>gi 16079600 ref NP_390424.1 heat-shock protein [Bacillus subtilis subsp. subti lis str.

168] MSKRDYYEVLGVSKSASKDEIKKAYRKLSKKYHPDINKEAGSDEKFKEVKEAYETLSDDQKRAHYDQFGH TDPNQGFGGGGFGGGDFGGFGFDDIFSSIFGGGTRRRDPKLRARGADLQYTMTLSFEDAAFGKETTIEIP REETCETCKGSGAKPGTNPETCSHCGGSGQLNVEQNTPFGKVVNRRVCHHCEGTGKIIKNKCADCGGKGK IKKRKKINVTIPAGVDDGQQLRLSGQGEPGINGGLPDLFVVFHVRAHEFFERDGDDIYCEMPLTFAQAAL GDEVEVPTLHGKVKIPAGTQTGTKFRLRGKGVQNVRGYGQGDQHIVVRVVTPTNLTDKQKDIIREFAEVS GNLPDEQEMSFFDKVKRAFKGD >gi 28211652 ref NP_782596.1 chaperone protein DnaJ [Clostridium tetani E88] MPKKDFYEVLGVEKGANDAEIKKAFRKLALKYHPDKNAGNKEAEERFKEINEAYQVLSDPQKRAQYDQFG TADFNGGGAGFSGFEDFDLGDIFESFFGGGFGGFGGSSRRRNGPQKGPDVQYSINLTFNEAVFGVEKEVS ITKSETCETCTGTGAKPGTNSKTCPKCNGSGQIKVQRNTALGSFVSVNTCDMCGGKGTIISDPCSDCKGK GTVRKQKKIKVNIPAGVDTGNVIPIRGQGEAGVNGGPPGDLYISVRVMPDPFFKRRGDDIYIDQHISFAK ASLGTELKVKTIDGEVKYDIPSGTQPGTVFRLKGKGVPHVNGRGRGDQYVNIIVDIPKSLNQKQKEALFA YMEASGEIQSSEKEGFFDKIKKNFK >gi 16082112 ref NP_394547.1 chaperone protein DnaJ [Thermoplasma acidophilum D SM 1728] MAKDYYKILGVDRNATDEEIKKAFRELAKKWHPDLHPENKQEAEEKFKEISEAYEVLSDPQKRRMYDQTG TVDFGAGGQNFNWDNFTHYSDLNDIFNDIFGGNFASDFFSGFGRGQREEQYDLDLYTNLDITLEDAYYGT EKRIKYRRNAMCPDCNGTGAKNGKLITCPTCNGTGQQRIVRGQGFFRMVTVTTCQTCGGRGRIPEEKCPR CNGTGTVVVNEDISVKIPKGATDNLRLRVQGKGQSYNGRTGDLYVVLRVRNDRNVQRINDDLMIDQKINF AQAALGDTIEVNLFREKYSLKIPEGTQPGEVLRIKGAGMPHLNGHGSGDLLVRVNVEVPKRLTQKQKDLI REIFDIKENHRSWFH >gi 16079601 ref NP_390425.1 molecular chaperone DnaK [Bacillus subtilis subsp. subtilis str. 168] MSKVIGIDLGTTNSCVAVLEGGEPKVIANAEGNRTTPSVVAFKNGERQVGEVAKRQSITNPNTIMSIKRH MGTDYKVEIEGKDYTPQEVSAIILQHLKSYAESYLGETVSKAVITVPAYFNDAERQATKDAGKIAGLEVE RIINEPTAAALAYGLDKTDEDQTILVYDLGGGTFDVSILELGDGVFEVRSTAGDNRLGGDDFDQVIIDHL VSEFKKENGIDLSKDKMALQRLKDAAEKAKKDLSGVSSTQISLPFITAGEAGPLHLELTLTRAKFEELSS HLVERTMGPVRQALQDAGLSASEIDKVILVGGSTRIPAVQEAIKKETGKEAHKGVNPDEVVALGAAIQGG VITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTAADNQTAVDIHVLQGERPMSAD NKTLGRFQLTDIPPAPRGVPQIEVSFDIDKNGIVNVRAKDLGTGKEQNITIKSSSGLSDEEIERMVKEAE ENADADAKKKEEIEVRNEADQLVFQTEKTLKDLEGKVDEEQVKKANDAKDALKAAIEKNEFEEIKAKKDE LQTIVQELSMKLYEEAAKAQQAQGGANAEGKADDNVVDAEYEEVNDDQNKK >gi 28211653 ref NP_782597.1 molecular chaperone DnaK [Clostridium tetani E88] MAKVIGIDLGTTNSCVSVMEGGNPVVITNSEGARTTPSVVSFQDNGERLVGQIAKRQAITNPHKTIMSIK RYMGTDHKETIDGKEYTPQELSAIILQKLKADAEAYLGGTVTQAVITVPAYFNDSQRQATKDAGRIAGLE VLRIINEPTAASLAYGLDKMDTNQKILVYDLGGGTFDVSILELGDGVFEVKSTNGNTKLGGDDFDQRIID HIAETFKKDSGIDLRTDKMALQRLKEAAEKAKIELSSSTQTNINLPFITADATGPKHIDMNLTRAKFNEL TQDLVEGTLTPMKKALQDAEMSIGEIDKVILVGGSTRIPAVQDAVKNFTGKEPSKDVNPDECVAMGAAVQ AGVLTGDVKDVLLLDVTPLTLGIETLGGVATPLIERNTTIPTRKSQVFSTAADGQTSVEIHVVQGERQMA ADNKTLGRFTLSGIAPAPRGIPQIEVTFDIDANGIVNVSAKDKGTGKEANITITASTNLSDDEVEKAVND AKKFEEEDKKRKESVEVKNNAEQIFYQTEKTLNELGDKVSAEDKATIEEKLNALKGVKDGEDIEAIKKAT EDLTQAFYQISSKIYQDAGAPGAEGFDSNMAGEANAGQNANNDDNVVDADYKVEDDEK >gi 16082111 ref NP_394546.1 molecular chaperone DnaK [Thermoplasma acidophilum DSM 1728] MSKIIGIDLGTSNSAAAVVISGKPTVIPSSEGVSIGGKAFPSYVAFTKDGQMLVGEPARRQALLNPEGTI FAAKRKMGTDYKFKVFDKEFTPQQISAFILQKIKKDAEAFLGEPVNEAVITVPAYFNDNQRQATKDAGTI AGFDVKRIINEPTAAALAYGVDKSGKSEKILVFDLGGGTLDVTIMDFGDGVFQVLSTSGDTRLGGTDMDE AIVNYIADDFQKKEGIDLRKDRSAYIRLRDAAEKAKIELSTTLSTDIDLPYITVTNSGPKHIKMTLTRAK LEELISPIVERVKGPIDKALEGAKLKKTEITKLLFVGGPTRIPYVRKYVEDYLGIKAEGGVDPMEAVAIG AAIQGAVLKGEIKDIVLLDVTPLTLSVETLGGIATPIIPANTTIPVRKSQIFTTAEDMQTTVTIHVVQGE RPLAKDNVSLGMFNLTGIAPAPRGVPQIEVTFDIDSNGILNVTAVDKATGKKQGITITASTKLSKEEIER MKKEAEQYAEQDRKAKEQIELLNNAESLAYSVEKTLNDAGDKVDKETKERLTNEVKDLRKAIEEKNTENV KTLMDKLSKDIQEVGAKMYQQASANTQQSAQSNSQNSGSSDGKTVDAEYKEKS

1 heat shock protein GrpE [Bacillus subtilis subsp.1 heat shock protein GrpE [Thermoplasma acidophilum DSM 1728] MQPTPSEYARTPVRIEMQRSKERNSMVYKEMYNDAQRKYSEALDRISKLTDAYLREKAEVENFIKIKDRE VEMSKKNANEKLLKDFLPVLDSIDAAIQAEKDNNLIRIRDQMLGVLSRYGLKPIKAEGSKFDPYLHEVVG VTADGEDGMVKYEVQRGYTLNDGVLRTSKVIVVKR .1 heat shock protein GrpE [Clostridium tetani E88] MKWRHDYMAEKKVEDLEMDLNEEELEESEVNEDKEFEELDKSEEENEVEELISTLKDENEKLNNEMEALK DRLLRTTGEYDNYRKRTDREKEGLYASACEDVLKEILPVLDNLERAILAKGDIEDLKKGVDMTLKQFKDS FKNLGVEEISTENGFDPNLHDAVMHVEDSQYGEKEVVEVFLKGYKKGDKIIRHSMVKVAN >gi 16082110 ref NP_394545. 168] MSEEKQTVEQNETEEQEIIEEQAAADEQQEETNESELLQNQINELQGLLEEKENKLLRVQADFENYKRRS RLEMEASQKYRSQNIVTDLLPALDSFERALQVEADNEQTKSLLQGMEMVHRQLVEALKKEGVEAIEAVGQ EFDPNLHQAVMQAEDENYGSNIVVEEMQKGYKLKDRVIRPSMVKVNQ >gi 28211654 ref NP_782598. subtilis str.>gi 16079602 ref NP_390426.

Sign up to vote on this title
UsefulNot useful