You are on page 1of 98

NOTES ON THIS MANUAL

Keep these instructions with your computer at all times. The
proper set up, use and care can help extend the life of your
computer. In the event that you transfer ownership of this
computer, please provide these instructions to the new
owner.
This manual is divided into sections to help you locate the
information you require. Along with the Table of Contents at
the beginning of this manual, an Index has been provided to
help you find topical information.
If you want to start up your PC immediately, please read the
chapters Operational Safety (page 3) and Setting up and
Getting Started (page 10).
We strongly recommend you read this entire manual to en-
sure the proper set-up and operation of your PC.
Many application programs incorporate extensive help func-
tions. As a general rule, you can access help functions by
pressing F1 on the keyboard. These help functions will be
available to you while you are using the Microsoft Windows
®

operating system or the respective application program.
We strongly recommend that you read the Online Manual
for your PC, which can be found in the Start Menu.

Information about your PC
This interactive manual is designed to provide additional in-
formation about your PC as well as useful links accessible via
the World Wide Web.
Windows
xp
invites you to a tour (notes on the task bar) to
familiarize yourself with the operating system. We listed fur-
ther useful sources of information starting on page 61.

ii
AUDIENCE
These instructions are intended for both the novice and ad-
vanced user. Regardless of the possible professional utilisa-
tion, this PC is designed for day-to-day household use. The
functions and applications for use with this PC have been
designed with the entire family in mind.
PURCHASE DETAILS
Enter your purchase details below for quick reference.

Serial Number ......................................
Date of Purchase ......................................
Place of Purchase ......................................

You will find the PC serial number on the Service Hotline
card. The serial number also appears on the rear of the PC.
QUALITY
Medion has selected the components in this computer for their
high level of functionality, ease of use, safety and reliability.
Through balanced hardware and software design we are able to
provide you with an innovative personal computer useful for ap-
plications relating to both work and leisure.
We are pleased to welcome you as our newest customer.
Thank you for choosing our products.
©
2004 Medion
®
. All rights reserved. Microsoft
®
, MS-DOS
®
, and Windows are registered
trademarks of Microsoft Corporation in the U.S. and other countries. Pentium
®
is a
registered trademark of Intel Corporation. The names of actual companies and products
mentioned herein may be the trademarks of their respective owners.
This product incorporates copyright protection technology that is protected by method
claims of certain U.S. patents and other intellectual property rights owned by Macrovi-
sion Corporation and other rights owners. Use of this copyright protection t echnology
must be authorised by Macrovision Corporation, and is intended for home and other
limited viewing uses only unless otherwise authorized by Macrovision Corporation.
Reverse engineering or disassembly is prohibited.
Information in this document is subject to change without notice.

iii
Table of Contents
Notes on This Manual .......................................................... i
Audience ...........................................................................ii
Purchase Details.................................................................ii
Quality..............................................................................ii
Safety and Maintenance ............................................. 1
Safety and Maintenance ........................................................ 3
Operational Safety............................................................. 3
Data Security.................................................................... 4
Important Additional Safety Instructions ............................... 5
Setting Up & Getting Started ...................................... 7
Included with Your PC ........................................................ 9
Setting Up..........................................................................10
Positioning the Monitor ......................................................10
Set-Up Location................................................................ 12
Connecting.........................................................................13
Cabling ...........................................................................13
Front connectors .............................................................. 14
Getting Started ...................................................................29
Short description of the Windows
®
Desktop ..........................31
Operation ................................................................. 33
Operation...........................................................................35
The Mouse.......................................................................35
The Keyboard...................................................................35
The Hard Drive.................................................................39
The optical drive............................................................... 41
Subjects Concerning the CD/DVD-Rewriter........................... 46
The Card Reader............................................................... 47
The Graphics Card ............................................................ 48
The Sound Card ............................................................... 51
USB Port .........................................................................52
IEEE 1394 (Fire Wire) .......................................................53
The Radio-/TV- Tuner Card ................................................54
The Network ....................................................................55
Modem / ISDN .................................................................60
Serial COM-Port................................................................ 61
Software .........................................................................61

iv
Customer Service & Self-Help ................................... 69
Self-Help............................................................................ 71
Data and System Security ................................................. 71
System Recovery.............................................................. 72
Windows
®
Update............................................................. 73
Restoring the Factory Settings............................................ 73
FAQ - Frequently Asked Questions......................................75
Customer Service................................................................ 77
Troubleshooting ............................................................... 77
Driver Support .................................................................79
Additional Support ............................................................ 79
Cleaning and Care ............................................................ 80
Recycling and Disposal ...................................................... 80
Battery treatment ............................................................. 81
Upgrades and Repairs ....................................................... 83
Appendix .................................................................. 85
Standards........................................................................ 87
Warranty......................................................................... 91
Making Copies of This Manual ............................................. 92
Index.............................................................................. 93


C
C
h
h
a
a
p
p
t
t
e
e
r
r
1
1

Safety and Maintenance
Subject Page


Operational Safety ............................... 3
Data Security ....................................... 4
Important Additional Safety Instructions .. 5


S SA AF FE ET TY Y A AN ND D M MA AI IN NT TE EN NA AN NC CE E

2



S SA AF FE ET TY Y A AN ND D M MA AI IN NT TE EN NA AN NC CE E

3
S
SA AF FE ET TY Y A AN ND D M
MA AI IN NT TE EN NA AN NC CE E
OPERATIONAL SAFETY
Please read this chapter carefully and observe all listed notes. This
ensures a reliable operation and long life expectancy of your PC.







• DO NOT allow children to play unattended
with electrical equipment.
• DO NOT open the PC casing or use the PC
with the casing removed. When the casing is
open there is a danger to life from electric shock.
• DO NOT insert objects through the slots
and openings of the PC. This may lead to elec-
tric shock or an electrical short-circuit or fire that
will damage your PC.
• Connect the PC ONLY to an earthed, easy accessible
power socket. For disconnecting the PC from the
mains, unplug the power cord from the mains socket.




• DO NOT cover the slots and openings in
the PC casing. These openings are for ventila-
tion purposes. Covering these vents may lead
to overheating.
• This PC is NOT designed for use within in-
dustrial environments.




• CD-ROM-/CDRW-/DVD-drives are Laser Class
1 devices. These lasers must remain in their
sealed PC casing. DO NOT remove the drive
covers, as exposure to the lasers may
prove harmful.
• DO NOT look directly into the laser, even
when wearing eye protection.
S SA AF FE ET TY Y A AN ND D M MA AI IN NT TE EN NA AN NC CE E

4
For U.S. / Canadian purposes:
Danger - Invisible laser radiation when open. Avoid direct expo-
sure to beam.
Danger - radiations invisibles du laser en cas d´ouverture. Eviter
toute exposition directe au faisceau.
This product is certified by the manufacturer to comply with DHHS
rules 21CFR, Chapter 1, Subchapter J, applicable at date of manu-
facturer. Refer to optical drive labels for additional details.
Please contact Customer Service when:
• ... the power cord or the attached plug is worn or
damaged. Have the defective power cord replaced with
an original cable. Never try to repair a defective cable.
• ... the housing of the PC is damaged or liquids have
penetrated. Have the PC checked by Customer Service
first. Otherwise it is possible the PC cannot be operated
safely which might cause danger to life by electric shock!
The power cord is worn or damaged.
DATA SECURITY

Every time you update your data make back-up
copies on an external storage medium. The sup-
plier does not assume liability for data loss or
damage to data storage units, and no claims can
be accepted for damages resulting from the loss
of data or consequential losses.

S SA AF FE ET TY Y A AN ND D M MA AI IN NT TE EN NA AN NC CE E

5
IMPORTANT ADDITIONAL SAFETY INSTRUCTIONS
When using any electronic equipment, basic safety precau-
tions should always be taken. Following the guidelines below
can reduce the risk of fire, electric shock and injury to per-
son:

• Do not use this product near water (e.g., near a bath-
tub, wash bowl, kitchen sink or laundry tub, in a wet
basement or near a swimming pool).
• Avoid using a telephone/modem (other than a cord-
less type) during an electrical storm. There may be a
remote risk of electric shock from lightning.
• Do not use the telephone/modem to report a gas leak
in the vicinity of the leak.
• Use only the power cord and batteries indicated in this
manual. Do not dispose of batteries in a fire. They
may explode. Check with local codes for possible spe-
cial disposal instructions.
• Keep batteries away from children at all times.
• Caution: To reduce the risk of fire, use only No. 26
AWG or larger telecommunication cords (applies to
American Standards).
• Caution: Lithium batteries can not handle intense pres-
sure, high temperatures or fire. Danger of explosion if
replaced incorrectly. Replace batteries with a compatible
type (Sony¯, CR 2032) as recommended by the manu-
facturer. Lithium batteries are hazardous waste and
require proper disposal. Contact your Service Center
for additional information on battery disposal.
S SA AF FE ET TY Y A AN ND D M MA AI IN NT TE EN NA AN NC CE E

6
C
C
h
h
a
a
p
p
t
t
e
e
r
r
2
2

Setting Up & Getting Started
Subject
Page


Included with Your PC ............................ 9
Setting Up ............................................. 10
Positioning the Monitor ........................... 10
Set-Up Location .................................... 12
Connecting ............................................ 13
Getting Started ..................................... 29


S SE ET TT TI IN NG G U UP P & & G GE ET TT TI IN NG G S ST TA AR RT TE ED D

8

S SA AF FE ET TY Y A AN ND D M MA AI IN NT TE EN NA AN NC CE E

9
INCLUDED WITH YOUR PC
Please check that the contents listed below are supplied with
your package and notify us within 14 days of purchase if this
is not the case. You MUST provide your PC´s serial number
when contacting a customer service representative.
Your PC bundle should include the following components:

1 x PC and power cord
1 x Windows-compatible keyboard
+

1 x Remote Control Set (optional)
1 x Mouse
+

1 x Microsoft Windows
®
Getting Started Manual + Recovery CD
(for re-installing the operation system, for factory roll -back refer to page 73)
1 x Application and Support CD (Drivers etc.)
This instruction manual
Warranty Card
1 x Setting-up poster (optional)


+
As a USB radio kit these devices may optionally be
equipped with a radio receiver.
S SE ET TT TI IN NG G U UP P & & G GE ET TT TI IN NG G S ST TA AR RT TE ED D

10
S
SE ET TT TI IN NG G U
UP P
Remember that choosing the proper location for your PC is
just as important as connecting it correctly. Place your PC in
a stable, vibration-free area. Detailed below are additional
guidelines on setting up your PC.
POSITIONING THE MONITOR
Ensure that the monitor is set up in such a way that reflec-
tions, glare and light/darkness contrast are avoided.



Hand rest: 2¨ - 4¨
Top line of screen at eye level or
slightly below
Viewing distance: 20¨ - 27.5¨
Legroom (vertical):
minimum 25.5¨
Legroom (horizontal):
minimum 23.6¨

0-15•
50-70 cm
-(20-28 inches)-
0-15•
S SE ET TT TI IN NG G U UP P

11
WORKING IN COMFORT
ÂTake regular breaks from the work at your
screen to prevent tenseness and exhaustion.
Sitting in one position for long periods can be uncomfortable.
To minimize the potential for physical discomfort or injury,
it´s important that you maintain proper posture.
• Overall: Change your position frequently and take regu-
lar breaks to avoid fatigue.
• Back: While sitting at your work surface, make sure
your back is supported by the chair´s backrest in erect
position or angled slightly backwards.
• Legs: Your thighs should be horizontal or angled
slightly downward. Your lower legs should be near a right
angle to your thighs. Your feet should rest flat on the
floor. If necessary, use a footrest, but double check that
you have your seat height adjusted correctly before get-
ting a footrest.
• Arms: Your arms should be relaxed and loose, elbows
close to your sides, with forearms and hands approxi-
mately parallel to the floor.
• Wrists: Your wrists should be as straight as possible
while using the keyboard, mouse or trackball. They
should not be bent sideways, or more than 10 degrees up
or down.
• Head: Your head should be upright or tilted slightly
forward. Avoid working with your head or trunk twisted.
S SE ET TT TI IN NG G U UP P & & G GE ET TT TI IN NG G S ST TA AR RT TE ED D

12
SET-UP LOCATION
• Keep your PC and all units connected to it away from
moisture, dust, heat and direct sunlight. Failure to
observe these instructions can lead to malfunctions or
damage to the PC.
• To prevent damage to your PC from a fall, place and op-
erate the PC and all connected units on a stable, bal-
anced and vibration-free surface.
AMBIENT TEMPERATURE
• The PC can be operated at an ambient temperature of
between 10° C and 35° C (+41° and +95° F) and at a rela-
tive humidity of between 30% and 70% (without conden-
sation).
• When powered off, the PC can be stored at temperatures
between -20° C and 50° C (-40° and +158° F).
• To provide additional protection against electric
shock, power surges, lightning strikes, or other
electrical damage to your PC, we recommend the use
of a surge protector.
• Wait until the PC has reached ambient (room) tem-
perature before turning it on or connecting it to the
power adapter. Drastic variations in temperature
and humidity can create condensation within the PC
and may cause it to short-circuit.


C CO ON NN NE EC CT TI IN NG G

13
C
CO ON NN NE EC CT TI IN NG G

For a better guidance, open up the left inner page of
the cover with the diagrams to find the location of the
described connections.

ÂNote: The devices listed are not necessarily
included with your PC.
CABLING
Please follow the instructions below in order to correctly con-
nect your PC:
• Arrange cables in such a way that no one can tread on or
trip over them.
• DO NOT place objects on the cables.
• To avoid damage to your PC, connect your peripherals
(e.g., keyboard, mouse and monitor) whilst your PC is
powered off. Some devices can be connected whilst your
PC is in use. These devices usually have a USB or IEEE
1394 connector. Please follow the appropriate in-
structions for each device.
• Keep the PC at least one meter (approximately three feet)
away from high frequency and magnetic interference
sources (e.g., televisions, loudspeaker cabinets, mobile
telephones, etc.) in order to avoid malfunctions and/or
loss of data.
• To avoid EMC issues, make sure that all devices are con-
nected to each cable or that cables not in use are re-
moved from the computer.
• Please note that only shielded cables shorter than
3 metres (9.84 ft) should be used for the LPT, COM, USB,
IEEE 1394, audio, video and network interfaces with this PC.
S SE ET TT TI IN NG G U UP P & & G GE ET TT TI IN NG G S ST TA AR RT TE ED D

14
• The connection of devices is limited to equipment that complies
with EN60950 "Safety of information technology equip-
ment¨ or EN60065 "Audio, video and similar electronic ap-
paratus. Safety requirements¨.
ÂNote: You only need to connect those compo-
nents to your computer you require. If you do
not have the described device (e. g. printer)
you may skip the respective item and carry it
out later, if necessary.
FRONT CONNECTORS
Here is how you can access the (optional) card reader and
some further connectors on the front of your PC casing.





(Diagram the same)
DVD-RW


DVD-ROM
Connect XL

Please press this
button to slide
down the cover.
Push carefully the cover up to hide the
card reader and the connectors.
DVD-RW

DVD-ROM






Connect XL

C CO ON NN NE EC CT TI IN NG G

15
CONNECTING THE MONITOR
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : W W
• If your graphics card has two VGA sockets), you can use
either port to connect to the monitor. Your PC may op-
tionally be equipped with a digital connector (DVI,
W2).
• Because of its asymmetric form the plug only fits into
the socket in one position.
1. Connect the data cable of the monitor to the blue
socket on the graphics card (reference W or W2). If
necessary, remove the white guard-ring on the
monitor plug and ensure that the plug and socket
mate together precisely.
2. Hand-tighten the screws on the monitor cable.
ÂCAUTION! Your PC monitor is preconfigured for a
screen resolution of 1024 x 768 pixels and an
optimal refresh rate of 75 hz. If your monitor
does not support these settings it may become
damaged or malfunction during use.
You can change the screen resolution and configuration of your
monitor as follows (See also your monitor's User Manual):
1. Once you have powered on the PC, press the F8
key to select Safe Mode.
ÂIf you don´t hit the F8 key on time, you won't
see the start menu which gives you the option
to run in Safe Mode. Reboot your PC and re-
try if you have missed this.
2. Select Display Properties to designate the
screen resolution for your monitor.
You can then adjust the "Display Features¨ to your monitor.
S SE ET TT TI IN NG G U UP P & & G GE ET TT TI IN NG G S ST TA AR RT TE ED D

16
CONNECTING WIRELESS KEYBOARD & MOUSE
These devices are optional. The wireless keyboard and mou-
se operate with digital radio technology to ensure no hinder
communication between the keyboard, the mouse and your
computer without connecting cable. The transmission and
receiving of keyboard and mouse are free from angle
restriction. There are two frequency channels each for key-
board and mouse to prevent malfunctions when you operate
several radio transmission devices simultaneously.
Before working with your new keyboard and mouse, take a
few one-time preparations.
ÂBeware: Please read and follow the security ad-
vices concerning the use of batteries on page 81.
INSERTING BATTERIES IN MOUSE
The mouse requires two alkaline batteries (Type: AAA).

1 = Cover
2 = Battery compartment
3 = Channel setting button

(Diagram the same)
1. Remove the battery compartment cover (1) on the bot-
tom of the keyboard.
2. Insert the two alkaline batteries (AAA) in the battery
compartment.
3. Fix the battery compartment cover (1) on the bottom
of mouse again.
ÂNote: Please do not push the channel setting
button (3) at one side of the battery com-
partment cover. It may cause the channel or
ID change.
C CO ON NN NE EC CT TI IN NG G

17
INSERTING BATTERIES IN KEYBOARD
The keyboard requires two alkaline batteries (AA).


1. Remove the battery compartment cover (1) on the bot-
tom of the keyboard by pushing it in the direction of the
arrow.
2. Insert two AA batteries. The illustration in the battery
compartment (2) shows how to insert the batteries prop-
erly.
3. Recover the battery compartment by pushing the locking
lug (2) under the battery compartment.
ÂNote: Please do not push the channel setting
button (3) at one side of the battery com-
partment cover. It may cause the channel or
ID change.
1 = Cover
2 = Battery compartment
3 = Channel setting button
(Diagram the same)
S SE ET TT TI IN NG G U UP P & & G GE ET TT TI IN NG G S ST TA AR RT TE ED D

18
SETTING FREQUENCY CHANNEL OR ID
ÂNote: Please make the following setting only
after installing your PC as described on the
other chapters in this manual.
For the radio connection, set the keyboard to receiver, and
mouse to receiver, with the same frequency channel and ID.
Different ID can keep the keyboard and mouse working well
with the same frequency channel. There are 255 IDs each for
keyboard and mouse. Change the frequency channel may
prevent interference between two devices.

SETTING FREQUENCY CHANNEL ON KEYBOARD AND MOUSE
1. Push the connect button on the top of receiver. The indi-
cator will be blinking.
2. Push the button on the bottom of keyboard or mouse.
The channel will be changed after the button released.
ÂNote: Please do not hold the button longer
than 3 seconds.
It will change the ID, instead of channel.
SETTING ID ON KEYBOARD AND MOUSE
1. Push the connect button on the top of the receiver. The
indicator on the top of the receiver will be blinking.
2. Hold down the button on the bottom of keyboard and
mouse for approx. 3 seconds. The ID will be changed af-
ter the button released.
C CO ON NN NE EC CT TI IN NG G

19
CONNECT THE KEYBOARD AND MOUSE

1 = USB Receiver plug (black)
2 = Receiver
3 = Mouse
4 = Keyboard
1. Plug the plug (1, black) of the receiver into an USB port
of your computer. The computer will activate your mouse
and keyboard after 10 seconds.
2. Place the receiver at least 20 cm (8 inches) from other
electrical devices (e.g. monitor) to achieve optimum per-
formance. The distance between the keyboard, mouse
and receiver should not exceed 5 feet. Do not place the
receiver on metal surfaces.
ÂThe driver for these devices has already been
installed on your PC.
ÂThe operation of the mouse and the keyboard
is described on page 35.
S SE ET TT TI IN NG G U UP P & & G GE ET TT TI IN NG G S ST TA AR RT TE ED D

20
CONNECTING A PS/2 KEYBOARD
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : R R
1. Connect the keyboard to the left, blue PS/2 port.
If you want to connect a USB Keyboard please follow the in-
structions below.

CONNECTING A USB KEYBOARD
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : E E
1. Connect the USB keyboard to a USB port.
If you want to connect a PS/2 Keyboard please follow the
instructions below.

CONNECTING A PS/2 MOUSE
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : O O
1. Connect the mouse cable to the right, green PS/2 port.
If you want to connect a USB mouse please follow the in-
structions below.

CONNECTING A USB MOUSE
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : E E
1. Connect the USB mouse to a USB port.
If you want to connect a PS/2 mouse please follow the
instructions below.

C CO ON NN NE EC CT TI IN NG G

21
CONNECTING PARALLEL DEVICES
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : P P ( (O Op pt ti io on n) )
• Because of its asymmetric form the plug only fits in-
to the socket in one position.
1. If you wish to connect a printer with a parallel (25-
pin) connecting cable, connect the printer cable
from your printer to the red printer socket P on the
rear of your PC.
2. Hand-tighten the screws.
If you wish to use a scanner, which also connects to the PC
via the parallel interface, follow the instructions above. With
the PC parallel port in use, the printer can be connected di-
rectly to the scanner. You will have use of both devices if
they are connected in this manner.

CONNECTING SERIAL DEVICES
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : S S ( (O Op pt ti io on n) )
• Because of its asymmetric form the plug only fits
into the socket in one position. Hand-tighten the
screws.
1. In order to connect an external modem, card
reader or other serial device, connect the serial ca-
ble with the turquoise-coloured connection socket
(S) on the rear of your PC.
2. Hand-tighten the screws.

S SE ET TT TI IN NG G U UP P & & G GE ET TT TI IN NG G S ST TA AR RT TE ED D

22
MODEM/ISDN CONNECTION
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : Z Z
If your computer is fitted with a modem or ISDN card, con-
nect the matching end of the communications cable with port
Z of your PC. The socket is identified as Line. Plug the other
end into of the communications cable to the telephone wall
socket or into the network port provided.
MODEM
The modem cable has an RJ11 plug, which is plugged into
the modem of your PC, and a TAE plug, which fits an N-
coded, analogue telephone socket. For further information
please refer to the Modem section.
ÂATTENTION! Please observe that the modem
may only be connected to an analogue tele-
phone line. The connection of a digital system
(ISDN etc.) to an analogue telephone line can
possibly cause damage to the modem or the
connected devices and the telecommunication
network.
ISDN
The ISDN cable has RJ45 plugs at either end. It makes no
difference which end is plugged into which socket.
1. Connect the matching plug of the enclosed com-
munication cable to jack Z of your computer. Usu-
ally the jack is marked with "Line¨.
2. Then connect the other plug to the telephone or
ISDN outlet.
ÂATTENTION! Operate the ISDN unit only
with digital telephone systems. This prevents
an inadmissible operation possibly causing
damage to the unit or the connected devices.
C CO ON NN NE EC CT TI IN NG G

23
LAN CONNECTION
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : Q Q
According to the features your PC can be equipped with a net-
work connection, in order to prepare it for network operation.
The network cable usually has two RJ45 plugs so that it is
unimportant which plug is connected to which jack.
1. Connect the one plug of the cable to the PC jack.
2. Connect the other plug to the other PC or
hub/switch.
For further information refer to chapter "The Network¨
starting at page 54.
CONNECTING DEVICES TO THE GAMING PORT
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : G G ( (O Op pt ti io on n) )
The multi-pin, orange gaming port G can be used to connect
game controllers (joystick, game-pad, steering wheel
etc.) as well as Game-to-MIDI-adapters.
• Because of its asymmetric form the plug only fits into
the socket in one position. Hand-tighten the screws.
1. Connect the plug of the respective device with the
turquoise coloured jack in the rear of your PC.
2. Then tighten the screws of the serial cord by hand.
CONNECTING SPEAKERS/AUDIO OUTPUT
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : H H
Connect your headphones or active speakers by plugging
the cable with the 3.5 mm stereo jack plug into the green
socket (reference H).
S SE ET TT TI IN NG G U UP P & & G GE ET TT TI IN NG G S ST TA AR RT TE ED D

24
PCS WITH SURROUND SOUND
If your PC is equipped with it the following connection is required:
1. Connect the front speaker to the green socket (refer-
ence H).
2. Connect your rear speaker to the Rear connector (H2).
3. Your centre speaker or subwoofer can be connected
to the socket Centre/Subwoofer (H3).
4. In order to use the (optional) digital audio outlet
plug the cinch cable in the jack at location U. The op-
tical digital audio outlet is positioned at location U2.
Connect the cable with an audio device with a digital
cinch inlet according to the SPDIF standard.
CONNECTING A SOUND SOURCE/AUDIO INPUT
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : J J
This port is used to accommodate a connecting cable for exter-
nal audio sources (i.e. stereo system, keyboard/synthesizer).
1. Connect the cable with the 3.5 mm stereo jack plug to
the light-blue coloured socket (reference J). You can
also connect a stereo Cinch cable (position J2).
2. If you want to record a digital audio source use the
(optional) audio input T or T2. A SPDIF-Cinch cable
will also be necessary for the T while T2 is an optical
output.
CONNECTING A MICROPHONE
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : I I
1. You can use the pink socket I to connect a micro-
phone with a 3.5 mm mono jack plug.
2. Position the microphone in such a way that it does
not point directly at the speakers. If you hear feed-
back, characterised by loud whistling noises, reposi-
tion the microphone until the sound stops.
C CO ON NN NE EC CT TI IN NG G

25
ANTENNA CONNECTION FOR TV / RADIO RECEIVER
P Po os si it ti io on n i in n t th he e f fl la ap p- -o ou ut t o ov ve er rv vi ie ew w: : Y Y, , Y Y2 2
Should your PC be equipped with a TV tuner card, then you
must connect the corresponding 75 Ohm coaxial cables (aerial
or cable) for radio and TV reception.
1. Connect the supplied radio antenna with the correspond-
ing connector (Y) on the TV card.
2. Connect the TV connector on your TV card (Y2) with the
aerial antenna or cable TV.
CONNECTING THE PC TO A TELEVISION
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : V V ( (C Ci in nc ch h) ), , V V2 2 ( (S S- -V Vi id de eo o) )
If your computer´s VGA card is equipped with a TV-Out
socket you can establish a connection to a TV.
1. Connect your PC and your television with the cord
required (available separately) for your TV.
CONNECTING A RECORDING SOURCE / VIDEO INLET
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : K K ( (C Ci in nc ch h) ), , L L ( (S S- -V Vi id de eo o) )
Your PC may be fitted with a TV-input, depending on the
model you selected. You can transfer data from your video
camera to your PC and edit the images using this connection.
1. Connect the plug of the cord to the jack (position K
for cinch and L for S-Video).
S SE ET TT TI IN NG G U UP P & & G GE ET TT TI IN NG G S ST TA AR RT TE ED D

26
USB/IEEE 1394
ÂWarning: Connect your USB-/IEEE 1394 de-
vices after initial set-up of your new PC. This
will prevent unnecessary confusion during in-
stallation. These devices can generally be con-
nected during operation. Read the manual for
your peripheral device first.
The voltage outputs of your PC for IEEE 1394 as well as for
USB are protected by a fuse (limited power source according
to EN60950). This ensures that a malfunction of the PC will
not damage the peripheral devices connected to the respec-
tive jacks.
CONNECTING IEEE 1394 (FIRE WIRE) DEVICES
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : F F ( (6 6- -p po ol le e) ), , F F2 2 ( (4 4- -p po ol le e) )
ÂPeripheral devices can have different connect-
ing cables (6-pole = F, 4-pole = F2). Please
check what kind of cable you need for your pe-
ripheral device.
Important: The connectors of the front side
are not configured for parallel use.
CONNECTING USB DEVICES
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : E E
You have a choice of several connection sockets.
It does not matter which you use.
1. If you wish to use a printer, scanner or other device with a
USB port, connect the cable to the USB socket on your PC.
ÂNote: Connect your devices always to the
same port otherwise your operating system
will give a new ID and asks for driver installa-
tion.
C CO ON NN NE EC CT TI IN NG G

27
CONNECTING THE POWER SUPPLY
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : X X
1. Finally, connect the power supply to your PC and
monitor, by plugging the power cord into the out-
let.
Observe the following safety precautions:
• The power socket must be in the vicinity of the PC
and within reach of the power cables. DO NOT
stretch the power cables tightly to reach a
power socket.
• In order to disconnect your PC from the power
source, or set the PC to voltage free, remove the
power cord from the socket.
• Use only the supplied power cord.
• To provide additional protection against electric
shock, power surges, lightning strikes, or other elec-
trical damage to your PC, we recommend the use of a
surge protector.
• If you are using an extension cord, ensure that the
cord meets your local safety requirements. If in
doubt, ask an electrician.
• The power supply unit has an On/Off switch (X2) that
can be used to power off the PC. When the switch is
Off no power is being consumed.
DO NOT Start Your PC Yet!
First, read the following section to find out what you need to
know in order to get started.

S SE ET TT TI IN NG G U UP P & & G GE ET TT TI IN NG G S ST TA AR RT TE ED D

28
G GE ET TT TI IN NG G S ST TA AR RT TE ED D

29
G
GE ET TT TI IN NG G S
ST TA AR RT TE ED D

The software on this PC comes fully pre-installed.
You do not have to load any of the CD's/DVD´s supplied.
With many programs (e.g., telephone-CD's or encyclopaedias),
however, it is necessary to insert the corresponding CD/DVD in
order to call up the data which is stored on it. The software will
ask you to do this as necessary.
Once you have made all the connections and secured the neces-
sary connectors you can turn on the monitor, the other periph-
erals and finally the PC itself.
Step 1
1. Power on the monitor and your peripherals.
SWITCH
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : X X2 2
2. Power on your PC by pressing the
Switch to position [1]. (You will
interrupt the current entry by
pressing the switch to position 0)
MAIN POWER SWITCH
D Di ig gr ra am m r re ef fe er re en nc ce e: : N N
1. Press Main Power Switch briefly to start loading the op-
erating system. You are now ready to setup the (op-
tional) wireless keyboard / mouse set (p. 16).
You can program the function of the main switch in the
power management of Windows
®
(please refer to on-line
help). The PC will always be switched off, if the main switch
is pressed for more than 4 seconds.
ÂWarning! If the operating system is not shut
down properly (through á Ö Shut Down),
then there is a risk of data loss.
S SE ET TT TI IN NG G U UP P & & G GE ET TT TI IN NG G S ST TA AR RT TE ED D

30
Step 2
The PC starts and now goes through a number of phases:
ÂNote: Ensure that there is no bootable CD (e.g. the
Recovery-CD) in the CD-ROM drive. Such disks will
prevent the operating system from loading directly
off the hard drive.
The operating system is loaded from the hard disk. During the
initial set-up, the loading process takes slightly longer than normal
to register the operating system and the individual components
completely. Your operating system is finished loading when a
welcome screen is shown on your display.
Follow the instructions on the screen. Dialogue boxes will explain
any steps that need to be taken. The greeting procedure will
guide you through the following screens and dialogues.
Should you have any questions just click on .

License Agreement
Explanation:
Please read through the license agreement carefully.
It contains important legal information on the use of your
software.
In order to see the full text, use the mouse and the scroll bar
to move downwards until you have reached the end of the
document. You accept the agreement by clicking on the I ac-
cept the agreement option field. Only by doing so will you
be entitled to use the product under lawful terms and condi-
tions.
Computer Name
Please note, that when assigning a name to a computer, the com-
puter name and the user name may not be identical.
Step 3
After the login procedure the Windows
®
desktop appears on
your screen.
This can be adjusted so that the screen of your computer
looks different. The basic operation, however, is ensured.
G GE ET TT TI IN NG G S ST TA AR RT TE ED D

31
SHORT DESCRIPTION OF THE WINDOWS
®
DESKTOP
(The respective illustration is shown on the next page.)
n
The Start button
Click once on this button with your left mouse key to call the illus-
trated start menu.
o
Program bar
The most commonly used programs are listed here. The operating
system recognizes them automatically. If you press the right mouse
key on an entry you can determine which entry is kept and which is
deleted from the list. The program associated with the entry will not be
deleted.
p
All programs
Here you find the entries to every program installed on your PC.
Here, too, you can edit entries with the right mouse key.
q
Information about your PC
Click on this button once with the left mouse key to receive impor-
tant information about your PC as well as valuable hints and addi-
tional assistance.
r
Switching off
Click on this button with the left mouse key to switch off the PC.
s
Task bar
Here you receive information and status reports about the operating
system and the running programs.
t
"Icons" on the "Desktop"
Icons are program links used to start the respective programs. A
double click (press the left mouse key quickly twice) on the sym-
bol starts the application.
The Desktop includes almost the complete screen and is the filing
area for those entries or other links you would like to access
quickly.
S SE ET TT TI IN NG G U UP P & & G GE ET TT TI IN NG G S ST TA AR RT TE ED D

32
u
Logged in user
This shows the logged in user. The image is changed by clicking on it.
v
Control Panel
This is the central control of your computer. Here you are able to
configure your computer at will. However, you should read about
the implications of possible changes in "Help and Support¨.
















nop q r s





t
u

v
C
C
h
h
a
a
p
p
t
t
e
e
r
r
3
3

Operation
Subject Page


The Mouse .................... 35
The Keyboard ...................................... 35
The Hard Drive .................................... 39
The Optical Drive ................ 41
The Card Reader .................................. 47
The Graphics Card ................................. 48
The Sound Card .................................... 51
The USB Port ........................................ 52
IEEE 1394 (Fire Wire) ........................... 53
The Radio-/TV- Tuner Card ...................... 54
Network ............................................... 55
Software ..................... 61
Modem / ISDN ....................................... 60


O OP PE ER RA AT TI IO ON N

34

O OP PE ER RA AT TI IO ON N

35
O
OP PE ER RA AT TI IO ON N

THE MOUSE
The mouse has beside the two key a wheel that can be used
as:

• A third mouse button by clicking as
shown in the picture.

• To scroll through a document or inter-
net pages.

With the help of the mouse software in the control panel you
can choose more functions.
THE KEYBOARD
This section contains useful information on using the
keyboard. All diagrams are schematic.
On the base of the keyboard are two folding feet that let you
adjust the angle of the keyboard.


Adjustable Feet
O OP PE ER RA AT TI IO ON N

36
THE ALT AND CTRL KEYS
The left Alt key performs certain functions in conjunction with
other keys. The application program determines these func-
tions. In order to enter a combination of keys that include the
Alt key, hold the Alt key down while pressing the other key.
The right Alt key operates in a similar way but selects certain
special characters. The Ctrl key, like the Alt key, carries out
program functions.
Useful key combinations (software-dependent):
Key
Combination
Function and Description
Alt + F4
As a rule ends the program selected or
closes the window opened.
Alt + Print screen
Copies the image of the window cur-
rently active to the clipboard.
Shift + 2
Generates the @ character required for
e-mails (pronounced: at).
Ctrl + Alt + Del Windows security is launched.

(Country-specific variances are possible.)
O OP PE ER RA AT TI IO ON N

37
MULTIMEDIA FUNCTIONS
Some keyboards are provided with multimedia keys. These
keys have the following functions:
Symbol Function

Standby Mode
Depending on the settings in the BIOS Setup or
operating system the computer switches to a
standby mode.
Internet
With this key you can start the standard browser.
E-Mail
Use this key to start the standard e-mail program.
Favorites
Opens the folder "Favorites¨.
Calculator
Activates the Windows default calculator.
Search
Activates the OS default search function.

O OP PE ER RA AT TI IO ON N

38

Back
Switches to the previous web page/folder.
Forward
Switch to the next web page.
Previous Track
Use this key to skip to the forward title in the active
player.
Stop
Use this key to end the playback of a title.
Play/Pause
Use this key to start or pause for a short time the play-
back of a title just as you would with a normal CD
player.
Next Track
Use this key to skip to the next title in the active player.
Decrease the volume
This key decreases the volume of the soundcard.
Mute
Use this key to switch on/off the soundcard.
Increase the volume
This key increases the volume of the soundcard.
Cut
Cuts the content you selected.
Copy
Copies the content you selected.
Paste
Pastes the content you have been copied or cut.

O OP PE ER RA AT TI IO ON N

39
THE HARD DRIVE
The hard drive is the main storage medium combining large
storage capacity and rapid data access.
The hard drive contains the operating system of the computer,
other application programs and backup files. These programs
and files are pre-installed on your PC, so you may note that
some of the space on your hard drive is already taken.
The Windows operating system cannot use the full capacity
of the hard drive, which means that there will be a difference
between the capacity that the BIOS displays and what the
operating system displays. The operating system of the PC,
further application programs and backup files are located on the
hard drive and reduce its total capacity.
The hard drive is addressed as drive C, D and E.
ÂNever switch off the computer while the busy
indicator is lit since this may result in loss of
data.
Usually your hard disk is divided into more partitions, but
there can also be some minor variations.
Partition Drive Type Capacity (approx.)
Boot C: NTFS or FAT32 50%
Backup D: NTFS or FAT32 40%
Recover E: NTFS or FAT32 10%
In your first partition (Boot) you will find your operating sys-
tem, application programs and the users´ documents and
settings.
The second partition (Backup) serves for data security and
contains additional drivers and tools.
The third partition (Recover) contains the copies of your
Windows-installation in the delivery state.
O OP PE ER RA AT TI IO ON N

40
IMPORTANT DIRECTORIES
In the following we listed the most important directories de-
scribing their contents.
ÂAttention! Do not delete or modify these di-
rectories or their contents since data could be
lost or the functionality of the system could be
at risk.
C:\ The master directory of drive C: includes important
files required to start Windows. In the factory setting
these files are hidden for safety reasons.
C:\Programs As the name suggests, in this directory pro-
grams install the files belonging to the application.
C:\Windows The main directory of Windows.
This is where the files of the operating system are
saved.
C:\Documents and Settings This folder includes the set-
tings and documents of all the PC users.
D:\Driver This folder includes the drivers required by your
computer (pre-installed).
D:\Tools Here you find additional programs and other docu-
mentation for your PC.
E:\Recover Here the backup files are located enabling you
to recover the factory setting (see page 73).

O OP PE ER RA AT TI IO ON N

41
THE OPTICAL DRIVE
Depending on the model of your PC it will have a CD-ROM, a
CD-ReWriter, a DVD, a DVD-ReWriter or a combination of
these drives. The drives installed in your PC are appropriately
labeled to allow you to easily select the desired drive.
The table below shows which media you can use in which drive:
Medium CD-ReWriter DVD DVD-ReWriter
CD 9 9 9
DVD 8 9 9
CD-R/-RW 9 9 9
DVD-R/-RW 8 9* 9*

Whether or not you can use a disc in a particular drive de-
pends on whether the format is supported by the drive and
the operating system. So for example, a CD that has been
created for another operating system may not be readable.
* Writable media for DVD (DVD-R/RW) must be compatible
with your drive type. There are various formats (DVD-R,
DVD+R, etc.), which are not compatible with each other. The
specified writing speed must also be supported by your drive.
Since this technology is still very new, incompatibilities may
still occur even if the correct media are used.
We therefore recommend that you use only branded blank
media and that you check these for compatibility with your
devices. Blank CD´s, however, do not really cause any prob-
lems and can generally be written to without hesitation with
your CD- or DVD-writer (where present).
Nevertheless, we recommend that you check which media
suit your devices best.
O OP PE ER RA AT TI IO ON N

42
LOADING A DISK:
ÂAttention: Do not place protective foils or
other stickers on your CD´s. To avoid damage
to your drive, do not use deformed of dam-
aged CD´s. Attention: Do not use scratched or
dirty disks, discs with pieces broken off or
disks of poor quality. Because of the high
speeds in the drive the disks might break and
damage your data as well as your drive.
Examine the disks before you enter them. If
damage or dirt is visible, you should not use
them.
Damage caused by faulty media is excluded
from warranty and their repair must be
charged.
D Di ia ag gr ra am m r re ef fe er re en nc ce e: : A A
1. Press the eject button (Diagram reference, B) on the
front of the CD-ROM-drive to open the tray.
2. Place the disk on the tray so that it lays flat with the la-
bel facing upward.
3. Press the eject button again to close the tray.
ÂMany CD's start automatically when they are
inserted.
O OP PE ER RA AT TI IO ON N

43
PLAYING BACK AND RETRIEVING DATA FROM DISCS
In order to access the CD via Windows Explorer, select the let-
ter corresponding to the drive. When accessing audio or video
disks (or audio or video files on conventional CDs) you should
use the media playback application pre-installed on the com-
puter. CD-ROM and DVD-ROM drives can play audio CDs, but
only the DVD-ROM drive can play DVD audio or video disks.
Depending on the DVD audio CD and the software installed
you may also have to open a DVD player program. For fur-
ther information on the subject DVD refer to page 44.
HOW TO REMOVE A DISC:
1. Press the eject button (Diagram reference, B) at the
front of the CD-ROM drive to open the drawer.
2. Remove the disc and store it in the CD cover in a safe
place.
ÂDo not try to remove the CD from the drive
while the computer is accessing the disk.
THE CD-ROM/DVD DRIVE AS BOOT DRIVE
The optical drives can be used for booting the operating sys-
tem. If the PC does not boot, it is possible that autostart is
turned off in the BIOS or the CD is not bootable.
O OP PE ER RA AT TI IO ON N

44
DVD TECHNOLOGY
The Compact Disc (CD) was introduced in 1982.
Who could imagine doing without the CD as a storage me-
dium for data, multimedia, computer games and video now?
A CD can hold up to 700 MB of data, but that amount is too
small to store a high-quality encoding of an entire feature
film. The DVD (Digital Versatile Disc) has the same dimen-
sions as a CD but stores more data at a greater density. In
some cases, both sides of the DVD can be used to store in-
formation. Furthermore, each side can contain two layers of
information (dual layer).
Thanks to high data density, the transfer speed is considera-
bly higher than for a CD, so that a DVD drive with 6 times
speed can transfer considerably more data than a 6-speed
CD drive.
A DVD drive can also read both DVD-ROMs and CD-ROMs,
providing the user access to an astounding amount of media.
VARIOUS DVD FORMATS

Format Side A Side B Max. capacity
DVD-5 SL - 4.7 GB
DVD-9 DL - 8.5 GB
DVD-10 SL SL 9.4 GB
DVD-14 DL SL 13.2 GB
DVD-18 DL DL 17.0 GB

SL=Single Layer, DL=Dual Layer


O OP PE ER RA AT TI IO ON N

45
DVD-VIDEO
Special characteristics of DVD-Video:
• Up to 8 hours of feature films on a single DVD.
• Up to 8 audio tracks and 32 subtitle tracks.
• Greater picture quality than VHS or SVHS.
• Time-frame navigation and picture stills.
• Selection of different camera angles in some media.
• Parental Control, in which certain scenes or an en-
tire film or rating of films can be made accessible only
to certain age groups. DVD players can, for example,
be set so that scenes or films which have not been
approved for younger audiences will not play.
In spite of the high storage capability of the DVD the data
must be extremely compressed in order for a complete fea-
ture film to be stored.
REGIONAL PLAYBACK INFORMATION FOR DVD
The playback of DVD movies includes the decoding of MPEG2
videos, digital AC3 audio data and the deciphering of CSS
protected contents.
CSS (sometimes called copy guard) is the name of a data pro-
tection program incorporated by the movie industry as an ac-
tion against illegal copies.
Among the numerous regulations for CSS licensees the most
important ones are the country specific playback restrictions.
In order to facilitate the geographically restricted release of
movies, DVD titles are released for certain regions.
Copyright laws require the restriction of each DVD movie to a
certain region (usually the region, in which it is sold).
DVD movie versions can be published in several regions but
the CSS regulations require that each CSS decipherable sys-
tem may only be used in one region.
O OP PE ER RA AT TI IO ON N

46
ÂAttention: The decoding software included with
your PC may be changed for regional DVD de-
coding up to five times, after which the drive will
only play DVD movies for the region setting last
entered. Changing the region code after that will
require factory resetting which is not covered by
warranty. If resetting is desired, shipping and
resetting costs will be billed to the user.
SUBJECTS CONCERNING THE CD/DVD-
REWRITER
You receive information on the so-called blank discs.
These media, requiring a CD rewriter (burner) to produce CDs
are called CD recordable (CD-R) or CD rewritable (CD-RW).
RECORDABLE/REWRITEABLE DISCS
Normal Discs are pressed from a digital, glass master and
then sealed. In the case of blank disc, the information is
burnt onto the disc with the laser of the Rewriter. Therefore
these discs are more sensitive than normal CDs.
Please avoid the following when using recordable/rewriteable
discs - especially blanks - that have never before been used:
- radiation by direct sunlight (UVA/UVB)
- scratches and damage to the disk surface
- extreme temperatures

O OP PE ER RA AT TI IO ON N

47
THE CARD READER












(Diagram the same)





If your PC is provided with a Card Reader (Diagram refer-
ence: C), you can handle different memory card types.
The following table refers to the use of the Card Reader:
Slot Card type Contacts
Top, left
SD (Secure Digital)
MMC (MultiMediaCard)
point to bottom
Top, right Memory Stick point to bottom
Bottom, left
CF (Compact Flash)
IBM
®
Microdrive
point to front
Bottom, right SmartMedia point to top

If a card is inserted, a free drive will be assigned by Win-
dows
®
and the LED next to the slot is lit.
SD / MMC Memory Stick
Compact Flash /IBM
®
Microdrive SmartMedia
O OP PE ER RA AT TI IO ON N

48
THE GRAPHICS CARD
Your computer is fitted with an A.G.P. high performance
graphics card, one of the most technologically advanced and
best-equipped VGA cards available.
PERFORMANCE CHARACTERISTICS
¾A.G.P. (Accelerated Graphic Port)
¾High Performance Acceleration
¾Interactive Direct3D Acceleration
¾Video Acceleration for DirectDraw/DirectVideo, MPEG-1,
MPEG-2, DVD and Indeo
®
Video Technology
¾ACPI Power Management

CURRENT IMAGE PLAYBACK FREQUENCIES
The graphic card can, depending on the set resolution, display
vertical image playback frequencies of between 60 Hz and 240 Hz.
Resolution Colors Resolution Colors
640 x 480 8-, 16-, 32-bit 1600 x 900 8-, 16-, 32-bit
800 x 600 8-, 16-, 32-bit 1600 x 1200 8-, 16-, 32-bit
1024 x 768 8-, 16-, 32-bit 1920 x 1080 8-, 16-, 32-bit
1152 x 864 8-, 16-, 32-bit 1920 x 1200 8-, 16-, 32-bit
1280 x 960 8-, 16-, 32-bit 1920 x 1440 8-, 16-, 32-bit
1280 x 1024 8-, 16-, 32-bit 2048 x 1536 8-, 16-, 32-bit
You can change the graphics setting using the Display
Properties help program. For optimum image reproduction
we recommend an image playback frequency of between 75
Hz and 85 Hz, provided that your monitor can support this.
An image playback frequency of less than 70 Hz will generate
a flickering image, unless an LCD monitor is being used.

O OP PE ER RA AT TI IO ON N

49
CONNECTING THE PC TO A TELEVISION
ÂThe graphics card shown here is symbolic.
Your graphics card possibly has more or less
jacks. For detailed information refer to the
online help "Information about your PC¨.
If your graphics card has a TV output, you can transfer the
image from your PC to the television set.


(Diagram the same)
n
VGA connectors
(second connector is optional!)
o S-Video Output
p
Composite Video Output (Cinch)
q
Digital DVI-outlet (optional)
ÂIn order to connect your TV to the PC you will
need an S-Video cable or a composite video cable.
This cable is not included with your computer but
may be obtained from an audio/video specialist or
dealer. Read the operating instructions for your
television set to find out which cable you need.
o p q n
O OP PE ER RA AT TI IO ON N

50
HOW TO CONNECT THE PC TO A TELEVISION:
ÂTo use the TV function you must first con-
nect the TV to the graphics card before
starting up the PC.

1. Shut down Windows

and power off the PC.
2. If your TV set has a composite video port, connect the
composite video input on your set with the composite
video output on the PC (reference V/V2). If your TV
set has an S-video port, connect the S-video input on
your set with the S-video output on the PC.
Switch on the television to see the PC image on your TV set.
1. Start up the PC and wait for Windows to fully load.
2. In the Display Properties program set up the con-
figuration.
3. End configuration by clicking on OK.
SYSTEM REQUIREMENTS
If you wish to use the graphics card in another PC, that PC
must meet the following requirements. Also, updated drivers
for your video card can be downloaded from the Web at
www.medion.com.

Processor
From Pentium
®
II/III Processor or equivalent
Slot AGP - slot
Monitor VGA, supporting at least 640 x 480 resolution
CD-ROM Min. 2-speed (for driver installation)
Operating system starting from Microsoft Windows
®
98SE / ME /
2000 / XP
O OP PE ER RA AT TI IO ON N

51
THE SOUND CARD
Your PC has an integrated stereo sound card.
The sound card is compatible with the industry standard
Sound Blaster and Microsoft Sound System Version 2.0.
This guarantees optimal support for all popular programs and
games.
ÂNote: The speaker/headphones output is designed for
active speaker systems or headphones. Passive speak-
ers cannot be used or if they are the quality will be
significantly reduced.
If your PC is equipped with a surround sound you can set it
with the enclosed software as required.

O OP PE ER RA AT TI IO ON N

52
THE MIDI/GAME PORT
The MIDI-/Game port-Interface is an optional feature. Here
you can connect control equipment like a joystick, game pad
or steering wheel. In general these controllers are used in
games or simulations to gain realistic and easy control of the
program. Steering Wheels can add a realistic feeling to racing
games.
MIDI is a standard that enables exchange of data between key-
boards and similar equipment for musicians. Data is sent to the
respective equipment via DIN cable. The common environment
of a MIDI-implication is:
• Keyboard plays passages or single notes in a sequencer
program.
• The sequence is edited in the PC and stored as a MIDI-
File.
• The PC controls the MIDI-equipment (sound creation of
keyboard, Sampler, etc.).
To be able to work with MIDI you will need an adapter cable
that is connected to the MIDI/Game port.
This adapter can be purchased in music speciality shops.
USB PORT
• Devices connected directly to the USB bus should not
draw more than 500 mA. The voltage output is protected
by a fuse (Limited Power Source according to EN 60950).
Should the devices need more power than this, it will
be necessary to provide a hub (distributor / booster).

On the USB it is possible to connect up to 127 devices which
correspond to the USB standard (1.1 and 2.0 supported).
The data transfer speed is 1.5 Mbit or 12 Mbit, depending on
the device connected. USB 2.0 can reach up to 480 Mbit.
O OP PE ER RA AT TI IO ON N

53
IEEE 1394 (FIRE WIRE)
The IEEE 1394 connector, also known as iLink
®
or Fire Wire,
is a serial bus standard used for rapid digital data exchange.
APPLICATION OPTIONS FOR IEEE1394
• Connection of digital devices of the entertainment
industry, such as set-top speakers, digital video
and camcorder, 'Digital Versatile Disk´ (DVD),
television etc.
• Multimedia applications and video processing.
• Input and output devices such as printers, scan-
ners, etc.
TECHNICAL SPECIFICATIONS
• Depending on the application, the maximum data
transfer is about 100, 200 or 400 Mbit/s, corre-
sponding to a data throughput of up to 50 MB per
second.
• The device can be plugged in or unplugged during
operation (hot plugging).
• The standardised cord ('Shielded Twisted Pair´ -
STP) includes 6 strands. Two lines are live (8V up
to 40V, 1.5 A max.) and can be used as an exter-
nal power supply. The four signal lines transfer
data or control information. Some devices do not
require a power supply via the cord so that four
pole plugs are used.
• The voltage output of the 6-pole IEEE 1394 jack is
protected by a fuse (limited power source accord-
ing to EN60950).
O OP PE ER RA AT TI IO ON N

54
THE RADIO-/TV- TUNER CARD
The Radio-/TV- Tuner Card is an optional feature. Possibly
your PC is equipped with a so-called Combo board. You recog-
nise this at the modem or ISDN jack on the outside in addition
to the TV/Radio antenna sockets. Then both devices are lo-
cated on one Combo board requiring a special Combo slot.
In regard to a Combo board the following must be observed:
• The installation, removal and conversion of a board
require the necessary technical training. Please
read the chapter "Safety precautions", starting
on p. 1 or consult a PC technician.
• If you would like to use a different modem or
ISDN board, the built-in modem/TV Tuner Combo
board must not be removed or plugged into a
different slot.
• The built-in modem/TV Tuner Combo board only
works properly in the intended blue Combo slot.
ÂATTENTION: In another slot the PC may not
be able to start.

SOFTWARE FOR YOUR RADIO/TV TUNER CARD
The Software to watch TV and listen to Radio broadcasts is
already installed and can be found in All Programs, Medion
Home Cinema XL. You can control the program with the
optional remote controller (see Online help and/or separate
Operating Instructions). Get additional help by pressing the
F1 Key. Please keep in mind that recording broadcasts can
occupy up to 2.4 GB per hour.
O OP PE ER RA AT TI IO ON N

55
THE NETWORK
If your PC is provided with a Fast Ethernet-Network connec-
tor, you can connect it to a network. The following explana-
tion refers to PCs with a network connector. You will find fur-
ther information about networking in the Help section within
the Start menu.

WHAT IS A NETWORK?
A network means connecting your PC to another or several
other PCs. Users can transfer information and data between
computers and share resources such as printers, modems
and hard disk drives.
Here are some practical examples:
• You can exchange Email and manage appointments in an
office.
• Users share a printer in a network and save their data on
a central server.
• Share one modem or one ISDN card among computers
for Internet access.
• Two or more PCs can be connected to play network
games or share data.
O OP PE ER RA AT TI IO ON N

56
WHAT DO YOU NEED FOR NETWORKING?
Some requirements have to be fulfilled if you want to make
PCs communicate with one another.
1. The PCs must have the same network cards that support
the same network technology. Unless otherwise stated
your PC will support the current standard, Fast Ethernet
(10/100 Mbit).
2. The network cards must be connected to one another. All
you need is a Shielded Twisted Pair cable (CAT5) which
has an RJ-45 connector.
- If you want to connect two PCs you need a Cross-
Link cable.
- If more PCs must be connected you need a supple-
mentary distributor (Hub or Switch) and a Patch
cable.
3. All connected PCs need a networking operating system.
That´s the case with Windows
®
.
4. All network PCs must speak the same "language¨ to un-
derstand one another. For this purpose they use proto-
cols.
- The network protocol is determined by the integra-
tion of the client server. Loading all PCs with the
same client, for example "Client for Microsoft
®
Networks¨, meets the first prerequisite. Your PC, if
equipped with a network connection, has been pre-
configured with this server in the factory.
- A transport protocol is required so data can be trans-
ported via the network. Your network PC has TCP/IP
preconfigured. It is the most common protocol and
mandatory for internet access. You need IPX/SPX
usually only, if access is required to Novell
®
networks.



O OP PE ER RA AT TI IO ON N

57
5. The setting of protocols, therefore, must be correct. In
your network computer, TCP/IP is preconfigured so that
the required settings are automatically taken from a so-
called DHCP server.
Since usually only large networks are equipped with it,
Windows
®
ME and Windows
®
XP offer a mechanism
automating this function and accepting this setting
automatically.
You can call these settings in the input request with
ipconfig /all.
6. The correct protocols must be enabled to make shared
access possible. This requires the installation of the
server "File and printer release for Microsoft
®
net-
works¨. It is also factory installed.
The release is awarded on the PC where the resource
(folders or printers) are located.
Here the release name or, if necessary, a required pass-
word can be determined.
A successful release is indicated by a
stretched out hand below the icon:

7. The released resources can be shown and linked via the
network environment.
O OP PE ER RA AT TI IO ON N

58
WIRELESS LAN
Wireless LAN is an optional feature. This function allows you
to create a wireless network link with a partner.
SAFETY NOTES
ÂATTANTION: Don´t use this feature in environments
where highly sensitive devices are placed such as in hosp i-
tals etc.. To avoid any interference disable this option in
your device manager.
CONDITIONS
The partner used can be a wireless access point. An access point is
a wireless transmitter that communicates with your notebook and con-
trols access to the network connection (e.g., a home network or a
broadband connection such as DSL).
Wireless access points are often found in offices, airports, universi-
ties or Internet cafés. They offer access to enterprise services and
networks or to the Internet. Access authorizations are normally
needed. A fee may be required to use a public access point.
To set up a wireless network to share Internet access, files, and print-
ers at home, you will need an access point, a router, and a broadband
(DSL or cable) modem. Some access points can also serve as a router
and/or a broadband modem. Check with your retailer to find the best
solution for your needs.
A link to another computer with wireless LAN functionality can also
be created without an access point. This will allow you to share
files, but you will need an access point and a router to share an
Internet connection.
The wireless network link works according to standard IEEE
802.11g and is compatible to the standard IEEE 802.11b. Other
standards (802.11a etc.) are not supported.
If encrypted transmission is used, this must operate according to
the same principle on all devices. Encryption is a method of pro-
tecting the network from unauthorized access.
The transmission speed (max. 54 Mbps) can vary according to distance
and other factors. If i.e. the other devices support the 802.11b standard
the transmission speed can be max. 11 Mbps.
Search for "wireless networking¨ in Windows Help and Support for
more information.
O OP PE ER RA AT TI IO ON N

59
TROUBLESHOOTING WITHIN THE NETWORK

Why does the network environment not show the re-
leases?

The network environment is delayed in time. Check
the release by searching for the respective com-
puter name.

Why does an error message appear when I click on the
network environment?

The computer name must be unique on the net-
work and may not be the same as the task group.

It appears that the network boards are unable to com-
municate. What might be the problem?

Maybe one of the used network boards works with a
different speed (e. g. 10 instead 100 Mbit) and
your network computer is unable to recognize this.
If necessary, set the network driver to the compati-
ble speed.
If two PCs should be linked you require a cross-
link cable, otherwise use a patch cable.
In addition, check the protocols and the configu-
ration.

The data transmission is incorrect or very slow. What
might be the problem?

Maybe you have the wrong cable (UTP / CAT3 or
lower) or the problem is the proximity of a power
cord or another source of interference.
For further hints on troubleshooting refer to the Windows
help under "Network errors¨.
O OP PE ER RA AT TI IO ON N

60
MODEM / ISDN
This chapter is intended for systems equipped with a modem
or ISDN jack.
WHAT IS A MODEM?
The term "modem¨ is an abbreviation of Modulator/ DEModula-
tor. A modem changes the bit stream of the PC into analogue
signals which then can also be transmitted via the telephone
line (modulation). The modem on the other side reverses the
conversion (demodulation). Simplified, a modem converts out-
going data into tone and tone incoming via the telephone line
back into data.
The built-in modem is able to receive data according to the ITU
standard for V.90 transmissions with up 56 Kbit/s.
Since the power output of modems is restricted due to the
regulations of some telecommunication providers, the possible
maximum download speed can be restricted. The actual speed
may be dependent on the online conditions and other factors.
Data sent from the user to the server are transmitted with 31.2
Kbit/s. Prerequisite for this high speed reception is an analogue
telephone line compatible with the V.90 standard and a corre-
sponding compatible Internet provider or company-owned host
computer.
Contrary to the modem, ISDN data are transmitted digitally.

The modem is fitted with an RJ-11 interface, into which a
standard telephone lead can be plugged. If your modem is a
combo card please make sure that it is used only with the
appropriate port.
ÂWARNING! Use only analogue telephone
sockets. The modem cannot withstand the
voltage levels of digital telephone systems
such PABX or lines such as ISDN or Broadband
services
O OP PE ER RA AT TI IO ON N

61
SERIAL COM-PORT
The optional 9-pin serial interface is used as the port for serial
devices such as modems, card readers or mice. The interfaces are
addressed as COM1 or COM2 and are FIFO 16550-compatible. To
use these ports it is necessary, as standard, to have a so-called
null-modem cable which is usually supplied with the device to be
connected.
SOFTWARE
This section deals with software, differentiating between
BIOS, application programs and operating systems.
GETTING TO KNOW WINDOWS XP

Windows XP offers different options to understand its opera-
tion. We will mention only a few of those options here:
WINDOWS XP

HOME EDITION - FIRST STEP
This manual will provide general information about the operat-
ing system. We recommend that all beginning users or users
of previous versions of Windows read this information.
WINDOWS
XP
HELP AND SUPPORT
An answer to almost every question can be found in this pro-
gram. You´ll find it in the Start menu or you can launch it by
simply pressing the F1 key.
MICROSOFT INTERACTIVE TRAINING - STEP BY STEP
Training is the best way to get skills which helps you to per-
form a specific task save and effectively.
You´ll find it in "All Programs¨, "Accessories¨. It is also
linked up in "Information about your PC¨.
This is a very good feature.
O OP PE ER RA AT TI IO ON N

62
WRITING CDS/DVDS
We describe the writing process with the software Nero -
Burning ROM. Please follow this instruction only if you use
this software.
ÂNote: A writing process should always take
place on its own. Please terminate all running
programs (fax reception, screen savers,
Power-Management etc.).
STARTING NERO - EXPRESS
To start nero - Express proceed as follows:

1. Click
2. Now select
3. The program is located in the "ahead Nero" folder
and can be started by clicking "Nero - EXPRESS".
4. An interface appears that allows you to easily create dif-
ferent media. Follow the instructions on the screen.
ÂNote: The nero - BURNING ROM program has
enhanced functions and is particularly suitable
for the more experienced user. You can also
start this program from the ahead Nero folder
or switch directly to it from the Express pro-
gram.
ÂFor detailed information, read the extensive
On-line Help (F1 key).

O OP PE ER RA AT TI IO ON N

63
INSTALLATION OF SOFTWARE

It happens that during installation procedure
important files can be changed or even can-
celled. To avoid eventual problems in using
older files after installation, make sure to
safeguard your hard disk.
The software included in delivery is already pre-installed in
the factory.

Note: If your operating system is configured that the
installation procedure accepts only signed drivers
(default) and software this information screen will
appear:

Although the software lacks the digital signature it
may work properly. Click on "Tell me why this testing
is important¨ to get detailed information.
Confirm by clicking on "Continue Anyway¨.
O OP PE ER RA AT TI IO ON N

64
THIS IS HOW TO INSTALL YOUR SOFTWARE:
Please follow the instruction of the software vendor. We will
describe a typical installation. Once you insert a CD, the in-
stallation menu is started automatically.
ÂNote: If the automatic start does not work, it
is likely that the so-called Autorun function
has been deactivated. Read the respective
chapter in Windows Help on how to activate
this function.
An example for the manual installation without the autorun
function:
1. Click on and select the item
(Or hit á + R to launch the corresponding dialog).
2. Now enter the letter of the CD-ROM drive followed by
a colon and the program name setup:

3. Click on ¨OK¨.
4. Follow the instruction given by the program.
O OP PE ER RA AT TI IO ON N

65
SOFTWARE DEINSTALLATION
In order to remove installed software from your PC, follow
the next steps:
1. Click on
2. Click on
3. Then select the following program:

Select the respective program, start the deinstallation and
follow the instructions on the screen.
If the system becomes unstable due to a certain software or
driver, you are able to recover the stability of the system
with various methods (see starting on page 72).
Then you do not need to uninstall the driver.
O OP PE ER RA AT TI IO ON N

66
WINDOWS ACTIVATION
Microsoft is committed to the protection of intellectual prop-
erty rights and the reduction of software piracy. Therefore
Windows XP contains software-based product activation
technology. Your copy of Windows XP has already been acti-
vated for your PC.
Product activation is needed if some components of your PC
have been replaced or you use a non-authorized BIOS. If
necessary you can activate Windows XP as often as re-
quested.
You will probably need to activate Windows XP by telephone
even if Internet Activation is available. This is due to the pre-
activated SLP version which runs with a special Product-ID.
However, activation needs your unique Product ID which can
be found on the Certificate of Authenticity sticker on your
PC housing. When you call, please inform your agent that
you are running an OEM-(SLP) version of the software.
PRODUCT ACTIVATION ON YOUR PC
In few cases it may still be required to activate Windows
XP. If an activation via the internet is acknowledged with an
error message you should perform the following steps.
1. Please select the telephone activation and click until
the related screen appears.
2. Now click on Change Product Key. A new window ap-
pears. Enter the product key. This is located on the Cer-
tificate of Authenticity (COA), on the computer´s cas-
ing.
3. Acknowledge your entry and follow the instructions on
the screen. Notify your Microsoft consultant, if neces-
sary, that you have an OEM license.
O OP PE ER RA AT TI IO ON N

67
BIOS SETUP
THE BIOS SETUP PROGRAM
In the BIOS set up (your PC´s Basic Configuration) you have
a number of parameter settings available for your PC. For
example, you can change the operating mode of the inter-
faces, security features or power management.

The PC is factory pre-set to guarantee optimum
operation. Please only modify the parameters if
this is absolutely essential and if you are familiar
with the configuration possibilities.
EXECUTION OF THE BIOS SETUP
You can only execute the configuration program when start-
ing the system. If the PC has already been started exit Win-
dows
®
and reboot. Prior to rebooting the PC press the key
»Del« and keep it pressed until the message »Entering
Setup« appears.
O OP PE ER RA AT TI IO ON N

68
C
C
h
h
a
a
p
p
t
t
e
e
r
r
4
4

Customer Service & Self-Help
Subject
Page


Data and System Security .......... 71
System Recovery ............... 72
FAQ - Frequently Asked Questions ..... 75
Troubleshooting ................ 77
Driver Support ................. 79
Cleaning and Care ............... 80
Recycling and Disposal ............ 80
Transport .................... 83
Upgrades and Repairs ............ 83


C CU US ST TO OM ME ER R S SE ER RV VI IC CE E & & S SE EL LF F- -H HE EL LP P

70

S SE EL LF F- -H HE EL LP P

71
S
SE EL LF F
-
-
H
HE EL LP P

DATA AND SYSTEM SECURITY
The programs described below are part of your Windows op-
erating system. You will additional information on these pro-
grams in the Windows Help file.
DATA SECURITY
Back up data regularly on external media such as a CD-R or
CD-RW. Windows offers both a Backup program and a Files
and Settings Transfer Wizard.
You will find both programs in Accessories/System Tools
within the Start menu. Make a backup disk with all your
passwords and the operating system´s original configuration.
MAINTENANCE PROGRAMS
You can avoid some hardware and software errors with the
help programs such as Disk Defragmenter and Disk
Cleanup. The help program System Information can also
be helpful since it gives you detailed information about your
system configuration. You will find these programs in Acces-
sories/System Tools too.
PASSWORD RESET FILE
To protect individual user accounts from complications result-
ing from lost passwords, users should create a password re-
set disk and keep it in a safe place. If the user should forget
his/her password, the password can be reset with the password
reset disk so that the user has access again to his/her local user
account.
Windows Help describes how to create a password reset file.
C CU US ST TO OM ME ER R S SE ER RV VI IC CE E & & S SE EL LF F- -H HE EL LP P

72
SYSTEM RECOVERY
Windows
xp
provides a useful function enabling the storage of
the so-called Recovery points.
The system remembers the current configuration as a snap-
shot and returns to this, if necessary. The advantage is that
an unsuccessful installation can be cancelled.
Recovery points are created automatically by the system,
but they can also be set manually.
You can determine and configure yourself the maximum
memory taken up by this. You find this program in the pro-
gram file under accessories, system programs.
We recommend setting a recovery point before installing a
new software or driver. If the system does not run stable any
longer this enables you usually to return to a workable con-
figuration without deleting newly created documents. In the
next paragraph read your options for a repair of an incorrect
installation.
CORRECTION
Windows
xp
includes various functions ensuring that the PC as
well as the installed applications and devices work correctly.
These functions assist you in solving the problems which
might occur by adding, deleting or replacing files required for
the functionality of the operating system, the applications
and devices. The recovery function or functions you use de-
pend on the type of occurring problem or error. For detailed
information refer to the Windows help.
Enter the search word "Overview over the repair¨ in order
to evaluate which of the following functions is the safest way
to correct your problem:
Backup, Recovery of the driver, Deactivation of the device,
System recovery, Last function known to work, Secured
mode and system recovery, Recovery console, Windows in-
stallation CD.
Please refer to the tool.
S SE EL LF F- -H HE EL LP P

73
WINDOWS
®
UPDATE
To keep your notebook up to date to the latest version, we
recommend to regularly run Windows Update from the Inter-
net. To select this option go to Start Ö Programs Ö Win-
dows Update.
ÂThe update can only be executed via the Inter-
net. Ensure that you are on-line with your
notebook when downloading the updates.

RESTORING THE FACTORY SETTINGS

Should your system not function correctly, you have the op-
portunity to recover the original set-up.
Use the included application/support disk to do this. This re-
covery method offers you several possibilities for system re-
covery:
System recovery from hard disk
1. Rebuild start files
2. Rebuild system and driver files
3. Return to shipping status
C CU US ST TO OM ME ER R S SE ER RV VI IC CE E & & S SE EL LF F- -H HE EL LP P

74
LIMITS OF THE RECOVERY
• Changes made to the original configuration (RAS, Desk-
top or Internet settings) and installed Software will be ig-
nored by this Recovery and will not be reloaded.
• Driver Updates or hardware installed by you will be ig-
nored by this Recovery.
• Beware! All data on drive C will be erased. If necessary,
backup all required data on drive D.
This recovery will reset your system to its condition at deliv-
ery. Printer installations or other additional software must be
reinstalled. You will also need to enter the Product Key (Li-
cense Number) again.
ÂAttention! If you delete the directory
E:\Recover or the files located there a recov-
ery is no longer possible. For safety reasons
you can copy the file FACTORY.PQI and all
other FACTORY.00X files to a CD-Recordable.
CARRYING OUT A RESTORE
1. First, please read the entire Restore section of the Win-
dows Help file.
2. Insert the Support-CD and reboot the PC.
ÂAttention! Do not use the Product Recovery
CD-ROM for restoration purposes. This disk
does not restore the original set-up. You can
use it when an individual set up is required.
3. Select the option Start from CD-ROM.
4. Follow the on-screen instructions
5. The PC restarts to its original factory settings.
S SE EL LF F- -H HE EL LP P

75
FAQ - FREQUENTLY ASKED QUESTIONS

When do I have to activate Windows?

Your software has been preactivated in the factory.
An activation will only be required, if ...
... several components are replaced by others.
... you install a new motherboard.
... a different BIOS version has been installed.
... you install the software to another computer.


What is the Windows activation?

Your operating instructions include a chapter about
this subject.


How do I perform a data backup?

Use the program Backup for this.
It is important that you follow the operating instruc-
tions of this program.
Make a backup and another backup of selected data
to an external medium (CD-R), to familiarise your-
self with the technique.
A backup is unsuitable if you are not able to recover
the data, the medium (CD-R, CD-RW) is defective or
no longer available.
C CU US ST TO OM ME ER R S SE ER RV VI IC CE E & & S SE EL LF F- -H HE EL LP P

76


Do I still have to install the enclosed CDs/DVDs?

No. Basically all programs are already preinstalled.
The disks are only intended as backup copies.


When is the recovery of the factory setting recom-
mended?

This method should be chosen as the last resort.
Read chapter "System recovery¨ on page 72 con-
cerning the alternatives possible.


Why is the boot partition missing when booting from
the support/ application CD?

The first partition is formatted with the file system
NTFS. Compared to FAT32 this file system offers
more security and a more efficient access. However,
NTFS partitions can only be read from operating sys-
tems supporting this. This is not the case in the
aforementioned CD.
C CU US ST TO OM ME ER R S SE ER RV VI IC CE E

77
C
CU US ST TO OM ME ER R S
SE ER RV VI IC CE E

TROUBLESHOOTING
LOCALISE THE CAUSE
Errors can have simple causes, but sometimes they are
caused by faulty equipment. We would like to give you some
ideas to solve common problems. Should these instructions
not lead to success, please feel free to call us.
Check Cables and Connections
Visibly check all cables and connections. Should all lights be
off, check whether all equipment is supplied with power.
• Check power points, power cable and all power switches.
• Switch off the PC and check all cable connections. Check
the connections to peripherals. Do not exchange cables,
even though they may look similar. The polarity in those
cables may be different. When it is confirmed that the
computer has power and all connections are correct, turn
the computer on again.
Frequent use of the programs Disk Defragmenter and Disk
Cleanup will help you to avoid problems with your operating
system.
C CU US ST TO OM ME ER R S SE ER RV VI IC CE E & & S SE EL LF F- -H HE EL LP P

78
ERRORS AND POSSIBLE CAUSES
The monitor is blank:
- Confirm that the system is not in stand-by mode. Press
any key on the keyboard to test this out.
- Check that the cable is fully connected.

Wrong Date and Time:
- Double-click the clock on the taskbar and correct the date
and time.
- Check that Regional Settings are set to English (Brit-
ish/United Kingdom)

No data can be accessed from the CD-ROM Drive:
- Check whether the CD is inserted correctly.
- Is the CD-ROM (Drive E) displayed in Windows Explorer?
If so, test another CD.

The Printer does not work:
- Check the printer cable.
- Do a Printer Self Test.
- Should several pieces of equipment be operating from the
same port, check all peripherals and reinstall the drivers.
- If you have access to the Internet, download and install
the latest drivers from the manufacturer´s Web site.

C CU US ST TO OM ME ER R S SE ER RV VI IC CE E

79
DRIVER SUPPORT
This PC has been extensively tested in our laboratories with a
large number of compatible devices. It fulfils all required stan-
dards and complies with the standard "Designed for Windows¨,
which certifies utmost compatibility.
However, often the software drivers for individual components
are updated from time to time. This is a regular process pro-
vided by the manufactured to mend possible compatibility prob-
lems that may occur with components (e.g., programs or hard-
ware) that were not tested at the time of your PC´s manufac-
ture. Driver updates and the latest information on your product
are available on the Internet.

Visit Medion on the Web at
www.medion.com

ADDITIONAL SUPPORT
If the suggestions in the above section have not solved your
problem, please contact the service hotline and we will attempt
to help you solve the problem. Before you contact the Technol-
ogy Centre, however, please have the following information
available:
- How is your computer configured?
- What additional peripherals do you use?
- What messages, if any, appear on your screen?
- What software were you using when the error occurred?
- What steps have you already undertaken to solve the
problem?
- Have you upgraded or removed drivers or hardware?
- Can you manually repeat the problem?
- If you have been given a customer number previously,
please quote this.
C CU US ST TO OM ME ER R S SE ER RV VI IC CE E & & S SE EL LF F- -H HE EL LP P

80
CLEANING AND CARE
The lifetime of the PC can be extended by taking the follow-
ing measures:

• Before cleaning, always remove the power plug and
all connecting cables.
• Clean the PC with a damp, lint-free cloth.






• Warning! There are no user-serviceable or
user-cleanable parts inside the PC housing.
• DO NOT use any solvents, corrosive or
gaseous cleaning agents.
• DO NOT use CD-ROM cleaning disks or
similar products that clean the lens of the
laser to clean your CD-ROM/CDR-W/DVD-
drive.
RECYCLING AND DISPOSAL
This PC and its packaging was produced mostly from materi-
als which can be disposed of in an environmentally friendly
manner and be professionally recycled.
After its use the computer will be taken back and recycled or
use will be made of its useful material, if it is returned in a
condition corresponding to its intended use.
Parts not usable will be properly disposed of.
ÂATTENTION! There is a lithium battery (Type:
Sony¯, CR 2032) on the motherboard. No
type of battery belongs in the household
waste. All are taken back free of charge by the
manufacturer, dealer or their representatives
for a proper method of utilisation or disposal.
Should you have any questions concerning the disposal
please contact your dealer or our service.
C CU US ST TO OM ME ER R S SE ER RV VI IC CE E

81
BATTERY TREATMENT
Batteries may contain combustible materials. By misuse, this
may cause battery leakage, heat, explosion or ignition,
bringing about injury or damage to the device.

Please observe strictly the following matters:
- KEEP CHILDREN AWAY from batteries.
If by any chance, the batteries are swallowed, consult a
doctor immediately.
- DO NOT CHARGE batteries (except rechargeable batter-
ies).
- DO NOT FORCIBLY DISCHARGE batteries.
- DO NOT SHORT-CIRCUIT batteries.
- DO NOT HEAT or DISPOSE OF IN FIRE.
- DO NOT DISASSEMBLE or DEFORM batteries.
Your hands and fingers may be injured, or the liquid of
the battery may get into your eyes or adhere to your
skin. If this happens, rinse with a large quantity of water
immediately and consult a doctor.
- DO NOT expose batteries to strong impact by dropping
or throwing the batteries.
- DO NOT reverse the positive (+) and negative (-) ter-
minals to avoid short-circuit.
- Do NOT MIX used and new or different types of batter-
ies together.
Your equipment may not operate properly. In addition,
the battery exhausted first may be excessively drained
(over-discharged).
- REMOVE PROMPTLY the used batteries from the de-
vice.
- REPLACE ALL BATTERIES with new batteries of the
same type at the same time.
C CU US ST TO OM ME ER R S SE ER RV VI IC CE E & & S SE EL LF F- -H HE EL LP P

82
- INSULATE THE TERMINAL parts with tape or the like
at the storage or disposal of the batteries.
- DO NOT throw rundown batteries in the domestic re-
fuses! Respect the environment and throw them in the
specific containers for separate collection. If necessary,
turn to your reseller or to our service assistance. Thank
you!

C CU US ST TO OM ME ER R S SE ER RV VI IC CE E

83
TRANSPORTING THE PC
Please observe the following guidelines when transporting
the PC:
• To avoid damage during transport, store the PC in its
original packaging.
• Wait until the PC has reached ambient (room) temperature
before connecting it to the power supply. Drastic variations
in temperature and humidity can create condensation
within the PC and may cause it to short-circuit.
UPGRADES AND REPAIRS
• Only a qualified engineer should perform upgrades and
repairs to your PC.
• If you do not have the necessary qualifications, go to an
appropriate Service Engineer. Please contact our Ser-
vice Centre if you are experiencing technical problems
with your PC.
NOTES FOR SERVICE ENGINEERS
• Before opening the housing, disconnect the PC from
all power sources and remove any connecting ca-
bles. If the PC has not been disconnected from the
power outlet before being opened, there is a danger to
life through electric shock. There is also a risk of dam-
age to the components.
• Internal components of the PC may be damaged by
electrostatic discharge (ESD). Carry out system up-
grades and changes in an ESD-protected workshop.
If no such workshop is available, wear an antistatic
wrist strap or touch a highly conductive metal object.
Medion can repair damage sustained by inappropriate
handling for a fee.
• Use only original spare parts.

C CU US ST TO OM ME ER R S SE ER RV VI IC CE E & & S SE EL LF F- -H HE EL LP P

84

ÂCaution: Lithium batteries can not handle in-
tense pressure, high temperatures or fire.
Danger of explosion if replaced incorrectly.
Replace batteries with a compatible type as
recommended by the manufacturer.
Lithium batteries are hazardous waste and re-
quire proper disposal. Contact the Service
Centre for additional information on battery
disposal.
Notes on Laser Radiation:
Laser devices of Laser Class 1 to Laser Class 3b may be used
in the PC. Where the PC housing remains closed, the device
meets the requirements of Laser Class 1. By opening the PC
housing you will gain access to laser devices of up to Laser
Class 3b.
The CD-ROM-/CDRW-/DVD-drives installed contain no user-
serviceable parts.
When removing and/or opening laser devices, the following
guidelines must be observed:
• Only the manufacturer should perform repairs to the
CD-ROM-/CDRW-/DVD-drives.
• DO NOT look into the laser beam, even while wearing
optical protection.
• DO NOT allow yourself to be exposed to the laser
beam. Avoid exposure of the eyes or skin to direct or
stray radiation.
C CU US ST TO OM ME ER R S SE ER RV VI IC CE E

85
C
C
h
h
a
a
p
p
t
t
e
e
r
r
5
5

Appendix
Subject
Page


Electromagnetic Compatibility ........ 87
Electrical Safety ................ 88
FCC Compliance Statement ......... 90
Warranty .................... 91




A AP PP PE EN ND DI IX X

86

C CU US ST TO OM ME ER R S SE ER RV VI IC CE E

87
STANDARDS
This PC meets the requirements of the following standards:
ELECTROMAGNETIC COMPATIBILITY
This PC meets the following requirements for standards of elec-
tromagnetic compatibility and electrical safety:
EN 55022
Information technology equipment - Radio distur-
bance characteristics - Limits and methods of meas-
urement.
EN 55024
Information technology equipment - Immunity char-
acteristics - Limits and methods of measurement.
EN 61000-3-2
Limits - Limits for harmonic current emissions
(equipment input current up to and including 16 A per
phase).
EN 61000-3-3
Limits - Limitation of voltage fluctuations and flicker
in low-voltage supply systems for equipment with a
rated current up to 16 A.
• Keep the PC at least one metre (approximately three feet)
away from high frequency and magnetic interference
sources (e.g., televisions, loudspeaker cabinets, mobile
telephones, etc.) in order to avoid malfunctions and/or
loss of data.
• Please note that only shielded cables shorter than
3 metres (9.84 ft) should be used for the LPT, COM,
USB, IEEE 1394, audio, video and network interfaces
with this PC.
• When connecting additional components, please observe
the Guidelines on Electromagnetic Compatibility (EMC).

A AP PP PE EN ND DI IX X

88
ELECTRICAL SAFETY
EN 60950
Safety of information technology equipment.
• The connection of devices is limited to equipment that com-
plies with EN60950 "Safety of information technology
equipment¨ or EN60065 "Audio, video and similar elec-
tronic apparatus. Safety requirements¨
• For U.S. / Canadian purposes:
The PC should only be connected to equipment which
complies with UL 60950 / CAN CSA 22.2 No 60950
ERGONOMICS
EN 29241-3
Ergonomic requirements for office work with vis-
ual display terminals (VDTs). Visual display r e-
quirements.
EN ISO 9241-8
Ergonomic requirements for office work with vi s-
ual display terminals (VDTs). Requirements for
displayed colours.
NOISE EMISSION
ISO 7779
(ISO 9296)
Acoustics. Measurement of airborne noise emitted by
information technology and telecommunications
equipment.
This PC fulfils the requirements of noise emissions according
to ISO 7779 with following values:
Operating Mode Max. Sound power level L
WAd
(B/A)
(declared according to ISO 9296)
Idling 4.8
Operating 5.2
Max. Sound pressure level L
pAm
(dB/A)
(declared according to ISO 9296)
At bystander position Idling 40
St bystander position Operating 47

C CU US ST TO OM ME ER R S SE ER RV VI IC CE E

89
INFORMATION ABOUT THE REGULATORY COMPLIANCE OF
THE MODEM
This PC, if equipped with a modem, has been tested according and
complies with the European regulatory guidelines for radio equi p-
ment and telecommunication installations (R&TTE 1999/5/EG).
The modem meets the requirements of TBR21 (01/1998) and
EG201120/V1.1.1/01/98 regarding connection with an analog tele-
phone network.
INFORMATION ABOUT THE REGUALTORY COMPLIANCE OF
WIRELESS KEYBOARD / MOUSE AND WIRELESS LAN
The following low power radio equipment, which has separately
been tested and approved according R&TTE guideline (1999/5/EC),
is bundled with this PC:
-Wireless keyboard / mouse / receiver
-Wireless LAN
These radio devices are marked individually with the CE mark. The
declarations of conformity of these radio devices are available under
www.medion.com/conformity.


A AP PP PE EN ND DI IX X

90
FCC COMPLIANCE STATEMENT
This equipment has been tested and found to comply with
the limits for a Class B digital device, pursuant to Part 15 of
FCC Rules. These limits are designed to provide reasonable
protection against harmful interference in a residential instal-
lation. This equipment generates, uses, and can radiate radio
frequency energy and, if not installed and used in accordance
with the instructions, may cause harmful interference to ra-
dio communications. However, there is no guarantee that
interference will not occur in a particular installation. If this
equipment does cause harmful interference to radio or televi-
sion reception, which can be determined by turning the
equipment off and on, the user is encouraged to try to cor-
rect the interference by one or more of the following meas-
ures:

• Reorient or relocate the receiving antenna.
• Increase the separation between the equipment and
receiver.
• Connect the equipment into an outlet on a circuit
different from that to which the receiver is connected.
• Consult the dealer or an experienced technician for
help.

Changes or modifications not expressly approved by the party
responsible for compliance could void the user´s authority to
operate the equipment. Shielded interface cables, if any, must
be used in order to comply with the emission limits.

C CU US ST TO OM ME ER R S SE ER RV VI IC CE E

91
WARRANTY

PLEASE READ THIS LIMITED WARRANTY CAREFULLY TO UNDERSTAND YOUR
RIGHTS AND OBLIGATIONS.

The receipt is considered valid proof of purchase and should be kept in a
safe place. This receipt will be required for receiving any warranty service.
This warranty is transferable. When transferring ownership to a third party,
please provide the receipt and warranty information.

We warrant to the end user that each product, including related software,
accessories, media and supplies, shall be free from defects in mater ials and
workmanship for the warranty time from date of purchase. This warranty
covers only those defects that arise as a result of normal use of the product.
This warranty does not cover any other problems, including pro blems that
arise as a result of improper maintenance or modification; software, acces-
sories, media or supplies not provided or supported by us; or operation
outside the manufacturer´s specifications.

Any parts in this PC repaired or exchanged by a valid service representative
will be covered under the original warranty period. Back up all programs and
data before shipping this PC for repair under the warranty agreement. Do
not leave any media in the disk drives. Products shipped without accessories
will be returned without accessories. Any replacement product or component
may be either new or like new, provided that it´s fun ctionality is at least
equal to that of the product being replaced.

LIMITATION OF WARRANTY
To the extent allowed by local law, no other warranties are made with r e-
spect to this personal computer or the warranty services by any person,
including but not limited to us and our suppliers. The express warranty
stated above is the only express warranty made to you and is provided in
lieu of all other express or implied warranties and con ditions (if any) includ-
ing any created by any other documentation or packaging. For additional
warranty information, please refer to enclosed wa rranty card.

LIMITS OF LIABILITY
To the extent allowed by local law, except for the obligations specifically se t
forth in this warranty statement, in no event shall we or our third party
suppliers are liable for direct, indirect, special, incidental, or consequential
damage, whether based on contract or any other legal theory and whether
advised of the possibility of such damages. This includes loss or damage of
personal data on your PC.

A AP PP PE EN ND DI IX X

92
LOCAL LAW
This warranty statement gives you legal rights. You may also have other
rights which vary from jurisdiction to jurisdiction. To the extent this warranty
statement is inconsistent with local law, certain disclaimers and limitations of
this statement may not apply to the customer.

MAKING COPIES OF THIS MANUAL
This manual contains information protected by law. All rights reserved.
Duplicating this information in mechanical , electronic, or any other form, without
the written approval by the manufacturer, is prohi bited by copyright law.
C CU US ST TO OM ME ER R S SE ER RV VI IC CE E

93
INDEX
A
Ambient Temperature........12
Audience ...........................ii
Autorun...........................64
B
BIOS Setup......................67
C
Card Readerr....................47
Care................................80
CD-blanks........................46
CD-ROM ..........................41
CD-Rom-/DVD-Drive as
bootdrive......................43
CF ..................................47
Cleaning ..........................80
Cleaning agents................80
COM1..............................61
Compact Flash..................47
Connecting ......................13
Recording .....................25
Video inlet ....................25
Connections
Antenna for radio/TV......25
Customer Service .............77
D
Data and System Security..71
Data security....................71
Data Security .................... 4
Directories .......................40
Disc drive ........................41
DVD Technology ...............44
E
Einschalten ......................29
Electrical Safety................88
Electromagnetic
Compatibility.................87
EMC................................87
Ergonomics......................88
Execution of the Bios Setup67
F
FAQ ................................ 75
FCC Compliance Statement 90
Frequently Asked Questions75
Front connectors...............14
G
Game Port .......................52
Gamepad.........................52
Graphics Card ..................48
H
Hard Drive.......................39
Hauptschalter...................29
HD................ See Hard Drive
Hotline ............................79
I
IBM
®
Microdrive ...............47
J
Joystick...........................52
L
Laser Radiation ................84
M
Main Power Switch............29
Maintenance ....................80
Maintenance programs ......71
Memory...........................48
Memory Stick ...................47
MIDI ............................... 52
MMC ............................... 47
MultiMediaCard.................47
N
Nero ............................... 62
Network
A AP PP PE EN ND DI IX X

94
LAN Access Point ...........58
Troubleshooting.............59
What do you need for
networking?...............56
What is a Network?........55
Noise Emission .................88
O
Operational Safety
Connecting ...................13
Optical disc drive ..............41
P
Password reset File ...........71
Q
Quality ..............................ii
R
Radio-/TV- Tuner Card ......54
Remote controller .............54
Restore ...........................74
Restoring Factory Settings .73
S
Safety Instructions............. 1
SD..................................47
Secure Digital...................47
Serial Number ....................ii
Service Engineers ............. 83
SmartMedia ..................... 47
Software Deinstallation......65
Sound Card...................... 51
Standards
Electrical Safety ............ 88
Electromagnetic
Compatibility ............. 87
Ergonomics................... 88
FCC Compliance
Statement .................... 90
Noise Emission.............. 88
System Recovery.............. 72
T
Transporting .................... 83
Troubleshooting.......... 72, 77
U
USB Port ......................... 52
W
Warranty......................... 91
Wheel ............................. 52
Windows
®
Desktop ........... 31
Wireless LAN.................... 58
Writing CDs ..................... 62

DQG6HWWLQJXSDQG *HWWLQJ6WDUWHG SDJH

 :HVWURQJO\UHFRPPHQG\RXUHDGWKLVHQWLUHPDQXDOWRHQ VXUHWKHSURSHUVHWXSDQGRSHUDWLRQRI\RXU3& 0DQ\DSSOLFDWLRQSURJUDPVLQFRUSRUDWHH[WHQVLYHKHOSIXQF WLRQV$VDJHQHUDOUXOH\RXFDQDFFHVVKHOSIXQFWLRQVE\ SUHVVLQJ)RQWKHNH\ERDUG7KHVHKHOSIXQFWLRQVZLOOEH DYDLODEOHWR\RXZKLOH\RXDUHXVLQJWKH0LFURVRIW:LQGRZVŠ RSHUDWLQJV\VWHPRUWKHUHVSHFWLYHDSSOLFDWLRQSURJUDP :HVWURQJO\UHFRPPHQGWKDW\RXUHDGWKH2QOLQH0DQXDO IRU\RXU3&ZKLFKFDQEHIRXQGLQWKH6WDUW0HQX  ,QIRUPDWLRQDERXW\RXU3& 7KLVLQWHUDFWLYHPDQXDOLVGHVLJQHGWRSURYLGHDGGLWLRQDOLQ IRUPDWLRQDERXW\RXU3&DVZHOODVXVHIXOOLQNVDFFHVVLEOHYLD WKH:RUOG:LGH:HE :LQGRZV[SLQYLWHV\RXWRDWRXU QRWHVRQWKHWDVNEDU

WR IDPLOLDUL]H\RXUVHOIZLWKWKHRSHUDWLQJV\VWHP:HOLVWHGIXU WKHUXVHIXOVRXUFHVRILQIRUPDWLRQVWDUWLQJRQSDJH .

(1&( 7KHVHLQVWUXFWLRQVDUHLQWHQGHGIRUERWKWKHQRYLFHDQGDG YDQFHGXVHU5HJDUGOHVVRIWKHSRVVLEOHSURIHVVLRQDOXWLOLVD WLRQWKLV3&LVGHVLJQHGIRUGD\WRGD\KRXVHKROGXVH7KH IXQFWLRQVDQGDSSOLFDWLRQVIRUXVHZLWKWKLV3&KDYHEHHQ GHVLJQHGZLWKWKHHQWLUHIDPLO\LQPLQG 385&+$6('(7$.QWHO&RUSRUDWLRQ7KHQDPHVRIDFWXDOFRPSDQLHVDQGSURGXFWV PHQWLRQHGKHUHLQPD\EHWKHWUDGHPDUNVRIWKHLUUHVSHFWLYHR ZQHUV 7KLVSURGXFWLQFRUSRUDWHVFRS\ULJKWSURWHFWLRQWHFKQRORJ\WKDWLVSURWHF WHGE\PHWKRG FODLPVRIFHUWDLQ86SDWHQWVDQGRWKHULQWHOOHFWXDOSURSHUW\ULJKWVRZQHGE\0DFURY L VLRQ&RUSRUDWLRQDQGRWKHUULJKWVRZQHUV8VHRIWKLVFRS\ULJKWSURWHFWLRQW HFKQRORJ\ PXVWEHDXWKRULVHGE\0DFURYLVLRQ&RUSRUDWLRQDQGLVLQWHQGHGIRUKRPHDQGRWKHU OLPLWHGYLHZLQJXVHVRQO\XQOHVVRWKHUZLVHDXWKRUL]HGE\0DFURYLVLRQ&RUSRUDWLRQ 5HYHUVHHQJLQHHULQJRUGLVDVVHPEO\LVSURKLELWHG .$8'.7< 0HGLRQKDVVHOHFWHGWKHFRPSRQHQWVLQWKLVFRPSXWHUIRUWKHLU KLJKOHYHORIIXQFWLRQDOLW\HDVHRIXVHVDIHW\DQGUHOLDELOLW\ 7KURXJKEDODQFHGKDUGZDUHDQGVRIWZDUHGHVLJQZHDUHDEOHWR SURYLGH\RXZLWKDQLQQRYDWLYHSHUVRQDOFRPSXWHUXVHIXOIRUDS SOLFDWLRQVUHODWLQJWRERWKZRUNDQGOHLVXUH :HDUHSOHDVHGWRZHOFRPH\RXDVRXUQHZHVWFXVWRPHU 7KDQN\RXIRUFKRRVLQJRXUSURGXFWV ‹ 0HGLRQŠ$OOULJKWVUHVHUYHG0LFURVRIW Š06'26ŠDQG:LQGRZVDUHUHJLVWHUHG WUDGHPDUNVRI0LFURVRIW&RUSRUDWLRQLQWKH86DQGRWKHUFRXQWULHV3HQWLXP ŠLVD UHJLVWHUHGWUDGHPDUNRI.QIRUPDWLRQLQWKLVGRFXPHQWLV VXEMHFWWRFKDQJHZLWKRXWQRWLFH  LL  ./6 (QWHU\RXUSXUFKDVHGHWDLOVEHORZIRUTXLFNUHIHUHQFH  6HULDO1XPEHU  'DWHRI3XUFKDVH 3ODFHRI3XUFKDVH    <RXZLOOILQGWKH3&VHULDOQXPEHURQWKH6HUYLFH+RWOLQH FDUG7KHVHULDOQXPEHUDOVRDSSHDUVRQWKHUHDURIWKH3& 48$/.

QVWUXFWLRQV      6HWWLQJ8S *HWWLQJ6WDUWHG   .PSRUWDQW$GGLWLRQDO6DIHW\.QFOXGHGZLWK<RXU3&   6HWWLQJ8S 3RVLWLRQLQJWKH0RQLWRU   6HW8S/RFDWLRQ  &RQQHFWLQJ  &DEOLQJ  )URQWFRQQHFWRUV   *HWWLQJ6WDUWHG  6KRUWGHVFULSWLRQRIWKH:LQGRZV Š'HVNWRS   2SHUDWLRQ   2SHUDWLRQ 7KH0RXVH  7KH.((( )LUH:LUH.H\ERDUG 7KH+DUG'ULYH  7KHRSWLFDOGULYH   6XEMHFWV&RQFHUQLQJWKH&''9'5HZULWHU  7KH&DUG5HDGHU  7KH*UDSKLFV&DUG   7KH6RXQG&DUG   86%3RUW  .7DEOHRI&RQWHQWV 1RWHVRQ7KLV0DQXDO  L $XGLHQFH LL 3XUFKDVH'HWDLOV LL 4XDOLW\ LL 6DIHW\DQG0DLQWHQDQFH   6DIHW\DQG0DLQWHQDQFH  2SHUDWLRQDO6DIHW\  'DWD6HFXULW\  .

6'1  6HULDO&203RUW  6RIWZDUH   LLL .   7KH5DGLR797XQHU&DUG  7KH1HWZRUN  0RGHP.

&XVWRPHU6HUYLFH 6HOI+HOS   6HOI+HOS  'DWDDQG6\VWHP6HFXULW\   6\VWHP5HFRYHU\  :LQGRZVŠ8SGDWH  5HVWRULQJWKH)DFWRU\6HWWLQJV  )$4±)UHTXHQWO\$VNHG4XHVWLRQV   &XVWRPHU6HUYLFH   7URXEOHVKRRWLQJ   'ULYHU6XSSRUW   $GGLWLRQDO6XSSRUW   &OHDQLQJDQG&DUH   5HF\FOLQJDQG'LVSRVDO   %DWWHU\WUHDWPHQW   8SJUDGHVDQG5HSDLUV   $SSHQGL[   6WDQGDUGV  :DUUDQW\   0DNLQJ&RSLHVRI7KLV0DQXDO   .QGH[    LY  .

PSRUWDQW$GGLWLRQDO6DIHW\.QVWUXFWLRQV   .&KDSWHU  6DIHW\DQG0DLQWHQDQFH 6XEMHFW 3DJH      2SHUDWLRQDO6DIHW\ 'DWD6HFXULW\ .

1 7 ( 1 $ 1 & (  .     6 $ ) ( 7 < $ 1 '  0 $ .

17(1$1&( 23(5$7.6$)(7<$1'0$.21$/6$)(7< 3OHDVHUHDGWKLVFKDSWHUFDUHIXOO\DQGREVHUYHDOOOLVWHGQRWHV7KLV HQVXUHVDUHOLDEOHRSHUDWLRQDQGORQJOLIHH[SHFWDQF\RI\RXU3&  • '2127DOORZFKLOGUHQWRSOD\XQDWWHQGHG ZLWKHOHFWULFDOHTXLSPHQW       • '2127RSHQWKH3&FDVLQJRUXVHWKH3& ZLWKWKHFDVLQJUHPRYHG:KHQWKHFDVLQJLV RSHQWKHUHLVDGDQJHUWROLIHIURPHOHFWULFVKRFN • '2127LQVHUWREMHFWVWKURXJKWKHVORWV DQGRSHQLQJVRIWKH3&7KLVPD\OHDGWRHOHF WULFVKRFNRUDQHOHFWULFDOVKRUWFLUFXLWRUILUHWKDW ZLOOGDPDJH\RXU3& • &RQQHFWWKH3&21/<WRDQHDUWKHGHDV\DFFHVVLEOH SRZHUVRFNHW)RUGLVFRQQHFWLQJWKH3&IURPWKH PDLQVXQSOXJWKHSRZHUFRUGIURPWKHPDLQVVRFNHW • '2127FRYHUWKHVORWVDQGRSHQLQJVLQ WKH3&FDVLQJ7KHVHRSHQLQJVDUHIRUYHQWLOD WLRQSXUSRVHV&RYHULQJWKHVHYHQWVPD\OHDG  WRRYHUKHDWLQJ • 7KLV3&LV127GHVLJQHGIRUXVHZLWKLQLQ GXVWULDOHQYLURQPHQWV • &'520&'5:'9'GULYHVDUH/DVHU&ODVV GHYLFHV7KHVHODVHUVPXVWUHPDLQLQWKHLU VHDOHG3&FDVLQJ'2127UHPRYHWKHGULYH  FRYHUVDVH[SRVXUHWRWKHODVHUVPD\ SURYHKDUPIXO • '2127ORRNGLUHFWO\LQWRWKHODVHUHYHQ ZKHQZHDULQJH\HSURWHFWLRQ        6 $ ) ( 7 < $ 1 '  0 $ .1 7 ( 1 $ 1 & (   .

QYLVLEOHODVHUUDGLDWLRQZKHQRSHQ$YRLGGLUHFWH[S R VXUHWREHDP 'DQJHU²UDGLDWLRQVLQYLVLEOHVGXODVHUHQFDVG¶RXYHUWXUH(YLWHU WRXWHH[SRVLWLRQGLUHFWHDXIDLVFHDX 7KLVSURGXFWLVFHUWLILHGE\WKHPDQXIDFWXUHUWRFRPSO\ZLWK'++6 UXOHV&)5&KDSWHU6XEFKDSWHU-DSSOLFDEOHDWGDWHRIPDQ X IDFWXUHU5HIHUWRRSWLFDOGULYHODEHOVIRUDGGLWLRQDOGHWDLOV  3OHDVHFRQWDFW&XVWRPHU6HUYLFHZKHQ • WKHSRZHUFRUGRUWKHDWWDFKHGSOXJLVZRUQRU GDPDJHG+DYHWKHGHIHFWLYHSRZHUFRUGUHSODFHGZLWK DQRULJLQDOFDEOH1HYHUWU\WRUHSDLUDGHIHFWLYHFDEOH • WKHKRXVLQJRIWKH3&LVGDPDJHGRUOLTXLGVKDYH SHQHWUDWHG+DYHWKH3&FKHFNHGE\&XVWRPHU6HUYLFH ILUVW2WKHUZLVHLWLVSRVVLEOHWKH3&FDQQRWEHRSHUDWHG VDIHO\ZKLFKPLJKWFDXVHGDQJHUWROLIHE\HOHFWULFVKRFN 7KHSRZHUFRUGLVZRUQRUGDPDJHG '$7$6(&85.1 7 ( 1 $ 1 & (  .7< (YHU\WLPH\RXXSGDWH\RXUGDWDPDNHEDFNXS FRSLHVRQDQH[WHUQDOVWRUDJHPHGLXP7KHVXS SOLHUGRHVQRWDVVXPHOLDELOLW\IRUGDWDORVVRU GDPDJHWRGDWDVWRUDJHXQLWVDQGQRFODLPVFDQ  EHDFFHSWHGIRUGDPDJHVUHVXOWLQJIURPWKHORVV RIGDWDRUFRQVHTXHQWLDOORVVHV    6 $ ) ( 7 < $ 1 '  0 $ .)RU86&DQDGLDQSXUSRVHV 'DQJHU².

16758&7.21$/6$)(7<.03257$17$''.7..216 :KHQXVLQJDQ\HOHFWURQLFHTXLSPHQWEDVLFVDIHW\SUHFDX WLRQVVKRXOGDOZD\VEHWDNHQ)ROORZLQJWKHJXLGHOLQHVEHORZ FDQUHGXFHWKHULVNRIILUHHOHFWULFVKRFNDQGLQMXU\WRSHU VRQ  • 'RQRWXVHWKLVSURGXFWQHDUZDWHU HJQHDUDEDWK WXEZDVKERZONLWFKHQVLQNRUODXQGU\WXELQDZHW EDVHPHQWRUQHDUDVZLPPLQJSRRO.

 • $YRLGXVLQJDWHOHSKRQHPRGHP RWKHUWKDQDFRUG OHVVW\SH.

HHSEDWWHULHVDZD\IURPFKLOGUHQDWDOOWLPHV &DXWLRQ7RUHGXFHWKHULVNRIILUHXVHRQO\1R $:*RUODUJHUWHOHFRPPXQLFDWLRQFRUGV DSSOLHVWR $PHULFDQ6WDQGDUGV.GXULQJDQHOHFWULFDOVWRUP7KHUHPD\EHD UHPRWHULVNRIHOHFWULFVKRFNIURPOLJKWQLQJ 'RQRWXVHWKHWHOHSKRQHPRGHPWRUHSRUWDJDVOHDN LQWKHYLFLQLW\RIWKHOHDN 8VHRQO\WKHSRZHUFRUGDQGEDWWHULHVLQGLFDWHGLQWKLV PDQXDO'RQRWGLVSRVHRIEDWWHULHVLQDILUH7KH\ PD\H[SORGH&KHFNZLWKORFDOFRGHVIRUSRVVLEOHVSH FLDOGLVSRVDOLQVWUXFWLRQV .

 &DXWLRQ/LWKLXPEDWWHULHVFDQQRWKDQGOHLQWHQVHSUHV VXUHKLJKWHPSHUDWXUHVRUILUH'DQJHURIH[SORVLRQLI UHSODFHGLQFRUUHFWO\5HSODFHEDWWHULHVZLWKDFRPSDWLEOH W\SH 6RQ\Œ&5.

1 7 ( 1 $ 1 & (   .DVUHFRPPHQGHGE\WKHPDQX IDFWXUHU/LWKLXPEDWWHULHVDUHKD]DUGRXVZDVWHDQG UHTXLUHSURSHUGLVSRVDO&RQWDFW\RXU6HUYLFH&HQWHU IRUDGGLWLRQDOLQIRUPDWLRQRQEDWWHU\GLVSRVDO • • • • •  6 $ ) ( 7 < $ 1 '  0 $ .

  6 $ ) ( 7 < $ 1 '  0 $ .1 7 ( 1 $ 1 & (  .

QFOXGHGZLWK<RXU3& 6HWWLQJ8S 3RVLWLRQLQJWKH0RQLWRU 6HW8S/RFDWLRQ &RQQHFWLQJ *HWWLQJ6WDUWHG   .&KDSWHU  6HWWLQJ8S *HWWLQJ6WDUWHG 6XEMHFW 3DJH          .

1*67$57(' .1*83 *(77.   6(77.

1&/8'(':.7+<2853& 3OHDVHFKHFNWKDWWKHFRQWHQWVOLVWHGEHORZDUHVXSSOLHGZLWK \RXUSDFNDJHDQGQRWLI\XVZLWKLQGD\VRISXUFKDVHLIWKLV LVQRWWKHFDVH<RX0867SURYLGH\RXU3&¶VVHULDOQXPEHU ZKHQFRQWDFWLQJDFXVWRPHUVHUYLFHUHSUHVHQWDWLYH <RXU3&EXQGOHVKRXOGLQFOXGHWKHIROORZLQJFRPSRQHQWV  [3&DQGSRZHUFRUG [:LQGRZVFRPSDWLEOHNH\ERDUG [5HPRWH&RQWURO6HW RSWLRQDO..

 [0RXVH [0LFURVRIW:LQGRZVŠ*HWWLQJ6WDUWHG0DQXDO5HFRYHU\&' [$SSOLFDWLRQDQG6XSSRUW&' 'ULYHUVHWF.

 7KLVLQVWUXFWLRQPDQXDO :DUUDQW\&DUG [6HWWLQJXSSRVWHU RSWLRQDO.

    IRUUHLQVWDOOLQJWKHRSHUDWLRQV\VWHPIRUIDFWRU\UROOEDFNUHIHUWRSDJH.

 $VD86%UDGLRNLWWKHVHGHYLFHVPD\RSWLRQDOO\EH HTXLSSHGZLWKDUDGLRUHFHLYHU  6 $ ) ( 7 < $ 1 '  0 $ .1 7 ( 1 $ 1 & (   .

1*7+(021.7.21.1*83 5HPHPEHUWKDWFKRRVLQJWKHSURSHUORFDWLRQIRU\RXU3&LV MXVWDVLPSRUWDQWDVFRQQHFWLQJLWFRUUHFWO\3ODFH\RXU3&LQ DVWDEOHYLEUDWLRQIUHHDUHD'HWDLOHGEHORZDUHDGGLWLRQDO JXLGHOLQHVRQVHWWLQJXS\RXU3& 326.725 (QVXUHWKDWWKHPRQLWRULVVHWXSLQVXFKDZD\WKDWUHIOHF WLRQVJODUHDQGOLJKWGDUNQHVVFRQWUDVWDUHDYRLGHG     +DQGUHVW´±´  7RSOLQHRIVFUHHQDWH\HOHYHORU VOLJKWO\EHORZ  9LHZLQJGLVWDQFH´±´  /HJURRP YHUWLFDO.6(77.

 PLQLPXP´  /HJURRP KRUL]RQWDO.

 PLQLPXP´ 50-70 cm -(20-28 inches)0-15• 0-15•    6(77.1*67$57(' .1*83 *(77.

IQHFHVVDU\XVHDIRRWUHVWEXWGRXEOHFKHFNWKDW \RXKDYH\RXUVHDWKHLJKWDGMXVWHGFRUUHFWO\EHIRUHJHW WLQJDIRRWUHVW $UPV <RXUDUPVVKRXOGEHUHOD[HGDQGORRVHHOERZV FORVHWR\RXUVLGHVZLWKIRUHDUPVDQGKDQGVDSSUR[L PDWHO\SDUDOOHOWRWKHIORRU :ULVWV <RXUZULVWVVKRXOGEHDVVWUDLJKWDVSRVVLEOH ZKLOHXVLQJWKHNH\ERDUGPRXVHRUWUDFNEDOO7KH\ VKRXOGQRWEHEHQWVLGHZD\VRUPRUHWKDQGHJUHHVXS RUGRZQ +HDG <RXUKHDGVKRXOGEHXSULJKWRUWLOWHGVOLJKWO\ IRUZDUG$YRLGZRUNLQJZLWK\RXUKHDGRUWUXQNWZLVWHG • • • •  6(77.1*.1&20)257 Â7DNHUHJXODUEUHDNVIURPWKHZRUNDW\RXU VFUHHQWRSUHYHQWWHQVHQHVVDQGH[KDXVWLRQ 6LWWLQJLQRQHSRVLWLRQIRUORQJSHULRGVFDQEHXQFRPIRUWDEOH 7RPLQLPL]HWKHSRWHQWLDOIRUSK\VLFDOGLVFRPIRUWRULQMXU\ LW¶VLPSRUWDQWWKDW\RXPDLQWDLQSURSHUSRVWXUH • • 2YHUDOO &KDQJH\RXUSRVLWLRQIUHTXHQWO\DQGWDNHUHJX ODUEUHDNVWRDYRLGIDWLJXH %DFN :KLOHVLWWLQJDW\RXUZRUNVXUIDFHPDNHVXUH \RXUEDFNLVVXSSRUWHGE\WKHFKDLU¶VEDFNUHVWLQHUHFW SRVLWLRQRUDQJOHGVOLJKWO\EDFNZDUGV <RXUWKLJKVVKRXOGEHKRUL]RQWDORUDQJOHG /HJV VOLJKWO\GRZQZDUG<RXUORZHUOHJVVKRXOGEHQHDUDULJKW DQJOHWR\RXUWKLJKV<RXUIHHWVKRXOGUHVWIODWRQWKH IORRU..1*83  .:25.

(177(03(5$785( • 7KH3&FDQEHRSHUDWHGDWDQDPELHQWWHPSHUDWXUHRI EHWZHHQƒ&DQGƒ& ƒDQGƒ).6(783/2&$7.21 • .HHS\RXU3&DQGDOOXQLWVFRQQHFWHGWRLWDZD\IURP PRLVWXUHGXVWKHDWDQGGLUHFWVXQOLJKW)DLOXUHWR REVHUYHWKHVHLQVWUXFWLRQVFDQOHDGWRPDOIXQFWLRQVRU GDPDJHWRWKH3& • 7RSUHYHQWGDPDJHWR\RXU3&IURPDIDOOSODFHDQGRS HUDWHWKH3&DQGDOOFRQQHFWHGXQLWVRQDVWDEOHEDO DQFHGDQGYLEUDWLRQIUHHVXUIDFH $0%.

DQGDWDUHOD WLYHKXPLGLW\RIEHWZHHQDQG ZLWKRXWFRQGHQ VDWLRQ.

 • :KHQSRZHUHGRIIWKH3&FDQEHVWRUHGDWWHPSHUDWXUHV EHWZHHQƒ&DQGƒ& ±ƒDQGƒ).

 • 7RSURYLGHDGGLWLRQDOSURWHFWLRQDJDLQVWHOHFWULF VKRFNSRZHUVXUJHVOLJKWQLQJVWULNHVRURWKHU HOHFWULFDOGDPDJHWR\RXU3&ZHUHFRPPHQGWKHXVH RIDVXUJHSURWHFWRU :DLWXQWLOWKH3&KDVUHDFKHGDPELHQW URRP.

1*83 *(77.1*67$57(' .WHP SHUDWXUHEHIRUHWXUQLQJLWRQRUFRQQHFWLQJLWWRWKH SRZHUDGDSWHU'UDVWLFYDULDWLRQVLQWHPSHUDWXUH DQGKXPLGLW\FDQFUHDWHFRQGHQVDWLRQZLWKLQWKH3& DQGPD\FDXVHLWWRVKRUWFLUFXLW •     6(77.

&211(&7.1* 3OHDVHIROORZWKHLQVWUXFWLRQVEHORZLQRUGHUWRFRUUHFWO\FRQ QHFW\RXU3& • $UUDQJHFDEOHVLQVXFKDZD\WKDWQRRQHFDQWUHDGRQRU WULSRYHUWKHP • '2127SODFHREMHFWVRQWKHFDEOHV • 7RDYRLGGDPDJHWR\RXU3&FRQQHFW\RXUSHULSKHUDOV HJNH\ERDUGPRXVHDQGPRQLWRU.1* )RUDEHWWHUJXLGDQFHRSHQXSWKHOHIWLQQHUSDJHRI WKHFRYHUZLWKWKHGLDJUDPVWRILQGWKHORFDWLRQRIWKH GHVFULEHGFRQQHFWLRQV  Â 1RWH7KHGHYLFHVOLVWHGDUHQRWQHFHVVDULO\ LQFOXGHGZLWK\RXU3& &$%/.

HHSWKH3&DWOHDVWRQHPHWHU DSSUR[LPDWHO\WKUHHIHHW.ZKLOVW\RXU3&LV SRZHUHGRII6RPHGHYLFHVFDQEHFRQQHFWHGZKLOVW\RXU 3&LVLQXVH7KHVHGHYLFHVXVXDOO\KDYHD86%RU.((( FRQQHFWRU3OHDVHIROORZWKHDSSURSULDWHLQ VWUXFWLRQVIRUHDFKGHYLFH • .

 DZD\IURPKLJKIUHTXHQF\DQGPDJQHWLFLQWHUIHUHQFH VRXUFHV HJWHOHYLVLRQVORXGVSHDNHUFDELQHWVPRELOH WHOHSKRQHVHWF.

LQRUGHUWRDYRLGPDOIXQFWLRQVDQGRU ORVVRIGDWD • 7RDYRLG(0&LVVXHVPDNHVXUHWKDWDOOGHYLFHVDUHFRQ QHFWHGWRHDFKFDEOHRUWKDWFDEOHVQRWLQXVHDUHUH PRYHGIURPWKHFRPSXWHU • 3OHDVHQRWHWKDWRQO\VKLHOGHGFDEOHVVKRUWHUWKDQ PHWUHV IW.

1 *  .VKRXOGEHXVHGIRUWKH/37&2086% .(((DXGLRYLGHRDQGQHWZRUNLQWHUIDFHVZLWKWKLV3&   & 2 1 1 ( & 7 .

I\RXGR QRWKDYHWKHGHVFULEHGGHYLFH HJSULQWHU.• 7KHFRQQHFWLRQRIGHYLFHVLVOLPLWHGWRHTXLSPHQWWKDWFRPSOLHV ZLWK(1³6DIHW\RILQIRUPDWLRQWHFKQRORJ\HTXLS PHQW´RU(1³$XGLRYLGHRDQGVLPLODUHOHFWURQLFDS SDUDWXV6DIHW\UHTXLUHPHQWV´ Â1RWH<RXRQO\QHHGWRFRQQHFWWKRVHFRPSR QHQWVWR\RXUFRPSXWHU\RXUHTXLUH.

 \RXPD\VNLSWKHUHVSHFWLYHLWHPDQGFDUU\LW RXWODWHULIQHFHVVDU\ )5217&211(&7256 +HUHLVKRZ\RXFDQDFFHVVWKH RSWLRQDO.

/  &RQQHFW.FDUGUHDGHUDQG VRPHIXUWKHUFRQQHFWRUVRQWKHIURQWRI\RXU3&FDVLQJ  '9'5:   '9'520 3OHDVHSUHVVWKLV EXWWRQWRVOLGH GRZQWKHFRYHU '9'5:  '9'520       &RQQHFW./     3XVKFDUHIXOO\WKHFRYHUXSWRKLGHWKH FDUGUHDGHUDQGWKHFRQQHFWRUV    'LDJUDPWKHVDPH.

1*67$57(' .    6(77.1*83 *(77.

I\RXUJUDSKLFVFDUGKDVWZR9*$VRFNHWV.1*7+( 021.725 'LDJUDPUHIHUHQFH: • .&211(&7.

\RXFDQXVH HLWKHUSRUWWRFRQQHFWWRWKHPRQLWRU<RXU3&PD\RS WLRQDOO\EHHTXLSSHGZLWKDGLJLWDOFRQQHFWRU '9. :.

 %HFDXVHRILWVDV\PPHWULFIRUPWKHSOXJRQO\ILWVLQWR WKHVRFNHWLQRQHSRVLWLRQ  &RQQHFWWKHGDWDFDEOHRIWKHPRQLWRUWRWKHEOXH VRFNHWRQWKHJUDSKLFVFDUG UHIHUHQFH:RU:

,I QHFHVVDU\UHPRYHWKHZKLWHJXDUGULQJRQWKH PRQLWRUSOXJDQGHQVXUHWKDWWKHSOXJDQGVRFNHW PDWHWRJHWKHUSUHFLVHO\  +DQGWLJKWHQWKHVFUHZVRQWKHPRQLWRUFDEOH Â&$87,21<RXU3&PRQLWRULVSUHFRQILJXUHGIRUD VFUHHQUHVROXWLRQRI[SL[HOVDQGDQ RSWLPDOUHIUHVKUDWHRIK],I\RXUPRQLWRU GRHVQRWVXSSRUWWKHVHVHWWLQJVLWPD\EHFRPH GDPDJHGRUPDOIXQFWLRQGXULQJXVH <RXFDQFKDQJHWKHVFUHHQUHVROXWLRQDQGFRQILJXUDWLRQRI\RXU PRQLWRUDVIROORZV 6HHDOVR\RXUPRQLWRU
V8VHU0DQXDO

  2QFH\RXKDYHSRZHUHGRQWKH3&SUHVVWKH) NH\WRVHOHFW6DIH0RGH Â,I\RXGRQ¶WKLWWKH)NH\RQWLPH\RXZRQµW VHHWKHVWDUWPHQXZKLFKJLYHV\RXWKHRSWLRQ WRUXQLQ6DIH0RGH5HERRW\RXU3&DQGUH WU\LI\RXKDYHPLVVHGWKLV  6HOHFW'LVSOD\3URSHUWLHVWRGHVLJQDWHWKH VFUHHQUHVROXWLRQIRU\RXUPRQLWRU <RXFDQWKHQDGMXVWWKH³'LVSOD\)HDWXUHV´WR\RXUPRQLWRU

• 

& 2 1 1 ( & 7 ,1 *  

1*%$77(5.5(/(66.(6.&211(&7.10286( 7KHPRXVHUHTXLUHVWZRDONDOLQHEDWWHULHV 7\SH$$$.16(57.(<%2$5' 0286( 7KHVHGHYLFHVDUHRSWLRQDO7KHZLUHOHVVNH\ERDUGDQGPRX VHRSHUDWHZLWKGLJLWDOUDGLRWHFKQRORJ\WRHQVXUHQRKLQGHU FRPPXQLFDWLRQEHWZHHQWKHNH\ERDUGWKHPRXVHDQG\RXU FRPSXWHUZLWKRXWFRQQHFWLQJFDEOH7KHWUDQVPLVVLRQDQG UHFHLYLQJRINH\ERDUGDQGPRXVHDUHIUHHIURPDQJOH UHVWULFWLRQ7KHUHDUHWZRIUHTXHQF\FKDQQHOVHDFKIRUNH\ ERDUGDQGPRXVHWRSUHYHQWPDOIXQFWLRQVZKHQ\RXRSHUDWH VHYHUDOUDGLRWUDQVPLVVLRQGHYLFHVVLPXOWDQHRXVO\ %HIRUHZRUNLQJZLWK\RXUQHZNH\ERDUGDQGPRXVHWDNHD IHZRQHWLPHSUHSDUDWLRQV Â%HZDUH3OHDVHUHDGDQGIROORZWKHVHFXULW\DG YLFHVFRQFHUQLQJWKHXVHRIEDWWHULHVRQSDJH .1*:.

  &RYHU  %DWWHU\FRPSDUWPHQW  &KDQQHOVHWWLQJEXWWRQ  'LDJUDPWKHVDPH.

   5HPRYHWKHEDWWHU\FRPSDUWPHQWFRYHU .

RQWKHERW WRPRIWKHNH\ERDUG  .QVHUWWKHWZRDONDOLQHEDWWHULHV $$$.

LQWKHEDWWHU\ FRPSDUWPHQW  )L[WKHEDWWHU\FRPSDUWPHQWFRYHU .

RQWKHERWWRP RIPRXVHDJDLQ Â1RWH3OHDVHGRQRWSXVKWKHFKDQQHOVHWWLQJ EXWWRQ .

1*67$57(' .'FKDQJH   6(77.1*83 *(77.DWRQHVLGHRIWKHEDWWHU\FRP SDUWPHQWFRYHU.WPD\FDXVHWKHFKDQQHORU .

(<%2$5' 7KHNH\ERDUGUHTXLUHVWZRDONDOLQHEDWWHULHV $$.1.(6.1*%$77(5.16(57..

   &RYHU  %DWWHU\FRPSDUWPHQW  &KDQQHOVHWWLQJEXWWRQ  'LDJUDPWKHVDPH.

5HPRYHWKHEDWWHU\FRPSDUWPHQWFRYHU .

QVHUWWZR$$EDWWHULHV7KHLOOXVWUDWLRQLQWKHEDWWHU\ FRPSDUWPHQW .RQWKHERW WRPRIWKHNH\ERDUGE\SXVKLQJLWLQWKHGLUHFWLRQRIWKH DUURZ .

VKRZVKRZWRLQVHUWWKHEDWWHULHVSURS HUO\  5HFRYHUWKHEDWWHU\FRPSDUWPHQWE\SXVKLQJWKHORFNLQJ OXJ .

XQGHUWKHEDWWHU\FRPSDUWPHQW Â1RWH3OHDVHGRQRWSXVKWKHFKDQQHOVHWWLQJ EXWWRQ .

WPD\FDXVHWKHFKDQQHORU .DWRQHVLGHRIWKHEDWWHU\FRP SDUWPHQWFRYHU.1 *   .'FKDQJH  & 2 1 1 ( & 7 .

'FDQNHHSWKHNH\ERDUGDQGPRXVHZRUNLQJZHOO ZLWKWKHVDPHIUHTXHQF\FKDQQHO7KHUHDUH.6(77.1*67$57(' .'21.'ZLOOEHFKDQJHGDI WHUWKHEXWWRQUHOHDVHG   6(77.1*83 *(77.(<%2$5'$1'0286( 3XVKWKHFRQQHFWEXWWRQRQWKHWRSRIUHFHLYHU7KHLQGL FDWRUZLOOEHEOLQNLQJ 3XVKWKHEXWWRQRQWKHERWWRPRINH\ERDUGRUPRXVH 7KHFKDQQHOZLOOEHFKDQJHGDIWHUWKHEXWWRQUHOHDVHG Â1RWH3OHDVHGRQRWKROGWKHEXWWRQORQJHU WKDQVHFRQGV .'LQVWHDGRIFKDQQHO 6(77.(<%2$5'$1'0286( 3XVKWKHFRQQHFWEXWWRQRQWKHWRSRIWKHUHFHLYHU7KH LQGLFDWRURQWKHWRSRIWKHUHFHLYHUZLOOEHEOLQNLQJ +ROGGRZQWKHEXWWRQRQWKHERWWRPRINH\ERDUGDQG PRXVHIRUDSSUR[VHFRQGV7KH.1*.' 'LIIHUHQW.1*)5(48(1&<&+$11(/25.1*)5(48(1&<&+$11(/21.WZLOOFKDQJHWKH.' Â1RWH3OHDVHPDNHWKHIROORZLQJVHWWLQJRQO\ DIWHULQVWDOOLQJ\RXU3&DVGHVFULEHGRQWKH RWKHUFKDSWHUVLQWKLVPDQXDO )RUWKHUDGLRFRQQHFWLRQVHWWKHNH\ERDUGWRUHFHLYHUDQG PRXVHWRUHFHLYHUZLWKWKHVDPHIUHTXHQF\FKDQQHODQG.'VHDFKIRU NH\ERDUGDQGPRXVH&KDQJHWKHIUHTXHQF\FKDQQHOPD\ SUHYHQWLQWHUIHUHQFHEHWZHHQWZRGHYLFHV  6(77.

H\ERDUG 3OXJWKHSOXJ EODFN.(<%2$5'$1'0286(  86%Receiver plug (black)  Receiver  0RXVH  .&211(&77+(.

RIWKHUHFHLYHULQWRDQ86%SRUW RI\RXUFRPSXWHU7KHFRPSXWHUZLOODFWLYDWH\RXUPRXVH DQGNH\ERDUGDIWHUVHFRQGV 3ODFHWKHUHFHLYHUDWOHDVWFP LQFKHV.

IURPRWKHU HOHFWULFDOGHYLFHV HJPRQLWRU.

WRDFKLHYHRSWLPXPSHU IRUPDQFH7KHGLVWDQFHEHWZHHQWKHNH\ERDUGPRXVH DQGUHFHLYHUVKRXOGQRWH[FHHGIHHW'RQRWSODFHWKH UHFHLYHURQPHWDOVXUIDFHV Â7KHGULYHUIRUWKHVHGHYLFHVKDVDOUHDG\EHHQ LQVWDOOHGRQ\RXU3& Â7KHRSHUDWLRQRIWKHPRXVHDQGWKHNH\ERDUG LVGHVFULEHGRQSDJH   & 2 1 1 ( & 7 .1 *   .

1*67$57(' .I\RXZDQWWRFRQQHFWD86%PRXVHSOHDVHIROORZWKHLQ VWUXFWLRQVEHORZ  &211(&7.1*$86%.H\ERDUGSOHDVHIROORZWKH LQVWUXFWLRQVEHORZ  &211(&7.(<%2$5' 'LDJUDPUHIHUHQFH5 &RQQHFWWKHNH\ERDUGWRWKHOHIWEOXH36SRUW .I\RXZDQWWRFRQQHFWD36.I\RXZDQWWRFRQQHFWD86%.H\ERDUGSOHDVHIROORZWKHLQ VWUXFWLRQVEHORZ  &211(&7.(<%2$5' 'LDJUDPUHIHUHQFH( &RQQHFWWKH86%NH\ERDUGWRD86%SRUW .&211(&7.1*$36.I\RXZDQWWRFRQQHFWD36PRXVHSOHDVHIROORZWKH LQVWUXFWLRQVEHORZ    6(77.1*83 *(77.1*$86%0286( 'LDJUDPUHIHUHQFH( &RQQHFWWKH86%PRXVHWRD86%SRUW .1*$360286( 'LDJUDPUHIHUHQFH2 &RQQHFWWKHPRXVHFDEOHWRWKHULJKWJUHHQ36SRUW .

&211(&7.1*3$5$//(/'(9.&(6 'LDJUDPUHIHUHQFH3 2SWLRQ.

I\RXZLVKWRFRQQHFWDSULQWHUZLWKDSDUDOOHO  SLQ. • %HFDXVHRILWVDV\PPHWULFIRUPWKHSOXJRQO\ILWVLQ WRWKHVRFNHWLQRQHSRVLWLRQ  .

&(6 'LDJUDPUHIHUHQFH6 2SWLRQ.1*6(5.FRQQHFWLQJFDEOHFRQQHFWWKHSULQWHUFDEOH IURP\RXUSULQWHUWRWKHUHGSULQWHUVRFNHW3RQWKH UHDURI\RXU3&  +DQGWLJKWHQWKHVFUHZV .$/'(9.I\RXZLVKWRXVHDVFDQQHUZKLFKDOVRFRQQHFWVWRWKH3& YLDWKHSDUDOOHOLQWHUIDFHIROORZWKHLQVWUXFWLRQVDERYH:LWK WKH3&SDUDOOHOSRUWLQXVHWKHSULQWHUFDQEHFRQQHFWHGGL UHFWO\WRWKHVFDQQHU<RXZLOOKDYHXVHRIERWKGHYLFHVLI WKH\DUHFRQQHFWHGLQWKLVPDQQHU  &211(&7.

 • %HFDXVHRILWVDV\PPHWULFIRUPWKHSOXJRQO\ILWV LQWRWKHVRFNHWLQRQHSRVLWLRQ+DQGWLJKWHQWKH VFUHZV  .QRUGHUWRFRQQHFWDQH[WHUQDOPRGHPFDUG UHDGHURURWKHUVHULDOGHYLFHFRQQHFWWKHVHULDOFD EOHZLWKWKHWXUTXRLVHFRORXUHGFRQQHFWLRQVRFNHW 6.

RQWKHUHDURI\RXU3&  +DQGWLJKWHQWKHVFUHZV   & 2 1 1 ( & 7 .1 *   .

6'1FDUGFRQ QHFWWKHPDWFKLQJHQGRIWKHFRPPXQLFDWLRQVFDEOHZLWKSRUW =RI\RXU3&7KHVRFNHWLVLGHQWLILHGDV/LQH3OXJWKHRWKHU HQGLQWRRIWKHFRPPXQLFDWLRQVFDEOHWRWKHWHOHSKRQHZDOO VRFNHWRULQWRWKHQHWZRUNSRUWSURYLGHG 02'(0 7KHPRGHPFDEOHKDVDQ5-SOXJZKLFKLVSOXJJHGLQWR WKHPRGHPRI\RXU3&DQGD7$(SOXJZKLFKILWVDQ1 FRGHGDQDORJXHWHOHSKRQHVRFNHW)RUIXUWKHULQIRUPDWLRQ SOHDVHUHIHUWRWKH0RGHPVHFWLRQ Â$77(17.6'1HWF.213OHDVHREVHUYHWKDWWKHPRGHP PD\RQO\EHFRQQHFWHGWRDQDQDORJXHWHOH SKRQHOLQH7KHFRQQHFWLRQRIDGLJLWDOV\VWHP .6'1&211(&7.I\RXUFRPSXWHULVILWWHGZLWKDPRGHPRU.02'(0.21 'LDJUDPUHIHUHQFH= .

1*67$57(' .6'1RXWOHW Â$77(17.1*83 *(77.6'1 7KH.WPDNHVQR GLIIHUHQFHZKLFKHQGLVSOXJJHGLQWRZKLFKVRFNHW  &RQQHFWWKHPDWFKLQJSOXJRIWKHHQFORVHGFRP PXQLFDWLRQFDEOHWRMDFN=RI\RXUFRPSXWHU8VX DOO\WKHMDFNLVPDUNHGZLWK³/LQH´  7KHQFRQQHFWWKHRWKHUSOXJWRWKHWHOHSKRQHRU .WRDQDQDORJXHWHOHSKRQHOLQHFDQ SRVVLEO\FDXVHGDPDJHWRWKHPRGHPRUWKH FRQQHFWHGGHYLFHVDQGWKHWHOHFRPPXQLFDWLRQ QHWZRUN .6'1FDEOHKDV5-SOXJVDWHLWKHUHQG.6'1XQLWRQO\ ZLWKGLJLWDOWHOHSKRQHV\VWHPV7KLVSUHYHQWV DQLQDGPLVVLEOHRSHUDWLRQSRVVLEO\FDXVLQJ GDPDJHWRWKHXQLWRUWKHFRQQHFWHGGHYLFHV   6(77.212SHUDWHWKH.

1*'(9.&(6727+(*$0.1*3257 'LDJUDPUHIHUHQFH* 2SWLRQ./$1&211(&7.21 'LDJUDPUHIHUHQFH4 $FFRUGLQJWRWKHIHDWXUHV\RXU3&FDQEHHTXLSSHGZLWKDQHW ZRUNFRQQHFWLRQLQRUGHUWRSUHSDUHLWIRUQHWZRUNRSHUDWLRQ 7KHQHWZRUNFDEOHXVXDOO\KDVWZR5-SOXJVVRWKDWLWLV XQLPSRUWDQWZKLFKSOXJLVFRQQHFWHGWRZKLFKMDFN  &RQQHFWWKHRQHSOXJRIWKHFDEOHWRWKH3&MDFN  &RQQHFWWKHRWKHUSOXJWRWKHRWKHU3&RU KXEVZLWFK )RUIXUWKHULQIRUPDWLRQUHIHUWRFKDSWHU³7KH1HWZRUN´ VWDUWLQJDWSDJH &211(&7.

 7KHPXOWLSLQRUDQJHJDPLQJSRUW*FDQEHXVHGWRFRQQHFW JDPHFRQWUROOHUV MR\VWLFNJDPHSDGVWHHULQJZKHHO HWF.

DVZHOODV*DPHWR0.DGDSWHUV • %HFDXVHRILWVDV\PPHWULFIRUPWKHSOXJRQO\ILWVLQWR WKHVRFNHWLQRQHSRVLWLRQ+DQGWLJKWHQWKHVFUHZV  &RQQHFWWKHSOXJRIWKHUHVSHFWLYHGHYLFHZLWKWKH WXUTXRLVHFRORXUHGMDFNLQWKHUHDURI\RXU3&  7KHQWLJKWHQWKHVFUHZVRIWKHVHULDOFRUGE\KDQG &211(&7.1*63($.(56$8'.2287387 'LDJUDPUHIHUHQFH+ &RQQHFW\RXUKHDGSKRQHVRUDFWLYHVSHDNHUVE\SOXJJLQJ WKHFDEOHZLWKWKHPPVWHUHRMDFNSOXJLQWRWKHJUHHQ VRFNHW UHIHUHQFH+.'.

1 *   .  & 2 1 1 ( & 7 .

3&6:.I\RXU3&LVHTXLSSHGZLWKLWWKHIROORZLQJFRQQHFWLRQLVUHTXLUHG  &RQQHFWWKHIURQWVSHDNHUWRWKHJUHHQVRFNHW UHIHU HQFH+.7+6855281'6281' .

  &RQQHFW\RXUUHDUVSHDNHUWRWKH5HDUFRQQHFWRU +.

  <RXUFHQWUHVSHDNHURUVXEZRRIHUFDQEHFRQQHFWHG WRWKHVRFNHW&HQWUH6XEZRRIHU +.

QRUGHUWRXVHWKH RSWLRQDO.  .

GLJLWDODXGLRRXWOHW SOXJWKHFLQFKFDEOHLQWKHMDFNDWORFDWLRQ87KHRS WLFDOGLJLWDODXGLRRXWOHWLVSRVLWLRQHGDWORFDWLRQ8 &RQQHFWWKHFDEOHZLWKDQDXGLRGHYLFHZLWKDGLJLWDO FLQFKLQOHWDFFRUGLQJWRWKH63'.1387 'LDJUDPUHIHUHQFH- 7KLVSRUWLVXVHGWRDFFRPPRGDWHDFRQQHFWLQJFDEOHIRUH[WHU QDODXGLRVRXUFHV LHVWHUHRV\VWHPNH\ERDUGV\QWKHVL]HU.)VWDQGDUG &211(&7.2.1*$6281'6285&($8'.

  &RQQHFWWKHFDEOHZLWKWKHPPVWHUHRMDFNSOXJWR WKHOLJKWEOXHFRORXUHGVRFNHW UHIHUHQFH-.

<RXFDQ DOVRFRQQHFWDVWHUHR&LQFKFDEOH SRVLWLRQ-.

I\RXZDQWWRUHFRUGDGLJLWDODXGLRVRXUFHXVHWKH RSWLRQDO.  .

  <RXFDQXVHWKHSLQNVRFNHW.1*$0.WRFRQQHFWDPLFUR SKRQHZLWKDPPPRQRMDFNSOXJ  3RVLWLRQWKHPLFURSKRQHLQVXFKDZD\WKDWLWGRHV QRWSRLQWGLUHFWO\DWWKHVSHDNHUV.I\RXKHDUIHHG EDFNFKDUDFWHULVHGE\ORXGZKLVWOLQJQRLVHVUHSRVL WLRQWKHPLFURSKRQHXQWLOWKHVRXQGVWRSV   6(77.DXGLRLQSXW7RU7$63'.1*67$57(' .)&LQFKFDEOH ZLOODOVREHQHFHVVDU\IRUWKH7ZKLOH7LVDQRSWLFDO RXWSXW &211(&7.1*83 *(77.&523+21( 'LDJUDPUHIHUHQFH.

9(5 3RVLWLRQLQWKHIODSRXWRYHUYLHZ<< 6KRXOG\RXU3&EHHTXLSSHGZLWKD79WXQHUFDUGWKHQ\RX PXVWFRQQHFWWKHFRUUHVSRQGLQJ2KPFRD[LDOFDEOHV DHULDO RUFDEOH.$17(11$&211(&7.25(&(.21)25795$'.

IRUUDGLRDQG79UHFHSWLRQ &RQQHFWWKHVXSSOLHGUDGLRDQWHQQDZLWKWKHFRUUHVSRQG LQJFRQQHFWRU <.

RQWKH79FDUG  &RQQHFWWKH79FRQQHFWRURQ\RXU79FDUG <.

21 'LDJUDPUHIHUHQFH9 &LQFK.1*7+( 3&72$7(/(9.6.ZLWKWKH DHULDODQWHQQDRUFDEOH79 &211(&7.

9 69LGHR.

 ,I\RXUFRPSXWHU¶V9*$FDUGLVHTXLSSHGZLWKD792XW VRFNHW\RXFDQHVWDEOLVKDFRQQHFWLRQWRD79  &RQQHFW\RXU3&DQG\RXUWHOHYLVLRQZLWKWKHFRUG UHTXLUHG DYDLODEOHVHSDUDWHO\

IRU\RXU79

&211(&7,1*$5(&25',1*6285&(9,'(2,1/(7
'LDJUDPUHIHUHQFH. &LQFK

/ 69LGHR

 <RXU3&PD\EHILWWHGZLWKD79LQSXWGHSHQGLQJRQWKH PRGHO\RXVHOHFWHG<RXFDQWUDQVIHUGDWDIURP\RXUYLGHR FDPHUDWR\RXU3&DQGHGLWWKHLPDJHVXVLQJWKLVFRQQHFWLRQ  &RQQHFWWKHSOXJRIWKHFRUGWRWKHMDFN SRVLWLRQ. IRUFLQFKDQG/IRU69LGHR.

1 *   .  & 2 1 1 ( & 7 .

(((GH YLFHVDIWHULQLWLDOVHWXSRI\RXUQHZ3&7KLV ZLOOSUHYHQWXQQHFHVVDU\FRQIXVLRQGXULQJLQ VWDOODWLRQ7KHVHGHYLFHVFDQJHQHUDOO\EHFRQ QHFWHGGXULQJRSHUDWLRQ5HDGWKHPDQXDOIRU \RXUSHULSKHUDOGHYLFHILUVW 7KHYROWDJHRXWSXWVRI\RXU3&IRU.(((DVZHOODVIRU 86%DUHSURWHFWHGE\DIXVH OLPLWHGSRZHUVRXUFHDFFRUGLQJ WR(1.((( Â:DUQLQJ&RQQHFW\RXU86%.86%.

((( ).5(:.5(.7KLVHQVXUHVWKDWDPDOIXQFWLRQRIWKH3&ZLOO QRWGDPDJHWKHSHULSKHUDOGHYLFHVFRQQHFWHGWRWKHUHVSHF WLYHMDFNV &211(&7.1*.

'(9.&(6 'LDJUDPUHIHUHQFH) SROH.

) SROH.

 Â3HULSKHUDOGHYLFHVFDQKDYHGLIIHUHQWFRQQHFW LQJFDEOHV SROH )SROH ).

WGRHVQRWPDWWHUZKLFK\RXXVH  .1*83 *(77.I\RXZLVKWRXVHDSULQWHUVFDQQHURURWKHUGHYLFHZLWKD 86%SRUWFRQQHFWWKHFDEOHWRWKH86%VRFNHWRQ\RXU3& Â1RWH&RQQHFW\RXUGHYLFHVDOZD\VWRWKH VDPHSRUWRWKHUZLVH\RXURSHUDWLQJV\VWHP ZLOOJLYHDQHZ.PSRUWDQW7KHFRQQHFWRUVRIWKHIURQWVLGH DUHQRWFRQILJXUHGIRUSDUDOOHOXVH &211(&7.1*67$57(' .&(6 'LDJUDPUHIHUHQFH( <RXKDYHDFKRLFHRIVHYHUDOFRQQHFWLRQVRFNHWV .'DQGDVNVIRUGULYHULQVWDOOD WLRQ   6(77.3OHDVH FKHFNZKDWNLQGRIFDEOH\RXQHHGIRU\RXUSH ULSKHUDOGHYLFH .1*86%'(9.

ILQ GRXEWDVNDQHOHFWULFLDQ 7KHSRZHUVXSSO\XQLWKDVDQ2Q2IIVZLWFK .1*7+( 32:(56833/< 'LDJUDPUHIHUHQFH.QRUGHUWRGLVFRQQHFW\RXU3&IURPWKHSRZHU VRXUFHRUVHWWKH3&WRYROWDJHIUHHUHPRYHWKH SRZHUFRUGIURPWKHVRFNHW 8VHRQO\WKHVXSSOLHGSRZHUFRUG 7RSURYLGHDGGLWLRQDOSURWHFWLRQDJDLQVWHOHFWULF VKRFNSRZHUVXUJHVOLJKWQLQJVWULNHVRURWKHUHOHF WULFDOGDPDJHWR\RXU3&ZHUHFRPPHQGWKHXVHRID VXUJHSURWHFWRU .&211(&7..  )LQDOO\FRQQHFWWKHSRZHUVXSSO\WR\RXU3&DQG PRQLWRUE\SOXJJLQJWKHSRZHUFRUGLQWRWKHRXW OHW 2EVHUYHWKHIROORZLQJVDIHW\SUHFDXWLRQV • 7KHSRZHUVRFNHWPXVWEHLQWKHYLFLQLW\RIWKH3& DQGZLWKLQUHDFKRIWKHSRZHUFDEOHV'2127 VWUHWFKWKHSRZHUFDEOHVWLJKWO\WRUHDFKD SRZHUVRFNHW .I\RXDUHXVLQJDQH[WHQVLRQFRUGHQVXUHWKDWWKH FRUGPHHWV\RXUORFDOVDIHW\UHTXLUHPHQWV.

WKDW FDQEHXVHGWRSRZHURIIWKH3&:KHQWKHVZLWFKLV 2IIQRSRZHULVEHLQJFRQVXPHG • • • • • '21276WDUW<RXU3&<HW )LUVWUHDGWKHIROORZLQJVHFWLRQWRILQGRXWZKDW\RXQHHGWR NQRZLQRUGHUWRJHWVWDUWHG   & 2 1 1 ( & 7 .1 *   .

1*83 *(77.  6(77.1*67$57(' .

*(77.1*67$57(' 7KHVRIWZDUHRQWKLV3&FRPHVIXOO\SUHLQVWDOOHG <RXGRQRWKDYHWRORDGDQ\RIWKH&' V'9'¶VVXSSOLHG :LWKPDQ\SURJUDPV HJWHOHSKRQH&' VRUHQF\FORSDHGLDV.

 KRZHYHULWLVQHFHVVDU\WRLQVHUWWKHFRUUHVSRQGLQJ&''9'LQ RUGHUWRFDOOXSWKHGDWDZKLFKLVVWRUHGRQLW7KHVRIWZDUHZLOO DVN\RXWRGRWKLVDVQHFHVVDU\ 2QFH\RXKDYHPDGHDOOWKHFRQQHFWLRQVDQGVHFXUHGWKHQHFHV VDU\FRQQHFWRUV\RXFDQWXUQRQWKHPRQLWRUWKHRWKHUSHULSK HUDOVDQGILQDOO\WKH3&LWVHOI 6WHS  3RZHURQWKHPRQLWRUDQG\RXUSHULSKHUDOV 6:.  3RZHURQ\RXU3&E\SUHVVLQJWKH 6ZLWFKWRSRVLWLRQ>@ <RXZLOO LQWHUUXSWWKHFXUUHQWHQWU\E\ SUHVVLQJWKHVZLWFKWRSRVLWLRQ.7&+ 'LDJUDPUHIHUHQFH.

 0$.7&+ 'LJUDPUHIHUHQFH1  3UHVV0DLQ3RZHU6ZLWFKEULHIO\WRVWDUWORDGLQJWKHRS HUDWLQJV\VWHP<RXDUHQRZUHDG\WRVHWXSWKH RS WLRQDO.132:(56:.

ZLUHOHVVNH\ERDUGPRXVHVHW S.

 <RXFDQSURJUDPWKHIXQFWLRQRIWKHPDLQVZLWFKLQWKH SRZHUPDQDJHPHQWRI:LQGRZVŠ SOHDVHUHIHUWRRQOLQH KHOS.

IWKHRSHUDWLQJV\VWHPLVQRWVKXW GRZQSURSHUO\ WKURXJKáÖ6KXW'RZQ.7KH3&ZLOODOZD\VEHVZLWFKHGRIILIWKHPDLQVZLWFK LVSUHVVHGIRUPRUHWKDQVHFRQGV Â:DUQLQJ.

1*67$57('  . WKHQWKHUHLVDULVNRIGDWDORVV  *(77.

6WHS 7KH3&VWDUWVDQGQRZJRHVWKURXJKDQXPEHURISKDVHV Â1RWH(QVXUHWKDWWKHUHLVQRERRWDEOH&' HJWKH 5HFRYHU\&'.

1*83 *(77.QRUGHUWRVHHWKHIXOOWH[WXVHWKHPRXVHDQGWKHVFUROOEDU WRPRYHGRZQZDUGVXQWLO\RXKDYHUHDFKHGWKHHQGRIWKH GRFXPHQW<RXDFFHSWWKHDJUHHPHQWE\FOLFNLQJRQWKH.DF FHSWWKHDJUHHPHQWRSWLRQILHOG2QO\E\GRLQJVRZLOO\RX EHHQWLWOHGWRXVHWKHSURGXFWXQGHUODZIXOWHUPVDQGFRQGL WLRQV &RPSXWHU1DPH 3OHDVHQRWHWKDWZKHQDVVLJQLQJDQDPHWRDFRPSXWHUWKHFRP SXWHUQDPHDQGWKHXVHUQDPHPD\QRWEHLGHQWLFDO 6WHS $IWHUWKHORJLQSURFHGXUHWKH:LQGRZVŠGHVNWRSDSSHDUVRQ \RXUVFUHHQ 7KLVFDQEHDGMXVWHGVRWKDWWKHVFUHHQRI\RXUFRPSXWHU ORRNVGLIIHUHQW7KHEDVLFRSHUDWLRQKRZHYHULVHQVXUHG   6(77.LQWKH&'520GULYH6XFKGLVNVZLOO SUHYHQWWKHRSHUDWLQJV\VWHPIURPORDGLQJGLUHFWO\ RIIWKHKDUGGULYH  7KHRSHUDWLQJV\VWHPLVORDGHGIURPWKHKDUGGLVN'XULQJWKH LQLWLDOVHWXSWKHORDGLQJSURFHVVWDNHVVOLJKWO\ORQJHUWKDQQRUPDO WRUHJLVWHUWKHRSHUDWLQJV\VWHPDQGWKHLQGLYLGXDOFRPSRQHQWV FRPSOHWHO\<RXURSHUDWLQJV\VWHPLVILQLVKHGORDGLQJZKHQD ZHOFRPHVFUHHQLVVKRZQRQ\RXUGLVSOD\ )ROORZWKHLQVWUXFWLRQVRQWKHVFUHHQ'LDORJXHER[HVZLOOH[SODLQ DQ\VWHSVWKDWQHHGWREHWDNHQ7KHJUHHWLQJSURFHGXUHZLOO JXLGH\RXWKURXJKWKHIROORZLQJVFUHHQVDQGGLDORJXHV 6KRXOG\RXKDYHDQ\TXHVWLRQVMXVWFOLFNRQ   /LFHQVH$JUHHPHQW ([SODQDWLRQ 3OHDVHUHDGWKURXJKWKHOLFHQVHDJUHHPHQWFDUHIXOO\ .WFRQWDLQVLPSRUWDQWOHJDOLQIRUPDWLRQRQWKHXVHRI\RXU VRIWZDUH .1*67$57(' .

1'2:6Š '(6.6+257'(6&5.723 7KHUHVSHFWLYHLOOXVWUDWLRQLVVKRZQRQWKHQH[WSDJH.37.212)7+(:.

FRQVDUHSURJUDPOLQNVXVHGWRVWDUWWKHUHVSHFWLYHSURJUDPV$ GRXEOHFOLFN SUHVVWKHOHIWPRXVHNH\TXLFNO\WZLFH. &OLFNRQFHRQWKLVEXWWRQZLWK\RXUOHIWPRXVHNH\WRFDOOWKHLOOX V WUDWHGVWDUWPHQX  n 7KH6WDUWEXWWRQ 7KHPRVWFRPPRQO\XVHGSURJUDPVDUHOLVWHGKHUH7KHRSHUDWLQJ V\VWHPUHFRJQL]HVWKHPDXWRPDWLFDOO\.FRQV´RQWKH³'HVNWRS´ .I\RXSUHVVWKHULJKWPRXVH NH\RQDQHQWU\\RXFDQGHWHUPLQHZKLFKHQWU\LVNHSWDQGZKLFKLV GHOHWHGIURPWKHOLVW7KHSURJUDPDVVRFLDWHGZLWKWKHHQWU\ZLOO QRWEH GHOHWHG o 3URJUDPEDU +HUH\RXILQGWKHHQWULHVWRHYHU\SURJUDPLQVWDOOHGRQ\RXU3& +HUHWRR\RXFDQHGLWHQWULHVZLWKWKHULJKWPRXVHNH\  p q r s t $OOSURJUDPV .QIRUPDWLRQDERXW\RXU3& &OLFNRQWKLVEXWWRQRQFHZLWKWKHOHIWPRXVHNH\WRUHFHLYHLPSR U WDQWLQIRUPDWLRQDERXW\RXU3&DVZHOODVYDOXDEOHKLQWVDQGDGG L WLRQDODVVLVWDQFH 6ZLWFKLQJRII 7DVNEDU &OLFNRQWKLVEXWWRQZLWKWKHOHIWPRXVHNH\WRVZLWFKRIIWKH3&  +HUH\RXUHFHLYHLQIRUPDWLRQDQGVWDWXVUHSRUWVDERXWWKHRSHUD WLQJ V\VWHPDQGWKHUXQQLQJSURJUDPV  ³.

RQWKHV\P EROVWDUWVWKHDSSOLFDWLRQ 7KH'HVNWRSLQFOXGHVDOPRVWWKHFRPSOHWHVFUHHQDQGLVWKHILOLQJ DUHDIRUWKRVHHQWULHVRURWKHUOLQNV\RXZRXOGOLNHWRD FFHVV TXLFNO\  *(77.1*67$57('  .

1*83 *(77.1*67$57(' .7KLVVKRZVWKHORJJHGLQXVHU7KHLPDJHLVFKDQJHGE\FOLFNLQJRQLW  u v /RJJHGLQXVHU &RQWURO3DQHO 7KLVLVWKHFHQWUDOFRQWURORI\RXUFRPSXWHU+HUH\RXDUHDEOHWR FRQILJXUH\RXUFRPSXWHUDWZLOO+RZHYHU\RXVKRXOGUHDGDERXW WKHLPSOLFDWLRQVRISRVVLEOHFKDQJHVLQ³+HOSDQG6XSSRUW´                 t u  v nop qr   s       6(77.

H\ERDUG 7KH+DUG'ULYH 7KH2SWLFDO'ULYH««««««««««««««« 7KH&DUG5HDGHU 7KH*UDSKLFV&DUG 7KH6RXQG&DUG 7KH86%3RUW .&KDSWHU 2SHUDWLRQ 6XEMHFW 3DJH                 7KH0RXVH««««««««««««««««««« 7KH.((( )LUH:LUH.

6'1   . 7KH5DGLR797XQHU&DUG 1HWZRUN 6RIWZDUH«««««««««««««««««««« 0RGHP.

   23(5$7.21 .

21  .23(5$7.(<%2$5' 7KLVVHFWLRQFRQWDLQVXVHIXOLQIRUPDWLRQRQXVLQJWKH NH\ERDUG$OOGLDJUDPVDUHVFKHPDWLF 2QWKHEDVHRIWKHNH\ERDUGDUHWZRIROGLQJIHHWWKDWOHW\RX DGMXVWWKHDQJOHRIWKHNH\ERDUG $GMXVWDEOH)HHW    23(5$7.21 7+(0286( 7KHPRXVHKDVEHVLGHWKHWZRNH\DZKHHOWKDWFDQEHXVHG DV  • $WKLUGPRXVHEXWWRQE\FOLFNLQJDV VKRZQLQWKHSLFWXUH  • 7RVFUROOWKURXJKDGRFXPHQWRULQWHU QHWSDJHV  :LWKWKHKHOSRIWKHPRXVHVRIWZDUHLQWKHFRQWUROSDQHO\RX FDQFKRRVHPRUHIXQFWLRQV 7+(.

(<6 7KHOHIW$OWNH\SHUIRUPVFHUWDLQIXQFWLRQVLQFRQMXQFWLRQZLWK RWKHUNH\V7KHDSSOLFDWLRQSURJUDPGHWHUPLQHVWKHVHIXQF WLRQV.7+($/7$1'&75/.QRUGHUWRHQWHUDFRPELQDWLRQRINH\VWKDWLQFOXGHWKH $OWNH\KROGWKH$OWNH\GRZQZKLOHSUHVVLQJWKHRWKHUNH\ 7KHULJKW$OWNH\RSHUDWHVLQDVLPLODUZD\EXWVHOHFWVFHUWDLQ VSHFLDOFKDUDFWHUV7KH&WUONH\OLNHWKH$OWNH\FDUULHVRXW SURJUDPIXQFWLRQV 8VHIXONH\FRPELQDWLRQV VRIWZDUHGHSHQGHQW.

H\ &RPELQDWLRQ $OW) $OW3ULQWVFUHHQ 6KLIW &WUO$OW'HO )XQFWLRQDQG'HVFULSWLRQ $VDUXOHHQGVWKHSURJUDPVHOHFWHGRU FORVHVWKHZLQGRZRSHQHG &RSLHVWKHLPDJHRIWKHZLQGRZFXU UHQWO\DFWLYHWRWKHFOLSERDUG *HQHUDWHVWKH#FKDUDFWHUUHTXLUHGIRU HPDLOV SURQRXQFHGDW. .

 :LQGRZVVHFXULW\LVODXQFKHG  &RXQWU\VSHFLILFYDULDQFHVDUHSRVVLEOH.

   23(5$7.21 .

216 6RPHNH\ERDUGVDUHSURYLGHGZLWKPXOWLPHGLDNH\V7KHVH NH\VKDYHWKHIROORZLQJIXQFWLRQV 6\PERO )XQFWLRQ 6WDQGE\0RGH 'HSHQGLQJRQWKHVHWWLQJVLQWKH%.08/7.$)81&7.266HWXSRU RSHUDWLQJV\VWHPWKHFRPSXWHUVZLWFKHVWRD VWDQGE\PRGH .0('.21  .QWHUQHW :LWKWKLVNH\\RXFDQVWDUWWKHVWDQGDUGEURZVHU (0DLO 8VHWKLVNH\WRVWDUWWKHVWDQGDUGHPDLOSURJUDP )DYRULWHV 2SHQVWKHIROGHU³)DYRULWHV´ &DOFXODWRU $FWLYDWHVWKH:LQGRZVGHIDXOWFDOFXODWRU 6HDUFK $FWLYDWHVWKH26GHIDXOWVHDUFKIXQFWLRQ    23(5$7.

21 .%DFN 6ZLWFKHVWRWKHSUHYLRXVZHESDJHIROGHU )RUZDUG 6ZLWFKWRWKHQH[WZHESDJH 3UHYLRXV7UDFN 8VHWKLVNH\WRVNLSWRWKHIRUZDUGWLWOHLQWKHDFWLYH SOD\HU 6WRS 8VHWKLVNH\WRHQGWKHSOD\EDFNRIDWLWOH 3OD\3DXVH 8VHWKLVNH\WRVWDUWRUSDXVHIRUDVKRUWWLPHWKHSOD\ EDFNRIDWLWOHMXVWDV\RXZRXOGZLWKDQRUPDO&' SOD\HU 1H[W7UDFN 8VHWKLVNH\WRVNLSWRWKHQH[WWLWOHLQWKHDFWLYHSOD\HU 'HFUHDVHWKHYROXPH 7KLVNH\GHFUHDVHVWKHYROXPHRIWKHVRXQGFDUG 0XWH 8VHWKLVNH\WRVZLWFKRQRIIWKHVRXQGFDUG .QFUHDVHWKHYROXPH 7KLVNH\LQFUHDVHVWKHYROXPHRIWKHVRXQGFDUG &XW &XWVWKHFRQWHQW\RXVHOHFWHG &RS\ &RSLHVWKHFRQWHQW\RXVHOHFWHG 3DVWH 3DVWHVWKHFRQWHQW\RXKDYHEHHQFRSLHGRUFXW     23(5$7.

26GLVSOD\VDQGZKDWWKH RSHUDWLQJV\VWHPGLVSOD\V7KHRSHUDWLQJV\VWHPRIWKH3& IXUWKHUDSSOLFDWLRQSURJUDPVDQGEDFNXSILOHVDUHORFDWHGRQWKH KDUGGULYHDQGUHGXFHLWVWRWDOFDSDFLW\ 7KHKDUGGULYHLVDGGUHVVHGDVGULYH&'DQG( Â1HYHUVZLWFKRIIWKHFRPSXWHUZKLOHWKHEXV\ LQGLFDWRULVOLWVLQFHWKLVPD\UHVXOWLQORVVRI GDWD 8VXDOO\\RXUKDUGGLVNLVGLYLGHGLQWRPRUHSDUWLWLRQVEXW WKHUHFDQDOVREHVRPHPLQRUYDULDWLRQV 3DUWLWLRQ 'ULYH 7\SH &DSDFLW\ DSSUR[.9( 7KHKDUGGULYHLVWKHPDLQVWRUDJHPHGLXPFRPELQLQJODUJH VWRUDJHFDSDFLW\DQGUDSLGGDWDDFFHVV 7KHKDUGGULYHFRQWDLQVWKHRSHUDWLQJV\VWHPRIWKHFRPSXWHU RWKHUDSSOLFDWLRQSURJUDPVDQGEDFNXSILOHV7KHVHSURJUDPV DQGILOHVDUHSUHLQVWDOOHGRQ\RXU3&VR\RXPD\QRWHWKDW VRPHRIWKHVSDFHRQ\RXUKDUGGULYHLVDOUHDG\WDNHQ 7KH:LQGRZVRSHUDWLQJV\VWHPFDQQRWXVHWKHIXOOFDSDFLW\ RIWKHKDUGGULYHZKLFKPHDQVWKDWWKHUHZLOOEHDGLIIHUHQFH EHWZHHQWKHFDSDFLW\WKDWWKH%.7+(+$5''5.

 %RRW & 17)6RU)$7  %DFNXS ' 17)6RU)$7  5HFRYHU ( 17)6RU)$7  .Q\RXUILUVWSDUWLWLRQ %RRW.

\RXZLOOILQG\RXURSHUDWLQJV\V WHPDSSOLFDWLRQSURJUDPVDQGWKHXVHUV¶GRFXPHQWVDQG VHWWLQJV 7KHVHFRQGSDUWLWLRQ %DFNXS.

VHUYHVIRUGDWDVHFXULW\DQG FRQWDLQVDGGLWLRQDOGULYHUVDQGWRROV 7KHWKLUGSDUWLWLRQ 5HFRYHU.

FRQWDLQVWKHFRSLHVRI\RXU :LQGRZVLQVWDOODWLRQLQWKHGHOLYHU\VWDWH  23(5$7.21  .

03257$17'.(6  ..QWKHIROORZLQJZHOLVWHGWKHPRVWLPSRUWDQWGLUHFWRULHVGH VFULELQJWKHLUFRQWHQWV Â$WWHQWLRQ'RQRWGHOHWHRUPRGLI\WKHVHGL UHFWRULHVRUWKHLUFRQWHQWVVLQFHGDWDFRXOGEH ORVWRUWKHIXQFWLRQDOLW\RIWKHV\VWHPFRXOGEH DWULVN &? 7KHPDVWHUGLUHFWRU\RIGULYH&LQFOXGHVLPSRUWDQW ILOHVUHTXLUHGWRVWDUW:LQGRZV.5(&725.QWKHIDFWRU\VHWWLQJ WKHVHILOHVDUHKLGGHQIRUVDIHW\UHDVRQV &?3URJUDPV$VWKHQDPHVXJJHVWVLQWKLVGLUHFWRU\SUR JUDPVLQVWDOOWKHILOHVEHORQJLQJWRWKHDSSOLFDWLRQ &?:LQGRZV7KHPDLQGLUHFWRU\RI:LQGRZV 7KLVLVZKHUHWKHILOHVRIWKHRSHUDWLQJV\VWHPDUH VDYHG &?'RFXPHQWVDQG6HWWLQJV7KLVIROGHULQFOXGHVWKHVHW WLQJVDQGGRFXPHQWVRIDOOWKH3&XVHUV '?'ULYHU7KLVIROGHULQFOXGHVWKHGULYHUVUHTXLUHGE\\RXU FRPSXWHU SUHLQVWDOOHG.

 '?7RROV+HUH\RXILQGDGGLWLRQDOSURJUDPVDQGRWKHUGRFX PHQWDWLRQIRU\RXU3& (?5HFRYHU +HUHWKHEDFNXSILOHVDUHORFDWHGHQDEOLQJ\RX WRUHFRYHUWKHIDFWRU\VHWWLQJ VHHSDJH.

21 .    23(5$7.

7+(237.&$/'5.9( 'HSHQGLQJRQWKHPRGHORI\RXU3&LWZLOOKDYHD&'520D &'5H:ULWHUD'9'D'9'5H:ULWHURUDFRPELQDWLRQRI WKHVHGULYHV7KHGULYHVLQVWDOOHGLQ\RXU3&DUHDSSURSULDWHO\ ODEHOHGWRDOORZ\RXWRHDVLO\VHOHFWWKHGHVLUHGGULYH 7KHWDEOHEHORZVKRZVZKLFKPHGLD\RXFDQXVHLQZKLFKGULYH 0HGLXP &' '9' &'55: '9'55:  :KHWKHURUQRW\RXFDQXVHDGLVFLQDSDUWLFXODUGULYHGH SHQGVRQZKHWKHUWKHIRUPDWLVVXSSRUWHGE\WKHGULYHDQG WKHRSHUDWLQJV\VWHP6RIRUH[DPSOHD&'WKDWKDVEHHQ FUHDWHGIRUDQRWKHURSHUDWLQJV\VWHPPD\QRWEHUHDGDEOH :ULWDEOHPHGLDIRU'9' '9'55:.

PXVWEHFRPSDWLEOH ZLWK\RXUGULYHW\SH7KHUHDUHYDULRXVIRUPDWV '9'5 '9'5HWF.

ZKLFKDUHQRWFRPSDWLEOHZLWKHDFKRWKHU7KH VSHFLILHGZULWLQJVSHHGPXVWDOVREHVXSSRUWHGE\\RXUGULYH 6LQFHWKLVWHFKQRORJ\LVVWLOOYHU\QHZLQFRPSDWLELOLWLHVPD\ VWLOORFFXUHYHQLIWKHFRUUHFWPHGLDDUHXVHG :HWKHUHIRUHUHFRPPHQGWKDW\RXXVHRQO\EUDQGHGEODQN PHGLDDQGWKDW\RXFKHFNWKHVHIRUFRPSDWLELOLW\ZLWK\RXU GHYLFHV%ODQN&'¶VKRZHYHUGRQRWUHDOO\FDXVHDQ\SURE OHPVDQGFDQJHQHUDOO\EHZULWWHQWRZLWKRXWKHVLWDWLRQZLWK \RXU&'RU'9'ZULWHU ZKHUHSUHVHQW.

21  . 1HYHUWKHOHVVZHUHFRPPHQGWKDW\RXFKHFNZKLFKPHGLD VXLW\RXUGHYLFHVEHVW &'5H:ULWHU '9' '9'5H:ULWHU 9 8 9 8 9 9 9 9  9 9 9 9   23(5$7.

/2$'.6. Â$WWHQWLRQ'RQRWSODFHSURWHFWLYHIRLOVRU RWKHUVWLFNHUVRQ\RXU&'¶V7RDYRLGGDPDJH WR\RXUGULYHGRQRWXVHGHIRUPHGRIGDP DJHG&'¶V$WWHQWLRQ'RQRWXVHVFUDWFKHGRU GLUW\GLVNVGLVFVZLWKSLHFHVEURNHQRIIRU GLVNVRISRRUTXDOLW\%HFDXVHRIWKHKLJK VSHHGVLQWKHGULYHWKHGLVNVPLJKWEUHDNDQG GDPDJH\RXUGDWDDVZHOODV\RXUGULYH ([DPLQHWKHGLVNVEHIRUH\RXHQWHUWKHP.I GDPDJHRUGLUWLVYLVLEOH\RXVKRXOGQRWXVH WKHP 'DPDJHFDXVHGE\IDXOW\PHGLDLVH[FOXGHG IURPZDUUDQW\DQGWKHLUUHSDLUPXVWEH FKDUJHG 'LDJUDPUHIHUHQFH$  3UHVVWKHHMHFWEXWWRQ 'LDJUDPUHIHUHQFH%.1*$'.

21 .RQWKH IURQWRIWKH&'520GULYHWRRSHQWKHWUD\  3ODFHWKHGLVNRQWKHWUD\VRWKDWLWOD\VIODWZLWKWKHOD EHOIDFLQJXSZDUG  3UHVVWKHHMHFWEXWWRQDJDLQWRFORVHWKHWUD\ Â0DQ\&' VVWDUWDXWRPDWLFDOO\ZKHQWKH\DUH LQVHUWHG   23(5$7.

3/$<.QRUGHUWRDFFHVVWKH&'YLD:LQGRZV([SORUHUVHOHFWWKHOHW WHUFRUUHVSRQGLQJWRWKHGULYH:KHQDFFHVVLQJDXGLRRUYLGHR GLVNV RUDXGLRRUYLGHRILOHVRQFRQYHQWLRQDO&'V.(9.$1'5(75.1*%$&.6&6 .1*'$7$)520'.

6& 3UHVVWKHHMHFWEXWWRQ 'LDJUDPUHIHUHQFH%.\RXVKRXOG XVHWKHPHGLDSOD\EDFNDSSOLFDWLRQSUHLQVWDOOHGRQWKHFRP SXWHU&'520DQG'9'520GULYHVFDQSOD\DXGLR&'VEXW RQO\WKH'9'520GULYHFDQSOD\'9'DXGLRRUYLGHRGLVNV 'HSHQGLQJRQWKH'9'DXGLR&'DQGWKHVRIWZDUHLQVWDOOHG \RXPD\DOVRKDYHWRRSHQD'9'SOD\HUSURJUDP)RUIXU WKHULQIRUPDWLRQRQWKHVXEMHFW'9'UHIHUWRSDJH +2:725(029($'.

IWKH3&GRHVQRWERRWLWLVSRVVLEOHWKDWDXWRVWDUWLV WXUQHGRIILQWKH%.9($6%227'5.21  .DWWKH IURQWRIWKH&'520GULYHWRRSHQWKHGUDZHU 5HPRYHWKHGLVFDQGVWRUHLWLQWKH&'FRYHULQDVDIH SODFH Â'RQRWWU\WRUHPRYHWKH&'IURPWKHGULYH ZKLOHWKHFRPSXWHULVDFFHVVLQJWKHGLVN 7+(&'520'9''5.26RUWKH&'LVQRWERRWDEOH  23(5$7.9( 7KHRSWLFDOGULYHVFDQEHXVHGIRUERRWLQJWKHRSHUDWLQJV\V WHP.

'9'7(&+12/2*< 7KH&RPSDFW'LVF &'.

ZDVLQWURGXFHGLQ :KRFRXOGLPDJLQHGRLQJZLWKRXWWKH&'DVDVWRUDJHPH GLXPIRUGDWDPXOWLPHGLDFRPSXWHUJDPHVDQGYLGHRQRZ" $&'FDQKROGXSWR0%RIGDWDEXWWKDWDPRXQWLVWRR VPDOOWRVWRUHDKLJKTXDOLW\HQFRGLQJRIDQHQWLUHIHDWXUH ILOP7KH'9' 'LJLWDO9HUVDWLOH'LVF.

Q VRPHFDVHVERWKVLGHVRIWKH'9'FDQEHXVHGWRVWRUHLQ IRUPDWLRQ)XUWKHUPRUHHDFKVLGHFDQFRQWDLQWZROD\HUVRI LQIRUPDWLRQ GXDOOD\HU.KDVWKHVDPHGLPHQ VLRQVDVD&'EXWVWRUHVPRUHGDWDDWDJUHDWHUGHQVLW\.

286'9')250$76  )RUPDW 6LGH$ 6LGH% 0D[FDSDFLW\ '9' '9' '9' '9' '9'    6/ '/ 6/ '/ '/   6/ 6/ '/ *% *% *% *% *% 6/ 6LQJOH/D\HU'/ 'XDO/D\HU   23(5$7.21 . 7KDQNVWRKLJKGDWDGHQVLW\WKHWUDQVIHUVSHHGLVFRQVLGHUD EO\KLJKHUWKDQIRUD&'VRWKDWD'9'GULYHZLWKWLPHV VSHHGFDQWUDQVIHUFRQVLGHUDEO\PRUHGDWDWKDQDVSHHG &'GULYH $'9'GULYHFDQDOVRUHDGERWK'9'520VDQG&'520V SURYLGLQJWKHXVHUDFFHVVWRDQDVWRXQGLQJDPRXQWRIPHGLD 9$5.

'9'9.'(2 6SHFLDOFKDUDFWHULVWLFVRI'9'9LGHR • • • • • • 8SWRKRXUVRIIHDWXUHILOPVRQDVLQJOH'9' 8SWRDXGLRWUDFNVDQGVXEWLWOHWUDFNV *UHDWHUSLFWXUHTXDOLW\WKDQ9+6RU69+6 7LPHIUDPHQDYLJDWLRQDQGSLFWXUHVWLOOV 6HOHFWLRQRIGLIIHUHQWFDPHUDDQJOHVLQVRPHPHGLD 3DUHQWDO&RQWUROLQZKLFKFHUWDLQVFHQHVRUDQHQ WLUHILOPRUUDWLQJRIILOPVFDQEHPDGHDFFHVVLEOHRQO\ WRFHUWDLQDJHJURXSV'9'SOD\HUVFDQIRUH[DPSOH EHVHWVRWKDWVFHQHVRUILOPVZKLFKKDYHQRWEHHQ DSSURYHGIRU\RXQJHUDXGLHQFHVZLOOQRWSOD\ ..21)25'9' 7KHSOD\EDFNRI'9'PRYLHVLQFOXGHVWKHGHFRGLQJRI03(* YLGHRVGLJLWDO$&DXGLRGDWDDQGWKHGHFLSKHULQJRI&66 SURWHFWHGFRQWHQWV &66 VRPHWLPHVFDOOHGFRS\JXDUG.1)250$7.21$/3/$<%$&.QVSLWHRIWKHKLJKVWRUDJHFDSDELOLW\RIWKH'9'WKHGDWD PXVWEHH[WUHPHO\FRPSUHVVHGLQRUGHUIRUDFRPSOHWHIHD WXUHILOPWREHVWRUHG 5(*.

QRUGHUWRIDFLOLWDWHWKHJHRJUDSKLFDOO\UHVWULFWHGUHOHDVHRI PRYLHV'9'WLWOHVDUHUHOHDVHGIRUFHUWDLQUHJLRQV &RS\ULJKWODZVUHTXLUHWKHUHVWULFWLRQRIHDFK'9'PRYLHWRD FHUWDLQUHJLRQ XVXDOO\WKHUHJLRQLQZKLFKLWLVVROG.LVWKHQDPHRIDGDWDSUR WHFWLRQSURJUDPLQFRUSRUDWHGE\WKHPRYLHLQGXVWU\DVDQDF WLRQDJDLQVWLOOHJDOFRSLHV $PRQJWKHQXPHURXVUHJXODWLRQVIRU&66OLFHQVHHVWKHPRVW LPSRUWDQWRQHVDUHWKHFRXQWU\VSHFLILFSOD\EDFNUHVWULFWLRQV .

 '9'PRYLHYHUVLRQVFDQEHSXEOLVKHGLQVHYHUDOUHJLRQVEXW WKH&66UHJXODWLRQVUHTXLUHWKDWHDFK&66GHFLSKHUDEOHV\V WHPPD\RQO\EHXVHGLQRQHUHJLRQ 23(5$7.21   .

Â$WWHQWLRQ7KHGHFRGLQJVRIWZDUHLQFOXGHGZLWK \RXU3&PD\EHFKDQJHGIRUUHJLRQDO'9'GH FRGLQJXSWRILYHWLPHVDIWHUZKLFKWKHGULYHZLOO RQO\SOD\'9'PRYLHVIRUWKHUHJLRQVHWWLQJODVW HQWHUHG&KDQJLQJWKHUHJLRQFRGHDIWHUWKDWZLOO UHTXLUHIDFWRU\UHVHWWLQJZKLFKLVQRWFRYHUHGE\ ZDUUDQW\.IUHVHWWLQJLVGHVLUHGVKLSSLQJDQG UHVHWWLQJFRVWVZLOOEHELOOHGWRWKHXVHU 68%-(&76&21&(51.7(5 <RXUHFHLYHLQIRUPDWLRQRQWKHVRFDOOHGEODQNGLVFV 7KHVHPHGLDUHTXLULQJD&'UHZULWHU EXUQHU.1*7+(&''9' 5(:5.

WRSURGXFH&'V DUHFDOOHG&'UHFRUGDEOH &'5.

RU&'UHZULWDEOH &'5:.

QWKHFDVHRIEODQNGLVFWKHLQIRUPDWLRQLV EXUQWRQWRWKHGLVFZLWKWKHODVHURIWKH5HZULWHU7KHUHIRUH WKHVHGLVFVDUHPRUHVHQVLWLYHWKDQQRUPDO&'V 3OHDVHDYRLGWKHIROORZLQJZKHQXVLQJUHFRUGDEOHUHZULWHDEOH GLVFVHVSHFLDOO\EODQNVWKDWKDYHQHYHUEHIRUHEHHQXVHG UDGLDWLRQE\GLUHFWVXQOLJKW 89$89%.7($%/('.6&6 1RUPDO'LVFVDUHSUHVVHGIURPDGLJLWDOJODVVPDVWHUDQG WKHQVHDOHG. 5(&25'$%/(5(:5.

 VFUDWFKHVDQGGDPDJHWRWKHGLVNVXUIDFH H[WUHPHWHPSHUDWXUHV    23(5$7.21 .

7+(&$5'5($'(5                  .I\RXU3&LVSURYLGHGZLWKD&DUG5HDGHU 'LDJUDPUHIHU HQFH&.

\RXFDQKDQGOHGLIIHUHQWPHPRU\FDUGW\SHV 7KHIROORZLQJWDEOHUHIHUVWRWKHXVHRIWKH&DUG5HDGHU 6ORW 7RSOHIW 7RSULJKW %RWWRPOHIW %RWWRPULJKW &DUGW\SH 6' 6HFXUH'LJLWDO.

 00& 0XOWL0HGLD&DUG.

 0HPRU\6WLFN &) &RPSDFW)ODVK.

 .%0Š0LFURGULYH 6PDUW0HGLD &RQWDFWV SRLQWWRERWWRP SRLQWWRERWWRP SRLQWWRIURQW SRLQWWRWRS 6'00&0HPRU\6WLFN  &RPSDFW)ODVK  .%0Š0LFURGULYH6PDUW0HGLD  'LDJUDPWKHVDPH.

  .21  .IDFDUGLVLQVHUWHGDIUHHGULYHZLOOEHDVVLJQHGE\:LQ GRZVŠDQGWKH/('QH[WWRWKHVORWLVOLW  23(5$7.

&6 ¾$*3 $FFHOHUDWHG*UDSKLF3RUW.7+(*5$3+.67.&6&$5' <RXUFRPSXWHULVILWWHGZLWKDQ$*3KLJKSHUIRUPDQFH JUDSKLFVFDUGRQHRIWKHPRVWWHFKQRORJLFDOO\DGYDQFHGDQG EHVWHTXLSSHG9*$FDUGVDYDLODEOH 3(5)250$1&(&+$5$&7(5.

3RZHU0DQDJHPHQW  &855(17.0$*(3/$<%$&.(6 7KHJUDSKLFFDUGFDQGHSHQGLQJRQWKHVHWUHVROXWLRQGLVSOD\ YHUWLFDOLPDJHSOD\EDFNIUHTXHQFLHVRIEHWZHHQ+]DQG+] 5HVROXWLRQ [ [ [ [ [ [ &RORUV ELW ELW ELW ELW ELW ELW 5HVROXWLRQ [ [ [ [ [ [ &RORUV ELW ELW ELW ELW ELW ELW <RXFDQFKDQJHWKHJUDSKLFVVHWWLQJXVLQJWKH'LVSOD\ 3URSHUWLHVKHOSSURJUDP)RURSWLPXPLPDJHUHSURGXFWLRQ ZHUHFRPPHQGDQLPDJHSOD\EDFNIUHTXHQF\RIEHWZHHQ +]DQG+]SURYLGHGWKDW\RXUPRQLWRUFDQVXSSRUWWKLV $QLPDJHSOD\EDFNIUHTXHQF\RIOHVVWKDQ+]ZLOOJHQHUDWH DIOLFNHULQJLPDJHXQOHVVDQ/&'PRQLWRULVEHLQJXVHG    23(5$7.QGHRŠ9LGHR7HFKQRORJ\ ¾$&3. ¾+LJK3HUIRUPDQFH$FFHOHUDWLRQ ¾.QWHUDFWLYH'LUHFW'$FFHOHUDWLRQ ¾9LGHR $FFHOHUDWLRQ IRU 'LUHFW'UDZ'LUHFW9LGHR 03(* 03(*'9'DQG.21 .)5(48(1&.

&211(&7.21 Â7KHJUDSKLFVFDUGVKRZQKHUHLVV\PEROLF <RXUJUDSKLFVFDUGSRVVLEO\KDVPRUHRUOHVV MDFNV)RUGHWDLOHGLQIRUPDWLRQUHIHUWRWKH RQOLQHKHOS³.QIRUPDWLRQDERXW\RXU3&´ .I\RXUJUDSKLFVFDUGKDVD79RXWSXW\RXFDQWUDQVIHUWKH LPDJHIURP\RXU3&WRWKHWHOHYLVLRQVHW  q n o p  'LDJUDPWKHVDPH.1*7+( 3&72$7(/(9.6.

 n VHFRQGFRQQHFWRULVRSWLRQDO.

 o 69LGHR2XWSXW p &RPSRVLWH9LGHR2XWSXW &LQFK.

RXWOHW RSWLRQDO. q 'LJLWDO'9.

QRUGHUWRFRQQHFW\RXU79WRWKH3&\RXZLOO QHHGDQ69LGHRFDEOHRUDFRPSRVLWHYLGHRFDEOH 7KLVFDEOHLVQRWLQFOXGHGZLWK\RXUFRPSXWHUEXW PD\EHREWDLQHGIURPDQDXGLRYLGHRVSHFLDOLVWRU GHDOHU5HDGWKHRSHUDWLQJLQVWUXFWLRQVIRU\RXU WHOHYLVLRQVHWWRILQGRXWZKLFKFDEOH\RXQHHG 9*$FRQQHFWRUV  23(5$7.21  . Â.

I\RXU79VHWKDVDFRPSRVLWHYLGHRSRUWFRQQHFWWKH FRPSRVLWHYLGHRLQSXWRQ\RXUVHWZLWKWKHFRPSRVLWH YLGHRRXWSXWRQWKH3& UHIHUHQFH99.+2:72&211(&77+(3&72$7(/(9.21 Â7RXVHWKH79IXQFWLRQ\RXPXVWILUVWFRQ QHFWWKH79WRWKHJUDSKLFVFDUGEHIRUH VWDUWLQJXSWKH3&   6KXWGRZQ:LQGRZVDQGSRZHURIIWKH3&  .6.

...I\RXZLVKWRXVHWKHJUDSKLFVFDUGLQDQRWKHU3&WKDW3& PXVWPHHWWKHIROORZLQJUHTXLUHPHQWV$OVRXSGDWHGGULYHUV IRU\RXUYLGHRFDUGFDQEHGRZQORDGHGIURPWKH:HEDW ZZZPHGLRQFRP  3URFHVVRU 6ORW 0RQLWRU &'520 )URP3HQWLXPŠ.I\RXU79 VHWKDVDQ6YLGHRSRUWFRQQHFWWKH6YLGHRLQSXWRQ \RXUVHWZLWKWKH6YLGHRRXWSXWRQWKH3& 6ZLWFKRQWKHWHOHYLVLRQWRVHHWKH3&LPDJHRQ\RXU79VHW  6WDUWXSWKH3&DQGZDLWIRU:LQGRZVWRIXOO\ORDG  . 6<67(05(48..5(0(176 .QWKH'LVSOD\3URSHUWLHVSURJUDPVHWXSWKHFRQ ILJXUDWLRQ  (QGFRQILJXUDWLRQE\FOLFNLQJRQ2..3URFHVVRURUHTXLYDOHQW $*3±VORW 9*$VXSSRUWLQJDWOHDVW[UHVROXWLRQ 0LQVSHHG IRUGULYHULQVWDOODWLRQ.

 2SHUDWLQJV\VWHP VWDUWLQJIURP0LFURVRIW:LQGRZV Š6(0( .3   23(5$7.21 .

I\RXU3&LVHTXLSSHGZLWKDVXUURXQGVRXQG\RXFDQVHWLW ZLWKWKHHQFORVHGVRIWZDUHDVUHTXLUHG   23(5$7.7+(6281'&$5' <RXU3&KDVDQLQWHJUDWHGVWHUHRVRXQGFDUG 7KHVRXQGFDUGLVFRPSDWLEOHZLWKWKHLQGXVWU\VWDQGDUG 6RXQG%ODVWHUDQG0LFURVRIW6RXQG6\VWHP9HUVLRQ 7KLVJXDUDQWHHVRSWLPDOVXSSRUWIRUDOOSRSXODUSURJUDPVDQG JDPHV Â 1RWH7KHVSHDNHUKHDGSKRQHVRXWSXWLVGHVLJQHGIRU DFWLYHVSHDNHUV\VWHPVRUKHDGSKRQHV3DVVLYHVSHDN HUVFDQQRWEHXVHGRULIWKH\DUHWKHTXDOLW\ZLOOEH VLJQLILFDQWO\UHGXFHG .21  .

'.1FDEOH7KHFRPPRQHQYLURQPHQW RID0.'.QWHUIDFHLVDQRSWLRQDOIHDWXUH+HUH \RXFDQFRQQHFWFRQWUROHTXLSPHQWOLNHDMR\VWLFNJDPHSDG RUVWHHULQJZKHHO.*$0(3257 7KH0.*DPHSRUW.'.'.QJHQHUDOWKHVHFRQWUROOHUVDUHXVHGLQ JDPHVRUVLPXODWLRQVWRJDLQUHDOLVWLFDQGHDV\FRQWURORIWKH SURJUDP6WHHULQJ:KHHOVFDQDGGDUHDOLVWLFIHHOLQJWRUDFLQJ JDPHV 0.HTXLSPHQW VRXQGFUHDWLRQRI NH\ERDUG6DPSOHUHWF.7+(0.'.'.LVDVWDQGDUGWKDWHQDEOHVH[FKDQJHRIGDWDEHWZHHQNH\ ERDUGVDQGVLPLODUHTXLSPHQWIRUPXVLFLDQV'DWDLVVHQWWRWKH UHVSHFWLYHHTXLSPHQWYLD'.LPSOLFDWLRQLV • .H\ERDUGSOD\VSDVVDJHVRUVLQJOHQRWHVLQDVHTXHQFHU SURJUDP • 7KHVHTXHQFHLVHGLWHGLQWKH3&DQGVWRUHGDVD0. )LOH • 7KH3&FRQWUROVWKH0.

*DPHSRUW 7KLVDGDSWHUFDQEHSXUFKDVHGLQPXVLFVSHFLDOLW\VKRSV 86%3257 • 'HYLFHVFRQQHFWHGGLUHFWO\WRWKH86%EXVVKRXOGQRW GUDZPRUHWKDQP$7KHYROWDJHRXWSXWLVSURWHFWHG E\DIXVH /LPLWHG3RZHU6RXUFHDFFRUGLQJWR(1. 7REHDEOHWRZRUNZLWK0.'.\RXZLOOQHHGDQDGDSWHUFDEOH WKDWLVFRQQHFWHGWRWKH0.'.

 6KRXOGWKHGHYLFHVQHHGPRUHSRZHUWKDQWKLVLWZLOO EHQHFHVVDU\WRSURYLGHDKXE GLVWULEXWRUERRVWHU.

  2QWKH86%LWLVSRVVLEOHWRFRQQHFWXSWRGHYLFHVZKLFK FRUUHVSRQGWRWKH86%VWDQGDUG DQGVXSSRUWHG.

21 . 7KHGDWDWUDQVIHUVSHHGLV0ELWRU0ELWGHSHQGLQJRQ WKHGHYLFHFRQQHFWHG86%FDQUHDFKXSWR0ELW   23(5$7.

5(:.5(..((( ).

&$7.216)25.((( • &RQQHFWLRQRIGLJLWDOGHYLFHVRIWKHHQWHUWDLQPHQW LQGXVWU\VXFKDVVHWWRSVSHDNHUVGLJLWDOYLGHR DQGFDPFRUGHUµ'LJLWDO9HUVDWLOH'LVN¶ '9'.21 237. 7KH.(((FRQQHFWRUDOVRNQRZQDVL/LQNŠRU)LUH:LUH LVDVHULDOEXVVWDQGDUGXVHGIRUUDSLGGLJLWDOGDWDH[FKDQJH $33/.

&$/63(&.&$7.).216  • 'HSHQGLQJRQWKHDSSOLFDWLRQWKHPD[LPXPGDWD WUDQVIHULVDERXWRU0ELWVFRUUH VSRQGLQJWRDGDWDWKURXJKSXWRIXSWR0%SHU VHFRQG 7KHGHYLFHFDQEHSOXJJHGLQRUXQSOXJJHGGXULQJ RSHUDWLRQ KRWSOXJJLQJ. WHOHYLVLRQHWF 0XOWLPHGLDDSSOLFDWLRQVDQGYLGHRSURFHVVLQJ .QSXWDQGRXWSXWGHYLFHVVXFKDVSULQWHUVVFDQ QHUVHWF • • 7(&+1.

 7KHVWDQGDUGLVHGFRUG µ6KLHOGHG7ZLVWHG3DLU¶ 673.

LQFOXGHVVWUDQGV7ZROLQHVDUHOLYH 9XS WR9$PD[.

DQGFDQEHXVHGDVDQH[WHU QDOSRZHUVXSSO\7KHIRXUVLJQDOOLQHVWUDQVIHU GDWDRUFRQWUROLQIRUPDWLRQ6RPHGHYLFHVGRQRW UHTXLUHDSRZHUVXSSO\YLDWKHFRUGVRWKDWIRXU SROHSOXJVDUHXVHG 7KHYROWDJHRXWSXWRIWKHSROH.(((MDFNLV SURWHFWHGE\DIXVH OLPLWHGSRZHUVRXUFHDFFRUG LQJWR(1.

 • • •  23(5$7.21  .

Q DQRWKHU VORW WKH 3& PD\ QRW EHDEOHWRVWDUW  62)7:$5()25<285 5$'./<RXFDQFRQWUROWKHSURJUDPZLWKWKH RSWLRQDOUHPRWHFRQWUROOHU VHH2QOLQHKHOSDQGRUVHSDUDWH 2SHUDWLQJ.21 .279781(5&$5' 7KH6RIWZDUHWRZDWFK79DQGOLVWHQWR5DGLREURDGFDVWVLV DOUHDG\LQVWDOOHGDQGFDQEHIRXQGLQ$OO3URJUDPV0HGLRQ +RPH&LQHPD.279781(5&$5'  7KH5DGLR797XQHU&DUGLVDQRSWLRQDOIHDWXUH3RVVLEO\ \RXU3&LVHTXLSSHGZLWKDVRFDOOHG&RPERERDUG<RXUHFRJ QLVHWKLVDWWKHPRGHPRU.7+(5$'.QVWUXFWLRQV.6'1MDFNRQWKHRXWVLGHLQDGGLWLRQ WRWKH795DGLRDQWHQQDVRFNHWV7KHQERWKGHYLFHVDUHOR FDWHGRQRQH&RPERERDUGUHTXLULQJDVSHFLDO&RPERVORW .QUHJDUGWRD&RPERERDUGWKHIROORZLQJPXVWEHREVHUYHG • 7KHLQVWDOODWLRQUHPRYDODQGFRQYHUVLRQRIDERDUG UHTXLUHWKHQHFHVVDU\WHFKQLFDOWUDLQLQJ3OHDVH UHDGWKHFKDSWHU³6DIHW\SUHFDXWLRQV´VWDUWLQJ RQSRUFRQVXOWD3&WHFKQLFLDQ .I\RXZRXOGOLNHWRXVHDGLIIHUHQWPRGHPRU .6'1ERDUGWKHEXLOWLQPRGHP797XQHU&RPER ERDUGPXVWQRWEHUHPRYHGRUSOXJJHGLQWRD GLIIHUHQWVORW 7KHEXLOWLQPRGHP797XQHU&RPERERDUGRQO\ ZRUNVSURSHUO\LQWKHLQWHQGHGEOXH&RPERVORW • • Â$77(17.

21 .H\3OHDVHNHHSLQPLQGWKDWUHFRUGLQJEURDGFDVWVFDQ RFFXS\XSWR*%SHUKRXU   23(5$7.*HWDGGLWLRQDOKHOSE\SUHVVLQJWKH ).

6$1(7:25.I\RXU3&LVSURYLGHGZLWKD)DVW(WKHUQHW1HWZRUNFRQQHF WRU\RXFDQFRQQHFWLWWRDQHWZRUN7KHIROORZLQJH[SODQD WLRQUHIHUVWR3&VZLWKDQHWZRUNFRQQHFWRU<RXZLOOILQGIXU WKHULQIRUPDWLRQDERXWQHWZRUNLQJLQWKH+HOSVHFWLRQZLWKLQ WKH6WDUWPHQX  :+$7." $QHWZRUNPHDQVFRQQHFWLQJ\RXU3&WRDQRWKHURUVHYHUDO RWKHU3&V8VHUVFDQWUDQVIHULQIRUPDWLRQDQGGDWDEHWZHHQ FRPSXWHUVDQGVKDUHUHVRXUFHVVXFKDVSULQWHUVPRGHPV DQGKDUGGLVNGULYHV +HUHDUHVRPHSUDFWLFDOH[DPSOHV • • • • <RXFDQH[FKDQJH(PDLODQGPDQDJHDSSRLQWPHQWVLQDQ RIILFH 8VHUVVKDUHDSULQWHULQDQHWZRUNDQGVDYHWKHLUGDWDRQ DFHQWUDOVHUYHU 6KDUHRQHPRGHPRURQH.7+(1(7:25. .QWHUQHWDFFHVV 7ZRRUPRUH3&VFDQEHFRQQHFWHGWRSOD\QHWZRUN JDPHVRUVKDUHGDWD  23(5$7.21  .6'1FDUGDPRQJFRPSXWHUV IRU.

:+$7'2<281((')251(7:25..1*" 6RPHUHTXLUHPHQWVKDYHWREHIXOILOOHGLI\RXZDQWWRPDNH 3&VFRPPXQLFDWHZLWKRQHDQRWKHU  7KH3&VPXVWKDYHWKHVDPHQHWZRUNFDUGVWKDWVXSSRUW WKHVDPHQHWZRUNWHFKQRORJ\8QOHVVRWKHUZLVHVWDWHG \RXU3&ZLOOVXSSRUWWKHFXUUHQWVWDQGDUG)DVW(WKHUQHW 0ELW.

  7KHQHWZRUNFDUGVPXVWEHFRQQHFWHGWRRQHDQRWKHU$OO \RXQHHGLVD6KLHOGHG7ZLVWHG3DLUFDEOH &$7.

I\RXZDQWWRFRQQHFWWZR3&V\RXQHHGD&URVV /LQNFDEOH .ZKLFK KDVDQ5-FRQQHFWRU .IPRUH3&VPXVWEHFRQQHFWHG\RXQHHGDVXSSOH PHQWDU\GLVWULEXWRU +XERU6ZLWFK.

3.21 .WLVWKHPRVWFRPPRQSURWRFRODQG PDQGDWRU\IRULQWHUQHWDFFHVV<RXQHHG.3 SUHFRQILJXUHG.63.DQGD3DWFK FDEOH  $OOFRQQHFWHG3&VQHHGDQHWZRUNLQJRSHUDWLQJV\VWHP 7KDW¶VWKHFDVHZLWK:LQGRZVŠ  $OOQHWZRUN3&VPXVWVSHDNWKHVDPH³ODQJXDJH´WRXQ GHUVWDQGRQHDQRWKHU)RUWKLVSXUSRVHWKH\XVHSURWR FROV 7KHQHWZRUNSURWRFROLVGHWHUPLQHGE\WKHLQWHJUD WLRQRIWKHFOLHQWVHUYHU/RDGLQJDOO3&VZLWKWKH VDPHFOLHQWIRUH[DPSOH³&OLHQWIRU0LFURVRIWŠ 1HWZRUNV´PHHWVWKHILUVWSUHUHTXLVLWH<RXU3&LI HTXLSSHGZLWKDQHWZRUNFRQQHFWLRQKDVEHHQSUH FRQILJXUHGZLWKWKLVVHUYHULQWKHIDFWRU\ $WUDQVSRUWSURWRFROLVUHTXLUHGVRGDWDFDQEHWUDQV SRUWHGYLDWKHQHWZRUN<RXUQHWZRUN3&KDV7&3. XVXDOO\RQO\LIDFFHVVLVUHTXLUHGWR1RYHOOŠQHWZRUNV -      23(5$7.

3LVSUHFRQILJXUHGVRWKDW WKHUHTXLUHGVHWWLQJVDUHDXWRPDWLFDOO\WDNHQIURPDVR FDOOHG'+&3VHUYHU 6LQFHXVXDOO\RQO\ODUJHQHWZRUNVDUHHTXLSSHGZLWKLW :LQGRZVŠ0(DQG:LQGRZVŠ.Q \RXUQHWZRUNFRPSXWHU7&3.WLVDOVRIDFWRU\LQVWDOOHG 7KHUHOHDVHLVDZDUGHGRQWKH3&ZKHUHWKHUHVRXUFH IROGHUVRUSULQWHUV. 7KHVHWWLQJRISURWRFROVWKHUHIRUHPXVWEHFRUUHFW.3RIIHUDPHFKDQLVP DXWRPDWLQJWKLVIXQFWLRQDQGDFFHSWLQJWKLVVHWWLQJ DXWRPDWLFDOO\ <RXFDQFDOOWKHVHVHWWLQJVLQWKHLQSXWUHTXHVWZLWK ipconfig /all  7KHFRUUHFWSURWRFROVPXVWEHHQDEOHGWRPDNHVKDUHG DFFHVVSRVVLEOH7KLVUHTXLUHVWKHLQVWDOODWLRQRIWKH VHUYHU³)LOHDQGSULQWHUUHOHDVHIRU0LFURVRIWŠQHW ZRUNV´.

DUHORFDWHG +HUHWKHUHOHDVHQDPHRULIQHFHVVDU\DUHTXLUHGSDVV ZRUGFDQEHGHWHUPLQHG $VXFFHVVIXOUHOHDVHLVLQGLFDWHGE\D VWUHWFKHGRXWKDQGEHORZWKHLFRQ   7KHUHOHDVHGUHVRXUFHVFDQEHVKRZQDQGOLQNHGYLDWKH QHWZRUNHQYLURQPHQW  23(5$7.21  .

:.5(/(66/$1 :LUHOHVV/$1LVDQRSWLRQDOIHDWXUH7KLVIXQFWLRQDOORZV\RX WRFUHDWHDZLUHOHVVQHWZRUNOLQNZLWKDSDUWQHU 6$)(7<127(6 Â$77$17.7.216 7KHSDUWQHUXVHGFDQEHDZLUHOHVVDFFHVVSRLQW$QDFFHVVSRLQWLV DZLUHOHVVWUDQVPLWWHUWKDWFRPPXQLFDWHVZLWK\RXUQRWHERRNDQGFR Q WUROVDFFHVVWRWKHQHWZRUNFRQQHFWLRQ HJDKRPHQHWZRUNRUD EURDGEDQGFRQQHFWLRQVXFKDV'6/.21'RQ¶WXVHWKLVIHDWXUHLQHQY LURQPHQWV ZKHUHKLJKO\VHQVLWLYHGHYLFHVDUHSODFHGVXFKDVLQKRVS L WDOVHWF7RDYRLGDQ\LQWHUIHUHQFHGLVDEOHWKLVRSWLRQLQ \RXUGHYLFHPDQDJHU &21'.

 :LUHOHVVDFFHVVSRLQWVDUHRIWHQIRXQGLQRIILFHVDLUSRUWVXQLYHUV L WLHVRU.QWHUQHWDFFHVVILOHVDQGSULQ W HUVDWKRPH\RXZLOOQHHGDQDFFHVVSRLQWDURXWHUDQGDEURDGEDQG '6/RUFDEOH.QWHUQHWFDIpV7KH\RIIHUDFFHVVWRHQWHUSULVHVHUYLFHVDQG QHWZRUNVRUWRWKH.QWHUQHW$FFHVVDXWKRUL]DWLRQVDUHQRUPDOO\ QHHGHG$IHHPD\EHUHTXLUHGWRXVHDSXEOLFDFFHVVSRLQW 7RVHWXSDZLUHOHVVQHWZRUNWRVKDUH.

((( JDQGLVFRPSDWLEOHWRWKHVWDQGDUG.QWHUQHWFRQQHFWLRQ 7KHZLUHOHVVQHWZRUNOLQNZRUNVDFFRUGLQJWRVWDQGDUG .PRGHP6RPHDFFHVVSRLQWVFDQDOVRVHUYHDVDURXWHU DQGRUDEURDGEDQGPRGHP&KHFNZLWK\RXUUHWDLOHUWRILQGWKHEHVW VROXWLRQIRU\RXUQHHGV $OLQNWRDQRWKHUFRPSXWHUZLWKZLUHOHVV/$1IXQFWLRQDOLW\FDQDOVR EHFUHDWHGZLWKRXWDQDFFHVVSRLQW7KLVZLOODOORZ\RXWRVKDUH ILOHVEXW\RXZLOOQHHGDQDFFHVVSRLQWDQGDURXWHUWRVKDUHDQ .(((E2WKHU VWDQGDUGV DHWF.

DUHQRWVXSSRUWHG .IHQFU\SWHGWUDQVPLVVLRQLVXVHGWKLVPXVWRSHUDWHDFFRUGLQJWR WKHVDPHSULQFLSOHRQDOOGHYLFHV(QFU\SWLRQLVDPHWKRGRISUR WHFWLQJWKHQHWZRUNIURPXQDXWKRUL]HGDFFHVV 7KHWUDQVPLVVLRQVSHHG PD[0ESV.

FDQYDU\DFFRUGLQJWRGLVWDQFH DQGRWKHUIDFWRUV.ILHWKHRWKHUGHYLFHVVXSSRUWWKHEVWDQGDUG WKHWUDQVPLVVLRQVSHHGFDQEHPD[0ESV 6HDUFKIRU³ZLUHOHVVQHWZRUNLQJ´LQ:LQGRZV+HOSDQG6XSSRUWIRU PRUHLQIRUPDWLRQ   23(5$7.21 .

WDSSHDUVWKDWWKHQHWZRUNERDUGVDUHXQDEOHWRFRP  PXQLFDWH:KDWPLJKWEHWKHSUREOHP" 0D\EHRQHRIWKHXVHGQHWZRUNERDUGVZRUNVZLWKD  GLIIHUHQWVSHHG HJLQVWHDG0ELW.FOLFNRQWKH  QHWZRUNHQYLURQPHQW" 7KHFRPSXWHUQDPHPXVWEHXQLTXHRQWKHQHW  ZRUNDQGPD\QRWEHWKHVDPHDVWKHWDVNJURXS .17+(1(7:25.1*:.7+. :K\GRHVWKHQHWZRUNHQYLURQPHQWQRWVKRZWKHUH  OHDVHV" 7KHQHWZRUNHQYLURQPHQWLVGHOD\HGLQWLPH&KHFN  WKHUHOHDVHE\VHDUFKLQJIRUWKHUHVSHFWLYHFRP SXWHUQDPH :K\GRHVDQHUURUPHVVDJHDSSHDUZKHQ.7528%/(6+227.

QDGGLWLRQFKHFNWKHSURWRFROVDQGWKHFRQILJX UDWLRQ 7KHGDWDWUDQVPLVVLRQLVLQFRUUHFWRUYHU\VORZ:KDW  PLJKWEHWKHSUREOHP" 0D\EH\RXKDYHWKHZURQJFDEOH 873&$7RU  ORZHU.IWZR3&VVKRXOGEHOLQNHG\RXUHTXLUHDFURVV OLQNFDEOHRWKHUZLVHXVHDSDWFKFDEOH  .DQG \RXUQHWZRUNFRPSXWHULVXQDEOHWRUHFRJQL]HWKLV .IQHFHVVDU\VHWWKHQHWZRUNGULYHUWRWKHFRPSDWL EOHVSHHG  .

21  .RUWKHSUREOHPLVWKHSUR[LPLW\RIDSRZHU FRUGRUDQRWKHUVRXUFHRILQWHUIHUHQFH )RUIXUWKHUKLQWVRQWURXEOHVKRRWLQJUHIHUWRWKH:LQGRZV KHOSXQGHU³1HWZRUNHUURUV´  23(5$7.

02'(0.6'1MDFN :+$7.6'1 7KLVFKDSWHULVLQWHQGHGIRUV\VWHPVHTXLSSHGZLWKDPRGHP RU.6$02'(0" 7KHWHUP³PRGHP´LVDQDEEUHYLDWLRQRI0RGXODWRU'(0RGXOD WRU$PRGHPFKDQJHVWKHELWVWUHDPRIWKH3&LQWRDQDORJXH VLJQDOVZKLFKWKHQFDQDOVREHWUDQVPLWWHGYLDWKHWHOHSKRQH OLQH PRGXODWLRQ.

7KHPRGHPRQWKHRWKHUVLGHUHYHUVHVWKH FRQYHUVLRQ GHPRGXODWLRQ.

1*8VHRQO\DQDORJXHWHOHSKRQH VRFNHWV7KHPRGHPFDQQRWZLWKVWDQGWKH YROWDJHOHYHOVRIGLJLWDOWHOHSKRQHV\VWHPV VXFK3$%.ELWV 6LQFHWKHSRZHURXWSXWRIPRGHPVLVUHVWULFWHGGXHWRWKH UHJXODWLRQVRIVRPHWHOHFRPPXQLFDWLRQSURYLGHUVWKHSRVVLEOH PD[LPXPGRZQORDGVSHHGFDQEHUHVWULFWHG7KHDFWXDOVSHHG PD\EHGHSHQGHQWRQWKHRQOLQHFRQGLWLRQVDQGRWKHUIDFWRUV 'DWDVHQWIURPWKHXVHUWRWKHVHUYHUDUHWUDQVPLWWHGZLWK .6'1GDWDDUHWUDQVPLWWHGGLJLWDOO\  7KHPRGHPLVILWWHGZLWKDQ5-LQWHUIDFHLQWRZKLFKD VWDQGDUGWHOHSKRQHOHDGFDQEHSOXJJHG.I\RXUPRGHPLVD FRPERFDUGSOHDVHPDNHVXUHWKDWLWLVXVHGRQO\ZLWKWKH DSSURSULDWHSRUW Â:$51.78 VWDQGDUGIRU9WUDQVPLVVLRQVZLWKXS.6'1RU%URDGEDQG VHUYLFHV   23(5$7.QWHUQHWSURYLGHURUFRPSDQ\RZQHGKRVW FRPSXWHU &RQWUDU\WRWKHPRGHP.RUOLQHVVXFKDV.6LPSOLILHGDPRGHPFRQYHUWVRXW JRLQJGDWDLQWRWRQHDQGWRQHLQFRPLQJYLDWKHWHOHSKRQHOLQH EDFNLQWRGDWD 7KHEXLOWLQPRGHPLVDEOHWRUHFHLYHGDWDDFFRUGLQJWRWKH.21 .ELWV3UHUHTXLVLWHIRUWKLVKLJKVSHHGUHFHSWLRQLVDQDQDORJXH WHOHSKRQHOLQHFRPSDWLEOHZLWKWKH9VWDQGDUGDQGDFRUUH VSRQGLQJFRPSDWLEOH.

9(75$.3RIIHUVGLIIHUHQWRSWLRQVWRXQGHUVWDQGLWVRSHUD WLRQ:HZLOOPHQWLRQRQO\DIHZRIWKRVHRSWLRQVKHUH :.12::.21±).3+(/3$1'6833257 $QDQVZHUWRDOPRVWHYHU\TXHVWLRQFDQEHIRXQGLQWKLVSUR JUDP<RX¶OOILQGLWLQWKH6WDUWPHQXRU\RXFDQODXQFKLWE\ VLPSO\SUHVVLQJWKH)NH\ 0.26DSSOLFDWLRQSURJUDPVDQGRSHUDWLQJV\VWHPV *(77.1*±67(3%<67(3 7UDLQLQJLVWKHEHVWZD\WRJHWVNLOOVZKLFKKHOSV\RXWRSHU IRUPDVSHFLILFWDVNVDYHDQGHIIHFWLYHO\ <RX¶OOILQGLWLQ³$OO3URJUDPV´³$FFHVVRULHV´.6(5.3 :LQGRZV.56767(3 7KLVPDQXDOZLOOSURYLGHJHQHUDOLQIRUPDWLRQDERXWWKHRSHUDW LQJV\VWHP:HUHFRPPHQGWKDWDOOEHJLQQLQJXVHUVRUXVHUV RISUHYLRXVYHUVLRQVRI:LQGRZVUHDGWKLVLQIRUPDWLRQ :.1'2:6.17(5$&7.3+20(('.1'2:6.$/&203257 7KHRSWLRQDOSLQVHULDOLQWHUIDFHLVXVHGDVWKHSRUWIRUVHULDO GHYLFHVVXFKDVPRGHPVFDUGUHDGHUVRUPLFH7KHLQWHUIDFHVDUH DGGUHVVHGDV&20RU&20DQGDUH).)2FRPSDWLEOH7R XVHWKHVHSRUWVLWLVQHFHVVDU\DVVWDQGDUGWRKDYHDVRFDOOHG QXOOPRGHPFDEOHZKLFKLVXVXDOO\VXSSOLHGZLWKWKHGHYLFHWREH FRQQHFWHG 62)7:$5( 7KLVVHFWLRQGHDOVZLWKVRIWZDUHGLIIHUHQWLDWLQJEHWZHHQ %.QIRUPDWLRQDERXW\RXU3&´ 7KLVLVDYHU\JRRGIHDWXUH  23(5$7.7.1'2:6.21  .1.WLVDOVR OLQNHGXSLQ³.&5262)7.1*72.

7.1*&'6'9'6 :HGHVFULEHWKHZULWLQJSURFHVVZLWKWKHVRIWZDUH1HUR± %XUQLQJ5203OHDVHIROORZWKLVLQVWUXFWLRQRQO\LI\RXXVH WKLVVRIWZDUH Â1RWH$ZULWLQJSURFHVVVKRXOGDOZD\VWDNH SODFHRQLWVRZQ3OHDVHWHUPLQDWHDOOUXQQLQJ SURJUDPV ID[UHFHSWLRQVFUHHQVDYHUV 3RZHU0DQDJHPHQWHWF.:5.

1*520 SURJUDPKDV HQKDQFHGIXQFWLRQVDQGLVSDUWLFXODUO\VXLWDEOH IRUWKHPRUHH[SHULHQFHGXVHU<RXFDQDOVR VWDUWWKLVSURJUDPIURPWKHDKHDG1HURIROGHU RUVZLWFKGLUHFWO\WRLWIURPWKH([SUHVVSUR JUDP Â)RUGHWDLOHGLQIRUPDWLRQUHDGWKHH[WHQVLYH 2QOLQH+HOS )NH\.1*1(52(.35(66 7RVWDUWQHUR([SUHVVSURFHHGDVIROORZV   &OLFN   1RZVHOHFW    7KHSURJUDPLVORFDWHGLQWKH³DKHDG1HUR³IROGHU DQGFDQEHVWDUWHGE\FOLFNLQJ³1HUR(.35(66³  $QLQWHUIDFHDSSHDUVWKDWDOORZV\RXWRHDVLO\FUHDWHGLI IHUHQWPHGLD)ROORZWKHLQVWUXFWLRQVRQWKHVFUHHQ Â1RWH7KHQHUR%851. 67$57.

    23(5$7.21 .

212)62)7:$5( .167$//$7..I\RXURSHUDWLQJV\VWHPLVFRQILJXUHGWKDWWKH LQVWDOODWLRQSURFHGXUHDFFHSWVRQO\VLJQHGGULYHUV GHIDXOW.WKDSSHQVWKDWGXULQJLQVWDOODWLRQSURFHGXUH LPSRUWDQWILOHVFDQEHFKDQJHGRUHYHQFDQ FHOOHG7RDYRLGHYHQWXDOSUREOHPVLQXVLQJ ROGHUILOHVDIWHULQVWDOODWLRQPDNHVXUHWR  VDIHJXDUG\RXUKDUGGLVN 7KHVRIWZDUHLQFOXGHGLQGHOLYHU\LVDOUHDG\SUHLQVWDOOHGLQ WKHIDFWRU\  1RWH.

DQGVRIWZDUHWKLVLQIRUPDWLRQVFUHHQZLOO DSSHDU  $OWKRXJKWKHVRIWZDUHODFNVWKHGLJLWDOVLJQDWXUHLW PD\ZRUNSURSHUO\&OLFNRQ³7HOOPHZK\WKLVWHVWLQJ LVLPSRUWDQW´WRJHWGHWDLOHGLQIRUPDWLRQ &RQILUPE\FOLFNLQJRQ³&RQWLQXH$Q\ZD\´  23(5$7.21  .

6.IWKHDXWRPDWLFVWDUWGRHVQRWZRUNLW LVOLNHO\WKDWWKHVRFDOOHG$XWRUXQIXQFWLRQ KDVEHHQGHDFWLYDWHG5HDGWKHUHVSHFWLYH FKDSWHULQ:LQGRZV+HOSRQKRZWRDFWLYDWH WKLVIXQFWLRQ $QH[DPSOHIRUWKHPDQXDOLQVWDOODWLRQZLWKRXWWKHDXWRUXQ IXQFWLRQ  &OLFNRQ DQGVHOHFWWKHLWHP  2UKLWá5WRODXQFKWKHFRUUHVSRQGLQJGLDORJ.6+2:72.7+.167$//<28562)7:$5( 3OHDVHIROORZWKHLQVWUXFWLRQRIWKHVRIWZDUHYHQGRU:HZLOO GHVFULEHDW\SLFDOLQVWDOODWLRQ2QFH\RXLQVHUWD&'WKHLQ VWDOODWLRQPHQXLVVWDUWHGDXWRPDWLFDOO\ Â1RWH.

21 .  1RZHQWHUWKHOHWWHURIWKH&'520GULYHIROORZHGE\ DFRORQDQGWKHSURJUDPQDPHVHWXS   &OLFNRQ³2.³  )ROORZWKHLQVWUXFWLRQJLYHQE\WKHSURJUDP   23(5$7.

62)7:$5('(.QRUGHUWRUHPRYHLQVWDOOHGVRIWZDUHIURP\RXU3&IROORZ WKHQH[WVWHSV  &OLFNRQ  &OLFNRQ   7KHQVHOHFWWKHIROORZLQJSURJUDP  6HOHFWWKHUHVSHFWLYHSURJUDPVWDUWWKHGHLQVWDOODWLRQDQG IROORZWKHLQVWUXFWLRQVRQWKHVFUHHQ .167$//$7.IWKHV\VWHPEHFRPHVXQVWDEOHGXHWRDFHUWDLQVRIWZDUHRU GULYHU\RXDUHDEOHWRUHFRYHUWKHVWDELOLW\RIWKHV\VWHP ZLWKYDULRXVPHWKRGV VHHVWDUWLQJRQSDJH.21 .

 7KHQ\RXGRQRWQHHGWRXQLQVWDOOWKHGULYHU  23(5$7.21  .

I QHFHVVDU\\RXFDQDFWLYDWH:LQGRZV.3DVRIWHQDVUH TXHVWHG <RXZLOOSUREDEO\QHHGWRDFWLYDWH:LQGRZV.26.:.QWHUQHW$FWLYDWLRQLVDYDLODEOH7KLVLVGXHWRWKHSUH DFWLYDWHG6/3YHUVLRQZKLFKUXQVZLWKDVSHFLDO3URGXFW.21 0LFURVRIWLVFRPPLWWHGWRWKHSURWHFWLRQRILQWHOOHFWXDOSURS HUW\ULJKWVDQGWKHUHGXFWLRQRIVRIWZDUHSLUDF\7KHUHIRUH :LQGRZV.9$7.3FRQWDLQVVRIWZDUHEDVHGSURGXFWDFWLYDWLRQ WHFKQRORJ\<RXUFRS\RI:LQGRZV.'ZKLFKFDQ EHIRXQGRQWKH&HUWLILFDWHRI$XWKHQWLFLW\VWLFNHURQ\RXU 3&KRXVLQJ:KHQ\RXFDOOSOHDVHLQIRUP\RXUDJHQWWKDW \RXDUHUXQQLQJDQ2(0 6/3.' +RZHYHUDFWLYDWLRQQHHGV\RXUXQLTXH3URGXFW.1'2:6$&7.3KDVDOUHDG\EHHQDFWL YDWHGIRU\RXU3& 3URGXFWDFWLYDWLRQLVQHHGHGLIVRPHFRPSRQHQWVRI\RXU3& KDYHEHHQUHSODFHGRU\RXXVHDQRQDXWKRUL]HG%.3E\WHOHSKRQH HYHQLI.

2121<2853& .IDQDFWLYDWLRQYLDWKHLQWHUQHWLVDFNQRZOHGJHGZLWKDQ HUURUPHVVDJH\RXVKRXOGSHUIRUPWKHIROORZLQJVWHSV 3OHDVHVHOHFWWKHWHOHSKRQHDFWLYDWLRQDQGFOLFNXQWLO WKHUHODWHGVFUHHQDSSHDUV 1RZFOLFNRQ&KDQJH3URGXFW.9$7.H\$QHZZLQGRZDS SHDUV(QWHUWKHSURGXFWNH\7KLVLVORFDWHGRQWKH&HU WLILFDWHRI$XWKHQWLFLW\ &2$.QIHZFDVHVLWPD\VWLOOEHUHTXLUHGWRDFWLYDWH:LQGRZV .3.YHUVLRQRIWKHVRIWZDUH 352'8&7$&7.

21 .RQWKHFRPSXWHU¶VFDV LQJ $FNQRZOHGJH\RXUHQWU\DQGIROORZWKHLQVWUXFWLRQVRQ WKHVFUHHQ1RWLI\\RXU0LFURVRIWFRQVXOWDQWLIQHFHV VDU\WKDW\RXKDYHDQ2(0OLFHQVH   23(5$7.

QWKH%.266(783 7+(%.26VHWXS \RXU3&¶V%DVLF&RQILJXUDWLRQ.%.266(783352*5$0 .

212)7+(%.IWKH3&KDVDOUHDG\EHHQVWDUWHGH[LW:LQ GRZVŠDQGUHERRW3ULRUWRUHERRWLQJWKH3&SUHVVWKHNH\ ª'HO©DQGNHHSLWSUHVVHGXQWLOWKHPHVVDJHª(QWHULQJ 6HWXS©DSSHDUV  23(5$7.21  .266(783 <RXFDQRQO\H[HFXWHWKHFRQILJXUDWLRQSURJUDPZKHQVWDUW LQJWKHV\VWHP.(&87.\RXKDYH DQXPEHURISDUDPHWHUVHWWLQJVDYDLODEOHIRU\RXU3&)RU H[DPSOH\RXFDQFKDQJHWKHRSHUDWLQJPRGHRIWKHLQWHU IDFHVVHFXULW\IHDWXUHVRUSRZHUPDQDJHPHQW 7KH3&LVIDFWRU\SUHVHWWRJXDUDQWHHRSWLPXP RSHUDWLRQ3OHDVHRQO\PRGLI\WKHSDUDPHWHUVLI WKLVLVDEVROXWHO\HVVHQWLDODQGLI\RXDUHIDPLOLDU  ZLWKWKHFRQILJXUDWLRQSRVVLELOLWLHV (.

  23(5$7.21 .

&KDSWHU  &XVWRPHU6HUYLFH 6HOI+HOS 6XEMHFW 3DJH             'DWDDQG6\VWHP6HFXULW\«««««««««« 6\VWHP5HFRYHU\««««««««««««««« )$4±)UHTXHQWO\$VNHG4XHVWLRQV««««« 7URXEOHVKRRWLQJ«««««««««««««««« 'ULYHU6XSSRUW««««««««««««««««« &OHDQLQJDQG&DUH««««««««««««««« 5HF\FOLQJDQG'LVSRVDO«««««««««««« 7UDQVSRUW«««««««««««««««««««« 8SJUDGHVDQG5HSDLUV««««««««««««   .

& (   6 ( / )  + ( / 3 .   & 8 6 7 2 0 ( 5  6 ( 5 9 .

IWKHXVHUVKRXOGIRUJHW KLVKHUSDVVZRUGWKHSDVVZRUGFDQEHUHVHWZLWKWKHSDVVZRUG UHVHWGLVNVRWKDWWKHXVHUKDVDFFHVVDJDLQWRKLVKHUORFDOXVHU DFFRXQW :LQGRZV+HOSGHVFULEHVKRZWRFUHDWHDSDVVZRUGUHVHWILOH  6 ( / )  + ( / 3  .7< %DFNXSGDWDUHJXODUO\RQH[WHUQDOPHGLDVXFKDVD&'5RU &'5::LQGRZVRIIHUVERWKD%DFNXSSURJUDPDQGD)LOHV DQG6HWWLQJV7UDQVIHU:L]DUG <RXZLOOILQGERWKSURJUDPVLQ$FFHVVRULHV6\VWHP7RROV ZLWKLQWKH6WDUWPHQX0DNHDEDFNXSGLVNZLWKDOO\RXU SDVVZRUGVDQGWKHRSHUDWLQJV\VWHP¶VRULJLQDOFRQILJXUDWLRQ 0$.17(1$1&(352*5$06 <RXFDQDYRLGVRPHKDUGZDUHDQGVRIWZDUHHUURUVZLWKWKH KHOSSURJUDPVVXFKDV'LVN'HIUDJPHQWHUDQG'LVN &OHDQXS7KHKHOSSURJUDP6\VWHP./( 7RSURWHFWLQGLYLGXDOXVHUDFFRXQWVIURPFRPSOLFDWLRQVUHVXOW LQJIURPORVWSDVVZRUGVXVHUVVKRXOGFUHDWHDSDVVZRUGUH VHWGLVNDQGNHHSLWLQDVDIHSODFH.7< 7KHSURJUDPVGHVFULEHGEHORZDUHSDUWRI\RXU:LQGRZVRS HUDWLQJV\VWHP<RXZLOODGGLWLRQDOLQIRUPDWLRQRQWKHVHSUR JUDPVLQWKH:LQGRZV+HOSILOH '$7$6(&85.QIRUPDWLRQFDQDOVR EHKHOSIXOVLQFHLWJLYHV\RXGHWDLOHGLQIRUPDWLRQDERXW\RXU V\VWHPFRQILJXUDWLRQ<RXZLOOILQGWKHVHSURJUDPVLQ$FFHV VRULHV6\VWHP7RROVWRR 3$66:25'5(6(7).6(/)+(/3 '$7$$1'6<67(06(&85.

21 :LQGRZV[SLQFOXGHVYDULRXVIXQFWLRQVHQVXULQJWKDWWKH3&DV ZHOODVWKHLQVWDOOHGDSSOLFDWLRQVDQGGHYLFHVZRUNFRUUHFWO\ 7KHVHIXQFWLRQVDVVLVW\RXLQVROYLQJWKHSUREOHPVZKLFK PLJKWRFFXUE\DGGLQJGHOHWLQJRUUHSODFLQJILOHVUHTXLUHGIRU WKHIXQFWLRQDOLW\RIWKHRSHUDWLQJV\VWHPWKHDSSOLFDWLRQV DQGGHYLFHV7KHUHFRYHU\IXQFWLRQRUIXQFWLRQV\RXXVHGH SHQGRQWKHW\SHRIRFFXUULQJSUREOHPRUHUURU)RUGHWDLOHG LQIRUPDWLRQUHIHUWRWKH:LQGRZVKHOS (QWHUWKHVHDUFKZRUG³2YHUYLHZRYHUWKHUHSDLU´LQRUGHU WRHYDOXDWHZKLFKRIWKHIROORZLQJIXQFWLRQVLVWKHVDIHVWZD\ WRFRUUHFW\RXUSUREOHP %DFNXS5HFRYHU\RIWKHGULYHU'HDFWLYDWLRQRIWKHGHYLFH 6\VWHPUHFRYHU\/DVWIXQFWLRQNQRZQWRZRUN6HFXUHG PRGHDQGV\VWHPUHFRYHU\5HFRYHU\FRQVROH:LQGRZVLQ VWDOODWLRQ&' 3OHDVHUHIHUWRWKH WRRO   & 8 6 7 2 0 ( 5  6 ( 5 9 .6<67(05(&29(5< :LQGRZV[SSURYLGHVDXVHIXOIXQFWLRQHQDEOLQJWKHVWRUDJHRI WKHVRFDOOHG5HFRYHU\SRLQWV 7KHV\VWHPUHPHPEHUVWKHFXUUHQWFRQILJXUDWLRQDVDVQDS VKRWDQGUHWXUQVWRWKLVLIQHFHVVDU\7KHDGYDQWDJHLVWKDW DQXQVXFFHVVIXOLQVWDOODWLRQFDQEHFDQFHOOHG 5HFRYHU\SRLQWVDUHFUHDWHGDXWRPDWLFDOO\E\WKHV\VWHP EXWWKH\FDQDOVREHVHWPDQXDOO\ <RXFDQGHWHUPLQHDQGFRQILJXUH\RXUVHOIWKHPD[LPXP PHPRU\WDNHQXSE\WKLV<RXILQGWKLVSURJUDPLQWKHSUR JUDPILOHXQGHUDFFHVVRULHVV\VWHPSURJUDPV :HUHFRPPHQGVHWWLQJDUHFRYHU\SRLQWEHIRUHLQVWDOOLQJD QHZVRIWZDUHRUGULYHU.IWKHV\VWHPGRHVQRWUXQVWDEOHDQ\ ORQJHUWKLVHQDEOHV\RXXVXDOO\WRUHWXUQWRDZRUNDEOHFRQ ILJXUDWLRQZLWKRXWGHOHWLQJQHZO\FUHDWHGGRFXPHQWV.QWKH QH[WSDUDJUDSKUHDG\RXURSWLRQVIRUDUHSDLURIDQLQFRUUHFW LQVWDOODWLRQ &255(&7. & (   6 ( / )  + ( / 3 .

QWHU QHW7RVHOHFWWKLVRSWLRQJRWR6WDUWÖ3URJUDPVÖ:LQ GRZV8SGDWH 7KHXSGDWHFDQRQO\EHH[HFXWHGYLDWKH.1*6  6KRXOG\RXUV\VWHPQRWIXQFWLRQFRUUHFWO\\RXKDYHWKHRS SRUWXQLW\WRUHFRYHUWKHRULJLQDOVHWXS 8VHWKHLQFOXGHGDSSOLFDWLRQVXSSRUWGLVNWRGRWKLV7KLVUH FRYHU\PHWKRGRIIHUV\RXVHYHUDOSRVVLELOLWLHVIRUV\VWHPUH FRYHU\ 6\VWHPUHFRYHU\IURPKDUGGLVN 5HEXLOGVWDUWILOHV 5HEXLOGV\VWHPDQGGULYHUILOHV 5HWXUQWRVKLSSLQJVWDWXV  6 ( / )  + ( / 3  .QWHU Â QHW(QVXUHWKDW\RXDUHRQOLQHZLWK\RXU QRWHERRNZKHQGRZQORDGLQJWKHXSGDWHV  5(6725.1*7+()$&725<6(77.:.1'2:6Š83'$7( 7RNHHS\RXUQRWHERRNXSWRGDWHWRWKHODWHVWYHUVLRQZH UHFRPPHQGWRUHJXODUO\UXQ:LQGRZV8SGDWHIURPWKH.

/.762)7+(5(&29(5< • &KDQJHVPDGHWRWKHRULJLQDOFRQILJXUDWLRQ 5$6'HVN WRSRU.0.QWHUQHWVHWWLQJV.

DQGLQVWDOOHG6RIWZDUHZLOOEHLJ QRUHGE\WKLV5HFRYHU\DQGZLOOQRWEHUHORDGHG 'ULYHU8SGDWHVRUKDUGZDUHLQVWDOOHGE\\RXZLOOEHLJ QRUHGE\WKLV5HFRYHU\ %HZDUH$OOGDWDRQGULYH&ZLOOEHHUDVHG.IQHFHVVDU\ EDFNXSDOOUHTXLUHGGDWDRQGULYH' • • 7KLVUHFRYHU\ZLOOUHVHW\RXUV\VWHPWRLWVFRQGLWLRQDWGHOLY HU\3ULQWHULQVWDOODWLRQVRURWKHUDGGLWLRQDOVRIWZDUHPXVWEH UHLQVWDOOHG<RXZLOODOVRQHHGWRHQWHUWKH3URGXFW.H\ /L FHQVH1XPEHU.

& (   6 ( / )  + ( / 3 .1*287$5(6725(  )LUVWSOHDVHUHDGWKHHQWLUH5HVWRUHVHFWLRQRIWKH:LQ GRZV+HOSILOH  .DQGDOO RWKHU)$&725<.ILOHVWRD&'5HFRUGDEOH &$55<.QVHUWWKH6XSSRUW&'DQGUHERRWWKH3& Â$WWHQWLRQ'RQRWXVHWKH3URGXFW5HFRYHU\ &'520IRUUHVWRUDWLRQSXUSRVHV7KLVGLVN GRHVQRWUHVWRUHWKHRULJLQDOVHWXS<RXFDQ XVHLWZKHQDQLQGLYLGXDOVHWXSLVUHTXLUHG  6HOHFWWKHRSWLRQ6WDUWIURP&'520  )ROORZWKHRQVFUHHQLQVWUXFWLRQV  7KH3&UHVWDUWVWRLWVRULJLQDOIDFWRU\VHWWLQJV   & 8 6 7 2 0 ( 5  6 ( 5 9 .I\RXGHOHWHWKHGLUHFWRU\ (?5HFRYHURUWKHILOHVORFDWHGWKHUHDUHFRY HU\LVQRORQJHUSRVVLEOH)RUVDIHW\UHDVRQV \RXFDQFRS\WKHILOH)$&725<34.DJDLQ Â$WWHQWLRQ.

SHUIRUPDGDWDEDFNXS"  8VHWKHSURJUDP%DFNXSIRUWKLV .216  :KHQGR.KDYHWRDFWLYDWH:LQGRZV" <RXU VRIWZDUH KDV EHHQ SUHDFWLYDWHG LQ WKH IDFWRU\  $QDFWLYDWLRQZLOORQO\EHUHTXLUHGLI VHYHUDOFRPSRQHQWVDUHUHSODFHGE\RWKHUV \RXLQVWDOODQHZPRWKHUERDUG DGLIIHUHQW%.WLVLPSRUWDQWWKDW\RXIROORZWKHRSHUDWLQJLQVWUXF WLRQVRIWKLVSURJUDP 0DNHDEDFNXSDQGDQRWKHUEDFNXSRIVHOHFWHGGDWD WRDQH[WHUQDOPHGLXP &'5.('48(67.)$4±)5(48(17/<$6.26YHUVLRQKDVEHHQLQVWDOOHG \RXLQVWDOOWKHVRIWZDUHWRDQRWKHUFRPSXWHU   :KDWLVWKH:LQGRZVDFWLYDWLRQ" <RXURSHUDWLQJLQVWUXFWLRQVLQFOXGHDFKDSWHUDERXW  WKLVVXEMHFW   +RZGR.

WRIDPLOLDULVH\RXU VHOIZLWKWKHWHFKQLTXH $EDFNXSLVXQVXLWDEOHLI\RXDUHQRWDEOHWRUHFRYHU WKHGDWDWKHPHGLXP &'5&'5:.

LVGHIHFWLYHRU QRORQJHUDYDLODEOH  6 ( / )  + ( / 3  .

  'R.VWLOOKDYHWRLQVWDOOWKHHQFORVHG&'V'9'V" 1R%DVLFDOO\DOOSURJUDPVDUHDOUHDG\SUHLQVWDOOHG  7KHGLVNVDUHRQO\LQWHQGHGDVEDFNXSFRSLHV  :KHQLVWKHUHFRYHU\RIWKHIDFWRU\VHWWLQJUHFRP  PHQGHG" 7KLVPHWKRGVKRXOGEHFKRVHQDVWKHODVWUHVRUW  5HDGFKDSWHU³6\VWHPUHFRYHU\´RQSDJHFRQ FHUQLQJWKHDOWHUQDWLYHVSRVVLEOH  :K\LVWKHERRWSDUWLWLRQPLVVLQJZKHQERRWLQJIURP  WKHVXSSRUWDSSOLFDWLRQ&'" 7KHILUVWSDUWLWLRQLVIRUPDWWHGZLWKWKHILOHV\VWHP  17)6&RPSDUHGWR)$7WKLVILOHV\VWHPRIIHUV PRUHVHFXULW\DQGDPRUHHIILFLHQWDFFHVV+RZHYHU 17)6SDUWLWLRQVFDQRQO\EHUHDGIURPRSHUDWLQJV\V WHPVVXSSRUWLQJWKLV7KLVLVQRWWKHFDVHLQWKH DIRUHPHQWLRQHG&'   & 8 6 7 2 0 ( 5  6 ( 5 9 . & (   6 ( / )  + ( / 3 .

&86720(56(59.6(7+(&$86( (UURUVFDQKDYHVLPSOHFDXVHVEXWVRPHWLPHVWKH\DUH FDXVHGE\IDXOW\HTXLSPHQW:HZRXOGOLNHWRJLYH\RXVRPH LGHDVWRVROYHFRPPRQSUREOHPV6KRXOGWKHVHLQVWUXFWLRQV QRWOHDGWRVXFFHVVSOHDVHIHHOIUHHWRFDOOXV &KHFN&DEOHVDQG&RQQHFWLRQV 9LVLEO\FKHFNDOOFDEOHVDQGFRQQHFWLRQV6KRXOGDOOOLJKWVEH RIIFKHFNZKHWKHUDOOHTXLSPHQWLVVXSSOLHGZLWKSRZHU • • &KHFNSRZHUSRLQWVSRZHUFDEOHDQGDOOSRZHUVZLWFKHV 6ZLWFKRIIWKH3&DQGFKHFNDOOFDEOHFRQQHFWLRQV&KHFN WKHFRQQHFWLRQVWRSHULSKHUDOV'RQRWH[FKDQJHFDEOHV HYHQWKRXJKWKH\PD\ORRNVLPLODU7KHSRODULW\LQWKRVH FDEOHVPD\EHGLIIHUHQW:KHQLWLVFRQILUPHGWKDWWKH FRPSXWHUKDVSRZHUDQGDOOFRQQHFWLRQVDUHFRUUHFWWXUQ WKHFRPSXWHURQDJDLQ )UHTXHQWXVHRIWKHSURJUDPV'LVN'HIUDJPHQWHUDQG'LVN &OHDQXSZLOOKHOS\RXWRDYRLGSUREOHPVZLWK\RXURSHUDWLQJ V\VWHP  & 8 6 7 2 0( 5 6 ( 5 9 .&( 7528%/(6+227.1* /2&$/.& (   .

(55256$1'3266.&KHFNWKDWWKHFDEOHLVIXOO\FRQQHFWHG  :URQJ'DWHDQG7LPH .&KHFNWKDW5HJLRQDO6HWWLQJVDUHVHWWR(QJOLVK %ULW LVK8QLWHG.%/(&$86(6 7KHPRQLWRULVEODQN .'RXEOHFOLFNWKHFORFNRQWKHWDVNEDUDQGFRUUHFWWKHGDWH DQGWLPH .&RQILUPWKDWWKHV\VWHPLVQRWLQVWDQGE\PRGH3UHVV DQ\NH\RQWKHNH\ERDUGWRWHVWWKLVRXW .LQJGRP.

&KHFNZKHWKHUWKH&'LVLQVHUWHGFRUUHFWO\ .  1RGDWDFDQEHDFFHVVHGIURPWKH&'520'ULYH .VWKH&'520 'ULYH(..

GLVSOD\HGLQ:LQGRZV([SORUHU" .IVRWHVWDQRWKHU&'  7KH3ULQWHUGRHVQRWZRUN .'RD3ULQWHU6HOI7HVW .QWHUQHWGRZQORDGDQGLQVWDOO WKHODWHVWGULYHUVIURPWKHPDQXIDFWXUHU¶V:HEVLWH    & 8 6 7 2 0 ( 5  6 ( 5 9 . & (   6 ( / )  + ( / 3 ..I\RXKDYHDFFHVVWRWKH.&KHFNWKHSULQWHUFDEOH .6KRXOGVHYHUDOSLHFHVRIHTXLSPHQWEHRSHUDWLQJIURPWKH VDPHSRUWFKHFNDOOSHULSKHUDOVDQGUHLQVWDOOWKHGULYHUV .

WIXOILOVDOOUHTXLUHGVWDQ GDUGVDQGFRPSOLHVZLWKWKHVWDQGDUG³'HVLJQHGIRU:LQGRZV´ ZKLFKFHUWLILHVXWPRVWFRPSDWLELOLW\ +RZHYHURIWHQWKHVRIWZDUHGULYHUVIRULQGLYLGXDOFRPSRQHQWV DUHXSGDWHGIURPWLPHWRWLPH7KLVLVDUHJXODUSURFHVVSUR YLGHGE\WKHPDQXIDFWXUHGWRPHQGSRVVLEOHFRPSDWLELOLW\SURE OHPVWKDWPD\RFFXUZLWKFRPSRQHQWV HJSURJUDPVRUKDUG ZDUH.'5.9(56833257 7KLV3&KDVEHHQH[WHQVLYHO\WHVWHGLQRXUODERUDWRULHVZLWKD ODUJHQXPEHURIFRPSDWLEOHGHYLFHV.

QWHUQHW   9LVLW0HGLRQRQWKH:HEDW ZZZPHGLRQFRP  $''.& (   .21$/6833257 .I \RX KDYH EHHQ JLYHQ D FXVWRPHU QXPEHU SUHYLRXVO\ SOHDVHTXRWHWKLV  & 8 6 7 2 0( 5 6 ( 5 9 .IWKHVXJJHVWLRQVLQWKHDERYHVHFWLRQKDYHQRWVROYHG\RXU SUREOHPSOHDVHFRQWDFWWKHVHUYLFHKRWOLQHDQGZHZLOODWWHPSW WRKHOS\RXVROYHWKHSUREOHP%HIRUH\RXFRQWDFWWKH7HFKQRO RJ\&HQWUHKRZHYHUSOHDVHKDYHWKHIROORZLQJLQIRUPDWLRQ DYDLODEOH +RZLV\RXUFRPSXWHUFRQILJXUHG" :KDWDGGLWLRQDOSHULSKHUDOVGR\RXXVH" :KDWPHVVDJHVLIDQ\DSSHDURQ\RXUVFUHHQ" :KDWVRIWZDUHZHUH\RXXVLQJZKHQWKHHUURURFFXUUHG" :KDW VWHSV KDYH \RX DOUHDG\ XQGHUWDNHQ WR VROYH WKH SUREOHP" +DYH\RXXSJUDGHGRUUHPRYHGGULYHUVRUKDUGZDUH" &DQ\RXPDQXDOO\UHSHDWWKHSUREOHP" .7.WKDWZHUHQRWWHVWHGDWWKHWLPHRI\RXU3&¶VPDQXIDF WXUH'ULYHUXSGDWHVDQGWKHODWHVWLQIRUPDWLRQRQ\RXUSURGXFW DUHDYDLODEOHRQWKH.

6326$/ 7KLV3&DQGLWVSDFNDJLQJZDVSURGXFHGPRVWO\IURPPDWHUL DOVZKLFKFDQEHGLVSRVHGRILQDQHQYLURQPHQWDOO\IULHQGO\ PDQQHUDQGEHSURIHVVLRQDOO\UHF\FOHG $IWHULWVXVHWKHFRPSXWHUZLOOEHWDNHQEDFNDQGUHF\FOHGRU XVHZLOOEHPDGHRILWVXVHIXOPDWHULDOLILWLVUHWXUQHGLQD FRQGLWLRQFRUUHVSRQGLQJWRLWVLQWHQGHGXVH 3DUWVQRWXVDEOHZLOOEHSURSHUO\GLVSRVHGRI Â$77(17.1*$1''.1*$1'&$5( 7KHOLIHWLPHRIWKH3&FDQEHH[WHQGHGE\WDNLQJWKHIROORZ LQJPHDVXUHV  • %HIRUHFOHDQLQJDOZD\VUHPRYHWKHSRZHUSOXJDQG DOOFRQQHFWLQJFDEOHV • &OHDQWKH3&ZLWKDGDPSOLQWIUHHFORWK  • :DUQLQJ7KHUHDUHQRXVHUVHUYLFHDEOHRU XVHUFOHDQDEOHSDUWVLQVLGHWKH3&KRXVLQJ    • '2127XVHDQ\VROYHQWVFRUURVLYHRU JDVHRXVFOHDQLQJDJHQWV • '2127XVH&'520FOHDQLQJGLVNVRU VLPLODUSURGXFWVWKDWFOHDQWKHOHQVRIWKH ODVHUWRFOHDQ\RXU&'520&'5:'9' GULYH   5(&<&/.217KHUHLVDOLWKLXPEDWWHU\ 7\SH 6RQ\Œ&5.&/($1.

& (   6 ( / )  + ( / 3 .RQWKHPRWKHUERDUG1R W\SHRIEDWWHU\EHORQJVLQWKHKRXVHKROG ZDVWH$OODUHWDNHQEDFNIUHHRIFKDUJHE\WKH PDQXIDFWXUHUGHDOHURUWKHLUUHSUHVHQWDWLYHV IRUDSURSHUPHWKRGRIXWLOLVDWLRQRUGLVSRVDO 6KRXOG\RXKDYHDQ\TXHVWLRQVFRQFHUQLQJWKHGLVSRVDO SOHDVHFRQWDFW\RXUGHDOHURURXUVHUYLFH   & 8 6 7 2 0 ( 5  6 ( 5 9 .

%$77(5<75($70(17 %DWWHULHVPD\FRQWDLQFRPEXVWLEOHPDWHULDOV%\PLVXVHWKLV PD\FDXVHEDWWHU\OHDNDJHKHDWH[SORVLRQRULJQLWLRQ EULQJLQJDERXWLQMXU\RUGDPDJHWRWKHGHYLFH  3OHDVHREVHUYHVWULFWO\WKHIROORZLQJPDWWHUV  .IE\DQ\FKDQFHWKHEDWWHULHVDUHVZDOORZHGFRQVXOWD GRFWRULPPHGLDWHO\  '2127&+$5*(EDWWHULHV H[FHSWUHFKDUJHDEOHEDWWHU LHV.((3&+./'5(1$:$<IURPEDWWHULHV .

6326(2).1).5(  '2127'.6&+$5*(EDWWHULHV  '21276+257&.  '2127)25&.6$66(0%/(RU'()250EDWWHULHV <RXUKDQGVDQGILQJHUVPD\EHLQMXUHGRUWKHOLTXLGRI WKHEDWWHU\PD\JHWLQWR\RXUH\HVRUDGKHUHWR\RXU VNLQ.IWKLVKDSSHQVULQVHZLWKDODUJHTXDQWLW\RIZDWHU LPPHGLDWHO\DQGFRQVXOWDGRFWRU  '2127H[SRVHEDWWHULHVWRVWURQJLPSDFWE\GURSSLQJ RUWKURZLQJWKHEDWWHULHV  '2127UHYHUVHWKHSRVLWLYH .7EDWWHULHV  '2127+($7RU'.5&8.%/<'.

DQGQHJDWLYH .

XVHGDQGQHZRUGLIIHUHQWW\SHVRIEDWWHU LHVWRJHWKHU <RXUHTXLSPHQWPD\QRWRSHUDWHSURSHUO\.QDGGLWLRQ WKHEDWWHU\H[KDXVWHGILUVWPD\EHH[FHVVLYHO\GUDLQHG RYHUGLVFKDUJHG.WHU PLQDOVWRDYRLGVKRUWFLUFXLW  'R1270..

& (  .(6ZLWKQHZEDWWHULHVRIWKH VDPHW\SHDWWKHVDPHWLPH   & 8 6 7 2 0( 5 6 ( 5 9 .  5(029(352037/<WKHXVHGEDWWHULHVIURPWKHGH YLFH  5(3/$&($//%$77(5.

& (   6 ( / )  + ( / 3 .1$/SDUWVZLWKWDSHRUWKHOLNH DWWKHVWRUDJHRUGLVSRVDORIWKHEDWWHULHV  '2127WKURZUXQGRZQEDWWHULHVLQWKHGRPHVWLFUH IXVHV5HVSHFWWKHHQYLURQPHQWDQGWKURZWKHPLQWKH VSHFLILFFRQWDLQHUVIRUVHSDUDWHFROOHFWLRQ.IQHFHVVDU\ WXUQWR\RXUUHVHOOHURUWRRXUVHUYLFHDVVLVWDQFH7KDQN \RX    & 8 6 7 2 0 ( 5  6 ( 5 9 .168/$7(7+(7(50. .

75$163257.1*7+( 3& 3OHDVH REVHUYH WKH IROORZLQJ JXLGHOLQHV ZKHQ WUDQVSRUWLQJ WKH3& • 7RDYRLGGDPDJHGXULQJWUDQVSRUWVWRUHWKH3&LQLWV RULJLQDOSDFNDJLQJ • :DLWXQWLOWKH3&KDVUHDFKHGDPELHQW URRP.

56 • 2QO\DTXDOLILHGHQJLQHHUVKRXOGSHUIRUPXSJUDGHVDQG UHSDLUVWR\RXU3& • .WHPSHUDWXUH EHIRUHFRQQHFWLQJLWWRWKHSRZHUVXSSO\'UDVWLFYDULDWLRQV LQWHPSHUDWXUHDQGKXPLGLW\FDQFUHDWHFRQGHQVDWLRQ ZLWKLQWKH3&DQGPD\FDXVHLWWRVKRUWFLUFXLW 83*5$'(6$1'5(3$.QWHUQDOFRPSRQHQWVRIWKH3&PD\EHGDPDJHGE\ HOHFWURVWDWLFGLVFKDUJH (6'.IWKH3&KDVQRWEHHQGLVFRQQHFWHGIURPWKH SRZHURXWOHWEHIRUHEHLQJRSHQHGWKHUHLVDGDQJHUWR OLIHWKURXJKHOHFWULFVKRFN7KHUHLVDOVRDULVNRIGDP DJHWRWKHFRPSRQHQWV .I\RXGRQRWKDYHWKHQHFHVVDU\TXDOLILFDWLRQVJRWRDQ DSSURSULDWH6HUYLFH(QJLQHHU3OHDVHFRQWDFWRXU6HU YLFH&HQWUHLI\RXDUHH[SHULHQFLQJWHFKQLFDOSUREOHPV ZLWK\RXU3& 127(6)256(59.1((56 • %HIRUHRSHQLQJWKHKRXVLQJGLVFRQQHFWWKH3&IURP DOOSRZHUVRXUFHVDQGUHPRYHDQ\FRQQHFWLQJFD EOHV.&((1*.

IQRVXFKZRUNVKRSLVDYDLODEOHZHDUDQDQWLVWDWLF ZULVWVWUDSRUWRXFKDKLJKO\FRQGXFWLYHPHWDOREMHFW 0HGLRQFDQUHSDLUGDPDJHVXVWDLQHGE\LQDSSURSULDWH KDQGOLQJIRUDIHH 8VHRQO\RULJLQDOVSDUHSDUWV • •   & 8 6 7 2 0( 5 6 ( 5 9 .&DUU\RXWV\VWHPXS JUDGHVDQGFKDQJHVLQDQ(6'SURWHFWHGZRUNVKRS .& (   .

& (   6 ( / )  + ( / 3 . Â&DXWLRQ/LWKLXPEDWWHULHVFDQQRWKDQGOHLQ WHQVHSUHVVXUHKLJKWHPSHUDWXUHVRUILUH 'DQJHURIH[SORVLRQLIUHSODFHGLQFRUUHFWO\ 5HSODFHEDWWHULHVZLWKDFRPSDWLEOHW\SHDV UHFRPPHQGHGE\WKHPDQXIDFWXUHU /LWKLXPEDWWHULHVDUHKD]DUGRXVZDVWHDQGUH TXLUHSURSHUGLVSRVDO&RQWDFWWKH6HUYLFH &HQWUHIRUDGGLWLRQDOLQIRUPDWLRQRQEDWWHU\ GLVSRVDO 1RWHVRQ/DVHU5DGLDWLRQ /DVHUGHYLFHVRI/DVHU&ODVVWR/DVHU&ODVVEPD\EHXVHG LQWKH3&:KHUHWKH3&KRXVLQJUHPDLQVFORVHGWKHGHYLFH PHHWVWKHUHTXLUHPHQWVRI/DVHU&ODVV%\RSHQLQJWKH3& KRXVLQJ\RXZLOOJDLQDFFHVVWRODVHUGHYLFHVRIXSWR/DVHU &ODVVE 7KH&'520&'5:'9'GULYHVLQVWDOOHGFRQWDLQQRXVHU VHUYLFHDEOHSDUWV :KHQUHPRYLQJDQGRURSHQLQJODVHUGHYLFHVWKHIROORZLQJ JXLGHOLQHVPXVWEHREVHUYHG • • • 2QO\WKHPDQXIDFWXUHUVKRXOGSHUIRUPUHSDLUVWRWKH &'520&'5:'9'GULYHV '2127ORRNLQWRWKHODVHUEHDPHYHQZKLOHZHDULQJ RSWLFDOSURWHFWLRQ '2127DOORZ\RXUVHOIWREHH[SRVHGWRWKHODVHU EHDP$YRLGH[SRVXUHRIWKHH\HVRUVNLQWRGLUHFWRU VWUD\UDGLDWLRQ   & 8 6 7 2 0 ( 5  6 ( 5 9 .

& (   .&KDSWHU  $SSHQGL[ 6XEMHFW 3DJH          (OHFWURPDJQHWLF&RPSDWLELOLW\«««««««« (OHFWULFDO6DIHW\«««««««««««««««« )&&&RPSOLDQFH6WDWHPHQW««««««««« :DUUDQW\««««««««««««««««««««      & 8 6 7 2 0( 5 6 ( 5 9 .

.   $33(1'. .

PPXQLW\FKDU DFWHULVWLFV/LPLWVDQGPHWKRGVRIPHD VXUHPHQW /LPLWV/LPLWVIRUKDUPRQLFFXUUHQWHPLVVLRQV HTXLSPHQWLQSXWFXUUHQWXSWRDQGLQFOXGLQJ$SHU SKDVH.& &203$7./.QIRUPDWLRQWHFKQRORJ\HTXLSPHQW .QIRUPDWLRQWHFKQRORJ\HTXLSPHQW 5DGLRGLVWXU EDQFHFKDUDFWHULVWLFV/LPLWVDQGPHWKRGVRIPHD V XUHPHQW .7<  7KLV 3& PHHWV WKH IROORZLQJ UHTXLUHPHQWV IRU VWDQGDUGV RI HOHF WURPDJQHWLFFRPSDWLELOLW\DQGHOHFWULFDOVDIHW\ (1 (1 (1 (1 .67$1'$5'6 7KLV3&PHHWVWKHUHTXLUHPHQWVRIWKHIROORZLQJVWDQGDUGV (/(&7520$*1(7.%.

HHSWKH3&DWOHDVWRQHPHWUH DSSUR[LPDWHO\WKUHHIHHW. /LPLWV/LPLWDWLRQRIYROWDJHIOXFWXDWLRQVDQGIOLFNHU LQORZYROWDJHVXSSO\V\VWHPVIRUHTXLSPHQWZLWKD UDWHGFXUUHQWXSWR$  • .

 DZD\IURPKLJKIUHTXHQF\DQGPDJQHWLFLQWHUIHUHQFH VRXUFHV HJWHOHYLVLRQVORXGVSHDNHUFDELQHWVPRELOH WHOHSKRQHVHWF.

LQRUGHUWRDYRLGPDOIXQFWLRQVDQGRU ORVVRIGDWD • 3OHDVHQRWHWKDWRQO\VKLHOGHGFDEOHVVKRUWHUWKDQ PHWUHV IW.

VKRXOGEHXVHGIRUWKH/37&20 86%.(((DXGLRYLGHRDQGQHWZRUNLQWHUIDFHV ZLWKWKLV3& • :KHQFRQQHFWLQJDGGLWLRQDOFRPSRQHQWVSOHDVHREVHUYH WKH*XLGHOLQHVRQ(OHFWURPDJQHWLF&RPSDWLELOLW\ (0&.

& (   .   & 8 6 7 2 0( 5 6 ( 5 9 .

(/(&75.62 (UJRQRPLFUHTXLUHPHQWVIRURIILFHZRUNZLWK YLV XDOGLVSOD\WHUPLQDOV 9'7V.&6 (1 (1.&$/6$)(7< (1 6DIHW\RILQIRUPDWLRQWHFKQRORJ\HTXLSPHQW • 7KHFRQQHFWLRQRIGHYLFHVLVOLPLWHGWRHTXLSPHQWWKDWFRP SOLHVZLWK(1³6DIHW\RILQIRUPDWLRQWHFKQRORJ\ HTXLSPHQW´RU(1³$XGLRYLGHRDQGVLPLODUHOHF WURQLFDSSDUDWXV6DIHW\UHTXLUHPHQWV´ • )RU86&DQDGLDQSXUSRVHV 7KH3&VKRXOGRQO\EHFRQQHFWHGWRHTXLSPHQWZKLFK FRPSOLHVZLWK8/&$1&6$1R (5*2120.

9LVXDOGLVSOD\U H TXLUHPHQWV (UJRQRPLFUHTXLUHPHQWVIRURIILFHZRUNZLWKYL V XDOGLVSOD\WHUPLQDOV 9'7V.

6((0.62 .5HTXLUHPHQWVIRU GLVSOD\HGFRORXUV 12.21 .66.62.

GOLQJ 2SHUDWLQJ  $WE\VWDQGHUSRVLWLRQ.62ZLWKIROORZLQJYDOXHV 2SHUDWLQJ0RGH .GOLQJ 6WE\VWDQGHUSRVLWLRQ2SHUDWLQJ 0D[6RXQGSRZHUOHYHO/ :$G %$. $FRXVWLFV0HDVXUHPHQWRIDLUERUQHQRLVHHPLWWHGE\ LQIRUPDWLRQWHFKQRORJ\DQGWHOHFRPPXQLFDWLRQV HTXLSPHQW 7KLV3&IXOILOVWKHUHTXLUHPHQWVRIQRLVHHPLVVLRQVDFFRUGLQJ WR.

 GHFODUHGDFFRUGLQJWR.62.

   0D[6RXQGSUHVVXUHOHYHO/ S$P G%$.

 GHFODUHGDFFRUGLQJWR.62.

 ..       $33(1'.

1)250$7.$1&(2) 7+(02'(0 7KLV3&LIHTXLSSHGZLWKDPRGHPKDVEHHQWHVWHG DFFRUGLQJDQG FRPSOLHVZLWKWKH(XURSHDQUHJXODWRU\JXLGHOLQHVIRUUDGLRHTXL S PHQWDQGWHOHFRPPXQLFDWLRQLQVWDOODWLRQV 5 77((*.21$%2877+(5(*8/$725<&203/..

  7KHPRGHPPHHWVWKHUHTXLUHPHQWVRI7%5 .

$1&(2) :.1)250$7.21$%2877+(5(*8$/725<&203/.(<%2$5' 0286($1':.5(/(66 /$1 7KHIROORZLQJORZSRZHUUDGLRHTXLSPHQWZKLFKKDVVHSDUDWHO\ EHHQWHVWHGDQGDSSURYHGDFFRUGLQJ5 77(JXLGHOLQH (&.DQG (*9UHJDUGLQJFRQQHFWLRQZLWKDQDQDORJWHOH SKRQHQHWZRUN .5(/(66.

 LVEXQGOHGZLWKWKLV3& 7KHVHUDGLRGHYLFHVDUHPDUNHGLQGLYLGXDOO\ZLWKWKH&(PDUN7KH GHFODUDWLRQVRIFRQIRUPLW\RIWKHVHUDGLRGHYLFHVDUH DYDLODEOHXQGHU ZZZPHGLRQFRPFRQIRUPLW\   :LUHOHVVNH\ERDUGPRXVHUHFHLYHU  :LUHOHVV/$1  & 8 6 7 2 0( 5 6 ( 5 9 .& (   .

$1&(67$7(0(17 7KLVHTXLSPHQWKDVEHHQWHVWHGDQGIRXQGWRFRPSO\ZLWK WKHOLPLWVIRUD&ODVV%GLJLWDOGHYLFHSXUVXDQWWR3DUWRI )&&5XOHV7KHVHOLPLWVDUHGHVLJQHGWRSURYLGHUHDVRQDEOH SURWHFWLRQDJDLQVWKDUPIXOLQWHUIHUHQFHLQDUHVLGHQWLDOLQVWDO ODWLRQ7KLVHTXLSPHQWJHQHUDWHVXVHVDQGFDQUDGLDWHUDGLR IUHTXHQF\HQHUJ\DQGLIQRWLQVWDOOHGDQGXVHGLQDFFRUGDQFH ZLWKWKHLQVWUXFWLRQVPD\FDXVHKDUPIXOLQWHUIHUHQFHWRUD GLRFRPPXQLFDWLRQV+RZHYHUWKHUHLVQRJXDUDQWHHWKDW LQWHUIHUHQFHZLOOQRWRFFXULQDSDUWLFXODULQVWDOODWLRQ.IWKLV HTXLSPHQWGRHVFDXVHKDUPIXOLQWHUIHUHQFHWRUDGLRRUWHOHYL VLRQUHFHSWLRQZKLFKFDQEHGHWHUPLQHGE\WXUQLQJWKH HTXLSPHQWRIIDQGRQWKHXVHULVHQFRXUDJHGWRWU\WRFRU UHFWWKHLQWHUIHUHQFHE\RQHRUPRUHRIWKHIROORZLQJPHDV XUHV  • • • • 5HRULHQWRUUHORFDWHWKHUHFHLYLQJDQWHQQD .. .QFUHDVHWKHVHSDUDWLRQEHWZHHQWKHHTXLSPHQWDQG UHFHLYHU &RQQHFWWKHHTXLSPHQWLQWRDQRXWOHWRQDFLUFXLW GLIIHUHQWIURPWKDWWRZKLFKWKHUHFHLYHULVFRQQHFWHG &RQVXOWWKHGHDOHURUDQH[SHULHQFHGWHFKQLFLDQIRU KHOS  &KDQJHVRUPRGLILFDWLRQVQRWH[SUHVVO\DSSURYHGE\WKHSDUW\ UHVSRQVLEOHIRUFRPSOLDQFHFRXOGYRLGWKHXVHU¶VDXWKRULW\WR RSHUDWHWKHHTXLSPHQW6KLHOGHGLQWHUIDFHFDEOHVLIDQ\PXVW EHXVHGLQRUGHUWRFRPSO\ZLWKWKHHPLVVLRQOLPLWV    $33(1'.)&&&203/.

7(':$55$17<&$5()8//<7281'(567$1'<285 5.216  7KHUHFHLSWLVFRQVLGHUHGYDOLGSURRIRISXUFKDVHDQGVKRXOGEHNHSWLQD VDIHSODFH7KLVUHFHLSWZLOOEHUHTXLUHGIRUUHFHLYLQJDQ\ZDUUDQW\VHUYLFH 7KLVZDUUDQW\LVWUDQVIHUDEOH:KHQWUDQVIHUULQJRZQHUVKLSWRDWKLUGSDUW\ SOHDVHSURYLGHWKHUHFHLSWDQGZDUUDQW\LQIRUPDWLRQ   :HZDUUDQWWRWKHHQGXVHUWKDWHDFKSURGXFWLQFOXGLQJUHODWHGVRIWZDUH DFFHVVRULHVPHGLDDQGVXSSOLHVVKDOOEHIUHHIURPGHIHFWVLQPDWHU LDOVDQG ZRUNPDQVKLSIRUWKHZDUUDQW\WLPHIURPGDWHRISXUFKDVH7KLVZD UUDQW\ FRYHUVRQO\WKRVHGHIHFWVWKDWDULVHDVDUHVXOWRIQRUPDOXVHRIWKHSURGXFW 7KLVZDUUDQW\GRHVQRWFRYHUDQ\RWKHUSUREOHPVLQFOXGLQJSUR EOHPVWKDW DULVHDVDUHVXOWRILPSURSHUPDLQ WHQDQFHRUPRGLILFDWLRQVRIWZDUHDFFH V VRULHVPHGLDRUVXSSOLHVQRWSURYLGHGRUVXSSRUWHGE\ XVRURSHUDWLRQ RXWVLGHWKHPDQXIDFWXUHU¶VVSHFLILFDWLRQV   $Q\SDUWVLQWKLV3&UHSDLUHGRUH[FKDQJHGE\DYDOLGVHUYLFHUHSUHVHQWDWLYH ZLOOEHFRYHUHGXQGHUWKHRULJLQDOZDUUDQW\SHULRG%DFNXSDOOSURJUDPVDQG GDWDEHIRUHVKLSSLQJWKLV3&IRUUHSDLUXQGHUWKHZDUUDQW\DJUHHPHQW'R QRWOHDYHDQ\PHGLDLQWKHGLVNGULYHV3URGXFWVVKLSSHGZLWKRXWDFFHVVRULHV ZLOOEHUHWXUQHGZLWKRXWDFFHVV RULHV$Q\UHSODFHPHQWSURGXFWRUFRPSRQHQW PD\EHHLWKHUQHZRUOLNHQHZSURYLGHGWKDWLW¶VIXQ FWLRQDOLW\LVDWOHDVW HTXDOWRWKDWRIWKHSURGXFWEHLQJUHSODFHG   /.*$7.7$7.212):$55$17< 7RWKHH[WHQWDOORZHGE\ORFDOODZQRRWKHUZDUUDQWLHVDUHPDGHZLWKU H VSHFWWRWKLVSHUVRQDOFRPSXWHURUWKHZDUUDQW\VHUYLFHVE\DQ\SHUVRQ LQFOXGLQJEXWQRWOLPLWHGWR XVDQGRXUVXSSOLHUV7KHH[SUHVVZD UUDQW\ VWDWHGDERYHLVWKHRQO\H[SUHVVZD UUDQW\PDGHWR\RXDQGLVSURYLGHGLQ OLHXRIDOORWKHUH[SUHVVRULPSOLHGZDUUDQWLHVDQGFRQ GLWLRQV LIDQ\.:$55$17<  3/($6(5($'7+.0.*+76$1'2%/.0.6/.

LQFOXG LQJDQ\FUHDWHGE\DQ\RWKHUGRFXPHQWDWLRQRUSDFNDJLQJ)RUDGGLWLRQDO ZDUUDQW\LQIRUPDWLRQSOHDVHUHIHUWRHQFORVHGZD UUDQW\FDUG  /.$%.0./.762)/.& (   .7< 7RWKHH[WHQWDOORZHGE\ORFDOODZH[FHSWIRUWKHREOLJDWLRQVVSHFLILFDOO\VH W IRUWKLQWKLVZDUUDQW\VWDWHPHQWLQQRHYHQWVKDOO ZHRURXUWKLUGSDUW\ VXSSOLHUVDUHOLDEOHIRUGLUHFWLQGLUHFWVSHFLDOLQFLGHQWDORUFRQVHTXHQWLDO GDPDJHZKHWKHUEDVHGRQFRQWUDFWRUDQ\RWKHUOHJDOWKHRU\DQGZKHWKHU DGYLVHGRIWKHSRVVLELOLW\RIVXFKGDPDJHV7KLVLQFOXGHVORVVRUGDPDJHRI SHUVRQDOGDWDRQ\RXU3&    & 8 6 7 2 0( 5 6 ( 5 9 .

. .1*&23..(62)7+./2&$//$: 7KLVZDUUDQW\VWDWHPHQWJLYHV\RXOHJDOULJKWV<RXPD\DOVRKDYHRWKHU ULJKWVZKLFKYDU\IURPMXULVGLFWLRQWRMXULVGLFWLRQ7RWKHH[WHQWWKLVZDUUDQW\ VWDWHPHQWLVLQFRQVLVWHQWZLWKORFDOODZFHUWDLQGLVFODLPHUVDQGOLPLWDWLRQVRI WKLVVWDWHPHQWPD\QRWDSSO\WRWKHFXVWRPHU   0$.60$18$/ 7KLVPDQXDOFRQWDLQVLQIRUPDWLRQSURWHFWHGE\ODZ$OOULJKWVUHVHUYHG 'XSOLFDWLQJWKLVLQIRUPDWLRQLQPHFKDQLFDO HOHFWURQLFRUDQ\RWKHUIRUPZLWKRXW WKHZULWWHQDSSURYDOE\WKHPDQXIDFWXUHULVSURKL ELWHGE\FRS\ULJKWODZ   $33(1'.

 .1'(.266HWXS  & &DUG5HDGHUU &DUH &'EODQNV &'520  &'5RP'9''ULYHDV ERRWGULYH  &)  &OHDQLQJ  &OHDQLQJDJHQWV  &20 &RPSDFW)ODVK &RQQHFWLQJ  5HFRUGLQJ  9LGHRLQOHW  &RQQHFWLRQV $QWHQQDIRUUDGLR79  &XVWRPHU6HUYLFH  ' 'DWDDQG6\VWHP6HFXULW\  'DWDVHFXULW\ 'DWD6HFXULW\   'LUHFWRULHV  'LVFGULYH  '9'7HFKQRORJ\  ( (LQVFKDOWHQ  (OHFWULFDO6DIHW\ (OHFWURPDJQHWLF &RPSDWLELOLW\ (0&  (UJRQRPLFV  ([HFXWLRQRIWKH%LRV6HWXS  ) )$4   )&&&RPSOLDQFH6WDWHPHQW  )UHTXHQWO\$VNHG4XHVWLRQV )URQWFRQQHFWRUV * *DPH3RUW  *DPHSDG  *UDSKLFV&DUG  + +DUG'ULYH  +DXSWVFKDOWHU +' 6HH+DUG'ULYH +RWOLQH   .& (   .   00&   0XOWL0HGLD&DUG 1 1HUR   1HWZRUN  & 8 6 7 2 0( 5 6 ( 5 9 . $ $PELHQW7HPSHUDWXUH $XGLHQFH LL $XWRUXQ  % %.'.%0Š0LFURGULYH  - -R\VWLFN   / /DVHU5DGLDWLRQ  0 0DLQ3RZHU6ZLWFK  0DLQWHQDQFH  0DLQWHQDQFHSURJUDPV  0HPRU\  0HPRU\6WLFN  0..

 .QVWUXFWLRQV  6'  6HFXUH'LJLWDO 6HULDO1XPEHU LL  6HUYLFH(QJLQHHUV   6PDUW0HGLD   6RIWZDUH'HLQVWDOODWLRQ  6RXQG&DUG  6WDQGDUGV (OHFWULFDO6DIHW\   (OHFWURPDJQHWLF &RPSDWLELOLW\   (UJRQRPLFV  )&&&RPSOLDQFH 6WDWHPHQW   1RLVH(PLVVLRQ   6\VWHP5HFRYHU\   7 7UDQVSRUWLQJ   7URXEOHVKRRWLQJ  8 86%3RUW   : :DUUDQW\   :KHHO   :LQGRZVŠ'HVNWRS   :LUHOHVV/$1   :ULWLQJ&'V     $33(1'./$1$FFHVV3RLQW  7URXEOHVKRRWLQJ :KDWGR\RXQHHGIRU QHWZRUNLQJ"  :KDWLVD1HWZRUN"  1RLVH(PLVVLRQ  2 2SHUDWLRQDO6DIHW\ &RQQHFWLQJ  2SWLFDOGLVFGULYH  3 3DVVZRUGUHVHW)LOH  4 4XDOLW\ LL 5 5DGLR797XQHU&DUG  5HPRWHFRQWUROOHU  5HVWRUH  5HVWRULQJ)DFWRU\6HWWLQJV  6 6DIHW\..