UNIVERSIDAD DE CÓRDOBA FACULTAD DE CIENCIAS

GRADO EN BIOQUÍMICA “ENZIMOLOGÍA” “Estudio general sobre la Dopamina Beta Hidroxilasa (EC 1,14,17,1)” Rafael Diego Macho Reyes b02marer@uco.es Índice de Contenidos 1. Conceptos clave. 2. Abstract. 3. Introducción. 4. Papel Biológico. 5. Historia y Descubridores. 6. Mecanismo de Catálisis. 7. Ensayo de la Actividad. 8. Estructura Enzimática. 9. Aplicaciones y Enfermedades Asociadas. 10. Referencias, Bibliografía y Agradecimientos.

1. PALABRAS CLAVE:
noradrenalina, dopamina, sinapsis neuronal, neurotransmisores, hormona,médula suprarrenal, deshidroascorbato, catecolaminas, tiramina, adenilato ciclasa, sistema nervioso simpático, locus coeruleus, Dr. Hugh Blaschko, Levin, Levenberg, Kaufman, Ronald Frigon, Richard Stone,tetrámerica, glicosilación, cobre, sustituciones de aminoácidos, traumas psicológicos crónicos, polimorfismo genético, enfermedad de Alzheimer.

2. ABSTRACT
El presente trabajo es una recopilación de información acerca de las características de la enzima Dopamina Beta Hidroxilasa (DBH), se trata de una enzima catecolaminérgica básica en la formación del hormoneurotransmisor noradrenalina (norepinefrina) pues cataliza la aparición de ésta molécula a partir de la dopamina. La enzima es un N-glucopolipéptido con presencia de cationes de cobre 2+, y requiere de ascorbato y fumarato como cofactores y medio de reacción. La reacción que cataliza esta enzima sucede en 2 fases, en la primera el ascorbato se oxida a deshidroascorbato, reduciendo los cationes de cobre del centro activo a Cu+, una vez que son reducidos, entran en este centro una molécula de oxígeno y la dopamina, y se produce la hidroxilación del carbono beta de la cadena lateral y la reducción del oxígeno en agua. Esta enzima se ha medido en numerosos seres vivos, tales como el Ser Humano (Homo sapiens sapiens), Toro (Bos Taurus), Gallo (Gallus gallus) o la Rata (Mus musculus), aunque a la hora de este trabajo se han primado las investigaciones en las 2 primeras especies. Se localiza en diferentes órganos y tejidos, tales como la médula suprarrenal o el “locus coeruleus”, una región específica del tronco encefálico. Sus efectos a nivel corporal se establecen en la medida en que genera o no la norepinefrina, puesto que , como hormona es necesaria para procesos de huida en los cuales la sangre debe de llegar más rápido a los músculos y por ello se da una vasoconstricción para mejorar el flujo sanguíneo, y como neurotransmisor es básico para la apertura de los transportadores noradrenérgicos en la transmisión del impulso nervioso. Ciertas enfermedades como el Alzheimer, el alcoholismo o ciertos trastornos psicológicos como el síndrome post-traumático crónico se pueden relacionar con el grado de actividad de esta enzima. Su descubrimiento se produjo en la década de los 60, tras la enunciación por parte del farmacólogo Hugh Blaschko de la necesidad de una enzima que catalizase esta reacción cómo medio de explicación de la aparición de la noradrenalina en el cuerpo, siendo ésta vital para la síntesis posterior de adrenalina, a partir de su descubrimiento, numerosos estudios se han centrado en pormenorizar en las características de la enzima (Km, Kcat, Vmáx) en diferentes especies y o situaciones, conocer más detenidamente su mecanismo de acción, su estructura y su posible relación con la enfermedad o adicciones humanas tales como la cocaína, que compite con el producto de su síntesis por los centros de los receptores nerviosos, provocando la sobreestimulación que genera esta droga, de todas maneras, no se han encontrado resultados concluyentes a este efecto.

3. INTRODUCCIÓN
La dopamina beta hidroxilasa, es una enzima capaz de crear noradrenalina a partir de dopamina, lo cual es vital para el adecuado funcionamiento de la sinapsis neuronal, puesto que ambas especies son neurotransmisores, como del funcionamiento del sistema hormonal, la noradrenalina también actúa como una hormona de la médula suprarrenal pudiendo crear vasoconstricción en condiciones de peligro. Esta enzima se encuentra en diferentes especies, tales como: Homo sapiens (Ser Humano), Bos Taurus (Toro), Mus Musculus (Ratón), Gallus gallus (Gallo), entre otras. Según el criterio de la Enzyme Commission, esta enzima se encuadra dentro de las enzimas (1.x.y.z), ya que cataliza es la oxidación del deshidroascorbato, y la reducción del centro activo dará los electrones necesarios para reducir la dopamina y el oxígeno a noradrenalina y agua. Luego es (1.14.y.z) ya que actúa con donadores apareados (Centro Activo y Ascorbato), y con la interacción de una molécula de oxígeno, el ascorbato se oxida como donador y se incorpora un átomo de oxígeno (1.14.17.z=1). Según la nomenclatura sistemática de química orgánica, esta enzima recibe el nombre de la reacción que cataliza y es, por tanto conocida como 3,4-dihidrofenetilamina, ascorbato:oxígeno oxidoreductasa (β-hidroxilante). Pertenece a la familia de las enzimas catecolaminérgicas, y en palabras de científicos como Blaschko, se dice que la actuación de esta enzima es un paso limitante en la síntesis de catecolaminas, puesto que cataliza la hidroxilación de la cadena lateral para dar lugar a norepinefrina. Su reacción básica de catálisis quedó demostrada en 1965 por los científicos Friedman y Kaufman, y queda enunciada así: Fumarato Dopamina + O2 + ascorbato L-Norepinefrina + Deshidroascorbato + H2O Cu2+ Tal y como se ve, la catálisis de un mol de dopamina a 1 mol de norepinefrina conlleva la reducción de una molécula de oxígeno en una molécula de agua y la oxidación del ascorbato a deshidroascorbato. También cataliza de la misma manera la conversión tiramina en octopamina, en seres humanos, en otras especies, como Bos Taurus (vaca) actúa sobre otros compuestos recogiendo fenil2-aminoetil sulfato para general fenil-2-aminoetil sulfóxido, o catalizar la reacción sobre la tiramina para dar octopamina pero con la colaboración de otros cofactores como el N-4-trifluorometilfenil-Nhidroxiguanidina para dar lugar a 3 cofactores distintos.

4. PAPEL BIOLÓGICO
Esta enzima es necesaria en la síntesis de catecolaminas, algunas rutas metabólicas y en el metabolismo de la tirosina. Las catecolaminas son neurotransmisores que se vierten al torrente sanguíneo derivadas de la tirosina generan múltiples sustancias, pero para nuestro trabajo sólo nos interesan 3: la dopamina, la noradrenalina y la adrenalina. Las catecolaminas se producen en las terminaciones nerviosas, realizando la función de neurotransmisor o en las glándulas suprarrenales actuando como hormonas que se secretan al torrente sanguíneo. Su mecanismo de formación recuerda a una producción en cadena, en la que partimos del aminoácido tirosina, y obtenemos consecutivamente la L-Dihidroxifenilalanina (por la EC 1.14.16.2), ésta se transforma en Dopamina por la EC 4.1.1.28, la Norepinefrina aparece por acción

de nuestra enzima de estudio y ésta se transforma en adrenalina (epinefrina) por acción de la EC 2.1.1.28. Una vez que las catecolaminas se han sintetizado quedan almacenadas en vesículas de secreción (o sinápticas para el sistema nervioso), asociadas como complejo a cromograminas, calcio y ATP. La entrada de las catecolaminas en las vesículas se da por transporte activo primario ácido (protones) antiporte, por lo tanto el interior de estas vesículas tiene una pH ácido entorno a 5,5. La formación de noradrenalina en el sistema nervioso es fundamental puesto que este compuesto es captado por receptores noradrenérgicos y su captación coordina una cascada de reacciones de 2º mensajero con la activación de la adenilato ciclasa intracelular, afectando a procesos como la vasoconstricción, vasorelajación o la intensidad y frecuencias cardíacas. La DBH es una enzima intraneuronal del sistema nervioso simpático, su mayor actividad se destaca en el cerebro, el corazón y en las médulas adrenales. Tanto la noradrenalina como la dopamina como neurotransmisores u hormonas que actúan preparando al organismo para la actividad física, un incremento de la concentración de norepinefrina en el sistema nervioso simpáitico aumenta la frecuencia cardíaca. A nivel hormonal la noradrenalina genera la respuesta de lucha y huida por el efecto anteriormente descrito, y si es captada por receptores adrenérgicos-alfa incrementando la presión sanguínea.. Su origen es diverso, en el sistema nervioso central aparece en el “locus coeruleus” (tronco encefálico), y en las neuronas postganglionares (considerando las células medulares suprarrenales también), los axones del “locus coeruleus” afectan a receptores noradrenérgicos en diferentes zonas como la amígdala cerebral, el hipotálamo, el neocórtex y la médula espinal. La actuación de la norepinefrina comienza una vez que se ha formado por el proceso que hemos descrito, se empaqueta en vesículas por acción del transportador vesicular de monoaminas por un mecanismo similar al descrito anteriormente para las catecolaminas en general. La norepinefrina es liberada de esas vesículas para que pueda realizar su función por diferentes efectos, la norepinefrina es captada por receptores noradrenérgicos, una vez que la noradrenalina ha actuado sobre el receptor destacado, se recapta a nivel presináptico,o bien por células vecinas cuando actúa como hormona, puede llegar a degradarse en varios metabolitos que suelen eliminarse a través de la orina. Como dato extra, cambios en su ruta de formación pueden generar graves disfunciones psicológicas, por ejemplo, ciertas drogas como las anfetaminas compiten con los centros recaptadores de la noradrenalina, lo cual provoca su acumulación.

5. HISTORIA Y DESCUBRIDORES
Esta enzima fue inicialmente supuesta por el Dr. Hugh Blaschko farmacólogo quien en su artículo de 1956 “Hypontesive drugs” ya lanzó la idea de la necesidad de una enzima en la ruta de las catecolaminas que catalizase la conversión de la dopamina en norepinefrina. Cuatro años después, Levin, Levenberg y Kaufman, publicaron en “The Journal of Biological Chemistry” el trabajo “The Enzymatic conversion of 3,4-Dihydroxyphenylethylamine to Norepinefrine” en la que confirmaban la hipótesis de partida de Blaschko, si bien es cierto que con un error inicial en cuanto al mecanismo de reacción, que fue revisado de nuevo en 1964 por Stanley Friedman y Seymour Kaufman, del anterior proyecto, demostrando que la reacción se realizaba a través del cobre como agente REDOX y dejando al oxígeno como mero intermediario/sustrato en su artículo “3,4-Dihydroxyphenylethylamine beta-Hydroxylase: Physical properties, copper content and role of copper in the catalytic activity”. Desde mediados de los 60 numerosos estudios han trabajado sobre esta enzima, la mayoría de ellos han sido de índole clínica describiendo su relación con enfermedades mentales y de tipo fisiológico

a nivel renal y muscular. Una de las primeras descripciones de esta enzima en humanos se la debemos a Ronald Frigon y Richard Stone en su artículo de 1977 “Human plasma Dopamine Beta Hydroxylase” también en el “Journal of Biological Chemistry”, pero tuvimos que esperar hasta diez años después para conocer el primer estudio a nivel estructural de esta macromolécula con la publicación del artículo “The primary structure of human DBH:insights into the relationship between the soluble and the membrane bound forms of enzyme”, en la que se nos empezaba a describir la cadena polipeptídica que compone a esta molécula, las posiciones de centros de interés sitios de modificación posttranscripcional y un largo etc, dicho artículo fue obra de científicos franceses del Laboratorio de Neurobiología Celular y Molecular de París. Artículos más recientes provienen de 2008, tales como el realizado por colaboración entre científicos británicos y brasileños acerca del polimorfismo del gen que contiene la DBH y como esta enzima surgida de dicho gen puede tener una cierta relación con el consumo de cocaína, con resultados no concluyentes a este efecto.

6. MECANISMO DE CATÁLISIS
Como ya hemos dicho, la enzima cataliza la siguiente reacción, Fumarato Dopamina + O2+ Ascorbato Noradrenalina + Deshidroascorbato + H2O 2+ Cu Esta enzima también puede actuar sobre otras cadenas laterales de otros compuestos orgánicos tales como la fenilalanina, en esta reacción se observa la presencia de ascorbato y fumarato(a), que son cofactores imprescindibles en la reacción, en función de diferentes estudios se ha demostrado que se pueden utilizar otros compuestos como el glucoascorbato o el ácido tetrahidrofólico, pero con éstos se produce una disminución de la actividad referida a cantidad de norepinefrina formada. La reacción se da en 2 etapas, en la primera asistimos a la oxidación de ascorbato a deshidroascorbato, quedando el centro catalitico con Cu2+, reducido a Cu+, ese cambio en la enzima es fundamental para la siguiente etapa de la reacción, con la entrada de O2 y de la dopamina, se procede al ataque electrófilo del oxigeno sobre el grupo metilo de la cadena lateral, generando la aparición de un grupo hidroxilo y una molécula de agua. La reacción REDOX se da por la presencia en el centro activo de 4 átomos de cobre (2+), y esto quedó demostrado por espectofotometría al localizarse una banda asociada al complejo dietilditiocarbamato-cobre. A continuación, se expone un esquema de la reacción de catálisis: E= Enzima E
Cu2+ Cu2+ Cu +

+ Ascorbato

E

Cu +

+ Deshidroascorbato + 2 H+ (electrones de alta

energía)

Cu +

                        Cu 2+

E

Cu+

+ O2 + RH

E

Cu 2+ +

Norepinefrina + H2O

Ahora analizaremos de forma más concreta el mecanismo de esta reacción, bajo una óptica esquemática. E E
Cu + Cu + Cu + Cu +

+ O2 O2 + Dopamina (Concretamente
el carbono alfa de la cadena lateral)

E

Cu + Cu +

O2 E

Se genera un complejo intermedio centro activo/oxígeno molecular
Cu + Cu +

RO2H

E

Cu+ Cu+

Cu2+

RO2H + 2 H⁺

E

Cu2+

+ Norepinefrina + H2O

El complejo Dopamina/Enzima Reducida se separa, provocando la liberación de norepinefrina, la reducción de oxígeno a agua y la oxidación del centro de cobre que pasa de Cu+ a Cu2+. Como se ha visto, el ascorbato actúa como un cofactor que “activa” a la enzima para poder catalizar las reacciones de la segunda etapa, y el oxígeno, que inicialmente se pensaba que era el causante de la óxido-reducción, actúa como un sustrato más en la reacción. Dicha reacción se puede encuadrar en una reacción bisustrato Bi-Bi de Doble Desplazamiento(*), que ocurriría esquemáticamente de la siguiente manera:
ASCTO DhASC DOPA O2 NORAD H2O

E

E[A]

E`[Dh]

E`

E`[DOPA(O2 )]

E[NORAD(H2O)]

E

(*) Descrita como Doble Desplazamiento, considerando que los sustratos oxígeno y dopamina entran a la misma vez, y que los productos noradrenalina y agua abandonan el centro activo de la misma manera, si fuese erróneo este planteamiento, simplemente se debería de separar en dos la entrada/salida de estos componentes.

(a) Tablas acerca de la afinidad por el fumarato y el ascorbato como cofactores.

Enlace estructura en 3D: http://www.proteinmodelportal.org/?aid=getModelQualityAnalysis&sid=PMPSIDD56553F837D3BB12EA84D59927FE2C7F&queryfromto=0_617

7. ENSAYO DE LA ACTIVIDAD
En este trabajo hemos recurrido a dos estudios sobre la actividad de esta enzima, por un lado, en 1960, Kaufman, Levin y Levenberg publicaron un trabajo en el que se demostraba la existencia de esta enzima, ya señalada por Blaschko, en un estudio de las células adrenales de vaca. Desde un punto de vista humano, nos hemos de remitir a 2 trabajos, el de Stone y Frigon, que se llamaba “Human Plasma Dopamine-beta-hidroxylase” y “Dopamine-β-Hydroxylase (DBH), Its Cofactors and Other Biochemical Parameters in the Serum of Neurological Patients in Bangladesh ” de Kato, Rahman, Rahman y Rahman. En el primero de los dos, se analizó la actividad enzimática y la aparición de norepinefrina, para ello, se realizó una mezcla de base que contenía los siguientes componentes: Tampón de Fosfato Potásico con un pH de 6,4 y en una concentración de 100μM. Ácido Ascórbico (6μM). Ácido Fumárico (10μM). ATP (12,5 μM) Dopamina con un isótopo de C14, lo cual, provocaría que se mostrase dicho átomo en la norepinefrina formada. (1μM). 6. Glucosa Deshidrogenasa hasta completar el volumen para facilitar la reacción. 7. (1-metil-2-fenil)etilhidrazina hidroclorida (1,3E-2 μM) El volumen final de este preparado era de 0,68 mL, dicho volumen fue incubado a 35ºC mientras se le daba agitación en tubos de test abiertos. Posteriormente, a esta mezcla inicial se le realizaban tres técnicas de trabajo ara determinar la aparición de norepinefrina. 1. Ensayo Cromatográfico: se dejaba llevar a cabo la reacción durante el tiempo de incubación y se detenía añadiendo 2mL de una disolución al 3% de Ácido Acético en Etanol. Posteriormente, se calentaba dicha mezcla hasta los 55º durante 5 minutos para desnaturalizar la enzima. En el cromatógrafo se observa que la norepinefrina formada posee el isótopo de carbono presente en la dopamina anterior, lo cual es síntoma de la aparición de producto. 2. Ensayo Químico: se busca demostrar el anterior proceso, desde otro punto de vista, el peryodato potásico consigue oxidar la cadena lateral de la norepinefrina, más concretamente al grupo hidroxilo del carbono beta de la misma, dando lugar a la aparición de formaldehído, por un método adecuado mediríamos la formación de formaldehído que presentaría el isótopo de carbono 14 ya recogido en la noradrenalina de partida y por tanto la presencia de la enzima que la genera. El tratamiento y parada de la reacción es similar al de la técnica anterior, si bien es cierto que tras detener la reacción se administra una pequeña cantidad de peryodato y la incubación se da en un corto período de tiempo (45 s), a fin de evitar que se formase formaldehído radioactivo de la dopamina C14. Este método es útil como método cuantitativo para la medida de actividad relativa en preparaciones de enzima cruda conteniendo notables cantidades de catecolaminas. 3. Ensayo Fluorométrico: similar a la cromatografía pero variando la parada, esta vez con un volumen de HCl (3,3%) igual a la mitad del volumen total, se requiere del uso del fluorómetro de Farrand. 1. 2. 3. 4. 5.

Tras todas estas pruebas y mediciones se llega a la conclusión de que: la enzima DBH cataliza la conversión de dopamina en norepinefrina en un balance estequiométrico 1 a 1, que la aparición del grupo hidroxilo se debía de dar en el carbono “beta” de la cadena lateral y que para que el proceso se diese eran necesarios 2 intermediarios, el ácido ascórbico (vitamina C) y el ácido fumárico. El ácido ascórbico es el agente reductor por excelencia para que se de adecuadamente esta reacción, dando lugar a una Km = 6*10^-4 en células adrenales de vaca. Si en este mismo ensayo se añaden grandes cantidades de ÁcidoAscórbicoOxidasa (que cataliza la primera etapa del total de pasos de la enzima), no se produce la aparición de producto, deteniendo la acción de la enzima. En torno al ensayo en rumiantes se demostró la elevada concentración de ascorbato en las células adrenales, como principio necesario para la catalización de norepinefrina como hormona. El ácido fumárico es necesario, debido a que supone un aporte de energía extra, en otros ensayos se comprobó que su falta propicia una disminución de norepinefrina, ésto nos puede hacer inducir que este proceso esté en conexión con el ciclo de los ácidos tricarboxílicos. También por comprobación se demostró que el fumarato es el mejor ambiente de desarrollo de esta reacción. En el otro trabajo referido se habla de la relación entre esta enzima y las enfermedades mentales, punto que trataremos más profundamente en otro apartado de esta exposición, basándose en el estudio de 38 individuos sanos determinaron que el valor de Km era 5,2x10^-4 mM y la velocidad máxima a la que trabajaba la enzima se establecía en los 1,1*10^-4 mU.
Tomar como referencia la gráfica denominada “normal” de puntos, se puede observar que su corte con el eje Y es más lejano que el corte de la gráfica “patient”, en una representación primaria como ésta nos indica que la Km de los sujetos sanos es menor que la Km de los enfermos, y por tanto la enzima es más afín por el sustrato de este estudio, en este caso la tiramina, en sanos que en enfermos.

Otros estudios han determinado para el ser humano, una Km de 0.8mM atendiendo sólo a la actuación sobre el ascorbato, o de 2mM sobre la tiramina.

Esta enzima puede sufrir también

inhibición, tanto por exceso de productos, como por interacción de inhibidores específicos tales como: A) Compuestos capaces de crear efectos quelantes: sobre los cationes de cobre del centro activo como compuestos similares a la fenetilamina, o cuya cadena lateral sea comparable al anillo aromático de la dopamina, por ejemplo: al ácido 5 alquipicolínico o el 1-alquil-2-mercaptoimidazol, inhibidores muy potentes pues interactúan directamente con el centro activo. B) Benciloxamina y la Bencilhidrazina, que actúan como inhibidores competitivos. También hemos de incluir a los derivados del ácido fusárico, que además pueden resultar hepatotóxicos. De esta manera se ha determinado que la KI, en vaca (Bos Taurus) alcanza un valor de 4,6; en presencia del 1-(3,4-Dihydroxybenzyl) imidazol. La constante catalítica de esta enzima, también medida sobre Bos Taurus se ha determinado en 110s^-1 con la dopamina y de 121s^-1 para otros sustratos sobre los que también actúa la enzima como la tiramina. Otros parámetros a tener en cuenta son el pH óptimo de trabajo, en Homo sapiens es un pH ácido de 5, con un pI de 5,8, mientras que en Bos Taurus se ha determinado un pH de 6. La temperatura óptima de trabajo se establece en Homo sapiens en 37ºC, en Bos Taurus en 50ºC.

8. ESTRUCTURA ENZIMÁTICA
Esta enzima adopta una forma tetrámerica, asociada a cobre y ciertos residuos presentan glicosilación. El peptopolímero que la compone está formado por 671 residuos en humanos,
Dopamine beta-hydroxylase OS=Homo sapiens GN=DBH PE=1 SV=3 MPALSRWASLPGPSMREAAFMYSTAVAIFLVILVAALQGSAPRESPLPYHIPLDPEGSLE LSWNVSYTQEAIHFQLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAW SDQKGQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILE EPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWC YIKELPKGFSRHHIIKYEPIVTKGNEALVHHMEVFQCAPEMDSVPHFSGPCDSKMKPD RLNYCRHVLAAWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSS GIRLYYTAKLRRFNAGIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIF ASQLHTHLTGRKVVTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLIT SCTYNTEDRELATVGGFGILEEMCVNYVHYYPQTQLELCKSAVDAGFLQKYFHLINR FNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWN LQPLPKVISTLEEPTPQCPTSQGRSPAGPTVVSIGGGKG

los cuales se distribuyen en diferentes dominios, los residuos 1 a 16 son restos que se distribuyen por el citoplasma celular, los residuos 17 a 37 generan una estructura helicoidal que se incrusta en la membrana celular, los residuos 38 a 617 se reparten entre los gránulos de secreción de la propia célula. Por cada tetrámero se presentan cuatro átomos de cobre, los cuales siempre se sustituyen en residuos de Histidina que ocupan las posiciones (262,263,333,412,414,487), los centros activos de esta enzima se localizan en 2 residuos, de Histidina (412) y de Tirosina (230). La glucosilación sobre esta enzima se produce en los residuos Asparragina, por tanto se trata de una N-Glicosilación, dichos residuos son el 64 y el 184. A fin de reforzar la estructura terciaria aparecen numerosos puentes disulfuro entre los residuos de Cys situados en las posiciones (154-596/232-283/269-295/390-503/394-565/466-488/528/530).

Existen numerosas variantes, pero se destacan aquellas relacionadas con deficiencias en la enzima, son sustituciones de aminoácidos, en las posiciones, 101 (V*M, posible sustitución en el codón de GUG en AUG), 114 (D*E, se podría suponer otra sustitución de nucleótidos GAU a GAA), 345 (D*N, posible sustitución púrica-púrica entre nucleótidos GAU-GAC a AAU-AAC). Todos los cambios supuestos se han pensado para cambios únicos en la secuencia, cambios simples. A continuación se muestran imágenes de estructuras similares a ciertos dominios de la secuencia, calculados según el algoritmo MODBASE para una equivalencia válida del 32% y del 29% respectivamente a fin de conseguir hacernos una idea de la distribución espacial por homología en la secuencia con otras proteínas conocidas.

Estructura cristalina de la forma oxidada de un mutante de PeptidoglicinaAlfaHidroxilante Monooxigenasa. Esta estructura es homóloga en un 29%.

Como se puede observar, los intervalos de confianza se pueden tomar como “orientativos” ya que no están en la zona de identidad máxima y lindan con la de identidad por puro azar.

Forma reducida de la anterior enzima con presencia de Cu+ y oxígeno molecular. Esta estructura es homóloga en un 32 %

En un trabajo de octubre de 2011, unos científicos indios consiguieron realizar un alineamiento de la secuencia con secuencias similares en otras especies de esta enzima y además, determinar su estructura tridimensional.

Estructura final de la DBH.

9. APLICACIONES Y ENFERMEDADES ASOCIADAS
Esta enzima está muy relacionada con ciertos problemas de tipo fisiológico al influir en la respuesta del sistema simpático sobre ciertos órganos o su relación con afecciones psicológicas. La DBH en humanos se puede utilizar, entre otros usos, para uso médico, tanto investigador como diagnóstico. Para el diagnóstico de desórdenes post-traumáticos, conocer la labor de la dopamina y la norepinefrina es básico, se ha demostrado que cuando la generación de esta enzima se debe a un polimorfismo en el ADN, los sujetos que sufren polimorfismo para este gen, si sufren situaciones muy estresantes (veteranos de guerra con traumas crónicos) presentan una actividad DBH menor que personas de su misma edad que no han pasado por dicho trance y que a) no tienen polimorfismo en dicha zona génica o b) lo tienen pero no han sufrido dicho trauma. Luego, los resultados de este estudio nos dicen que conocer la actividad de la DBH traducida de forma controlada se puede utilizar como un marcador biológico potencial en casos de trauma. Enfermedades asociadas al alcoholismo se pueden determinar según la actividad de la DBH, debido a que el etanol (alcohol de consumo) provoca un aumento de la transcripción de los genes de la DBH, a través de rutas secundarias basadas en el AMPc y cascadas kinasas, por tanto, se podría suponer en pacientes crónicos alcohólicos unos elevados niveles de esta enzima o norepinefrina en sangre. Para conocer deficiencias clínicas en la ruta de las catecolaminas, se pueden utilizar métodos fotométricos para determinar la actividad de la DBH del plasma sanguíneo (correlacionada con los niveles de la proteína en sí). Trastornos en la DBH pueden causar, en humanos, bastantes complicaciones, de las que citaremos algunas:

Por una parte, la deficiencia de la DBH es una forma muy extraña de fallo autonómico primario caracterizado por una completa ausencia de noradrenalina y adrenalina y una alta concentración de dopamina, pero, de forma aún desconocida su falta sigue prevaleciendo a nivel genético con muy pocos casos diagnosticados en el mundo. Su ausencia genera, desórdenes cardiovasculares, hipotensión, hipotonia muscular, hipoglucemia, en resumidas cuentas una debilidad general del sistema locomotor que se agrava con la edad y que se puede complicar más afectando al sistema circulatorio (túnicas musculares del corazón y los conductos con muy baja resistencia no suelen ser buenos conductores de la sangre). Un posible tratamiento es saltar este paso en la ruta de las catecolaminas mediante la introducción via oral de noradrenalina, o bien otros precursores sintéticos tales como el DOPS. La actividad Dopamina 3 hidroxilasa estaba altamente reducida sólo en pacientes con enfermedad de Alzheimer, la actividad enzimática no tiene relación entre sexo, edad, causa de la muerta, sólo afectada por acción de drogas psicotrópicas Existe una posibilidad de que los pacientes con Alzheimer generen un inhibidor endógeno que no puede ser desechada, por ejemplo, metales como el aluminio parecen estar más presentes en pacientes aquejados de esta dolencia y el aluminio es un inhibidor para muchas actividades enzimáticas. De todas maneras, una explicación más plausible a la relación entre la actividad de la DBH y el Alzheimer sea debida a una progresiva degeneracíón de las neuronas noradrenérgicas Lo que se demostró en un estudio analizando las concentraciones de noradrenalina post mortem mostrando pérdida de estas células en el locus coeruleus, que ya ha sido referido como uno de los centro principales donde esta enzima trabaja. Aunque estas hipótesis han de seguir siendo comprobadas. Otras enfermedades asociadas a variaciones en la actividad de esta enzima, o en las que para su diagnóstico es necesario conocer la actividad de esta enzima causan fallos renales tales como hypo e hiperglucemia, lcucemia, fallo renal, fallo hepático, hiper e hipotensión, algunos tipos de migrañas e incluso determinadas clases de diabetes son afectadas por esta enfermedad.

10. REFERENCIAS, BIBLIOGRAFÍA Y AGRADECIMIENTOS. Artículos revisados para este trabajo:
“The enzymatic conversion of 3,4-Dihydroxyphenylethylamine to Norepinefrine”; Levin, Levenberg y Kaufman, Journal of Biological Chemistry, Febrero 1960. “3,4-Dihydroxyphenylethylamine beta Hydroxylase: physical properties, copper content, and role of copper in the catalytic activity”: Firedman y Kaufman, Journal of Biological Chemistry, Diciembre 1965. “The primary structure of human dopamine-3-hydroxylase: insights into the relationship between the soluble and the membrane-bound forms of the enzyme”; Varios, The EMBO Journal, 1987. “Reduced dopamine-beta-hydroxylase activity in Alzheimer's disease”; Varios, British Medical Journal, Enero 1981.

“The Copper-Enzyme Family of Dopamine Beta-Monooxygenase and Peptidylglycine Alfa Hydroxylating Monooxygenase: Resolving the Chemical Pathway for Substrate Hydroxylation”;Klinman, Journal of Biological Chemistry, Noviembre 2005. “ Dopamine beta-hydroxylase deficiency ”; Senard, Rouet, Orphanet Journal of Rare Diseases, Marzo 2006. “Dopamine-beta hydroxylase polymorphism and cocaine addiction ”; Varios, Behavourial and Brain Functions, Enero 2008. “Human Plasma Dopamine Beta Hydroxylase”, Frigon y Stone, Journal of Biological Chemistry, Mayo 1978 Páginas web consultadas: http://www.brenda-enzymes.org/php/result_flat.php4?ecno=1.14.17.1 http://www.cathdb.info/ http://www.rcsb.org/pdb/explore/explore.do?structureId=1ZHB http://www.proteinmodelportal.org/?aid=getModelQualityAnalysis&sid=PMPSIDD56553F837D3BB12EA84D59927FE2C7F&queryfromto=0_617 www.wikipedia.org (artículos sobre DBH, Dopamina, Noradrenalina y Catecolaminas)

Bibliografía:
“Fisiología Dinámica”, A. Córdova. “Tema 9: Reacciones Bisustrato”, Enzimología, Tena y Jorrín, 2º Grado en Bioquímica, Universidad de Córdoba.

Agradecimientos:
Dr. Rafael Luque Álvarez de Sotomayor del Departamento de Química Orgánica de la Facultad de Ciencias de Córdoba por su inestimable colaboración en el mecanismo de reacción de esta enzima.