“Indonesia

Menguggat
JilidII”?



Oleh
KwikKianGie
MenjabarkanPidato
ProklamasiCalonWakil
PresidenBoediono
“IndonesiaMenggugatJilidII”? J
“INDONESIAMENGGUGATJILIDII”?
MenjabarkanPidatoProklamasi
CalonWakilPresidenBoediono
PleidooiIr.SoekarnodanDeklarasiDr.Boediono
SetelahIr.Soekarno(bersama-samadenganGatotMangkupradja,
Maskun Sumadiredja dan Soepriadinata) ditangkap pada
tanggal 29 Desember 1929, mereka diadili oleh landraad di
Bandungyangberlangsungantaratanggal18Agustus1930
sampaitanggal22Desember1930.Padahariitu,Soekarno
dankawan-kawandijatuhihukumanpenjara4tahundengan
tuduhan melanggar pasal 169 dan 153 bis Wetboek van
Strafrecht.PidatopembelaannyaBungKarnomenjadisangat
terkenaldiseluruhduniadenganjudul“Indonesieklaagtaan”
atau“Indonesiamenggugat”.
Padatanggal15Mei2009Dr.BoedionoberpidatodiBandung
dalamrangkamemproklamasikandirinyasebagaicalonwakil
presiden dalam pemilihan tahun 2009.Antara lain dikatakan
olehnya: ”Bapak Presiden yang saya hormati dan para
hadirin, di awal abad ke-20 Bung Karno di kota Bandung
ini menyatakan Indonesia menggugat. Waktu itu Indonesia
menggugatpenjajahanyangmenjadikannegaraterbelenggu
“IndonesiaMenggugatJilidII”? 4
dan merasa kerdil. Di awal abad ke-21 ini, Indonesia juga
selayaknyamenggugat.Kiniyangkitagugatadalahpenjajahan
olehkekuatandariluardandaridalam.”
JelasBoedionomenganggapIndonesiasekarangmasihdijajah
yang menurutnya selayaknya harus digugat. Implikasinya
jelas,yaitukalaunantidiaterpilihsebagaiWakliPresiden,dia
akanmenggugatkekuatandariluardandaridalam.Adadua
halyangperludijelaskan.
Beberapapertanyaan
Siapa kekuatan dari luar yang sedang menjajah Indonesia,
dan siapa pula kekuatan dari dalam?Apakah kekuatan luar
dan kekuatan dalam ini menjajah Indonesia secara sendiri-
sendiri ataukah bersama-sama dalam sebuah konspirasi, di
manaelitbangsaIndonesianyayangmenjadimitradariluar
bertindaksebagaipengkhianatkepadabangsanyasendiri?
Sejak kapan Indonesia dijajah dengan tanggal pidatonya
sebagai titik tolak, yaitu tanggal 15 Mei 2009. Apakah
mulai tanggal itu Indonesia dijajah dalam bentuk yang
ada dalam benak Boediono, ataukah sebelumnya sudah.
Kalau sebelumnya sudah, siapa kiranya yang menjajah dan
siapa kiranya kroni dan kompradornya para penjajah yang
berbangsaIndonesia(kekuatandaridalam)?Boedionotentu
dapat mengenalinya dengan akurat karena dia cukup lama
menjadiorangdidalamlingkunganpuncakkekuasaan.
PersamaanBungKarnodenganBoediono
Boediono menyamakan dirinya dengan Bung Karno. Bung
KarnomenggugatpenjajahanolehpemerintahHindiaBelanda
yang menjajah Indonesia secara fsik, dengan bayonet, bedil,
pelurudanmeriam,armadalautdansebagainya.
“IndonesiaMenggugatJilidII”? 5
Boedionojugainginmenggugatpenjajahanzamansekarang
yangtentunyaberbentuklain.Apabentuknyatidakdijelaskan.
Sangat mungkin bentuk penjajahan yang ada dalam benak
BoedionosamadenganyangditulisolehJenderalRyamizard
Ryacududalambukunyayangberjudul”PerangModern”.
Intinya yalah bahwa dalam zaman modern sekarang ini,
hakikat penjajahan bangsa mangsa oleh bangsa penjajah
tidak perlu dilakukan dengan sebutir pelurupun, apalagi
pasukan dan armada perang. Caranya dengan membentuk
elit bangsa mangsa yang dijadikan mitranya atau kroni
atau kompradornya. Mereka dibantu supaya senantiasa
memegang kendali kebijakan ekonomi yang sesuai dengan
kehendak bangsa penjajah, seperti yang digambarkan oleh
JohnPilger,BradleySimpson,JeffreyWinters,JohnPerkins
dan 12 perusak ekonomi yang “mengaku dosa” dalam buku
“AGameasoldasEmpire”.Parakroniinidiyakinkanbahwa
kebijakan haruslah seliberal mungkin, membangun proyek-
proyek raksasa dengan hutang dari negara-negara penjajah
supayamerekabisamemperolehpendapatanbungadanlaba
mark up yang tinggi. Implikasi politiknya supaya senantiasa
dicengkeram dan didikte kebijakannya yang senantiasa
menguntungkan korporatokrasi negara penjajah. PDB
dinaikkanolehbeberapainvestorasingraksasatanpatrickle
down effect pada yang miskin. Inikah yang oleh Boediono
disebut dengan kata-kata “penjajah dari dalam negeri” yang
mungkinbekerjasamadenganpenjajahdariluar?
Boediono menyamakan dirinya dengan Bung Karno yang
sama-sama ingin menggugat atas nama bangsa Indonesia.
Yang digugat juga sama, yaitu penjajahan. Pernyataannya
sama-sama diucapkan di kota Bandung. Tempat ini begitu
pentingnyabuatBoedionosehinggaimplisitdidalampidatonya
kotaBandungdianggapsebagaifaktoryangmenyamakannya
denganBungKarno.
“IndonesiaMenggugatJilidII”? 6
Saya menduga tujuan atau target penjajahan oleh kekuatan
penjajah yang ada dalam benak Bung Karno dan Boediono
sama, yaitu penghisapan kekayaan bangsa Indonesia
oleh bangsa asing, yang dibantu oleh kroni dan komprador
bangsa Indonesia sendiri. Merendahkan dan melecehkan
martabatbangsaIndonesia;Boedionomemakaiistilah“yang
membuatkitamerasaterpurukdantidakbisabangkit”.Yang
perludiperjelassiapakronidankompradorbangsaIndonesia
sendiri?
Perbedaan-perbedaannya
Yangberbeda,Ir.Soekarnolangsungmenghadapihakimketua
Mr. Siegenbeek van Heukelom dengan jaksa penuntutnya
seorang Indonesia yang ketika itu berstatus inlander dan
bernamaR.Sumadisurja.Boedionomenyatakankehendaknya
menggugat kaum penjajah zaman sekarang. Kehendaknya
inibarudimintakanizindari“BapakPresiden”,sebutanyang
dipakainyadalambagiandaripidatonyayangmenggunakan
istilah“IndonesiaMenggugat”.BungKarnodijatuhihukuman
penjara,Boedionoditepukitangan.
Bung Karno seorang inlander yang tidak mungkin bergaul
dengankekuatanasingpadastratayangsama.BoedionoHis
Excellency Prof.Dr.BoedionoyanganggotaDewanGubernur
BankDunia.
PerjuanganBungKarnomembawanyakeluarmasukpenjara
dan pembuangan. Boediono tidak pernah masuk penjara.
Menjaditersangkasajatidakpernah.
Perilaku Bung Karno tidak pernah diarahkan menjadi
PresidenRI.DiaberjuangsupayaIndonesiamerdekadengan
pengorbananapasaja.Gugatannyasudahmenjadikenyataan
dan merupakan pengorbanan luar biasa buat dirinya, yang
akhirnya memang memerdekakan bangsa Indonesia dari
“IndonesiaMenggugatJilidII”? 7
penjajahan.
Boediono baru memberi pernyataan bahwa penjajahan di
abadke21sekaranginiselayaknyadigugat.Jelasjugabahwa
pernyataantersebutdikemukakanjustruuntukdipilihmenjadi
wakilpresiden.Itupuntidakjelassiapapenjajahnyadariluar
dansiapapenjajahnyayangdaridalamnegerisendiri.Lantas
apakah betul dia akan menggugat penjajahan masih harus
dibuktikan.
BungKarnohanyaberjuangdanberjuang.Karenatindakannya
ituseluruhbangsaIndonesiamenganggapnyasebagainatural
leader,sehinggadiamenjadiPresidenRIyangbarumerdeka.
Boediono tidak demikian. Gugatannya terhadap kaum
penjajahjustrusebelumdiamelakukanapa-apa.Gugatannya
barusebagaipropagandauntukdirinyasupayadipilihsebagai
wakilpresidendibulanJuli2009mendatang.
BungKarnodanPakHartoberbuatsangatbanyak,sehingga
rakyatmenganggapnyasebagaiparapemimpinnya.Boediono
lain.Diaadalahcalonwakilpresidenyangdalamkampanye
pemilihan pilpres tidak boleh mempunyai rasa rendah
hati, tidak boleh humble. Dalam kampanye nanti dia harus
berkelilingIndonesiamengatakankepadarakyatIndonesia:
“Wahai rakyatku, aku ini orang hebat yang akan menggugat
penjajahandanmemberantaskorupsi,mereformasibirokrasi.
Makapilihlahakusebagaiwakilpresidenmu.”
ApaNeoliberalismeItu?
Dengan dipilihnya Boediono sebagai cawapres-nya SBY,
diskusi tentang “neolib” menjadi marak. Namun diskusinya
tidakmemberikangambaranyangjelas.
Liberalismeadalahfahamyangsangatjelasdigambarkanoleh
AdamSmithdalambukunyayangterbitditahun1776dengan
“IndonesiaMenggugatJilidII”? 8
judul“Aninquiryintothenatureandthecausesofthewealth
of nations”. Buku ini sangat terkenal dengan singkatannya
“The wealth of nations” dan luar biasa pengaruhnya. Dia
menggambarkan pengenalannya tentang kenyataan hidup.
Intinyasebagaiberikut.
Manusiaadalahhomo economicus yangsenantiasamengejar
kepentingannya sendiri guna memperoleh manfaat atau
kenikmatan yang sebesar-besarnya dari apa saja yang
dimilikinya. Kalau karakter manusia yang egosentris dan
individualistik seperti ini dibiarkan tanpa campur tangan
pemerintahsedikitpun,dengansendirinyaakanterjadialokasi
yang efsien dari faktor-faktor produksi, pemerataan dan
keadilan, kebebasan, daya inovasi dan kreasi berkembang
sepenuhnya.Prosesnyasebagaiberikut.
Kalau ada barang dan jasa yang harganya tinggi sehingga
memberikan laba yang sangat besar (laba super normal)
kepada para produsennya, banyak orang akan tertarik
memproduksibarangyangsama.Akibatnyasupply meningkat
danceteris paribus hargaturun.Kalauhargaturunsampaidi
bawahhargapokok,ceteris paribus supply menyusutdengan
akibat harga meningkat lagi. Harga akan berfuktuasi tipis
dengan kisaran yang memberikan laba yang sepantasnya
saja(labanormal)bagiparaprodusen.Halyangsamaberlaku
untukjasadistribusi.
Bukuiniterbitditahun1776ketikahampirsemuabarangadalah
komoditi yang homogen (stapel producten) seperti gandum,
gula,garam,katoendansejenisnya.Lambatlaundayainovasi
dan daya kreasi dari beberapa produsen berkembang. Ada
sajadiantaraparaprodusenbarangsejenisyanglebihpandai,
sehingga mampu melakukan diferensiasi produk. Sebagai
contoh,garamdikemaskedalambotolkecilpraktisyangsiap
pakaidimejamakan.Didalamnyaditambahibeberapavitamin,
diberimerkyangdipatenkan.Diamempromosikangaramnya
“IndonesiaMenggugatJilidII”? 9
sebagai sangat berlainan dengan garam biasa. Konsumen
percaya, dan bersedia membayar lebih mahal dibandingkan
dengan harga garam biasa. Produsen yang bersangkutan
bisamemperolehlabatinggitanpaadasainganuntukjangka
waktuyangcukuplama.Selamaitudiamenumpuklabatinggi
(labasupernormal)yangmenjadikannyakaya.
Karena semuanya dibolehkan tanpa pengaturan oleh
pemerintah,diamulaimelakukanpersainganyangmematikan
para pesaingnya dengan cara kotor, yang ditopang oleh
kekayaannya. Sebagai contoh, produknya dijual dengan
harga yang lebih rendah dari harga pokoknya. Dia merugi.
Kerugiannya ditopang dengan modalnya yang sudah
menumpuk. Dengan harga ini semua pesaingnya akan
merugidanbangkrut.Diatidak,karenamodalnyayangpaling
kuat.Setelahparapesaingnyabangkrut,dengankedudukan
monopolinyadiamenaikkanhargaproduknyasangattinggi.
Contoh lain: ada kasus pabrik rokok yang membeli rokok
pesaingnya, disuntik sangat halus dengan cairan sabun.
Lantas dijual lagi ke pasar. Beberapa hari lagi, rokoknya
rusak, sehingga merknya tidak laku sama sekali, pabriknya
bangkrut.
Yang digambarkan oleh Adam Smith mulai tidak berlaku
lagi. Karena apa saja boleh, pengusaha majikan mulai
mempekerjakansesamamanusiadengangajidanlingkungan
kerjayangdiluarperikemanusiaan.Puncaknyaterjadidalam
erarevolusiindustri,yangantaralainmengakibatkanbahwa
anak-anakdanwanitahamildipekerjakanditambang-tambang.
Wanitamelahirkandalamtambangdibawahpermukaanbumi.
Mereka juga dicambuki bagaikan binatang. Dalam era itu
seluruhduniajugamengenalperbudakan,karenapemerintah
tidakbolehcampurtanganmelindungiburuh.
Dalam kondisi seperti ini lahir pikiran-pikiran Karl Marx.
“IndonesiaMenggugatJilidII”? 10
Banyak karyanya, tetapi yang paling terkenal menentang
Adam Smith adalah Das Kapital yang terbit di tahun 1848.
Marx menggugat semua ketimpangan yang diakibatkan
oleh mekanisme pasar yang tidak boleh dicampuri oleh
pemerintah.Marxberkesimpulanbahwauntukmembebaskan
penghisapan manusia oleh manusia, tidak boleh ada orang
yangmempunyaimodalyangdipakaiuntukberproduksidan
berdistribusi dengan maksud memperoleh laba. Semuanya
harus dipegang oleh negara/pemerintah, dan setiap orang
adalahpegawainegeri.
Dunia terbelah dua. Sovyet Uni, Eropa Timur, China, dan
beberapa negara menerapkannya. Dunia Barat mengakui
sepenuhnya gugatan Marx, tetapi tidak mau membuang
mekanisme pasar dan kapitalisme. Eksesnya diperkecil
dengan berbagai peratutan dan pengaturan. Setelah dua
sistem ini bersaing selama sekitar 40 tahun, persaingan
dimenangkanolehBarat.
Makatidakadalaginegarayangmenganutsistemkomunisme
a la Marx-Lenin-Mao. Semuanya mengadopsi mekanisme
pasar dan mengadopsi kaptalisme dalam arti sempit, yaitu
dibolehkannyaorangperorangmemilikikapitalyangdipakai
untukberprodukidanberdistribusidenganmotifmencarilaba.
Tetapi kapital yang dimilikinya harus berfungsi sosial. Apa
artinya dan bagaimana perwujudannya? Sangat beragam.
Keragaman ini berarti juga bahwa kadar campur tangannya
pemerintah juga sangat bervariasi dari yang sangat minimal
sampaiyangbanyaksekali.
SiapaKaumNeolib?
Orang-orang yang menganut faham bahwa campur tangan
pemerintah haruslah sekecil mungkin adalah kaum neolib;
mereka tidak bisa mengelak terhadap campur tangannya
pemerintah, sehingga tidak bisa lagi mempertahankan
“IndonesiaMenggugatJilidII”? 11
liberalisme mutlak dan total, tetapi toh harus militan
mengkerdilkanpemerintahuntukkepentingankorporatokrasi.
Jadi walaupun yang liberal mutlak, yang total, yang laissez
fair laissez aller danlaissez fair laissez passer,yangcut throat
competition danyangsurvival of the fttest mutlaksudahtidak
bisadipertahankanlagi,kaumneolibmasihbisamembiarkan
kekayaanalamnegarakitadihisaphabisolehparamajikannya
yangkaumkorporatokratdengandukunganBankDunia,Bank
PembangunanAsiadanIMF.
Boedionoperlumelakukansoul searchingyangmendalam
Meledaknyadebattentangneolibtidakdapatdipisahkandari
persepsiyangdimilikisangatbanyakorangbahwaBoediono
adalah personifkasi dari aliran neolib di Indonesia. Bahkan
beliaulah yang dewasa ini dianggap sebagai pemimpin kaum
neolib Indonesia, yang dianggap sama dan sebangun dengan
kelompok yang terkenal dengan sebutan “The Berkeley Mafa”.
Tidak hanya itu, banyak yang mempunyai dugaan dan
perasaan bahwa dipilihnya Boediono sebagai calon wakil
presidenadalahhasildesakandari“kekuatandariluar”.Istilah
iniyangdipakaiolehBoedionosendiridalampidatonya,yang
merasa selayaknya menggugat penjajahan yang masih ada
dalamabadke21ini,baikyangdariluarmaupunyangdari
dalam.
Dugaan ini bertambah besar setelah Boediono menyatakan
kepada The Jakarta Post tanggal 25 Mei 2009 bahwa
penerimaannya sebagai calon wakil presiden adalah karena
adanya arus besar yang tidak mampu ditolaknya (Boediono
saidhisnominationwasa“bigstream”hecouldnotresist”).
Karena itu, untuk kepentingan seluruh bangsa yang bagian
terbesarnyasedangsangatmenderitakemiskinan,kebodohan,
kurang sehat jasmani dan rokhaninya, keterbelakangan,
“IndonesiaMenggugatJilidII”? 12
apakah betul bahwa dirinya didorong oleh kekuatan asing
untukmenerimapencalonannyasebagaiwakilpresiden?
Untuk kepentingannya sendiri juga, rasanya sangat perlu
beliau memberikan penjelasan yang sejujurnya dan masif
kepadarakyatyangakanmelakukanpilihannyapadatanggal
8Juli2009.
Apakah dalam karirnya yang panjang dalam kedudukan
yang tinggi di birokrasi Boediono ikut berperan dalam
segalasesuatuyangtergambarkandalamtulisanini?
Boediono berkarir dalam kedudukan sangat tinggi dalam
kepemimpinan negara, yaitu berturut-turut sebagai Direktur
BankIndonesia,Menteri/KepalaBappenas,MenteriKeuangan,
Menko Perekonomian, Gubernur BI, dan sekarang Calon
WakilPresidenRIuntukperiode2009-2014.
Banyak yang menilai bahwa Boediono ikut berperan cukup
besardalamsegalasesuatuyangdigambarkandalamtulisan
ini. Maka rasanya beliau perlu menjelaskannya kepada
rakyat,karenaposisinyasebagaicalonwakilpresidendengan
kemungkinansangatbesarakanterpilih.
Bagaimana gambaran penjajahan dan siapa para
pelakunya?
DenganjelasdikatakandalampidatoBoedionobahwadiabad
21 ini penjajahan masih ada. Sayang seribu sayang bahwa
diatidakmenjelaskantentangapadanbagaimanapenjajahan
zamansekarangitu?
Karenaitu,izinkanlahsayamenjelaskannyadaripengenalan
oranglainyangmempelajarinyadenganseksamadanmenurut
saya dapat dipertanggung jawabkan kebenarannya, yaitu
yang ditulis oleh John Pilger dalam bukunya yang berjudul
“IndonesiaMenggugatJilidII”? 1J
“TheNewRulersoftheWorld.”
Saya kutip seakurat mungkin dengan terjemahan ke dalam
bahasaIndonesiaolehsayasendirisebagaiberikut.
“Dalam bulan November 1967, menyusul tertangkapnya
‘hadiah terbesar’, hasil tangkapannya dibagi. The Time-Life
CorporationmensponsorikonperensiistimewadiJenewayang
dalamwaktutigaharimerancangpengambilalihanIndonesia.
Parapesertanyameliputiparakapitalisyangpalingberkuasadi
dunia,orang-orangsepertiDavidRockefeller.Semuaraksasa
korporasi Barat diwakili: perusahaan-perusahaan minyak
dan bank, General Motors, Imperial Chemical Industries,
BritishLeyland,BritishAmericanTobacco,AmericanExpress,
Siemens,Goodyear,TheInternationalPaperCorporation,US
Steel. Di seberang meja adalah orang-orangnya Soeharto
yangolehRockefellerdisebut“ekonoom-ekonoomIndonesia
yangtop”.
“DiJenewa,TimSultanterkenaldengansebutan‘theBerkeley
Mafa’, karena beberapa di antaranya pernah menikmati
beasiswa dari pemerintah Amerika Serikat untuk belajar di
Universitas California di Berkeley. Mereka datang sebagai
peminta-minta yang menyuarakan hal-hal yang diinginkan
oleh para majikan yang hadir. Menyodorkan butir-butir yang
dijualdarinegaradanbangsanya,Sultanmenawarkan:……
buruhmurahyangmelimpah….cadanganbesardarisumber
dayaalam…..pasaryangbesar.”
Di halaman 39 ditulis: “Pada hari kedua, ekonomi Indonesia
telah dibagi, sektor demi sektor. ‘Ini dilakukan dengan cara
yang spektakuler’ kata Jeffrey Winters, guru besar pada
NorthwesternUniversity,Chicago,yangdenganmahasiwanya
yang sedang bekerja untuk gelar doktornya, Brad Simpson
telah mempelajari dokumen-dokumen konperensi. ‘Mereka
membaginya ke dalam lima seksi: pertambangan di satu
“IndonesiaMenggugatJilidII”? 14
kamar, jasa-jasa di kamar lain, industri ringan di kamar lain,
perbankan dan keuangan di kamar lain lagi; yang dilakukan
olehChaseManhattandudukdengansebuahdelegasiyang
mendiktekan kebijakan-kebijakan yang dapat diterima oleh
merekadanparainvestorlainnya.Kitasaksikanparapemimpin
korporasi besar ini berkeliling dari satu meja ke meja yang
lain,mengatakaniniyangkamiinginkan:ini,inidanini,dan
merekapadadasarnyamerancanginfrastrukturhukumuntuk
berinvestasi di Indonesia. Saya tidak pernah mendengar
situasi seperti itu sebelumnya, di mana modal global duduk
dengan para wakil dari negara yang diasumsikan sebagai
negaraberdaulatdanmerancangpersyaratanbuatmasuknya
investasimerekakedalamnegaranyasendiri.
Freeport mendapatkan bukit (mountain) dengan tembaga di
Papua Barat (Henry Kissinger duduk dalam board). Sebuah
konsorsiumEropamendapatnikelPapuaBarat.Sangraksasa
Alcoa mendapat bagian terbesar dari bauksit Indonesia.
Sekelompok perusahaan-perusahaan Amerika, Jepang dan
Perancis mendapat hutan-hutan tropis di Sumatra, Papua
Barat dan Kalimantan. Sebuah undang-undang tentang
penanamanmodalasingyangdenganburu-burudisodorkan
kepada Soeharto membuat perampokan ini bebas pajak
untuk lima tahun lamanya. Nyata dan secara rahasia,
kendali dari ekonomi Indonesia pergi ke Inter Governmental
Group on Indonesia (IGGI), yang anggota-anggota intinya
adalahAmerikaSerikat,Canada,Eropa,Australiadan,yang
terpenting,DanaMoneterInternasionaldanBankDunia.”
DemikiangambaranyangdiberikanolehBradSimpson,Jeffrey
Winters dan John Pilger tentang suasana, kesepakatan-
kesepakatandanjalannyasebuahkonferensiyangmerupakan
titikawalsangatpentingbuatnasibekonomibangsaIndonesia
selanjutnya.
Kalaubarusebelumkrisisglobalberlangsungkitamengenal
“IndonesiaMenggugatJilidII”? 15
istilah “korporatokrasi”, paham dan ideologi ini sudah
ditancapkan di Indonesia sejak tahun 1967. Delegasi
IndonesiaadalahPemerintah.Tetapicounter part-nyacaptain
of industries atauparakorporatokrat.
PARAPERUSAKEKONOMINEGARA-NEGARAMANGSA
BenarkahsinyalemenJohnPilger,JosephStiglitzdanmasih
banyakekonomASkenamaanlainnyabahwahutanglahyang
dijadikaninstrumenuntukmencengkeramIndonesia?
Dalamrangkaini,sayakutipbukuyangmenggemparkan.Buku
iniditulisolehJohnPerkinsdenganjudul:“TheConfessions
of an Economic Hit man”, atau “Pengakuan oleh seorang
PerusakEkonomi”.BukuinitercantumdalamNewYorkTimes
bestseller list selama7minggu.
Saya kutip sambil menterjemahkannya ke dalam bahasa
Indonesiasebagaiberikut:
Halaman 12: “Saya hanya mengetahui bahwa penugasan
pertama saya di Indonesia, dan saya salah seorang dari
sebuah tim yang terdiri dari 11 orang yang dikirim untuk
menciptakan cetak biru rencana pembangunan pembangkit
listrikbuatpulauJawa.”
Halaman13:“Sayatahubahwasayaharusmenghasilkanmodel
ekonometrik untuk Indonesia dan Jawa”. “Saya mengetahui
bahwastatistikdapatdimanipulasiuntukmenghasilkanbanyak
kesimpulan,termasukapayangdikehendakiolehanalisatas
dasarstatistikyangdibuatnya.”
Halaman 15: “Pertama-tama saya harus memberikan
pembenaran (justifcation) untuk memberikan hutang yang
sangat besar jumlahnya yang akan disalurkan kembali ke
MAIN(perusahaankonsultandimanaJohnPerkinsbekerja)
“IndonesiaMenggugatJilidII”? 16
danperusahan-perusahaanAmerikalainnya(sepertiBechtel,
Halliburton, Stone & Webster, dan Brown & Root) melalui
penjualanproyek-proyekraksasadalambidangrekayasadan
konstruksi.Kedua,sayaharusmembangkrutkannegarayang
menerima pinjaman tersebut (tentunya setelah MAIN dan
kontraktorAmerikalainnyatelahdibayar),agarnegaratarget
ituuntukselamanyatercengkeramolehkreditornya,sehingga
negara penghutang (baca: Indonesia) menjadi target yang
empuk kalau kami membutuhkan favours, termasuk basis-
basis militer, suara di PBB, atau akses pada minyak dan
sumberdayaalamlainnya.”
Halaman15-16:“Aspekyangharusdisembunyikandarisemua
proyektersebutialahmembuatlabasangatbesarbuatpara
kontraktor,danmembuatbahagiabeberapagelintirkeluarga
dari negara-negara penerima hutang yang sudah kaya dan
berpengaruhdinegaranyamasing-masing.Dengandemikian
ketergantungan keuangan negara penerima hutang menjadi
permanen sebagai instrumen untuk memperoleh kesetiaan
daripemerintah-pemerintahpenerimahutang.Makasemakin
besarjumlahhutangsemakinbaik.Kenyataanbahwabeban
hutangyangsangatbesarmenyengsarakanbagiantermiskin
dari bangsanya dalam bidang kesehatan, pendidikan dan
jasa-jasa sosial lainnya selama berpuluh-puluh tahun tidak
perlumasukdalampertimbangan.”
Halaman 15: “Faktor yang paling menentukan adalah
Pendapatan Domestik Bruto (PDB). Proyek yang memberi
kontribusi terbesar terhadap pertumbuhan PDB harus
dimenangkan. Walaupun hanya satu proyek yang harus
dimenangkan,sayaharusmenunjukkanbahwamembangun
proyek yang bersangkutan akan membawa manfaat yang
unggulpadapertumbuhanPDB.”
Halaman 16: “Claudia dan saya mendiskusikan karakteristik
dariPDByangmenyesatkan.MisalnyapertumbuhanPDBbisa
“IndonesiaMenggugatJilidII”? 17
terjadiwalaupunhanyamenguntungkansatuorangsaja,yaitu
yang memiliki perusahaan jasa publik, dengan membebani
hutangyangsangatberatbuatrakyatnya.Yangkayamenjadi
semakin kaya dan yang miskin menjadi semakin miskin.
Statistikakanmencatatnyasebagaikemajuanekonomi.”
Halaman 19: “Sangat menguntungkan buat para penyusun
strategi karena di tahun-tahun enam puluhan terjadi
revolusi lainnya, yaitu pemberdayaan perusahaan-perusahaan
internasionaldanorganisasi-organisasimultinasionalsepertiBank
DuniadanIMF.”
John Perkins seorang pembual atau fktif?
Para ekonom kelompok mazhab tertentu yang berfungsi
sebagaiagenpelaksanadarikorporatokrasidanprinsip-prinsip
WashingtonConcensussertamertamengatakanbahwaJohn
Perkins itu tidak ada. Itu adalah orang yang fktif. Kalaupun
adaorangnya,diaseorangpemimpidanpembual(fantast).
Kalau memang demikian, bagaimana mungkin bukunya
tercantum dalam best seller list selama enam minggu di
NewYorkTimes.Seminggusetelahdijualditoko-tokobuku,
sudah tercantum sebagai buku terlaris nomor 4 di amazon.
com. Dalam waktu kurang dari 14 bulan, bukunya telah
diterjemahkankedalam25bahasa.Copyright-nyatelahdibeli
oleh perusahaan flm utama di Hollywood.
Saya bertemu dengan seorang insinyur Indonesia yang
sampai sekarang masih bekerja di BUMN. Tidak etis buat
sayamenyebutkannamanya.Beliaumenceriterakankepada
sayabahwabeliaulahyangmenjadipartnernyaJohnPerkins
diBandungditahun1970.Ketikaitubeliautidakmengetahui
bahwaPerkinssedangmelakukanperusakanekonomi.Ketika
beliaumembacabukunya,begitumarahnya,sehinggasegera
membuatsangatbanyakcopy yangdibagi-bagikan.
“IndonesiaMenggugatJilidII”? 18
Mereka yang menyebut John Perkins seorang pembual
sekaranginibanyaksekaliyangmemegangkekuasaandalam
bidang ekonomi. Mengapa tidak ada kebutuhan mencari
danmenanyakankepadainsinyuryangditahun1970tanpa
mengetahuimaksuddantujuanJohnPerkinsbekerjasebagai
mitranyadikantorPLNBandung?
AGameasoldasEmpire
John Perkins mengakui bahwa sangatlah sulit menemukan
penerbit,walaupunsetiapkaliparapenerbititumenunjukkan
perhatianyangsangatbesar.Tetapipadaakhirnyamenolak.
Barupenerbityangke26menyetujuimenerbitkannya.
Apaalasannyadiceriterakandalamkatapengantarnyadalam
buku terbaru yang ditulis oleh 12 para perusak ekonomi
lainnya.Judulbukunyatelahsayakemukakan,yaitu“AGame
As OldAs Empire”, dan sub judulnya “The Secret World of
EconomicHitMenandtheWebofGlobalCorruption.”
Semakinkokohnyaneolibdengankonsekuensinya
NamunsayangbahwasejakIbuMegawatimenjabatsebagai
Presiden, kendali ekonomi jatuh ke tangan Berkeley Mafa
lagi, yang sejak itu kendali serta kekuasaannya bertambah
mutlak.
Konsekuensinya adalah semakin kokohnya liberalisme dan
mekanisme pasar primitif, dan semakin kokohnya pengaruh
asingdalammenentukankebijakan-kebijakanekonomikita.
Tingkatkerusakannyasudahsangatparah.Jumlahmanusia
Indonesia yang menderita kemiskinan sudah melampaui
batas-batasyangwajar.Infrastruktur,barangdanjasapublik
yangkrusialbuattingkatkehidupanyangwajarsudahmerosot
“IndonesiaMenggugatJilidII”? 19
jauhdibawahyangdibutuhkansecaraminimal.
Elit bangsa yang sedang berkuasa dengan dukungan
dari pembentukan opini publik di dunia semakin gencar
menggambarkan bangsa Indonesia yang semakin maju dan
sejahtera. Indikator-indikator yang dikemukakannya adalah
stabilitas nilai tukar rupiah, PDB yang meningkat, infasi yang
terkendalidansejenisnya.
Bahwakesemuanyaitumenyesatkandapatkitapahamikalau
kita membandingkannya dengan indikator-indikator yang
sama selama penjajahan oleh Belanda selama berabad-
abad. Dalam zaman penjajahan segala sesuatunya serba
teraturdanstabil.PDBHindiaBelandameningkatterus.Itulah
sebabnya sampai sekarang kita menyaksikan Wassenaar
denganvila-vilayangbesardanmewahdandisebutsebagai
daerah pemukimannya oud Indische gasten (para mantan
tamudiHindiaBelanda).CirikhasAmsterdamsebagaipusat
perdagangan ketika itu ialah rumah-rumah besar sepanjang
sungai-sungai buatan. Kebanyakan dari gedung-gedung
itu sekarang berfungsi sebagai perkantoran. Dalam zaman
penjajahan adalah rumah-rumah tinggalnya para keluarga
yang memperoleh kekayaannya dari Hindia Belanda. Tetapi
rakyatIndonesiahidupdengansegobangsehari.
Sekarang juga begitu, kota-kota besar, terutama Jakarta
berlimpah-ruah dengan kemewahan. Indikator-indikator
yang selalu didengung-dengungkan serba stabil, walaupun
ketertiban dan kebersihannya masih kalah dibandingkan
dengan zaman penjajahan Belanda. Pesawat udara penuh
penumpang, mal-mal mewah padat pengunjung dan jalan-
jalan raya macet dengan mobil-mobil mewah. Tetapi ketika
BankDuniamengumumkanbahwagariskemiskinansekarang
ditetapkanUS$2perhariperorang,50%darirakyatIndonesia
menjadimiskin.
“IndonesiaMenggugatJilidII”? 20
BuatsayadansangatbanyakorangIndonesialainnyayang
peduli dan prihatin terhadap nasib bangsa, inilah gambaran
negaraIndonesiayangdijajahsecaramodern.Kalauiniyang
akandigugatolehBoedionoseandainyadiamenangmenjadi
wakilpresiden,bersyukurlahkita.
Perangolongankemapananyangtidaktampaklagi
Kondisiinitidakdapatdibiarkanolehgolongankemapananyang
masihmempunyaihatinurani.Mengapagolongankemapanan
yang harus membalikkan proses yang menjuruskan bangsa
kitakedalamjurangpenderitaan,kemiskinandankenistaan?
Karenamerekayangmiskindanmenderitatidakmempunyai
kekuatanapapununtukmemperbaikinasibnya.Merekahanya
mampumenerawangkelangitdenganwajahtanpaekspresi
sambilmenerimakematiannyakarenakekuranganmakanan
danpelayanankesehatanyangpalingmendasar.
Golongan kemapanan yang dirinya sendiri tidak mempunyai
persoalan untuk hidup serba kecukupan, tetapi hatinya
terusik, tidak tega menyaksikan penderitaan sesama anak
bangsanya itulah yang harus bergerak membela sesama
anakbangsanyayangterinjak,terpinggirkandanternistakan
olehelitbangsanyasendiriyangsedangberkuasa,danlebih
senang menjadi kroni dan kompradornya para penghisap
bangsa-bangsa lain. Kelompok seperti inilah yang berhasil
memerdekakan bangsa Indonesia dari penjajahan. Para
pendirinegarakitaadalahorang-orangberpendidikantinggi,
yang kalau mau menjadi pegawai negeri (ambtenaar) pada
pemerintahan Hindia Belanda menikmati gaji yang sangat
tinggi.Tetapimerekamemilihkeluarmasukpenjaraketimbang
menjadi pegawai negeri yang menjadi bagian dari birokrasi
yangmenghisapbangsanyasendiri.
Golongan kemapanan yang peduli, prihatin dan membela
kepentinganyangtertindassudahsangatlamatidaktampak
“IndonesiaMenggugatJilidII”? 21
diIndonesia.
PROSES PENJAJAHAN DALAM PERUNDANG-
UNDANGAN DAN KEBIJAKAN-KEBIJAKAN OLEH ELIT
BANGSAINDONESIASENDIRI
Menujukearahliberalisasisejauhmungkin
Sejak Republik Indonesia berdiri sampai tahun 1967 tidak
pernahadarinciankonkretdariketentuanpasal33UUD1945
yangbunyinya:“Barangyangpentingbaginegaradancabang-
cabang produksi yang menguasai hajat hidup orang banyak
dikuasaiolehnegaradandipergunakanuntuksebesar-besar
kemakmuranrakyat.”
Undang-undangnomor1tahun1967

Penjabaranyangkonkretsampaibisamenjadiperaturantidak
pernahadasampaitahun1967.DalamtahunituterbitUUno.
1tahun1967tentangPenanamanModalAsing.TerbitnyaUU
tersebut sebagai tindak lanjut dari Konferensi Jenewa bulan
November1967.
Saya kutip pasal 6 ayat 1 yang berbunyi: “Bidang-bidang
usaha yang tertutup untuk penanaman modal asing secara
pengusahaan penuh ialah bidang-bidang yang penting bagi
negara dan menguasai hajat hidup rakyat banyak sebagai
berikut:
a.pelabuhan-pelabuhan;
b.produksi,transmisidandistribusitenagalistrikuntukumum;
c.telekomunikasi;
d.pelayaran;
e.penerbangan;
f.airminum;
g.keretaapiumum;
“IndonesiaMenggugatJilidII”? 22
h.pembangkitantenagaatom;
i.massmedia.“
UU tentang Penanaman Modal Dalam Negeri di tahun
1968
Undang-undangnomor6tahun1968mengenaiPenanaman
Modal Dalam Negeri pasal 3 ayat 1 sudah mengizinkan
investorasingmemasukicabang-cabangproduksiyangjelas
disebut “menguasai hajat hidup orang banyak” itu asalkan
porsinya modal asing tidak melampaui 49%. Namun ada
ketentuanbahwaporsiinvestorIndonesiayang51%ituharus
ditingkatkanmenjadi75%tidaklebihlambatdaritahun1974.
PeraturanPemerintahnomor20tahun1994
Ditahun1994terbitperaturanpemerintahnomor20dengan
pasal 5 ayat 1 yang isinya membolehkan perusahaan asing
melakukankegiatanusahayangtergolongpentingbaginegara
dan menguasai hajat hidup rakyat banyak, yaitu pelabuhan,
produksi dan transmisi serta distribusi tenaga listrik umum,
telekomunikasi, pelayaran, penerbangan, air minum, kereta
apiumum,pembangkitantenagaatomdanmassmedia.”
Pasal 6 ayat 1 mengatakan: “Saham peserta Indonesia
sebagaimana dimaksud dalam pasal 2 ayat (1) huruf a
sekurang-kurangnya5%(limaperseratus)dariseluruhmodal
disetorperusahaanpadawaktupendirian.”
Apaartinyaini?Artinyaadalahbahwapasal6ayat1UUno.
1/1967 mengatakan bahwa perusahaan asing tidak boleh
memasukibidangusahayangtergolongpentingbaginegara
danmenguasaihajathiduporangbanyakbesertaperinciannya.
UU no. 6/1968 pasal 3 ayat 1 secara implisit mengatakan
bahwaasingbolehmemilikidanmenguasaisampai49%.UU
no.4/1982melarangasingsamasekalimasukdidalambidang
“IndonesiaMenggugatJilidII”? 2J
usaha pers. PP 20/1994 lalu dengan enaknya mengatakan
bahwakalaudidalamperusahaankandunganIndonesianya
adalah5%sudahdianggapperusahaanIndonesiayangdapat
melakukankegiatanusahayangtergolongpentingbaginegara
danmenguasaihajathiduprakyatbanyakbesertaperinciannya,
termasukmediamassaJadiPPno.20/1994menentangUUno.
1/1967,menentangUUno.6/1968,menentangUUno.4/1982
danmenentangjiwapasal33UUD1945.
DalamaspeklainPP20/1994jugamenentangUUno.6/1968
pasal 6 yang berbunyi: “Waktu berusaha bagi perusahaan
asing,baikperusahaanbarumaupunlama,dibatasisebagai
berikut:
a.Dalambidangperdaganganberakhirpadatanggal31
Desember1997;
b.Dalambidangindustriberakhirpadatanggal31Desember
1997;
c.Dalambidang-bidangusahalainnyaakanditentukanlebih
lanjutolehpemerintahdenganbataswaktuantara10dan
30tahun.”
PPno.20/1994menentukanbahwabatasantaraboleholeh
asing atau tidak adalah kepemilikan oleh pihak Indonesia
dengan 5%. Tidak ada lagi pembatasan waktu tentang
dikuranginyaporsimodalasing.
Yang sangat menyakitkan juga ialah diambilnya rumusan
pasal 33 UUD 1945 secara mentah-mentah, yang lalu
dikatakan bahwa itu sekarang boleh ada di tangan asing
dengan kandungan Indonesia 5%. Jadi seperti menantang
ataumeremehkanUUD1945.
Infra Struktur Summit I
PosisinyahariiniialahyangdikumandangkandiInfraStruktur
“IndonesiaMenggugatJilidII”? 24
SummitolehMenkoPerekonomianketikadijabatolehAburizal
Bakrie di Hotel Shangrilla. Intinya mengumumkan kepada
masyarakat bisnis dan korporasi di dunia bahwa Indonesia
membuka pintunya lebar-lebar buat investor asing untuk
berinvestasidenganmotifmemperolehlabadalambidanginfra
strukturdanbarang-barangpubliklainnya.Kepadamasyarakat
bisnis dan korporasi diberitahukan bahwa kebijakan akan
dijuruskanpadaterbukanyahampirsemuapublic goods and
services bagiinvestorswasta,termasukinvestorasing.
Infra Struktur Summit II
DalamInfraStrukturSummitIIyangMenkoPerekonomiannya
dijabat oleh Boediono, pengumuman pendahulunya diulangi
lagi. Namun sekarang ditambah dengan penegasan bahwa
tidakakanadaperbedaanperlakuansedikitpunantarainvestor
asingdaninvestorIndonesia.
Kebijakanpemerintahdalambidanginfrastrukturdanpublic
goods padaumumnyahanyaakanditanganiolehpemerintah
kalau penyediaannya tidak menguntungkan secara komersial.
Melaluireformasisektorallambatlaunsemuabarangpublikdaninfra
struktur akan dibuat menguntungkan secara komersial, sehingga
bisadisediakanolehswastadenganmotifmencarilaba.
IniberartibahwarakyatIndonesiaakandijuruskanhanyadapat
menikmati barang dan jasa publik dengan membayar harga
yang tingginya memungkinkan investor swasta memperoleh
laba daripadanya. Falsafah bahwa perlu ada barang dan
jasapublikyangpenyediaannyadiadakanatasdasargotong
royong, yaitu dibiayai oleh seluruh rakyat sesuai dengan
kemampuannya masing-masing melalui sistem perpajakan
lambat laun harus diperkecil. Semuanya harus diserahkan
padamekanismepasar.Dengandemikian,secaraperlahan-
lahan bangsa Indonesia yang miskin tidak akan dapat
menikmatibarangdanjasapublikdengancuma-cuma.
“IndonesiaMenggugatJilidII”? 25
Apa lagi kalau kebijakan semacam ini ini tidak bersifat
liberalisme yang primitif dan masih liar? Di seluruh dunia
kita mengenal jaringan jalan raya bebas hambatan sangat
luasyangdigunakanolehsiapasajadengancuma-cuma.Di
Indonesiatidak.Namanyasaja“jalantol”,yangimplisitberarti
barangsiapainginmenggunakanjalanrayabebashambatan
harusmembayartariftol.
Undang-Undang tentang Penanaman Modal nomor 25
tahun2007
Undang-Undangtersebutmenggantikansemuaperundangan
dan peraturan dalam bidang penanaman modal. Butir-butir
pokoknyadapatdikemukakansebagaiberikut.
Pasal 1 yang mendefnisikan “Ketentuan Umum” yang
mempunyai banyak ayat itu intinya menyatakan tidak ada
perbedaanantaramodalasingdanmodaldalamnegeri.
Pasal 6 mengatakan: “Pemerintah memberikan perlakuan
yang sama kepada semua penanam modal yang berasal
darinegaramanapunyangmelakukankegiatanpenanaman
modaldiIndonesia...”
Pasal7menegaskanbahwa“Pemerintahtidakakanmelakukan
tindakannasionalisasiataupengambilalihanhakkepemilikan
penanamanmodal,kecualidenganundang-undang.”
Pasal8ayat3mengatakan“Penanammodaldiberihakuntuk
melakukan transfer dan repatriasi dalam valuta asing”, yang
dilanjutkandenganperinciantentangapasemuayangboleh
ditransfer, yaitu sebanyak 12 jenis, dari a sampai dengan l,
yangpraktistidakadayangtidakbolehditransferkembalike
negaraasalnya.
“IndonesiaMenggugatJilidII”? 26
Pasal12mengatakanbahwasemuabidangusahaataujenis
usaha terbuka bagi kegiatan penanaman modal, kecuali
produksi senjata dan bidang usaha yang secara eksplisit
dinyatakantertutupberdasarkanundang-undang.
Hak atas tanah menjadi 95 tahun untuk Hak Guna Usaha, 80
tahununtukHakGunaBangunandan70tahununtukHakPakai.
KECENDERUNGANLIBERALISASIPENUHDANSURVIVAL
OF THE FITTEST
Denganseluruhrangkaiankebijakanyangtelahdikemukakan
tadi, menjadi sangat jelas garis kebijakan yang konsisten
sejak tahun 1967. Kebijakan itu ialah semakin mengecilnya
peranpemerintahdalambidangpengadaanbarangdanjasa
yang tergolong dalam barang dan jasa publik, atau barang
dan jasa yang pengadaannya membutuhkan dana sangat
besar, tetapi merupakan kebutuhan pokok manusia. Karena
kebutuhan dana yang sangat besar itu, sifatnya selalu
menjadimonopolistik.Karenasifatmonopolistikitudipegang
sepenuhnyaolehperusahaanswastayangmotifnyamencari
laba, maka rakyat yang sangat membutuhkannya harus
membayar dengan harga yang tingginya mencukupi untuk
memberi laba yang menarik bagi investor swasta. Karena
itu, yang mampu menggunakan barang dan jasa publik
ialah perusahaan-perusahaan besar dan perorangan yang
tergolongkaya.
Kewajibanpemerintahuntukmengadakannyasecaragotong
royongmelaluiinstrumenpajaksetahapdemisetahapdibuat
minimal. Banyak sekali barang dan jasa publik yang akan
dijadikan obyek mencari laba, dan dalam berlomba mencari
laba itu tidak ada lagi perbedaan antara investor asing dan
investorIndonesia.
Semuanya didahului dengan mempengaruhi pikiran dan
“IndonesiaMenggugatJilidII”? 27
pembentukan opini publik dalam bidang mekanisme pasar,
liberalisasi, swastanisasi dan globalisasi yang cakupannya
sebanyak dan tingkat keterbukaannya sejauh mungkin,
yang harus memusnahkan nasionalisme dan patriotisme.
Elit negara-negara mangsa harus diyakinkan dan diberi
pemahaman bahwa nasionalisme dan patriotisme sudah
sangatketinggalanzaman.Orangmodernharusmemahami
globalisasiyangmerupakanthe borderless world.Nasionalisme
dan patriotisme bagaikan katak dalam tempurung dengan
wawasan yang sangat sempit. Demikianlah pikiran, paham,
penghayatanyangberlakupadaelitbangsayangmemegang
kekuasaanekonomisejaktahun1967sampaisekarang.
Pusat dari indoktrinasi paham seperti dikemukakan di atas
adalahAmerika Serikat. Namun tengoklah apa semua yang
dilakukan oleh Amerika Serikat dalam bidang proteksi,
melindungi warga negaranya sendiri. Tidak saja defensif
dengan menutup pintu masuk negaranya dalam bidang apa
sajadandengantarifsetinggiberapasajakalaudirasaperlu.
Tetapi kalau perlu melakukan agresi, menangkap Presiden
Noriega di negaranya sendiri yang lantas dipenjarakan di
AS.Irakdihancurleburkandengandalihmempunyaisenjata
pemusnah massal yang akan dipakai untuk memusnahkan
umat manusia. Tidak kurang dari Tim Ahli Perserikatan
Bangsa-BangsayangdiketuaiolehHansBlik,yangsebelum
invasiASkeIrakmenyatakanbahwadiIraktidakadasenjata
pemusnahmassal.
TohIrakdiserbu,PresidenSaddamHuseindihukumgantung,
semua peninggalan sejarah yang begitu pentingnya untuk
peradaban umat manusia dimusnahkan, manusia dalam
jumlah sangat besar terbunuh, yang akhirnya pasukan AS
sendiritidakmenemukansenjatapemusnahmassal.
Sayamengemukakaninisemuanyahanyamembeoparaelit
AS sendiri yang menyuarakan hal-hal yang sama. Bahwa
“IndonesiaMenggugatJilidII”? 28
sayakutipdalamtulisaniniuntukmenggambarkanbahwadi
kalangan elit mashab tertentu di Indonesia berlaku pepatah
“Gurukencingberdiri,muridkencingberlari.”
Beberapakenyataananehyangsamasekalitidaklogis
Sampai sekarang, sekitar 90% dari minyak kita dieksploitasi
oleh perusahaan-perusahaan minyak asing. Tambang kita
dikedukolehpemodalasing,danhasilyangmilikmerekaitu
dicatatolehBiroPusatStatistikkitasebagaiProdukDomestik
BrutoIndonesia.BangsaIndonesiakebagianroyaltidanpajak
yang relatif sangat kecil. Hasil tambang dan mineral sangat
mahal yang milik pemodal asing itu ketika diekspor dicatat
oleh Biro Pusat Statistik sebagai Ekspor Indonesia yang
meningkat. Sejak tahun 1967, tanpa membunuh siapapun,
elit bangsa Indonesia sendiri telah menyerahkan segala-
galanyakepadakekuatan-kekuatannonIndonesiayanglebih
kuatdanlebihraksasa.Apakahitukarenakebodohan,karena
pengkhianatan,ataukahkarenakeyakinanbahwaliberalisme,
dan fundamentalisme pasar dihayatinya bagaikan agama
adalah hal yang tidak jelas. Inikah yang akan digugat oleh
Boediono? Dan apakah yang akan digugat para teknokrat
yang dalam konperensi Jenewa bulan November tahun
1967dipimpinolehProf.WidjojoNitisastro?Dimanaposisi
Boediono antara para teknokrat yang disebut “Bekerley Mafa”
danparaekonomyangdisebut“BlogPerubahan.”
LIBERALISASIYANGJELASMELANGGARKONSTITUSI
Liberalisasidanmekanismepasaryangdihayatinyabagaikan
“agama” telah diberlakukan sedemikian jauhnya, sehingga
terang-terangan melanggar Konstitusi, memberlakukan
kebijakan yang menyesatkan dan membuat rakyat sangat
sengsara.
Mahkamah Konstitusi (MK) telah menyatakan bahwa pasal
“IndonesiaMenggugatJilidII”? 29
28 ayat (2) Undang-Undang nomor 22 tahun 2001 tentang
Minyak dan Gas Bumi bertentangan dengan Konstitusi.
Pemerintah dan DPR sama sekali tidak menghiraukannya.
Bahkanseolah-olahmenantang,hargaBBMdinaikkandengan
mengacupadapasal28didalamundang-undangnomor22
tahun 2001 tersebut, yang oleh MK dianggap paling krusial
dalam menentang amanat Konstitusi. Ketua MK menulis
surat kepada Presiden bahwa kebijakan menaikkan harga
BBM sampai 126 %, karena harus ekuivalen dengan harga
minyak mentah yang terbentuk melalui mekanisme pasar
di New York Mercantile Exchange (NYMEX) bertentangan
denganKonstitusikita.Surattersebuttidakdihiraukantanpa
konsekuensi buat Pemerintah, maupun DPR maupun DPD.
KetikaituBoedionoMenkoPerekonomian,
Demi mekanisme pasar yang mutlak tanpa pandang bulu,
caranya memberi argumen dan penjelasan kepada rakyat
jugamelaluipenyesatandankebohongan.Dikatakanbahwa
kalauhargaBBMtidakdisamakandenganekuivalennyaharga
minyakmentahyangterbentukdiNYMEX,pemerintahharus
mengeluarkanuangRp.115trilyununtukmensubsidi.Uangitu
tidakada.MakahargaBBMdinaikkan.Sebagaicontoh,harga
bensinpremiumdinaikkandariRp.2.700perlitermenjadiRp.
4.500perliter.Ketikaitu,hargaminyakmentahdiNewYork
US$ 60 per barrel. Dengan kenyataan bahwa biaya-biaya
untukpenyedotan,pengilangandantransportasisebesarUS
10perbarrelatauRp.630perliter(denganasumsikursUS
1 = Rp. 10.000), harga bensin premium yang Rp. 4.500 per
litersamadenganhargaminyakmentahsebesarRp.61,5per
barrel(1barrel=159liter).
Kita membaca dan menyaksikan betapa bagian terbesar dari
rakyat serta merta menjadi miskin dan sangat menderita.
Bersamaandenganitukitasaksikanbermunculannyastasiun-
stasiunpenjualanbensinolehShell,Petronas,yangakandisusul
denganperusahaan-perusahaanminyakasinglainnya.
“IndonesiaMenggugatJilidII”? J0
Dalam menaikkan harga BBM, Pemerintah mengemukakan
dan menjelaskannya kepada publik menggunakan istilah
“subsidi” yang disamakan dengan pengeluaran uang tunai,
padahaltidakdemikiankenyataannya.Kalaukitamengambil
bensinpremiumsebagaicontoh,uangtunaiyangdikeluarkan
Rp. 630 per liter. Seperti telah berkali-kali dijelaskan, ketika
itu nilai tukar rupiah adalah Rp. 10.000 per dollarAS. Biaya
lifting, refning dantransporting seluruhnyaUS$10perbarrel
dansepertikitaketahui,1barrrel=159liter.
Sebelum dinaikkan, harga bensin premium Rp. 2.700 per
liternya,sehinggauntuksetiapliternya,pemerintahkelebihan
uangtunaisebanyakRp.2.070.Tetapikepadarakyatdikatakan
bahwa uang yang dikeluarkan sama dengan “subsidi” yang
bukanpengeluaranuangtunai,tetapiperbedaanantaraharga
Rp.2.700denganRp.4.500perliter(yangsamadenganUS$
61,5perbarrel).MakabelumlamaberselangIMFmenyatakan
bahwaPemerintahIndonesiasangatkayauangtunai,karena
ketambahan Rp. 15 trilyun sebagai hasil menaikkan harga
BBM.
MEKANISMEPASARYANGUNGGULTELAHMEMASUKKAN
BANYAKINTERVENSIOLEHPEMERINTAH
Bahwasistemmekanismepasarterbuktiungguldibandingkan
dengan sistem perencanaan sentral seperti yang diterapkan
oleh negara-negara komunis memang benar validitasnya.
Namunmekanismepasaryang“ditemukan”olehAdamSmith
danditulisditahun1776telahmengalamibanyakperubahan.
Perubahan-perubahan itu ialah tidak ditabukannya campur
tanganpemerintahyangdibutuhkan,agarmekanismepasar
yang efsien dapat dikombinasikan dengan intervensi berupa
kebijakan-kebijakan pemerintah dengan maksud melindungi
yang lemah dan memperoleh keadilan serta pemerataan
dalammenikmatipertumbuhanekonomi.
“IndonesiaMenggugatJilidII”? J1
Dalampidatonyatanggal15Mei2009diBandungBoediono
mengatakan dengan jelas bahwa: “Perekonomian Indonesia
tidak dapat seluruhnya diserahkan kepada pasar bebas.....
dsb.”,yanglangsungdisambungdengan“Negaratidakboleh
terlalu banyak campur tangan, sebab itu akan mematikan
kreativitas.Tetapinegarajugatidakbolehhanyatidur.”Buat
saya ini ideologi bukanisme, yaitu bukan diserahkan pasar
bebas,tetapijugabukandiaturterlalubanyakolehpemerintah.
Yangtidakterlalubanyakituyangsepertiapa?
Berkaitan dengan kata “tidur” yang dipakai oleh Boediono,
seniorsemashabdenganBoedionosecaraberkelakarpernah
mengatakanbahwa“PDBtumbuhsepanjangmalamsampai
pagihariketikapemerintahtidur.”
Sepertidapatkitalihatdariuraiandiatas,secarasistematis
praktik penyelenggaraan negara dalam bidang ekonomi
diarahkan pada kapitalisme, liberalisme dan mekanisme
pasardalambentuknyayangpalingawal,palingprimitifdan
sudah sangat lama ditinggalkan oleh negara-negara Eropa
BaratdanAmerikaSerikat.
MaksudnyatiadalainuntukmenjadikanIndonesialahanyang
suburuntukdihisapdandijadikansapiperahan.
Dengansistemtersebutyangmenangadalahpemilikmodal
besardanyangkuat.Kompetisiyangmelekatpadamekanisme
pasartidakdijadikankompetisiyangberadab,tetapidibiarkan
menjadikompetisiyangmenganuthukumrimba,yangmenjadi
kompetisisalingmemotongleherataucut throat competition.
Hasilnyaadalahsurvival of the fttest,sepertiyangdapatkita
lihat di Indonesia sekarang ini. Walaupun hampir 64 tahun
sudah merdeka secara politik, namun kemerdekaan yang
diidam-idamkan sebagai pintu gerbang emas menuju pada
kemakmurandankesejahteraanyangadilbuatseluruhrakyat
“IndonesiaMenggugatJilidII”? J2
semakinjauhdarikenyataan.
PENGHANCURANMELALUISISTEMKEUANGAN
Kalau tadi disebutkan peran pemerintah yang semakin
minimal dalam produksi dan distribusi barang dan jasa,
walaupun termasuk kategori barang dan jasa publik, tidak
kalah pentingnya ialah liberalisasi dalam bidang keuangan.
Justrusisteminilahyangmerupakanfrontier untukmembuat
negara-negaramangsatergantungdandikendalikan.
Dalam buku yang tadi telah disebut, yaitu “A GameAs Old
As Empire” Steven Hiatt sebagai editornya menulis bahwa
“.....pembayaran dari negara-negara dunia ketiga berjumlah
sekitar US$ 375 milyar per tahun atau 20 kali lebih besar
darijumlahuangyangditerimanyadarinegara-negarakaya.
Sistem ini juga disebut Marshall Plan yang terbalik, dengan
negara-negara dari belahan Selatan dunia memberikan
subsidi kepada negara-negara kaya di belahan Utara dunia,
walaupunseparuhdarimanusiadiduniahidupdenganUS$2
perhari.”(halaman19).
Indonesiamasukkedalamjebakanhutang(debt trap)tersebut.
Sejaktahun1967dibentukperkumpulandarinegara-negara
kaya yang disebut Inter Governmental Group on Indonesia
(IGGI)yangberubahnamamenjadiCGI.Pekerjaannyahanya
memberihutangsetiaptahunnyakepadaIndonesia.Dengan
hutang yang tanpa henti diberikannya sejak tahun 1967
sampaisekarang,bangsaIndonesiatidakbertambahmakmur
dansejahterasecaraberkeadilan.
Seperti telah disinggung tadi, belum lama berselang Bank
Dunia mengumumkan bahwa garis kemiskinan sekarang
pendapatan sebesar US$ 2 per orang per hari. Karena itu,
menurut Kantor Perwakilan Bank Indonesia di Jakarta, 50%
darirakyatIndonesiamiskin.
“IndonesiaMenggugatJilidII”? JJ
Dampak dari jebakan hutang sudah lama sangat terasa.
Pertama tentunya besarnya jumlah hutang luar negeri itu
sendiri yang sudah melampaui batas-batas kewajaran kalau
dihitung dengan ukuran Debt Service Ratio (DSR). Tetapi
pemerintahkemudianmenyajikanangkahutangnegarayang
dinyatakan dalam persen dari PDB yang relatif lebih kecil.
Permainanstatistiksepertiinidiberlakukanpadasemualini.
WalaupunPemerintahdapatmenunjukkanangkahutangyang
terus berkurang kalau dinyatakan dalam persen dari PDB,
namun pos pengeluaran APBN untuk pembayaran cicilan
hutangpokokdanbungamengambilporsiterbesar.Akibatnya
Pemerintah tidak dapat memberikan yang minimal kepada
rakyatnya dalam memenuhi kebutuhan hidup yang paling
mendasar seperti pendidikan, pelayanan kesehatan dasar,
penyediaanairbersih,listrikdanlingkunganyangsehat.
KrisisMoneter/Ekonomi1997danIMF
Sistem ekonomi, terutama sistem moneternya yang sudah
dibuat sangat terbuka dan liberal akhirnya mengakibatkan
krisismoneterdanekonomiditahun1997yangdisusuldengan
depresiyangcukuphebat.Kondisimoneterdankepercayaan
terhadapIndonesiahancur.RupiahmerosotnilainyadariRp.
2.400perdollarmenjadiRp.16.000perdollar.Kepercayaan
dunia internasional maupun para pengusaha Indonesia
sendiri merosot sampai nol. Dalam kondisi seperti itu
IndonesiasebagaianggotaIMFmenggunakanhaknyaminta
bantuannya, yang diberikan dalam bentuk Extended Fund
Facility atau yang lebih terkenal dengan sebutan program
Letter of Intent.
Pada akhir pemerintahan Megawati sebuah badan evaluasi
independendidalamtubuhIMFyangbernamaIndependent
Evaluation Offce mengakui bahwa IMF telah melakukan
“IndonesiaMenggugatJilidII”? J4
banyakkesalahandiIndonesia.
DiIndonesia,kesalahanyangpalingmencolokialahdengan
ditutupnya 16 bank tanpa persiapan yang matang dengan
akibat BLBI sebesar Rp. 144 trilyun, Obligasi Rekapitalisasi
Perbankan sebesar Rp. 430 trilyun beserta kewajiban
pembayaran bunganya dengan jumlah Rp. 600 trilyun, atau
seluruh beban menjadi Rp. 144 trilyun BLBI, Rp. 430 trilyun
ObligasiRekap.danminimalRp.600trilyunbebanbunganya,
atau keseluruhannya Rp. 1.174 trilyun. Kalau kurs dollarAS
kitaambilRp.10.000perdollar,jumlahiniekuivalendengan
117,4milyardollarAS.
OR adalah surat pengakuan hutang oleh pemerintah yang
dipakaiuntukmeningkatkankecukupanmodaldaribank-bank
yang dirusak oleh para pemiliknya, tetapi sekarang menjadi
milikpemerintah.Menjadinyamilikpemerintahkarenadalam
keadaandaruratpemerintahharusmenghentikanrushdengan
BLBI.KarenaBLBIyangdipakaiolehbank-bankswastauntuk
menghentikan rush tidak mungkin dikembalikan, maka dana
BLBIdikonversimenjadimodalekuitimilikpemerintah.Sampai
di sini OR merupakan injeksi dana oleh pemerintah kepada
bankyangmilikpemerintah,yangkejadiannyadalamkeadaan
darurat.Mestinyadannalarnya,ORituditarikkembalisambil
pulihnyabank-bankmenjadisehatkembali.
Tidakdemikianyangdilakukanolehpemerintahatasinstruksi
atau petunjuk IMF. Bank-bank milik pemerintah Indonesia
yang di dalamnya ada surat tagihan kepada pemerintah
(atau dirinya sendiri) dijual dengan harga murah kepada
swasta,antaranyabanyakswastaasing.Contohyangpaling
fenomenaltentangketidakwarasannyakebijakanpemerintah
dalambidanginiadalahpenjualanBCA.97%dariBCAsudah
milik pemerintah. Di dalamnya ada OR atau surat hutang
pemerintahsebesarRp.60trilyun.IMFmemaksamenjualnya
kepadaswastadenganhargayangekuivalendenganRp.10
“IndonesiaMenggugatJilidII”? J5
trilyun.JadiBCAharusdijualdenganhargaRp.10trilyun,dan
yangmemilikiBCAdenganhargaitusertamertamempunyai
tagihan kepada pemerintah sebesar Rp. 60 trilyun dalam
bentuk OR yang dapat dijual kepada siapa saja, kapan saja
dandimanasaja.
SatuharisebelumpenandatangananpenjualanBCAkepada
Farallon terjadi sidang kabinet terbatas tidak resmi selama
tiga jam. Perdebatan sangat sengit. Sebelum tuntas, pada
jam18.00MenkoDorodjatunmenghentikanrapat,mengajak
MenegBUMNLaksamanaSukardimelaporkepadaPresiden
Megawati bahwa penandatanganan penjualan keesokan
harinya dapat dilakukan. Dalam rapat tersebut hanya
seorang menteri yang menentang sangat keras. Semuanya
menyetujui,tentunyatermasukMenteriKeuanganBoediono,
yang notabene paling bertanggung jawab atas penciptaan
bebankeuangannegarayangdahsyatini.Apakahinibentuk
penjajahan yang ingin digugat oleh Boediono? Bukankah
lantas menjadi cerita “Boediono menggugat Boediono”?
SangatperluBoedionomenjelaskansiapaparapenjajahdari
dalamnegeriyangbangsanyasendiri!!
Sebagai catatan perlu saya kemukakan bahwa ketika saya
menjabat Menko EKUIN telah dicapai kesepakatan lisan
denganwakilIMFAnoopSinghbahwapenjualanBCAharus
melaluitenderterbuka.Semuaniatmembelidikirimkandalam
amploptertutupkepadanotarisyangditunjukbersamaolehIMF
danPemerintahIndonesia.Pemerintahberhakmemasukkan
amploptertutupyangisinyahargaminimumuntukpenjualan
BCA.Kalauhargatertinggidarisemuaminatlebihrendahdari
harga minimum yang ditentukan oleh pemerintah, penjualan
BCAditundadengan6bulan,dandemikianseterusnyasampai
kondisiekonomimembaikdanBCAdapatdijualdenganharga
yangsamaataudiatashargaminimum.Semuaprinsip-prinsip
samasekalidibuangdalampenjualanBCA.Tidakadaharga
minimumyangdisyaratkanolehpemerintah,walaupunketika
“IndonesiaMenggugatJilidII”? J6
saya Kepala Bappenas, dalam rapat antar menteri sudah
saya tegaskan dengan jelas. Bukankah ini berarti bahwa
kesepakatan yang bisa membuat hasil penjualan BCA tidak
merugiditiadakansegerasajasetelahTimEkonomiberganti
menjadi Boediono sebagai menteri keuangannya? Mengapa
BoedionobegitungototharusmenjualBCAtepatpadawaktu
yang ditentukan oleh IMF dengan meniadakan kesepakatan
sebelumnya yang menguntungkan pemerintah? Bukankah
ini sikap dan praktek yang sepenuhnya menurut pada IMF
secara membabi buta? Apakah praktik semacam ini yang
akandigugatolehBoediono?
Buatsayamasihmerupakanpertanyaanbesar,apakahsemua
hutangdalamnegeriyangdiciptakanolehIMFdengandukungan
oleh beberapa elit Indonesia sendiri itu sebuah kesengajaan
ataukah sebuah kebodohan? Besarnya hutang dalam negeri
yangdiciptakandalamhitunganminggulebihbesardarihutang
luarnegeriyangdiakumulasiselama32tahun.
Hutangluarnegeripemerintah,saldonyaketikaitusekitar80
milyar dollar AS, tetapi selama 32 tahun jumlah yang telah
dibayarkan berjumlah sekitar 128 milyar dollar AS. Saldo
ini diukur dengan persen dari PDB yang lantas dianggap
sudah rendah. Babak belurnya yang kumulatif sama sekali
dilupakan.
LatarBelakangKehancuranSistemPerbankanIndonesia
Biang keladinya lagi-lagi adalah liberalisasi. Dalam bulan
Oktober 1988 lahir Paket Kebijakan Oktober yang terkenal
dengan sebutan PAKTO. Isinya liberalisasi perbankan yang
menentukan bahwa dengan modal disetor sebesar Rp. 10
milyar seseorang dapat mendirikan bank. Maka serta merta
sekitar160-anbanklahir.Ditambahdenganyangsudahada,
sekitar200bank-bankswastaberoperasidiIndonesia.
“IndonesiaMenggugatJilidII”? J7
Bank-bank PAKTO didirikan, dimiliki dan dikelola oleh para
pedagang besar yang sama sekali tidak mempunyai latar
belakang perbankan. Dana masyarakat yang dipercayakan
disalahgunakan dengan cara memakainya untuk membiayai
pendirian perusahaan-perusahaannya sendiri dengan mark
up. Maka bank sudah kalah clearing.Tetapi Bank Indonesia
ketika itu bukannya menghukum, malahan memberikan
fasilitasyangdinamakanFasilitasDiskontoI.Setelahitumasih
kalah clearing lagi. Oleh BI juga masih dilindungi dengan
memberikanFasilitasDiskontoII.Bank-bankyangdidalamnya
sudah rusak tidak terlihat oleh publik yang mempercayakan
uangnyauntukdisimpanpadabank-banktersebut.
Dengan terjadinya krisis di tahun 1997 dan ikut campurnya
IMF dalam penentuan kebijakan moneter dan ekonomi di
Indonesia,16bankditutupmendadaktanpapersiapanyang
matangsepertiyangtelahdigambarkandiatas.Kepadapara
nasabahnyadikatakanbahwauangnyahilangkarenamereka
salahpilihbank.Tentumerekasangatmarah,karena16bank
tersebut masih mengiklankan laporan keuangannya yang
diaudit dan dinyatakan sehat. Maka terjadilah rush besar-
besaran pada bank-bank yang lain. Dalam kondisi panik
lagi, untuk menghentikan rush, bank-bank diguyur dengan
BLBI sebesar Rp. 144 trilyun, yang sampai saat ini menjadi
kontroversi.
Setelahgejolakperbankanreda,ternyatasangatbanyakbank
rusak berat. Pemerintah menginjeksi dengan surat hutang
negara yang dinamakan Obligasi Rekapitalisasi Perbankan
(Obligasi Rekap atau OR) sampai jumlah Rp. 430 trilyun
denganbebanbungasebesarRp.600trilyun.Bank-bankini
menjadi milik pemerintah.Terus dijual dengan harga murah,
padahal di dalamnya masih ada tagihan kepada pemerintah
yangbesar.Sebagaicontoh,sayaulangilagikasusBCAyang
dijual dengan nilai sekitar Rp. 10 trilyun, tetapi di dalamnya
ada tagihan kepada pemerintah (Obligasi Rekap) sebesar
“IndonesiaMenggugatJilidII”? J8
Rp. 60 trilyun. Jadi pembeli membayar Rp. 10 trilyun, dan
langsung mempunyai surat hutang negara sebesar Rp. 60
trilyun.BebanbungapertahundariRp.60trilyuniniselama
belumdilunasibesarnyamelebihihasilpenjualanyangRp.10
trilyun.
Dampaknya pada besarnya beban hutang pemerintah,
baik hutang luar negeri maupun dalam negeri untuk tahun
anggaran2006sebesarRp.140,22trilyun,yaitubebanbunga
sebesarRp.76,63trilyundancicilanhutangpokoknyasebesar
Rp. 63,59 trilyun. Jumlah ini pengeluaran terbesar setelah
keseluruhan pengeluaran pemerintah pusat dan pemerintah
daerah,baikrutinmaupunpembangunan.
ProspekKeuanganNegaraSangatSuram
Seperti dikemukakan tadi, kalau kita membatasi diri pada
Obligasi Rekapitalisasi Perbankan saja (OR), jumlah
nominalnyaRp.430trilyun.KalausetiaplembarORinidibayar
tepat pada tanggal jatuh tempo, dengan tingkat suku bunga
yangtercantumpadasetiapOR,kewajibanmembayarbunga
sebesar Rp. 600 trilyun. Maka Pemerintah tidak bisa lepas
dari kewajiban membayar hutang pokok dan bunga yang
secara keseluruhannya Rp. 1.030 trilyun. Ini jumlah yang
sangatbesar.
DenganjumlahhutangdalambentukORsebesarini,sangat
besarkemungkinannyabahwaPemerintahtidakakanmampu
membayar hutang pokoknya tepat waktu pada tanggal jatuh
temponya. Kalau ada bagian dari OR yang jatuh tempo dan
ditunda pembayarannya, jumlah hutang pokoknya tetap,
tetapi kewajiban membayar bunganya membesar. Dengan
berapa membesarnya tergantung dari berapa besar hutang
pokokyangpembayarannyaharusditunda,danditundauntuk
berapalama.
“IndonesiaMenggugatJilidII”? J9
Tiga pegawai dari BPPN yang bekerja pada Bagian
SekretariatdanPenelitian,yaitiGatotAryaPutra,IraSetiati,
danDamayantimembuatstudidengancaramengembangkan
6buahskenario.Skenarioterburukialahkalausetiaplembar
ORharusditundadengantenoryangsama.Kalauiniterjadi,
maka kewajiban Pemerintah membayar keseluruhan jumlah
hutang OR ditambah bunganya membengkak menjadi Rp.
14.000trilyun.
Makalah mereka yang sedianya akan dipublikasikan dalam
majalahBPPNdihentikan,danmerekadipecat.
Besarnya hutang pemerintah dalam bentuk OR beserta
besarnya bunga yang harus dibayar menjadi beban
sangat berat untuk keuangan negara yang sudah menjadi
pengetahuan publik. Menteri Keuangan Boediono menjamin
kepada DPR bahwa dengan skema yang dinamakannya
reprofling atau pengaturan kembali jadwal pembayaran cicilan
hutangpokokOR,ORakandapatdiselesaikandalamwaktu8
tahundengantambahanpembayaranbungasebesarRp.800
milyarsetiaptahunnya.Artinya,jumlahhutangORditambah
dengan bunganya yang Rp. 1.030 trilyun akan ketambahan
Rp.6,4 trilyun saja. Tidak ada orang yang percaya. Setelah
itu, kita baca terus menerus betapa seringnya pemerintah
menerbitkan Surat Hutang Negara (SUN), baik dalam
rupiah maupun dalam valuta asing. Kita sudah tidak dapat
mengikutinya lagi bagaimana perkembangannya beban
hutangpemerintahdewasaini.Yangjelasterasaadalahserba
kekurangan uang untuk melindungi bagian terbesar rakyat
darikelaparan,kekuranganpendidikandanpenyakit.
Saya sebagai Menko EKUIN dengan Bambang Sudibyo
sebagaiMenteriKeuanganmempunyairencanakonkretuntuk
menarikORterlebihdahulusebelumbank-bankdijualkepada
swasta.Rencanayangkonkretditulisoleh6orangakhliyang
secarasukarelamenyumbangkanpikiran-pikirannyadibawah
“IndonesiaMenggugatJilidII”? 40
pimpinanDradjatWibowo.Kesemuanyapernahdipublikasikan
di Kompas dan juga dibukukan dengan fasilitas dari
Bappenas.KononkabarnyasetelahdijelaskanolehAnthony
Budiawan, (salah satu penulis) Menteri Keuangan Boediono
(dalam pemerintahan Megawati) memahaminya, tetapi toh
semua bank dijual tanpa menarik OR-nya terlebih dahulu.
Apaalasannyatidakjelas.KamimendugakerasbahwaBank
DuniadanIMFtidakmenyetujuinya.Kalauinibenar,Boediono
ketikaitutidakberdayamandiriterhadapBankDuniadanIMF.
Kalau sekarang mau menggugat, apakah ini termasuk yang
akandigugatolehnyakalaudianantinyaterpilihmenjadiWakil
Presiden?
TONGGAK-TONGGAK KEBIJAKAN EKONOMI SETELAH
PERTEMUANJENEWABULANNOVEMBERTAHUN1967
Setelah kaki-kaki korporatokrasi ditancapkan yang oleh
Jeffrey Winters dikatakan “pengambil alihan ekonomi
Indonesia dalam 3 hari”, berbagai istilah dan pengertian
yang tidak lazim diciptakan dengan maksud memperlancar
terjerumusdanterjeratnyaIndonesiakedalamhutang,yang
dijadikan alat penekan untuk memaksakan kebijakan yang
pro korporatokrasi. Bahwa hutang luar negeri dijadikan alat
penekan pada negara debitur dibantah oleh beberapa akhli
ekonomi Indonesia yang mencuat ketika tulisan ini sedang
dibuat. Saya perlu menjelaskan bahwa seperti dapat dibaca
dalamtulisanini,yangmengatakaninibukansaya,tetapipara
akhli ekonomi Amerika yang mengaku sebagai pelakunya,
yaituJohnPerkinsyangdiperintahkanolehagenCIAClaudia
Martin. Kalau mau membantah jangan membantah saya,
tetapi bantahlah Claudia Martin dan John Perkins. Semoga
Boediono menggugat mereka berdua yang merencanakan
dan melakukan penggerojokan hutang kepada Indonesia
dengan maksud menggunakannya sebagai leverage guna
memaksakankehendaknya.
“IndonesiaMenggugatJilidII”? 41
Perwujudannya yalah organisasi yang khusus diciptakan
buat negara-negara pemberi hutang yang bernama
IntergovernmentalGrouponIndonesia(IGGI),yangkemudian
bergantinamamenjadiConsultativeGroupofIndonesia(CGI).
Koordinatornya Bank Dunia, yang bersama-sama dengan
Bank Pembangunan Asia dan IMF merupakan trio pemberi
hutangjuga.
Bentuk-bentuknyaantaralainadalahsebagaiberikut:
• Anggaran negara (APBN) yang jelas defsit disebut
berimbang,yangditutupdenganhutangluarnegeri,tetapi
tidakdisebuthutang.SebutannyadalamAPBN“Pemasukan
Pembangunan”.
•HutangluarnegeridariIGGI/CGIdan3lembagakeuangan
tidak disebut “loan” atau hutang, tetapi disebut “aid” atau
bantuan.
• Jumlah defsit APBN dihitung tanpa memasukkan cicilan
hutang pokok sebagai pengeluaran. Yang dihitung hanya
pengeluaranuanguntukmembayarbunga.
Memang kebiasaan internasional seperti ini supaya bisa
membandingkan dengan negara-negara lain. Tetapi kalau
jumlah hutang ditambah bunga sudah sekitar 25 % dari
APBN, gambarannya lantas menyesatkan, dan perlu
memberikancatatankhusus.
• Anggaran pembangunan dibiayai sepenuhnya dari hutang
luarnegeriyangkatanyauntukmenghindaricrowdingoutdi
dalamnegeri.Tetapiketikakrisisdenganenaknyamembuat
hutang dalam negeri, yang ditambah dengan kewajiban
membayar bunga menjadi ribuan trilyun rupiah dalam
bentuk BLBI ditambah obligasi rekap, yang sebenarnya
dapatditarikkembalisebelumbank-bankyangmempunyai
“IndonesiaMenggugatJilidII”? 42
obligasirekapinidijualdenganhargamurah.
• BoedionosebagaiMenteriKeuangannyaPresidenMegawati
menyatakandenganyakinbebanhutangakanmeratadan
selesaidalamwaktu8tahunsetelahmelakukanapayang
olehnya dinamakan reprofling. Sekarang kedodoran dengan
beban sangat luar biasa beberapa tahun mendatang,
seperti yang diberitakan oleh media massa. Pada tanggal
15 Mei 2009 Boediono mencalonkan diri sebagai calon
wakilpresidenRI.
• Demikian juga dengan ukuran tentang jumlah hutang
luar negeri, apakah sudah melampaui batas yang aman.
Tadinyadinyatakandalamrasioantaraekspornetodengan
pembayaran cicilan hutang pokok + bunga hutang luar
negeriyangdisebutDebtServiceRatio(DSR).Ketikasudah
menjadi sangat tinggi, ukurannya diubah menjadi dalam
persendariPDB.
• Dalam menghitung ukuran tentang ambang batas yang
aman, dalam DSR cicilan hutang pokok dihitung sebagai
faktor. Tetapi dalam menghitung Defsit dalam APBN cicilan
hutang pokoknya tidak dihitung, karena sudah menjadi
sangatbesar.
• HutangluarnegeripemerintahIndonesiadinyatakanmasih
dalam batas yang normal, karena didasarkan atas persen
dariPDB.LompatandariukuranDSRmenjadipersendari
PDBsudahkontroversial.Tetapiyanglebihsubstantifyalah
kitaharusmembedakanantarasolvabilitas(solvency)dan
likuiditas. Persen dari PDB adalah solvency yang tidak
mestilikuid.Karenatidaklikuid,terpaksaberhutangterus.
Yang menentukan apakah sebuah negara bangkrut atau
tidak yalah kemampuannya membayar hutang beserta
bunganyatepatpadawaktunya(likuiditas),bukanbesarnya
hutangdalampersendariPDB.BahwaIndonesiatidaklikuid
“IndonesiaMenggugatJilidII”? 4J
terbuktidalameraBoedionosebagaiMenkoEkonomidan
Sri Mulyani sebagai Menteri Keuangan yang menerbitkan
SUN dalam dollar AS dengan suku bunga antara 10,5%
sampai11%.Untukduniausahaswastasaja,tingkatbunga
seperti ini tergolong junk bond yang sangat rongsokan.
Kalau negara RI memberikan tingkat bunga seperti ini,
bagaimana penjelasannya, terutama kalau dibandingkan
denganASyangmendekatinolpersen,dannegara-negara
lainyangmemberikanbungadepositoantara0,3%sampai
2%saja(dalamhaljangkasangatpanjang).
Kalaumaumengemukakansolvabilitasnyasaja,mengapa
tidaksekalianmenyatakanhutangIndonesiadalampersen
dari seluruh kekayaan alamnya? Jatuhnya menjadi 0,----
persensaja!
• Subsidi BBM dinyatakan sebagai identik dengan
pengeluaran uang tunai oleh pemerintah, padahal tidak
ada uang tunai yang dikeluarkan untuk memperoleh
minyakmentahkecualiyangharusdiimpor.
• Dalamkampanyepemilulegislatifyanglalu,yangdikemukakan
terusmenerusmelaluiiklansangatmahalyalahpemerintah
menurunkan harga BBM tiga kali. Tetapi menaikkannya
tigakalisebelumnyatidakdisebut.MenaikkannyadariRp.
2.700 sampai Rp. 6.000. Menurunkannya hanya sampai
Rp. 4.500 saja, tetapi dijadikan bahan kampanye dalam
iklan yang sangat mahal. Dalam kampanye mendatang,
Boediono yang calon wapres dari yang mengiklankan ini,
terpaksa harus berbicara tentang hal yang sama sekali
tidakbenar.
• Lantassiapayangmaudigugat?Berkaitandenganisuini,
bukankah kebijakan menentukan harga BBM di Indonesia
membiarkan dirinya didikte oleh NYMEX? Dan bukankah
yangmenjiwainyasupayaperusahaan-perusahaanminyak
“IndonesiaMenggugatJilidII”? 44
asing bisa membuka pompa-pompa bensin di Indonesia
dengan laba, karena rakyat dibiasakan membayar harga
bensindenganhargayangdidikteolehNYMEX?
• Sampai saat ini pemerintah masih saja menggunakan
istilah “subsidi” yang implisit membiarkan dirinya didikte
olehNYMEX.Tetapiyangsangataneh,dengankursyang
berubah dan harga minyak mentah yang sudah berubah
pula, harga BBM masih tetap saja dipertahankan seperti
apaadanya.
ApakahBoedionosebagaigurubesarakanmenggugatnya
berdasarkan nalar ilmu pengetahuannya, ataukah atas
pertimbangan politik akan membelanya? Kalau kita
mempelajaripikiran-pikiranBungKarno,sangatkonsisten,
baik sebagai intelektual maupun sebagai negarawan.
Konsistensinya inilah yang membawanya ke berbagai
penjaradanpembuangan.
APA HASIL AKHIR DARI KEBIJAKAN EKONOMI OLEH
TIM EKONOMI PEMERINTAH YANG SENANTIASA
TERDIRI DARI SATU KELOMPOK MASHAB PIKIRAN,
DAN BERGANTUNG PADA KAPITALISME PARTIKELIR
SERTA KEPERCAYAAN MUTLAK PADA KEAMPUHAN
MEKANISMEPASAR?
Dimulai dengan pertemuan di Jenewa bulan November
1967 yang ditulis sangat ilustratif, dan kebijakan yang terus
menerussangatliberalataspendiktean3lembagakeuangan
internasional,makasaatini,setelahhampir64tahunmerdeka,
kondisibangsakitadapatdigambarkansebagaiberikut:
• SelamaOrdeBaruPDBmemangmeningkatdenganrata-
rata 7 % per tahun, yang sangat dibanggakan oleh Tim
Ekonomi dan diagungkan oleh trio lembaga keuangan
“IndonesiaMenggugatJilidII”? 45
internasionaldanolehparakorporatokratdiseluruhdunia.
PDB adalah penjumlahan dari seluruh produksi barang
dan jasa di Indonesia, tanpa mempedulikan siapa yang
memproduksidanbagaimanapembagiannya.Makasekedar
sebagaiilustrasi,misalnyaPDByangdalamtahuntertentu
mencapaiRp.5.000trilyun,sangatmungkindibentukoleh
5%dariprodusendiIndonesia,denganbagianyangcukup
besarolehpengusahaasing.
Jadi kalau perusahaan tambang asing mengeduk sumber
dayamineralyangsangatmahalharganya,danpemerintah
hanyamemperolehroyaltidanpajak,nilaidarisumberdaya
mineral yang sangat mahal itu milik perusahaan tambang
asing,tetapididalamstatistikkitamasukkedalamProduk
Domestik Bruto. Kalau yang milik perusahaan asing
dikeluarkan,namanyaProdukNasionalBruto(PNB).PNB
tidakpernahdipakaisebagaiindikatorekonomiyangpenting
olehTimEkonomiPemerintahyangmemegangkekuasaan
dankendaliekonomisampaisaatini.
Padawaktumineralyangsangatbesarnilainyaitudiboyong
ke negerinya, dalam statistik kita dicatat sebagai ekspor
yangmerupakankomponendariPDB.
Bagaimana pembagian dari PDB yang terus menerus
meningkat itu? Walaupun tidak dapat dijadikan gambaran
yangakurattentangpembagiannya,sebagaiindikasidapat
dikemukakansebagaiberikut.YangmembentukPDBitulah
yangmenikmatinilaitambahyangpalingbesar.Tentuada
dampak positifnya seperti penciptaan lapangan kerja dan
sebagainya.
Data tahun 2003 menunjukkan bahwa jumlah seluruh
perusahaan 40,199 juta. Yang berskala besar 2.020
perusahaan atau 0,01 %. Yang tergolong UKM sebanyak
“IndonesiaMenggugatJilidII”? 46
40,197jutaperusahaanatau99,99%.
Andil UKM yang 99,99% dari seluruh perusahaan dalam
pembentukan PDB hanya 56,7%, sedangkan Usaha
berskalabesardanraksasayanghanya0,01%ituandilnya
sebesar43,3%
Walaupun angka-angka tersebut tahun 2003, kondisinya
sekarang tidak banyak berubah. Bahkan mungkin porsi
UKMKmenjadisemakinkecil.
AndilUKMdalampenyerapantenagakerjasebesar99,74%.
Alangkahtidakadilnya,karenasekianbanyakoranghanya
terlibat dalam UKM yang tentunya pendapatannya juga
minimal.
• Negara kita yang kaya dengan minyak telah menjadi
importirnetominyakuntukkebutuhanbangsakita.Sekitar
90% dari minyak kita dieksploitasi oleh perusahaan-
perusahaan minyak asing. Pembagian hasil minyak yang
prinsipnya85%untukIndonesiadan15%untukkontraktor
asing kenyataannya sampai sekarang 70% untuk
bangsa Indonesia dan 30% untuk perusahaan asing. Ini
disebabkankarenapembayaranapayangdinamakancost
recovery sampaisekarangtidakhabis-habis.Semuaorang
mengetahui bahwa biaya eksplorasi digelembungkan,
sehingga cost recovery-nya tidak habis-habis, walaupun
sudahlamatidakadaeksplorasilagi.
MinyakmilikrakyatIndonesiaharusdijualkepadarakyatyang
memilikinya dengan harga yang ditentukan oleh New York
Mercantile Exchange (NYMEX); tidak oleh para pemimpin
bangsa yang didasarkan atas hikmat kebijaksanaan, sesuai
dengankepatutan,dayabelirakyatdannilaistrategisnyadalam
membangkitkan sektor-sektor ekonomi lainnya, seperti yang
direncanakansejaksemulaolehparapendiribangsakita.
“IndonesiaMenggugatJilidII”? 47
• Kalaupun mau fanatik mati pada mekanisme pasar yang
dihayatinya bagaikan agama, NYMEX bukan pasar yang
sempurna. Pertama, volume yang diperdagangkan di
sana hanya 30% dari volume minyak dunia, sisanya atas
dasar kontrak-kontrak. Kedua, adanya OPEC berarti
harga sangat dipengaruhi oleh kartel yang bernama
OPEC ini. Ketiga, NYMEX memperkeruh kompetisi yang
diamanatkan oleh mekanisme pasar, karena ikut-ikutan
dalam menciptakan future trading dalam pembentukan
harga minyak, sehingga harga sangat dipengaruhi oleh
spekulasi dengan posisi pelaku pasar yang kuat yang
menang. Mengapa Boediono membela mati-matian harga
NYMEXharusmutlakdiberlakukanbuatbangsaIndonesia
yanginginmenggunakanminyakmiliknyasendiri?Adakah
yangmenyuruh?
Apakahhalsepertiinitermasukpenjajahandalambenaknya
Boedionoyanghendakdigugatnya?
• Masih dalam kebijakan perminyakan, sikap Boediono
bersama-samadenganMenterilainnyasangattidakdapat
dimengerti,yaitutentangblokCepudanExxonMobil.
TommySoehartomempunyaikontrakdenganExxonMobil
dalam bentuk Technical Assistance Agreement (TAC)
sampai tahun 2010. Setelah itu menjadi milik pemerintah.
Namunpagi-pagiExxonMobilmintaperpanjangansampai
tahun2030yangbentuknyajugaberubahmenjadikontrak
bagi hasil. Ketika Pertamina masih dalam bentuk Persero
hak memutuskan terletak pada Dewan Komisaris, tetapi
harusdengansuarabulat.Mensesneg.BambangKesowo
tidak setuju atas dasar pertimbangan yuridis, karena TAC
tidakdapatbegitusajadiubahmenjadiKontrakBagiHasil.
Sayamenolakdenganalasansangatprinsipil,yaituharus
“IndonesiaMenggugatJilidII”? 48
dikelolaolehPertaminasendiri.3anggotaDewanKomisaris
lainnya setuju diberikan kepada Exxon Mobil, termasuk
Boediono. Perdebatan cukup sengit. Setelah sudah tidak
mempunyai argumentasi apapun juga, akhirnya 3 yang
proExxonMobilterang-teranganmengatakan:”Indonesia/
Pertamina tidak mampu”. Dalam rapat-rapat yang
bersangkutan,DirekturUtama,BaihakiHakimmenyatakan
sanggupdansangatmampumengelolasendiri,mengingat
akan pengalamannya 13 tahun sebagai Dirut PT Caltex
Indonesia. Boediono menyatakan tidak mempunyai uang,
tetapiDirekturKeuangannyaketikaitu,Ainunmengatakan
sudahada6bankyangantrimemberikreditkarenadeposit
minyakdidalamnya600jutabarrel.Karenakeputusanharus
aklamasi, keputusan ada di tangan Presiden Megawati.
Beliau tidak mengambil keputusan, dan sementara itu
saya didatangi dan ditekan oleh Dubes AS Ralph Boyce
danDirekturExxonMobildariHouston.Sayabersisikukuh
sangat tegas menolak dengan argumentasi dari pihak
mereka yang sama sekali tidak masuk akal. Mereka
didampingiolehDireksiExxonMobilIndonesiayangsangat
membelaboss-nyaorangASitu.Apakahiniyangdirasakan
olehBoedionopenjajahandariluar,dengandukungandari
dalamyangakandigugatnya?
Dalamkondisideadlock tanpakeputusan,masihdalamera
MegawatiBaihakiHakimdipecatdenganalasanyangsama
sekalitidaksayaketahuikecualimengatakan:“PakBaihaku
Hakim itu bagus, tetapi ibaratnya untuk sopir Mercedez
Benz. Yang kita butuhkan sopir truk”. Maka digantilah
Baihaki Hakim dengan Widya Purnama. Diapun ternyata
keras menentang diserahkannya kepada Exxon Mobil
sampaitahun2030,sehinggadiapundalamwaktusingkat
dipecatlagi.
Begitu SBY menjadi Presiden dan Boediono Menko
Perekonomiannya,langsungsajadiberikankepadaExxon
“IndonesiaMenggugatJilidII”? 49
Mobil. Mengapa berangapan bangsa Indonesia tidak
mampumengeksploitasiblokCepu?Apakahiniyangakan
digugatolehBoedionosebagaiWapresnantinya?
• Negarayangdikaruniaidenganhutanyangdemikianluas
dan lebatnya sehingga menjadikannya negara produsen
eksportir kayu terbesar di dunia dihadapkan pada hutan-
hutan yang gundul dan dana reboisasi yang praktis nihil
karenadikorup.Walaupuntelahgundul,masihsajaterjadi
penebanganliaryangdiselundupkankeluarnegeridengan
nilaisekitar2milyardollarAS.
• Sumber daya mineral kita dieksploitasi secara tidak
bertanggung jawab dengan manfaat terbesar jatuh pada
kontraktorasingdankroniIndonesianyasecaraindividual.
Rakyat yang adalah pemilik dari bumi, air dan segala
kekayaanalamyangterkandungdidalamnyamemperoleh
manfaatyangsangatminimal.
Inikah yang diartikan oleh Boediono dengan istilah
“penjajahan dari luar dan dari dalam” yang akan digugat
olehnya? Bukankah dia dan senior-seniornya yang se-
ideologi dengannya berperan besar dalam pembentukan
kebijakan-kebijakanyangsepertiini?
• Ikan kita dicuri oleh kapal-kapal asing yang nilainya
diperkirakanantara3sampai4milyardollarAS.
• Jadi pencurian di lautan Indonesia sangat marak dengan
kerugiannegarayangsangatbesarmencakupikan,pasir,
bensin, kayu curian beserta terumbu karang dan fora serta
faunalainnya.KetikaSBYmenjabatsebagaiMenkoPOLKAM
dalamkabinetMegawatidiBappenaspernahdiadakanrapat
dengan para menteri dan panglima TNI, Kapolri beserta
KepalaStaftigaangkatan.Topiknya“KeamanandiLaut”.
Yangmencuatyalahditenggelamkannyakapal-kapalilegal
“IndonesiaMenggugatJilidII”? 50
dengan bom dari udara. Saya sebagai Kepala Bappenas
memperolehtawarankreditdariPerancisuntukmembiayai
sistempengenalkapalilegalmelaluitransponderdansatelit.
Samasekalitidakadakelanjutannya.
• Sangatbanyakprodukpertaniandiimpor.
• Republik Indonesia yang demikian besarnya dan sudah
hampir 64 tahun merdeka dibuat lima kali bertekuk lutut
harus membebaskan pulau Batam dari pengenaan
pajak pertambahan nilai setiap kali batas waktu untuk
diberlakukannya pengenaan PPN sudah mendekat, dan
sekarangtelahmenjadiKawasanBebasTotalbuatnegara-
negara lain, tetapi terutama untuk Singapura, sehingga
bersama-sama dengan pulau Bintan dan Karimun praktis
merupakansatelitnyanegaralain.
Tim Ekonomi menjadikan tidak datangnya investor asing
sebagai ancaman untuk semua sikap yang sedikit saja
mencerminkan pikiran yang mandiri. Dijadikannya pulau-
pulau Batam, Bintan dan Karimun sebagai Free Trade
Zone total dengan acamana-ancaman bahwa kalau tidak,
sekianratusperusahaanakanhengkangdsb.
FreeTradeZonetotalberartibahwaantaraBatam,Bintan
danKarimundenganseluruhduniatidakadabatasan,tetapi
antaratigapulautersebutdengansemuawilayahIndonesia
harus dibuat batasan supaya tidak terjadi penyelundupan
yangbesar-besarandanbebastotaljuga.
Sayatidakapriorisertamertamenolak,tetapidibutuhkan
perhitungan tentang untung ruginya yang lengkap dan
akurat, dan ini tidak pernah dipublikasi kalau ada, atau
samasekalitidakpernahdibuat.
“IndonesiaMenggugatJilidII”? 51
• Industri-industri yang kita banggakan hanyalah industri
manufaktur yang sifatnya industri tukang jahit dan
perakitan yang bekerja atas upah kerja yang sangat
rendah dibandingkan dengan nilai tambah yang diperoleh
majikannya. Oleh John Pilger industri-industri pengolahan
itudisebutsweat shops.
• Saya beruntung dibolehkan memutar flm tersebut dalam
salah satu sidang kabinet. Begitu selesai, Boediono
mendatangi saya sambil mengatakan bahwa yang
ditayangkan itu tadi semuanya tidak benar. Sampai saat
ini saya masih tidak mengerti mengapa dia merasa perlu
mengatakan demikian tentang flm yang dibuat dengan
wawancara langsung dengan para pejabat Bank Dunia
besertabanyakwawancaradenganburuhIndonesia.Saya
tidakdapatmelepaskandiridariperasaanbahwaBoediono
selaluharusmembelaapasajayangproBankDuniadan
apa saja yang anti trio Bank Dunia, Bank Pembangunan
AsiadanIMFharusditentangnya.
• Pembangunan dibiayai dengan hutang luar negeri melalui
organisasi yang bernama IGGI/CGI yang penggunaannya
diawasi oleh lembaga-lembaga internasional. Sejak tahun
1967 setiap tahunnya pemerintah mengemis hutang dari
IGGI/CGI sambil dimintai pertanggungjawaban tentang
bagaimana dirinya mengurus Indonesia? Mulai tahun lalu
CGImemangdibubarkan,tetapipembubaranituhanyalah
pura-pura. Kenyataannya APBN kita masih sangat
tergantungpadahutangluarnegeridariBankDunia,Bank
Pembangunan Asia dan negara-negara anggota CGI
terpenting.
• Hutang dipicu terus tanpa kendali sehingga sudah lama
pemerintahhanyamampumembayarcicilanhutangpokok
yang jatuh tempo dengan hutang baru atau dengan cara
galilubangtutuplubang.Pembayaranuntukcicilanhutang
“IndonesiaMenggugatJilidII”? 52
pokokdanbunganyasudahmencapai25%ataulebihdari
APBNsetiaptahunnya.
• DalampemerintahanMegawati3jettempurAStipeF-18
mengepung1F-16diatasBaweanJawaTimurtanpaizin
memasukiwilayahRI,yangmengawalkapalperanginduk
yang juga masuk ke dalam wilayah RI tanpa izin. Ketika
pilot kita memperingatkan, pesawat F-18 mengeluarkan
senjatanya.Setelahpilotkitamengatakantidakmaubaku
tembak,danhanyamaumenjelaskan,dijawabsingkatoleh
pilot AS, bahwa setelah mendarat dan pada waktunya,
dia akan minta izin. Minta izin setelah kejadian. Sungguh
pelecehandanpenghinaanterang-terangandanluarbiasa,
karenaTNIkitamemanghanyamempunyaisatuF-16yang
bisaterbangketikaitu.
• Dalam pemerintahan SBY-JK, kapal nelayan Indonesia
tidak sengaja tersesat ke dalam wilayah Australia.
Seluruh isi kapal dipindahkan ke geladak kapal perang
Australia. Kapal nelayan kita digranat berkali-kalik, dan
setiap granat meledak, orang-orang Australia yang ada
di geladak kapal itu bersorak sorai, dan para nelayan kita
menangis. Tragedi ini berlangsung terus sampai kapal
nelayan Indonesia tenggelam. Adegan ini ditayangkan di
TV Indonesia tanpa pemerintahnya berdaya melindungi
atau membela para nelayan kita yang naas dan sangat
mengenaskan itu. Sepanjang pengetahuan saya tidak
pernahadaprotesjugadaripemerintahkita.
• Dalam pemerintahan Megawati telah dirintis membangun
industri pertahanan dengan 4 industri strategis yang
sudah kita miliki. Study-nya dilakukan oleh experts China
yang dibiayai oleh pemerintah China sebagai hibah.
Mereka bekerja keras dan sudah praktis selesai dengan
studi tahap pertama. Mereka mengatakan bahwa PT
Dirgantara mesin-mesinnya sangat bagus, bisa dipakai
“IndonesiaMenggugatJilidII”? 5J
untukmembuatbanyakhal.DenganPTPAL,PINDAD,PT
DirgantaradanKarakatuSteel,Indonesiasudahbisamulai
membangun industri pertahanan yang sangat lumayan
tanpa investasi lagi. Pemerintah China berjanji tidak akan
ada yang disembunyikan dalam alih teknologi.Alasannya
masukakal,yaituuntukmembantuIndonesiamembangun
industripertahanannyapadatahappalingawalinimemang
tidak ada teknologi canggih yang harus diberikan kepada
Indonesia.Lainhalnyakalaukitamintasupayamemberikan
teknologiluarangkasa.Tentanghalinisudahdicekmasuk
akalatautidaknyadenganPanglimaTNIdanMenkoPolkam
yang ketika itu Bapak SBY sendiri. Beliau berminat dan
sudahbertemudenganPresidentdariGreatWalldiBeijing,
industripertahananChina.
Begitu pemerintahan diganti oleh pemerintahan SBY-Kalla,
KepaladariExecutingAgency-nya,MenteriBPPTmemanggil
sayadanwakilDubesChina,TanWeiWenuntukmenjelaskan
bagaimanariwayatnya.Setelahmendengarkanceriterakami,
seorang Deputy muda hanya memberi komentar: “Why
China?”Habislahriwayatperintisanini,dansekarangKrakatau
Steel mau dijual. Entah apa nasibnya PT Dirgantara. Yang
jelas Indonesia tidak mempunyai industri pertahanan yang
memadaiyangsekarangmenjadipembicaraanramaikarena
jatuhnya sekian banyak pesawat udara AU, yang terakhir
denganHerculesdengankorbanjiwabegitubanyak.
Jelas bahwa kecuali kekurangan dana, rapuhnya alutsista
kita tidak dapat dilepaskan dari kesengajaan membiarkan
diri sendiri dikekang oleh kekuatan-kekuatan Barat. Negara
bangsa Indonesia yang lemah seperti ini dalam pertahanan
merupakanbagiandariapayangdinamakanleverage untuk
menekanIndonesia.Apakahinimerupakanpenjajahanzaman
modernyangakandigugatolehBoediono?
“IndonesiaMenggugatJilidII”? 54
POKOK-POKOK KEBIJAKAN DALAM MENGHADAPI
KRISISGLOBAL
Sejaktahun2008meledakkrisisbalonderivatifkeuangandi
ASyangdemikianbesardandemikiandahsyatnya,sehingga
seluruh dunia sekarang ini sedang mengalami proses yang
menyakitkandansangattidakmenentu.
KondisiekonomiIndonesiasepertiyangtergambarkandiatas
tentutidakdapatmenghadapinyadenganmantab,karenatidak
adadana,Kecualiitu,rupanyakondisikeuangannegarajuga
jauhlebihparahdaripadayangdiketahuiolehmasyarakat.
Maka tindakan-tindakannya hanya sporadis dan compang-
camping.Marikitatelusurisebagaiberikut:
• Rp.60trilyunAPBN2008tidakdapatdiserapyangberarti
kontraktif.Tapidigembar-gemborkantahun2009akanada
stimulus fskal Rp. 73,1 trilyun, yang per saldo hanya Rp.
13,1trilyunsajaatauUS$1,062milyar(kursRp12.000per
dollarAS).Inihanya0,19%sajadariPDByangRp.7.000
trilyun.Katanyaakanbisadicapaimacammacam.Menko
EkonominyaBoediono.
AS yang jumlah stimulus fskalnya hampir 10% dari PDB-
nya, Presiden Obama ngomongnya tidak sesombong Tim
Ekonomi kita. Dengan jumlah stimulus fskal sebesar US$
900 milyar, Presiden Obama hanya berani mengatakan
akan menciptakan lapangan kerja sebanyak 3 sampai 4
jutaorangdalam2sampai3tahunkedepan.Pemerintah
Indonesia dengan stimulus fskal neto sebesar Rp. US$
1,062milyarmengatakanakanmenciptakanlapangankerja
sebesar3jutaorangjuga,yangtidakdirinciselamaberapa
tahun.Mungkindalamsetahun?
“IndonesiaMenggugatJilidII”? 55
• Dikatakan cadangan devisa cukup banyak, tetapi
menerbitkan obligasi dalam dollar dengan suku bunga
antara10sampai11%dalamdenominasidollarAS.Kalau
kita menaruh uang kita dalam deposito rupiah di bank
dalam negeri, maksimal hanya mendapat 9%. Bagaimana
mungkin kebijakan seperti ini diwujudkan? Siapa yang
menyuruh? Hati nurani sendiri ataukah ada kekuatan luar
yangdisinyalirolehBoedionodalampidatoproklamasinya
sebagaicawapres?
• Sekarang Gubernur BI mengatakan rupiah akan stabil,
karena akan mendapat rembesan dollar AS dari uang
yang dicetak secara besar-besaran oleh pemerintah
AS. Aneh, mereka selalu menganggap mencetak uang
adalah kebijakannya orang yang tidak waras. Sekarang
mengandalkan pencetakan uang oleh pemerintah AS
untukmenstabilkannilairupiah.KetikaituGubernurBI-nya
Boediono.
DiASsendiridandiEropakebijakandantindakaninidinilai
sangatkontroversialdanmenyulutperdebatanyangsedang
berlangsung.
• Dalam waktu dua bulan, nilai rupiah merosot dari sekitar
Rp. 9.000 menjadi Rp. 12.000 atau 33% yang memang
menguatlagi,entahbertahansampaikapan.
Di tahun 1969 1 dollar = Rp. 378. Thai Bath ketika itu 20
per US$. Sekarang Thai Bath 36 per US$, tapi rupiah
sudah sekitar Rp. 10.500 per US. Dalam kurun waktu
yang sama, Thai Bath terdepresiasi sebesar 80%, tetapi
rupiah terdepresasi sebanyak antara 3.075% sampai
2.678%. Penurunan ini terjadi selama kendali ekonomi di
tangan para senior si-ideologinya Boediono. Bagaimana
menjelaskannyakalausepanjangperiodeituTimEkonomi
mendapatpujianterusmenerusdaripersBarat?Bukankah
“IndonesiaMenggugatJilidII”? 56
pujiandanhutangyangdisebut“aid”itudisengajasupaya
Indonesia terjerumus ke dalam jebakan hutang? Dan
prosesnya mendapat dukungan dari kekuatan dari dalam
yangkesemuanyaingindigugatolehBoediono?
Inilah secara singkat hasil dari kebijakan Tim Ekonomi
yang kiprahnya selalu didasarkan atas Fundamentalisme
MekanismePasar,danantiBUMNsertaantiCampurTangan
Pemerintahyangmencukupi.
Apakah ini yang akan digugat oleh Boediono? Kalau ya,
sangat mengagumkan, karena Boediono akan menggugat
paraseniorse-ideologinya.
PAULKRUGMANDANIMF
Tentang IMF, dalam bukunya terbaru yang berjudul “The
Return of Depression Economics and the Crisis of 2008” di
halaman 115 Paul Krugman menulis tentang kebijakan IMF
menanganikrisisdiIndonesiatahun1997sebagaiberikut:
“Banyak orang berpendapat bahwa sebenarnya IMF dan
Departemen Keuangan Amerika Serikat yang de facto
mendiktekan kebijakan IMF yang menyebabkan krisis, atau
palingtidaksalahmenanganinya(mishandled)yangmembuat
krisissemakinparah.(KKG:MenteriKeuanganASketikaitu
LarrySummers).Apakahmerekabenar?
Marilah kita mulai dengan bagian yang termudah: dua hal
yangIMFjelasmelakukankesalahan.
Pertama, ketika IMF diminta bantuannya oleh Thailand,
KoreadanIndonesia,merekasegeramendiktekankebijakan
fskal yang ketat, yaitu menaikkan pajak dan mengurangi
pengeluaran pemerintah untuk menghindari defsit anggaran.
SangatsulitdimengertimengapaIMFmelakukaninikarenadi
“IndonesiaMenggugatJilidII”? 57
Asia(berbedadengandiBrasilsetahunkemudian),tidakada
seorangpun kecuali IMF yang menganggap defsit anggaran
sebagaimasalahyangpenting.Upayauntukmemenuhitarget
pengetatan anggaran tersebut mempunyai dampak negatif
ganda untuk negara-negara yang bersangkutan; di mana
arahanIMFinidilaksanakan,dampaknyamemperburukresesi
melalui pengurangan permintaan. Kalau tidak dilaksanakan,
karena IMF gembar-gembor, mengakibatkan kepanikan
bahwa perekonomian seolah-olah tidak terkendali. (KKG:
Sekarang Larry Summers, Timothy Geithner dan Bernanke,
GubernurBankSentralASmenurunkansukubungasampai
mendekatinolpersen).
Kedua, IMF menghendaki reformasi “struktural”, yaitu
perubahan-perubahan dalam bidang-bidang yang tidak
ada hubungannya dengan kebijakan fskal dan moneter
sebagai persyaratan untuk memperoleh pinjaman dari IMF.
Beberapa dari reformasi ini seperti penutupan bank-bank
sangat diragukan relevansinya dalam menanggulangi krisis
keuangan.Kebijakanlainnya,sepertipenghapusanpemberian
monopolikepadaparakroni-kroninyasangPresidentidakada
hubungannyasamasekalidenganmandatataukewenangan
IMF. Pemberian monopoli dalam perdagangan cengkeh
memang hal yang buruk, contoh yang paling mencolok dari
crony capitalism.Tetapiapahubungannyainidenganpelarian
rupiahkedalamdollar?”.
SemuanyainitulisannyaPaulKrugman,bukantulisansaya.
BeranikahBoedionoberpolemikdenganPaulKrugman.Kalau
setuju dengan Paul Krugman, bagaimana dia menjelaskan
kebijakannyadimasalampaudanjugakebijakanparasenior
se-ideologinyadalamperiodeyangsejaktahun1967?
BelumlamainidalamkonperensitingkattinggiUniEropa,IMF
disuntikdanasebesarUS$500milyarolehUniEropa,tetapi
lebihdariUS$450milyarakandipakaiolehUniEropasendiri.
“IndonesiaMenggugatJilidII”? 58
JadiIMFde factosudahmenjadilembagakeuanganregional.
ApapendiriandankebijakanWakilPresidenBoediono(kalau
terpilih)terhadapIMFdengankedudukannyadewasaini?
“SIHIR” IMF BESERTA KRONINYA TENTANG HUTANG
INDONESIAKEPADAIMF
Bersama-sama dengan para penjajah dari dalam yang
dikenali oleh Boediono, IMF menyihir bangsa Indonesia
dengan mengatakan bahwa Indonesia hebat karena dapat
mengembalikan hutangnya yang menumpuk sampai US$
9 milyar sebagai hutang yang diberikan sedikit demi sedikt
setiapkaliLOIditandatangani.
“Sihir” ini membuat orang percaya bahwa Indonesia hebat,
padahaljustrumembayarbungayangtidakadagunanya.
SebelumadakreditdariIMF,cadangandevisaIndonesiasudah
meningkatmenjadiUS$24milyardariUS$14milyar.Hutang
dariIMFUS$9milyaryangmenjadikankeseluruhannyaUS$
33milyar.
KetikaitusudahadayangmendesaksupayahutangyangUS$
9 milyar ini dibayar lunas, karena tidak ada gunanya sama
sekali. Jawabnya: Kalau dibayar lunas, cadangan devisa
Indonesia akan anjlok dari US$ 33 milyar menjadi US$ 24
milyar,daninimengguncangkankepercayaanduniakepada
Indonesia.
Tidak dikatakan bahwa hutang dari IMF yang US$ 9 milyar
itutidakbolehdipakaisamasekalisebelumcadangandevisa
miliknyasendiriyangUS$24milyarituterpakaihabissama
sekali.Karenaitu,hutangdariIMFyangUS$9milyarhanya
relevankalaupemerintahIndonesiabisamengatakankepada
dunia:“CadangandevisamilikkitayangUS$24milyarhabis
samasekali,tetapikitaharusbersyukurbahwasaatinimasih
“IndonesiaMenggugatJilidII”? 59
mempunyaicadangandevisaUS$9milyardariIMF.”
Kalau ini yang dikatakan, apakah tidak lebih memperpuruk
kepercayaan kepada Indonesia dibandingkan dengan
mengatakan: ”Dengan mengembalikan hutang kita yang
US$9milyarsekarangjuga,kitamasihmempunyaiUS$24
milyar.HutangdariIMFyangUS$9milyartidakbolehdipakai
sebelum cadangan devisa milik sendiri yang US$ 24 habis
terpakai sama sekali. Selama dipertahankan, kita harus
membayarbungatanpabolehmenggunakannya.”
Inilah yang oleh Jenderal Ryamizard Ryacudu dimaksud
sebagaipenjajahanmelaluiperangmodern,yaituantaralain
pencucianotak(brainwashing)untukmenundukkanlogikanya
bangsamangsadalamposisijongkok.
Banyakorangmengemukakankeberatannyamenahanhutang
yang tidak diperlukan itu dengan alasan bahwa selama kita
masihberhutang,kitadikenakanpemandoranolehIMFyang
dinamakan post program monitoring. Jawaban pemerintah
yangmenterikeuangannyaketikaituBoedionoyalahbahwa
kita memang masih memerlukan post program monitoring
ataupemandoranolehIMF.
Sisa hutang yang US$ 9 milyar akhirnya memang dibayar
lunas,tetapisangatterlambat,sehinggakitasudahmembayar
sangatbanyakbungayangtidakadagunanya.
ARUS BESAR YANG MENJADIKAN BOEDIONO CALON
WAKILPRESIDEN
Di harianThe Jakarta Post tanggal 25 Mei 2009 diberitakan
acara perpisahan Boediono dengan staf pengajar di
UniversitasGajahMada.Boedionodikutipmengatakan“…his
nomination was ‘a big stream’ he could not resist”yangberarti
bahwapencalonannyaadalaharusbesaryangtidakmampu
“IndonesiaMenggugatJilidII”? 60
ditolaknya.
Sebagai sesama menteri dalam kabinet Megawati, dalam
sidang kabinet terakhir Boediono berpamitan dengan saya
dan beberapa rekan menteri lainnya, mengatakan: “Ada
kemungkinanbahwabeberapadarikitaakandimintamasuk
dalamkabinetlagi.Sayasudahmengambilkeputusanuntuk
kembalikekampusdansudahpastitidakakanmaumenjadi
pejabat di pemerintahan lagi. Maka saya berpamitan”, dan
lantasberjabatantangan.
Konon kabarnya Presiden SBY menelpon Boediono, Sri
MulyanidanMariE.Pangestuuntukduduksebagaimenteri-
menteri ekonomi. Boediono menolak. Jadi konsisten
dengan “pamitannya”. Namun beberapa minggu menjelang
pengumuman reshuffe kabinet saya mendengar bahwa
Boediono sedang “digarap habis-habisan” untuk mau duduk
dalam kabinet sebagai Menko Perekonomian. Jelas saya
tidak percaya bahwa dia takluk. Ternyata benar berita yang
saya kira berita burung itu sebagai penggarapan besar-
besaran.BoedionomasuklagidalamkabinetsebagaiMenko
Perekonomian.
DariberitaTheJakartaPosttersebutmenjadilebihjelaslagi
betapabesararusyangmenekannya,sehinggasekarangdia
bahkanmaumenjadiWakilPresiden!Apageranganarusbesar
itu?Hatinuranidankecintaannyapadabangsayangbagian
terbesarnya sedang menderita ini, ataukah arus besar yang
datangnya dari elit dalam negeri, ataukah arus besar yang
datangnyadariluar?HanyaTuhan,BoedionodanSBYyang
mengetahuinya. Harapan saya tentunya Boediono dan SBY
jujurdalammenjelaskankepadarakyatnya,karenainiurusan
sangatpentingdengandampakyangsangatbesarpulapada
nasib negara bangsa ini kalau mereka terpilih dalam pilpres
bulanJuli2009mendatang.
“IndonesiaMenggugatJilidII”? 61
LAHIRNYA“BERKELEYMAFIA”DANPERANNYASAMPAI
SEKARANG
Buat saya dan banyak orang lainnya, di Indonesia memang
adasekelompokakhliekonomidenganideologidankeyakinan
tertentuyangsangatberkuasadansangatbesarpengaruhnya.
Kelompok ini terkenal dengan sebutan “Berkeley Mafa”.
Istilah ini sama sekali tidak mengandung pelecehan atau
merendahkan martabatnya. Sebaliknya, yang jelas dalam
tulisan ini, istilah ini lahir di Jenewa di tahun 1967 dengan
konotasi yang sangat terhormat dan mengagumkan banyak
tokoh dunia Barat, yang oleh David Rockefeller disebut
sebagai sekelompok para akhli ekonomi Indonesia yang top
(the top economists of Indonesia).Ketikakabinetdidominasi
olehmereka,covermajalahTimememuatfotoparamenteri
satupersatudenganjuduldibawahnya“The most qualifed
cabinet in the world”.
Asalmulanyamemangterdiridarimerekayangmemperoleh
gelarPh.DdariUniversityofCaliforniainBerkeley.Kelompok
ini merupakan inti yang dalam perjalanan sejarah Indonesia
membentuk “keturunan-keturunannya”. Maka tidak mungkin
membatasi diri dengan hanya yang lulus dari Berkeley
University saja. Sebutan “anggota Berkeley Mafa” adalah
siapasajayangideologidankeyakinannyamerupakanmashab
yang sama, yaitu sangat jauh condong pada pasar bebas
dengan campur tangan pemerintah yang sekecil mungkin.
Maka Boediono yang menurut pengakuannya orang dari
kampusndeso sangat bisa menjadi anggota Berkeley Mafa.
Bahkandimatasangatbanyakorang,dizamansekarangini
dialahpemimpinnya.
Para teknokrat hanya profesional dan tidak berpolitik,
ataujustrupolitisiyangsangatpiawaidanulung?
Kelompok Berkeley Mafa terkait erat dengan perguruan
“IndonesiaMenggugatJilidII”? 62
tinggi, sehingga memberikan kesan profesional yang tidak
berpolitik.Namunsejarahmembuktikanbahwakecanggihan
dan kepiawaiannya mempertahankan kekuasaan ekonomi
dalam pemerintahan siapapun juga sejak tahun 1967 tidak
tertandingiolehpartaipolitikyangmanapunjuga.
Makakalaudikatakanmurniprofesionalyangtidakberpolitik
tidak benar. Saya sendiri mengalami bahwa setelah pak
Hartotidakberkuasalagi,dalampembukaanKongresPDIdi
Bali yang besar-besaran di stadion terbuka, Dr. Sri Mulyani
beserta banyak akhli ekonomi lainnya hadir. Ketika saya
terheran-heran menanyakan kepada teman, saya mendapat
penjelasan bahwa mereka dibawa oleh Erros Djarot yang
diperkenalkankepadaMegawatisebagaicalon-calonmenteri
di dalam kabinetnya kalau Megawati menjadi Presiden
nantinya. Dan benar, ketika Megawati menjadi Presiden,
Menko Perekonomiannya Dorodjatun Kuntjorojakti dan
MenteriKeuangannyaBoedionoyangsamasekalitidakada
hubungannyadenganPDI.SriMulyanimenjadiwakilRIdalam
pimpinanIMFdiWashingtonDC.
Dalam sidang CGI yang saya ikut menghadirinya sebagai
Kepala Bappenas, secara setengah berkelakar Menko
Dorodjatun antara lain mengatakan bahwa dirinya tidak dari
partai politik. Tetapi dalam zaman reformasi dan demokrasi
iniyangserbapartaipolitik,kalautohmaudikatakananggota
partaipolitik,makapartainyaadalah“PartaiUIdiDepok,dan
parapemimpinnyaadalahProf.WidjojoNitisastrodanProf.Ali
Wardhana. Maka dirinya merasa mengetahui perekonomian
Indonesia dengan baik dari kedua guru besar/teknokrat/
mantanmenteritersebut”.
Pengototannyaberkuasaketikatidakadadalamkabinet
Dalam waktu sangat singkat setelah KH Abdurrachman
WahidmenjadiPresidenRIdansayadiangkatmenjadiMenko
“IndonesiaMenggugatJilidII”? 6J
EKUIN, dibentuk Dewan Ekonomi Nasional (DEN) dengan
Dr. Emil Salim sebagai Ketua dan Dr. Sri Mulyani sebagai
sekretarisnya. Setelah itu dengan Keputusan Presiden
dibentuk lagi Tim Asistensi pada Menko EKUIN. Ketuanya
tidak tanggung-tanggung, yaitu Prof. Dr. Widjojo Nitisastro
sendiri dan sekretarisnya Dr. Sri Mulyani Indrawati. Mereka
mengawal saya dan Menteri Keuangan Bambang Sudibyo
dalam perundingan penjadwalan kembali hutang luar negeri
diParisClub.TidakpernahadaDENdanTimAsistensipada
Menko EKUIN/Perekonomian sebelum dan sesudahnya.
SayamerasakandenganjelasbahwakeduaTiminidibentuk
atau “dipaksakan” pada Gus Dur untuk mengawasi dan
mengendalikan saya yang dianggap mempunyai sikap yang
independen, sangat cenderung tidak mau diatur oleh trio
Bank Dunia, Bank Pembangunan Asia dan IMF. Kecuali itu
tidakpernahadapemerintahsebelumdansesudahPresiden
AbdurrahmanWahidyangTimEkonominyabukandansama
sekali tidak berorientasi pada ideologi kelompok Berkeley
Mafa kecuali Tim Kwik Kian Gie/Bambang Sudibyo/Jusuf
Kalla(MenperindagmerangkapKepalaBULOG).
Semua anggota DEN harus diperbolehkan hadir dan ikut
berbicara dalam semua rapat-rapat para menteri dalam
lingkungankoordinasiMenkoEKUIN.
KetikasayamelakukankunjungankehormatanpadaMenteri
KeuanganASketikaituyangdijabatolehLarrySummers,yang
didampingiolehTimothyGeithner,sayaditegurdengankeras
bagaikan pejabat negara jajahan tentang kecenderungan
saya atau sikap saya yang tidak mau mengikuti IMF. Saya
tercengang karena informasinya tentang apa saja yang
dibicarakan dalam kabinet dan dalam rapat koordinasi oleh
saya sebagai Menko EKUIN diketahui semua oleh mereka.
JadibenaryangdikatakanolehBoedionobahwaadapenjajah
dari dalam, yang dalam pengalaman saya tidak beroperasi
sendiri, tetapi bekerja sama dengan penjajah dari luar. Mari
“IndonesiaMenggugatJilidII”? 64
kitatunggusiapayangakandigugatolehnyasebagaipenjajah
daridalam?
Sebagai Menko EKUIN yang harus berpidato dalam sidang
CGI, kepada saya diberikan naskah pidato oleh staf saya.
Saya sama sekali tidak setuju dengan isinya. Maka kepada
staf saya minta diadakan perubahan-perubahan. Dia
mengatakankepadasayabahwaitutidakboleh,karenasudah
merupakantradisibahwapidatoMenkoEKUINdalamsidang
IGGI/CGIharusdibuatolehBankDunia.Sayabekerjakeras
menulisnya sendiri dengan membuang naskah pidato yang
sudahdisiapkan.
SejakitusayamengalamitekananterusmenerusdanPresiden
pernah memberitahukan akan memecat saya, tetapi entah
mengapa tidak jadi lagi. Maka menjelang reshuffe kabinet
saya mengundurkan diri sebagai Menko EKUIN dari kabinet
GusDur.
Kesenjangan luar biasa antara yang terlihat dan yang
tidakterlihat
Terus menerus saya “dikuliahi” sahabat-sahabat saya yang
termasuk golongan kemapanan dengan kehidupan yang
sangat enak, bahwa Indonesia sudah sangat maju, sudah
sangatbanyakmall,restoran,rumahdanapartemenmewah,
banyak mobil mewah, gedung-gedung apartemen dan
perkantoranpencakarlangitdansebagainya.
Saya melihat dan melewatinya setiap hari. Yang menjadi
pertanyaan, berapa persen dari seluruh rakyat kita yang
menikmatikemakmuranyangdikuliahkankepadasaya?
Saya yakin minimal 180 juta dari 230 juta rakyat Indonesia
hidup dalam kemiskinan yang sangat parah. Ketika saya di
Bappenas, saya membentuk 4 regu yang masuk ke desa-
“IndonesiaMenggugatJilidII”? 65
desa kantong-kantong kemiskinan secara sampling untuk
melihat dengan mata kepala sendiri dan berbicara langsung
dengansesamaanakbangsayangternyatamemangmasih
sangat terjajah. Gambaran yang selalu di depan mata saya
tidakbisahilangdengankehidupansayadikotaJakartayang
gemerlapandengankemewahanini.
Gambaran tersebut ialah bahwa bagian terbesar dari rakyat
kitayangmemilikisemuakekayaanalamyangadadinegara
ini hidup dalam kemiskinan, kenistaan, kekurangan gisi,
kekurangan pendidikan seperti yang disaksikan oleh saya
dan rekan-rekan di Bappenas ketika saya masih menjabat
sebagai Kepala di sana. Dalam kondisi seperti ini saya juga
mengalami betapa saya ditekan oleh trio Bank Dunia, Bank
Pembangunan Asia dan IMF serta rekan-rekan bangsa
sendiri yang menekan saya harus mengikuti keinginan
para pejabat trio lembaga keuangan internasional tersebut.
Ketikasayadenganregusayamelihatdanberbicaradengan
mereka,merekahidupdenganRp.1.250perorangperhari.
Kalaupun karena infasi sekarang menjadi tiga kali lipat atau
Rp.3.750perhari,masihjauhdariUS$2perharibuatsatu
orang,sedangkanBankDuniayangdikagumiolehkelompok
Berkeley Mafa menentukan US$ 2 per orang per hari sebagai
garis kemiskinan. Ini berarti bahwa rakyat yang miskin dan
sangat besar jumlahnya itu hidup dengan 17,85% saja dari
gariskemiskinanyangditentukanolehBankDunia.
Penutup
Mohon kiranya tulisan ini dilihat juga dari sisi memberikan
amunisikepadaBoedionountukmenggugatpenjajahanyang
sekarangmasihberlangsungdalambentukmodern.
Kalau AS bisa berubah total menjadikan demikian banyak
perusahaan swasta menjadi BUMN dan Presiden Obama
bisa memecat CEO-nya pabrik mobil swasta, dan Larry
“IndonesiaMenggugatJilidII”? 66
Summers bisa mengatakan: “If circumstances change, I
change too”, sambil mengutip John Maynard Keynes yang
pernahmengatakandemikian,mengapaBoedionotidakbisa
lantasmenjadiindependen,nasionalisdanpatriotyangberani
menghadapisiapasajauntukkepentinganbangsa?
Mengantisipasi beliau akan berubah seperti ini, walaupun
berharap-harap cemas, saya berharap ada amunisi baginya
daritulisanini.

“Indonesia Menggugat Jilid II”? 

“INDONESIA MENGGUGAT JILID II” ?
Menjabarkan Pidato Proklamasi Calon Wakil Presiden Boediono

Pleidooi Ir. Soekarno dan Deklarasi Dr. Boediono Setelah r. oekarno bersama-sama engan atot angkupradja, I S ( d G M Maskun Sumadiredja dan Soepriadinata) ditangkap pada tanggal 29 Desember 1929, mereka diadili oleh landraad di Bandung yang berlangsung antara tanggal 18 Agustus 1930 sampai tanggal 22 Desember 1930. Pada hari itu, Soekarno dan kawan-kawan dijatuhi hukuman penjara 4 tahun dengan tuduhan melanggar pasal 169 dan 153 bis Wetboek van Strafrecht. Pidato pembelaannya Bung Karno menjadi sangat terkenal di seluruh dunia dengan judul “Indonesie klaagt aan” atau “Indonesia menggugat”. Pada tanggal 15 Mei 2009 Dr. Boediono berpidato di Bandung dalam rangka memproklamasikan dirinya sebagai calon wakil presiden dalam pemilihan tahun 2009. Antara lain dikatakan olehnya: ”Bapak Presiden yang saya hormati dan para hadirin, di awal abad ke-20 Bung Karno di kota Bandung ini menyatakan Indonesia menggugat. Waktu itu Indonesia menggugat penjajahan yang menjadikan negara terbelenggu

Kini yang kita gugat adalah penjajahan oleh kekuatan dari luar dan dari dalam. siapa kiranya yang menjajah dan siapa kiranya kroni dan kompradornya para penjajah yang berbangsa Indonesia (kekuatan dari dalam)? Boediono tentu dapat mengenalinya dengan akurat karena dia cukup lama menjadi orang di dalam lingkungan puncak kekuasaan. dia akan menggugat kekuatan dari luar dan dari dalam. Kalau sebelumnya sudah. Bung Karno menggugat penjajahan oleh pemerintah Hindia Belanda yang menjajah Indonesia secara fisik. . dan siapa pula kekuatan dari dalam? Apakah kekuatan luar dan kekuatan dalam ini menjajah Indonesia secara sendirisendiri ataukah bersama-sama dalam sebuah konspirasi. peluru dan meriam. Persamaan Bung Karno dengan Boediono Boediono menyamakan dirinya dengan Bung Karno. dengan bayonet. yaitu kalau nanti dia terpilih sebagai Wakli Presiden. di mana elit bangsa Indonesianya yang menjadi mitra dari luar bertindak sebagai pengkhianat kepada bangsanya sendiri? Sejak kapan Indonesia dijajah dengan tanggal pidatonya sebagai titik tolak. “Indonesia Menggugat Jilid II”? dan merasa kerdil. Beberapa pertanyaan Siapa kekuatan dari luar yang sedang menjajah Indonesia. Ada dua hal yang perlu dijelaskan.” Jelas Boediono menganggap Indonesia sekarang masih dijajah yang menurutnya selayaknya harus digugat. bedil. Di awal abad ke-21 ini. Apakah mulai tanggal itu Indonesia dijajah dalam bentuk yang ada dalam benak Boediono. armada laut dan sebagainya. Indonesia juga selayaknya menggugat. ataukah sebelumnya sudah. yaitu tanggal 15 Mei 2009. Implikasinya jelas.

seperti yang digambarkan oleh John Pilger. . Yang digugat juga sama. Sangat mungkin bentuk penjajahan yang ada dalam benak Boediono sama dengan yang ditulis oleh Jenderal Ryamizard Ryacudu dalam bukunya yang berjudul ”Perang Modern”. Intinya yalah bahwa dalam zaman modern sekarang ini.“Indonesia Menggugat Jilid II”?  Boediono juga ingin menggugat penjajahan zaman sekarang yang tentunya berbentuk lain. Caranya dengan membentuk elit bangsa mangsa yang dijadikan mitranya atau kroni atau kompradornya. Tempat ini begitu pentingnya buat Boediono sehingga implisit di dalam pidatonya kota Bandung dianggap sebagai faktor yang menyamakannya dengan Bung Karno. Implikasi politiknya supaya senantiasa dicengkeram dan didikte kebijakannya yang senantiasa menguntungkan korporatokrasi negara penjajah. Inikah yang oleh Boediono disebut dengan kata-kata “penjajah dari dalam negeri” yang mungkin bekerja sama dengan penjajah dari luar? Boediono menyamakan dirinya dengan Bung Karno yang sama-sama ingin menggugat atas nama bangsa Indonesia. membangun proyekproyek raksasa dengan hutang dari negara-negara penjajah supaya mereka bisa memperoleh pendapatan bunga dan laba mark up yang tinggi. hakikat penjajahan bangsa mangsa oleh bangsa penjajah tidak perlu dilakukan dengan sebutir pelurupun. Para kroni ini diyakinkan bahwa kebijakan haruslah seliberal mungkin. Jeffrey Winters. yaitu penjajahan. Pernyataannya sama-sama diucapkan di kota Bandung. Apa bentuknya tidak dijelaskan. John Perkins dan 12 perusak ekonomi yang “mengaku dosa” dalam buku “A Game as old as Empire”. Mereka dibantu supaya senantiasa memegang kendali kebijakan ekonomi yang sesuai dengan kehendak bangsa penjajah. PDB dinaikkan oleh beberapa investor asing raksasa tanpa trickle down effect pada yang miskin. Bradley Simpson. apalagi pasukan dan armada perang.

Bung Karno dijatuhi hukuman penjara. Soekarno langsung menghadapi hakim ketua Mr. yang dibantu oleh kroni dan komprador bangsa Indonesia sendiri. Boediono tidak pernah masuk penjara. Perilaku Bung Karno tidak pernah diarahkan menjadi Presiden RI. Perjuangan Bung Karno membawanya keluar masuk penjara dan pembuangan. “Indonesia Menggugat Jilid II”? Saya menduga tujuan atau target penjajahan oleh kekuatan penjajah yang ada dalam benak Bung Karno dan Boediono sama. Boediono His Excellency Prof. Bung Karno seorang inlander yang tidak mungkin bergaul dengan kekuatan asing pada strata yang sama. Boediono ditepuki tangan. Gugatannya sudah menjadi kenyataan dan merupakan pengorbanan luar biasa buat dirinya. Dia berjuang supaya Indonesia merdeka dengan pengorbanan apa saja. Siegenbeek van Heukelom dengan jaksa penuntutnya seorang Indonesia yang ketika itu berstatus inlander dan bernama R. Menjadi tersangka saja tidak pernah. Boediono memakai istilah “yang membuat kita merasa terpuruk dan tidak bisa bangkit”. sebutan yang dipakainya dalam bagian dari pidatonya yang menggunakan istilah “Indonesia Menggugat”. Ir. Boediono menyatakan kehendaknya menggugat kaum penjajah zaman sekarang. Dr. Merendahkan dan melecehkan martabat bangsa Indonesia. Sumadisurja. Yang perlu diperjelas siapa kroni dan komprador bangsa Indonesia sendiri? Perbedaan-perbedaannya Yang berbeda. yang akhirnya memang memerdekakan bangsa Indonesia dari . yaitu penghisapan kekayaan bangsa Indonesia oleh bangsa asing. Boediono yang anggota Dewan Gubernur Bank Dunia. Kehendaknya ini baru dimintakan izin dari “Bapak Presiden”.

Boediono tidak demikian. tidak boleh humble. mereformasi birokrasi. Gugatannya baru sebagai propaganda untuk dirinya supaya dipilih sebagai wakil presiden di bulan Juli 2009 mendatang. Bung Karno dan Pak Harto berbuat sangat banyak. Gugatannya terhadap kaum penjajah justru sebelum dia melakukan apa-apa. Boediono lain. Itupun tidak jelas siapa penjajahnya dari luar dan siapa penjajahnya yang dari dalam negeri sendiri.“Indonesia Menggugat Jilid II”?  penjajahan. Namun diskusinya tidak memberikan gambaran yang jelas. sehingga rakyat menganggapnya sebagai para pemimpinnya. Liberalisme adalah faham yang sangat jelas digambarkan oleh Adam Smith dalam bukunya yang terbit di tahun 1776 dengan . Dia adalah calon wakil presiden yang dalam kampanye pemilihan pilpres tidak boleh mempunyai rasa rendah hati. Maka pilihlah aku sebagai wakil presidenmu. Dalam kampanye nanti dia harus berkeliling Indonesia mengatakan kepada rakyat Indonesia : “Wahai rakyatku. Jelas juga bahwa pernyataan tersebut dikemukakan justru untuk dipilih menjadi wakil presiden. Boediono baru memberi pernyataan bahwa penjajahan di abad ke 21 sekarang ini selayaknya digugat. Lantas apakah betul dia akan menggugat penjajahan masih harus dibuktikan. Bung Karno hanya berjuang dan berjuang. sehingga dia menjadi Presiden RI yang baru merdeka. aku ini orang hebat yang akan menggugat penjajahan dan memberantas korupsi. Karena tindakannya itu seluruh bangsa Indonesia menganggapnya sebagai natural leader. diskusi tentang “neolib” menjadi marak.” Apa Neoliberalisme Itu ? Dengan dipilihnya Boediono sebagai cawapres-nya SBY.

 “Indonesia Menggugat Jilid II”? judul “An inquiry into the nature and the causes of the wealth of nations”. Kalau ada barang dan jasa yang harganya tinggi sehingga memberikan laba yang sangat besar (laba super normal) kepada para produsennya. pemerataan dan keadilan. Dia mempromosikan garamnya . Di dalamnya ditambahi beberapa vitamin. Akibatnya supply meningkat dan ceteris paribus harga turun. diberi merk yang dipatenkan. banyak orang akan tertarik memproduksi barang yang sama. Lambat laun daya inovasi dan daya kreasi dari beberapa produsen berkembang. garam dikemas ke dalam botol kecil praktis yang siap pakai di meja makan. Hal yang sama berlaku untuk jasa distribusi. katoen dan sejenisnya. ceteris paribus supply menyusut dengan akibat harga meningkat lagi. dengan sendirinya akan terjadi alokasi yang efisien dari faktor-faktor produksi. Dia menggambarkan pengenalannya tentang kenyataan hidup. daya inovasi dan kreasi berkembang sepenuhnya. Buku ini terbit di tahun 1776 ketika hampir semua barang adalah komoditi yang homogen (stapel producten) seperti gandum. gula. sehingga mampu melakukan diferensiasi produk. kebebasan. Manusia adalah homo economicus yang senantiasa mengejar kepentingannya sendiri guna memperoleh manfaat atau kenikmatan yang sebesar-besarnya dari apa saja yang dimilikinya. Kalau karakter manusia yang egosentris dan individualistik seperti ini dibiarkan tanpa campur tangan pemerintah sedikitpun. Buku ini sangat terkenal dengan singkatannya “The wealth of nations” dan luar biasa pengaruhnya. garam. Prosesnya sebagai berikut. Intinya sebagai berikut. Ada saja di antara para produsen barang sejenis yang lebih pandai. Harga akan berfluktuasi tipis dengan kisaran yang memberikan laba yang sepantasnya saja (laba normal) bagi para produsen. Kalau harga turun sampai di bawah harga pokok. Sebagai contoh.

produknya dijual dengan harga yang lebih rendah dari harga pokoknya. Dia merugi. Dalam era itu seluruh dunia juga mengenal perbudakan. Beberapa hari lagi. dia mulai melakukan persaingan yang mematikan para pesaingnya dengan cara kotor. Lantas dijual lagi ke pasar. dan bersedia membayar lebih mahal dibandingkan dengan harga garam biasa. yang ditopang oleh kekayaannya. Konsumen percaya. Dengan harga ini semua pesaingnya akan merugi dan bangkrut. Setelah para pesaingnya bangkrut. dengan kedudukan monopolinya dia menaikkan harga produknya sangat tinggi. pabriknya bangkrut. Dia tidak. yang antara lain mengakibatkan bahwa anak-anak dan wanita hamil dipekerjakan di tambang-tambang. Selama itu dia menumpuk laba tinggi (laba super normal) yang menjadikannya kaya. Contoh lain: ada kasus pabrik rokok yang membeli rokok pesaingnya. rokoknya rusak. Dalam kondisi seperti ini lahir pikiran-pikiran Karl Marx. Mereka juga dicambuki bagaikan binatang. disuntik sangat halus dengan cairan sabun. Produsen yang bersangkutan bisa memperoleh laba tinggi tanpa ada saingan untuk jangka waktu yang cukup lama. sehingga merknya tidak laku sama sekali. Kerugiannya ditopang dengan modalnya yang sudah menumpuk. Karena apa saja boleh. Sebagai contoh. Wanita melahirkan dalam tambang di bawah permukaan bumi. karena modalnya yang paling kuat. Karena semuanya dibolehkan tanpa pengaturan oleh pemerintah. pengusaha majikan mulai mempekerjakan sesama manusia dengan gaji dan lingkungan kerja yang di luar perikemanusiaan. Puncaknya terjadi dalam era revolusi industri. . Yang digambarkan oleh Adam Smith mulai tidak berlaku lagi. karena pemerintah tidak boleh campur tangan melindungi buruh.“Indonesia Menggugat Jilid II”?  sebagai sangat berlainan dengan garam biasa.

dan beberapa negara menerapkannya. Marx menggugat semua ketimpangan yang diakibatkan oleh mekanisme pasar yang tidak boleh dicampuri oleh pemerintah. sehingga tidak bisa lagi mempertahankan . Eksesnya diperkecil dengan berbagai peratutan dan pengaturan. Sovyet Uni. tetapi tidak mau membuang mekanisme pasar dan kapitalisme. China. dan setiap orang adalah pegawai negeri.10 “Indonesia Menggugat Jilid II”? Banyak karyanya. tidak boleh ada orang yang mempunyai modal yang dipakai untuk berproduksi dan berdistribusi dengan maksud memperoleh laba. Marx berkesimpulan bahwa untuk membebaskan penghisapan manusia oleh manusia. Semuanya harus dipegang oleh negara/pemerintah. tetapi yang paling terkenal menentang Adam Smith adalah Das Kapital yang terbit di tahun 1848. Dunia terbelah dua. yaitu dibolehkannya orang per orang memiliki kapital yang dipakai untuk berproduki dan berdistribusi dengan motif mencari laba. Keragaman ini berarti juga bahwa kadar campur tangannya pemerintah juga sangat bervariasi dari yang sangat minimal sampai yang banyak sekali. Apa artinya dan bagaimana perwujudannya? Sangat beragam. Setelah dua sistem ini bersaing selama sekitar 40 tahun. Siapa Kaum Neolib? Orang-orang yang menganut faham bahwa campur tangan pemerintah haruslah sekecil mungkin adalah kaum neolib. Maka tidak ada lagi negara yang menganut sistem komunisme a la Marx-Lenin-Mao. Semuanya mengadopsi mekanisme pasar dan mengadopsi kaptalisme dalam arti sempit. Tetapi kapital yang dimilikinya harus berfungsi sosial. Dunia Barat mengakui sepenuhnya gugatan Marx. persaingan dimenangkan oleh Barat. mereka tidak bisa mengelak terhadap campur tangannya pemerintah. Eropa Timur.

yang total. yang dianggap sama dan sebangun dengan kelompok yang terkenal dengan sebutan “The Berkeley Mafia”. Boediono perlu melakukan soul searching yang mendalam Meledaknya debat tentang neolib tidak dapat dipisahkan dari persepsi yang dimiliki sangat banyak orang bahwa Boediono adalah personifikasi dari aliran neolib di Indonesia. Tidak hanya itu. untuk kepentingan seluruh bangsa yang bagian terbesarnya sedang sangat menderita kemiskinan. Karena itu. banyak yang mempunyai dugaan dan perasaan bahwa dipilihnya Boediono sebagai calon wakil presiden adalah hasil desakan dari “kekuatan dari luar”. tetapi toh harus militan mengkerdilkan pemerintah untuk kepentingan korporatokrasi. Jadi walaupun yang liberal mutlak. Bahkan beliaulah yang dewasa ini dianggap sebagai pemimpin kaum neolib Indonesia. Bank Pembangunan Asia dan IMF. Istilah ini yang dipakai oleh Boediono sendiri dalam pidatonya.“Indonesia Menggugat Jilid II”? 11 liberalisme mutlak dan total. keterbelakangan. . baik yang dari luar maupun yang dari dalam. kurang sehat jasmani dan rokhaninya. kaum neolib masih bisa membiarkan kekayaan alam negara kita dihisap habis oleh para majikannya yang kaum korporatokrat dengan dukungan Bank Dunia. yang merasa selayaknya menggugat penjajahan yang masih ada dalam abad ke 21 ini. yang cut throat competition dan yang survival of the fittest mutlak sudah tidak bisa dipertahankan lagi. yang laissez fair laissez aller dan laissez fair laissez passer. kebodohan. Dugaan ini bertambah besar setelah Boediono menyatakan kepada The Jakarta Post tanggal 25 Mei 2009 bahwa penerimaannya sebagai calon wakil presiden adalah karena adanya arus besar yang tidak mampu ditolaknya (Boediono said his nomination was a “big stream” he could not resist”).

Sayang seribu sayang bahwa dia tidak menjelaskan tentang apa dan bagaimana penjajahan zaman sekarang itu? Karena itu. Banyak yang menilai bahwa Boediono ikut berperan cukup besar dalam segala sesuatu yang digambarkan dalam tulisan ini. dan sekarang Calon Wakil Presiden RI untuk periode 2009-2014. Menteri/Kepala Bappenas. yaitu berturut-turut sebagai Direktur Bank Indonesia. Menko Perekonomian. Gubernur BI. Bagaimana gambaran penjajahan dan siapa para pelakunya? Dengan jelas dikatakan dalam pidato Boediono bahwa di abad 21 ini penjajahan masih ada. Apakah dalam karirnya yang panjang dalam kedudukan yang tinggi di birokrasi Boediono ikut berperan dalam segala sesuatu yang tergambarkan dalam tulisan ini ? Boediono berkarir dalam kedudukan sangat tinggi dalam kepemimpinan negara. yaitu yang ditulis oleh John Pilger dalam bukunya yang berjudul . Menteri Keuangan. izinkanlah saya menjelaskannya dari pengenalan orang lain yang mempelajarinya dengan seksama dan menurut saya dapat dipertanggung jawabkan kebenarannya. Maka rasanya beliau perlu menjelaskannya kepada rakyat. karena posisinya sebagai calon wakil presiden dengan kemungkinan sangat besar akan terpilih.12 “Indonesia Menggugat Jilid II”? apakah betul bahwa dirinya didorong oleh kekuatan asing untuk menerima pencalonannya sebagai wakil presiden? Untuk kepentingannya sendiri juga. rasanya sangat perlu beliau memberikan penjelasan yang sejujurnya dan masif kepada rakyat yang akan melakukan pilihannya pada tanggal 8 Juli 2009.

menyusul tertangkapnya ‘hadiah terbesar’. ‘Ini dilakukan dengan cara yang spektakuler’ kata Jeffrey Winters. Di seberang meja adalah orang-orangnya Soeharto yang oleh Rockefeller disebut “ekonoom-ekonoom Indonesia yang top”. US Steel.“Indonesia Menggugat Jilid II”? 1 “The New Rulers of the World.” Saya kutip seakurat mungkin dengan terjemahan ke dalam bahasa Indonesia oleh saya sendiri sebagai berikut. Tim Sultan terkenal dengan sebutan ‘the Berkeley Mafia’. British American Tobacco.. British Leyland. The Time-Life Corporation mensponsori konperensi istimewa di Jenewa yang dalam waktu tiga hari merancang pengambil alihan Indonesia. Goodyear. hasil tangkapannya dibagi. ekonomi Indonesia telah dibagi.cadangan besar dari sumber daya alam …. The International Paper Corporation. Chicago. General Motors. “Di Jenewa.” Di halaman 39 ditulis: “Pada hari kedua. yang dengan mahasiwanya yang sedang bekerja untuk gelar doktornya. orang-orang seperti David Rockefeller. sektor demi sektor. pasar yang besar. Brad Simpson telah mempelajari dokumen-dokumen konperensi. Menyodorkan butir-butir yang dijual dari negara dan bangsanya. Siemens. Mereka datang sebagai peminta-minta yang menyuarakan hal-hal yang diinginkan oleh para majikan yang hadir. ‘Mereka membaginya ke dalam lima seksi: pertambangan di satu . American Express. Imperial Chemical Industries. “Dalam bulan November 1967. Para pesertanya meliputi para kapitalis yang paling berkuasa di dunia. karena beberapa di antaranya pernah menikmati beasiswa dari pemerintah Amerika Serikat untuk belajar di Universitas California di Berkeley. Sultan menawarkan: …… buruh murah yang melimpah…. guru besar pada Northwestern University. Semua raksasa korporasi Barat diwakili: perusahaan-perusahaan minyak dan bank.

jasa-jasa di kamar lain. yang anggota-anggota intinya adalah Amerika Serikat. Kita saksikan para pemimpin korporasi besar ini berkeliling dari satu meja ke meja yang lain. yang dilakukan oleh Chase Manhattan duduk dengan sebuah delegasi yang mendiktekan kebijakan-kebijakan yang dapat diterima oleh mereka dan para investor lainnya. perbankan dan keuangan di kamar lain lagi. Papua Barat dan Kalimantan. Canada. industri ringan di kamar lain. dan mereka pada dasarnya merancang infra struktur hukum untuk berinvestasi di Indonesia.” Demikian gambaran yang diberikan oleh Brad Simpson. Kalau baru sebelum krisis global berlangsung kita mengenal . Sebuah undang-undang tentang penanaman modal asing yang dengan buru-buru disodorkan kepada Soeharto membuat perampokan ini bebas pajak untuk lima tahun lamanya. Saya tidak pernah mendengar situasi seperti itu sebelumnya. Sang raksasa Alcoa mendapat bagian terbesar dari bauksit Indonesia. Australia dan. Sebuah konsorsium Eropa mendapat nikel Papua Barat. di mana modal global duduk dengan para wakil dari negara yang diasumsikan sebagai negara berdaulat dan merancang persyaratan buat masuknya investasi mereka ke dalam negaranya sendiri. mengatakan ini yang kami inginkan: ini. Dana Moneter Internasional dan Bank Dunia. Jeffrey Winters dan John Pilger tentang suasana. Eropa. yang terpenting. Freeport mendapatkan bukit (mountain) dengan tembaga di Papua Barat (Henry Kissinger duduk dalam board). Sekelompok perusahaan-perusahaan Amerika. kesepakatankesepakatan dan jalannya sebuah konferensi yang merupakan titik awal sangat penting buat nasib ekonomi bangsa Indonesia selanjutnya. ini dan ini. Nyata dan secara rahasia.1 “Indonesia Menggugat Jilid II”? kamar. Jepang dan Perancis mendapat hutan-hutan tropis di Sumatra. kendali dari ekonomi Indonesia pergi ke Inter Governmental Group on Indonesia (IGGI).

paham dan ideologi ini sudah ditancapkan di Indonesia sejak tahun 1967. Buku ini tercantum dalam New York Times bestseller list selama 7 minggu. Joseph Stiglitz dan masih banyak ekonom AS kenamaan lainnya bahwa hutanglah yang dijadikan instrumen untuk mencengkeram Indonesia? Dalam rangka ini.” Halaman 15: “Pertama-tama saya harus memberikan pembenaran (justification) untuk memberikan hutang yang sangat besar jumlahnya yang akan disalurkan kembali ke MAIN (perusahaan konsultan di mana John Perkins bekerja) . PARA PERUSAK EKONOMI NEGARA-NEGARA MANGSA Benarkah sinyalemen John Pilger. Buku ini ditulis oleh John Perkins dengan judul: “The Confessions of an Economic Hit man”. Delegasi Indonesia adalah Pemerintah. dan saya salah seorang dari sebuah tim yang terdiri dari 11 orang yang dikirim untuk menciptakan cetak biru rencana pembangunan pembangkit listrik buat pulau Jawa. Saya kutip sambil menterjemahkannya ke dalam bahasa Indonesia sebagai berikut: Halaman 12: “Saya hanya mengetahui bahwa penugasan pertama saya di Indonesia. atau “Pengakuan oleh seorang Perusak Ekonomi”. saya kutip buku yang menggemparkan. Tetapi counter part-nya captain of industries atau para korporatokrat. termasuk apa yang dikehendaki oleh analis atas dasar statistik yang dibuatnya.” Halaman 13: “Saya tahu bahwa saya harus menghasilkan model ekonometrik untuk Indonesia dan Jawa”.“Indonesia Menggugat Jilid II”? 1 istilah “korporatokrasi”. “Saya mengetahui bahwa statistik dapat dimanipulasi untuk menghasilkan banyak kesimpulan.

termasuk basisbasis militer. suara di PBB. Proyek yang memberi kontribusi terbesar terhadap pertumbuhan PDB harus dimenangkan.” Halaman 15-16: “Aspek yang harus disembunyikan dari semua proyek tersebut ialah membuat laba sangat besar buat para kontraktor. Kenyataan bahwa beban hutang yang sangat besar menyengsarakan bagian termiskin dari bangsanya dalam bidang kesehatan. saya harus membangkrutkan negara yang menerima pinjaman tersebut (tentunya setelah MAIN dan kontraktor Amerika lainnya telah dibayar). Kedua. sehingga negara penghutang (baca: Indonesia) menjadi target yang empuk kalau kami membutuhkan favours. dan membuat bahagia beberapa gelintir keluarga dari negara-negara penerima hutang yang sudah kaya dan berpengaruh di negaranya masing-masing.” Halaman 15: “Faktor yang paling menentukan adalah Pendapatan Domestik Bruto (PDB). saya harus menunjukkan bahwa membangun proyek yang bersangkutan akan membawa manfaat yang unggul pada pertumbuhan PDB. Walaupun hanya satu proyek yang harus dimenangkan. Stone & Webster.” Halaman 16: “Claudia dan saya mendiskusikan karakteristik dari PDB yang menyesatkan. Dengan demikian ketergantungan keuangan negara penerima hutang menjadi permanen sebagai instrumen untuk memperoleh kesetiaan dari pemerintah-pemerintah penerima hutang. pendidikan dan jasa-jasa sosial lainnya selama berpuluh-puluh tahun tidak perlu masuk dalam pertimbangan. atau akses pada minyak dan sumber daya alam lainnya. dan Brown & Root) melalui penjualan proyek-proyek raksasa dalam bidang rekayasa dan konstruksi. Misalnya pertumbuhan PDB bisa .1 “Indonesia Menggugat Jilid II”? dan perusahan-perusahaan Amerika lainnya (seperti Bechtel. Maka semakin besar jumlah hutang semakin baik. agar negara target itu untuk selamanya tercengkeram oleh kreditornya. Halliburton.

Copyright-nya telah dibeli oleh perusahaan film utama di Hollywood. bagaimana mungkin bukunya tercantum dalam best seller list selama enam minggu di New York Times. Itu adalah orang yang fiktif. sudah tercantum sebagai buku terlaris nomor 4 di amazon. sehingga segera membuat sangat banyak copy yang dibagi-bagikan. Beliau menceriterakan kepada saya bahwa beliaulah yang menjadi partnernya John Perkins di Bandung di tahun 1970. Saya bertemu dengan seorang insinyur Indonesia yang sampai sekarang masih bekerja di BUMN. begitu marahnya. Yang kaya menjadi semakin kaya dan yang miskin menjadi semakin miskin. . Tidak etis buat saya menyebutkan namanya. dia seorang pemimpi dan pembual (fantast). dengan membebani hutang yang sangat berat buat rakyatnya. bukunya telah diterjemahkan ke dalam 25 bahasa. Ketika itu beliau tidak mengetahui bahwa Perkins sedang melakukan perusakan ekonomi. yaitu pemberdayaan perusahaan-perusahaan internasional dan organisasi-organisasi multinasional seperti Bank Dunia dan IMF. Ketika beliau membaca bukunya. Dalam waktu kurang dari 14 bulan. Statistik akan mencatatnya sebagai kemajuan ekonomi. com. Seminggu setelah dijual di toko-toko buku. Kalaupun ada orangnya.“Indonesia Menggugat Jilid II”? 1 terjadi walaupun hanya menguntungkan satu orang saja.” John Perkins seorang pembual atau fiktif? Para ekonom kelompok mazhab tertentu yang berfungsi sebagai agen pelaksana dari korporatokrasi dan prinsip-prinsip Washington Concensus serta merta mengatakan bahwa John Perkins itu tidak ada. Kalau memang demikian. yaitu yang memiliki perusahaan jasa publik.” Halaman 19: “Sangat menguntungkan buat para penyusun strategi karena di tahun-tahun enam puluhan terjadi revolusi lainnya.

dan sub judulnya “The Secret World of Economic Hit Men and the Web of Global Corruption. Baru penerbit yang ke 26 menyetujui menerbitkannya. Konsekuensinya adalah semakin kokohnya liberalisme dan mekanisme pasar primitif.1 “Indonesia Menggugat Jilid II”? Mereka yang menyebut John Perkins seorang pembual sekarang ini banyak sekali yang memegang kekuasaan dalam bidang ekonomi. Mengapa tidak ada kebutuhan mencari dan menanyakan kepada insinyur yang di tahun 1970 tanpa mengetahui maksud dan tujuan John Perkins bekerja sebagai mitranya di kantor PLN Bandung? A Game as old as Empire John Perkins mengakui bahwa sangatlah sulit menemukan penerbit. dan semakin kokohnya pengaruh asing dalam menentukan kebijakan-kebijakan ekonomi kita. Infra struktur. Tingkat kerusakannya sudah sangat parah. Jumlah manusia Indonesia yang menderita kemiskinan sudah melampaui batas-batas yang wajar.” Semakin kokohnya neolib dengan konsekuensinya Namun sayang bahwa sejak Ibu Megawati menjabat sebagai Presiden. Judul bukunya telah saya kemukakan. yaitu “A Game As Old As Empire”. yang sejak itu kendali serta kekuasaannya bertambah mutlak. walaupun setiap kali para penerbit itu menunjukkan perhatian yang sangat besar. Apa alasannya diceriterakan dalam kata pengantarnya dalam buku terbaru yang ditulis oleh 12 para perusak ekonomi lainnya. barang dan jasa publik yang krusial buat tingkat kehidupan yang wajar sudah merosot . kendali ekonomi jatuh ke tangan Berkeley Mafia lagi. Tetapi pada akhirnya menolak.

walaupun ketertiban dan kebersihannya masih kalah dibandingkan dengan zaman penjajahan Belanda. Dalam zaman penjajahan adalah rumah-rumah tinggalnya para keluarga yang memperoleh kekayaannya dari Hindia Belanda. 50 % dari rakyat Indonesia menjadi miskin. Kebanyakan dari gedung-gedung itu sekarang berfungsi sebagai perkantoran. PDB yang meningkat. Tetapi ketika Bank Dunia mengumumkan bahwa garis kemiskinan sekarang ditetapkan US$ 2 per hari per orang. Sekarang juga begitu. Itulah sebabnya sampai sekarang kita menyaksikan Wassenaar dengan vila-vila yang besar dan mewah dan disebut sebagai daerah pemukimannya oud Indische gasten (para mantan tamu di Hindia Belanda). inflasi yang terkendali dan sejenisnya. Tetapi rakyat Indonesia hidup dengan segobang sehari. Elit bangsa yang sedang berkuasa dengan dukungan dari pembentukan opini publik di dunia semakin gencar menggambarkan bangsa Indonesia yang semakin maju dan sejahtera. Indikator-indikator yang dikemukakannya adalah stabilitas nilai tukar rupiah. Bahwa kesemuanya itu menyesatkan dapat kita pahami kalau kita membandingkannya dengan indikator-indikator yang sama selama penjajahan oleh Belanda selama berabadabad.“Indonesia Menggugat Jilid II”? 1 jauh di bawah yang dibutuhkan secara minimal. terutama Jakarta berlimpah-ruah dengan kemewahan. Dalam zaman penjajahan segala sesuatunya serba teratur dan stabil. . Indikator-indikator yang selalu didengung-dengungkan serba stabil. Ciri khas Amsterdam sebagai pusat perdagangan ketika itu ialah rumah-rumah besar sepanjang sungai-sungai buatan. Pesawat udara penuh penumpang. kota-kota besar. mal-mal mewah padat pengunjung dan jalanjalan raya macet dengan mobil-mobil mewah. PDB Hindia Belanda meningkat terus.

bersyukurlah kita. Kalau ini yang akan digugat oleh Boediono seandainya dia menang menjadi wakil presiden. inilah gambaran negara Indonesia yang dijajah secara modern. kemiskinan dan kenistaan ? Karena mereka yang miskin dan menderita tidak mempunyai kekuatan apapun untuk memperbaiki nasibnya. Golongan kemapanan yang peduli. prihatin dan membela kepentingan yang tertindas sudah sangat lama tidak tampak . tetapi hatinya terusik. tidak tega menyaksikan penderitaan sesama anak bangsanya itulah yang harus bergerak membela sesama anak bangsanya yang terinjak. Mengapa golongan kemapanan yang harus membalikkan proses yang menjuruskan bangsa kita ke dalam jurang penderitaan. Mereka hanya mampu menerawang ke langit dengan wajah tanpa ekspresi sambil menerima kematiannya karena kekurangan makanan dan pelayanan kesehatan yang paling mendasar. Para pendiri negara kita adalah orang-orang berpendidikan tinggi. dan lebih senang menjadi kroni dan kompradornya para penghisap bangsa-bangsa lain.20 “Indonesia Menggugat Jilid II”? Buat saya dan sangat banyak orang Indonesia lainnya yang peduli dan prihatin terhadap nasib bangsa. Golongan kemapanan yang dirinya sendiri tidak mempunyai persoalan untuk hidup serba kecukupan. Peran golongan kemapanan yang tidak tampak lagi Kondisi ini tidak dapat dibiarkan oleh golongan kemapanan yang masih mempunyai hati nurani. terpinggirkan dan ternistakan oleh elit bangsanya sendiri yang sedang berkuasa. yang kalau mau menjadi pegawai negeri (ambtenaar) pada pemerintahan Hindia Belanda menikmati gaji yang sangat tinggi. Kelompok seperti inilah yang berhasil memerdekakan bangsa Indonesia dari penjajahan. Tetapi mereka memilih keluar masuk penjara ketimbang menjadi pegawai negeri yang menjadi bagian dari birokrasi yang menghisap bangsanya sendiri.

c. kereta api umum. air minum. telekomunikasi.“Indonesia Menggugat Jilid II”? 21 di Indonesia. e. pelabuhan-pelabuhan. d. f. . Dalam tahun itu terbit UU no. b. 1 tahun 1967 tentang Penanaman Modal Asing. g.” Undang-undang nomor 1 tahun 1967 Penjabaran yang konkret sampai bisa menjadi peraturan tidak pernah ada sampai tahun 1967. PROSES PENJAJAHAN DALAM PERUNDANGUNDANGAN DAN KEBIJAKAN-KEBIJAKAN OLEH ELIT BANGSA INDONESIA SENDIRI Menuju ke arah liberalisasi sejauh mungkin Sejak Republik Indonesia berdiri sampai tahun 1967 tidak pernah ada rincian konkret dari ketentuan pasal 33 UUD 1945 yang bunyinya: “Barang yang penting bagi negara dan cabangcabang produksi yang menguasai hajat hidup orang banyak dikuasai oleh negara dan dipergunakan untuk sebesar-besar kemakmuran rakyat. Terbitnya UU tersebut sebagai tindak lanjut dari Konferensi Jenewa bulan November 1967. penerbangan. transmisi dan distribusi tenaga listrik untuk umum. produksi. Saya kutip pasal 6 ayat 1 yang berbunyi: “Bidang-bidang usaha yang tertutup untuk penanaman modal asing secara pengusahaan penuh ialah bidang-bidang yang penting bagi negara dan menguasai hajat hidup rakyat banyak sebagai berikut: a. pelayaran.

air minum.” Apa artinya ini? Artinya adalah bahwa pasal 6 ayat 1 UU no. UU no. penerbangan. Peraturan Pemerintah nomor 20 tahun 1994 Di tahun 1994 terbit peraturan pemerintah nomor 20 dengan pasal 5 ayat 1 yang isinya membolehkan perusahaan asing melakukan kegiatan usaha yang tergolong penting bagi negara dan menguasai hajat hidup rakyat banyak. kereta api umum. Namun ada ketentuan bahwa porsi investor Indonesia yang 51% itu harus ditingkatkan menjadi 75% tidak lebih lambat dari tahun 1974. 6/1968 pasal 3 ayat 1 secara implisit mengatakan bahwa asing boleh memiliki dan menguasai sampai 49%. pelayaran. “ UU tentang Penanaman Modal Dalam Negeri di tahun 1968 Undang-undang nomor 6 tahun 1968 mengenai Penanaman Modal Dalam Negeri pasal 3 ayat 1 sudah mengizinkan investor asing memasuki cabang-cabang produksi yang jelas disebut “menguasai hajat hidup orang banyak” itu asalkan porsinya modal asing tidak melampaui 49%. mass media.” Pasal 6 ayat 1 mengatakan: “Saham peserta Indonesia sebagaimana dimaksud dalam pasal 2 ayat (1) huruf a sekurang-kurangnya 5% (lima perseratus) dari seluruh modal disetor perusahaan pada waktu pendirian. 1/1967 mengatakan bahwa perusahaan asing tidak boleh memasuki bidang usaha yang tergolong penting bagi negara dan menguasai hajat hidup orang banyak beserta perinciannya.22 “Indonesia Menggugat Jilid II”? h. pembangkitan tenaga atom dan mass media. UU no. pembangkitan tenaga atom. telekomunikasi. 4/1982 melarang asing sama sekali masuk di dalam bidang . yaitu pelabuhan. produksi dan transmisi serta distribusi tenaga listrik umum. i.

” PP no. 20/1994 menentang UU no. 20/1994 menentukan bahwa batas antara boleh oleh asing atau tidak adalah kepemilikan oleh pihak Indonesia dengan 5%. PP 20/1994 lalu dengan enaknya mengatakan bahwa kalau di dalam perusahaan kandungan Indonesianya adalah 5% sudah dianggap perusahaan Indonesia yang dapat melakukan kegiatan usaha yang tergolong penting bagi negara dan menguasai hajat hidup rakyat banyak beserta perinciannya. termasuk media massa Jadi PP no. baik perusahaan baru maupun lama. dibatasi sebagai berikut: a. Jadi seperti menantang atau meremehkan UUD 1945. 6/1968. Infra Struktur Summit I Posisinya hari ini ialah yang dikumandangkan di Infra Struktur . Yang sangat menyakitkan juga ialah diambilnya rumusan pasal 33 UUD 1945 secara mentah-mentah. Dalam bidang industri berakhir pada tanggal 31 Desember 1997. yang lalu dikatakan bahwa itu sekarang boleh ada di tangan asing dengan kandungan Indonesia 5%. menentang UU no. 6/1968 pasal 6 yang berbunyi: “Waktu berusaha bagi perusahaan asing. Dalam aspek lain PP 20/1994 juga menentang UU no. Dalam bidang-bidang usaha lainnya akan ditentukan lebih lanjut oleh pemerintah dengan batas waktu antara 10 dan 30 tahun. Dalam bidang perdagangan berakhir pada tanggal 31 Desember 1997. menentang UU no. 1/1967. b. 4/1982 dan menentang jiwa pasal 33 UUD 1945. Tidak ada lagi pembatasan waktu tentang dikuranginya porsi modal asing. c.“Indonesia Menggugat Jilid II”? 2 usaha pers.

2

“Indonesia Menggugat Jilid II”?

Summit oleh Menko Perekonomian ketika dijabat oleh Aburizal Bakrie di Hotel Shangrilla. Intinya mengumumkan kepada masyarakat bisnis dan korporasi di dunia bahwa Indonesia membuka pintunya lebar-lebar buat investor asing untuk berinvestasi dengan motif memperoleh laba dalam bidang infra struktur dan barang-barang publik lainnya. Kepada masyarakat bisnis dan korporasi diberitahukan bahwa kebijakan akan dijuruskan pada terbukanya hampir semua public goods and services bagi investor swasta, termasuk investor asing. Infra Struktur Summit II Dalam Infra Struktur Summit II yang Menko Perekonomiannya dijabat oleh Boediono, pengumuman pendahulunya diulangi lagi. Namun sekarang ditambah dengan penegasan bahwa tidak akan ada perbedaan perlakuan sedikitpun antara investor asing dan investor Indonesia. Kebijakan pemerintah dalam bidang infra struktur dan public goods pada umumnya hanya akan ditangani oleh pemerintah kalau penyediaannya tidak menguntungkan secara komersial. Melalui reformasi sektoral lambat laun semua barang publik dan infra struktur akan dibuat menguntungkan secara komersial, sehingga bisa disediakan oleh swasta dengan motif mencari laba. Ini berarti bahwa rakyat Indonesia akan dijuruskan hanya dapat menikmati barang dan jasa publik dengan membayar harga yang tingginya memungkinkan investor swasta memperoleh laba daripadanya. Falsafah bahwa perlu ada barang dan jasa publik yang penyediaannya diadakan atas dasar gotong royong, yaitu dibiayai oleh seluruh rakyat sesuai dengan kemampuannya masing-masing melalui sistem perpajakan lambat laun harus diperkecil. Semuanya harus diserahkan pada mekanisme pasar. Dengan demikian, secara perlahanlahan bangsa Indonesia yang miskin tidak akan dapat menikmati barang dan jasa publik dengan cuma-cuma.

“Indonesia Menggugat Jilid II”?

2

Apa lagi kalau kebijakan semacam ini ini tidak bersifat liberalisme yang primitif dan masih liar? Di seluruh dunia kita mengenal jaringan jalan raya bebas hambatan sangat luas yang digunakan oleh siapa saja dengan cuma-cuma. Di Indonesia tidak. Namanya saja “jalan tol”, yang implisit berarti barang siapa ingin menggunakan jalan raya bebas hambatan harus membayar tarif tol. Undang-Undang tentang Penanaman Modal nomor 25 tahun 2007 Undang-Undang tersebut menggantikan semua perundangan dan peraturan dalam bidang penanaman modal. Butir-butir pokoknya dapat dikemukakan sebagai berikut. Pasal 1 yang mendefinisikan “Ketentuan Umum” yang mempunyai banyak ayat itu intinya menyatakan tidak ada perbedaan antara modal asing dan modal dalam negeri. Pasal 6 mengatakan: “Pemerintah memberikan perlakuan yang sama kepada semua penanam modal yang berasal dari negara manapun yang melakukan kegiatan penanaman modal di Indonesia...” Pasal 7 menegaskan bahwa “Pemerintah tidak akan melakukan tindakan nasionalisasi atau pengambilalihan hak kepemilikan penanaman modal, kecuali dengan undang-undang.” Pasal 8 ayat 3 mengatakan “Penanam modal diberi hak untuk melakukan transfer dan repatriasi dalam valuta asing”, yang dilanjutkan dengan perincian tentang apa semua yang boleh ditransfer, yaitu sebanyak 12 jenis, dari a sampai dengan l, yang praktis tidak ada yang tidak boleh ditransfer kembali ke negara asalnya.

2

“Indonesia Menggugat Jilid II”?

Pasal 12 mengatakan bahwa semua bidang usaha atau jenis usaha terbuka bagi kegiatan penanaman modal, kecuali produksi senjata dan bidang usaha yang secara eksplisit dinyatakan tertutup berdasarkan undang-undang. Hak atas tanah menjadi 95 tahun untuk Hak Guna Usaha, 80 tahun untuk Hak Guna Bangunan dan 70 tahun untuk Hak Pakai. KECENDERUNGAN LIBERALISASI PENUH DAN SURVIVAL OF THE FITTEST Dengan seluruh rangkaian kebijakan yang telah dikemukakan tadi, menjadi sangat jelas garis kebijakan yang konsisten sejak tahun 1967. Kebijakan itu ialah semakin mengecilnya peran pemerintah dalam bidang pengadaan barang dan jasa yang tergolong dalam barang dan jasa publik, atau barang dan jasa yang pengadaannya membutuhkan dana sangat besar, tetapi merupakan kebutuhan pokok manusia. Karena kebutuhan dana yang sangat besar itu, sifatnya selalu menjadi monopolistik. Karena sifat monopolistik itu dipegang sepenuhnya oleh perusahaan swasta yang motifnya mencari laba, maka rakyat yang sangat membutuhkannya harus membayar dengan harga yang tingginya mencukupi untuk memberi laba yang menarik bagi investor swasta. Karena itu, yang mampu menggunakan barang dan jasa publik ialah perusahaan-perusahaan besar dan perorangan yang tergolong kaya. Kewajiban pemerintah untuk mengadakannya secara gotong royong melalui instrumen pajak setahap demi setahap dibuat minimal. Banyak sekali barang dan jasa publik yang akan dijadikan obyek mencari laba, dan dalam berlomba mencari laba itu tidak ada lagi perbedaan antara investor asing dan investor Indonesia. Semuanya didahului dengan mempengaruhi pikiran dan

manusia dalam jumlah sangat besar terbunuh. yang akhirnya pasukan AS sendiri tidak menemukan senjata pemusnah massal. Tetapi kalau perlu melakukan agresi. yang sebelum invasi AS ke Irak menyatakan bahwa di Irak tidak ada senjata pemusnah massal. Tidak kurang dari Tim Ahli Perserikatan Bangsa-Bangsa yang diketuai oleh Hans Blik. penghayatan yang berlaku pada elit bangsa yang memegang kekuasaan ekonomi sejak tahun 1967 sampai sekarang. Demikianlah pikiran. Tidak saja defensif dengan menutup pintu masuk negaranya dalam bidang apa saja dan dengan tarif setinggi berapa saja kalau dirasa perlu. Namun tengoklah apa semua yang dilakukan oleh Amerika Serikat dalam bidang proteksi. menangkap Presiden Noriega di negaranya sendiri yang lantas dipenjarakan di AS. Saya mengemukakan ini semuanya hanya membeo para elit AS sendiri yang menyuarakan hal-hal yang sama. semua peninggalan sejarah yang begitu pentingnya untuk peradaban umat manusia dimusnahkan. Presiden Saddam Husein dihukum gantung. Bahwa . Pusat dari indoktrinasi paham seperti dikemukakan di atas adalah Amerika Serikat. liberalisasi. Toh Irak diserbu. Elit negara-negara mangsa harus diyakinkan dan diberi pemahaman bahwa nasionalisme dan patriotisme sudah sangat ketinggalan zaman. Orang modern harus memahami globalisasi yang merupakan the borderless world. swastanisasi dan globalisasi yang cakupannya sebanyak dan tingkat keterbukaannya sejauh mungkin. melindungi warga negaranya sendiri. Nasionalisme dan patriotisme bagaikan katak dalam tempurung dengan wawasan yang sangat sempit. Irak dihancur leburkan dengan dalih mempunyai senjata pemusnah massal yang akan dipakai untuk memusnahkan umat manusia. yang harus memusnahkan nasionalisme dan patriotisme.“Indonesia Menggugat Jilid II”? 2 pembentukan opini publik dalam bidang mekanisme pasar. paham.

Bangsa Indonesia kebagian royalti dan pajak yang relatif sangat kecil.2 “Indonesia Menggugat Jilid II”? saya kutip dalam tulisan ini untuk menggambarkan bahwa di kalangan elit mashab tertentu di Indonesia berlaku pepatah “Guru kencing berdiri. Tambang kita dikeduk oleh pemodal asing. dan fundamentalisme pasar dihayatinya bagaikan agama adalah hal yang tidak jelas. dan hasil yang milik mereka itu dicatat oleh Biro Pusat Statistik kita sebagai Produk Domestik Bruto Indonesia. Apakah itu karena kebodohan.” LIBERALISASI YANG JELAS MELANGGAR KONSTITUSI Liberalisasi dan mekanisme pasar yang dihayatinya bagaikan “agama” telah diberlakukan sedemikian jauhnya. elit bangsa Indonesia sendiri telah menyerahkan segalagalanya kepada kekuatan-kekuatan non Indonesia yang lebih kuat dan lebih raksasa. Widjojo Nitisastro ? Di mana posisi Boediono antara para teknokrat yang disebut “Bekerley Mafia” dan para ekonom yang disebut “Blog Perubahan. tanpa membunuh siapapun. Hasil tambang dan mineral sangat mahal yang milik pemodal asing itu ketika diekspor dicatat oleh Biro Pusat Statistik sebagai Ekspor Indonesia yang meningkat. Inikah yang akan digugat oleh Boediono? Dan apakah yang akan digugat para teknokrat yang dalam konperensi Jenewa bulan November tahun 1967 dipimpin oleh Prof. Mahkamah Konstitusi (MK) telah menyatakan bahwa pasal . memberlakukan kebijakan yang menyesatkan dan membuat rakyat sangat sengsara. sekitar 90% dari minyak kita dieksploitasi oleh perusahaan-perusahaan minyak asing. murid kencing berlari.” Beberapa kenyataan aneh yang sama sekali tidak logis Sampai sekarang. sehingga terang-terangan melanggar Konstitusi. karena pengkhianatan. Sejak tahun 1967. ataukah karena keyakinan bahwa liberalisme.

000). 115 trilyun untuk mensubsidi. .“Indonesia Menggugat Jilid II”? 2 28 ayat (2) Undang-Undang nomor 22 tahun 2001 tentang Minyak dan Gas Bumi bertentangan dengan Konstitusi. 4. 61. Surat tersebut tidak dihiraukan tanpa konsekuensi buat Pemerintah. 630 per liter (dengan asumsi kurs US 1 = Rp.500 per liter sama dengan harga minyak mentah sebesar Rp. Ketika itu. yang oleh MK dianggap paling krusial dalam menentang amanat Konstitusi. pemerintah harus mengeluarkan uang Rp. 10. harga minyak mentah di New York US$ 60 per barrel. karena harus ekuivalen dengan harga minyak mentah yang terbentuk melalui mekanisme pasar di New York Mercantile Exchange (NYMEX) bertentangan dengan Konstitusi kita. Bahkan seolah-olah menantang.5 per barrel (1 barrel = 159 liter). harga bensin premium dinaikkan dari Rp.500 per liter. Dengan kenyataan bahwa biaya-biaya untuk penyedotan. harga bensin premium yang Rp. maupun DPR maupun DPD. Petronas. harga BBM dinaikkan dengan mengacu pada pasal 28 di dalam undang-undang nomor 22 tahun 2001 tersebut. Ketua MK menulis surat kepada Presiden bahwa kebijakan menaikkan harga BBM sampai 126 %. Kita membaca dan menyaksikan betapa bagian terbesar dari rakyat serta merta menjadi miskin dan sangat menderita. Pemerintah dan DPR sama sekali tidak menghiraukannya. Sebagai contoh. Bersamaan dengan itu kita saksikan bermunculannya stasiunstasiun penjualan bensin oleh Shell. Uang itu tidak ada. Demi mekanisme pasar yang mutlak tanpa pandang bulu. 2. Ketika itu Boediono Menko Perekonomian. caranya memberi argumen dan penjelasan kepada rakyat juga melalui penyesatan dan kebohongan. pengilangan dan transportasi sebesar US 10 per barrel atau Rp. Dikatakan bahwa kalau harga BBM tidak disamakan dengan ekuivalennya harga minyak mentah yang terbentuk di NYMEX. Maka harga BBM dinaikkan. 4.700 per liter menjadi Rp. yang akan disusul dengan perusahaan-perusahaan minyak asing lainnya.

refining dan transporting seluruhnya US$ 10 per barrel dan seperti kita ketahui. Sebelum dinaikkan.500 per liter (yang sama dengan US $ 61. . Maka belum lama berselang IMF menyatakan bahwa Pemerintah Indonesia sangat kaya uang tunai. Biaya lifting. 2. MEKANISME ASAR ANG NGGUL ELAH EMASUKKAN P Y U T M BANYAK INTERVENSI OLEH PEMERINTAH Bahwa sistem mekanisme pasar terbukti unggul dibandingkan dengan sistem perencanaan sentral seperti yang diterapkan oleh negara-negara komunis memang benar validitasnya. 15 trilyun sebagai hasil menaikkan harga BBM. 4.700 dengan Rp. Seperti telah berkali-kali dijelaskan. uang tunai yang dikeluarkan Rp. ketika itu nilai tukar rupiah adalah Rp. tetapi perbedaan antara harga Rp. pemerintah kelebihan uang tunai sebanyak Rp. Kalau kita mengambil bensin premium sebagai contoh. harga bensin premium Rp.000 per dollar AS. Perubahan-perubahan itu ialah tidak ditabukannya campur tangan pemerintah yang dibutuhkan. karena ketambahan Rp. 2. agar mekanisme pasar yang efisien dapat dikombinasikan dengan intervensi berupa kebijakan-kebijakan pemerintah dengan maksud melindungi yang lemah dan memperoleh keadilan serta pemerataan dalam menikmati pertumbuhan ekonomi. 1 barrrel = 159 liter.0 “Indonesia Menggugat Jilid II”? Dalam menaikkan harga BBM. 10. Pemerintah mengemukakan dan menjelaskannya kepada publik menggunakan istilah “subsidi” yang disamakan dengan pengeluaran uang tunai. Namun mekanisme pasar yang “ditemukan” oleh Adam Smith dan ditulis di tahun 1776 telah mengalami banyak perubahan.070. 2.700 per liternya. 630 per liter.5 per barrel). padahal tidak demikian kenyataannya. sehingga untuk setiap liternya. Tetapi kepada rakyat dikatakan bahwa uang yang dikeluarkan sama dengan “subsidi” yang bukan pengeluaran uang tunai.

seperti yang dapat kita lihat di Indonesia sekarang ini. yang langsung disambung dengan “Negara tidak boleh terlalu banyak campur tangan. senior semashab dengan Boediono secara berkelakar pernah mengatakan bahwa “PDB tumbuh sepanjang malam sampai pagi hari ketika pemerintah tidur. Tetapi negara juga tidak boleh hanya tidur. namun kemerdekaan yang diidam-idamkan sebagai pintu gerbang emas menuju pada kemakmuran dan kesejahteraan yang adil buat seluruh rakyat ..” Seperti dapat kita lihat dari uraian di atas. Kompetisi yang melekat pada mekanisme pasar tidak dijadikan kompetisi yang beradab. Maksudnya tiada lain untuk menjadikan Indonesia lahan yang subur untuk dihisap dan dijadikan sapi perahan.” Buat saya ini ideologi bukanisme. dsb.. tetapi dibiarkan menjadi kompetisi yang menganut hukum rimba.”. secara sistematis praktik penyelenggaraan negara dalam bidang ekonomi diarahkan pada kapitalisme. sebab itu akan mematikan kreativitas. liberalisme dan mekanisme pasar dalam bentuknya yang paling awal. tetapi juga bukan diatur terlalu banyak oleh pemerintah. yang menjadi kompetisi saling memotong leher atau cut throat competition. yaitu bukan diserahkan pasar bebas.. paling primitif dan sudah sangat lama ditinggalkan oleh negara-negara Eropa Barat dan Amerika Serikat. Hasilnya adalah survival of the fittest.. Dengan sistem tersebut yang menang adalah pemilik modal besar dan yang kuat.“Indonesia Menggugat Jilid II”? 1 Dalam pidatonya tanggal 15 Mei 2009 di Bandung Boediono mengatakan dengan jelas bahwa: “Perekonomian Indonesia tidak dapat seluruhnya diserahkan kepada pasar bebas. Yang tidak terlalu banyak itu yang seperti apa? Berkaitan dengan kata “tidur” yang dipakai oleh Boediono. Walaupun hampir 64 tahun sudah merdeka secara politik.

walaupun termasuk kategori barang dan jasa publik. Seperti telah disinggung tadi. menurut Kantor Perwakilan Bank Indonesia di Jakarta. belum lama berselang Bank Dunia mengumumkan bahwa garis kemiskinan sekarang pendapatan sebesar US$ 2 per orang per hari. dengan negara-negara dari belahan Selatan dunia memberikan subsidi kepada negara-negara kaya di belahan Utara dunia.pembayaran dari negara-negara dunia ketiga berjumlah sekitar US$ 375 milyar per tahun atau 20 kali lebih besar dari jumlah uang yang diterimanya dari negara-negara kaya. Pekerjaannya hanya memberi hutang setiap tahunnya kepada Indonesia.” (halaman 19). Dengan hutang yang tanpa henti diberikannya sejak tahun 1967 sampai sekarang.. tidak kalah pentingnya ialah liberalisasi dalam bidang keuangan. Indonesia masuk ke dalam jebakan hutang (debt trap) tersebut. PENGHANCURAN MELALUI SISTEM KEUANGAN Kalau tadi disebutkan peran pemerintah yang semakin minimal dalam produksi dan distribusi barang dan jasa.. Sejak tahun 1967 dibentuk perkumpulan dari negara-negara kaya yang disebut Inter Governmental Group on Indonesia (IGGI) yang berubah nama menjadi CGI. walaupun separuh dari manusia di dunia hidup dengan US$ 2 per hari... . Karena itu. Sistem ini juga disebut Marshall Plan yang terbalik. Dalam buku yang tadi telah disebut. bangsa Indonesia tidak bertambah makmur dan sejahtera secara berkeadilan. 50% dari rakyat Indonesia miskin. Justru sistem inilah yang merupakan frontier untuk membuat negara-negara mangsa tergantung dan dikendalikan. yaitu “A Game As Old As Empire” Steven Hiatt sebagai editornya menulis bahwa “.2 “Indonesia Menggugat Jilid II”? semakin jauh dari kenyataan.

Walaupun Pemerintah dapat menunjukkan angka hutang yang terus berkurang kalau dinyatakan dalam persen dari PDB. Permainan statistik seperti ini diberlakukan pada semua lini. pelayanan kesehatan dasar. listrik dan lingkungan yang sehat. yang diberikan dalam bentuk Extended Fund Facility atau yang lebih terkenal dengan sebutan program Letter of Intent. Dalam kondisi seperti itu Indonesia sebagai anggota IMF menggunakan haknya minta bantuannya. penyediaan air bersih.“Indonesia Menggugat Jilid II”?  Dampak dari jebakan hutang sudah lama sangat terasa.000 per dollar. namun pos pengeluaran APBN untuk pembayaran cicilan hutang pokok dan bunga mengambil porsi terbesar. Tetapi pemerintah kemudian menyajikan angka hutang negara yang dinyatakan dalam persen dari PDB yang relatif lebih kecil. 16. Kondisi moneter dan kepercayaan terhadap Indonesia hancur. terutama sistem moneternya yang sudah dibuat sangat terbuka dan liberal akhirnya mengakibatkan krisis moneter dan ekonomi di tahun 1997 yang disusul dengan depresi yang cukup hebat. Kepercayaan dunia internasional maupun para pengusaha Indonesia sendiri merosot sampai nol. Rupiah merosot nilainya dari Rp. Pertama tentunya besarnya jumlah hutang luar negeri itu sendiri yang sudah melampaui batas-batas kewajaran kalau dihitung dengan ukuran Debt Service Ratio (DSR). Akibatnya Pemerintah tidak dapat memberikan yang minimal kepada rakyatnya dalam memenuhi kebutuhan hidup yang paling mendasar seperti pendidikan.400 per dollar menjadi Rp. Pada akhir pemerintahan Megawati sebuah badan evaluasi independen di dalam tubuh IMF yang bernama Independent Evaluation Office mengakui bahwa IMF telah melakukan . Krisis Moneter/Ekonomi 1997 dan IMF Sistem ekonomi. 2.

600 trilyun. Kalau kurs dollar AS kita ambil Rp. 144 trilyun BLBI. yang kejadiannya dalam keadaan darurat. Tidak demikian yang dilakukan oleh pemerintah atas instruksi atau petunjuk IMF. IMF memaksa menjualnya kepada swasta dengan harga yang ekuivalen dengan Rp. 430 trilyun beserta kewajiban pembayaran bunganya dengan jumlah Rp. 1. atau keseluruhannya Rp. kesalahan yang paling mencolok ialah dengan ditutupnya 16 bank tanpa persiapan yang matang dengan akibat BLBI sebesar Rp. dan minimal Rp. maka dana BLBI dikonversi menjadi modal ekuiti milik pemerintah. Bank-bank milik pemerintah Indonesia yang di dalamnya ada surat tagihan kepada pemerintah (atau dirinya sendiri) dijual dengan harga murah kepada swasta. 600 trilyun beban bunganya. 430 trilyun Obligasi Rekap. Mestinya dan nalarnya. 10 . Contoh yang paling fenomenal tentang ketidak warasannya kebijakan pemerintah dalam bidang ini adalah penjualan BCA. 10. Di Indonesia.174 trilyun. Rp. Menjadinya milik pemerintah karena dalam keadaan darurat pemerintah harus menghentikan rush dengan BLBI. 60 trilyun. tetapi sekarang menjadi milik pemerintah. atau seluruh beban menjadi Rp.4 milyar dollar AS. 144 trilyun. Di dalamnya ada OR atau surat hutang pemerintah sebesar Rp. antaranya banyak swasta asing. Karena BLBI yang dipakai oleh bank-bank swasta untuk menghentikan rush tidak mungkin dikembalikan. 97% dari BCA sudah milik pemerintah. OR adalah surat pengakuan hutang oleh pemerintah yang dipakai untuk meningkatkan kecukupan modal dari bank-bank yang dirusak oleh para pemiliknya. Sampai di sini OR merupakan injeksi dana oleh pemerintah kepada bank yang milik pemerintah. “Indonesia Menggugat Jilid II”? banyak kesalahan di Indonesia. Obligasi Rekapitalisasi Perbankan sebesar Rp.000 per dollar. jumlah ini ekuivalen dengan 117. OR itu ditarik kembali sambil pulihnya bank-bank menjadi sehat kembali.

dan yang memiliki BCA dengan harga itu serta merta mempunyai tagihan kepada pemerintah sebesar Rp. Kalau harga tertinggi dari semua minat lebih rendah dari harga minimum yang ditentukan oleh pemerintah. dan demikian seterusnya sampai kondisi ekonomi membaik dan BCA dapat dijual dengan harga yang sama atau di atas harga minimum. Jadi BCA harus dijual dengan harga Rp.“Indonesia Menggugat Jilid II”?  trilyun. mengajak Meneg BUMN Laksamana Sukardi melapor kepada Presiden Megawati bahwa penandatanganan penjualan keesokan harinya dapat dilakukan. 60 trilyun dalam bentuk OR yang dapat dijual kepada siapa saja.00 Menko Dorodjatun menghentikan rapat. Semua niat membeli dikirimkan dalam amplop tertutup kepada notaris yang ditunjuk bersama oleh IMF dan Pemerintah Indonesia. Pemerintah berhak memasukkan amplop tertutup yang isinya harga minimum untuk penjualan BCA. tentunya termasuk Menteri Keuangan Boediono. penjualan BCA ditunda dengan 6 bulan. Dalam rapat tersebut hanya seorang menteri yang menentang sangat keras. Satu hari sebelum penandatanganan penjualan BCA kepada Farallon terjadi sidang kabinet terbatas tidak resmi selama tiga jam. kapan saja dan di mana saja. 10 trilyun. Tidak ada harga minimum yang disyaratkan oleh pemerintah. Sebelum tuntas. Perdebatan sangat sengit. Semuanya menyetujui. Semua prinsip-prinsip sama sekali dibuang dalam penjualan BCA. pada jam 18. yang notabene paling bertanggung jawab atas penciptaan beban keuangan negara yang dahsyat ini. Apakah ini bentuk penjajahan yang ingin digugat oleh Boediono? Bukankah lantas menjadi cerita “Boediono menggugat Boediono”? Sangat perlu Boediono menjelaskan siapa para penjajah dari dalam negeri yang bangsanya sendiri !! Sebagai catatan perlu saya kemukakan bahwa ketika saya menjabat Menko EKUIN telah dicapai kesepakatan lisan dengan wakil IMF Anoop Singh bahwa penjualan BCA harus melalui tender terbuka. walaupun ketika .

dalam rapat antar menteri sudah saya tegaskan dengan jelas. “Indonesia Menggugat Jilid II”? saya Kepala Bappenas. 10 milyar seseorang dapat mendirikan bank. Hutang luar negeri pemerintah. Babak belurnya yang kumulatif sama sekali dilupakan. Saldo ini diukur dengan persen dari PDB yang lantas dianggap sudah rendah. . saldonya ketika itu sekitar 80 milyar dollar AS. apakah semua hutang dalam negeri yang diciptakan oleh IMF dengan dukungan oleh beberapa elit Indonesia sendiri itu sebuah kesengajaan ataukah sebuah kebodohan? Besarnya hutang dalam negeri yang diciptakan dalam hitungan minggu lebih besar dari hutang luar negeri yang diakumulasi selama 32 tahun. sekitar 200 bank-bank swasta beroperasi di Indonesia. Latar Belakang Kehancuran Sistem Perbankan Indonesia Biang keladinya lagi-lagi adalah liberalisasi. Ditambah dengan yang sudah ada. Isinya liberalisasi perbankan yang menentukan bahwa dengan modal disetor sebesar Rp. Dalam bulan Oktober 1988 lahir Paket Kebijakan Oktober yang terkenal dengan sebutan PAKTO. Bukankah ini berarti bahwa kesepakatan yang bisa membuat hasil penjualan BCA tidak merugi ditiadakan segera saja setelah Tim Ekonomi berganti menjadi Boediono sebagai menteri keuangannya? Mengapa Boediono begitu ngotot harus menjual BCA tepat pada waktu yang ditentukan oleh IMF dengan meniadakan kesepakatan sebelumnya yang menguntungkan pemerintah? Bukankah ini sikap dan praktek yang sepenuhnya menurut pada IMF secara membabi buta? Apakah praktik semacam ini yang akan digugat oleh Boediono? Buat saya masih merupakan pertanyaan besar. tetapi selama 32 tahun jumlah yang telah dibayarkan berjumlah sekitar 128 milyar dollar AS. Maka serta merta sekitar 160-an bank lahir.

tetapi di dalamnya ada tagihan kepada pemerintah (Obligasi Rekap) sebesar . Dana masyarakat yang dipercayakan disalahgunakan dengan cara memakainya untuk membiayai pendirian perusahaan-perusahaannya sendiri dengan mark up. Setelah gejolak perbankan reda. Oleh BI juga masih dilindungi dengan memberikan Fasilitas Diskonto II.“Indonesia Menggugat Jilid II”?  Bank-bank PAKTO didirikan. padahal di dalamnya masih ada tagihan kepada pemerintah yang besar. saya ulangi lagi kasus BCA yang dijual dengan nilai sekitar Rp. Setelah itu masih kalah clearing lagi. ternyata sangat banyak bank rusak berat. karena 16 bank tersebut masih mengiklankan laporan keuangannya yang diaudit dan dinyatakan sehat. Bank-bank yang di dalamnya sudah rusak tidak terlihat oleh publik yang mempercayakan uangnya untuk disimpan pada bank-bank tersebut. 16 bank ditutup mendadak tanpa persiapan yang matang seperti yang telah digambarkan di atas. 430 trilyun dengan beban bunga sebesar Rp. 144 trilyun. Tetapi Bank Indonesia ketika itu bukannya menghukum. Sebagai contoh. 600 trilyun. Dalam kondisi panik lagi. Dengan terjadinya krisis di tahun 1997 dan ikut campurnya IMF dalam penentuan kebijakan moneter dan ekonomi di Indonesia. bank-bank diguyur dengan BLBI sebesar Rp. Terus dijual dengan harga murah. Tentu mereka sangat marah. Maka bank sudah kalah clearing. malahan memberikan fasilitas yang dinamakan Fasilitas Diskonto I. 10 trilyun. untuk menghentikan rush. Bank-bank ini menjadi milik pemerintah. dimiliki dan dikelola oleh para pedagang besar yang sama sekali tidak mempunyai latar belakang perbankan. yang sampai saat ini menjadi kontroversi. Kepada para nasabahnya dikatakan bahwa uangnya hilang karena mereka salah pilih bank. Maka terjadilah rush besarbesaran pada bank-bank yang lain. Pemerintah menginjeksi dengan surat hutang negara yang dinamakan Obligasi Rekapitalisasi Perbankan (Obligasi Rekap atau OR) sampai jumlah Rp.

Ini jumlah yang sangat besar. dan langsung mempunyai surat hutang negara sebesar Rp.22 trilyun. dengan tingkat suku bunga yang tercantum pada setiap OR. yaitu beban bunga sebesar Rp. 60 trilyun ini selama belum dilunasi besarnya melebihi hasil penjualan yang Rp. “Indonesia Menggugat Jilid II”? Rp. 63. baik hutang luar negeri maupun dalam negeri untuk tahun anggaran 2006 sebesar Rp. 60 trilyun. dan ditunda untuk berapa lama. Jumlah ini pengeluaran terbesar setelah keseluruhan pengeluaran pemerintah pusat dan pemerintah daerah. Jadi pembeli membayar Rp. Dengan jumlah hutang dalam bentuk OR sebesar ini. jumlah nominalnya Rp. jumlah hutang pokoknya tetap. . kalau kita membatasi diri pada Obligasi Rekapitalisasi Perbankan saja (OR). 600 trilyun. 10 trilyun. Prospek Keuangan Negara Sangat Suram Seperti dikemukakan tadi. sangat besar kemungkinannya bahwa Pemerintah tidak akan mampu membayar hutang pokoknya tepat waktu pada tanggal jatuh temponya. tetapi kewajiban membayar bunganya membesar. baik rutin maupun pembangunan. Kalau ada bagian dari OR yang jatuh tempo dan ditunda pembayarannya.63 trilyun dan cicilan hutang pokoknya sebesar Rp. 76. Dengan berapa membesarnya tergantung dari berapa besar hutang pokok yang pembayarannya harus ditunda. 10 trilyun. Beban bunga per tahun dari Rp. 1.030 trilyun. Maka Pemerintah tidak bisa lepas dari kewajiban membayar hutang pokok dan bunga yang secara keseluruhannya Rp. Dampaknya pada besarnya beban hutang pemerintah.59 trilyun. 60 trilyun. 140. kewajiban membayar bunga sebesar Rp. 430 trilyun. Kalau setiap lembar OR ini dibayar tepat pada tanggal jatuh tempo.

dan Damayanti membuat studi dengan cara mengembangkan 6 buah skenario. yaiti Gatot Arya Putra. 800 milyar setiap tahunnya. 1. Tidak ada orang yang percaya. Setelah itu. maka kewajiban Pemerintah membayar keseluruhan jumlah hutang OR ditambah bunganya membengkak menjadi Rp. Skenario terburuk ialah kalau setiap lembar OR harus ditunda dengan tenor yang sama.“Indonesia Menggugat Jilid II”?  Tiga pegawai dari BPPN yang bekerja pada Bagian Sekretariat dan Penelitian. 14. Kita sudah tidak dapat mengikutinya lagi bagaimana perkembangannya beban hutang pemerintah dewasa ini. OR akan dapat diselesaikan dalam waktu 8 tahun dengan tambahan pembayaran bunga sebesar Rp.030 trilyun akan ketambahan Rp. Kalau ini terjadi. Menteri Keuangan Boediono menjamin kepada DPR bahwa dengan skema yang dinamakannya reprofiling atau pengaturan kembali jadwal pembayaran cicilan hutang pokok OR. jumlah hutang OR ditambah dengan bunganya yang Rp. Saya sebagai Menko EKUIN dengan Bambang Sudibyo sebagai Menteri Keuangan mempunyai rencana konkret untuk menarik OR terlebih dahulu sebelum bank-bank dijual kepada swasta. Artinya. dan mereka dipecat. Ira Setiati. Besarnya hutang pemerintah dalam bentuk OR beserta besarnya bunga yang harus dibayar menjadi beban sangat berat untuk keuangan negara yang sudah menjadi pengetahuan publik. Yang jelas terasa adalah serba kekurangan uang untuk melindungi bagian terbesar rakyat dari kelaparan.4 trilyun saja. Rencana yang konkret ditulis oleh 6 orang akhli yang secara sukarela menyumbangkan pikiran-pikirannya di bawah .6.000 trilyun. kita baca terus menerus betapa seringnya pemerintah menerbitkan Surat Hutang Negara (SUN). kekurangan pendidikan dan penyakit. Makalah mereka yang sedianya akan dipublikasikan dalam majalah BPPN dihentikan. baik dalam rupiah maupun dalam valuta asing.

Kesemuanya pernah dipublikasikan di Kompas dan juga dibukukan dengan fasilitas dari Bappenas. tetapi para akhli ekonomi Amerika yang mengaku sebagai pelakunya. Kalau mau membantah jangan membantah saya. (salah satu penulis) Menteri Keuangan Boediono (dalam pemerintahan Megawati) memahaminya. yaitu John Perkins yang diperintahkan oleh agen CIA Claudia Martin. Bahwa hutang luar negeri dijadikan alat penekan pada negara debitur dibantah oleh beberapa akhli ekonomi Indonesia yang mencuat ketika tulisan ini sedang dibuat. yang dijadikan alat penekan untuk memaksakan kebijakan yang pro korporatokrasi. Kalau ini benar. berbagai istilah dan pengertian yang tidak lazim diciptakan dengan maksud memperlancar terjerumus dan terjeratnya Indonesia ke dalam hutang. Apa alasannya tidak jelas. tetapi bantahlah Claudia Martin dan John Perkins. Saya perlu menjelaskan bahwa seperti dapat dibaca dalam tulisan ini. yang mengatakan ini bukan saya. apakah ini termasuk yang akan digugat olehnya kalau dia nantinya terpilih menjadi Wakil Presiden? TONGGAK-TONGGAK KEBIJAKAN EKONOMI SETELAH PERTEMUAN JENEWA BULAN NOVEMBER TAHUN 1967 Setelah kaki-kaki korporatokrasi ditancapkan yang oleh Jeffrey Winters dikatakan “pengambil alihan ekonomi Indonesia dalam 3 hari”. . Boediono ketika itu tidak berdaya mandiri terhadap Bank Dunia dan IMF. Kalau sekarang mau menggugat. Konon kabarnya setelah dijelaskan oleh Anthony Budiawan. Kami menduga keras bahwa Bank Dunia dan IMF tidak menyetujuinya.0 “Indonesia Menggugat Jilid II”? pimpinan Dradjat Wibowo. tetapi toh semua bank dijual tanpa menarik OR-nya terlebih dahulu. Semoga Boediono menggugat mereka berdua yang merencanakan dan melakukan penggerojokan hutang kepada Indonesia dengan maksud menggunakannya sebagai leverage guna memaksakan kehendaknya.

“Indonesia Menggugat Jilid II”? 1 Perwujudannya yalah organisasi yang khusus diciptakan buat negara-negara pemberi hutang yang bernama Intergovernmental Group on Indonesia (IGGI). yang ditambah dengan kewajiban membayar bunga menjadi ribuan trilyun rupiah dalam bentuk BLBI ditambah obligasi rekap. • Anggaran pembangunan dibiayai sepenuhnya dari hutang luar negeri yang katanya untuk menghindari crowding out di dalam negeri. • Hutang luar negeri dari IGGI/CGI dan 3 lembaga keuangan tidak disebut “loan” atau hutang. Memang kebiasaan internasional seperti ini supaya bisa membandingkan dengan negara-negara lain. Koordinatornya Bank Dunia. Tetapi ketika krisis dengan enaknya membuat hutang dalam negeri. dan perlu memberikan catatan khusus. yang kemudian berganti nama menjadi Consultative Group of Indonesia (CGI). yang bersama-sama dengan Bank Pembangunan Asia dan IMF merupakan trio pemberi hutang juga. Bentuk-bentuknya antara lain adalah sebagai berikut: • Anggaran negara (APBN) yang jelas defisit disebut berimbang. yang sebenarnya dapat ditarik kembali sebelum bank-bank yang mempunyai . • Jumlah defisit APBN dihitung tanpa memasukkan cicilan hutang pokok sebagai pengeluaran. tetapi disebut “aid” atau bantuan. Sebutannya dalam APBN “Pemasukan Pembangunan”. Tetapi kalau jumlah hutang ditambah bunga sudah sekitar 25 % dari APBN. tetapi tidak disebut hutang. gambarannya lantas menyesatkan. yang ditutup dengan hutang luar negeri. Yang dihitung hanya pengeluaran uang untuk membayar bunga.

2 “Indonesia Menggugat Jilid II”? obligasi rekap ini dijual dengan harga murah. • Boediono sebagai Menteri Keuangannya Presiden Megawati menyatakan dengan yakin beban hutang akan merata dan selesai dalam waktu 8 tahun setelah melakukan apa yang olehnya dinamakan reprofiling. Yang menentukan apakah sebuah negara bangkrut atau tidak yalah kemampuannya membayar hutang beserta bunganya tepat pada waktunya (likuiditas). Ketika sudah menjadi sangat tinggi. Karena tidak likuid. karena sudah menjadi sangat besar. apakah sudah melampaui batas yang aman. Lompatan dari ukuran DSR menjadi persen dari PDB sudah kontroversial. Sekarang kedodoran dengan beban sangat luar biasa beberapa tahun mendatang. dalam DSR cicilan hutang pokok dihitung sebagai faktor. karena didasarkan atas persen dari PDB. • Demikian juga dengan ukuran tentang jumlah hutang luar negeri. Bahwa Indonesia tidak likuid . • Hutang luar negeri pemerintah Indonesia dinyatakan masih dalam batas yang normal. bukan besarnya hutang dalam persen dari PDB. Tetapi yang lebih substantif yalah kita harus membedakan antara solvabilitas (solvency) dan likuiditas. Pada tanggal 15 Mei 2009 Boediono mencalonkan diri sebagai calon wakil presiden RI. • Dalam menghitung ukuran tentang ambang batas yang aman. Tetapi dalam menghitung Defisit dalam APBN cicilan hutang pokoknya tidak dihitung. seperti yang diberitakan oleh media massa. Tadinya dinyatakan dalam rasio antara ekspor neto dengan pembayaran cicilan hutang pokok + bunga hutang luar negeri yang disebut Debt Service Ratio (DSR). terpaksa berhutang terus. Persen dari PDB adalah solvency yang tidak mesti likuid. ukurannya diubah menjadi dalam persen dari PDB.

4. tingkat bunga seperti ini tergolong junk bond yang sangat rongsokan. terutama kalau dibandingkan dengan AS yang mendekati nol persen. Menaikkannya dari Rp. • Dalam ampanye emilu egislatif ang alu. bukankah kebijakan menentukan harga BBM di Indonesia membiarkan dirinya didikte oleh NYMEX? Dan bukankah yang menjiwainya supaya perusahaan-perusahaan minyak .5% sampai 11%. Kalau negara RI memberikan tingkat bunga seperti ini.700 sampai Rp. terpaksa harus berbicara tentang hal yang sama sekali tidak benar. Boediono yang calon wapres dari yang mengiklankan ini. mengapa tidak sekalian menyatakan hutang Indonesia dalam persen dari seluruh kekayaan alamnya? Jatuhnya menjadi 0. ang ikemukakan k p l y l y d terus menerus melalui iklan sangat mahal yalah pemerintah menurunkan harga BBM tiga kali.“Indonesia Menggugat Jilid II”?  terbukti dalam era Boediono sebagai Menko Ekonomi dan Sri Mulyani sebagai Menteri Keuangan yang menerbitkan SUN dalam dollar AS dengan suku bunga antara 10. • Lantas siapa yang mau digugat? Berkaitan dengan isu ini. padahal tidak ada uang tunai yang dikeluarkan untuk memperoleh minyak mentah kecuali yang harus diimpor.500 saja. bagaimana penjelasannya. Untuk dunia usaha swasta saja.000. 6.---- persen saja! • Subsidi BBM dinyatakan sebagai identik dengan pengeluaran uang tunai oleh pemerintah. Kalau mau mengemukakan solvabilitasnya saja. Tetapi menaikkannya tiga kali sebelumnya tidak disebut. dan negara-negara lain yang memberikan bunga deposito antara 0. Menurunkannya hanya sampai Rp. Dalam kampanye mendatang. tetapi dijadikan bahan kampanye dalam iklan yang sangat mahal.3 % sampai 2 % saja (dalam hal jangka sangat panjang). 2.

karena rakyat dibiasakan membayar harga bensin dengan harga yang didikte oleh NYMEX? • Sampai saat ini pemerintah masih saja menggunakan istilah “subsidi” yang implisit membiarkan dirinya didikte oleh NYMEX. Apakah Boediono sebagai guru besar akan menggugatnya berdasarkan nalar ilmu pengetahuannya. Tetapi yang sangat aneh. maka saat ini. baik sebagai intelektual maupun sebagai negarawan. ataukah atas pertimbangan politik akan membelanya? Kalau kita mempelajari pikiran-pikiran Bung Karno. dan kebijakan yang terus menerus sangat liberal atas pendiktean 3 lembaga keuangan internasional. Konsistensinya inilah yang membawanya ke berbagai penjara dan pembuangan. dengan kurs yang berubah dan harga minyak mentah yang sudah berubah pula. APA HASIL AKHIR DARI KEBIJAKAN EKONOMI OLEH TIM EKONOMI PEMERINTAH YANG SENANTIASA TERDIRI DARI SATU KELOMPOK MASHAB PIKIRAN. DAN BERGANTUNG PADA KAPITALISME PARTIKELIR SERTA KEPERCAYAAN MUTLAK PADA KEAMPUHAN MEKANISME PASAR ? Dimulai dengan pertemuan di Jenewa bulan November 1967 yang ditulis sangat ilustratif. kondisi bangsa kita dapat digambarkan sebagai berikut: • Selama Orde Baru PDB memang meningkat dengan ratarata 7 % per tahun. harga BBM masih tetap saja dipertahankan seperti apa adanya. setelah hampir 64 tahun merdeka. yang sangat dibanggakan oleh Tim Ekonomi dan diagungkan oleh trio lembaga keuangan . “Indonesia Menggugat Jilid II”? asing bisa membuka pompa-pompa bensin di Indonesia dengan laba. sangat konsisten.

PNB tidak pernah dipakai sebagai indikator ekonomi yang penting oleh Tim Ekonomi Pemerintah yang memegang kekuasaan dan kendali ekonomi sampai saat ini. Yang membentuk PDB itulah yang menikmati nilai tambah yang paling besar. Maka sekedar sebagai ilustrasi. tanpa mempedulikan siapa yang memproduksi dan bagaimana pembagiannya. misalnya PDB yang dalam tahun tertentu mencapai Rp. dengan bagian yang cukup besar oleh pengusaha asing.020 perusahaan atau 0. Jadi kalau perusahaan tambang asing mengeduk sumber daya mineral yang sangat mahal harganya.01 %. Tentu ada dampak positifnya seperti penciptaan lapangan kerja dan sebagainya. Yang berskala besar 2. sangat mungkin dibentuk oleh 5 % dari produsen di Indonesia. Kalau yang milik perusahaan asing dikeluarkan. Yang tergolong UKM sebanyak . Pada waktu mineral yang sangat besar nilainya itu diboyong ke negerinya.199 juta. dalam statistik kita dicatat sebagai ekspor yang merupakan komponen dari PDB.“Indonesia Menggugat Jilid II”?  internasional dan oleh para korporatokrat di seluruh dunia. Data tahun 2003 menunjukkan bahwa jumlah seluruh perusahaan 40. dan pemerintah hanya memperoleh royalti dan pajak.000 trilyun. 5. sebagai indikasi dapat dikemukakan sebagai berikut. PDB adalah penjumlahan dari seluruh produksi barang dan jasa di Indonesia. tetapi di dalam statistik kita masuk ke dalam Produk Domestik Bruto. nilai dari sumber daya mineral yang sangat mahal itu milik perusahaan tambang asing. Bagaimana pembagian dari PDB yang terus menerus meningkat itu? Walaupun tidak dapat dijadikan gambaran yang akurat tentang pembagiannya. namanya Produk Nasional Bruto (PNB).

kondisinya sekarang tidak banyak berubah.01% itu andilnya sebesar 43. .99% dari seluruh perusahaan dalam pembentukan PDB hanya 56.74%. “Indonesia Menggugat Jilid II”? 40. Ini disebabkan karena pembayaran apa yang dinamakan cost recovery sampai sekarang tidak habis-habis. Andil UKM dalam penyerapan tenaga kerja sebesar 99. daya beli rakyat dan nilai strategisnya dalam membangkitkan sektor-sektor ekonomi lainnya. Pembagian hasil minyak yang prinsipnya 85% untuk Indonesia dan 15% untuk kontraktor asing kenyataannya sampai sekarang 70% untuk bangsa Indonesia dan 30% untuk perusahaan asing. tidak oleh para pemimpin bangsa yang didasarkan atas hikmat kebijaksanaan. Minyak milik rakyat Indonesia harus dijual kepada rakyat yang memilikinya dengan harga yang ditentukan oleh New York Mercantile Exchange (NYMEX). • Negara kita yang kaya dengan minyak telah menjadi importir neto minyak untuk kebutuhan bangsa kita.99%. Andil UKM yang 99.3% Walaupun angka-angka tersebut tahun 2003.7%. sedangkan Usaha berskala besar dan raksasa yang hanya 0. sesuai dengan kepatutan. karena sekian banyak orang hanya terlibat dalam UKM yang tentunya pendapatannya juga minimal.197 juta perusahaan atau 99. seperti yang direncanakan sejak semula oleh para pendiri bangsa kita. Semua orang mengetahui bahwa biaya eksplorasi digelembungkan. Alangkah tidak adilnya. Sekitar 90% dari minyak kita dieksploitasi oleh perusahaanperusahaan minyak asing. sehingga cost recovery-nya tidak habis-habis. Bahkan mungkin porsi UKMK menjadi semakin kecil. walaupun sudah lama tidak ada eksplorasi lagi.

Namun pagi-pagi Exxon Mobil minta perpanjangan sampai tahun 2030 yang bentuknya juga berubah menjadi kontrak bagi hasil. Pertama. sehingga harga sangat dipengaruhi oleh spekulasi dengan posisi pelaku pasar yang kuat yang menang. Kedua. Bambang Kesowo tidak setuju atas dasar pertimbangan yuridis. sikap Boediono bersama-sama dengan Menteri lainnya sangat tidak dapat dimengerti. Ketika Pertamina masih dalam bentuk Persero hak memutuskan terletak pada Dewan Komisaris. Saya menolak dengan alasan sangat prinsipil. Mengapa Boediono membela mati-matian harga NYMEX harus mutlak diberlakukan buat bangsa Indonesia yang ingin menggunakan minyak miliknya sendiri? Adakah yang menyuruh? Apakah hal seperti ini termasuk penjajahan dalam benaknya Boediono yang hendak digugatnya ? • Masih dalam kebijakan perminyakan. adanya OPEC berarti harga sangat dipengaruhi oleh kartel yang bernama OPEC ini. Tommy Soeharto mempunyai kontrak dengan Exxon Mobil dalam bentuk Technical Assistance Agreement (TAC) sampai tahun 2010. Ketiga. Mensesneg. Setelah itu menjadi milik pemerintah.“Indonesia Menggugat Jilid II”?  • Kalaupun mau fanatik mati pada mekanisme pasar yang dihayatinya bagaikan agama. volume yang diperdagangkan di sana hanya 30% dari volume minyak dunia. tetapi harus dengan suara bulat. yaitu tentang blok Cepu dan Exxon Mobil. karena TAC tidak dapat begitu saja diubah menjadi Kontrak Bagi Hasil. NYMEX bukan pasar yang sempurna. NYMEX memperkeruh kompetisi yang diamanatkan oleh mekanisme pasar. yaitu harus . karena ikut-ikutan dalam menciptakan future trading dalam pembentukan harga minyak. sisanya atas dasar kontrak-kontrak.

akhirnya 3 yang pro Exxon Mobil terang-terangan mengatakan: ”Indonesia/ Pertamina tidak mampu”. langsung saja diberikan kepada Exxon . Maka digantilah Baihaki Hakim dengan Widya Purnama. termasuk Boediono. masih dalam era Megawati Baihaki Hakim dipecat dengan alasan yang sama sekali tidak saya ketahui kecuali mengatakan: “Pak Baihaku Hakim itu bagus. dengan dukungan dari dalam yang akan digugatnya? Dalam kondisi deadlock tanpa keputusan. mengingat akan pengalamannya 13 tahun sebagai Dirut PT Caltex Indonesia. tetapi ibaratnya untuk sopir Mercedez Benz. Saya bersisikukuh sangat tegas menolak dengan argumentasi dari pihak mereka yang sama sekali tidak masuk akal. Setelah sudah tidak mempunyai argumentasi apapun juga. Diapun ternyata keras menentang diserahkannya kepada Exxon Mobil sampai tahun 2030. Begitu SBY menjadi Presiden dan Boediono Menko Perekonomiannya. Karena keputusan harus aklamasi. sehingga diapun dalam waktu singkat dipecat lagi. Baihaki Hakim menyatakan sanggup dan sangat mampu mengelola sendiri. dan sementara itu saya didatangi dan ditekan oleh Dubes AS Ralph Boyce dan Direktur Exxon Mobil dari Houston. Beliau tidak mengambil keputusan. 3 anggota Dewan Komisaris lainnya setuju diberikan kepada Exxon Mobil. Mereka didampingi oleh Direksi Exxon Mobil Indonesia yang sangat membela boss-nya orang AS itu. Boediono menyatakan tidak mempunyai uang. Perdebatan cukup sengit. Dalam rapat-rapat yang bersangkutan. “Indonesia Menggugat Jilid II”? dikelola oleh Pertamina sendiri. Direktur Utama. Ainun mengatakan sudah ada 6 bank yang antri memberi kredit karena deposit minyak di dalamnya 600 juta barrel. Apakah ini yang dirasakan oleh Boediono penjajahan dari luar. tetapi Direktur Keuangannya ketika itu. Yang kita butuhkan sopir truk”. keputusan ada di tangan Presiden Megawati.

Mengapa berangapan bangsa Indonesia tidak mampu mengeksploitasi blok Cepu? Apakah ini yang akan digugat oleh Boediono sebagai Wapres nantinya? • Negara yang dikaruniai dengan hutan yang demikian luas dan lebatnya sehingga menjadikannya negara produsen eksportir kayu terbesar di dunia dihadapkan pada hutanhutan yang gundul dan dana reboisasi yang praktis nihil karena dikorup. Walaupun telah gundul. bensin. Rakyat yang adalah pemilik dari bumi. masih saja terjadi penebangan liar yang diselundupkan ke luar negeri dengan nilai sekitar 2 milyar dollar AS. Inikah yang diartikan oleh Boediono dengan istilah “penjajahan dari luar dan dari dalam” yang akan digugat olehnya? Bukankah dia dan senior-seniornya yang seideologi dengannya berperan besar dalam pembentukan kebijakan-kebijakan yang seperti ini? • Ikan kita dicuri oleh kapal-kapal asing yang nilainya diperkirakan antara 3 sampai 4 milyar dollar AS.“Indonesia Menggugat Jilid II”?  Mobil. Yang mencuat yalah ditenggelamkannya kapal-kapal ilegal . Ketika SBY menjabat sebagai Menko POLKAM dalam kabinet Megawati di Bappenas pernah diadakan rapat dengan para menteri dan panglima TNI. air dan segala kekayaan alam yang terkandung di dalamnya memperoleh manfaat yang sangat minimal. Topiknya “Keamanan di Laut”. kayu curian beserta terumbu karang dan flora serta fauna lainnya. • Sumber daya mineral kita dieksploitasi secara tidak bertanggung jawab dengan manfaat terbesar jatuh pada kontraktor asing dan kroni Indonesianya secara individual. pasir. • Jadi pencurian di lautan Indonesia sangat marak dengan kerugian negara yang sangat besar mencakup ikan. Kapolri beserta Kepala Staf tiga angkatan.

tetapi dibutuhkan perhitungan tentang untung ruginya yang lengkap dan akurat. Saya sebagai Kepala Bappenas memperoleh tawaran kredit dari Perancis untuk membiayai sistem pengenal kapal ilegal melalui transponder dan satelit. • Republik Indonesia yang demikian besarnya dan sudah hampir 64 tahun merdeka dibuat lima kali bertekuk lutut harus membebaskan pulau Batam dari pengenaan pajak pertambahan nilai setiap kali batas waktu untuk diberlakukannya pengenaan PPN sudah mendekat. tetapi terutama untuk Singapura. sehingga bersama-sama dengan pulau Bintan dan Karimun praktis merupakan satelitnya negara lain. dan sekarang telah menjadi Kawasan Bebas Total buat negaranegara lain. dan ini tidak pernah dipublikasi kalau ada. atau sama sekali tidak pernah dibuat. sekian ratus perusahaan akan hengkang dsb. . Free Trade Zone total berarti bahwa antara Batam. Saya tidak a priori serta merta menolak.0 “Indonesia Menggugat Jilid II”? dengan bom dari udara. Bintan dan Karimun dengan seluruh dunia tidak ada batasan. • Sangat banyak produk pertanian diimpor. Bintan dan Karimun sebagai Free Trade Zone total dengan acamana-ancaman bahwa kalau tidak. tetapi antara tiga pulau tersebut dengan semua wilayah Indonesia harus dibuat batasan supaya tidak terjadi penyelundupan yang besar-besaran dan bebas total juga. Sama sekali tidak ada kelanjutannya. Dijadikannya pulaupulau Batam. Tim Ekonomi menjadikan tidak datangnya investor asing sebagai ancaman untuk semua sikap yang sedikit saja mencerminkan pikiran yang mandiri.

“Indonesia Menggugat Jilid II”? 1 • Industri-industri yang kita banggakan hanyalah industri manufaktur yang sifatnya industri tukang jahit dan perakitan yang bekerja atas upah kerja yang sangat rendah dibandingkan dengan nilai tambah yang diperoleh majikannya. Saya tidak dapat melepaskan diri dari perasaan bahwa Boediono selalu harus membela apa saja yang pro Bank Dunia dan apa saja yang anti trio Bank Dunia. Sejak tahun 1967 setiap tahunnya pemerintah mengemis hutang dari IGGI/CGI sambil dimintai pertanggungjawaban tentang bagaimana dirinya mengurus Indonesia? Mulai tahun lalu CGI memang dibubarkan. Bank Pembangunan Asia dan IMF harus ditentangnya. Bank Pembangunan Asia dan negara-negara anggota CGI terpenting. • Hutang dipicu terus tanpa kendali sehingga sudah lama pemerintah hanya mampu membayar cicilan hutang pokok yang jatuh tempo dengan hutang baru atau dengan cara gali lubang tutup lubang. Begitu selesai. • Pembangunan dibiayai dengan hutang luar negeri melalui organisasi yang bernama IGGI/CGI yang penggunaannya diawasi oleh lembaga-lembaga internasional. • Saya beruntung dibolehkan memutar film tersebut dalam salah satu sidang kabinet. Pembayaran untuk cicilan hutang . Oleh John Pilger industri-industri pengolahan itu disebut sweat shops. Kenyataannya APBN kita masih sangat tergantung pada hutang luar negeri dari Bank Dunia. tetapi pembubaran itu hanyalah pura-pura. Sampai saat ini saya masih tidak mengerti mengapa dia merasa perlu mengatakan demikian tentang film yang dibuat dengan wawancara langsung dengan para pejabat Bank Dunia beserta banyak wawancara dengan buruh Indonesia. Boediono mendatangi saya sambil mengatakan bahwa yang ditayangkan itu tadi semuanya tidak benar.

Kapal nelayan kita digranat berkali-kalik. dijawab singkat oleh pilot AS. bisa dipakai . Setelah pilot kita mengatakan tidak mau baku tembak. dan setiap granat meledak. Sungguh pelecehan dan penghinaan terang-terangan dan luar biasa. dan hanya mau menjelaskan. • Dalam pemerintahan Megawati 3 jet tempur AS tipe F-18 mengepung 1 F-16 di atas Bawean Jawa Timur tanpa izin memasuki wilayah RI. pesawat F-18 mengeluarkan senjatanya. Adegan ini ditayangkan di TV Indonesia tanpa pemerintahnya berdaya melindungi atau membela para nelayan kita yang naas dan sangat mengenaskan itu. orang-orang Australia yang ada di geladak kapal itu bersorak sorai. dan para nelayan kita menangis. kapal nelayan Indonesia tidak sengaja tersesat ke dalam wilayah Australia. Seluruh isi kapal dipindahkan ke geladak kapal perang Australia. bahwa setelah mendarat dan pada waktunya. • Dalam pemerintahan Megawati telah dirintis membangun industri pertahanan dengan 4 industri strategis yang sudah kita miliki. Study-nya dilakukan oleh experts China yang dibiayai oleh pemerintah China sebagai hibah. Mereka bekerja keras dan sudah praktis selesai dengan studi tahap pertama. Tragedi ini berlangsung terus sampai kapal nelayan Indonesia tenggelam. Ketika pilot kita memperingatkan. yang mengawal kapal perang induk yang juga masuk ke dalam wilayah RI tanpa izin. Mereka mengatakan bahwa PT Dirgantara mesin-mesinnya sangat bagus. Minta izin setelah kejadian. dia akan minta izin. karena TNI kita memang hanya mempunyai satu F-16 yang bisa terbang ketika itu. Sepanjang pengetahuan saya tidak pernah ada protes juga dari pemerintah kita.2 “Indonesia Menggugat Jilid II”? pokok dan bunganya sudah mencapai 25% atau lebih dari APBN setiap tahunnya. • Dalam pemerintahan SBY-JK.

Indonesia sudah bisa mulai membangun industri pertahanan yang sangat lumayan tanpa investasi lagi. seorang Deputy muda hanya memberi komentar: “Why China?” Habislah riwayat perintisan ini. dan sekarang Krakatau Steel mau dijual. yaitu untuk membantu Indonesia membangun industri pertahanannya pada tahap paling awal ini memang tidak ada teknologi canggih yang harus diberikan kepada Indonesia. Lain halnya kalau kita minta supaya memberikan teknologi luar angkasa. Tan Wei Wen untuk menjelaskan bagaimana riwayatnya.“Indonesia Menggugat Jilid II”?  untuk membuat banyak hal. Pemerintah China berjanji tidak akan ada yang disembunyikan dalam alih teknologi. Tentang hal ini sudah dicek masuk akal atau tidaknya dengan Panglima TNI dan Menko Polkam yang ketika itu Bapak SBY sendiri. Entah apa nasibnya PT Dirgantara. PT Dirgantara dan Karakatu Steel. Menteri BPPT memanggil saya dan wakil Dubes China. Begitu pemerintahan diganti oleh pemerintahan SBY-Kalla. PINDAD. Dengan PT PAL. Apakah ini merupakan penjajahan zaman modern yang akan digugat oleh Boediono? . Kepala dari Executing Agency-nya. Yang jelas Indonesia tidak mempunyai industri pertahanan yang memadai yang sekarang menjadi pembicaraan ramai karena jatuhnya sekian banyak pesawat udara AU. industri pertahanan China. Negara bangsa Indonesia yang lemah seperti ini dalam pertahanan merupakan bagian dari apa yang dinamakan leverage untuk menekan Indonesia. yang terakhir dengan Hercules dengan korban jiwa begitu banyak. Jelas bahwa kecuali kekurangan dana. Setelah mendengarkan ceritera kami. rapuhnya alutsista kita tidak dapat dilepaskan dari kesengajaan membiarkan diri sendiri dikekang oleh kekuatan-kekuatan Barat. Beliau berminat dan sudah bertemu dengan President dari Great Wall di Beijing. Alasannya masuk akal.

062 milyar (kurs Rp 12. AS yang jumlah stimulus fiskalnya hampir 10% dari PDBnya. Maka tindakan-tindakannya hanya sporadis dan compangcamping. Tapi digembar-gemborkan tahun 2009 akan ada stimulus fiskal Rp. sehingga seluruh dunia sekarang ini sedang mengalami proses yang menyakitkan dan sangat tidak menentu. Dengan jumlah stimulus fiskal sebesar US$ 900 milyar. 73. yang per saldo hanya Rp. Katanya akan bisa dicapai macam macam. 60 trilyun APBN 2008 tidak dapat diserap yang berarti kontraktif. karena tidak ada dana. Ini hanya 0. 7.000 per dollar AS).19 % saja dari PDB yang Rp. Mungkin dalam setahun? . Kondisi ekonomi Indonesia seperti yang tergambarkan di atas tentu tidak dapat menghadapinya dengan mantab. Mari kita telusuri sebagai berikut: • Rp.1 trilyun saja atau US$ 1. Menko Ekonominya Boediono. Presiden Obama hanya berani mengatakan akan menciptakan lapangan kerja sebanyak 3 sampai 4 juta orang dalam 2 sampai 3 tahun ke depan. rupanya kondisi keuangan negara juga jauh lebih parah daripada yang diketahui oleh masyarakat. Pemerintah Indonesia dengan stimulus fiskal neto sebesar Rp. Presiden Obama ngomongnya tidak sesombong Tim Ekonomi kita. 13.062 milyar mengatakan akan menciptakan lapangan kerja sebesar 3 juta orang juga.000 trilyun. yang tidak dirinci selama berapa tahun.1 trilyun. “Indonesia Menggugat Jilid II”? POKOK-POKOK KEBIJAKAN DALAM MENGHADAPI KRISIS GLOBAL Sejak tahun 2008 meledak krisis balon derivatif keuangan di AS yang demikian besar dan demikian dahsyatnya. Kecuali itu. US$ 1.

9. 378.“Indonesia Menggugat Jilid II”?  • Dikatakan cadangan devisa cukup banyak. Penurunan ini terjadi selama kendali ekonomi di tangan para senior si-ideologinya Boediono. entah bertahan sampai kapan. Di AS sendiri dan di Eropa kebijakan dan tindakan ini dinilai sangat kontroversial dan menyulut perdebatan yang sedang berlangsung.000 atau 33% yang memang menguat lagi. Sekarang mengandalkan pencetakan uang oleh pemerintah AS untuk menstabilkan nilai rupiah.000 menjadi Rp. Thai Bath ketika itu 20 per US$. Dalam kurun waktu yang sama. Kalau kita menaruh uang kita dalam deposito rupiah di bank dalam negeri.075% sampai 2. 10. Thai Bath terdepresiasi sebesar 80%. Ketika itu Gubernur BI-nya Boediono. Aneh.500 per US.678%. karena akan mendapat rembesan dollar AS dari uang yang dicetak secara besar-besaran oleh pemerintah AS. Bagaimana menjelaskannya kalau sepanjang periode itu Tim Ekonomi mendapat pujian terus menerus dari pers Barat? Bukankah . • Dalam waktu dua bulan. nilai rupiah merosot dari sekitar Rp. tetapi rupiah terdepresasi sebanyak antara 3. Di tahun 1969 1 dollar = Rp. tetapi menerbitkan obligasi dalam dollar dengan suku bunga antara 10 sampai 11% dalam denominasi dollar AS. Sekarang Thai Bath 36 per US$. maksimal hanya mendapat 9%. 12. mereka selalu menganggap mencetak uang adalah kebijakannya orang yang tidak waras. tapi rupiah sudah sekitar Rp. Bagaimana mungkin kebijakan seperti ini diwujudkan? Siapa yang menyuruh? Hati nurani sendiri ataukah ada kekuatan luar yang disinyalir oleh Boediono dalam pidato proklamasinya sebagai cawapres? • Sekarang Gubernur BI mengatakan rupiah akan stabil.

atau paling tidak salah menanganinya (mishandled) yang membuat krisis semakin parah. Apakah ini yang akan digugat oleh Boediono? Kalau ya. Korea dan Indonesia. mereka segera mendiktekan kebijakan fiskal yang ketat. yaitu menaikkan pajak dan mengurangi pengeluaran pemerintah untuk menghindari defisit anggaran. Sangat sulit dimengerti mengapa IMF melakukan ini karena di . PAUL KRUGMAN DAN IMF Tentang IMF. “Indonesia Menggugat Jilid II”? pujian dan hutang yang disebut “aid” itu disengaja supaya Indonesia terjerumus ke dalam jebakan hutang? Dan prosesnya mendapat dukungan dari kekuatan dari dalam yang kesemuanya ingin digugat oleh Boediono? Inilah secara singkat hasil dari kebijakan Tim Ekonomi yang kiprahnya selalu didasarkan atas Fundamentalisme Mekanisme Pasar. sangat mengagumkan. Pertama. dalam bukunya terbaru yang berjudul “The Return of Depression Economics and the Crisis of 2008” di halaman 115 Paul Krugman menulis tentang kebijakan IMF menangani krisis di Indonesia tahun 1997 sebagai berikut : “Banyak orang berpendapat bahwa sebenarnya IMF dan Departemen Keuangan Amerika Serikat yang de facto mendiktekan kebijakan IMF yang menyebabkan krisis. ketika IMF diminta bantuannya oleh Thailand. (KKG: Menteri Keuangan AS ketika itu Larry Summers). Apakah mereka benar? Marilah kita mulai dengan bagian yang termudah: dua hal yang IMF jelas melakukan kesalahan. dan anti BUMN serta anti Campur Tangan Pemerintah yang mencukupi. karena Boediono akan menggugat para senior se-ideologinya.

“Indonesia Menggugat Jilid II”?  Asia (berbeda dengan di Brasil setahun kemudian). karena IMF gembar-gembor. Kedua. yaitu perubahan-perubahan dalam bidang-bidang yang tidak ada hubungannya dengan kebijakan fiskal dan moneter sebagai persyaratan untuk memperoleh pinjaman dari IMF. . bagaimana dia menjelaskan kebijakannya di masa lampau dan juga kebijakan para senior se-ideologinya dalam periode yang sejak tahun 1967? Belum lama ini dalam konperensi tingkat tinggi Uni Eropa. Beberapa dari reformasi ini seperti penutupan bank-bank sangat diragukan relevansinya dalam menanggulangi krisis keuangan. di mana arahan IMF ini dilaksanakan. dampaknya memperburuk resesi melalui pengurangan permintaan. Upaya untuk memenuhi target pengetatan anggaran tersebut mempunyai dampak negatif ganda untuk negara-negara yang bersangkutan. (KKG: Sekarang Larry Summers. tetapi lebih dari US$ 450 milyar akan dipakai oleh Uni Eropa sendiri. IMF menghendaki reformasi “struktural”. contoh yang paling mencolok dari crony capitalism. seperti penghapusan pemberian monopoli kepada para kroni-kroninya sang Presiden tidak ada hubungannya sama sekali dengan mandat atau kewenangan IMF. Beranikah Boediono berpolemik dengan Paul Krugman. mengakibatkan kepanikan bahwa perekonomian seolah-olah tidak terkendali. IMF disuntik dana sebesar US$ 500 milyar oleh Uni Eropa. Semuanya ini tulisannya Paul Krugman. Timothy Geithner dan Bernanke. Gubernur Bank Sentral AS menurunkan suku bunga sampai mendekati nol persen). Kalau tidak dilaksanakan. bukan tulisan saya. Kebijakan lainnya. tidak ada seorangpun kecuali IMF yang menganggap defisit anggaran sebagai masalah yang penting. Pemberian monopoli dalam perdagangan cengkeh memang hal yang buruk. Tetapi apa hubungannya ini dengan pelarian rupiah ke dalam dollar?”. Kalau setuju dengan Paul Krugman.

Jawabnya: Kalau dibayar lunas. padahal justru membayar bunga yang tidak ada gunanya. Apa pendirian dan kebijakan Wakil Presiden Boediono (kalau terpilih) terhadap IMF dengan kedudukannya dewasa ini? “SIHIR” IMF BESERTA KRONINYA TENTANG HUTANG INDONESIA KEPADA IMF Bersama-sama dengan para penjajah dari dalam yang dikenali oleh Boediono. Karena itu. Sebelum ada kredit dari IMF. Tidak dikatakan bahwa hutang dari IMF yang US$ 9 milyar itu tidak boleh dipakai sama sekali sebelum cadangan devisa miliknya sendiri yang US$ 24 milyar itu terpakai habis sama sekali. karena tidak ada gunanya sama sekali. hutang dari IMF yang US$ 9 milyar hanya relevan kalau pemerintah Indonesia bisa mengatakan kepada dunia: “Cadangan devisa milik kita yang US$ 24 milyar habis sama sekali. dan ini mengguncangkan kepercayaan dunia kepada Indonesia. cadangan devisa Indonesia sudah meningkat menjadi US$ 24 milyar dari US$ 14 milyar. tetapi kita harus bersyukur bahwa saat ini masih . cadangan devisa Indonesia akan anjlok dari US$ 33 milyar menjadi US$ 24 milyar. “Sihir” ini membuat orang percaya bahwa Indonesia hebat. IMF menyihir bangsa Indonesia dengan mengatakan bahwa Indonesia hebat karena dapat mengembalikan hutangnya yang menumpuk sampai US$ 9 milyar sebagai hutang yang diberikan sedikit demi sedikt setiap kali LOI ditandatangani. Hutang dari IMF US$ 9 milyar yang menjadikan keseluruhannya US$ 33 milyar. Ketika itu sudah ada yang mendesak supaya hutang yang US$ 9 milyar ini dibayar lunas. “Indonesia Menggugat Jilid II”? Jadi IMF de facto sudah menjadi lembaga keuangan regional.

ARUS BESAR YANG MENJADIKAN BOEDIONO CALON WAKIL PRESIDEN Di harian The Jakarta Post tanggal 25 Mei 2009 diberitakan acara perpisahan Boediono dengan staf pengajar di Universitas Gajah Mada. Jawaban pemerintah yang menteri keuangannya ketika itu Boediono yalah bahwa kita memang masih memerlukan post program monitoring atau pemandoran oleh IMF. kita masih mempunyai US$ 24 milyar. Boediono dikutip mengatakan “…his nomination was ‘a big stream’ he could not resist” yang berarti bahwa pencalonannya adalah arus besar yang tidak mampu . Banyak orang mengemukakan keberatannya menahan hutang yang tidak diperlukan itu dengan alasan bahwa selama kita masih berhutang. apakah tidak lebih memperpuruk kepercayaan kepada Indonesia dibandingkan dengan mengatakan: ”Dengan mengembalikan hutang kita yang US$ 9 milyar sekarang juga.” Inilah yang oleh Jenderal Ryamizard Ryacudu dimaksud sebagai penjajahan melalui perang modern. kita harus membayar bunga tanpa boleh menggunakannya. sehingga kita sudah membayar sangat banyak bunga yang tidak ada gunanya. Sisa hutang yang US$ 9 milyar akhirnya memang dibayar lunas. yaitu antara lain pencucian otak (brainwashing) untuk menundukkan logikanya bangsa mangsa dalam posisi jongkok. Hutang dari IMF yang US$ 9 milyar tidak boleh dipakai sebelum cadangan devisa milik sendiri yang US$ 24 habis terpakai sama sekali.” Kalau ini yang dikatakan. kita dikenakan pemandoran oleh IMF yang dinamakan post program monitoring.“Indonesia Menggugat Jilid II”?  mempunyai cadangan devisa US$ 9 milyar dari IMF. Selama dipertahankan. tetapi sangat terlambat.

karena ini urusan sangat penting dengan dampak yang sangat besar pula pada nasib negara bangsa ini kalau mereka terpilih dalam pilpres bulan Juli 2009 mendatang. Saya sudah mengambil keputusan untuk kembali ke kampus dan sudah pasti tidak akan mau menjadi pejabat di pemerintahan lagi. Ternyata benar berita yang saya kira berita burung itu sebagai penggarapan besarbesaran. mengatakan: “Ada kemungkinan bahwa beberapa dari kita akan diminta masuk dalam kabinet lagi. ataukah arus besar yang datangnya dari luar? Hanya Tuhan. Boediono dan SBY yang mengetahuinya. ataukah arus besar yang datangnya dari elit dalam negeri. Pangestu untuk duduk sebagai menterimenteri ekonomi. . Boediono masuk lagi dalam kabinet sebagai Menko Perekonomian. Konon kabarnya Presiden SBY menelpon Boediono. dalam sidang kabinet terakhir Boediono berpamitan dengan saya dan beberapa rekan menteri lainnya. sehingga sekarang dia bahkan mau menjadi Wakil Presiden! Apa gerangan arus besar itu? Hati nurani dan kecintaannya pada bangsa yang bagian terbesarnya sedang menderita ini. Maka saya berpamitan”. Jelas saya tidak percaya bahwa dia takluk. Dari berita The Jakarta Post tersebut menjadi lebih jelas lagi betapa besar arus yang menekannya.0 “Indonesia Menggugat Jilid II”? ditolaknya. dan lantas berjabatan tangan. Namun beberapa minggu menjelang pengumuman reshuffle kabinet saya mendengar bahwa Boediono sedang “digarap habis-habisan” untuk mau duduk dalam kabinet sebagai Menko Perekonomian. Sebagai sesama menteri dalam kabinet Megawati. Sri Mulyani dan Mari E. Harapan saya tentunya Boediono dan SBY jujur dalam menjelaskan kepada rakyatnya. Jadi konsisten dengan “pamitannya”. Boediono menolak.

atau justru politisi yang sangat piawai dan ulung? Kelompok Berkeley Mafia terkait erat dengan perguruan .D dari University of California in Berkeley. Sebutan “anggota Berkeley Mafia” adalah siapa saja yang ideologi dan keyakinannya merupakan mashab yang sama. di Indonesia memang ada sekelompok akhli ekonomi dengan ideologi dan keyakinan tertentu yang sangat berkuasa dan sangat besar pengaruhnya. Ketika kabinet didominasi oleh mereka. istilah ini lahir di Jenewa di tahun 1967 dengan konotasi yang sangat terhormat dan mengagumkan banyak tokoh dunia Barat. Kelompok ini merupakan inti yang dalam perjalanan sejarah Indonesia membentuk “keturunan-keturunannya”. yang oleh David Rockefeller disebut sebagai sekelompok para akhli ekonomi Indonesia yang top (the top economists of Indonesia). Asal mulanya memang terdiri dari mereka yang memperoleh gelar Ph. Istilah ini sama sekali tidak mengandung pelecehan atau merendahkan martabatnya. yaitu sangat jauh condong pada pasar bebas dengan campur tangan pemerintah yang sekecil mungkin. cover majalah Time memuat foto para menteri satu per satu dengan judul di bawahnya “The most qualified cabinet in the world”. Bahkan di mata sangat banyak orang. Para teknokrat hanya profesional dan tidak berpolitik. yang jelas dalam tulisan ini.“Indonesia Menggugat Jilid II”? 1 LAHIRNYA “BERKELEY MAFIA” DAN PERANNYA SAMPAI SEKARANG Buat saya dan banyak orang lainnya. Maka Boediono yang menurut pengakuannya orang dari kampus ndeso sangat bisa menjadi anggota Berkeley Mafia. Maka tidak mungkin membatasi diri dengan hanya yang lulus dari Berkeley University saja. Kelompok ini terkenal dengan sebutan “Berkeley Mafia”. di zaman sekarang ini dialah pemimpinnya. Sebaliknya.

kalau toh mau dikatakan anggota partai politik. Widjojo Nitisastro dan Prof. Dr. sehingga memberikan kesan profesional yang tidak berpolitik. dan para pemimpinnya adalah Prof. Tetapi dalam zaman reformasi dan demokrasi ini yang serba partai politik. saya mendapat penjelasan bahwa mereka dibawa oleh Erros Djarot yang diperkenalkan kepada Megawati sebagai calon-calon menteri di dalam kabinetnya kalau Megawati menjadi Presiden nantinya. Ali Wardhana. Maka kalau dikatakan murni profesional yang tidak berpolitik tidak benar. Pengototannya berkuasa ketika tidak ada dalam kabinet Dalam waktu sangat singkat setelah KH Abdurrachman Wahid menjadi Presiden RI dan saya diangkat menjadi Menko . Sri Mulyani menjadi wakil RI dalam pimpinan IMF di Washington DC.2 “Indonesia Menggugat Jilid II”? tinggi. secara setengah berkelakar Menko Dorodjatun antara lain mengatakan bahwa dirinya tidak dari partai politik. ketika Megawati menjadi Presiden. Dalam sidang CGI yang saya ikut menghadirinya sebagai Kepala Bappenas. Dan benar. Saya sendiri mengalami bahwa setelah pak Harto tidak berkuasa lagi. Menko Perekonomiannya Dorodjatun Kuntjorojakti dan Menteri Keuangannya Boediono yang sama sekali tidak ada hubungannya dengan PDI. Ketika saya terheran-heran menanyakan kepada teman. Maka dirinya merasa mengetahui perekonomian Indonesia dengan baik dari kedua guru besar/teknokrat/ mantan menteri tersebut”. maka partainya adalah “Partai UI di Depok. Namun sejarah membuktikan bahwa kecanggihan dan kepiawaiannya mempertahankan kekuasaan ekonomi dalam pemerintahan siapapun juga sejak tahun 1967 tidak tertandingi oleh partai politik yang manapun juga. dalam pembukaan Kongres PDI di Bali yang besar-besaran di stadion terbuka. Sri Mulyani beserta banyak akhli ekonomi lainnya hadir.

Emil Salim sebagai Ketua dan Dr. Sri Mulyani Indrawati. Tidak pernah ada DEN dan Tim Asistensi pada Menko EKUIN/Perekonomian sebelum dan sesudahnya. Ketuanya tidak tanggung-tanggung. Sri Mulyani sebagai sekretarisnya. Widjojo Nitisastro sendiri dan sekretarisnya Dr. Dr. Kecuali itu tidak pernah ada pemerintah sebelum dan sesudah Presiden Abdurrahman Wahid yang Tim Ekonominya bukan dan sama sekali tidak berorientasi pada ideologi kelompok Berkeley Mafia kecuali Tim Kwik Kian Gie/Bambang Sudibyo/Jusuf Kalla (Menperindag merangkap Kepala BULOG). Mereka mengawal saya dan Menteri Keuangan Bambang Sudibyo dalam perundingan penjadwalan kembali hutang luar negeri di Paris Club. Ketika saya melakukan kunjungan kehormatan pada Menteri Keuangan AS ketika itu yang dijabat oleh Larry Summers.“Indonesia Menggugat Jilid II”?  EKUIN. yang didampingi oleh Timothy Geithner. yaitu Prof. Jadi benar yang dikatakan oleh Boediono bahwa ada penjajah dari dalam. dibentuk Dewan Ekonomi Nasional (DEN) dengan Dr. Setelah itu dengan Keputusan Presiden dibentuk lagi Tim Asistensi pada Menko EKUIN. Saya tercengang karena informasinya tentang apa saja yang dibicarakan dalam kabinet dan dalam rapat koordinasi oleh saya sebagai Menko EKUIN diketahui semua oleh mereka. Bank Pembangunan Asia dan IMF. saya ditegur dengan keras bagaikan pejabat negara jajahan tentang kecenderungan saya atau sikap saya yang tidak mau mengikuti IMF. Saya merasakan dengan jelas bahwa kedua Tim ini dibentuk atau “dipaksakan” pada Gus Dur untuk mengawasi dan mengendalikan saya yang dianggap mempunyai sikap yang independen. yang dalam pengalaman saya tidak beroperasi sendiri. sangat cenderung tidak mau diatur oleh trio Bank Dunia. Semua anggota DEN harus diperbolehkan hadir dan ikut berbicara dalam semua rapat-rapat para menteri dalam lingkungan koordinasi Menko EKUIN. Mari . tetapi bekerja sama dengan penjajah dari luar.

Dia mengatakan kepada saya bahwa itu tidak boleh. Sejak itu saya mengalami tekanan terus menerus dan Presiden pernah memberitahukan akan memecat saya. gedung-gedung apartemen dan perkantoran pencakar langit dan sebagainya. karena sudah merupakan tradisi bahwa pidato Menko EKUIN dalam sidang IGGI/CGI harus dibuat oleh Bank Dunia. Saya sama sekali tidak setuju dengan isinya. bahwa Indonesia sudah sangat maju. Maka menjelang reshuffle kabinet saya mengundurkan diri sebagai Menko EKUIN dari kabinet Gus Dur. sudah sangat banyak mall. kepada saya diberikan naskah pidato oleh staf saya. berapa persen dari seluruh rakyat kita yang menikmati kemakmuran yang dikuliahkan kepada saya? Saya yakin minimal 180 juta dari 230 juta rakyat Indonesia hidup dalam kemiskinan yang sangat parah. tetapi entah mengapa tidak jadi lagi. rumah dan apartemen mewah. Yang menjadi pertanyaan. Maka kepada staf saya minta diadakan perubahan-perubahan. banyak mobil mewah. Ketika saya di Bappenas. saya membentuk 4 regu yang masuk ke desa- . “Indonesia Menggugat Jilid II”? kita tunggu siapa yang akan digugat olehnya sebagai penjajah dari dalam? Sebagai Menko EKUIN yang harus berpidato dalam sidang CGI. Saya melihat dan melewatinya setiap hari. Saya bekerja keras menulisnya sendiri dengan membuang naskah pidato yang sudah disiapkan. restoran. Kesenjangan luar biasa antara yang terlihat dan yang tidak terlihat Terus menerus saya “dikuliahi” sahabat-sahabat saya yang termasuk golongan kemapanan dengan kehidupan yang sangat enak.

kenistaan. kekurangan gisi. Ketika saya dengan regu saya melihat dan berbicara dengan mereka. Gambaran yang selalu di depan mata saya tidak bisa hilang dengan kehidupan saya di kota Jakarta yang gemerlapan dengan kemewahan ini. Kalau AS bisa berubah total menjadikan demikian banyak perusahaan swasta menjadi BUMN dan Presiden Obama bisa memecat CEO-nya pabrik mobil swasta. Penutup Mohon kiranya tulisan ini dilihat juga dari sisi memberikan amunisi kepada Boediono untuk menggugat penjajahan yang sekarang masih berlangsung dalam bentuk modern. Gambaran tersebut ialah bahwa bagian terbesar dari rakyat kita yang memiliki semua kekayaan alam yang ada di negara ini hidup dalam kemiskinan.85% saja dari garis kemiskinan yang ditentukan oleh Bank Dunia. kekurangan pendidikan seperti yang disaksikan oleh saya dan rekan-rekan di Bappenas ketika saya masih menjabat sebagai Kepala di sana.750 per hari. mereka hidup dengan Rp.250 per orang per hari. 3. 1. Bank Pembangunan Asia dan IMF serta rekan-rekan bangsa sendiri yang menekan saya harus mengikuti keinginan para pejabat trio lembaga keuangan internasional tersebut. Kalaupun karena inflasi sekarang menjadi tiga kali lipat atau Rp. dan Larry . Ini berarti bahwa rakyat yang miskin dan sangat besar jumlahnya itu hidup dengan 17. sedangkan Bank Dunia yang dikagumi oleh kelompok Berkeley Mafia menentukan US$ 2 per orang per hari sebagai garis kemiskinan. masih jauh dari US$ 2 per hari buat satu orang.“Indonesia Menggugat Jilid II”?  desa kantong-kantong kemiskinan secara sampling untuk melihat dengan mata kepala sendiri dan berbicara langsung dengan sesama anak bangsa yang ternyata memang masih sangat terjajah. Dalam kondisi seperti ini saya juga mengalami betapa saya ditekan oleh trio Bank Dunia.

walaupun berharap-harap cemas. I change too”. nasionalis dan patriot yang berani menghadapi siapa saja untuk kepentingan bangsa? Mengantisipasi beliau akan berubah seperti ini. saya berharap ada amunisi baginya dari tulisan ini. mengapa Boediono tidak bisa lantas menjadi independen. . sambil mengutip John Maynard Keynes yang pernah mengatakan demikian. “Indonesia Menggugat Jilid II”? Summers bisa mengatakan: “If circumstances change.

Sign up to vote on this title
UsefulNot useful