P. 1
Sepia Andreana cytochrome oxidase C subunit 1

Sepia Andreana cytochrome oxidase C subunit 1

|Views: 6|Likes:
Published by Michael Lisieski
Gene sequence of sepia andreana Sepia Andreana cytochrome oxidase C subunit 1 from genbank
Gene sequence of sepia andreana Sepia Andreana cytochrome oxidase C subunit 1 from genbank

More info:

Categories:Types, Research, Science
Published by: Michael Lisieski on Mar 20, 2011
Copyright:Attribution Non-commercial

Availability:

Read on Scribd mobile: iPhone, iPad and Android.
download as TXT, PDF, TXT or read online from Scribd
See more
See less

03/20/2011

pdf

text

original

LOCUS AB430401 658 bp DNA linear INV 26-JUN-2009 DEFINITION Sepia andreana mitochondrial COI gene for

cytochrome c oxidase subunit I, partial cds. ACCESSION AB430401 VERSION AB430401.1 GI:242117663 KEYWORDS . SOURCE mitochondrion Sepia andreana ORGANISM Sepia andreana Eukaryota; Metazoa; Mollusca; Cephalopoda; Coleoidea; Neocoleoidea; Decapodiformes; Sepiida; Sepiina; Sepiidae; Sepia. REFERENCE 1 AUTHORS Yoshida,M., Tsuneki,K. and Furuya,H. TITLE Partial sequences of mitochodrial genes of the cuttlefishes JOURNAL Unpublished REFERENCE 2 (bases 1 to 658) AUTHORS Yoshida,M., Tsuneki,K. and Furuya,H. TITLE Direct Submission JOURNAL Submitted (26-MAR-2008) Contact:Masa-aki Yoshida Academic Production, Ochanomizu University; 2-1-1, Otsuka, Bunkyo, Tokyo 112-8610, Japan FEATURES Location/Qualifiers source 1..658 /organism="Sepia andreana" /organelle="mitochondrion" /mol_type="genomic DNA" /specimen_voucher="OUM-MO-00089" /db_xref="taxon:515515" /country="Japan: Osaka, Izumisano" /collection_date="26-Apr-2007" gene <1..>658 /gene="COI" CDS <1..>658 /gene="COI" /codon_start=2 /transl_table=5 /product="cytochrome c oxidase subunit I" /protein_id="BAH80104.1" /db_xref="GI:242117664" /translation="TLYFIFGIWSGLLGTSLSLMIRSELGKPGTLLNDDQLYNVMVTA HGFIMIFFLVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLSSSAV ESGAGTGWTVYPPLSSNLSHAGPSVDLAIFSLHLAGVSSILGAINFITTILNMRWEGL QMERLPLFAWSVFITAILLLLSLPVLAGAITMLLTDRNFNTTFFDPSGGGDPILYQHL F" ORIGIN 1 tacattatat tttattttcg gaatttgatc aggattacta ggtacatcac taagcttaat 61 aattcgaaga gaattaggta aacctggtac attattaaat gacgaccaat tatataatgt 121 tatagttaca gcccatggat ttattataat ttttttttta gtaataccta ttataattgg 181 cggttttggt aattgattag tacctttgat attaggtgct cctgatatag ccttccctcg 241 aataaataat ataagttttt gattattacc cccttccctt acacttcttt tatcatcatc 301 tgcagttgaa agaggtgcag gtacaggatg aactgtttac cctcctttat ctagaaatct 361 ttcccatgca ggaccttcag tagatttagc tattttttct ttacatcttg caggagtatc 421 ctctattcta ggtgctatta attttatcac aactatttta aatatacgtt gagaaggttt 481 acaaatagaa cgactacctt tatttgcttg atctgttttc atcactgcaa ttttattatt 541 attatctcta ccagtacttg caggagctat tactatatta ttaactgacc gaaattttaa 601 taccactttt tttgatccta gaggtggagg ggatccaatt ctctatcaac atttattt //

You're Reading a Free Preview

Download
scribd
/*********** DO NOT ALTER ANYTHING BELOW THIS LINE ! ************/ var s_code=s.t();if(s_code)document.write(s_code)//-->