibiotikum miért képződik az idio fázisban,
és miért nem a növekedési fázisban?
Mi a hasonlóság, ill. a különbség az ACV tripeptid és a glutation között?

Milyen penicillin építőelemek képződéséhez szükséges a NADPH ?
A cephalosporin-C bioszintézist katalizáló enzimek felsorolása
Milyen módszert ismer a 6-aminopenicillansav előállítására?
Milyen Gram

baktérium növekedését gátló penicillin származékot ismer?

Mit tud a penicillin hatásmódjáról?
A penicillin rezisztencia megjelenése, hogyan sikerült a rezisztencia leküzdése?
Mit tud a vancomycin hatásmódjáról?
Mit tud a vancomycin rezisztencia megjelenéséről?

A peptidoglükán sejtfal képződést a periplazmikus térben katalizáló enzimek
működését hatásosan befolyásoló hatóanyagok:
UDP-glükózamint hasznosító glükozidáz működését gátló ramoplanin
transzglikozidázt gátló moenomycin
transzpeptidázt gátló azetidinon származékok
232
izoprenil-PP foszfatázt gátló bacitracin
Milyen kötést hidrolizál a lizozim?
Milyen kötést hidrolizál a penicillináz, (ß-laktamáz)?
Milyen kötést hidrolizál a penicillin-amidáz, (penicillin-aciláz)?

Hogyan befolyásolja a baktérium szaporodást a ciklo-szerinamid (cikloszerin)?
Hogyan befolyásolja a baktérium szaporodást a foszfonomycin?

Milyen perorálisan alkalmazható penicillin származékot ismer?
7-amino-dezacetoxi-cephemsav származék előállításának lehetősége?

A penicillin előállítás szolgáló eljárás vázlata:[fermentációs lépés és kinyerés]
Miért előnyös szénforrás a Penicillium chrysogenum esetében a tejcukor?
Miért előnyös szénforrás az Acremonium chrysogenum esetében a növényolaj?
Miért előnyös nitrogénforrás a kukoricalekvár (cornsteepliquor)?
Miért előnyös a termelő (idio) fázisban az ammoniumszulfát
A prekurzor használatának jelentősége?

The laws of applied microbiology
The microorganism is always right The microorganism is your friend The microorganism is a sensitiv partner There are no stupid microorganisms Microorganisms can do anything Microorganisms are smarter, wiser and more energetic than chemists, engineers and biologists If you take care of your microbial friends, they will take care of your future

David Perlman 1960

2

KÜZDELEM A MIKROBIÁLIS KÓROKOZÓK ELLEN Ipari Mikrobiológia III.Szekunder metabolitok előállítása
Tartalom:
4. A KEMOTERÁPIA TUDATOS ALKALMAZÁSA 9. AZ ANTIBIOTIKUMOK (SZEKUNDER METABOLITOK) BIOLÓGIAI-KÉMIÁJA 11. AZ ANTIBIOTIKUM KÉPZŐDÉS LEHETŐSÉGE ÉS FELTÉTELEI 14. FARMAKOLÓGIAILAG HATÁSOS ANYAGOK 16. A PENICILLIN KÉMIAI SZERKEZETE ÉS BOMLÁSI FOLYAMATAI 18. AZETIDINON SZERKEZETŰ VEGYÜLETEK HATÁSMÓDJA. 21. A PENICILLINÁZ 22. AZETIDINON SZERKEZETÚ VEGYÜLETEK ELŐÁLLÍTÁSA, TÖRZSFEJLESZTÉS 25. ß-LAKTÁM SZERKEZETŰ ANTIBIOTIKUMOK FELSZAPORODÁSA A TENYÉSZETBEN 28. PENICILLIN GYÁRTÁS 31. ÚJABB -LAKTÁM SZERKEZETŰ BIOLÓGIAILAG AKTÍV METABOLITOK FELFEDEZÉSE 33. A -LAKTÁM SZERKEZETŰ VEGYÜLETEK, A PENICILLIN BIOSZINTÉZISE 41 Gyűrű tágítás Ring expandáz (REX) Cephem váz képződés 47. A PENICILLIN KÉMIAI SZINTÉZISE. 48. PENICILLIN ANALÓGOK ELŐÁLLÍTÁSA FÉLSZINTÉZISSEL 55. PENICILLIN ÉRZÉKENYSÉG KIALAKULÁSA, ALLERGIÁS TÜNETEK. 56. GLYCOPEPTID antibiotikumok: VANCOMYCIN, TEICOPLANIN 57. D-CIKLOSZERIN 59. FOSZFONOMYCIN 60. PEPTID JELLEGŰ ANTIBIOTIKUMOK (DEPSZIPEPTIDEK) 61. GRAMICIDIN-S 63. BACITRACIN 66. VIRGINIAMYCIN 68. NISIN 69. BLEOMYCIN 71. ACTINOMYCIN-D 74. CYCLOSPORIN-A; IMMUNSZUPRESSZÍV ANYAG HATÁSMÓDJA 82. NOVOBIOCIN 83. ANSA-LÁNCÚ ANTIBIOTIKUMOK CSOPORTJA 86. RIBOSZÓMÁLIS FEHÉRJESZINTÉZIST GÁTLÓ METABOLITOK 86. Chloramphenicol 88. Aminoglikozid antibiotikumok 102. Makrolid antibiotikumok 105. Thiostrepton 106. POLIKETID KÖZTESTERMÉKBŐL KÉPZŐDŐ METABOLITOK CSOPORTJA 108. Tetraciklin tipusú antibiotikumok 114. Koleszterinszint csökkentő farmakonok; sztatinok 117. Poliéterkarbonsav szerkezetű antibiotikumok 118. Fungisztatikumok Poliének, Actidion 122.FUMAGILLIN 123.FUSIDINSAV 125.RÁKOS MEGBETEGEDÉSEK ELLEN HATÁSOS ANTIBIOTIKUMOK CSOPORTJA 129.ÚJ ANTIBIOTIKUM ELŐÁLLÍTÁS (KUTATÁS) MŰVELETEI 132 Primer metabolitok előállítására szolgáló eljárások Citromsav előállítása 144.Glutamin sav előállítása 150.Esszenciális aminosavak előállítása 161.Arómás aminosavak előállítása 170.Aspartam 173.Laktobacillusok hasznosítása 174.Clostridiumok 177. Alkoholos erjesztés 192. Ecetsavgyártás 197.Cianocobalamin B12 205.Glükonsav előállítás

3

A KEMOTERÁPIA TUDATOS ALKALMAZÁSA
A kemoterápiai kutatások elméletének kialakítása és az első gyakorlati eredmények elérése Paul Ehrlich nevéhez kötődik (1854-1915). Munkatársaival fáradhatatlanul és tudatosan kereste azokat a vegyületeket, amelyek a mikroszervezetek szaporodását olyan koncentrációban gátolják, amelyet még a gazdaszervezet károsodás nélkül elvisel. Felismerte a hatóanyag és a hatáshely közötti fizikai, illetve kémiai kapcsolat szükségességét. Corpora non agunt nisi fixata - A testek nem hatnak, hacsak nem kötődnek. Iskolát teremtve kialakította a gyakorlati gyógyszerkutatás módszertanát, technikáját. A sikereken felbuzdulva a gyógyszerészeti kutatás művelői úgy vélték, hogy kellő ötletgazdagsággal végzett kísérleti munkával megtalálhatók azok a kémiai szintézissel előállítható vegyületek, amelyekkel az élő szervezetet fertőző kórokozók leküzdhetőkké válnak. Kísérleti módszerük szerint a kórokozóval fertőzött állatokba juttatták a hatásosnak vélt vegyület különböző mennyiségét, meghatározva a túlélés százalékát. Egészséges állatokba juttatott hatóanyaggal pedig vizsgálták a vegyület toxicitását. Az eredmények mérhetősége, számszerűsítése a biológiában bevezetett 50%-os hatás meghatározását jelenti. Ez a technika reprodukálható módszerként lehetőséget ad a hatásos (effektív) dózis (ED50) és a gyilkos (letális) dózis (LD 50) meghatározására, amely adott időn belül a fertőzött állatok 50%-ának túlélését, illetve az egészséges állatok 50%-ának pusztulását okozza.

A kísérleti eredményeket mutató ábra a testsúly kilogrammra vonatkozó hatóanyag mennyiségének az állatok pusztulási görbéjére kifejtett hatását mutatja. A statisztikailag értékelhető számban felhasznált kísérleti állatot olyan mértékben fertőzték, hogy belátható időn belül közel azonos időpontban elpusztuljanak. Ennek érdekében azonos érzékenységű, azonos korú, azonos tömegű állatok kerülnek felhasználásra. Gyógyászati alkalmazásra az a vegyület számíthat, amelynek az ED50 és az LD50 értéke közötti érték (távolság) jelentős. A hatásos anyag bevitele történhet a tápcsatornán keresztül (per os) a gyomorban és a vékonybélben, illetve a véráramba juttatva vénába, (i.v.) vagy izomba (i.m.), illetve bőr alá (sub cutan) adva. Felszívódhat az anyag a nyálkahártyán keresztül. Ez esetben elkerüli a máj méregtelenítő hatását.

A szervezetbe juttatott anyag a bevitel sebessége és a kiürülés , illetve bomlás függvényében kialakít egy vérszintet amitől a hatás várható. A vese áteresztőképessége és a máj méregtelenítő hatása egyedi illetve faji variációt mutat. Ezért az aktuális vérszint meghatározása feltétlenül indokolt

4

Az antibiotikum kezelés esetén a terápiás vérszint elérésére törekedve a meghatározó paraméterek figyelembe vételével a terápiás hatáshoz szükséges küszöbérték felett kell tartani a hatóanyag koncentrációját. vagy pedig olyan származékot használva amelynek kémiai stabilitása akár egy napon keresztül is képes a terápiás szintet biztosítani (lásd például az oxitetraciklin és vibramicin használatát) Nemcsak tudománytörténeti. lues) gyógyítására sikerült gyógyszert találni. Naponta többször adagolva. A kevéssé toxikus készítmény csak in vivo mutat biológiai aktivitást. a piroszőlő savból induló acetil-CoA szintézishez szükséges liponsavval reagál. Treponema pallidum okozta vérbaj (syphilis. A gazdaszervezetben végbemenő oxidációval felszabaduló biológiailag aktív aromás arzén származék. Az Ehrlich-O. Hata 606 jelzésű. Az Ehrlich által vezetett kutatócsoportnak (1909-ben Nobeldíj) az akkor népbetegségnek tekinthető igen súlyos következményekkel járó. később Salvarsan néven forgalomba került vegyületük aromás arzénszármazék. de szakmai szempontból is tanulságos röviden megismerkedni a kemoterápiai kutatás jelentősebb eredményeivel. 5 . A liponsav hiánya az egész ciklust blokkolva akadályozza a Treponema életműködését- Liponsav felesleggel egyébként a gátló hatás felfüggeszthető.

5-trimetoxi-benzil)-pirimidin előállítása és biológiai hatásának a felismerése. Proteus. sőt néhány Rickettsia szaporodását is gátolja (Trachoma. A gazdaszervezetben alakul olyan hatásos vegyületté (p-aminobenzol-szulfonamid).4-diamino-5(3. Az antibiotikumok elterjedése előtt a bakteriális fertőzés elleni küzdelem egyetlen. Aerobacter fajokkal szemben. a vérminták hatóanyagtartalmát analitikai méréssel vizsgálják. A másik csoportot alkotják a vízben jól oldódó. de igen hatásos fegyvereként tartották számon. bélből felszívódó.A kemoterápiás kutatás jelentős eredménye volt a harmincas években a szulfonamidok felfedezése. A Mietzsch és Klarer által szintetizált prontosil biológiai hatását Domagk 1935-ben írta le. Ilyen készítmény a sumetrolim. A szulfonamidok bakterium spektruma meglehetősen széles. A klinikai gyakorlatban 20-25 szulfonamid készítményt használnak. A hazai gyógyszerpiacon a vegyület metiltiazol származéka ultraseptyl néven terjedt el. Pseudomonas. 6 . Toxoplasma és Coccidium fajok. Lymphogranuloma psittacosis. nyújtott hatású készítmények. Ezek lassú kiürülésük miatt viszonylag tartósan hatásos vérszintet biztosítanak még napi egyszeri per os adagolás esetén is. a dihidropteridinnel. másrészt acilezett formában vagy glükuronidként történhet. a fólsav szintézis gátlásán keresztül zavart okoz a kórokozó anyagcseréjében. A szulfonamidok vérszintjének alakulását. A képződő p-amino-benzolszulfonamid.4-diamino-5(p-klórfenil)-6-etilpirimidin. Ilyen a több hazai szulfonamid készítményben alkalmazásra került 3-szulfa-5metil-izoxazol származék. a 2. de gyakoribb oka a rezisztenciának a permeabilitási körülmények változása. Gram-pozitív és Gram-negatív mikroorganizmusokon kívül az Actinomyces. Klebsiella. prontosil Jó példa erre a trimetoprim. amely a Streptococcus okozta fertőzések gyors leküzdésére sikerrel használható. A metabolitok természetesen a kiürülés szempontjából előnyösebb helyzetben vannak. A képződő származék dihidropteridin-hiányt okozva végül is fólsav hiányt eredményez. Mindkét pirimidin származék a szulfonamidokkal együtt adva azok hatását jelentősen fokozza (potencirozza). Gyenge hatású viszont az Escherichia. Az egyik csoportot alkotják a bélből nehezen felszívódó származékok. Brucella. az emlős sejtet nem károsítja. Hasonló hatású rokon vegyület a pyrimetamin. reagál a dihidrofólsav egyik alkotórészével. Általában szulfonamidokkal kombinálva alkalmazzák. Ez a vegyület in vitro ugyancsak inaktív. mint p-amino-benzoesav (PAB) analóg.4. A szulfonamidokkal szemben is kialakulhat rezisztencia egyrészt a p-amino-benzoesav szintézis fokozódása útján. valamint a Plasmodium malariae ellen is felhasználhatók. amelyeket bélfertőtlenítésre használnak. Kiürülésük a vesén keresztül egyrészt változatlan alakban. A forgalomba kerülő gyógyszerek hatásmechanizmusának részletes biokémiai vizsgálata. és a céltudatos kemoterápiai kutatás szép eredményeket hozott. Ílyen a hazai piacon elterjedt sulfaguanidin. a 2. Ezek két csoportba sorolhatók. Az emlős szervezetben ez az enzimreakció nem fordul elő. A szulfonamid csak a baktériumok anyagcseréjében okoz zavart. Lymphocyticus choriomeningitis). Ezért nem előnyös alacsony dózisban adagolni a szulfonamid készítményeket.

így nem meglepő.5). Az egyik az 1946-ban felfedezett p-amino-szalicilsav (PAS) mint PAB analóg. A másik pedig az 1951-ben felfedezett baktericid tulajdonságú izonikotinsav-hidrazid (INH). amely tabletta és injekciós formában adagolható. amelynek szerkezete hasonlít a piridoxaminhoz.4-dihidro-3-kinolinkarbonsav moltömege: 465. szívbelhártya és agyhártya gyulladás esetén is hatásos. Hasonló hatású a nalidix-sav. Pefloxacin Nalidix sav 7 . Széles spektrumú kinolon származékok közül emlitésre érdemes a vízben jól oldódó pefloxacin (1-etil-6-fluoro7-/4-metil-1-piperazinil/4-oxo-1. Ez az enzim nem csak a baktériumokban. de az emlős szervezetben is fontos szerepet tölt be. illetve a nikotinsavamidhoz. A hatóanyagnak a szervekben illetve a szövetekben kialakuló koncentrációját a következő oldalon található ábra szemlélteti. A dihidrofólsav reduktázt gátolva megakadályozza a tetrahidrofólsav képződését. Szepszis. Mindkettő a tuberkulózis elleni küzdelemben került felhasználásra.Az antibiotikum /400 mg hatóanyagot tartalmazó tabletta/ 8-10 óra alatt bekövetkező kiürülése után még néhány órán keresztül a kezelést esetleg túlélt baktériumok sem képesek növekedni. Feltételezhetően mindkét vitaminjellegű vegyület élettani hatását zavarja. A trimetoprim tehát a gazdaszervezetet is károsítja. A hatóanyag a baktericid hatást az RNS magra feltekeredett DNS fellazítását végző giráz működését gátolva fejti ki.Szerkezete bizonyos mértékig hasonlít a pteridin szerkezetéhez. hogy a szulfonamid fólsav szintézist zavaró hatását fokozni tudja a szintézist végző enzimek működésének gátlásával. Jellemző rá a posztantibiotikus hatás. Századunk közepén két kemoterápiás szer vált népszerűvé hazánkban.

A piperazinil-kinolin-karbonsav hatóanyagnak a szervekben illetve a szövetekben kialakuló koncentrációja 8 .

Az anyagi és a szellemi erőfeszítés hamarosan eredményt hozott.-én a Gyógyszerészeti Társaság tudományos űlésén számolt be az eredményekről. A munkában résztvevő kutatóhelyek száma közben 20-ra növekedett. Kezdetben négy gyógyszergyártó vállalat (Pfizer. Később (feltehetőleg szabadalmi okokból) a notatum előnév lemaradt. Ezekkel az eredményekkel indult 1941 júliusában Florey és Heatley az Egyesült Államokba a kormány anyagi támogatását kérni az eredmények továbbfejlesztéséhez. Közhasznú hazafias tevékenységgé vált a különböző helyekről származó gombatenyészetek eljuttatása a Mezőgazdasági Minisztérium által fenntartott NRRL törzsgyűjteményébe. Richards mikrobiológusokat bízta meg a téma vitelével. ez ma 1 milliárd NE ára). az US kutatói viszont a fenilecetsavat is tartalmazó kukorica áztató lé tejsavas erjesztéssel dúsított koncentrátumát alkalmazták a táptalaj nitrogén forrásaként. Az USA laboratóriumaiban előállított penicillin készítményeknek a fizikai-kémiai adatai jelentős mértékben eltértek az Angliában. N.(Az első világháborúban megsebesült katonák több mint 50%-a szepszisben halt meg!) A Pentagon a Northern Regional Research Laboratory (Peoria Illinois) fermentációs osztályán R. A tisztításban való előrehaladás a kémiai szerkezet felderítésének lehetőségét jelentette. Oxford-egységnek (NE) tekintették azt a legkisebb penicillin mennyiséget. hogy 1944 végére a havi termelés meghaladta a 200 kg-ot.doktori disszertációját a magasabb rendűek által védekező anyagként termelt lizozim tulajdonságait vizsgálva készítette. A kormányszervek felismerték a téma katonai jelentőségét. ahol szorgalmas munkával minden tenyészet biológiai aktivitását megvizsgálták. Az antibakteriális tulajdonságú hatásos anyag kinyerése céljából végzett eredménytelen kísérleti munka után. pH és hő érzékeny gyenge sav. C. biológiai egységet használtak összehasonlítási alapként. szeszgyártási maradékon előállított készítmények vizsgálatakor nyert adatoktól. Fleming valami lizozimhoz hasonló anyagra gondolt. 9 . A katonai költségvetés a háború utolsó éveiben 30 millió dollárral támogatta a program sikerét. Squibb) és több kutató laboratórium. Abban reménykedtek. Az egyik esetben G-penicillin (benzil-penicillin). Az anyag hatásossága és elhanyagolhatóan csekély toxicitása azonban nem hagyta feledésbe merülni Fleming felfedezését. hogy a kémiai szerkezet ismeretében a hatóanyag kémiai szintézisére lehetőséget találnak. A baktériumtenyészet penész hatására bekövetkező feloldódását látva. Ebből az izolátumból fejlesztették ki a gyógyszeripar fermentációs üzemeiben felhasználásra kerülő törzseket. A tenyésztő táptalaj kémiai összetételének meghatározó jelentőségét felismerve javasolták a prekurzorok alkalmazását.AZ ANTIBIOTIKUMOK (SZEKUNDER METABOLITOK) BIOLÓGIAI-KÉMIÁJA A PENICILLIN FELFEDEZÉSE A penicillint felfedező orvos . A munkába kapcsolódó Dr. Az első felhasználásra került termék mindössze 1% hatóanyagot tartalmazott. Ma már köztudott. amelyeket az angol alphabet betüivel jelöltek. D. Ez ma o. amely 1946-ban évi 32 tonnára emelkedett. Tiszta anyaggal nem rendelkezve. 1943 májusában az új gyógyszert már 300 sebesült esetében alkalmazhatták teljes sikerrel a szepszis kialakulásának akadályozására. amely egy bizonyos Staphylococcus törzs növekedését 50 ml táptalajban képes gátolni. hogy a penicillinnek elnevezett hatásos anyag labilis. Chain és Florey erőfeszítései végül eredményre vezettek. 1932-ben Clutterbuck csak annyit közölhetett. valamint a hatásos anyag hő és pH érzékenységét tapasztalva. Az Oxfordban összekovácsolódott munkacsoport kitartó munkája. bár a nehézségeket látva maga sem bízott a sikerben. hogy a különböző laboratóriumokban előállított gombatenyészetek szűrletei több mint 20 különféle penicillin keverékét tartalmazták. A katonai titoktartás szabályait betartó együttműködés a különböző kutatóhelyek között tökéletes volt.6 mg kristályos benzilpenicillin Na-sónak felel meg. Lederle. A hadügyminisztérium szakemberei ezt az életmentőnek tűnő anyagot minél előbb a szövetséges hatalmak katonakórházaiba kívánták juttatni. Fleming 1940 november 14. egy ritkán előforduló fajjal azonosítja az antibakteriális hatást mutató anyagot termelő fonalas gombát. A tápközeghez adott fenilecetsav jelenlétében a kutató laboratóriumokban főleg benzil-penicillin képződött a tenyésztési ciklus második fázisában. Merck. amellyel Abraham és munkatársai már bizonyíthatták az anyagnak a szeptikus folyamatok leküzdésében elért fantasztikusnak tűnő gyógyító hatását. Felületi tenyészetből elkülönített tenyészléből fagyasztva szárítva sikerült kielégítő stabilitású barna port nyerni. Angliában a szeszgyártás maradékát (distillers solubl) használták táptalajként. A termelő törzsek kiválasztásában az USA lakosságának a segítségét is igénybe vették. A szerkezetkutatásban l944-ben már 59 kutatóhely vett részt teljes katonai titoktartás mellett. University of Wisconsin) kapcsolódott a munkába. Thom mikológus rendszertanilag Penicillium notatum-mal. A fejlődés ütemét jól mutatja. hogy kutató munkát az zavarta.. illetve gyógyítására. a másik esetben F-penicillin (pentenil-penicillin) volt a főtermék. Coghill és A. A heti penicillin termelés 1943 végére elérte a 100 grammot (100 ezer NE penicillin akkor 20 dollárba került. Ez az enzim folytonosan termelődve az élőlény felületére került baktériumok sejtfalát feloldja.a Fleming által izoláltnál 10-szer nagyobb biológiai aktivitást mutatott. Az összegyűjtött törzsek közül egy háziasszony által beküldött grép fruitról származó Penicillium notatum chrysogenum néven leírt tenyészet . a sejtfal szénhidrát építőelemei közötti -glikozidos kötést hidrolizálja. (Carnegie Institute.Alexander Fleming . University of Minnesota. Az 1930-as évek végén csupán a tenyészet szűrletét javasolhatta külsődleges alkalmazásra.

A második világháború után a penicillin előállításával a gyógyítás történetében új korszak kezdődött. Az orvosi gyakorlatban, a fertőző betegségek elleni küzdelemben addig nem tapasztalt forradalmi fejlődést jelentett az antibiotikumok megjelenése. Széleskörű gyógyászati alkalmazásuk az átlagéletkor meghosszabbodását jelentette. A genetikailag megalapozott egyéni különbségek, az öröklött ellenálló képesség szintjében jelentkező eltérés szelekciós hatása csökkent. Addig ritkábban előforduló halált okozó megbetegedések ennek következtében előtérbe kerültek (rák, keringési problémák). A gyermekhalandóság csökkenése, a szeptikus folyamatok kialakulásának megakadályozása, a fertőző betegségek leküzdése a lakosság életkori összetételét jelentősen megváltoztatta. Nem csekély mértékben az antibiotikumok használatának terjedése is hozzájárul a Föld népességének ugrásszerű növekedéséhez. Áttételesen a társadalmi átalakulásokra is hatással van. Hagyománytiszteletből antibiotikumnak nevezzük azokat a mikro-organizmusok életműködését gátló vegyületeket, amelyeket mikroorganizmusok termelnek. E vegyületek utáni kutatás és a kiválasztott vegyületek nagyipari előállítása a gyógyszeripar legdinamikusabban fejlődő ágát teremtette meg. Az antibiózis fogalma a biológiában régóta ismert, mint a szimbiózis ellentéte. A kifejezést először Vuillemin használta 1889-ben megjelent dolgozatában. Évezredes hagyomány és gyakorlati tapasztalat a tejsavas erjedés tartósító szerepének használata. A tejsav azonban nem tekinthető antibiotikumnak, mert elsősorban a közeg hidrogén ion koncentrációjának megváltozása — a kialakított savanyú élettér — akadályozza más mikroorganizmusok elszaporodását. Időszámításunk előtt 5-600 évvel készült kínai feljegyzések említik, hogy szójababon nőtt gombák nedvével furunkulusok, gennyes fertőzések leküzdhetők. A tudománytörténet Roberts 1870-ben közzétett dolgozatát tekinti az első antibiózisra utaló híradásnak. Leírja, hogy Penicillium glaucum tenyészetében nem növekednek a baktériumok. Később Tyndall közli, hogy bizonyos zöld színanyagot termelő baktériumok más idegen mikroorganizmusok szaporodását gátolva, képesek leküzdeni azokat. Joubert és Pasteur 1877-ben bejelenti, hogy apatogén mikroorganizmusokkal le tudják küzdeni a lépfene fertőzést. Pasteur dolgozatában a jövőt sejtve megállapítja, hogy ez a jelenség nagy reményekre jogosítja a gyógyászat művelőit. A szorgalmas kutatómunka ellenére több mint 50 év telik el Alexander Fleming (1881-1955) a St. Mary kórház bakterológusának 1929-ben megjelent dolgozatáig, amelyben leírja, hogy a Staphylococcus növekedését gátolva a tenyészet lízisét okozza egy levegőből származó penész által kiválasztott ismeretlen vegyület. Ilyen jelenséget valószínűleg több klinikai laboratóriumban észleltek már ezt megelőzőleg is, sőt közlésre is került több esetben mint figyelemreméltó tapasztalat, mégsem lett belőle piacképes termék. Több szerencsés körülmény összjátéka indította el az antibiotikum ipar fejlődését. A PENICILLIN GYÓGYÁSZATI SIKERE AZ ANTIBIOTIKUMOK MEGJELENÉSE A TERÁPIÁBAN Közel tíz év telik el a penész által termelt vegyület — a penicillin — első parenterális gyógyászati alkalmazásáig. Ettől az időponttól ugrásszerű a fejlődés. Mi volt vajon a kezdeti sikertelenség oka? Nem más, mint az, hogy a kémiai tevékenység modern módszerei, a kis mennyiségű anyagok ma már megoldott tisztítási eljárásai az időben ismeretlenek voltak, illetve még gyermekcipőben jártak. Nem utolsó sorban éppen a biológiailag aktív anyagok tisztítására való törekvés volt a serkentője e mikrokémiai módszerek fejlesztésének. Ezen időszakban a kutató kapacitás jelentős részét világszerte a szép eredményekkel dicsekvő (salvarzán, prontozil stb.) kemoterápia gyógyszeripar által támogatott fejlesztése vonta el. Ezek az évtizedek az antibiotikum kutatás szempontjából is haszonnal jártak, amennyiben ebben az időszakban a kemoterápiai módszerek tökéletesedésével egy új gondolkodásmód terjedt el a fertőzéses megbetegedések leküzdése területén. Tüneti kezelés helyett a kórokozó elpusztítására törekedtek a gazdaszervezet károsítása nélkül. Az elmúlt félszázadban felfedezett hatásos vegyületek száma meghaladja a tízezret, a gyógyászati alkalmazásra került antibiotikumok száma azonban alig éri el a százat. Biológiai szempontból a rendszertani csoportokra kifejtett hatásuk szerint oszthatjuk be őket baktérium ellenes, gomba ellenes, antivirális és citosztatikus hatású anyagokra. Hatásmód szerint megkülönböztethetünk: baktérium sejtfalszintézist gátló, membránkárosító, fehérjeszintézist gátló, DNS képződést gátló, RNS szintézist akadályozó vegyületeket. Kémiai szerkezet szerint megkülönböztethetők az azetidinon ( -laktám) szerkezetű antibiotikumok, aminoglikozidok, tetraciklinek, makrolidok, ansa-láncúak, oligopeptidek, antraciklinek, poliéterek, spirolaktonok, ciklopentano-perhidrofenantrén vázúak, poliének, poliketid vázból épülők, antimetabolitok (anyagcsere köztestermékek, nukleotidok és aminosavak analógjai), poliének, stb. A kémiailag jelentős mértékben különböző vegyületek hatásmechanizmusa, de felhasználási módjuk is eltérő. Az antibiotikumokat termelő mikroorganizmusok rendszertani helye sem segít a csoportosításban. Képződésüket nem tekinthetjük faji jellegzetességnek, inkább anyagcseretípustól függő lehetőségnek. ß-laktám csoportot tartalmazó antibiotikumokat termelnek a prokariota törzsek és az eukariota tömlős gombák.

10

A ß-LAKTÁM SZERKEZETŰ ANTIBIOTIKUMOK BIOLÓGIAI-KÉMIÁJA
A penicillin molekula krisztallográfiás analízissel igazolt szerkezete 1945-ben vált ismertté Crowfoot és Low munkáiból. A benzil-penicillin, - más néven G-penicillin - D-valinból és L-ciszteinből álló penám alapvázát fenilecetsav acilezi. A tiazolidin gyűrűvel anellált négytagú, igen labilis -laktám szerkezet sav, lúg és oxigén érzékenysége jelentette a szerkezet felderítés fő nehézségét. .A három királis szénatom (vastagítva) pedig a gazdaságos totálszintézis reménytelenségét. A PENICILLIN KÉMIAI SZERKEZETE ÉS BOMLÁSI FOLYAMATAI VIZES KÖZEGBEN =R H H CH 3 : : | R-CH2-CO-NH-C----C—S—C-CH3 | | | O=C----N--------C-H : COOH
H 2O H+ R-CH2-CO-NH-CH-CHO COOH CH3 HS-C-CH3 H-C-NH2 COOH Penicillamin CO2

H2O OH-H H CH3 R-CH2-CO-NH-C----C—S—C—CH3 | | | HOOC HNC-H COOH Penicillo-sav CO2 H CH3 R-CH2-CO-NH-CH2---C—S—C-CH3 | | H-N------C-H COOH Penillo-sav

Penald-sav

R-CH2-CO-NH-CH2-CHO Penilloaldehid H+

H2O

CH3 | HOOC—CH----CH—S—C--CH3 | | | penill-sav N N----------C-H \\ / : C COOH | R—CH2

Savanyú kémiai kezeléssel a penaldsav mellett az úgynevezett penicillamin (dimetil-cisztein) különíthető el mint hidrolízis termék. Lúgos körülmények között penicillosav képződik. A penicillosav dekarboxilezésével penillosavhoz, a penaldsav dekarboxilezésével pedig penilloaldehidhez jutunk. Savanyú körülmények között egy intramolekuláris átrendeződéssel penillsav képződik. A laktám gyűrű felnyílása a biológiai hatás elvesztésével jár. A molekulában található három királis (vastagítva) szénatom azidőtájt reménytelenné tette a gazdaságos kémiai szintézist. A fejlesztési igény kielégítése elsősorban a mikológusok eredményes genetikai tevékenységétől volt várható A penicillin szerkezetének felderítése után a biológusok az acilező sav (prekurzor) változtatásával igyekeztek a G-penicillinnél előnyösebb tulajdonságú származékot nyerni. Itt azonban a bioszintézist végző Penicillium törzs enzimrendszerének specifitása behatárolta lehetőségeiket. A kipróbálásra került több mint ezer acilező sav közül alig száz esetben igazolták a prekurzor beépülését. Az előállított új származékok baktériumspektruma és penicillinázzal szembeni érzékenysége nem különbözött a gyógyszerként ma is forgalomban levő fenilecetsav származéktól, a G-penicillintől. Kiemelkedő savstabilitására való tekintettel csupán egyetlen új termék aratott sikert, a fenoxiecetsav származék, amely szabad savként a gyomorsav hatásának ellenállva tabletta formájában tartósan adagolható gyógyszerként növelte a penicillin népszerűségét.

11

A fermentlében talált, addig betüvel jelölt Gram-pozitív mikroszervezetek ellen eltérő mértékben hatásos fontosabb penicillinek kémiai szerkezete is közlésre került. Penicillin BT Penicillin O Penicillin F Flavicidin Penicillin K Dihidro-penicillin F Penicillin N Penicillin G Penicillin X penám-CO-CH2-S-CH2-CH2-CH2-CH3 penám-CO-CH2-S-CH2-CH=CH2 penám-CO-CH2-CH=CH-CH2-CH3 penám-CO-CH2-CH2-CH=CH-CH3 penám-CO-CH2-CH2-CH2-CH2-CH2-CH2-CH3 penám-CO-CH2-CH2-CH2-CH2-CH3 penám-CO-CH2-CH2-CH2-CHNH2-COOH H penám-CO-C--H H penám-CO-C-----OH H H penám-CO-C—O— H CH3 H H | : : H3C-C---S---C---C—NH2 | | | H-C-------N----C=O : COOH

Penicillin V

penám = 6-aminopenicillansav

A penicillin kémiai analitikai meghatározása is a laktám gyűrű labilitását hasznosítja. A jodometriás módszer alapja az, hogy az ép penicillin molekula nem köt jódot, a lúgos hidrolízis termék, a penicillosav viszont 7-8 atom jódot köt. Ez lehetőséget adott a penicillin jodometriás meghatározására. A hidrolízis nélkül mért aspecifikus jód kötés és a lúgos kezeléssel hidrolizált minta jódkötése közötti érték arányos a -laktám szerkezetű vegyület mennyiségével. A másik eljárás azt a tényt hasznosítja, hogy a penám váz jól reagál hidroxilaminnal. A képződő hidroxamát vaskomplexe kolorimetriás meghatározásra ad lehetőséget. H H CH3 : : | R—CO—HN--- C-------C----S-----C---CH3 Penicillin + HO-NH2. HCl | | | HO---HN----C=O HN----------C---H : COOH ÚJABB -LAKTÁM SZERKEZETŰ BIOLÓGIAILAG AKTÍV METABOLITOK FELFEDEZÉSE Hamarosan új vegyületcsoportot a carbapenemeket fedezték fel egymástól függetlenül a Merck és a Beecham kutatói, a Streptomyces fajok által termelt thienamycineket. Ez esetben a kén atom nem az anellált gyűrűben, hanem tioetanolamin származékként tioéter kötésben található. (Streptomyces clavuligerus, S olivaceus, Erwinia carotovora, Serratia sp.) .
CH3 Tienamicinek szerkezeti képlete | HO-C-H H O CH3 H H : : || | : : H—C-------C ------- CH2 HO—S—O—C------C-----C---------CH2 H H | | | || | | | | | | O=C--------N---C== C—S—CH2--CH2--NH2 O H O=C-----N---C==C--S--C=C---N---C---CH3 | | | || COOH COOH H O

12

Ugyancsak Streptomyces törzsek termelik a. Merck és az Eli Lilly kutatói által felfedezett cefamicineket. A Streptomyces clavuligerus, törzsek által termelt cefamicin származékok különlegessége a 7--metoxi csoport megjelenése és az oximetil csoport hiánya, illetve karbamoilezettsége. CH3 | NH2 H H H O H O H | | | | || | : : HOOC----C----C----C----C----C----N-----C------C-----S-----CH2 O | | | | | | | || H H H H O= C------N-----C===C---CH2--O--C---NH2 | Cephamycin szerkezete O=COH A Beecham Laboratórium kutatói által vizsgált Streptomyces clavuligerus tenyészlevében egy clavulansavnak elnevezett vegyületet izoláltak. Ez a vegyület a tiazolidin gyűrű helyett oxazolidin gyűrűt

tartalmaz. A kén helyett oxigént tartalmazó alapváz acilező aktivitása fokozott mértékű. A C 6 szubsztituens hiánya miatt antibakteriális hatást ugyan nem mutat, de a penicillináz enzimet képes inaktíválni. A -laktam bontásáért felelős -SH csoportot a felnyíló laktám gyürű acilezi. Ezt követőleg az oxazol gyürű felnyílása után a reaktív oldallánc stabil tioéter kötésbe lép az enzim másik SH csoportjával. Széles spektrumú félszintetikus penicillin származékokkal együtt adagolva penicillin rezisztens fertőzések leküzdésére használják. .A -laktám szerkezetű vegyületek sikere fokozta a kutató csoportok új hatásos anyagokat kereső tevékenységét. Azetidinon gyűrűt tartalmaznak a monolactamok. Első képviselőjüket a nocardicint Fujisava laboratóriumának a kutatói izolálták Nocardia uniformis tsuyamanensis tenyészlevéből. A molekula p-hidroxi-fenilglicinből, annak oximino származékából, ciszteinből és homo-szerinből ill. cisztathioninból épül fel.

A hetvenes évek végén végzett kutatómunka N-szulfonil azetidinon gyürűt tartalmazó Gram-negatív törzsekre ható -laktám vegyületek felfedezéséhez vezetett. Az irodalom monobaktám gyűjtőnéven tárgyalja őket, mert baktériumok (Pseudomonas acidophila, Gluconobacter, Acetobacter, Agrobacterium radiobacter) tenyészlevéből izolálták őket. A 3-amino-baktámsav alapváz savanyú természetét az N-szulfonsav csoport okozza. A -helyzetű amino-csoportot különféle savak, illetve savszármazékok acilezik. Több esetben a 3-helyzetű hidrogént metoxi csoport helyettesíti. CH3 H H H O H H

| | : O=C-------N--------C------CH2 | | O=C-------N SO3 K+

| || | : --CH2----C-----C-----N------C-----CH2 | | | NH O=C---- N | O=CCH3 SO3 K+

13

Az Agrobacterium radiobacter törzs termékében az acilező sav aromás gyűrűt tartalmaz. Ezek az utóbbi azetidinon szerkezetű antibiotikumok gyógyászati felhasználásra nem kerültek. 14 . de a megszerzett biokémiai ismeretek termékenyítőleg hatottak az új hatóanyagok előállítását célzó kutató munkában.

A legjobb mutánsok termelési értéke ma meghaladja az 50000 E/ml értéket. metil-bis-(-kloretil)amin. -sugárzás.AZETIDINON SZERKEZETÚ VEGYÜLETEK ELŐÁLLÍTÁSA — TÖRZSFEJLESZTÉS A penicillin kémiai szerkezetének felderítése után a tématerületen dolgozó kutató csoportok számára nyilvánvalóvá vált. hogy természetes élőhelyén bármely organizmus fölös mennyiségben állítson elő valamilyen számunkra hasznos terméket. Ez a primer metabolit a micéliumtömeg (réteg) alól elválasztott tenyészléből könnyen kinyerhető volt. Egyébként ez a törzs került ipari felhasználásra hazánkban is az ötvenes évek elején. A reakció elegy összetételében bekövetkező változások mérése és az adatok rögzítése alapvető jelentőségű.1 g/l értéket semleges körüli környezetben. A keverővel ellátott sterilizálható edényekben elhelyezett tenyészet oxigénellátását sterilre szűrt levegő befúvásával oldották meg. A negyvenes évek elején a fonalas gombák által termelt anyagok nagyipari előállítása közismert volt a biomérnökök előtt. Az oxigénellátást javító keverést a fonalas szerkezetű micélium tömeg növekedésével járó viszkozitásváltozás nehezítette. Különbség volt a hasznos termék koncentrációjában. A citromsav 100 g/l koncentrációban képződött savanyú körülmények között. Nyilvánvaló. penicillint alig termelő vad törzzsel szemben. 1946-ban a Wis-51-20 mutáns 1520 E termeléssel került az élre. A táblázat néhány fejlesztéssel foglalkozó laboratóriumban végzett tevékenység vázlatát mutatja megjelölve az alkalmazott klasszikusnak tekinthető genetikai eljárást. hogy ezzel a túltermeléssel terhelt mutáns a létért való küzdelemben alul marad a környezet energiaforrásait gazdaságosabban hasznosító. Az üzemek mikrobiológusainak fő feladata a magas termelőképességű oltóanyag előállítása. Műszerezettség szempontjából a belső nyomás a pH. 15 . amit habgátló anyagok adagolásával lehetett mérsékelni. Minden erejüket a biológiai eljárás technológiájának fejlesztésére fordították. Minden mikrobiális eljárás alapja a kitűzött feladat megoldására (sejt-tömeg termelés. Az eljárás kivitelezéséhez szükséges a környezettől elválasztott olyan aszeptikus körülményeket biztosító reakciótér. N-metil-N’-nitro-N-nitroso-guanidin. Nyilvánvaló volt mindenki számára. A citromsavat termelő felületi tenyészetet bakteriális fertőzés ellen jól védte a savanyú kémhatás. funkcionális kapcsolat felderítését. A törzsfejlesztéshez felhasznált mutagének (diepoxibután. Ez lényeges különbséget jelentett. A Wisconsin egyetemen előállított Q 176 jelű mutáns termelése elérte a 780 E értéket. primer vagy szekunder metabolit termelés) kiválasztott illetve genetikai munkával fejlesztett olyan baktérium vagy gomba törzs amely biokémiai tulajdonságát hosszabb időn át képes megőrizni. hogy a totálszintézis gazdaságos megoldására nem számíthatnak. etilénimin. Ezért nem kis feladat a jól termelő törzs termelőképességét meghatározó biokémiai tulajdonságok megőrzése. Egy-egy új jobban termelő mutáns fermentációs körülményeinek optimalizálása az előállítási technológia módosítását igényelte. A felületi kultúrában 200 E penicillint termelő törzs röntgen sugárral kezelt túlélői. amelyik változatlan körülmények között hosszú ideig képes termelőképességét megőrizni. Kezdetben a penicillin termelésre is ezt a technológiát alkalmazták. Az Aspergillus niger tenyészlevéből elkülöníthető citromsav nagyipari méretben folyó előállítása évtizedek óta évi több ezer tonnás tételt jelentett. a mikrobiális feladat megoldásában szerepet játszó enzimek közötti élettani. Ez nem csekély feladatot jelentett a habzás miatt. A semleges körüli pH tartományban termelődő penicillin viszont nem volt képes megvédeni a gombatenyészetet a gyakran jelentkező bakteriális eredetű fertőzésektől. Aszeptikus körülmények között a tápközeg felületén fejlődő micélium tömeg a táptalaj glükóz tartalmát 25-30%-os hatásfokkal alakította át citromsavvá. A megjelenő baktériumok a penicillint általában elbontották. enzim termelés. A magas színvonalú technológia kialakítása igényli a mikroszervezet anyagcsere rendszerének ismeretét. a penicillin viszont alig haladta meg a 0. A genetikai munkákban a szelekciós tevékenység mellett a mutagén kezelés is korán alkalmazásra került. Ennek szellemében nem várható. amilyen például a Carnegie Intézetben előállított X1612 jelű mutáns már 450E penicillin termelésére volt képes. hogy a technológiai folyamatban alkalmazható döntő áttörés nélkül a termék nem számíthat piaci sikerre. Nagyipari termelésre csak olyan mutáns alkalmas. Nyilvánvaló. etilmetánszulfonát. A gazdaságosabb anyagcseréjű egyed győzedelmeskedik. az oldott oxigén és széndioxid koncentráció beállított értéken való tartására alkalmas. A felületi tenyésztést hamarosan felváltotta a sűlyesztett körülmények között végzett eljárás. hogy ez a gomba számára haszontalan többlettermelés csak szigorúan meghatározott körülmények között valósul meg és ahhoz sem férhet kétség. UV-. X-.) hatására a törzs termelőképessége több százszorosra növekedett. amely hatékony hűtő és fűtő rendszerrel rendelkezve a sterilezés és a hőmérséklet tartás feladatát biztonsággal megoldja. Ez a mennyiség a tenyészet száraz micélium tömegének többszöröse. A két irány egymással állandó kapcsolatban levő kutató-fejlesztő munkát jelentett és jelent ma is. Az ipari alkalmazáskor kialakított technológia valójában az évmilliók alatt kialakult szabályozási mechanizmus félrevezetésével. Változtatható hatékonysággal működő keverő elemei az anyagátadást elősegítik. A fejlesztési munkákat a technológia jellegéből adódóan genetikai és technológiai tevékenységre csoportosíthatjuk. adott esetben kikapcsolásával éri el a gazdaságos termelés körülményeit. hogy a létért folytatott küzdelemben ez az improduktív tevékenység hátrányos helyzetbe juttatná a kiválasztott törzset. Természetes élőhelyén az anyagcsere szabályozott volta biztosítja a leggazdaságosabb életvitelt a mikroszervezet számára. Formalinnal és gőzzel sterilizálható helységekben elhelyezett 2x5 méteres saválló acélból készített tálcákban töltött 10-15 cm-es folyékony táptalaj felszínén növekedett a gomba micélium tömege. A természeti környezetünk kialakulásának evolúciós szemlélete szerint a rendszer fennmaradásában a természetes kiválogatódás érvényesül.

M= metil-bis(-kloretil)amin. A kísérleti eredmények a törzs specifikus termelőképességére jellemző adatokat szolgáltatnajk a sejttömeg és az idő függvényében. illetve törzsfenntartásra szolgáló szaporító felületet. NG = nitrozo-guanidin.növekedtek.Wisconsin Madison UV= ultraibolya kezelés. NG 52-1087 S F-3-64 53-174 UV-1 53-844 UV-1 54-912 52-318 S F-3 S 51-20 S 51-1113 53-533 S S 51-616 S S 52-8 UV-1 52-817 UV-1 50-1247 S 51-825 UV-1 50-529 S 50-1583 UV-1 49-2695 S 50-724 UV-1 49-482 S 49-2429 UV-1 48-1655 S 49-901 UV-1 47-1564 S 48-701 S 48-1372 UV-1 48-7865 UV-1 47-638 47-762 S 47-911 S 47-1040 S Wyeth Lab. Négy fejlesztő laboratórium törzsnemesítő tevékenysége a törzsjelzés feltüntetésével. Penicillium chrysogenum NRRL 1951 S NRRL 1951-B-25 Carnegie Institute Univ. A vizsgálandó.A legjobban termelő törzs kiválasztása egyspóra tenyészet (klon) termelőképességének meghatározásával kezdődik. Ezek az alakok sűlyesztett körülmények között 1-2 mm átmérőjű kompakt gömbszerű telepecskéket alkotnak. például köles szemeket. Eli Lilly Indianapolis West Chester Alkalmazott módszerek: S= szelekció. P-2) | V-116 | C-59-314 (P-6) | 4E-184 | 29 5E-119 | 6E-369 (P-9) 29/163 | 7E-408 | 8E-10 (P-11) | 9E-10 (P-14) Panlabs Seattle X = röntgenbesugárzás. A legjobban termelő változat biokémiai tulajdonságának stabilitását ismételt szélesztéssel és termelőképesség vizsgálattal igazolják. Rázott tenyészetben vizsgálják az izolátumokra jellemző antibiotikum képződés sebességét. NM = nitrogénmustár Az egymást követő mutagén kezelés természetesen nem csak a termelőképesség megváltozásával jár. amelyek rövid lekerekedő formában .pelletet képezve .Minnesota X X 1612 U Wis Q 176 UV-1 Wis BL 3DIO | S Peoria Illinois 47-636 S 47-1327 47-650 S 47-1380 S 47-749 NM 49-2166 NM 50-25 NM 50-935 NM 51-70 NM 51-20 U M-5 U M-30 U M-58 U M-73 DEB M-88 E-7 E-8 NG E-9 NG E-10 NG NG E-12 E-11 SA 1639 E-13 NG 16534 E-14 NG 15259 E-15 E-15-1 NG NG NG S E-5 E-6 NG E-4 NG 53-1162 E-2 E-1 X E-3 NG 53-399 S UV-1 54-1255 (AS-P-78 v. A kezdetben fonalasan növekedő micélium tömegből célszerűségi okokból azokat a jól termelő variánsokat választották ki. Univ. A kifejlett telepekről nyert spóra szuszpenzióval rázó lombikban elkészített termelő táptalajt oltanak. Ez a növekedési forma a 16 . hogy a kifejlődő telepek egymástól elkülönülve növekedjenek. mutagén kezelést túlélő higitott spóra-szuszpenziót szélesztik agar táptalajra.

Ez a rendszer a penicillináz rezisztencia magyarázata. A kémia szerkezet D-alaninhoz való hasonlósága miatt hatásmódja a penicillinéhez hasonlóan a peptidoglükán sejtfal felépülését gátolja. mert a térfogategységben megjelenő micélium tömeg mennyisége nagyobb. dezacetoxicephalosporin C szintetáz valamint a befejező lépéseket katalizáló hidroxiláz. A golyócskákból álló tenyészet jól keverhető és levegőztethető. a spórából csírázva jelennek meg laza. néha elágazó formát mutat. hogy egy Cephalosporium acremonium törzs tenyészlevében igen erős széles spektrumú antibakteriális hatás észlelhető (J. sőt a molekuláris biológiai vizsgálatok a gén prokariota eredetére utalnak Közel húsz év telik el Fleming emlékezetes bejelentése után a második -laktám típusú antibiotikum felfedezéséig. ACV tripeptid szintetáz (ACVS). Microbiol. A Cepalosporin-C hatóanyagon és a 6aminopenicillansav D--aminoadipinsavval acilezett Gram-pozitív és Gram-negatív kórokozók ellen hatásos származékán. A hattagú tiazin gyűrűvel anellált laktám gyűrű kémiai stabilitását a kvázi-delokalizált elektroneloszlás mezomer rendszere okozza. az izopenicillin epimeráz továbbá a gyűrűtágító rendszer. enyhén elágazó micéliumára. NH2 H H H O H H H | | | | || | : : HOOC----C----C----C----C----C---N----C-------C-----S-----CH2 O H H H H | | | || O=C-------N----C===C---CH2---O---C---CH3 | Cephalosporin-C szerkezeti képlete O=COH A kefém váz 7-amino csoportját D--aminoadipinsav acilezi.) Az ipari szempontból kinemesített variánsok csak a növekedés kezdetén. de ez a növekedési szakasz sem emlékeztet a vad törzs hosszú sima. Kémiai stabilitása alkalmassá teszi különböző O-acil és 7 amino-acil származékainak előállítására. A főtermékként megjelenő Cephalosporin-C-nek elnevezett azetidinon származékot Abraham és Newton izolálta 1961-ben. Brotzu 1948-ban közli. A század második felében végzett kiterjedt vizsgálatok megerősítették. az izopenicillin N szintetáz (IPNS) és az izopenicillin aciltranszferáz. hogy a bioszintetizáló rendszer számos nemzetségben előfordul. és a metiltranszferáz Jelenlétét a következő gomba törzsekben sikerült igazolni: 17 . A fermentlé több biológiailag aktív terméket tartalmaz. aciláz karbamoil transzferáz. Gen. az izopenicillin N szintetáz (IPNS). (A fonalas sűrű micéliumtömeg oxigén-ellátása technikai okok miatt nem oldható meg. A szélesebb baktérium spektrumát az acilező sav aminocsoportja hozza. artrospóraszerű. hanem hajlott göcsörtös.specifikus termelőképesség szempontjából is előnyös. A penicillin képződéséhez szükséges három enzim. Félszintetikus származékainak gyógyászati jelentősége az antibiotikum illetve kemoterápia sikeres korszakát indította el. az expandáz. Fleming felfedezését követően hosszabb ideig úgy vélték. (IAT) jelenlétét igazolták a felsorolt gombanemzetségekben: ASCOMYCETES (perfekt alak) DEUTEROMYCETES (imperfekt alak) Emericella nidulans Aspergillus nidulans Eurotium Penicillium notatum chrysogenum Sartorya Epidermophyton Eupenicillium Trichophyton Talaromyces Microsporum Carpenteles Malbranchea Thermoascus Polypaecilum Gymnoascus Arthroderma Nanizza Az N penicillin képződéséhez szűkséges enzimek. 47:1952). Később a törzs rendszertani hovatartozását végző mikológusok az antibiotikumot termelő törzset helyesen Acremonium chrysogenum névvel különítették el a Cephalosporium fajoktól A termelő törzs nevének változása nem befolyásolta az antibiotikum elnevezését. a penicillin-N antibiotikumon kívül egy savanyú természetű szteroid vázat tartalmazó kefalosporin-P-nek nevezett helvolinsav származék jelenlétét is bizonyították. fonalas formában. hogy a penám váz szintézisére csak a Penicillium nemzetség néhány faja jöhet számításba. az ACV tripeptid szintetáz (ACVS).

ASCOMYCETES Emericellopsis Byssochlamys Arachnomyces Anixiopsis DEUTEROMYCETES Cephalosporium acremonium (Acremonium chrysogenum) Paecilomyces persicinus Scopulariopsis Diheterospora Spiroidium További vizsgálatokban több azetidinon származékot termelő pokariotát sikerült izolálni: Streptomyces clavuligerus. A fialidok átmérője a konídiumnál 0. század közepén Cephalosporium acremonium-ként azonosították. Nocardia lactamdurans. Innen ered az antibiotikum elnevezése. holott a Botzu által cephalosporin-C termelésre alkalmas szervezetként izolált gombát a XX. A konidiumok (c) csoportosan a vékony fialidok csúcsán helyezkednek el. A taxonómiai szempontok változását szemlélteti az Acremonium strictum esete amely a Cephalosporium nemzetségből 1971-ben került át Gams W munkája eredményeként az Acremonium nemzetségbe. Penicillium notatum Penicillium chrysogenum (Önmegtermékenyítő is lehet). 1950-óta több mint 150 új Penicillium faj került leírásra. Talajban. Acremonium strictum 18 . A konidiumok általában egy a gomba által kiválasztott nyálkás anyag hatásaként összetapadva maradnak. Lysobacter lochenigenus. Az egyesével álló fialidok harántfallal különülnek el a. Flavobacterium A ß-laktám antibiotikumot termelő Penicillium chrysogenum törzs rendszertanilag az Ascomycota tagozat Euascomycia ágazat Eurotiales rend Eurotiaceae család Talaromyces nemzetség Asymetrica csoport Velutina alcsoport Chrysogenum sorozatba illeszthető faj olyan nemesített variánsa. növények maradványain gyakran előfordul. melynek szexuális folyamata ismeretlen. amelyek valójában valószinűleg az Eupenicillium és a Talaromyces fajok imperfekt alakjaiként tárgyalhatók. Ugyanez vonatkozik a Penicillium csoportokra.konidiofórumokon (b).5 µm-re szűkül. A penám és cephem szerkezetű antibiotikumot termelő fajuk Acremonium chrysogenum-ként ismert.

a 60-as évekig előnyösen laktózt. Ezt a lizinhez vezető reakció utat csapolja meg az izo-penicillin-N szintézis. de képződése ugyancsak központi szerepet betöltő piroszőlősavból kielégítő aktivitással folyik. Ebből acetil-CoA felhasználásával képződik az acetil-szerin. amely nélkülözhetetlen építőeleme a cephalosporin-C antibiotikum képződésének is. Hexóz szénforrásból a G-6-P szint természetesen kielégítené a szénváz felépítés igényét. Ezért az antibiotikum termelésre kidolgozott eljárások szénforrásként lassan bontható oligoszacharidot. A homocitrátból képződő homoakonitin-sav dehidrogénezésével és egy transzamináz reakcióval jutunk az L-aminoadipinsavhoz.) A bioszintézis egyes lépésének közvetlen energia és kofaktor igényét szemlélve. nyílvánvaló. amely feltétele az -aminocsoport kialakulásának. (Lásd a három aminosav (A. amelynek -karboxil csoportja ATP-vel reagálva adenilsav vegyes anhidridként hasznosul a tiotempláton folyó ACV-tripeptid képződéséhez.C. mert egyetlen ml fermentlében felhalmozódó 100 mmol antibiotikum (6x1017molekula) tömege meghaladja az őt termelő mikroszervezet száraz tömegét. L-Cisztein és L-Valin az ACV-tripeptid szintetáz működéséhez szükséges koncentrációban jelen legyenek. Ezért van jelentősége az eljárás szempontjából olyan optimális technológia kimunkálásának. Négy NADPH segíti a szulfátból származó kén redukcióját.6-biszfoszfát szint végzi. hogy a reakciót a végtermék. 19 . amely nem azonos a glutationt redukált formában tartó. hogy az építőelemek. Mindent összevetve végeredményben négy acetil-CoA felhasználásával képződik egy-egy aminoadipinsav. amely kénhidrogénnel reagálva alakul ciszteinné a szükséges mennyiségben. másrészt.6-P2 szint csökkenése megszünteti a biszfoszfát 6PG dehidrogenázt gátló hatását. a genetikailag meghatározott potenciális lehetőséget maximális mértékben kihasználja. Az L-valin képződése ugyan feedback kontrol alatt áll. esetleg növényi zsiradékot használnak. Ez nem elhanyagolható igény. ha a hexóz monofoszfát (HMP) úton hasznosul. Ezt az irányítást hatásosan a fruktóz-2. A Krebs-ciklusban képződő -ketoglutársav acetil-CoA-val reagálva alakul homocitráttá. A sejtben normál esetben előforduló aminosavak mennyiségének 100-szorosa található a termelt antibiotikumban. NADPH igényes reduktázzal. a lizin szintézis köztes terméke. Végül a NADPH poolt terheli a tripeptidet redukált formában tartó specifikus tioredoxin rendszerhez hasonló széles spektrumú diszulfidreduktáz. Különlegességként említhető a bioszintézis NADPH-t igénylő reduktoizomeráz reakciója. az L-Aminoadipinsav. ha a szulfát redukcióhoz szükséges NADPH formában megjelenő redukáló aktivitás nem áll rendelkezésre. A valin szintézis redukciós lépése ugyancsak NADPH-t igényel. A felhasználásra kerülő aminosavak előállítása a vázlaton bemutatott anyagcsere rendszert terheli. A bioszintézis szempontjából tehát meghatározó jelentőséget nyer a G-6-P dehidrogenáz és a 6-PG dehidrogenáz működésétől függő NADPH ellátottság.V) képződését bemutató vázlatot a következő oldalon A három aminosav közül az L-cisztein központi szerepet ellátva közvetlenül nem jelenthet limitáló faktort az azetidinon képzésben. (A prokariotákban a szacharopinen és aaminoadipinsav félaldehiden keresztül vezető lizin lebontási út szolgáltatja a kefém váz szintéziséhez szűkséges köztes terméket. A F-2. A Penicillium chrysogenum a laktózt — nem lévén galaktózzal indukálható ß-galaktozidáza — különösen lassan képes felhasználni.A PENÁM ÉS KEFÉM SZERKEZETŰ ANTIBIOTIKUMOK FELDÚSULÁSA A TENYÉSZETBEN Az azetidinon szerkezetű antibiotikumok képződésének előfeltétele egyrészt. A vízkilépést követően glutaminsavból származó amino csoportot hasznosít a transzamináz a ketovalin valinná alakításához. A növekedési fázist követő antibiotikumot termelő szakaszban (idio fázis) a mérsékelt glükóz ellátottság a cAMP szint növekedését eredményezi.. hogy a sejten belüli redukáló környezet szempontjából optimális NADPH szint fenntartása meghatározó jelentőségű. amely felszámolja az átmenetileg esetleg megjelenő biszulfid alakot. amely a termelő törzs igényeit szelektíven kielégítve. Nem véletlen. Hiánya áttételesen jelentkezhet. ami a foszfatáz hatást növeli. Ez a vegyes anhidrid a lizin szintézis irányában lehetővé teszi a karboxil csoport redukcióját. hogy a bioszintézisben résztvevő enzimek aktív formában kellő mennyiségben jelen legyenek. a lizin szabályozza. Az ammonia felvételt katalizáló glutaminsav dehidrogenáz NADPH-t igényel. A glikolitikus út köztes termékéből (3-foszfoglicerát) NAD-függő redukcióval képződő 2-keto-3-foszfoglicerát transzamináz segítségével alakul szerin foszfáttá. A harmadik építőelem az L--aminoadipinsav.

L-valin) képződése A limitált glükóz szinttől függően emelkedő cAMP szint a négy alegységből álló inaktív protein foszokinázt aktív monomerekké alakítja. L-cisztein. (Lásd a F-2.ACV tripeptid építőelemeinek (L--aminoadipinsav.6-P2 szabályozó szerepét bemutató vázlatot) Ez a cAMP-t tartalmazó 20 .

A FADH2 képződés növekedését jelenti a cephem szerkezetű termékek képződése. Az acetil-CoA-ból töténő bioszintézis esetében fontos szerepet nyer a Krebs ciklus és a glioxalát ciklus működése.protein foszforiláz a F-2. de a fruktóz1. amely NADPH hiányt eredményez. Nem véletlen tehát. amely az olajsavból szabályozás nélkül képződő acetil-CoA gyors felhasználódását lehetővé teszi. vagy a környezetből a tenyészetbe kerülő vad törzsek a fermentációs ciklus végére elszaporodva sok esetben elnyomják a kinemesített variánst. A bonyolult szabályozó mechanizmust látva érthetővé válik.6-foszfokinázt foszforilezve F-2.6-biszfoszfatázzá alakítja.6-biszfoszfát útra tereli. hogy az ipari termelésre kinemesített törzsek miért vesztik el olyan könnyen kiemelkedő termelőképességüket.6-biszfoszfatáz működésével megnyitja az utat az acetil-CoA ból táplált glükóz képződés (glükóz neogenezis!) irányába.6-foszfokinázt aktiválva serkenti a fruktóz-1.6-P2-ot. Ez utóbbi enzim elbontja a képződő F2. Nem meglepő. Ez utóbbi enzimaktivitás eltünteti a jelenlevő F-2. A tenyészethez adott fölös glükóz ugyanis a szénhidrát lebontást a fruktóz-1. az expandáz és a dioxigenáz jellegű hidroxilezéssel együttjáró szukcinát képződés.6-biszfoszfatázzá alakítja. hogy fokozott 21 . Ez a beavatkozás nemcsak a HMP út működését teszi szabaddá. Az anyagcsere teljesítőképességét ez esetben a redukált kofaktorok visszaoxidálásának sebessége határozza meg. gyorsabban növekedő spontán megjelenő mutánsai. elősegítve a HMP út működését. amelyik a F-2. azaz a NADPH képződést.6-P2 képződést.6-P2-ot. hogy a penicillint termelő tenyészethez adott glükóz leállítja a penám váz képződését.6-foszfokinázt foszforilezve 2. másrészt a fruktóz-1. Az antibiotikum termelés szintjét befolyásoló spontán mutáció ugyanis csökkenti az anyagcserére nehezedő szelekciós nyomást.6-biszfoszfát szabályozó szerepének a vázlata Glükóz-limit estén kialakuló cAMP szint a szénforrás hasznosulást a hexózmonofoszfát útra tereli. Ez esetben a lecsökkenő cAMP szint miatt inaktíválódik az a protein foszforiláz. amely egyrészt gátolva a 6-foszfoglükonát dehidrogenáz működését NADPH hiányt idézne elő. Ez a szabályozó melem különösen fontos szerepet nyer a szénforrásként növényi olajat hasznosító cephalosporin képződés szempontjából Fruktóz-2. amely végül az EMP útra tereli a szénhidrát lebontást. A populáció könnyebben. A zsírsav szénforrást hasznosító anyagcsere nagyobb mennyiségű redukált kofaktor (NADH és FADH 2) képződéssel jár.

Alacsonyabb spóraszám esetében viszont a pelletek mérete lesz nagyobb. amely ATP képződés nélkül képes az elektront az oxigénre mint elektron-akceptorra juttatni. Az oltóanyagot előállító laboratórium minőségileg ellenőrzött spóratömegével oltják az előinokulumot. A habgátló is az előkészített táptalajba kerül sterilizálás előtt. hanem megfelelő előkezelés. A törzsfenntartó laboratórium rutin feladata az oltóanyagok termelőképességének és az élőcsiraszámnak az ellenőrzése. Ma divatos a cseppfolyós nitrogénben. Ezek a törzskonzervek természetesen nem közvetlenül kerülnek felhasználásra. A technológiai előírások pontosan meghatározzák az oltófermentorba juttatandó élőcsiraszámot. A vegetatív inokulum táptalaj szerves nitrogénforrásaként a kukorica áztatóléből készült tejsavbacillusokkal erjesztett koncentrátumot használták 2% mennyiségben. Az optimális spóraszám túllépése a mikrotelepek összefonódását eredményezi.5-1% kalciumkarbonát a tenyészközeg savanyodását akadályozza. de szalicilhidroxamáttal gátolható — CN rezisztens — alternatív légző rendszer.VILÁGSZERTE MEGVALÓSULT A fehérje oldatban szuszpendált spórák fagyasztva szárított körülmények között (liofilizálás) hosszabb ideig biztonságosan tárolhatók. A spóraszám a termelő táptalajban kialakítandó gömb alakú telepecskék (pellet) kívánatos számával egyezik meg. Biztonsági okokból általában két oltó reaktort indítanak az esetleg fellépő zavarok (fertőződés) elhárítása céljából. vitaminok szempontjából előnyös. ami a célvegyület képződését zavarná. Ez a hőtermelésben megjelenő energia a rendszer fokozott hűtését igényli (24-26 oC-ra). (A NAD+ hiány. Az inokulum gazdasági megfontolásból több lépcsőben készül szerves nitrogénforrást és könnyen metabolizálható szénforrást tartalmazó táptalajon. Az oltóanyag energiaforrásaként általában a csírázást és a növekedést segítő glükózt használnak ugyancsak 2-3% mennyiségben. de jelentős a tejsav és foszfáttartalma is. Virulens oltóanyagként felhastználható spóratömeg nyerhető a nemsített törzs szuszuszpenziójával oltott sterilezett rizs. A pellet kialakulása és mérete több szempontból fontos. Een a szénforráson jelentős micélium tömeg fejlődik. A redukálódó kofaktorok regenerálása alapvető feltétele a rendszer működőképességének. A csírázás ellenőrzése után — a primer fonalak megjelenésekor — célszerű átoltani a tenyészetet. A méretnövelés céljából előnyös az oltóanyag előállítást két lépcsőben végezni. az oxidáció közben felszabaduló energia a tenyészet hőmérsékletét emeli. felélesztés után előállított spóra tömeggel történik a termelő fermentáció oltása. 0. A PENICILLIN GYÁRTÁS IPARI GYAKORLATA .szerepet kap a szalicil-savval. < flavin enzim red > (cianidddal gátolható) oxidatív foszforiláció alternatív légzés e– 1 - /2 O2 H2O < e– (cianid-rezisztens szalicilhidroxamáttal gátolható) Az elektron útja az oxigénhez Mivel a redukált kofaktor visszaoxidálása ATP képződés nélkül történik. ezért sebességmeghatározó. Az aszeptikusan lezárt spóratömeg –20 °C on 1-2 éven keresztül tárolható biológiai aktivitásának csökkenése nélkül. A apró. — idegen fertőzéstől való mentessége érdekében. vagy köles szemek felületén A spóratermelő fázis befejeztével a rizskultúrát vákuum szárítószekrényben vízmentesíthető. A végtértfogat méretének megfelelő spóratömeggel 1000 L térfogatban előinokulumként indítják az első lépcsőt. Ez az 50% szárazanyagot tartalmazó koncentrátum teljes értékű aminosavak és más növekedési faktorok. A penicillin képződés ugyanis a bioszintézis szempontjából legaktívabb csúcssejtekben folyik. Az alternatív légző rendszer fontos szerepet kap a mikroszervezet energia termelő és bioszintetizáló rendszerének optimálisra szabályozásakor. illetve az ATP felszaporodása — a kulcs enzimek működését befolyásolva — egyaránt a szénhidrát anyagcsere sebességét csökkentené. Mindkét esetben az oxigénellátás kielégítetlensége miatt a termék képződése károsodik.5-1 mm átmérőjű gömböcskék nagyobb mennyiségű gomba tömeg jelenlétét és a gömb felületen elhelyezkedő nagy számú csúcsi sejt működését teszi lehetővé a nagy viszkozitása miatt nehezen keverhető fonalas szerkezetű tenyészetnél előnyösebb levegőztetési körülmények között.1945 UTÁN . illetve -80 fokon való tárolás. A fejlődő inokulum tenyészetbe való adagolást kerülik a tenyészet — homogénitása. tehát adott esetben limitáló faktorként jelenik meg a biotechnikai folyamatokban. Az alternatív légzésnek nevezett elektronátvivő mechanizmus kiegyensúlyozó szerepe a primer metabolitokat túltermelő eljárások esetében is jól megfigyelhető. A táptalajba adott 0. NADH NAD+ ox. Az átoltások 22 . illetve borostyánkősavval indukálható.

Az arómás savak. A penicillin termelésre kiválasztott törzs ß-galaktozidáz aktivitását (laktáz) — a tömlós gombákban (Aspergillus nidulans) tapasztaltakkal ellentétben — nem indukálja a galaktóz. A szénforrás felhasználásának az útja a penicillin termelés szempontjából meghatározó jelentőségű. Ez kerül át a főfermentáció tápközegébe legkevesebb tízszeres higításra törekedve. Később. a mérési technika fejődése. A termelő fermentáció táptalaja nitrogén. A penicillin kémia stabilitása megkívánja a tenyészlé közel semleges állapotát. illetve keményítő hidrolízátummal a glükóz mennyisége a penicillin termelés szempontjából optimális alacsony szinten tartható. 23 . A tápközeg prerkurzor tartalma határozza meg a képződő penicillin minőségét. Energia forrásként szolgálhat a tápközeghez adott növényi olaj.és kén-forrásként főleg ammónium-szulfátot tartalmaz. Ez a technikai megoldás lehetőséget ad a szakaszos. lehetővé tette a pH állandó ellenőrzését. ráadagolásos technológia alkalmazására. Ebből következően a tenyészetben a glükóz limitált mennyiségben van jelen.6 pH tartására törekednek. fenoxiecetsavat adagolva V penicillin képződik főtermékként.idejét úgy határozzák meg. Mégis a glükózaminidáz képes a tejcukor lassú hidrolízisére. amelyben a mikrokolónia kezdemények még függetlenek. Ma ammónia adagolásával 6. akár tíz szakasz lefejtésére. Fenilecetsav jelenlétében G penicillin. Az első évtizedben a táptalajhoz adott kálcium karbonát akadályozta a tápközeg savanyodását. ezért szénforrásként kezdettől fogva a 60-as évekig tejcukrot használtak. Az elkészült inokulum 40-50 órás olyan vegetatív tenyészet.4-6. amely habgátló feladatot is ellát. A táptalajhoz adott glükóz ugyanis akadályozza a penicillin képződést. A mérési és adagolási technológia fejlődésével — ipari méretben — folyamatosan adagolt répacukorral. és bomlástermékeik toxikus volt miatt a prekurzor adagolásaa a termelő fázisban az igényeknek megfelelően folyamatosan történik. sterilezhető elektród alkalmazás. hogy a növekedés zavartalan legyen.

5 a rögvest szerves oldószerbe kerülő hatóanyagot nem károsítja. Ebből az oldatból kálium acetáttal a penicillin kálium sója könnyen kristályosítható. Gyenge sav lévén a szerves oldószeres extrakció járható útnak látszik. 24 . Ez azonban még átkristályosításra szorul. keverővel ellátott. A megsavanyított vizes fázisból így a penicillin a szeparátorral elkülönített szerves fázisban dúsul fel. kloroformot).10) szeparátort igénylő extrakciós lépések [lásd a szeparátor ábrát] (11) penicillin-só kristályosító (12) szűrőcentrifuga (13) vákuum szárítószekrény (14) granuláló (15) átkristályosító (16) szűrő (17) prokain-só képzés (18) penicillin-nátrium-só steril átkristályosítása (19) steril szűrők (20) vákuum szárító (liofilező) (21) steril penicillin tároló (22) kiszerelés A penicillin molekula kémiai érzékenysége miatt a feldolgozása egyes lépéseit hűtve végzik. de savanyú körülmények között észlelhető bomlása miatt a rendszer (pH 2) savanyítása célszerűen csak szerves oldószer jelenlétében végezhető. vagy rizs szemeken spórázó tenyészet (3) termelőképesség szempontjából minősített spóra szuszpenzió (4) oltóanyag tenyésztő bioreaktor. A savanyítást közvetlenül a centrifugál-szeparátor beömlőnyílásánál végzik folyamatosan. aerob inokulum-fermentor (5) pH szabályozott. kevert aerob termelő fermentor prekurzor [fenilecetsav] adagolással (6) a semleges fermentlé szúrése vákuum dobszűrővel [ lásd a dobszűrőt bemutató ábrát] (7) hűthető tároló tartály (8.A penicillin gyártás folyamatábrája (1) termelőképesség szempontjából "nemesített ipari törzs" (2) agar tenyészet. vagy foszforsavat használnak. A hűtött szűrlethez közvetlenül a szeparátor előtt folyamatosan adják a savat számított mennyiségben.9. A hűtve tárolt üledékmentes szűrletből a hatóanyagot szerves oldószerrel különítik el. butilacetát. Egészségvédelmi okokból ma etilacetát.2 viszik vissza. A szerves fázisból a következő szeparátoron a szabad savat újra pufferbe pH=7. A fermentáció befejezése után a 2-4 °C-ra hűtött semleges pH-jú tenyészléből a micélium eltávolítását vákuum dobszűrővel végzik. amilacetát illetve metilizobutilketon kerül felhasználásra. A pH beállítására kénsavat. Kezdetben előszeretettel használtak klórozott szénhidrogéneket (széntetrakloridot. Így a savanyú pH=2-2. Az egyik elterjedt módszer szerint a közel semleges pH-nál megszűrt (fermentlevet) tenyészlevet lehűtve amilacetáttal extrahálják.5-8. Az így nyert sót egy újabb szerves oldószeres extrakcióval tovább tisztítják és koncentrálják A szerves oldószerből kálium-acetáttal a penicillin kálium sója közvetlenül kristályosítható.

5 pH-nál gyakorlatilag bomlás nélkül folyamatosan végezhető. mert a galaktóz által indukálódó laktóz bontó aktivitás reakcióterrméke katabolikusan gátolja a kefém váz képződését. A vegyület-típus gyógyászatban elért félévszázados sikerét a peptidoglükán sejtfal felépítésében szerepet játszó reakció specifikus gátlásával magyarázhatjuk. Sőt a kísérleti eredmények szerint a tenyészközeghez adott -aminoadipinsav sem segíti a cefalosporin C képződését. Abnormális alakok. erre a célra kifejlesztett makropórusos adszorbciós gyanták használata terjedt el világszerte. Kiküszöbölhető azonban a bomlás. Igen előnyös a szerves oldószerben történő N-etilpiperidinnel végzett kicsapás. A piperidin sóból könnyenl előállítható a procain-penicillin. A benzilpenicillin extrakciója ílyen módon Amberlit LA-2 (375 moltömegű szekunder amin) n-butilacetát rendszerben 4. Nitrogénforrásként a kukorica-lekvár mellett az ammónia.. Elsősorban az alternativ oxidáció működtetése miatt. növekedő baktérium tenyészet osztódó sejtjeit pusztítja. Ez a módszer lehetőséget ad az ellenáramú extrakciós kolonnák használatára. Ezt a tulajdonságot a genetikusok a populációban megjelenő hiánymutánsok szelektív dúsítására évtizedek óta jó eredménnyel használják. A piperidin só előnyösen használható a félszintézishez szűkséges 6aminopenicillinsav előállítására. Tartós oxigénhiány esetén leáll az antibiotikum képződés. ha valamilyen folyékony ioncserélő felhasználásával végezzük a kinyerést. Az életben maradó auxotrófok penicillin mentes környezetben teljes 25 . A Penicillium esetében eklőnyösen alkalmazható tejcukor itt nem használható. a vad sejtek viszont jól növekednek. hogy a Penicillium által termelt anyag csak a virulens. amely képes a gyengén savanyú penicillinnel sót képezni. Később védőkolloidnak polyvinilpirrolidont alkalmaztak (Retardillin). Szerves oldószeres extrakció csak alkalmas karrier vegyület (szulfonsav típusú folyékony ioncserélő) használatakor jöhet számításba. Szénforrásként használható a keményítő hidrolízátum. szferoplaszt) átmeneti megjelenése mellett következik be a tenyészet lízise. Értelemszerűen nincs szükség prekurzor adagolásra. amely aluminium stearáttal stabil szuszpenziót adva tartós vérszint biztosítására adott lehetőséget (Supracillin). Az oxigén ellátás visszaállása után csak néhány órányi aktív növekedés szükséges az enzimrendszer kifejlődésdéhez. A tenyészetben a főtermékként képződő Cephalosporin C antibiotikumon kívül ennek dezacetil és dezacetoxi származéka is megjelenik. amely a rendszer természetéből következően az elméletileg kinyerhető mennyiség tetszőleges megközelítését jelenti. sőt kis mennyiségben a vegyület 7-metoxi származékának képződését is kimutatták. (protoplaszt. de a glükóz szint emelkedése zavarja a NADPH képződést is. A cefalosporin fermentációs úton történő előállítása lényegesen eltér a benzil-penicillin előállítására szolgáló eljárástól. Minimál táptalajra oltott baktériumok auxotróf variánsai nem osztódnak. Ezek az alifás természetű vegyületek olyan poláros csoportot (gyenge bázis) hordoznak. A vegyület érzékenysége miatt ioncserélő gyanta oszlopon nem oldható meg gazdaságosan a termék kinyerése. kénforrásként szulfát jöhet számításba. Feltünően nagy az eljárás oxigén igénye. Ezt a piperidin sót köztes termékként használva az igényeknek megfelelő formában lehet felhasználni a hatóanyagot kálium-só képzésre. AZETIDINON SZERKEZETŰ VEGYÜLETEK HATÁSMÓDJA. Nem kielégítő oxigénellátottság esetén először a képződő termékek aránya eltolódik a dezacetil-cefalosporin C irányába. A szilárd ioncserélő gyanták alkalmazása helyett a környezetbarát. A cefalosporin-C kémiai szerkezetéből következően a fermentléből való kinyerés módszere is eltér a penicillinnél megismert eljárástól. de a hatóanyag képződése szempontjából az idio-fázisban előnyösebb növény olajat használni szénforrásként. A penicillin csak a növekedő sejteket pusztítja el. Előnyös hatású a táptalajhoz adott kis mennyiségű metionin. Már Fleming észlelte.

. 26 . A transzpeptidáz reakció végbemenetele közben a szubsztrátum átmenetileg acilezi az enzimet és az acilezett enzimről kerül az acilező ágens a muropeptid sejtfal N terminális amino csoportjára. a periplazmikus térben az aktívált formában megjelenő N-acetil glükózaminil-N-acetil muramil oligopeptid egységek összeépülése folyik minimális energiaveszeteséggel. hogy a penicillin és a kefalosporin származékai nem mutatnak toxikus hatást az emlős szervezetben. . A sejtfal peptid vázának továbbépítését a membrán külső felületén működő transzpeptidáz és transzglikozidáz végzi. Az elnevezés a latin murus (fal) szóból származik. A transzglikozidáz az építőelem diszacharid komponensét a glükán polimer terminális hexóz C4 atomjához. A baktériumsejtfal murein rétegének. A citoplazma membránon kívül. a peptidoglukán váznak a felépülését a D-alanin transzpeptidáz inaktiválásával akadályozza a penicillin.membránhoz kötött foszfat