Albrecht W e z l e r a n d Shujun Motegi YuktidTpikä

Alt- u n d Neu-Indische Studien herausgegeben v o m Institut für Kultur u n d Geschichte Indiens u n d Tibets an der Universität H a m b u r g

44

Franz Steiner Verlag Stuttgart 1998

Y

U

K

T

I

D

I

P

I

K

Ä

The Most Significant C o m m e n t a r y on the Sämkhyakärikä

Critically edited by

ALBRECHT WEZLER and SHUJUN MOTEGI

Vol. I

Franz Steiner Verlag Stuttgart

Die Deutsche Bibliothek - CIP-Einheitsaufnahme Yuktidlpikä : the most significant commentary on the Sämkhyakärikä / critically ed. by Albrecht Wezler and Shujun Motegi. - Stuttgart: Steiner, 1998 (Alt- und neu-indische Studien ; 44) ISBN 3-515-06132-0

ISO 9706 Jede Verwertung des Werkes außerhalb der Grenzen des Urheberrechtsgesetzes ist unzulässig und strafbar. Dies gilt insbesondere für Übersetzung, Nachdruck, Mikroverfilmung oder vergleichbare Verfahren sowie für die Speicherung in Datenverarbeitungsanlagen. Gedruckt auf säurefreiem, alterungsbeständigem Papier. Gedruckt mit Unterstützung der Deutschen Forschungsgemeinschaft. © 1998 by Franz Steiner Verlag Wiesbaden GmbH, Sitz Stuttgart. Druck: Druckerei Peter Proff, Eurasburg. Printed in Germany

Table of

Contents VI VII IX-XXIX XXX-XXXII XXXIII XXXIV-XXXVI XXXVII

1. Preface by Shujun Motegi 2. Preface by Albrecht Wezler 3. Introduction 4. Signs and Abbreviations 5. Facsimile of K..., 6. Facsimile of D 7. Facsimile of B 8. The Text of the Yuktidipikä (a) Prathamam Ähnikam (b) Dvitiyam Ähnikam (c) Trtiyam Ähnikam (d) Caturtham Ähnikam (e) Pancamam Ahnikam (f) Sastamam Ähnikam (g) Saptamam Ähnikam (h) Astamam Ähnikam (i) Navamam Ähnikam (j) Dasamam-Ekädasam Ähnikam 9. Appendix I: Bibliography

1-56 57-108 109-142 143-166 167-186 187-200 201-220 221-238 239-254 255-270 271-277

10. Appendix II: The Text of the Sämkhyakärikä as attested in the Yuktidipikä within the commentary to the corresponding verse 278-285 11. Appendix III: The Text of the Sämkhyakärikä as found in contexts other than those of Appendix II 286-290 12. Appendix IV: Index of Words of the Sämkhyakärikä as attested in the Yuktidipikä and the Marginal Notes of the Kashmir and Delhi Mss 291-307 13. Appendix V: Index of the verses quoted or at any rate found in the Yuktidipikä 308-320 14. Appendix VI: Päda Index of the verses quoted or at any rate found in the Yuktidipikä 321-333

IV

YUKTIDIPIKA

15. Appendix VII: Index of the prose passages quoted or referred to in the Yuktidipikä and in the Marginal Notes of the Kashmir and Delhi Mss. according to the sources 334-342 16. Appendix VIII: Index of the prose passages quoted or referred to in the Yuktidipikä and in the Marginal Notes of Kashmir and Delhi Mss. in alphabetical order 343-346

For Masaaki

Hattori,

the great authority on Indian Philosophy

Preface The first time I encountered the text of the Yuktidipika edited by R.C. Pandeya was in the spring of 1971 in the office of Prof. Masaaki Hattori at Kyoto University. As a beginner in Sanskrit, I found its Devanägari script so mysterious that I was convinced that the text contained yet unknown truths of the world, and even of life itself. Wanting to unravel its secrets, I decided, a few years later when I was an M.A student studying, thanks to a grant of the General Cultural Scholarship Scheme of the Government of India, for two years at Benares Hindu University, to go through the text under the guidance of Prof. K.D.Tripathi. Following my return to Japan I continued — despite the fact that I had not discovered the truth which might have led me to the highest goal of life — to work on the Yuktidipika, and after some time I came to realize the necessity for a new edition of the text. As I knew that Prof. A.Wezler had already announced in his 1975 article "Some Observations on the Yuktidipika" his intention to prepare a critical edition of the text based on the newly discovered manuscripts, I contacted him and offered to work with him on the new edition. I must admit that I did so with some hesitation, for I was not sure that I had the requisite experience in collating manuscripts, and I had also, due to other demands, been away from Indological research for some time. Nevertheless, he was generous enough to accept my offer, and we decided to undertake a joint project. Five years ago, with the financial help of the Japan Society for the Promotion of Science (Nihon Gakujutsu Shinkökai) and the cooperation of my colleagues at Shinshu University, I was able to stay in Hamburg for an entire year. This year proved to be most pleasant and fruitful. Prof. Wezler's wide-ranged and deep knowledge of the Indian classics was a constant help and inspiration, and I gained much from his expertise, although, I am afraid, I took too much of his time. And now, much later, we have come to the final stage of our project (as regards the first volume of the edition). It will be my real pleasure and pride if this joint work is able to contribute even a little to the splendid history of Indian Studies. Space being limited, I am not able to thank all the unforgettable people who helped my wife and me in various ways in Hamburg. Nevertheless, we would like to express our heartfelt gratitude to Mrs. Monika Rieger and Mr. Günther Kahl who kindly provided us with a calm, comfortable and well-equipped flat at Jungfrauenthal. Without their help our life in Hamburg would have been quite different and certainly much more difficult. Last but not least, I would like to thank Mr. T.Tomabechi, assistant at the University of Lausanne. I owe much to him for the layout of the present edition. He was so cordial as to give much of his time to adapt the computer software to the needs of this edition, with the result that he was able to mysteriously call into existence all the elements we came to need. Without his invaluable assistance this edition would not have attained its present form. Nagano, September 1997 Shujun Motegi

Preface It was long ago that I realized the need for a new and fully critical edition of the Yuktidlpikä, took the decision to prepare it myself, started to microfilm the available manuscripts and announced my intention publicly! Nevertheless the publication of the present edition does not give me an opportunity to quote the German saying "Gut Ding will Weile haben" (= "good things take time"). Rather I do very much feel that an apology is due for the unusually long delay, for keeping in suspense fellow scholars and all those interested in Sämkya philosophy for so long a time. I realized quite early, in fact immediately after the publication of my first article on the YD in 1975 (cf. "Bibliography"), that I had gone one step too far in my "Observations", viz. by drawing the conclusion that the "Värttika" and the "Bhäsya" go back to two different authors; and this did not, frankly speaking, really fill me with enthusiasm for a work demanding no little self-denial. In passing only I should like to mention here that I told Shinkan Murakami about this revision of my opinion about the authorship of the "Värttika" and the "Bhäsya" when I met him in Japan in 1983, and that he was kind enough to report this in his article "Yuktidlpikä Yakuchü (I) ( « "Yuktidlpikä — Translated into Japanese with Critical Notes", published in the Annual Reports of the Faculty of Arts and Letters, Tohoku University 33, 1983, p.42 (cf. "Summary", p.251)) —just as Johannes Bronkhorst a little later (cf. his article "Värttika", WZKS XXXIV, 1990, p. 123 n.l). The main reason for the delay, however, is that I simply did not have the necessary staying power, even though I was once granted a special sabbatical term by the "German Research Council" (DFG) for this purpose. I was too short-winded, and almost exhausted my strength in writing articles: It was thus much easier to give my self-esteem what it direly needed, viz. regular confirmation by work finished within a relatively short period of time. There was perhaps also a — deceptive — idea of being thereby able to clear the way for the more demanding work of the critical edition. In any case, it was an extraordinary piece of luck that I finally came into contact with Shujun Motegi who had himself already started working on a critical edition of the YD, and we got along with each other so well that it was but natural to decide to join hands and to prepare the edition jointly. I do not want to describe our cooperation in any detail, but should like to state at least that Shujun Motegi did by far not only take on the tremendous job of putting all that is printed here into the computer — overcoming too the various and partly very intricate difficulties of the software used (which was in fact changed two times; cf. "Introduction", fn.12). Suffice to say that had he not come to my assistance I would still not have been able to finish this work. I am deeply grateful to him also for the composure with which he took my occasional outbursts of temper and his sympathetic approach when I was going through a difficult period and it looked as though I was down and out. We have certainly taken the seven steps of Pänini 5.2.22! Hamburg, September 1997 A. Wezler

I n t r o d u c t i o n

§ 1

T h e N e e d for a N e w

Edition'

When in 1967 Ram Chandra PANDEYA published his edition of the "Yuktidipika. An ancient Commentary of the Sämkhya-Kärikä of Isvarakrsna"1 it was no small step forward: in contradistinction to the editio princeps by Pulinbehari 2 CHAKRAVARTI in 1938, based on just a single manuscript from Poona, viz. our P, PANDEYA was able to use a second manuscript from Ahmedabad, viz. our A. To be sure, the number of passages, i.e. parts of sentences or whole sentences or even consecutive sentences, left out because of aberratio oculi etc. in either of these two manuscripts, is amazingly large; however they are also, fortunately, distributed in such a way that the two manuscripts supplement each other, at least in most cases, so that a much more complete text could be constituted by PANDEYA. But his edition stands out for other reasons, too; not a few quotations from or references to other texts have been identified, an attempt has been made to further the intelligibility of the text by dividing it properly * A critical edition as such clearly calls for no justification, and by no means only in a discipline like Indology. A. AKLUJKAR'S statement (in his review of W. RAU, Die handschriftliche Überlieferung des Vâkyapadïyaund seiner Kommentare, München 1971, OLZ 71 (1976), p.286): "If misinterpretations and wrong leads are to be avoided, studies of ancient and medieval works must, as far as possible, be based on critically presented texts" is only too true, although this is equally true of "modern works", a very instructive example being many of the various texts written by L. WITTGENSTEIN (cf.e.g. Wittgenstein über die Seele. Herausgegeben von Eike VON SAVIGNY und Oliver R. SCHOLZ, Frankfurt 1995 (Suhrkamp Taschenbuch Wissenschaft 1173)).
1

Yuktidtpikä, An Ancient Commentary on the Sämkhya Kärikä of ïévarakrsna, edited by R.C.Pandeya, Delhi-Varanasi-Patna, 1967. Yuktidîpika, edited by P.Chakravarti, Calcutta Sanskrit Series No.23, Calcutta, 1938. Note that editions which are not directly based on (the) MSS —like e.g. Râmasankar TRIPÂTHÏ, Iévarakrsnaviracitâ Sämkhyakärikä Rämasankara-Tripäthiviracitayä Tattvaprabhäkhyayä vyäkhyayä ajnätakartrkayä YuktidTpikävyäkhyayä vivrtyä ca vibhüsitä ..., VäränasT 1970 — have been ignored by us.

2

X

YUKTIDIPIKA

into paragraphs, by means of an improved punctuation, by many emendations 3 and last but not least by various "Appendixes" and "Indexes", the most useful no doubt being the "General Index" (though it is by far not complete, not even as regards the references given under the entries included). 4 Nevertheless PANDEYA'S edition did not come up entirely to the expectations which nowadays are justly placed on a critical edition, even in Indology: his edition is not based on all the available manuscript material, 5 his information about the actual readings6 is not always reliable, the text as constituted by him is at places clearly wrong for various reasons reaching from simple printing mistakes up to misinterpretations or failure to understand a passage. Therefore a new and fully critical edition of the Yuktidïpikâ is clearly a desideratum, especially in view of the extraordinary significance this text has, and by far not only for the history of Sämkhya philosophy.7 Characteristically for Indian studies, it may be noted at this point that we have already a summary of the contents of our text 8 and at least one complete translation, so-called.9 With all due deference to our predecessor(s) —our critical apparatus bears
3

It is not, however, always possible to determine whether a particular reading is an emendation proposed by PANDEYA or else actually found in one of the two MSS used by him. His main interest seems to have been to state time and again that CHAKRAVARTI reads x "against Pn" (our MS P). It should be noted that this is just a brief characterization of intended to be a comprehensive appraisal of his achievement.
PANDEYA'S

4

edition, and not

5

Even if the number of MSS of a particular text like e.g. the Mahâbhârata or the Manusmrti is very large indeed, a selection can be made only on the basis of criteria which have at least to be made explicit and after checking the critical value of each and every MS.

6

As should be well-known in the meantime, already the mere act of reading a MS is at times intimately bound up with interpretation, i.e. implies decisions which, even if all of them are taken consciously, cannot, at least not always, be expressly stated. Unfortunately, manuscriptology, and the corresponding branch of palaeography, are rather undeveloped in Indian studies; not even the knowledge accumulated so far has been gathered and made easily accessible in a publication. See, however, K.L.Janert, Bibliographie mit den Berichten über die mündliche und schriftliche Textweitergabe sowie die Schreibmaterialien in Indien (Berichtszeit bis 1955), Bonn 1995. The significance has already been recognized by E. FRAUWALLNER; cf. Geschichte der indischen Philosophie, l.Bd., Salzburg 1953, p.287 and 475. Viz. by RaghunathaSHARMA, Dayanand BHARGAVA, and Shiv Kumar SHARMA in : Sämkhya. A Dualist Tradition of Indian Philosophy. Ed. by Gerald James LARSON and Ram Shankar BHATTACHARYA (Encyclopedia of Indian Philosophies IV), Princeton 1987, pp.227-269.
KUMAR and D. RAKAMI'S translation

7

8

9

Shiv

N. BHARGAVA, Yuktidïpikâ, vol.1 Delhi 1990, vol.11 Delhi 1992. MU(for which see "Bibliography"), appearing in installments and not yet complete, is of quite different a quality. Edeltraud HARZER in the USA is presently working on an English translation.

INTRODUCTION

XI

ample evidence to this 10 —we feel justified to claim that we have brought matters further to a considerable degree, and in many regards at that: 1. we have been able to use three more manuscripts, though one of them (B) covers only a small portion of the text and another (D) is a modern transcript (cf. §§2 and 3 below); 2. thanks to this additional material we are able to offer a slightly more complete text, though as regards the longest 'new' portion, viz. pp.150.22154.5 of our edition, we disagree with each other, M. being rather inclined to regard it as secondary while W. thinks it is genuine; 3. with the help of this additional manuscript material we can edit also a Tippanï (aThe Marginal Notes..."), a kind of subcommentary, though it covers only approximately the first third of the Yuktidïpikâ (cf. §5 below); 4. many more emendations are proposed by us, and our text is certainly more intelligible than that printed by CHAKRAVARTI and PANDEYA; 5. we have succeeded in identifying quite some more passages as quotations and references, although we have not always been able also to discover their sources; 6. for the first time an attempt has been made at marking off the vârttikas (cf. "Preface" by W. and below §4) from the rest of the text; 7. we have tried to verify the cross-references within the Yuktidïpikâ as far as possible and for the readers' convenience we have added the reference in each case; 8. the layout, the typographical features, and the critical apparatus 11 have been given a shape that should facilitate reading the text and ensure precise and full information, in spite of the fact that we had to put up with certain constraints due to the software used;12 9. the various indices forming the "Appendix" are, we trust, a further improvement (it should however be noted that the present edition will be supplemented by a second volume containing a word index to the whole of the Yuktidïpikâ) ; In not a few cases we simply state that "we follow Pandeya", or "Chakravarti", or "Raghavan" (for whom see "Bibliography"). When we finally realized that a positive apparatus criticus is to be preferred, it was too late to change our edition accordingly.
2

The software used by us was "Techno Mate" in the beginning, then we changed it to "AMS IfejX" and this in its turn, finally, to "WT&L2€".

XII

YUKTIDIPIKA

10. last but not least we are able to offer some new arguments of palpable significance for dating the Yuktidïpikâ. Notwithstanding, we are, of course, fully aware that our edition is also far from being perfect. We do not, in this connection, mean the fact, highly deplorable though it is, that we, too, were not able to discover a single manuscript containing the whole of the text, and hence to fill the gaps already there in PANDEYA'S edition, viz. the commentary on roughly SK11-12, 60-63, 65-66; what we have in view is rather the possibility, nay, probability, that sometimes we, too, have overlooked a lacuna not marked as such in the manuscripts (one of the most intricate problems one is confronted with when editing a text), or have not recognized a quotation or reference as such, not to mention other mistakes, e.g. choosing the wrong reading, misunderstanding what the author actually intends, etc. Even simple printing mistakes were still there when going through the penultimate and even the final proofs — a work we were most kindly assisted in by Dr. Harunaga ISAACSON, whom we should like to thank very much indeed also for drawing our attention to other mistakes and problems. Hence there are reasons which would speak in favour of postponing publication. But we think that we should not make our fellow scholars wait any longer for this edition which after all was announced quite some time ago. In addition, after working on this edition for a number of years now, both of us have gathered the impression that we run the risk of moving round in circles, i.e. of discussing for the third or fourth time a problem, be it a real or an alleged one, simply because we don't remember that, and why, a particular decision had already been taken by us earlier — of which we could not, of course, always keep a full record or even keep minutes. That is to say, we very much need the detachment to be gained only by publishing away, as it were, our joint work in order then to be able to take a fresh and critical look at it — which our readers will certainly also take, whose criticism, suggestions and remarks will be most welcome: as in the case of other philosophical texts, too, colleagues specialized in other strands of the rich Indian tradition can solve problems, and sometimes quite easily, with which the editor(s) has/have tackled in vain: non omnia possumus omnes, to quote the apposite Latin proverb, or to say it with Udayana, 13 bhränteh purusadharmatvät.

§ 2

Description of the

Manuscripts14

As the descriptions of the two MSS of the Bhandarkar Oriental Research Institute, Poona — our P — and of the LâlbhâT Dalpatbhâï Institute of Indology,
13 14

Viz. Nyayakusumânjali 3, 13/14. Note that the descriptions are by and large based on prints made from microfilms, not on the manuscripts themselves; cf.fn.17.

INTRODUCTION

XIII

Ahmedabad — our A — respectively as given by PANDEYA 1 5 are very brief indeed, more detailed ones are being given here. Yet we don't deem it necessary to publish again facsimiles of these two MSS, but confine ourselves in this regard to the new material. P The manuscript forms part of the collection of the Bhandarkar Oriental Research Institute, Poona, Maharashtra. (For the catslpgue(s) concerned see below p.XVIII). A paper manuscript written in Dev&nâgarï, it has 118 folios and measures 34x 15.3cm. It is paged on the verso, on the left margin, below the indication of the title, viz. sâm. yu. dt, also on the right margin at the bottom, but the page number is lacking in some cases (e.g. folios 1, 12, 19, 70, 99, 100-103); upon folio 53 follows a single one carrying the numbers 54, 55, 56, 57. The text is written in a rectangular area with margins of appr. 4 cm to the left and right and appr. 3 cm at the top and bottom. There are 12 lines to a side, except for folio 74 verso which has 13 lines, folio 97 verso which has only one and a half lines, folio 98 which is entirely blank, folio 119 the recto of which has just 4 lines and a few words at the beginning of the 5th line, while its verso has only a few words, and folio 122 verso which contains only the colophon (cf.p.270). The number of aksaras per line is on the average 50. The manuscript contains no date; it covers the text of the YD from the beginning up to the end, but it is not complete. Lacunae in the text are indicated by blanks, with or without dots/dashes. The MS has not a few corrections on the margin, by at least one other hand. A The manuscritpt forms part of the collection of the Lâlbhâï Dalpatbhâï Institute of Indology, Ahmedabad, Gujerat. The manuscript, written in Devanägari, carries the number 173; it has 47 folios of old paper, and measures 11.5x26cm. It is paged 1 - 47 on the bottom of the right margin of the verso, and there are no title indications. The text is bordered on the left and the right by two vertical lines; there are no similar horizontal lines above and below the body of the text. There are 15 lines to a side except for folio 47 verso which has only 12 lines. In the middle of lines 6-10 each side has a roughly rhomboid blank area in the center. The remaining lines, viz. 1-5 and 11-15, usually have between 35-45 aksaras. A number of folios, viz. 14 verso, 25 recto and verso, 28 verso, 39 verso, bear on the right or left margin the oval stamp "Lälbhär Dalpatbhâï Bharatiya Samskrti Vidyärriandir Jnän Bhandar", which is, however, unfaded (almost) and legible only on folio 47 verso where it is there on the right below the body of the text. The manuscript contains no date; it covers the text of the YD from the beginning up to almost the end of the commentary on SK10. It starts with <bhale symbol>16 // Om namah kamaladalatnpulanayanäbhirämäya
15

Cf.

PANDEYA,

op. cit., Introduction, pp.xi-xii.

16

As for this symbol, cf.Chandrabhäl TripäthT, Catalogue of the Jain Manuscripts at Strasbourg

XIV

YUKTIDIPIKA

narayanaya // // snganesaya namah // (cf. p.l,fn.l), and breaks off with bhtstah pürvasamsthänahänitah tadabhäväd asiddho syai vise (cf.p.134.18). The intermediate colophon on fol. 37 verso, line 7f. (cf.p.107.14) is coloured and thus marked off from the text itself. At several places there are gaps in the text left blank, viz. on folios 12 verso, line 4 (appr. 6 aksaras), 17 recto, line 4 (appr. 7 aksaras, the gap being additionally marked by five dashes), 17 verso, line 12 (appr. 6 aksaras), 19 verso, line 3, 19 verso, line 12 continued into line 13 (altogether appr. 9 aksaras), 33 verso, line 8 (appr. 4 aksaras), 35 verso, line 14 (appr. 2 aksaras), 39 verso, line 4 (appr. 3 aksaras), 43 recto, line 12 (appr. 3 aksaras), 45 verso, line 15 (appr. 2 aksaras), 46 recto, line 1 (appr. 3 aksaras) and line 3 (appr. 4 aksaras) and 46 verso, line 10 (appr. 4 aksaras) and line 14 (appr. 4 aksaras). There is an ink(?)-spot on folios 3 recto, line 5 in the middle and on folio 17 recto, line 6 and 7 on the left which is visible also on folio 17 verso, lines 8-10 on the left. The MS has only a few corrections, apparently by another hand 17 . K The most important of the MSS not yet used by PANDEYA is K, i.e. the Säradä manuscript deposited at the University of Kashmir, Srïnagar. This MS is registered in the catalogue of the Sanskrit Manuscript Library in the Centre of Central Asian Studies of the University of Kashmir under the number 805 18 : A (Indologica Berolinensis Bd. 4), Leiden 1975, p.39, as well as Descriptive Catalogue of the Government Collections of Manuscripts deposited at the Bhandarkar Oriental Research Institute, compiled by Hiralal Rasikdas Kapadia, Vol.XVII: Jaina Literature and Philosophy, Pt.II: (a) Agamika Literature, Poona 1936, p.12 and Appendix II.
17

Several letters which I sent to the director of the LälbhäT DalpatbhäT Institute of Indology requesting him to come to my help regarding the exact description of the manuscript, were not answered. But Dr. N. M. Kansara who happened to be working at that time at the Institute as visiting professor and got in touch with me in another matter, was kind enough to give me the necessary information. In a personal communication dated May 27th 1997 he writes me (W.): "Dr. J. B. Shah had entrusted the work of locating your Ms. to the person in charge of the Ms. Library at the L.D. Institute here. But since, after going through all the old and new Catalogues of Mss., of the L.D. Institute, the Ms. of Yuktidïpika could not be traced at N. 173, he could not send you any letter. After receiving your letter, I took up the cudgels anew in company of Pandit Amratlal, who is in charge of the Mss. Library of the L.D.Institute. In spite of all our efforts from various angles, we could not locate the Yuktidïpika Ms. at No. 173 or any other number. We are sorry for our failure. As regards the entries of "le.sam.17 Sa" in the edition of R. Ch. Pandeya, "LE." stands for "LEKHAKA" (= 'scribe'), "SAM." stands for "SAMVATA" (= 'year') and "17 SA." stands for "17 SATAKA" (= 'century'). These are the usual abbreviations used in the Mss. by the scribes."

18

The description of K owes much to Prof.Shinkan MURAKAMI'S Yuktidïpika Yakuchû (I) (Yuktidïpika — Translated into Japanese with Critical Notes (I)), Annual Reports of the Faculty of Arts and Letters, Tohoku University, vol.33 (1983) p.40. He has been so kind, and selfless, as to come to our assistance by supplying copies of

INTRODUCTION

XV

paper manuscript, it is written in Sarada, measures ca. 13x 18cm, and is bound like a book. The MS consists of two parts, each written by a different hand. The first part has 7 folios, our siglum for it is KP, and it covers the text from the very beginning up to the upodghâtah, p.8.16 of our edition. It starts with a symbol often found in the beginning of a manucript. 19 The first six folios are written on both sides, and each of the fifteen or sixteen lines has 18-23 aksaras. On the verso of each folio, on the left margin at the bottom, is given the page number below the title indication yukti dt° . 20 The seventh folio is written only on the recto with six lines and, below this, five lines in smaller letters, this latter being a note on the term namas (cf.p.l,fn.(2) of our edition). Between the seventh folio and the first folio of the second part, there are four small slips of paper inserted. What is written on these slips are "The Marginal Notes....". We call these slips Ks.l, Ks.2, Ks.3, Ks.4, respectively.21 The second part, which is the main part of the MS, has 135 folios. Every folio is written on both sides, the number of lines being 22 or 23 with 20 aksaras on the average. As in the case of P, K is paged on the verso, on the left margin at the bottom, below which is the indication of the title as in P, that is, säm. yu. di. The page numbering is continuous from 1 to 105. The numbers 49 and 50 are missing though the title is there. On folio 105 a lacuna in the 16th line is indicated by dots and the text breaks off at this point (cf.p.224,fn.l). Then follows a blank folio, upon which we find a folio numbered 194, beginning with srï ganesäya namah. Thus this folio corresponds to the first folio of our MS B which too begins with the same salutation. The numbering thereafter is continuous to 223 which is the last folio. As a whole K has the same lacunae as P. The most conspicuous feature of both parts of K is that they carry notes or comments anywhere, on the margin, or between lines, and that the number of these mounts to nearly 300 (cf.§5). The notes usually set in at the point on the margin which the scribe considered to be nearest to the word(s) of the müla concerned, and there is no referential marking of any kind. Almost all these notes and comments are found in the first four Annikas. individual folios, and even of a whole MS (see p.XVII and fn.32 below), whenever we realized that our own material was incomplete or of too poor a quality. The full text of the registration is as follows: NO.805 Sankhya Yukti Deepika No.of copies one Script sharada Paper country Price 15 Date 27-X-56 Remarks 257
19 20 21

See above fn.16.

Only the first folio has the title indication érïh yukti dt°— naturally enough. For "The

See p.8,fn.(2)-(3); p.9,fn.(l)-(5),(7); P.10,fn.(l)-(2); p.l8,fn.(2); p.68,fn.(l). Marginal Notes..." see below §5.

XVI D

YUKTIDIPIKA

D is a paper Devanâgarî MS of the National Archives in New Delhi, the Serial No. being 3001 and the Acc.No.833/52; it has 361 leaves; its size is 34.5cmx 21cm. The leaves are numbered 1-298 on the right margin at the top— the count 232 has been left out by mistake —and thereafter 22 1-64. All the folios are bound like a book, and they are written only on one side. 23 This is evidently a very modern transcript of K2A made only after Independence, when, most probably for reasons of safety in the wake of the Kashmir imbroglio, a number of MSS were brought down from Srinagar to the National Archives in Delhi to be returned only later to their rightful owner (s). D is particularly noteworthy in that, on the margin, it quite often gives the readings of a kha-pustaka, called Dkha by us —which is often in agreement with A —, and at least twice also of a ga-pustaka25 showing that the copyist had access to two more MSS 26 and was scholar enough to note down the variants he found in them. As the result a folio usually consists of the main text and footnotes, if any. The footnotes are of two kinds. First, beneath the main text, the marginal notes of K are numbered in order to be able to identify the word(s) in the main text referred to. 2 7 Second, beneath the marginal notes again, if any, the variant readings of kha-pustaka are written with the line number of the main text added. The usual formula when indicating variant readings of kha-pustaka is pam° number kha°pu°.... iti päthah. But quite a few readings of kha-pustaka are written on the side margin too. In doing this the scribe evidently regarded the manuscript which he was actually transcribing in full as cka-pustaka\ One of the variants of Dkha was known also to the author(s) of "The Marginal Notes ..."(see p.H8,fn.9,(4) of our edition). The identity of both kha- and ga-pustaka, however, remains an open question. On the whole it is possible to say that D has a more ordered appearance than K. In this connection it should be pointed out that, in addition to the above mentioned characteristics of each folio, all the Ahnikas, except the 9th, begin on a fresh folio and generally the verses are set off from the prose. The sandhi rules are ignored more often than not and corrected on the margin,
22

The serial number 299 has been changed to 1. This is the point where K gives the serial number 194 after a blank folio and, at the same time, the point where B begins. Sometimes the marginal notes taken from K are written on the verso (cf.e.g.the leaves of serial number 9, 10). D sometimes uses a comma for punctuation (cf.p.80,fn.l7, p.l63,fn.2). See p.99,fn.7, p.212,fn.6. In addition, on the top margin of folio 45 we find the note ga°pustake 'pi, in small letters, though it is not clear which word is intended by this note.

23

24 25

26

The - theoretical - possibility of his referring to unknown editions can safely be ruled out. Corrections secunda manu in D, however, often agree with B so that one wonders whether the scribe of D had access to 5, or its original. In a few cases a mark is made in order to identify the word (cf.p.3,fn.(l); p.4,fn.(l)).

27

INTRODUCTION possibly by a different hand. B

XVII

The MS given the siglum B by us is the most fragmentary one, containing as it does only a small portion, i.e. appr. one fifth of the text, viz. pp.224270 of our edition. It forms part of the manuscript collection of the Library of the Benares Hindu University; its Serial No. is 3A/2194, the Accession No. C4083. "It consists of 29 leaves of about 14x23cm (leaves numbered 1-22, 25-27, three blank leaves and a final leaf unnumbered) written on both sides except l a (cover), last leaf (cover) and three further leaves; the whole is bound (or folded) as a booklet, each page contains 21 or 22 lines of 22~25 syllables in èâradâ." 28 In the very beginning of the main text, upon "om namo näräyanäya", there is again the bhale symbol. 29 Only the page number is written on the left margin at the bottom of each verso without any indication of the title. Folios 23 and 24 are missing. 30 The texts of these missing leaves corresponds to a lacuna of the other MSS. Hence the lacuna is marked in B only by skipping the numbers 23 and 24. Actually B lacks even a few more lines which the other MSS have, just before and after the lacuna (see p.264,fn.l8). It should be noted that B is a paper MS, the paper giving the impression of being rather modern, but as regards the size of the pages and the arrangement of the lines it evidently follows the tradition of Kashmirian birch bark MSS ('copy book'). Finally the MS called "K2" by MURAKAMI 3 1 has to be mentioned, a xerox copy of which we have kindly been given by him. It contains the text from the beginning up to p. 107.1 (prayunjä-) of our edition but is quite obviously a very modern 33 Devanâgarî transcript of a part of D, 34 as it includes "The Marginal Notes ...", too. In our view this MS is of practically no critical value and has therefore been ignored by us.
32 28

Shinkan MURAKAMI, Benares-Manuscripts of the Yuktidtpikä, JIBS vol.35-2 (1987), p.1019.37. See Descriptive Catalogue of the Government Collections of Manuscripts deposited at the Bhandarkar Oriental Research Institute, compiled by Hiralal Rasikdas Kapadia, Vol.XVII: Jaina Literature and Philosophy, Pt.II: (a) Ägamika Literature, Poona 1936, p.12. See above fn.16.

29

30

See Shinkan MURAKAMI, op.cit., p.1019.8-10. See his article mentioned in fn.28.

31 32

Of all the other MSS we used microfilms, taken by W. in 1972, 1974 (D) (in the latter case with the help of Michael WITZEL, who it was who actually discovered this manuscript, and
Balaram CHITRAKAR), and 1982 (B).

33

The paper sheets used have a headline "NOTES" and to its left "Form No 12A/ Mis."!

34

Cf. also MURAKAMI'S remark (op, cit., p.1020) that the MS "of the National Archivés, b&w* Delhi, ... is said to be the original of K2".

XVIII § 3 Stemma

YUKTIDIPIKA codicorum

P forms according to "A [Consolidated] Catalogue of the Collections of Manuscripts deposited in the Deccan College [Poona, from 1868 to 1884]",35 as is also quoted by PANDEYA,36 part of the "Collection of 1875-76", was "purchased from Kashmir" and its "material" is "bhürja". In fact, however, P is, as already stated above, a Devanâgarï paper MS. One possible explanation for this discrepancy is that P is but a copy of the original birch bark MS, and this is not only confirmed by the authorities of the BORI, 37 who rightly refer to G. BÜHLER,38 but also by typical misreadings of the Sarada original 39 by the scribe who made the Devanâgarï copy. Yet, one is still faced with the problem of the present whereabouts of the Sarada original of P: was it really purchased by the BORI, or was it not rather returned to Kashmir after copying it — and is it identical with "AT', i.e. MS No.805 of the University of Kashmir, Srinagar, as stated by MURAKAMI ? 40 There is, however, quite another and much more likely possibility, viz. that P is in fact the manuscript bought by BÜHLER in "Kasmîr", since all the particulars given by him in describing it agree with those of P except for the material that is indicated by "ditto" to be birchbark (bhürja) (top of p.XXIII). Especially noteworthy is the agreement as to the number of folios ("122") and lines per folio ("12"), as also the fact that BÜHLER'S manuscript is classed as a new copy ("N.C.") and is written in "DevanägarP. If this conclusion is correct BÜHLER'S "Detailed Report ..." would be wrong in just this one regard of "ditto" in the column on "Material". D, a Devanâgarï transcript of K [see above p.VI], is of no little help in deciphering K1 including "The Marginal Notes ...", and gives, as has already been mentioned, variants from two more MSS (cf. above §2). A — which covers the text only up to p. 134.18 of our edition — does not show any of the specific features indicating that it was — directly — copied
35

Compiled by Shridhar R. Bhandarkar, Bombay 1888, p.xxx. Note that the manuscripts mentioned in G. BÜHLER'S Detailed Report ... (see fn.38) have been incorporated into this [Consolidated] Catalogue ...: see K.L. JANERT, An Annotated Bibliography of the Catalogues of Indian Manuscripts, Part 1, Wiesbaden 1965, p.126 (no.269). R.C.Pandeya, op.cit., Introduction, p.xii. In a personal communication by A. M. Ghatage (addressed to W.) dated August 28th, 1995. Viz. his Detailed Report of a Tour in Search of Sanskrit MSS. made in Kashmir, Rajputana, and Central India, Bombay and London 1877, p.XXIV(no.374). For example, P has preserved the jihvämültya in the second line of folio No.2 verso. — As for typical misreadings of Sarada see Walter SLAJE, Sarada, Deskriptiv-synchrone Schriftkunde zur Bearbeitung kaschmirischer Sanskrit-Manuskripte (Indische Handschriften Bd. I), Reinbek 1993, pp.43ff. In fact what
MURAKAMI

36

37

38

39

40

says (op. cit., p.1020) is that it "is nearly the same as Pn", our P.

INTRODUCTION

XIX

from a Sarada original. It thus clearly stands out from the rest of the material. But at not a few points it is faulty and, what is even more important, offers readings which are clearly the result of an attempt at making the best, i.e. a meaningful text, of an original not really intelligible (for whatever reason). In parts of the text common to A, K, P and D, A has a number of lacunae peculiar to it as against the other three (at times they are even marked as such (e.g. p. 113 n.14, p. 123 n.10, p. 133 n,4)), and this its independence leads to positing the hyparchetype S. Note by the way that ^4's lacunae outnumber those in K, P and D (see e.g. p.62 n.14, p.66 n.12, p.67 n.12) and that many are cases of aberratio oculi (see e.g. p.4 n.6, p.8 n.2, p.11 n.4, p.14 n.14, p.59 n.4, p.61 n.17) — indeed all the others too are probably due to mechanical mistakes. The relation between A and B cannot be determined because there is no portion of the text that is common to both covering as they do entirely different Ahnikas. As for the relation in which B stands to the other MSS, i.e.A', P and D, we should like to refer to MURAKAMI 4 1 who has already stated that "on the whole B agrees with Pn", our P, "and Kl", but adds that this holds of course good for D, too. All four MSS have two large lacunae in common (see p.265 n.l and p.265 n.9), viz. practically the whole of the commentary on SK 60-63 and that on SK 65 and 66. All of them have therefore at any rate at least one source in common, namely one in which the corresponding folios were already lost or illegible. It has, however, also to be noted that B has a number of significant lacunae peculiar or substantially peculiar to it, and significant as concerning not merely individual words (see p.233 n.8 and p.234 n.12), but whole phrases or sentences or a part of the müla (see p.259 n.17, p.264 n.18 and p.255 n.8), while in K and P only one such lacuna is found (see p.242 n.2). The first of the lacunae in B, the long quotation from Kdth.S. 11.3 (see pp.259-260), can hardly be a mechanical mistake, whereas the second one (p.264 n.18) may simply be due to the fact that at this point B is reproducing a source in which itself this lacuna was more extensive, already gone beyond the limits it has in the MSS K and P. These lacunae in B, i.e. the ones peculiar to it and the one it shares only in part with K and P, have led us to posit the hyparchetype e. All our manuscripts have extensive lacunae in common; 42 they have hence to be regarded as all going back to a common source, our ß (in which certain parts of the text, i.e. most probably on various consecutive folios, were missing.) On the basis of these considerations the relation between the MSS, on which the present edition is based, can be represented thus:

41 42

MURAKAMI,

op. cit., p.1018.

See above p.XII.

XX

YUKTIDIPIKA

§ 4

The Constituted Text and the Features Employed

Typographical

In accordance with the methods of modern textual criticism 43 we have followed the so-called genetic principle 44 in constituting the text of the Yuktidïpikâ. Yet this principle too cannot of course be applied just mechanically as if automatically yielding the correct results; in some cases, e.g. where only the sequence of words of a phrase differs in one of the sources (cf.e.g. p.5 n.l, p.23 n.17), no decision at all was possible; in other cases two alternative interpretations of the origin of variant readings seemed equally possible; only in these latter cases do we add in the critical apparatus the remark that a particular reading "is also possibly the original one". After repeated discussions we have arrived at the conclusion that the author of the Yuktidïpikâ was most probably not consistent as regards his use of iti. Nevertheless we have at several places proposed or suggested the addition of an iti, which, if it should not appear acceptable as a conjecture, will at least clarify how we understand the passage or sentence. Our procedure was this: first we transliterated /f,45 comparing it carefully
43

See e.g. Martin WEST, Textual Criticism and Editorial Technique appliable to Greek and Latin texts, Stuttgart 1973; or Texte und Varianten. Probleme ihrer Edition und Interpretation. Hrsg. v. Gunter MARTENS und Hans ZELLER, München 1971; or G.Thomas TANSELLE, Textual Criticism and Scholarly Editing, Charlottesville-London 1990. On which cf. Srinivasa Ayya SRINIVASAN, Väcaspatimisras Tattvakaumudt. Ein Beitrag zur Textkritik bei kontaminierter Überlieferung (Alt-und Neu-Indische Studien 12), Hamburg 1967, p.29ff. It is for this reason that certain forms of internal sandhi as generally observed in Kashmirian

44

45

INTRODUCTION

XXI

with D step by step, and then we collated the other MSS in order to finally examine the variant readings and to decide (whenever we deemed it necessary because of the genetic principle, or for reasons of the intelligibility, etc., of the text) in favour of one of the variant readings, even if it happened to be found only in one of the MSS, or else to emend the text. 46 The number of the Sämkhyakärikä to which a particular portion of the Yuktidtpikd belongs as well as that of the Ahnika47 of which it forms part are given as running headlines on the pages to the right. The text of the corresponding Kârikâ, or a part of it, 48 are printed in capitals; pratïkas, i.e. words of a Kärikä repeated in the Yuktidtpikd for the sake of linguistic, grammatical or semantic explanations, are given in italics. Words, or a number of consecutive words explained in "The Marginal Notes ...", are marked off by a number within round brackets ((1), (2), (3) etc.). Emendations are placed within angle brackets, sounds, syllables or words to be deleted within square brackets. Round brackets are used to add information which in our view is immediately useful to the reader, viz. cross-references (page and line of our edition) and the name of texts which are either quoted or referred to by the author of the Yuktidtpikä, or in which a parallel — to a quotation or reference in the Yuktidtpikd— is found. In the case of references "cf." or "see"49 is added before the the name of the MSS have been retained. —Although in our case there was no reason whatsoever to become suspicious, it is perhaps advisable to remember what BÜHLER wrote, in his Detailed Report ... mentioned in fn.27, p.33, about the Kashmirian pandit's practice of 'cooking' MSS: "As the DevanâgarïMSS. are mostly prepared for the market, they are also not unfrequently cooked, i.e. the lacunae and defects in the original are filled in according to the fancy of the Pandit who corrects them. This most objectionable habit prevails in Kasmîr to a very great extent, perhaps to a greater extent than in India proper, though in India proper, too, the Pandit has little respect for the sacredness of the ancient texts. That sentiment is in Europe, too, of modern growth, and not much older than the historico-critical school of philology, which arose in the end of the last century. In no part of India have I, however, been told of the practice of restoring or 'cooking' Sanskrit books with so much simplicity as in Kasmîr. I was asked by my friends if the new copies to be made for me were to be made complete or not; and one Pandit confessed to me with contrition, after I had convinced him of the badness of the system, that formerly he himself had restored a large portion of the Vishnudharmottara."
46

A question mark after an emendation indicates that we are not certain a) whether it is necessary at all or b) whether it is the correct one among various possibilities that came to our mind. The Yuktidïpikâ as we have it now is divided into four prakaranas and (altogether) eleven âhnikas (for details cf. Ram Chandra PANDEYA, Yuktidtpikä..., p.xxiv). It is, at least at the present moment, difficult to say whether this division goes back to the author himself and whether and, if so, to what extent it, too, shows the influence of Patanjali's Mahäbhäsya taken as model by the author (cf. p.XXIIf. and fn.50 and fn.55). If less than a quarter of an äryä is quoted, an apostrophe is placed after the letter denoting the äryä quarter concerned. We need hardly add that in certain cases it is very difficult indeed to take a decision between these two alternative possibilities: what rather looks like a reference can be a (very) corrupt

47

48

49

XXII

YUKTIDIPIKA

source. 50 A wavy line indicates that we are not certain regarding the text as constituted. Lacunae are marked by a number of dots. By now it can certainly be regarded as an established fact that the Yuktidïpikâ consists of a combination of a Vârttika and Bhâsya, only that both are evidently written by one and the same author who wanted thus to follow the model of Patanjali's Mahäbhäsya embodying the work of Kätyäyana, and hence ultimately to create a kind of counterpart, within the tradition of Sämkhya, to the works of the famous trimunis of Vyakarana, thus raising the Särnkhya-kärikä to the status of a Sutra. 51 Nevertheless, it is a welcome confirmation, or in any case a noteworthy fact, that in "The Marginal Notes..." the keyword varttika is used four times, viz. in the note referring to p.19.6 (see p.l9,fn.(5)), to p.25.10 (see p.25,fn.(2)), to p.97.18 and to p.97.19 (see p.97,fn.(4),(5)). We have tried our very best to identify vârttikas as such and to mark them off from the Bhâsya text 52 by printing them in bold type; but there are cases, and quite a few at that, where one wonders whether a particular phrase should in fact be regarded as a varttika or not: the mere fact of the existence of a subsequent explanation written in the Bhâsya style is not sufficient proof—just as the particular nominal Vârttika style does not allow already by itself to draw the conclusion that what one has to do with is a vârttika in the proper sense. Good examples for such difficulties quotation, and what appears to be a quotation can be the result of a correction by a scribe, or, in general, a person involved in the transmission of the text.
50

Note that this information is not also included in the list of "Signs and Abbreviations" (p.XXX). This has already been noted by our predecessors. It is highly probable that the author of the Yuktidîpikâ thereby wanted to enhance the status of Isvarakrsna's work and that in doing so he did not have only Pänini, Kätyäyana and Patafijali in mind, but felt also provoked, if this is the right word, by the lack of an — old, not versified — Sütra in the Sämkhya tradition. — The details of the reception of the Mahäbhäsya by the author of the Yuktidîpikâ remain to be studied more closely; W. is preparing an article devoted to this problem.

51

52

This is not done in the MSS themselves. Note that in this regard the MSS of the YD do not differ from those of the Mahäbhäsya; for the remark of the editor of the Vyakarana Mahäbhäsya with Kaiyata's Pradïpa and Nägesa's Uddyota, Vol.IV, Bombay 1942, i.e. Pt. Bhärgavasästrf Joshi Sästräcärya, in fn.l on p.248, viz. vararucikrtänäm värttikänärn sarvesäm api kundalanä bhäsyakrdbhih kriyata ity abhiyuktänäm abhipräyah / atra ca [i.e. as regards the phrase samänädhikarana iti vaktavyam at MBhäsya II 340.20f.] asmadupalabdhapustakesu prâcïnesv api kundalanäder adarsanän naite värttike [the dual is due to the fact that the phrase äcäryäd anatvam ca, MBhäsya II 340.5, was also regarded as a varttika by some Indian scholars] iti nirnttam asmäbhih / yaié ca präctnatamesu pustakesu kundalanädinimittam drstam, bhavet tesäm gaudänäm värttikatve 'bhiniveéa iti sudhiyo vicärayantu / / can hardly be taken to testify to the existence, entirely unknown so far, of MSS of the MBhäsya in which the vârttikas are "encircled" or marked off in a similar graphic manner. The expression kundalanä is, also in view of the logical subject bhäsyakrdbhih, rather an attempt to render "paraphrase", "circumscription" in Sanskrit, although MONIER-WILLIAMS lists, with reference to "Naish. 1.14", the meaning "drawing a circle round a word which is to be left out in a MS".

INTRODUCTION

XXIII

are perhaps the argument on the three_ kinds of inference (SK 5) (see pp.8386) and the first paragraph of the 3rd Ahnika (see p.109). In many cases, the 'normal' structure of an objection 'taken up', 5 3 viz. "ABC (etc.) iti cen na VW (ablative)"— which, of course, is also found several times, e.g. pp.5.19, 14.12, 17.15, 20.15, 21.1,10 etc. — is slightly varied in so far as instead of na plus its paraphrase only naitad yuktam or a similar expression is met with. Taken together with similar observations this suggests that the author of the Yuktidïpikâ has not by any means been entirely consistent in distinguishing between the two levels of the text, viz. that of the Vârttika and that of the Bhâsya.54 At times one cannot but even consider it possible that he also made use of the device of formulating grahanakavâkyas.55 But it is equally possible that, at least at some points, the text is a puzzle to us in this very regard because parts of a vârttika or a Bhdsya explanation have been left out by scribes, e.g. because they were similar to each other or regarded as redundant, etc. 56 That is to say, our distinction between the Vârttika and the Bhdsya within the Yuktidïpikâ is but a first attempt which inevitably has to some extent a subjective character. It can certainly be improved upon, but we doubt that it will ever be possible to solve all the relevant problems, even if new MSS should be 'unearthed'. As for the critical apparatus, it has, of course, been our aim to always give reliable and precise information about the variant reading(s) so that the reader is able to form a clear idea which particular variant is found in the place of precisely which element of the constituted text. We have decided to report
53

In accordance with the dialectical strucure of Indian philosophical, or sästric, texts in general, and of the Yuktidïpikâ, with its long pürvapaksa sections, in particular, the reader is reminded of a particular objection, raised by an/the opponent and given earlier in extenso, by a brief repetition of it introduced by e.g. yat tüktam, etc. In the case of iti cet phrases the situation is slightly different in that the objection need not necessarily have been dealt with in a previous part of the text and in that it may have the character of an objection self-posed, an anticipation of a theoretically possible objection and hence an element of objection self-raised. In any case a remark of Medhâtithi's is quite noteworthy in connection with the — general — question of the distinction between Vârttika and Bhâsya, viz. istam hi vidusâm loke samäsavyäsadhäranam, found in his Bhâsya on Manusmrti 1.1. The sentence is introduced by tad uktam and followed by an iti, and is in fact a quotation, viz. from MBh.(Poona) 11.49cd (cf.also MBh. I app. I 1 [41]). The expression samäsavyäsadhärana, "keeping [something] in memory both succinctly and in extenso11, has been misunderstood by J.A.B. VAN BUITENEN who renders it (The Mahäbhärata I. The Book of the Beginning, Chicago-London 1973, p.22) by "(for the wise) wish to retain it for this world, in its parts and in its entirety" (our emphasis).

54

55

On which see Ernst WINDISCH, Ueber das Nyäyabhäshya, Leipzig 1888, and more recently Johannes BRONKHORST, Nägärjuna and the Naiydyikas, JlPh 13 (1985), pp.121-123. F. KiELHORN was faced with similar problems in reconstructing Kâtyâyana's Vârttika; cf. Kâtyâyana and Patanjali: their relation to each other and to Pânini. Bombay 1876, p.27 = Kleine Schriften mit einer Auswahl der epigraphischen Aufsätze hrsg. von Wilhelm RAU, Wiesbaden 1969, p.27.

56

XXIV

YUKTIDIPIKA

also evident scribal errors, but refrained from doing so in the case of sandhi phenomena and dandas. In the text itself we use first of all simple dandas — more or less as full stops — and, with hesitation, certain European punctuation marks (hyphen, colon, comma, semi-colon, quotation marks). A question mark, in the text as constituted by us, means that we are not sure about the authentic reading; in the critical apparatus, however, that readings of the MSS concerned are not clear. Expressions like "add(s)", "insert (s)" in the apparatus are merely descriptive, i.e. do not imply any judgement on the origin and nature, and hence value, of the reading(s) concerned. § 5 "The Marginal N o t e s " (TippanT) in t h e mir and Delhi Manuscripts Kash-

It has already been stated above (§1) that the discovery and edition of this scholion on the Yuktidïpikâ, although it is by far not a running commentary, forms one of the major improvements we think we have achieved. The designation "Marginal Notes" is fully justified in that these explanatory remarks are indeed written in K on the margins (right, left, top or bottom) of the folios. Yet it has to be noted that the first part of these notes, viz. Ks.2, is found a second time, viz. on separate leaves added before the very beginning of the text of the Yuktidïpikâ itself, yet clearly written by a third hand. 57 There can hardly be any doubt that this is an attempt, incomplete, to extract all "The Marginal Notes" and to turn them into a consecutive commentary. Significantly, this attempt seems to have been undertaken by the Delhi copyist, i.e. the scribe who made D by copying K, and that what he did was transcribed into Sarada most probably when K was returned to Srinagar. Nothing is known about the person(s) to whom we owe these "Marginal Notes". That is to say, there is no clear evidence to decide even the question whether they were written by one or more than one author, not to mention his/their identity or date. The author, or one of the authors, however, was remarkably familiar with Mahâyâna Buddhism, a fact that would suggest that he/they may have lived before the extinction of Buddhism in Kashmir, i.e. in the 14th century A.D. at the latest. 58 At one point, viz. in the note referring to p.43.12 (see p.43,fn.(4)), the author refers to the opinion of "others" (anye tu... ity ähuh) ; but that here he is referring to an older and now lost commentary, of whichever type, is just a possibility, and not by any means a certainty: he may equally well have merely had in mind the opinion expressed orally by a 'colleague' of his — as in the case where he introduces a particular interpretation by asmadguravas tu (note on p.104.5, see p.l04,fn.(2)). According to an infor57

The (implied) "second hand" refers to the person who is most probably not identical with the scribe of "The Marginal Notes" as such, but responsible for corrections made in them.
NAUDOU,

58

Cf. Jean

Les bouddhistes kaémiriens au moyen âge. Paris 1968, pp.210-206.

INTRODUCTION

XXV

mation kindly given by A. SANDERSON, 5 9 what is meant by "Abhinavagupta's Sämkhyanirnaya" referred to in the note on p.106.6,10 (see p.lO6,fn.(l)) is most probably not a yet unpublished or even unknown work of this name, but rather the section Tantrâloka 13.3-41b. References to other MSS, or another MS, or another "reading" are rather frequent (see p.23,fn.(3), p.25,fn.(4), p.54,fn.(6), p.95,fn.(2)andp.ll7,fn.(3)). Regarding the typographical features employed in "The Marginal Notes..." it should be noted that the expression explained is given within brackets, even if it is 'quoted' in the note itself (in which case it is underlined); at the end of each note, again within brackets, the references to K (folio number, a = recto, b = verso) and, if found there too, to D (folio number plus numbering of the marginal notes as given by the scribe) are added. Passage(s) 'quoted' from the Yuktidïpikâ, other than those directly annotated in a particular "Marginal Note", is/are given in italics. The use of question marks does not differ from that in the main text, and its critical apparatus. § 6 Title of the Text, Authorship a n d Date

The name " Yuktidïpikâ" seems to be the correct one: it is not only the one regularly given in the colophon at the end of each of the eleven Ahnikas, but also confirmed by the second of the concluding verses (see p.270.15f.) as clearly as one can wish.60 Some doubt, however, arises because in the sole two cases so far known of later authors referring to the Yuktidïpikâ, the name used is "Räjavärttika": in his Nyâyamanjarï Jayantabhatta introduces a quotation by yat tu räjä vyäkhyätavän and räjä is most convincingly explained by Cakradhara to be equivalent to râjavârttikakârah] similarly Väcaspatimisra ascribes in his Samkhyatattvakaumudî the verses he quotes from the very beginning of the Yuktidïpikâ (see p.2, nos.9-11) to the "Räjavärttika". 61 Obviously what Jayanta and Väcaspatimisra — or the person who coined the name "Räjavärttika" — had in mind was the specific, albeit by no means unique, 62 feature of the Yuktidïpikâ, viz. that its kernel is indeed formed by a Vârttika text. They seem to have regarded this feature to be so significant as to name the text as a whole after it, though it does by no means consist of värttikas only. 63 But there are, of course,
59 60

Viz. in a personal communication of March 16th, 1992 (addressed to W.).

As for its explanation cf. A. WEZLER, Some Observations on the Yuktidïpika, in: ZDMG, Supplement II, Wiesbaden 1975, p.434 and fn.2. Cf. A. WEZLER, op.cit., p.450f.

61 62

Cf. J. BRONKHORST, Vârttika, WZKS 34 (1990), pp.123-146, as well as Karen LANG, On Äryadeva's Citation of Nyäya Texts in the *Sataka, in: WZKS 32 (1988), p.132. Cf. also J. BRONKHORST, op. c«*.(fn.62), p.l40f.

63

XXVI

YUKTIDIPIKA

other possibilities too to account for "Rajavarttika", ranging from an alternative, though to all appearances secondary, title, in the full sense of the word, to a kind of a nickname created by and used e.g. among 'students'. Yet, the prior member of the compound poses a problem, too; does "Rajavarttika" mean "the Värttika of Raj an" or "of a/the king" or "the Värttika that is a king", i.e. the foremost of its class? 64 We are afraid that even the fact that this title has been given also to other works 65 does not help to solve this particular problem. This has, of course, also to do with the fact that the identity, and hence the name, of the author of the Yuktidipika alias Rajavarttika still remain a riddle; unfortunately he is not like those authors of philosophical texts who did not hesitate to mention — or should we say: attached quite some importance to mentioning — their own name in a verse at the beginning or the end of their work(s), 66 although he refers to himself by a personal pronoun of the first person (see p.270.20) ; 67 and unfortunately his name seems not to be known to any later author, be he a philosopher or not. This last remark offers the opportunity to state another rather strange, yet noteworthy fact, viz. that knowledge of the Yuktidipika seems to have been confined to Kashmir and some parts of Northern India, at least as far as we can judge at the moment: the extraordinary significance this text has for the history of classical Särnkhya 68 is apparently not reflected in corresponding reception and fame, in the centuries after its composition. Considerations like those just outlined, in the last two paragraphs, will necessarily be made by anybody who muses on the designation "Rajavarttika". "The Marginal Notes ...", however, point in quite different a direction. For immediately upon the second of the two ärambhaslokas — which are separated from each other by a gap of approximately 6 lines — and before
64

Cf. e.g. räjadanta, and Pan. 2.2.31. — Cakradhara's explanation of raja by räjavärttikakärah (Nyâyamanjarïgranthibhanga, ed. by Nagin J. SHAH (L. D. Series 35), Ahmedabad 1972, p.59) is unfortunately rather ambiguous; further, Cakradhara does not seem to have himself still known the real name of the author. Besides Akalaiika's Tattvärthavärttika "which is also known by the name Rajavarttika" (J. BRONKHORST, Värttika, op. cit., p.125) another Rajavarttika is referred to, or quoted, by Sarvajnanârâyana on Manu 1.75. W. is preparing a series of articles dealing with the "Probleme der Selbstnennung von indischen Autoren".

65

66

67

Cf. the last of the concluding verses, p.270 of our edition. — In passing only it should be noted that in P the Yuktidipika is ascribed to Vâcaspatimisra— and that this has, in its turn, led to MSS of the Sâmkhyatattvakaumudï being catalogued under the title " Yuktidipika"''' (as discovered by W. when he was kindly allowed to copy the corresponding entry in the — still — unpublished volume of the New Catalogus Catalogorum and he later checked the references). It is difficult to say whether the wrong ascription in the colophon at the very end of P has anything to do with Vacaspatimisra's quotation from the Yuktidipika or is simply caused by the scribe's having some knowledge of the fact that Vâcaspatimisra is the author of an extensive, particularly well-known commentary on the Sämkhya-Kärikä. Cf. also Eli FRANCO, Whatever happened to the Yuktidipika?, WZKS 35 (1995), pp.123-137.

68

INTRODUCTION

XXVII

the commentary itself, these "Notes ..." read krh rajanagopalakasya (cf.below p.l,fn.(l)); and this statement about the author of the work can hardly refer to the two, or the last of the two preceding verses, or to the following Tippanï proper: its very existence, in addition to the place where it is found, speak clearly against either assumption. What strongly suggests itself is hence the third alternative, viz. that the reader is given information about the Yuktidïpikâ — information which one would expect to find at the end of the Yuktidïpikâ, but which is conspicuously lacking in the colophons of all the extant MSS —, viz. that it is "the work of [a certain] Gopälaka Räjäna". In any case this is a particularly interesting, nay exciting piece of evidence, revealing as it does that there is yet another possibility of interpreting "Raja0" of "Räjavärttika": the prior member could be just a synonym of räjäna, regarding which M. A. 69 STEIN says among other things that "originally a title", it "must have become a family designation at an early date", in Kashmir and Kangra, similar to the related expression räjänaka70 : A work of the class called Värttika and written by the member of the family, or clan, of the Räjänas, or by a person bearing the title "almost a king" (räjänaka), could aptly be referred to by the name "the Värttika of Räj an". As for its date — the discussion of which is now avasaraprâpta—, the decisive evidence is the following: the author of the Yuktidïpikâ quotes Dignâga's Pramânasamuccaya71 several times (see p.5.11, p.75.5-6, and p.86.20); NAKADA'S 72 thesis that he refers also to Dharmakïrti has been rejected by STEINKELLNER, 7 3 and on good grounds too. This suggests that the Yuktidïpikâ was written after Dignâga and before the works of Dharmakïrti had become widely known, or could not any longer be ingored. If we start from the dates of these two Buddhist philosophers as proposed by FRAUWALLNER, 7 4 i.e. 480-540 A.D. (Dignäga) and 600-660 A.D. (Dharmakïrti), it is possible to assign the Yuktidïpikâ to a period between the end of 7th century and the beginning of
69

Kalhana's Rajataranginï ... Translated by M. A. STEIN, Vol. II. Westminster 1900, p.61 (note on VIII, 756).

70

On which see also op. cit. Vol.1, p.244 (note on VI, 117). The identification of those from the apohaväda section of the Pramânasamuccaya, viz. on p.75.5-6 (among others), we owe to Ole Holten PIND.

71

72

Viz. in his article Word and Inference in the Yuktidïpikâ Part I, Naritasan Bukkyö Kenkyüjo Kiyö 12 (1991), pp.47-74.

73

Cf. his article Dharmakïrti on the Inference of Effect (kärya), in Papers in Honour of Prof. Dr. Ji Xianlin on the Occasion of His 80th Birthday, Beijing 1991, pp.711-736.

74

Reference is, of cource, to his famous article Landmarks in the History of Indian Logic, WZKSO 5 (1961), pp.l25-148= Kleine Schriften, hrsg. v. Gerhard OBERHAMMER U. Ernst STEINKELLNER, Wiesbaden 1982, pp.847-870.

XXVIII

YUKTIDIPIKA

the 8th century. This date, i.e. ca.680-720 A.D., fully agrees with the fact — not observed by PANDEYA among others — that the Yuktidipikä also quotes a passage from the famous Käsikävrtti, viz. at the beginning of its commentary on Sämkhyakärikä 1 (see p. 11.10-11); since no parallel to this quotation is found in the Cändravyäkarana and the wording in the Mahävrtti on the Jainendravyäkarana is clearly different,75 there can hardly be any doubt that what is quoted at this point is in fact the Käsikä — which in its turn can be dated with a high degree of certitude 76 to 680-700 A.D. It should, however, be noted that 680-720 A.D. is but the lower limit, though one will certainly hesitate to think of an upper limit which is removed too far from Dharmakïrti. We do realize that this conclusion about the date of the Yuktidtpika is rather puzzling because most of those who have read this text or part of it will have gathered the impression that it is ca. 100 years younger. The quotation from the Käsikä cannot, however, be simply done away with by assuming that it is but a later addition to the text: it forms an essential part of the paraphrase of a värttika — which is in its turn confirmed by a subsequent passage. It is, hence, necessary to reckon seriously with the possibility that the author, inspite of his dates, did not know the works of Dharmakïrti, for whatever reason, but was aware of the works of Kumärila as cautiously assumed by Halbfass. 77 § 7 Acknowledgments

First of all our sincere thanks are due to the libraries, and the authorities in charge of them, for giving us permission to microfilm the MSS of the Yuktidtpika in their possession and to use them for our edition, viz. —the —the —the —the —the Bhandarkar Oriental Research Institute, Poona Lalbhai Dalpatbhai Indological Institute, Ahmedabad University of Kashmir, Srinagar National Archives, New Delhi, and Library of the Benares Hindu University, Varanasi.

Next we should like to thank our colleagues and friends Lambert Schmithausen and Karin Preisendanz who allowed us to use their own copies of Pandeya's edition with their own corrections, notes and annotations, and Srinivasa Ayya Srinivasan for correcting our English and making many valuable
75 76

As was kindly pointed out to us by Thomas OBERLIES.

Cf. most recently, Th. OBERLIES, Das zeitliche und ideengeschichtliche Verhältnis der Cändra-vrtti zu anderen V(ai)yäkaranas (Studien zum Cändravyäkarana III), in: Festschrift Paul Thieme zum 90. Geburtstag am 18. März 1995 dargebracht von Schülern und Kollegen, hrg. von H.-P.Schmidt und A. Wezler. ... Stil 20 (1995), pp.265-317. Cf. W. HALBFASS, Tradition and Reflection, Explorations in Indian Thought, Albany 1991, p.94.

77

INTRODUCTION

XXIX

suggestions. Not a small number of friends and colleagues have most kindly rendered us assistance, for the most part with regard to particular passages of the text. These are Koki Aruga, Ram Shankar Bhattacharya, Klaus Bruhn, Gerhard Ehlers, Felix Erb, Sieglinde Dietz, A.M. Ghatage, Jan E.M Houben, Harunaga Isaacson, Ashok Kapoor, Narayan Manila! Kansara, Masaaki Hattori, Minoru Hara, Yasushi Matsuoka, Rebecca Ann Marck, Hisayoshi Miyamoto, Shinkan Murakami, Naomichi Nakada, Yoshihito Muroji, Toru Tomabechi, Izumi Miyazaki, Bun'ei Otokawa, Thomas Oberlies, Rewati Raman Pandey, Ole Holten Pind, Alexander von Rospatt, Alexis Sanderson, Walter Slaje, Ernst Steinkellner, Esther Solomon, Kamalesh Datta Tripathi, and Michael Witzel. To all of them we should like to express our thanks. Last but not least we are most grateful to the "German Research Council" ("Deutsche Forschungsgemeinschaft") which made this publication possible by a subsidy, and to Gregor Hoppen of Franz Steiner Verlag Stuttgart who took excellent care of its production. Autumn 1997 Albrecht Wezler and Shujun Motegi

Signs and § 1 § 1.1 Signs

Abbreviations

Main Text addition correction deletion reading uncertain vârttika deduced by us word(s) of the Sämkhyakärikä commented on in the Yuktidïpikâ of the Kashmir and Delhi

< > < > with footnote [ ] wavy line letters in bold face italics

§ 1.2

Marginal Notes Manuscripts

< > with note wavy line underlining ( ) italics i.n. s.m. § 2 A AV(S) AK AKBh AKV ALB Isä U Ai.Br K Kath.U Käth.S Kai.U KP Ks GdhS

correction reading uncertain pratïka commented on müla element commented on word(s) quoted from the müla notes written between the lines of the Kashmir Manuscript secunda manus, corrected reading in the Delhi Manuscript

Abbreviations Manuscript of the Yuktidïpikâ, deposited at the Lâlbhâï Dalpatbhaï Indological Institute (Ahmedabad) Saunakïya Atharvaveda Samhitä Abhidharmakosa Abhidharmakosabhäsya Abhidharmakosavyäkhyä Adyar Library Bulletin, Madras Isa Upanisad Aitareyabrähmana Manuscript of the Yuktidïpikâ, which begins after the upodghätah(p.8.16), deposited at the Kashmir University Katha Upanisad Käthaka Yajurveda Samhitä Kaivalya Upanisad Manuscript of the Yuktidïpikâ which covers the upodghâtah(p.8.16), deposited at the Kashmir University Fragmentary sheets inserted in K Gautamadharmasütra

SIGNS AND ABBREVIATIONS Ch Chänd.U JIBS JlPh Tai.Br Tai.S Tai.U TV TSP TSV D

XXXI

Yuktidipika, editio princeps by P.Chakravarti Chändogya Upanisad Journal of Indian and Buddhist Studies, Tokyo Journal of Indian Philosophy, Dordrecht Taittirîyabrâhmana Taittirîyasarnhitâ Taittirïya Upanisad Tattvavaisâradï Tatt vasamgrahapanj ikä Tattvasamäsasütravrtti, included in the Sämkhya-Sangraha Manuscript of the Yuktidipika, deposited at the National Archives, New Delhi sDe-dge edition of Tibetan Tripitaka, kept in the Tokyo University, Derge Tsad Ma 1, (Ce) Manuscript of the Yuktidipika, referred to in D as kha pustaka Dkha Dvädasära Nayacakra DNC Mätharavrtti Math. Maitrâyanïya Upanisad Mait.U Nirukta Nir Nyäyabhäsya NBh Nyäyabhüsana NBhü Nyâyamanjarï NM Nyâyavârttika NV Nyâyavârttikatâtparyatîkâ NVTT Nyäyasütra NS Manuscript of the Yuktidipika, deposited at the Bhandarkar Oriental P Research Institute, Poona Astâdhyâyï of Pänini Pan Peking edition of the Tibetan Tripitaka, mDo 'Grel Ce(95) (vol.130) Peking Pränägnihotra Upanisad Prä.U Pramänasamuccaya PS Pramänasamuccayavrtti PSV Manuscript of the Yuktidipika, deposited at the Benares Hindu UniB versity Brhadäranyaka Upanisad Brh.U MV Madhyamakavrtti Manusmrti Manu S MBhâsya Mahäbhäsya MBh ' Mahäbhärata MS Mîmârnsâsùtra Mund.U Mundaka Upanisad YBh' Yogabhäsya YV Yogavârttika YS Yogasütra RV Rgvedasarnhitä Väj.Sam Väjasaneyi-Samhitä

XXXII Var Vims VP Vyo VS VSC SPBr SBh SV Svet.U SK SV(I) SDS STK WZKS WZKSO ZDMG

YUKTIDIPIKA Varttika of Katyayana Vijnaptimätratasiddhi Virnsatikä Vâkyapadïya Vyomavatî Vaisesikasutra Candrananda's commentary on the Vaisesikasutra Satapathabrâhmana âabarabhâsya Slokavärttika Svetâsvatara Upanisad Sämkhyakärikä Sämkhyavrtti(I) Sarvadarsanasangraha Sâmkhya-Tattvakaumudï Wiener Zeitschrift für die Kunde Südasiens, Wien Wiener Zeitschrift für die Kunde Süd- und Ost-Asiens, Wien Zeitschrift der Deutschen Morgenländischen Gesellschaft

FACSIMILE OF MANUSCRIPTS

XXXIII

u ^ . r t ^ ' ^ ^ S B T O

Ms. K, folio 10 (see pp.35.13-38.14 of the edition)

XXXIV

YUKTIDIPIKA

Ms. D, p.35 (see pp.35.1-36.2 of the edition)

FACSIMILE OF MANUSCRIPTS

XXXV

»iraüfl^ Bj^^i^fr j i t ; ! !: ; ;

Ms. D, p.36 (see p.36.2-18 of the edition)

XXXVI

YUKTIDÎPIKÀ

Ms. D, p.37 (see pp.36.18-38.1 of the edition)

FACSIMILE OF MANUSCRIPTS

XXXVII

P | l W | ^ W * W « f f

Ms. B, folio 1 (see pp.224.11-226.20 of the edition)

P r a t h a m a m

A h n i k a m

svasty astu / om namah sivaya^1)/ om [vitavitavisanasya paksatavanasevinah 2 / pravädäh sämkhyakarinah sallakisandabhariguräh 3 / / ] rsaye paramäyärkamaricisamatejase 4 / samsäragahanadhväntasüryäya gurave namah^2) / l / tattvam jijnäsamänäya vipräyäsuraye munih / yad uväca mahat tantram duhkhatrayanivrttaye / 2 / na tasyädhigamah sakyah 5 kartum varsasatair api / bhüyastväd iti samcintya munibhih süksmabuddhibhih / 3 / granthenälpena samksipya tad ärsam anusäsanam / KP. svasty astu om namah siväya // om A. om namah kamaladalavipulanayanäbhirämäya näräyanäya // sriganesäya namah // P. om Sriganesäya namah om namah siväya / om D. 0 7 srisämbasadäsiväya namah / atha / yuktidipikäbhidhänä sämkhyasaptatipaddhatih 71 2 A. nänätävanasevinah D tävanasevinah 3 This sloka is numbered No.l in A. D. writes this sloka with smaller letters and starts numbering at the next sloka. 4 A. paramäryärka0 recte: paramärthä0 (?) 5 A. sakyäh
J

5

10

Marginal Notes of Kashmir Mss seems to have a kind of arambhaslokas which are written, though not clearly, on the first folio of K., but are not found in D. pancavirnsatitattvesu janmanä jriänam äptavän / ya ädisrstau(?) namas tasmai kapiläya m ah at mane // bhüyah pro_ttapaksäs(?) cyutabahulasiläh ksobhayanty adrayas ced utplutyoccaih sakälau pad asu(?) dandahrte 'gnih / dedhlyante 'thaväntar miladalaghujalasaptakü (?) svasthänäj jätucin me pracalati na mano vlradhlram tathäpi / / krtl räjänagopalakasya ' •' (namah) namaskäro näma vägindriyasya tatkarmodlranapravanasabdaprabandhanirvartakakriyäsä<dä>ratvam* antahkaranasya ca tadvisayam eva samkalpäbhimänädhyavasäyacäturyam dehasya ca tathävidhasamastakaranavrttipürvakah pranamanarüpapränavrttisvabhävas cestävisesa ucyate //(KP.6b, not found in D.) * K. ° sädharatvam

YUKTIDIPIKA nibaddham amalaprajnaih sisyanam hitakamyaya / 4 / pratipaksäh punas tasya purusesänuvädinah1 / vainäsikäh präkrtikä vikärapurusäs2 tathä / 5 / tesäm icchävighätärtham äcäryaih süksmabuddhibhih / 5 racitäh svesu tantresu visamäs tarkagahvaräh / 6 / [vltävitavisänasya paksatävanasevinah / pravädäh sämkhyakarinah sallakisandabhanguräh / / ] 3 sisyair duravagähäs4 te tattvärthabhräntabuddhibhih5 tasmäd Isvarakrsnena samksiptärtham idam krtam / 7 / 10 saptatyäkhyam prakaranam sakalam sästram eva vä / yasmät sarvapadärthänäm iha vyäkhyä karisyate / 8 / pradhänastitvam ekatvam arthavattvam athänyatä / pärärthyam ca tathänaikyam viyogo yoga eva ca / 9 / (see e.g.STK on SK72) 15 sesavrttir akartrtvam cülikärthäh^ ) smrtä dasa / viparyayah pancavidhas tathoktä nava tustayah6 / 1 0 / (see e.g.STK on SK72) karanänäm asämarthyam astävimsatidhä matam / iti sastih padärthänäm astäbhih saha siddhibhih / l l / 20 (see e.g.STK on SK72) yathäkramam laksanatah kärtsnyenehäbhidhasyate /
X A. purusesänuvädinah 2 A. vikäräh purusäs 3 This äloka is not repeated here in A. 4 P. duravagähyäs 5 D. tattvärthabhräntrabuddhibhih, s.m. tattvärthabhräntabuddhibhih 6 P. tusta rthäh smrtärthasah viparyayah pancavidhas tatho yah 7 7 1

/

A. karanänäm

(^(culikarthah) pradhänastitvam ityadayo 'rthäh pradhänyena culatvenanyasastravaiviktye cihnatayämürdhäbhisiktatvenacehopadisyante/ te cülikäsadrsatväc cülikärthäuktäh / / (KP.la, D.2 without number) (cülikärthäh) pradhänastitvam ityäder agramatah(?) / asti pradhänam, tac caikarüpam tac ca bhogyatvän mahadädisvakäryakartrtväc cänyärtham(?) / tadvyatiriktam cästi bhoktrtattvam / tadartham eva ca bhogyam na svärtham / tac ca bhoktrtattvam bahuprakäram / bhogyasya bhoktäram prati caritärthatvena tadasvämikatvam viyogah / acaritärthatvena tatsvämikatvam yogah / prakrtipurusaviveky api tadavivekasamskärät kimcit kälam sade<ha>* evästv iti sesavrttih / saptavidhasya ca vaksyamänasya kartrtvasyäbhäväd akartä purusa ity ete 'rthäh / pradhänyena cülätvenänyaäästravaiviktyacihnatayä mürdhäbhisaktatvena ceha vyapadigyante / tena cülikäsadrsärthatväc cülikärthä ity uktäh / / (K.Oa, not found in D.) *K. sadesa(!)

PRATHAMAM AHNIKAM INTRODUCTION tasmäd atah sästram idam alam nänätvasiddhaye / 1 2 / alpagrantham analpärtham sarvais tantragunair yutam / päramarsasya tantrasya bimbam ädarsagam 1 yathä / 1 3 / tasya vyäkhyäm karisyämi yathänyäyopapattaye / kärunyäd apy ayuktäm täm pratinandantu 2 sürayah / 1 4 /

3

5

äha: karisyati bhavän 3 vyäkhyäm / i d a m tv ädäv upanyastam sarvais tantragunair yutam idam tantram iti / ke tantragunäh kiyanto veti / ucyate: sütrapramänävayavopapattir anyünatä sarnsayanirnayoktih / uddesanirdesam anukramas ca samjnopadesäv iti tantrasampat / / <iti /> süträni ca pramänäni cävayaväs ca sütrapramänävayaväh / tesäm upapattih sütrapramänävayavopapattih / upapattih sambhava ity anarthäntaram / ananyo 'rtho 'narthäntaram 5 / upapattisabdah pratyekam parisamäpyate sütropapattir ityädi / äha^ 1 ) 6 laksanopetasütropapattir 7 iti vaktavyam / itarathä hy alaksanopetasyäpi sütrasya tanträngabhävah syäd iti / ucyate: na näntarlyakatvät / na hy ant arena laksanopetatvam sütratvam / ato na vaktavyam et ad iti / äha: atha sütram iti kasmät / ucyate: sücanät sütram / sücayati täms tän arthavisesän iti sütram / tadyathä "käranam asty avyaktam"(SK16a) "bhedänäm parimänät"(SK15a) iti / atra pratijnähetü kanthoktau / tayor upayogi drstäntam sädhyasiddhaye samartham iti krtvä mülasakaläda<yo>8 'träntar anabhihitä apy etasmäd avasiyänte / athavä bhiksor upasamhrtabahiskaranäntahkaranasya 9 tesu tesv atindriyesv api pradhänädisv arthesu buddhim sücayatiti sütram / athavä "sauksmyät tadanupapattih" (cf.SK8a) iti 10 sütram / tadyathä— alpäksaram asandigdam säravad visvatomukham / astobham anavadyam ca sütram sütravido viduh / / (see e.g.NVTT.on NS.1.1.2)
1 D. ädarsanam, s.m. ädarsagam 2 KP., P. and D.: pratigrhnantu 3 A. bhagavän 4 A. iha 5 A. arthäntaram / anyo 'rtho 'rthäntaram 6 A. omits äha. 7 P. laksanopetas tatropattir 8 KP., P. and D.: mülasakalädaya A. mülasakalädayä We follow 9 A. upasamhrtabahiskaranasya 10 4

10

15

20

25

30

Chakravarti.

A.°papattis ceti

praSnah / / (KP.lb, D.3 with a figurative mark like oo)

YUKTIDIPIKA astobham apunaruktam ity arthah / tatha— laghüni sücitärthäni svalpäksarapadäni ca / sarvatah särabhütäni süträny ähur manisinah / / (see e.g.NVTT. on NS. 1.1.2) 5 pramänäni ca pratyaksädmi täny uttaratra vaksyati "drstam anumänam äptavacanam ca"(SK4ab') "prativisayädhyavasäyo drstam" (SK5ab') ityädi 1 / avayaväh 2 punar jijnäsädayah pratijnädayas ca / tatra jijnäsädayo vyäkhyängam pratijnädayah parapratyäyanängam / tän^1) uttaratra vaksyämah(89.16f.) / äha: avayavänabhidhänam anupadesät / na hi yathä pratyaksädlni pramänäny upadistäni tathävayavä upadistäh / tasmäd avayavopapattir ity et ad asat / bhäsyakäraprämänyäd adosa iti cet / syän matam / yady api sütrakärenävayavopadeso na krtas tathäpi bhäsyakäräh kecid esäm sangraham cakrus te ca nah pramänam / tasmäd yuktam avayavopapattir iti / etac cäyuktam 3 / kasmät / utsütratvät / na hi utsütram vyäcaksänäh bhäsyakäräh pramänam bhavanti(cf.MBhäsya.I.12.27) / tathä caitad utsütritam iti / ucyate: na lingät / naitad yuktam 4 anupadesän na santi jijnäsädayah / kirn tarhi / anupadistam apy esäm astitvam lingät pratipadyämahe 5 yad ayam 6 äcäryah— duhkhatrayäbhighätäj jijiiäsä tadapaghätake hetau /(SKlab) 20 iti jijfiäsanam 7 äcaste / "käranam asty avyaktam"(SK16a) iti pratijnäm karoti / "bhedänäm parimänät"(SK15a) iti hetum vyapadisati 8 / "natavad 9 vyavatisthate Ungarn" (SK42d) iti drstäntam dyotayati / "ksirasya yathä tathä 1 0 pravrttih pradhänasya" (SK57b'd) ity upasamharati / "tasmät trividham karanam 11 dväri"(SK35cd') iti nigamayati / na cänabhipretair äcäryänäm sästre vyavahäro laksyate / tena 12 vayam lingät pratipadyämahe santi 13 jijnäsädayo 'vayaväh sästra 14 iti /
X A. iti 2 A. avayavädayah 3 A. cäsatyam 4 KP. ne..ktam D. nettham 5 A. pratisidhyämahe 6 A. yam instead of yad ayam 7 A. jijnäsäprayojanam 8 A. upadisati 9 A. na tävad 10 A. omits tathä. 11 A. käranam 12 A. te 13 A. sati 14

10

15

25

P. not clear.

A. omits sästra iti // äha ... jijnäsädayo 'vayaväh.

tan iti / avayaväpeksaya pumlingena nirdesah krtah / / (KP.2a, D.4 with a figurative mark)

PRATHAMAM AHNIKAM INTRODUCTION aha: sat am anupadese prayojanavacanam / evam cen manyase santi jijnäsädayo 'vayaväh sästre tesäm anupadese prayojanam vaktavyam 1 amusmäd dhetor äcäryena nopadisyante 2 santi ca ta iti / ucyate: pramänäntarbhävät / pramänesv antarbhäva esäm ity ayam 3 upadisto hetur asmäbhih / anumänängam hi jijnäsädayah / tasmät tadantarbhütas ta iti na prthag upadisyante / kirn ca tanträntarokteh / tanträntaresu 4 hi vindhyaväsiprabhrtibhir 5 äcäryair upadistäh / pramänam ca6 nas ta äcäryä ity atas cänupadeso jijnäsädlnäm iti / äha: na pramänänupadesaprasangät / yadi 7 ca tanträntaropadesäd eva avayavänäm anupadesah pratyaksädlny api ca tanträntaresüpadisyante / "sroträdivrttih pratyaksam" (cf.e.g.PS.:Peking.Ce.3bl, Derge.Ce.3a3; NV. and NVTT.onNS.1.1.4) / "sambandhäd ekasmät sesasiddhir anumänam" (see e.g. NV.onNS.1.1.5) / "y° yaträbhiyuktah karmani cädustah sa taträptas tasyopadesa äptavacanam" (cf.SV(I). on SK4) iti tesäm apy 8 anupadesaprasahgah / atha sati t antränt aropadese pramänäny upadisyante nävayavä iti nanv 9 et ad icchämätram iti / ucyate: pürva 10 eva tarhi parihäro 'stu / athavä punar astu tanträntarokter ity ayam api 11 parihärah / yat 12 tüktam 13 (5.9) pramänänupadesaprasahga ity atra brümah: a y u k t a m etat / kasmät / prayojanavatäm upadesasyädosatvät / anupadeso hi prayojanavatas 14 codyata iti yuktam etat / upadesa 15 eva tu sadosa iti krtvä kah pratyäcaksita / tasmän na kimcid etat / kirn cänyat / pradhänopadese gunabhütäntarbhävasiddheh / tadyathä taksnuhi caitra ity ukte yävadbhih sädhanavisesair 16 vinä taksanam nopapadyate sarväms täms caitra upädatte / tathä pratyaksädisu pramänesüpadistesu yair esäm avinäbhävah sarväni täny upädäsyämahe 17 / kirn cänyat / anyaträpi tadanusthänät / na kevalam ihänyaträpy ayam äcäryah pradhänänäm evopadesam karoti / tadangabhütäs tu tadupadesäd eva pratiyante / tadyathä "käranam asty avyaktam"(SK16a) "bhedänäm parimänät" (SKI5a) iti 1 8 / itarathä hi drstäntäbhäväd asädhanam etat syät / pasyati tv ~ äcäryo nädrstäntam sädhanam sädhyam äpnotiti krtvä prätipädakäh 19 pratipä2 A. äcäryenopadiSyante 3 A. antarbhäva ity esäm 4 A. tanträntare 0 5 A. vindhyaväsa 6 KP., P. and D. omit ca. 7

5

10

15

20

25

30

*A. vaktavyam prayojanam aväyam(sic)

A. pramäna ca D. iti A. omits apy. P. na tv D. na tv, s.m. nanv A. pürvam 11 A. astu 12 D. tad, s.m. yad 13 A. yad uktam for yat tüktam 14 A. prayojanatas 15 A. upadesam D. sädhanasesair, s.m. sädhanavisesair A. upädhäsyämahe 18 A. omits iti. 19 A. prätipädikäh

YUKTIDIPIKA danakale 1 tantrantaropadistan api mulasakaladin aksepsyantiti / kim canyat / anumäne bhütavad upadesät / atas caitad evam yad ayam äcäryah "trividham anumänam äkhyätam" (SK5b') iti braviti / katham krtvä jnäpakam / äkhyätasya hi pratyämnäye bhütaväcinä sabdenopadeso bhavati na cänena 2 5 pürvam trividham anumänam äkhyätam / äkhyätam eveti 3 cen na / <na> tad äkhyätam 4 kvacid iti sakyam pratipädayitum / so 'yam anäkhyäyäpi yad bhütaväcinam sabdam upädatte 5 tajjiiäpayaty äcäryas tanträntaraklptänäm apiha sanniveso 'nglkriyate / kim etasya jnäpane prayojanam 6 / tanträntaro padisto 7 'pi karmayonmäm pränabhedädinäm ca laksanopadesah sangrhito 8 10 bhavatiti siddham tanträntaropadesäd avayavänupadesah / tasmät süktam L evävayavopapattir 9 iti / anyünatä(3.10) / padärthakärtsnyam asesatänyünatety abhidhiyate / padärthäs ca dasa cülikärthäh pancäsat pratyayäh / taträstitvam 10 ekatvam paficabhir vitaih siddham / arthavattvam käryakäranabhävah / pärärthyam sam15 hatyakärinäm 11 parärthatvät 12 (cf.SK17a) / ata evänyatvam cetanäsakter gunatrayät /"janmamaranakaranänäm 13 "(SK18a) ity evamädibhih purusabahutvam (cf.SK18a) / "purusasya darsanärthah"(SK21a) iti samyogah / "präpte sarirabhede 14 "(SK68a) iti viyogah / "samyagjnänädhigamät;>(SK67a) iti sesavrttih / "tasmäc ca viparyäsät"(SK19a) iti purusasyäkartrtvam ity ete dasa cülik^r20 thäh / S panca viparyayabhedä bhavanty asaktis ca karanavaikalyät / astävimsatibhedä tustir navadhästadhä siddhih //(SK47) iti pancäsat pratyayäh / saisä sastih padärthänäm / tadupapattir 15 anyünatä / samsayanirnayoktih(3.10) / samsayas ca nirnayas ca 16 samsayanirnayau tayor uktih samsayanirnayoktih / sämänyäbhidhänam samsayah / tadyathä— mahadädi tac 1 7 ca käryam prakrtivirüpam sarüpam ca / (SK8cd) ity ukte samsayo bhavati kena dharmena käryam prakrtivirüpam kena vä sarüpam iti 1 8 / visesäbhidhänam nirnayah / sa ca dvividhah, sabdato 'rthatas ca /
1 P. pratipädanäkäle 2 D. ca anyena 3 A. äkhyätam deti 4 D. tathäkhyätäm instead of tad äkhyätam 5 A. upädhatte 6 A. prayojanam näma 7 KR, P. and D.: tanträntaroddisto 8 A. omits sangrhito .... tanträntaropadesäd 9 KP., P. and D.: avayavopapattir 10 A. taträsristatvam(l) 11 P. samyatyakärinäm 12 A. padärthatvät 13 A. °käranänäm 14 A. sarirabheda 15 A. tadupattir 16 A. ca tau 17 18

25

avayavänupadesah.

P. tas A. sarüpam ceti

^

PRATHAMAM AHNIKAM INTRODUCTION

7

sabdatas tävad yathä hetumadädibhih 1 (cf.SK10) käryam prakrtivirüpam traigunyädibhih prakrtisarüpam iti / arthatas tadyathä "tebhyo bhütäni panca pancabhyah, ete smrtä visesäh" (SK38bc) / kirn käranam / yasmät "säntä ghoräs ca2 müdhäs ca"(SK38d) / asäntaghoramüdhatvät "tanmäträny 3 avisesäh"(SK 38a) / uddesanirdesam (3.11) / uddesas ca nirdesas coddesanirdesam / "sarvo dvandvo vibhäsayaikavad bhavati"(cf.MBhäsya.1.476.1) iti dvandvaikavadbhävah / samksepavacanam uddesah / tadyathä— esa pratyayasargo 4 viparyayäsaktitustisiddhyäkhyah / (SK46ab) vistaravacanam nirdesah / tadyathä "paiica viparyayabhedä bhavanti" (SK47 ab') "bhedas tamaso 'stavidhah" (SK48a) ityädih 5 / anukramas ca(3.11) / padärthänäm änupürvyä sannivesopadeso ?nukramah / tadyathä— prakrter mahärps tato 'hamkäras tasmäd ganas ca sodasakah / (SK22ab) ity anena / samjnopadesau(3.11) / samjnipratyäyanärthah 6 sabdah samjiiä (cf.MBhäsya.1.38.20) / sä ca dvividhä / arthanibandhanä svarüpanibandhanä ca / taträrthanibandhanärthavasenärthakriyäpeksä / j ätyädyarthasvarüpäntarbhävi7 yathärthas tathäbhütam eva samjiiinam8 pratyäyayati / tadyathä "päcako lävakah"(cf.SBh.onMS.1.1.5) iti / svarüpanibandhanä punah samjnipratyäyanopäyamätram svarüpamätropakärini 9 vinävayavärtham samayavasäd 10 atathäbhütam api samjiiinam pratyäyayati / tadyathä gajakarno 'svakarna iti / prayatnato bhagavatah paramarser ärsena jnänena sarvatattvänäm svarüpam upalabhya samjnäm vidadhato 11 nästi svarüpanibandhanah sabdah / tadyathä pradhiyante 'tra vikärä iti pradhänam / "puri sete" (cf.e.g.Gop.Br.l.l.39) iti purusa ityädi / tanmatänusärinäm apy äcäryänäm täbhir eva samvyavahärän nästy apürvasamjnävidhänam praty ädarah / upadesah (3.11) / itikartavyatäphalasamäkhyänam 12 upadesah / tadyathä— evam tattväbhyäsän näsmi na me näham ity aparisesam / aviparyayäd 13 visuddham kevalarri utpadyate jfiänam / / (SK64)
1

5

10

15

20

25

30

D. samjninah A. samjnipratyayopäyamätrasvarüpa0 10 D. samjnivaSäd 11 A. vivadato 2 A. • - -1 13A. ° samädhyänam A aviparyasad

3 A. ° müdhatvän mäträny 4 A. omits sargo. 5 A. ityädibhih 6 A. °pratyayanärthah 7 t>.°äntarbhäve 8

A. hetuh padadibhih A. omits ca.

YUKTIDIPIKA <iti /> ete sutropapattyadayas tantragunah / itikaranam (3.11) prakärärtham / evamprakärä anye 'pi drastavyäh / tadyathotsargo 'pavädo 'tidesa 1 ityädi / tatrotsargah "prakrtivirüpam"(SK8d') vyaktam "sarüpam ca"(SK8d') ity apavädah / tathä 2 "tadvipantah"(SKlld') ity utsargah / "tathä ca pumän"(SKlld') ity apavädah / "sämänyam acetanam prasavadharmi vyaktam tathä pradhänam"(SKllbc) ity atidesah / ity evam anyä api tantrayuktayah sakyä iha pradarsayitum / atiprasahgas tu prakrtam tirodadhätiti 3 nivartyate / siddham tantrayuktinäm sambandhopapattes tantram idam iti 4 / kim ca tanträntaravirodhät 5 / yadi khalv apidam 6 prakaranam syät tanträntare<säm> 7 pätanjalapancädhikaranavärsaganaprabhrtlnäm anyatamasya sesabhütam syät tais cäsya <v>irodhas8 tatra tatreti vaksyämah / pürvatantrasesabhäväd iti cet tulyam / etäny api pürvatantrasesabhütäni tesäm api prakaranatvaprasahgah / atha matam sakalapadärthasangrahät tanträntaräny etäni / evam ihäpi sakalapadärthasarigrahät tanträntaratvam abhyupagantavyam / tasmäd yuktam etat tantram idam / ity upodghätah^ 1 )/ äha: kimvisistäya^2)9 sisyäya punar idam tantram vyäkhyeyam iti / ucyate: jijnäsave matimate mimämsakäyärthine 'bhyupagatäya 10 sisyäya vyäkhyeyam sästram / kasmät / paramarsiprämänyät / yasmäd bhagavän visvägrajah paramarsir^3) bhagavadäsurer 11 jijfiäsäm upalabhyottaragunavise1 A. apadesa 2 A. omits tathä ... pumän ity apavädah. 3 A. tirodadätiti 4 A. idam iti kim iti instead of idam iti 5 KP., P. and D.: tanträntarävirodhät 6 A. idam api 7 K., P. and D.: t antränt arena A. tanträntare 8 K., P. and D.: cäsyävirodhas A. cäpy avirodhas 9 A. kimgunavisistäya D. kimvisistäya, s.m. kimgunavisistäya 10 P. 'dhyupagataya 11

5

10

15

20

A. paramarsibhagavadäsurer

(^(upodghatah) upamsur asphutam krtvarthavasad adav eva hanyate tarikitatvenollikhyate gamyate värth<o>* yena sa upodghätah samksepoktih // (D.8 without number, not found in K.) *D. värthä (2) (kimvisistäya)* adhikärinam nirüpayitum äha kimguneti / sampadam cety atra vyäkhyätavän iti sesah / athavokta ity atra sthitena sambandhah / vacanam uktam tad vidyate yasya sa ukta uktavän ity arthah // (Ks.2**, D.10b-l) *cf.p.8,fn.9 **Besides its main text K. has four fragmentary sheets on which marginal notes have been recompiled. We call them here Ks. for the sake of convenience (cf .Introduction of our edition, p.XVII; p.XVII,fn.21). (3) (visvägrajah paramarsir) paramarslti / paramarsim eva pramänlkurvantv itiyävat / tasya pramänikaranahetur visvägraja iti / / (Ks.2, D.10b-2)

PRATHAMAM AHNIKAM SKlab sasampadam^1) ca vyakhyatavan / raja eva duhkham^2) tannirakarisnor viveko 'yarn sattvät / sattvam cäsmän nänety^3) evamädinä^4) vacanapratipädyo 'yam artho mahadbhis coktah^5) / tasmäd rajoduhkhopaghatopaghatakajijnasoh^6) sattväd^7) dharmädikusalamülavipäkotpitsor duhkhatrayanivrttaya idam

(i)(uttaragunavisesasampadam) uttaraguna iti / matih sravanagrahanasaktatvam / mimamsohäpohayogah / arthitvam tattväbhinivesah / abhyupagatatvam upapannatvam* iti jijnäsänantarbhütä ye gunavisesäs tesäm sampadam sampannatvam pürnatvam copalabhya vyäkhyätavän iti väkyasesah / yadi vokta ity uttarena sangatih / vacanam uktam tad vidyate yasya sa ukta uktavän iti yävat / / (Ks.3, D.llb-3) *D. upapannam (2)(raja eva duhkam) nanu kutas tvayedrso vrttänto* jnäta ity äsarikyäha—raja evetyädi // (Ks.2, Ks.3, D.9b-5) '"Ks^ tvayedrsah paramarser vrttänto (raja eva duhkham) raja evetyädi* / raja eva duhkham / tena duhkhasyarajovirahena rüpam nasti / duhkhaniräkarisnoh sisyasya viveka utpanna iti sesah / ayam ca vivekah sattvät / nanu präg api sattvam abhün na ca viveka ity äha—sattvam** cäsmäd ityädi / asmäd rajaso yadä näneti prthagbhütam tadä tadanugrahädivirahitam prakrstam tadäsmäd viveka ity arthah // (Ks.2***, K.Ob, D.9J3-5) *D. omits raja evetyädi. **D. omits sattvam cäsmäd viveka ity arthah. ***cf.p.lO,fn.(2). (3) (sattvam cäsmän nänä) sattvam cäsmän näneti / asmäd rajasah sattvam nänä prthagbhütam / yadä rajogunäbhibhavarahitam sattvam udriktam* sambhavet tadäsmäd viveka ity arthah / / (Ks.3, D.9b-*5) *D. udraktam (4) (evamädinä) nanu tatkathanam katham taih krtam ity ähaivamädineti / grantheneti sesah / tadlyam* grantham eva pathati raja eva duhkham ityädi // (Ks.2, Ks.3, D.9b-5) *Ks.2 omits tadiyam grantham eva pathati raja eva duhkham ityädi (5) (vacanapratipädyo 'y a m artho mahadbhis coktah) vacanapratipädyo 'yam artho mahadbhis cokta iti / atra casabdo bhinnakramah / ayam atränvayah / ayam cärso vrttänto 'rthasabdenokto mahadbhir vindhyaväsiprabhrtibhir vacanapratipädyah / mahadbhir asyärthasya yad vacanam kathanam tatah kathanäd dhetoh pratipädyah pratipattum sakyo 'smäbhir ity arthah // (Ks.2*, Ks.3, D.9b-5) *Ks.2 only reads: ayam cärso vrtto mahadbhir vindhyaväsiprabhrtibhir vacanapratipädyah II (cf.p.lO,fn.(2).). (6)(rajoduhkhopaghätopaghätakajijnäsoh) rajoduhkhena ya upaghäto gamyamänas tadupaghätako ya upäyas tarn jijfiäsoh // (K.Ob, D.9-6) ^ ^(sattväd) katham1 jijfiäsur ity äha sattväd iti / sattvät kldrsäd / dharmädi yat kusalasya sattvaprakarsadänalaksanasya mülam käranam tasya yo vipäkas tasya2 dänätmakakäryaunmukhyam tasmin saty utpattum udgantum prakrstlbhavitum icchu yat sattvam tasmät / käranasya3 hy avikalpasya sämnidhye käryasya prädurbubhüsutä4 / / (Ks.2, K.Ob, D.9-7) Ks.2 omits katham jijnäsur ity äha sattväd iti. D. vipäkasattvaprakarsasya Ks.2 omits käryasya hy avikalpasya sämnidhye käryasya prädurbubhüsutä. D. prädurbabhüsutä

10

YUKTIDIPIKA

5

sastram pravrttam / tad arthat 1 parinamyate^ 1 ) 2 sisyasyeti / katham nama sisyasya3 nihsreyasena yogah syäd ity evamartham idam 4 vyäkhyänam kriyata iti / äha: yad uktam(8.18) jijnäsave vyäkhyänam^2) kartavyam iti tatra kutah punar iyam jijnäsä kasmin5 värthe bhavatiti / ucyate: yat tävad uktam(10.4) kutah punar iyam jijnäsä bhavatlty 6 atra brümah: DUHKHATRAYÄBHIGHÄTÄJ JIJNÄSÄ / (SKlab') duhkham raja ity anarthäntaram / duhkhayatiti duhkham iti bhavati 7 / tiayam iti samkhyäpadam^3) sarvadravyavisayam, tad duhkhena 8 visisyate /
1 A. omits tad arthät. 2 A. parinamsyate 3 A. omits sisyasya. 4 A. omits idam. 5 A. omits kasmin vä ... punar iyam jijnäsä. 6 P. inserts kasmin värthe before bhavatity. 7 K. and D.: duhkham bhavati P. duhkham 8

10

bhavatiti A. and Dkha.: duhkhasabdena instead of tad duhkhena

(

(^(parinamyate) parinamyate cankramanaya hrdaye 'nupraves"yate / / (Ks.2,not found in D.)

(2) (vyäkhyänam) vibhajyäkhyäyante 'rthä iti vyäkhyänam* // (Ks.2**, D.llb-4) *Ks.2 vyäkhyänam ca **Ks.2 is a random collection of marginal notes. Altogther it reads as follows: nanu kutas tvayedrsah paramarser vrttänto jnäta ity äsankyäha raja eva ityädi / ayarn cärso vrtto(vrtt<än>to) mahadbhir vindhyaväsiprabhrtibhir vacanapratipädyah / nanu tatkathanam taih katham krtam ity ähaivamädineti / grantheneti sesah / adhikärinam nirüpayitum äha kimguneti / sampadam cety atra vyäkhyätavän iti sesah / athavokta ity atra sthitena sambandhah / vacanam uktam tad vidyate yasya sa ukta uktavän ity arthah / paramarsiti / paramarsim eva pramänikurvantv iti yävat / tasya pramäntkaranahetur visvägraja iti / sattvam cäsmäd iti / näneti prthagbhütam / tadanugrahädivirahitam prakrstam, tadäsmäd viveka ity arthah / rajovirahena duhkhasya rüpam nästi / niräkarisno sisyasyety arthah / sattvät kidrsät / dharmädi yat kusalasya sattvaprakarsadänalaksanasya mülam käranam tasya yo vipäkah sattvaprakarsadänätmakakäryaunmukhyam tasmin saty utpattum udgantum prakrstt bhavitum icchu yat sattvam tasmät / parinamyate cankramanäy hrdaye 'nupravesyate / vibhajyäkhyäyante 'rthä iti vyäkhyänam ca / caturdasavidhe sarge yat kila traidhätukavädibhir ucyate / ihäviceh prsthe dvätrimsat sthänäny ürdhavrttyävatisthante / tatra prathamäni pancadasa sthänäny astau narakäs catväro manusyaloke ca dvipäs trini devasthänäni / tadyathä meror madhyabhäge caturprahäräjikäh (<cäturmahäräjakä>) meror upari trayastrimsäh, tesäm apy upari nirälamban vimänasthä uparyuparivrttayas tusitä nirmänaratayah parinirmitavasavartinas ceti saisa pancadasasthänah kämadhätuh / atra kämarägänäm kramena pretänäm manusyänärn devänäm ca sthitih / tadupari saptadasa sthänäni rüpadhätur yatra kämavitarägä abhidhyänasukhä atyaktabhavarägäs tisthanti / ärüpyadhätuh punar aniyataprasthäno yatra dhyänasukhavitarägäh / tatra rüpadhätuparyantam jarä vidyate maranam ca / ärüpyadhäto tu visistarüpatäbhäväj jaraso 'sambhave na maranam vidyate // (cf.p.l8,fn.(2) second half) (3) (samkhyäpadam) samkhyä hi näma na padärthäntaram api tu vastüny* eva samühabhävena grhyamänänlti vaktum samühaväcakam padam samkhyäpadam vyavahitam / / (K.Ob, D.9-8) *D. vastuny

PRATHAMAM AHNIKAM SKlab

11

prädhänyäc ca^1) vyatiriktabuddhyä grhyamänam sambandhitväd ädhärasya bhedanibandhanäyäh sasthyä nimittatvam pratipadyate x duhkhänäm trayam duhkhatrayam / abhihanyate 'nenety abhighätah^ / kah punar ayam abhighäto näma / ucyate: yo 'säv uparyuktaduhkhatrayenäntahkaranena 2 (10.8) cetanäsakter abhisambandhah^3) / tasmäd duhkhatrayäbhighätäj jijnäsä / yad uktam (10.5) kasminn arthe bhavatiti taträha 3 — TADAPAGHÄTAKE HETAU / (SKlb') apahantlty apaghätakah, tasyäpaghätakas tadapaghätakah4 / äha: tadapaghätake iti samäsänupapattih 5 pratisedhät / "kartari yau trjakau täbhyäm saha sasthi na samasyate" (Käsikä 2.2.16, Pän.2.2.15) / tasmät tasyäpaghätaka 6 iti vaktavyam / ucyate: na sästre^4) darsanät 7 / "tatprayojako hetus ca" (Pän. 1.4.55) iti sästre drstah prayogah / padakäras cäha "jätiväcakatvät" (Vär.7 on Pan.4.1.14, MBhäsya.II.206.23; Vär.l on Pän.1.2.10, MBhäsya.1.107.21) / tathä "kadäcid guno gunivisesako bhavati kadäcit tu 8 guninä 9 guno visisyate"(cf.MBhäsya.
2 A. upayukta0 3 A. omits taträha. 4 A. omits tasyäpaghätakas 5 A. samänupapattih 6 A. tasyäbhighätaka 7 A. sästradasanät 8 A. omits tu. 9

5

10

15

^Dkha. pratipadyate

tadapaghätakah.

Dkha. guninäm

W (prädhanyac ca) pradhanyac ceti / yada tu samuhinah pradhanatvena grhyante tada vastuny eva bhänti / yadä tu samühah pradhanatvena grhyate tadäsau vastunistha eva bhäti na svatantra iti vastüni tasyädhäratayä* laksyanta ädhäram ca sambandhitayä sakyo vivaksitum iti tätparyam / / (K.Ob, D.10-1) *K. indicates a lacuna after tasyädhäratayä. ' ' (abhighätah) abhihatis ca näma buddhisattvasya prakäsätmano rajasä duhkharüpena duhkhaprakäsarüpatävyaktih* / / (K.la, D.10-3) *D. °rüpatä vyaktih * ' (abhisambandhah) antahkarane parigrfiltavisayäkäre caitanyacchäyayä yo 'nugraho yasmin sati sa visayah prakäsito bhavati saiva cicchaktyantahkaranayoh* sambandha ucyate / sa ca dvidhänugraho 'bhighätas ceti / yadä tu grhltasukhäkäravisayapratibimbä buddhir bhavati tadä tasyäm yas cetanäsaktyanugraho yasminsati sukhaniscayätmä visayah prakäsito bhavati so 'nugrahah / grhltaduhkhäkäravisayapratibimbäyäm buddhau cicchaktisambandho 'bhighätatäm pratipadyate / tenedam tätparyam yas cetanäsakteh sambandhah sa duhkhatrayena hetunäbhighäta^abdaväcyo bhavati // (K.Ob, D.10-2) *K. prakäsi cicchaktyantahkaranayoh
(4

>(Sästre) sabdalaksane / / (K.la, D.10-4)

12

YUKTIDIPIKA

5

10

15

II.356.8-9) iti curnikarasya^1) prayogah / tasmad anavadyam etat / ayam tu pindärthah( 2 V trividhena duhkhenäbhihato brähmanas tadapaghätakam hetum jijiiäsate / ko nämäsau hetuh syäd yo duhkhatrayam abhihanyäd iti / äha: duhkhasabdävacanam 1 ädäv amangalärthatvät / mangalädini hi sästräni prathante vlrapurusäni^3) ca bhavanti / adhyetäras ca mangalenäbhihitasamskäräh^4) sästrärthän äsu2 pratipadyante(cf.MBhäsya.I.40.7-9) / duhkham ity ayam cämangalärthah^ 5 ) 3 sabdas tasmän 4 närabdhavyah sästrädäv iti / ucyate: na väkyasyärthe prayogät p a d a s y ä n a r t h a k y ä d a m a n g a lärthatvänupapattih / väkyam arthapratyäyanärtham prayujyate visistärthäbhidhänät / na padam 5 / tathä hi padärthavyatirekena 6 visista eva väkyärthah pratlyate kevalam tu padam sämänyärthäd apracyutam 7 visistärthäbhidhänäsamartham 8 / ata eva na vivaksitärthapratyäyanayogyatayopädlyate^ 6 ) 9 / tadyathä devadattety ayam sabdah kartrväcakatvenopättah sarvakriyävisayatvän näntarena 10 karmakriyäsabdau visistärthah pratlyate /
X A. sabdavacanam 2 A. äsu ca 3 A. ayathämangalärthah instead of ayam ca 4 A. tävan 5 A. visistärthäbhidhänänupapadam 6 P. padärtham vyatirekena 7 K. ad apracyutam 8 A. visisyärthä0 9 Dkha. °tayopädiyate änarthakyät 10

mangalärthah

A. omits näntarena

kriyä sarvakarmakartrvisayatvät(l2.15-13.2).

(^(curnikarasya) asamasabhuyistha yadasanghatanocyate tatpradhanam grantham karotiti cürnikäro mahäbhäsyakärah / / (K.la, D.10-5) (2) (pindärthah) pindärtha etävanmätravastv iti yävat // (K.la, D.10-6) (3)(vlrapurusäni) vTratvam utsähasampat // (K.la, D.ll-1) (4) (-samskäräh) samskäro vighnabhütasya matimändyasyäpäsanam // (K.la, D. 11-2) (5) (amangalärthah) amangalam duhkhapratipattilaksanam arthah prayojanam yasyeti yävad // (K.la, D.ll-3) (6) (-pratyäyanayogyatayä) pratiyogipadäd anyad yat <anyat> kärakäd api / vrttisabdakadambasya sam band has tena nesyate / / yathä tarunyo vrsallbhäryah pravlrarn putrakämyati* rddhasya räjamätangä iti na syuh prayuktayah // caitrasya däsabhäryeyam lünacakraratho** mayä / saraih sätitapatro 'yarP vrksäd iti satäm matam // (K.la, D.ll-4) (cf.Mughdhabodhavyäkarana, p.359.2-8.) *D. prakämyati / **The Mughdhabodhavyäkarana reads lünacakro ratho.

PRATHAMAM AHNIKAM SKlb

13

tathägäm iti karma^1) sarvakriyäkartrabhidhänanimittatvät 1 / tathä<bh>yäjeti2 kriyä^2^ sarvakarmakartrvisayatvät 3 <...> / yadä tu devadatta gäm abhyäja 4 sukläm ity ucyate tadä devadatto 5 gosabdena karmäntarebhyo vyavacchidya6 svätmany^3) avasthäpyate <...> kriyä ca <...> / gosabdas ca <devadattena> sarvakartrbhyo < vyavacchidya> devadattakarmatayä vyavasthäpyate / kartrkarmani cäbhyäjikriyäyäh 7 sädhanabhävenaiva niyamyete / suklasabdas ca 8 gosabdam^4) sarvagunavisayam^5)9 ädheyäntarebhyo vyavacchidya10 svätmana ädhäratve<na>11 niyamya 12 tadvisayatärp^ 6 ) 13 pratipädayatity anena kramena visisto väkyärthah / kevalänäm tu pad an am sämänyärthäd apracyutänäm 14 visesänabhidhänäd änarthakyam / äha ca 15 — prthannivistatattvänäW 7 ) prthagarthäbhipätinäm / indriyänäm yathä käryam rte dehän na labhyate / / tathaiva sarvasabdänäm prthagarthäbhidhäyinäm 16 / väkyebhyah pravibhaktänäm arthavattä na labhyate //(cf.VP.II.423-424)
x Dkha. °kartrabhidhänatvat 2 K., R and D.: tathätyäjeti 3 Dkha. sarvakarmakriyävis ayatvät 4 K., P. and D.: atyäja 5 A. devadattena 6 K., P. and D.: vicchidya 7 K. and P.: cätyäjikriyäyäh D. cätyäjyakriyäyäh 8

5

10

A. cäbhyäjakriyäyäh A. suklasabdo gosabdas ca 9 A. sarvagunivisayam 10 A. vyavacchedya 11 All the Mss read ädhäratve. 12 K. and P.: niyamyate D. niyamyate, s.m. niyamya Dkha. niyamya 13 A. tadvisayatä 14 A. sämänyärthät pracyutänäm 15 A. omits ca. 16 P. reads prthagarthäbhidhänäd and repeats änarthakyam // äha ca prthannivistatattvänäm ... sabdänäm prthagarthäbhi dhäyinäm, i.e. P. omits in this case sarva of sarvasabdänäm.

^) (karma) karma karmasabda ity arthah / nantarena kriyakarmasabdau visistarthah pratiyata ity adhyähärah / / (K.la, D.ll-5) (2)(kriyä) kriyäväcT sabdah / / (K.lb, D.llb-6) (3)(svätmany) sväbhidheye / / (K.lb, D.llb-7) (4)(gosabdam) gosabdärtham ity arthah / / (K.lb, D.llb-8) '5) (sarvagunavisayam) sarvagunädhäratayä yogyam iti yävat // (K.lb, D.llb-9)
(6

)(tadvisayatäm) suklagunavisayatäm // (K.lb, D.llb-10)

^7) (prthahnivistatattvänäm) bhinnäsrayänäm / / (K.lb, D.12-1)

14

YUKTIDIPIKA

5

10

15

20

iti / evam sati kuto ' y a m niscayapratilambhoyad 1 duhkhasabdo ' y a m amangalartho yävatä sandihyata eväyam kirn2 svärthapratipattyartham upätto 'tha heyatväyeti 3 / väkyasya tu mangalärthatvam 4 duhkhaprahänärtham 5 upädänät / yad dhi duhkhaprahänärtham 6 väkyam upädiyate tan mangalärtham drstam / tadyathä vyädhyapagamah 7 syäd alaksmir mä bhüd iti / duhkhaprahänärtham 8 cedam väkyam upättam / tasmän mangalärtham idam / tatra yad uktam(12.4) duhkhasabdävacanam 9 ädäv amangalärthatväd ity etad ayuktam / äha: trayagrahanänarthakyam gunaikatvät / duhkham raja iti pratipanno bhaväms tac caikam sästre pathyate / tasmät trayagrahanam anarthakam iti / nimittabhedäd bhedopacära iti cet / syän matam / yady apy ekam duhkham tathäpi nimittänäm adhyätmädhibhütädhidaivalaksanänäm bhedäd asya bhedopacärah karisyata 10 iti / tac ca naivam / kasmät / njmittänantyena gunänantyaprasangät 1 1 / ädhyätmikam hi 12 dvividham säriram mänasam ca / särlram tävad vätapittaslesmanäm vaisamyanimittam / tathä mänasam <kämakrodhalobhamohavisädabhayersyäratyäsüyävisesadarsananimittam>^) 1 3 / ädhibhautikam 14 ca manusyapasumrgapaksisarlsrpasthävaranimittam / ädhidaivikam sltosnavätavarsäsanyavasyäyävesanimittam 15 / tatra nimittabhedät tritvapratijnasya gunänantyaprasangah / sa ca nestah / tasmän na nimittabhedät tritvam / ucyate: yad uktam(14.8ff.) rajasa ekatvät tritvänupapattis tasya nimittabhedät tritvopacära iti satyam 16 etat / yat tüktam(14.13) nimittänantyena gunänantyaprasanga iti tad ayuktam / kasmät / bhede^2) 'pi sati varna1 A. reads niscayapratilambhah kuto yad, omitting 'yarn. 2 Dkha. atha kirn instead of ay am kirn 3 Dkha. °pratipattyartham upädatte atha heyatye(ti) 4 A. °ärtham 5 A. °prahäranärtham 6 A. °prahäranärtham 7 Dkha. vyapagamah 8 A. °prahäranärtham 9 A. ° sabdavacanam 10 12 K., 13

Dkha. tathäpi adhyätmädhibhütädi(sic)daivalaksananimittabhedäd bhedopacärah karisyate ^Dkha. duhkhänantyaprasangät P. and D. omit hi. K., P. and D.: °vi$ädabhayersyäratyavisesadarsana° A. and Dkha.: °visädabhayersyäsüyäratyavises adarsana0 14 A. omits ädhibhautikam ° sthävaranimittam. 15 P. °osma° instead of ° osna° 16 A. samam

(1)(kamakrodhalobhamohavisadabhayersyaratyasuya-) kämah strTbhogeccha / krodhah prajvalanätmä / mohah sukhasädhanesu sukh<ä>sädhanabuddhih(?)* / Trsyä sädhäranatayä bhogäyogye 'pi vastuni svätmakabhogyatärtham aparabhogäsahanam / asüyä gunesu dosäviskaranam / aratih kuträpy anavasthänam, arater bhäva äratyam** (cf.Pän.5.1.119) / visädo glänih / / (K.2a, D.13-1) *K. and D. sukhasädhanabuddhih **D. anavasthänam, s.m. anavasthänam arater bhäv äratyam (2)(bhede) prathamabhedäd eva sarvasangrahäd iti tätparyam / / (K.2a, D.13-2)

PRATHAMAM AHNIKAM SKlb

15

samkhyävad vyavasthänopapatteh / tadyathä catväro varnä ity asyäh samkhyäyäh sati paippalädädibhede 1 tesäm brähmanatvädivyatirekäbhävän na samkhyäntarahetutvam no khalv api varnävyatirekäd ekatvam bhavati / evam trini duhkhänity asyäh samkhyäyäh sati särirädibhede 2 tesäm ädhyätmikädivyatirekäbhävän 3 na samkhyäntarahetutvam no khalv api duhkhävyatirekäd ekatvam4 bhavitum arhati / kirn cänyat / nimittabhedäd bhedopacära iti bhavän eva pratipannah / na copacärah paramärtha ity alam asthäne 5 yatnena / äha: abhighätäj jijnäsäyäm atiprasangah sarvesäm s a m b h a vät / yady äsurer6 duhkhatray abhighätäj jijnäsä bhavatlty 7 et ad ist am tena sarvesäm abhighäto 'stiti sarvesäm jijnäsäprasangah / atha mata<m>8 duhkhäbhighäte^1) kasyacij jijnäsä bhavati kasyacin neti / nanv <etad> icchämätram 9 / präkprasangäc ca 1 0 / präg(2) apy äsurer 11 jijnäsäyä duhkhatrayäbhighäto na cäsyätyantike hetau jijnäsä babhüva / tena kirn präptam / pascäd asya yato babhüva tad vaktavyam / yathänyatra^3) brahmano 12 ? bhyäsanimittäd adharmaksayät pürvadharmänugrahäc 13 ca vividisä tathänyesäm^4) kusalaJ A. paipyaladi0 2 K., P. and A.: sarirädibhede D. sarirädi0, 3 A. and Dkha.: °vyatirekäsambhavän 4 P. ekam 5 A. ity ayasthäne 6 A. yathäsure 7 A. omits ity. 8 K., P. and D.: sati A. mata 9 K., A., P. and D.: nanv evam icchämätram 10 D. präkprasangäc ca, s.m. präkprasangäs l ^A. äsure 12 A. brahmano 13

5

10

15

s.m. särirädi0

Dkha. nanu icchämätraprasangäc ca ca

Dkha. pürvadharmänugrahena

(^(duhkhäbhighäte) matabhedesu pathyatväbhimänändhä janä vrthä / yato ghattakutlbhävah param tvam visvatomukha // ghattakutl jakätkhäna* iti bhäsayä prasiddhas tadvad bhävah sattä yasya sah / / (K.2b, D.141) *D. ghattakutTjakät khäna na tu punar iyam abhighätanimittä jijnäsälaksaneccheti jijnäsäyäh präg iti sambandhah // (K.2b, D.14-2) ^3^ (yathänyatra) yathänyatra samiksädisästre tannimittäntaram uktam <tathety api>* vaktavyam iti sambandhah / tatratyam eva grantham pathati brahmana** iti brähmanasyety arthah / yadi vä brahmano vedajnänasya yo 'bhyäsas tatkrtäd adharmaksayät / nanu sa eväbhyäsah kuta ity äha pürvadharmeti / / (K.2b,D.14-3) *K. and D.: tathäpi **D. brahmana ^4'(anyesäm) anyesäm api sästrakäränäm evamvidham väkyam astlti tad väkyam pathati / / (K.2b, D.14b-4)

16

YUKTIDIPIKA

5

10

mulabhyasaparipakat^ 1 ) <iti(?)> / na capadistam^2) ato laghuktam^3) etat / kirn cänyat / tadapaghätäc^ 4 ) cänirmokso 'krtsnatvät^ 5 )/ mokso hi kämarüpärüpyadhätutrayäd 1 isyate / daivamänusyatiryagyonitrayäd 2 vä / ekadesas ca samsärasya duhkhatrayam / tasmät prayojanam apy ayuktam^ 6 )/ kirn ca nimittäntarasadbhäväd / divyakämadhyänasukhänapeksasyäpi^7) vividisä sambhavati na kevalam täpodvignasya 3 / tasmän nimittam apy(8) ayuktam / kirn cänyat / ubhayathä cäsambhavät / parikalpyamänä khalv aplyam 4 jijnäsä purusasya vä syäd gunänäm vä / kirn cätah / tan 5 na tävat purusasya sambhavati / kasmät / nairgunyäbhyupagamät / icchädvesaprayatnasukhaduhkhadharmädharmajnänasamskäränäm ätmagunatvam (cf.NS.1.1.10) na 6 bhavadbhir abhyupagamyate / na gunänäm äcetanyät 7 / na hy acetanä ghatädayo hitähitapräptiparihäram 8 jijfiäsamänä drsyante / na ca cetanä 9
1 A. karmaruparupya0 Dkha. kamarupyarupya0 2 A. and Dkha.: devamänusatiryagyoni0 3 K., P. and A.: täpodvignasyäpi D. °vignasyäpi, 4 A. apiya 5 Dkha. omits tan. D. tan na, s.m. na 6 A. na tad 7 A. äcaitanyät 8 Dkha. °parihäsam 9

s.m. ° vignasya

A. cetanäh

(*) (kusalamulabhyasaparipakat) kusaleti / kusalam muladharmanugrahas taddhetuko yo ?bhyasas tasya paripäkät // (K.2b, D.14b-5) (2) (apadistam) nimittäntaram // (K.2b, i.n., not found in D.) (3) (laghüktam) aparipürnam uktam // (K.2b, D.14b-6) (4^ (tadapaghätäc) duhkhatrayäpaghätät // (K.2b i.n., not found in D.) (5) (tadapaghätäc cänirmokso 'krtsnatvät) duhkhatrayam asyäpaghätake krte 'pi kämadhätor eva traidhätukasamsäraikadesamäträd duhkhatrayasampürnän mukto bhavet / na tu rüpärüpyadhätubhyäm / tayor hi dhyänam äpattisukhaikaghanasvabhävatvän na tu duhkhatrayarüpatä / tad vaksyati samsäraikadesas ceti / nanu traidhätukah samsära iti naitat siddham / ucyate tathäpi deväditrayam samsärätmakam prasiddham / / (D.14b-3, not found in K.) ^6^ (prayojanam apy ayuktam) duhkhatrayaniväranam hi prayojanam tac cäyuktam asampürnamoksarüpatväd* iti bhävah // (K.2b, D.14b-7) *D. asampürnam moksa0 (7)(divyakämadhyänasukhänapeksasyäpi) divyam sukham devänäm kämasukham naränäm dhyä- nasukham dhyäyinäm / anena sukhänapeksäpi jijnäsäyämhetur bhavati na tu duhkhatrayäbhighäta evety uktam // (K.2b, D.14b-8) (8) (nimittam apy) nimittam apTti / jijnäsäyäm duhkhatrayajihäsä nimittam ity uktam, anyad api sambhavati / tat kirn iti noktam iti tätparyam / / (K.2b, D.14b-9)

PRATHAMAM AHNIKAM SKlb

17

bhavatäm gunäh "sämänyam 1 acetanam prasavadharmi"(SKllb) pradhänam iti vacanät2 / kirn cänyat / tattväntaränupapatteh / na ca gunapurusavyatiriktam vas tattväntaram 3 asti yasya jijfiäsä parikalpyamänä 4 parikalpyeta / tasmäd anupapannä 5 jijfiäsä / ucyate^: yad uktam(15.8) abhighätäj jijnäsäyäm atiprasangah sarvesäm tatsambhaväd ity atra brümah: na abhighätatvenäpratipatteh^/ yady apy avisisto 'bhighätas tathäpi 6 sarve nainam abhighätatvena pratipadyante / tathä hi satsv 7 ädhyätmikädiduhkhesv arjanaraksanaksayasangahirpsäsu8 ca prityabhisvarigäd esäm na visayesüdvegäpadvesau9 na ca visayaparityägo bhavati / tasmän nävisisto 10 'bhighätah / visese 'bhighätabuddher 1 1 nimittäbhidhänam 1 2 iti cet / athäpi syäd 13 yeyam asati visese sarvapränabhrtäm äsurer eva bhagavato duhkhatrayäbhighätabuddhir bhavati na punar anyesäm ity atra nimittam abhidhäniyam / na hy antarena nimittam asau viseso14 'vastKäpayitum15 sakyata iti / etac cäyuktam / kasmät / prasnäsambandhät / kuto jijfiäsä16 bhavatlty evam codakena pürvam akäri prasnas tasyäs ca säksät käranam abhighätah käranäntaränäm anabhidhänäd ity asyaiva 17 nirdesah krtah / yat tu khalv idänlm käranakäranam api prcchyate tad anavasthäpfasangabhayän nocyate / atha nirbandhah kriyate tena pürvadharmänugrahasya kusalamüläbhyäsaparipäkasya käranakäranatvam na 18 pratisidhyata iti tad eva kirn na grhyate / etena präkprasarigah pratyuktah / yat tüktam(16.2) täd<apaghätäc>19 cänirmokso 'krtsnatväd ity etad apy ayuktam 2 0 / kasmät /
2 K., P. and D.: vaksyamänavacanät 3 A. vastutattväntaram Dkha. nas tattväntaram 4 P. parikalpamänä 5 A. anupannä 6 A. omits api. 7 Dkha. na hi sa satsv for tathä hi satsv 8 A • ajainaraksana0 9 D. visayesüdvegäpadesau Dkha. visayesüdve rägadvesau 10 A. na vis ist o 11 A. ?buddhe D. avighäta0, s.m. abhighäta0 12 Dkha. nimittäd abhidhänam 13 Dkha. cet / api syäd 14 A. and Dkha.: visese 15

5

10

15

20

*A. sämänyem

Dkha. sthäpayitum Dkha. kuto hetor jijfiäsä A. hetau jijfiäsä 17 A. asaiva 18 A. and D.: asmäbhir na 19 All the Mss read tadabhighäte. 20 Dkha. omits apy.

(1

l(ucyate) siddhantino vakyam itah prabhrti // (K.3a, D.15 without number*) *D. deletes this note with a horizontal line.

' ) (abhighätatvena) abhighätatvena jfiäyamäno 'bhighäto jijfiäsänimittam ity anena tad api parihrtam yac cod it am äsureh pürvam eva kasmän näbhüj jijfiäsä (cf.15.12) iti / pürvam hy eso 'bhighätamnäbhighätatvenämamsteti bhävah // (K.3b, D.16-1)

18 sastrarthanavabodhat^ 1 ) /

YUKTIDIPIKA

astavikalpo daivas tairyagyonas 1 ca pancadhä bhavati / mänusyas caikavidhah /(SK53abc) ity etävän asmäkam samsärah / na tu tadvyatiriktäh kämarüpärüpyadhätavah^2) kvacid api^3) siddhäh / caturdasavidhe ca2 samsäre yä sukhamäträ sä duhkhabhüyastvät tacchabdaväcyä bhavatlti / tathä coktam—
1 K., 2

P. and D.: tairyagyonis A. tiryagyonis A. omits ca.

a-) tattvapariksaprayojanam hi säst ram idam iti bhavah / / (K.3b, D.17-1*) *D. writes the same note in the bottom margin of D.16, and deletes it with a horizontal line. (2) (kämarüpärüpyadhätavah) kämarüpärüpyadhätava1 iti / caturdalavidhe sarge2 yat3 kila traidhätukavädibhir ucyate / ihävlceh prsthe dvätrimsat sthänäny ürdhvordhvavrttyävatisthante / tatra4 prathamäni pancadasa sthänäny astau narakäs catväro manusyaloke ca dvlpäs trlni devasthänäni / tadyathä5 meror madhyabhäge <cäturmahäräjakä>6 meror upari trayastrimsäh, tesäm apy upari nirälambanä vimänasthä uparyuparivrttayas tusitä nirmänaratayah parinirmitavasavartinas ceti / saisa pancadasasthänah kämadhätuh / atra kämarägänäm kramena pretänäm manusyänäm devanäm ca sthitih / tadupari saptadasa sthänäni rüpadhätur yatra kämavltarägä abhidhyänasukhä atyaktabhavarägäs tisthanti / te ca saptadasavidhäh / tathä trlni dhyänäni pratyekam bhümikätritayena vartante / iti nava bhedäh / caturtham dhyänam astabhümikam iti saptadasa / evam uparyuparivittlni dvätrimsat sthänäni kämadhätü rüpadhätus ca / ärüpyadhätuh punar aniyatasthäno7 yatra dhyänasukhavltarägäh, tesäm caturdhopapattih / äkäsam anantam iti bhävayatäm ekah prakärah / vijnänam anantam 9 bhävayatäm dvitlyah / äkimcanyam8 anantam iti bhävayatäm trtlyo na iti samjnä na samjnlti bhävayatäm caturthah /10 ca bhävanänurüpasamvitsatattvamätrasesä ete bhavanti / taträsmims traidhätukakrame 'pi caturdasavidhät sargän na kimcid abhyadhikam uktam / / (Ks.lj D.17b-2) 1 D. kämarüpyadhätava, s.m. kämarüpärüpyadhätava 2 K. adds caturdhadasavidhe sarge 3 4 5 above the line. D. yathä, s.m. yat K. adds tatra above the line. K. omits 6 tadyathä meror ... °vartinas ceti. D. has this phrase in the bottom margin. D. catur7 8 9 prahärajikäh D. °sthänäh, s.m. °sthäno D. s.m. äkimcanyam D. na samjnä 10 nasamjnä iti D. omits 'pi. (kämarüpärüpyadhätavah) caturdasavidhe sarge yat kila traidhätukavädibhir ucyate / ihävlceh prsthe dvätrimsat sthänäny ürdhavrttyävatisthante / tatra prathamäni pancadasa sthänäny astau narakäs catväro manusyaloke ca dvlpäs trlni devasthänäni / tadyathä meror madhyabhäge <cäturmahäräjakä>* meror uparitrayastrimsäh, tesäm apy upari nirälambanä vimänasthä uparyuparivrttayas tusitä nirmänaratayah parinirmitavasavartinas ceti saisa pancadasasthänah kämadhätuh / atra kämarägänäm kramena pretänäm manusyänäm devanäm ca sthitih / tadupari saptadasa sthänäni rüpadhätur yatra kämavltarägä abhidhyänasukhä atyaktabhavarägäs tisthanti / ärüpyadhätuh punar aniyataprasthäno yatra dhyänasukhavltarägäh / tatra rüpadhätuparyantam jarä vidyate maranam ca / ärüpyadhätos tu visistarüpatäbhäväj jaraso 'sambhave na maranam vidyate / / (Ks.2**) *Ks.2 caturprahäräjikäh **cf.p.lO,fn.(2).) (3) (kvacid api) kvacid aplti / etävataiva pramänasiddhatvam samjnämätram adhikam krtam iti bhävah / / (K.3b, D.17-3)

PRATHAMAM AHNIKAM SKlb atra jarämaranakrtam 1 duhkham präpnoti cetanah purusah / lingasyävinivrttes tasmäd duhkham samäsena 2 / / (SK55)

19

drsyate ca' 1 ) loke bhüyasä grahanam / tadyathämravanam iti / tasmät krtsnavikalpapratisedho ' y a m 3 / Ya^ punar etad uktam(16.5) divyakämadhyänasukhänapeksasyäpi vividisäsambhavän nimittam ayuktam iti 4 tad apy anupapannam / kasmät / uttaratra^ 2 ) pratisedhäd ist am 5 evaitat^ 3 ) sangrhltam( 4 V tathä cottarasütrena^ 5 ) pratisetsyaty äcäryah— drstavad änusravikah sa hy avisuddhiksayätisayayuktah 6 / (SK2ab) tasmäd divyasukhänapeksasyäpi^6) yuktä 7 vividisä / dhyänasukham 8 api ksayätisayau nätivartate 9 / tad apy atraiva sangrhitam / tasmät pratisedhya eväyam paksa(7) iti na kimcid abhidhlyate / yad apy uktam lo (16.8) ubhayathäsambhaväj jijfiäsänupapattir ity astu gunänäm jijnäsä / yat tüktam (16.12) äcetanyäd 11 asambhava iti saty äcetanye 12 buddher^8) icchädisadbhävam uttaJ K. and P.: atra janmajarä0 D. 2 D. samäsena, s.m. svabhävena 3 A. °pratisedhäyam 4 A. ayktam ceti 5 D. drstam, s.m. istam 6 A. °ksayätiyuktah 7 K., P. and D.: ° änapeksasyoktä 8 Dkha. dhyänam 9

5

10

atra janma0, s.m. tatra janma0

K., P. and D.: kramätisayau nätivartate A. ksayatisayo notivartate Dkha. ksayätisayau nätivartate 10 A. ayuktam 11 Dkha. acaitanyäd A. äcaitanyäd 12 Dkha. saty api caitanye

M (drsyate ca) nanv atra sukham apy astity aha drsyate ceti / duhkham hi bhuyo bahutaram rajasa eva pravrttirüpatvena sarvatra sämänyät / / (K.3b, D.17-4) (2) (uttaratra) uttaratreti / uttarena hi sütrena sukhänapeksäpi nimittatvenopättä / anyanimittatvam jijnäsäyäity adhyähärah / yat tvayä coditam abhighäta eva hetutvena jijfiäsäyäm ukte nimittäntaram tu noktam ity uttarasütrena parihrtam // (K.3b, D.17-5) ^3^ (istam eva) istam eveti / anapeksäyä hetutvam ity adhyähärah / / (K.3b, D.17-6) ^4^ (sangrhitam) nanu kasmät tan noktam ity äha sangrhitam iti / uttarasütreneti bhävah / / (K.3b,'D.17-7) ^5) (tathä ca) etad värttikam vyäcaste tathä ceti / / (K.3b, D.17-8) ^ ' (divyasukhänapeksasya) sukhänapeksasya duhkhäbhighätena samvedanahetutayäsmäbhir uktä jijnäsä / saiva divyasukhänapeksasya na tv ahetuketi bhävah / / (K.3b, D.18-1) ' )(paksa) anapeksä jijfiäsäyäm hetur ity esa paksas tyäjyaiveti (K.3b, D.18-2) / ato hetor duhkhäbhighätam muktvä nänyat kimcid abhidhlyate jijfiäsähetutveneti / / (K.3b, D.17-8) ^(buddher) buddher iti / cetanäsaktiyogena cetayamänä* buddhir icchädlngunän bhajate / na tu cidekasvabhäve pumsTcchädiyogenäpy atyantäcetanadehaghatädäv** iti vaksyämah / /

20

YUKTIDIPIKA

5

10

15

ratra pratipadayisyamah(SK20) / tasmad upapanna jijfiasa / äha: tacchabdänarthakyam pratipadam asambandhät 1 / yo ' y a m äcäryena tacchabdah sütre pathito 'sya khalu pratipadam asambandhät svalpäm apy arthavattäm nopalabhämahe / tasmän nainam apuskalärtham adhyesyämaha iti / ucyate: katham hi näma prayoktrpäratantryäc chabdasya sabdäntarena sambandho^1) na syäd iti / äha: na brümo 'vidyamänasambandho 2 'sambandhah / kirn tarhi 3 / ayuktasambandho yah sa khalv asambandhah / tadyathänäcäro mänavaka iti dravyena kriyäsaktitvän^2) na sakyam kimcid anäcäravatä 4 ksanam apy 5 avasthätum / ayuktam tv äcarann 6 anäcära ity ucyate / tathä cäsya tacchabdasya pratipadam sambandho na yuktas tasmäd anarthakas tacchabdah / änantaryäj jijnäsäsabdasyeti cet / syän^3) matam / "anantarasya vidhir vä 7 bhavati pratisedho 8 vä"(cf.MBhäsya.I.101.12) ity anayä yuktyä 9 jijfiäsäsabdasya tacchabdenäbhisambandhah sakya iti / tac ca naivam / kasmät / tadapa^4) prayojanäsadbhävät 1 0 / na hi jijnäsäpaghäte kimcit prayojanam saty 11 api sambandhe na tacchabdenärthah / abhighätasyeti cet / athäpi syäd / yadi jijnäsäpaghäte na kimcit prayojanam astity atas tatsambandho 12 nesyate tena tarhy abhighätasabdenäsyäbhisambandhah 13 karisyate /
1 A. pratipadasambandhat 2 A. avidyamänas sambandho 3 A. türhy 4 D. anäcäravatah A. anäcäratä 5 A. omits apy. 6 A. äcarann 7 A. vidhi vä 8 A. pratisedhä 9 A. yuktyäm 10 K., P. and D.: prayojanäsambhävät 11 A. omits saty api ... kimcit prayojanam 12 A. atatsambandho 13

astiti.

Dkha. °sabdenä$yäpaghätasyäbhighätasambandhah

(K.3b, D.18-3) *D. cetayamänä, s.m. cetanäyamänä **D. °yogenäpi atyantäcetanadehaghatädäv, s.m. °yogo näpi atyantäcetane dehaghatädäv (*) (prayoktrpäratantryäc chabdasya sabdäntarena sambandho) na hi sabdena sabdasya sväbhävikah kascit sambandhah / sa tu prayoktrkalpitah // (K.4a, D.18-4) W (kriyäsaktitvän) kriyäsaktyavyatirekäd avyabhicärät kriyämsatvät / / (K.4a,D.18-5) (3) (syän) syäd iti / sambhävanäm darsayann abhyupagamamätram et at / / (K.4a, D.19-1) (4) (tadapaghätake) jijnäsäpaghäte // (K.4a, D.19-2) (5) (na hi jijnäsäpaghäte kimcit prayojanam asti) sväpädyavasthäyam api jijnäsä nästi na ca sä präpyeti bhävah / / (K.4a, D.19-3)

PRATHAMAM AHNIKAM SKlb

21

tathä cäpi tacchabdo 1 'rthavän bhavisyatiti / etad a n u p a p a n n a m / kasmät / nimitt ävast häne^1) punah punar 2 utpatteh 3 / naimittiko ' y a m abhighätas tasya nimittavattväd ätyantiko 4 'paghäto na syät / itarathä^ 2 ) jvaranimitto 5 däha iva sitadravyasarnsparsät prasänto 'pi nimittävasthänät punah punah pravartata ity asyäphalatvam 6 vyäyämasya / trayasabdasyeti cen na päratantryät / äsrayaparatanträ 7 hi samkhyä, tasyä näntarenäsrayopaghätam apaghätah 8 sakyah 9 kartum / änarthakyam ca samänam 10 iti sutaräm tacchabdena närthah / duhkhasyeti 1 1 cet / syän matam / yady etesäm padänäm abhisambandhe yathoktadosopapattih, duhkhasabdam 12 tarhi tacchabdenäbhisambhantsyämah 13 / tasminn esa nisedho visatiti / tac ca naivam / kasmät / anekapadavyavadhänät / katham anantaravrttinä 14 sarvanämnänekapadavyavahitasyaduhkhasabdasyäbhisambandhah sakyeta 15 pratipattum 1 6 / tasmän na kimcid etat / kirn cänyat / upasarjanatvät / ayam khalv api duhkhasabdah samäsa upasarjanlbhütah / na caikasmin käle sabdasya^3^ pradhänatvam upasarjanatvam ca yuktitah sambhavati / pradhänasya ca padäntarenäbhisambandhah 17 / tasmäd vivädäspadam 18 evaitat sütram / kirn cänyat / nityänäm apaghätänupapatteh / iha nityänäm apaghätah kartum na sakyate 19 / tadyathä purusänäm / anityänäm cäpaghäto drstah / tadyathä jvarädinäm / nityarn^4) ca
2 K., P. and D.: punar (not repeated) 3 A. utpakteh{7) 4 A. nimittavattve tv ätyantiko 5 A. jvaranimittako 6 A. aphalatvam asya 7 Dkha. äsritaparataträ 8 Dkha. näntarenäsrayam samapaghätah 9

5

10

15

a. tathä capasabdätho

A. saktah ^A. samänäm n K., P. and D.: duhkhasabdasyeti 12 A. duhkhasabdena 13 A. ° äbhibhatsyämas D. °sambatsyämah, s.m. °sambhatsyämah 14 Dkha. antaravrttinä 15 A. sakyate 16 A. pratipäditum 17 K., P. and D.: padärthenäbhisambandhah 18 A. vivädävastham 19 A. näsakyate

\ ' (nimittavasthane) duhkhatray<am>* sati nimitte bhavatiti yavat / yadi nimittocchedo na syäd iti sesah // (K.4a, b.19-4) *K. and D.: duhkhatraye
(2

^(itarathä) nimittänucchede / / (K.4a, D.19-5)

' *(sabdasya) anyatrahi paratantribhütasya katham anyatra samkräntih //(K.4b, D.20-1) ^4)(nityam) rajoguno hi nitya eva // (K.4b, D.20-2)

22

YUKTIDIPIKA

5

10

15

duhkham / tasmat tadapaghate 1 'bhyutthananarthakyamW / vrttyapaghate tadapaghata^ 2 ) 2 iti cet / syät punar esä buddhih / satyam nityänäm apaghäto na yuktitah sambhavati / na tu vayam gunalaksanasya duhkhasyäpaghätam brümah / kirn tarhi / vrttir asyäbhibhüyata iti / tac ca naivam / kasmät / uktottaratvät / uktam atrottaram 3 (21.2) nimittävasthäne punah punar^3) utpatter iti / tasmäd ayam apy amärgah 4 / kirn cänyat / avisesät / kalpayitväpi vrttyapaghätam vrttivrttimator 5 ananyatväd vrttyapaghäte 6 vrttimadapaghätah präpta iti nästi kascid visesah / tasmät krso 'yam7 parihära iti närthas tacchabdena / ucyate: yad uktam(20.2) tacchabdänarthakyam pratipadam asambandhäd iti / astu duhkhasabdenäbhisambandhah / tatsambandhe 8 yathoktadosopapattir iti cet / syän matam / yadi tarhi tacchabdasya duhkhasabdenäbhisambandho 9 'bhyupagamyate tena ye 'smäbhih pürvam abhihitä dosäs te prasajyante 10 / tasmät pratisiddhasya 11 paksasya 12 parigrahe sähasamätram iti / etac ca naivam / kasmät / pratividhänät / satyam asati pratividhäne sähasamätram syät / pratividhiyate tu, tasmäd adoso ' y a m iti / kirn tad iti cet / syän matam 1 3 / ucyatäm 14 tarhi kirn tat pratividhänam^ 4 ) yasyävastambhenänekadosavyähato 'py 15 ayam paksa äsriyate 16 / na hy anuktam asmäbhir äkäramätrena^ 5 ) sakyam pratipattum iti / ucyate bädham / yat tävad uk1 Dkha. omits tad-. A. tadupaghate 2 A. vrttyupaghätatadaghäta 3 A. atrottare 4 A. amärga iti 5 A. kalayitväpi vrttyabhighätam vrttimator 6 A. ° apaghäto 7 A. krsoya 8 A. ° sambandho 9 A. °sabdenaiväbhisambandho D. duhkhasabdasyäbhi0, 10 A. prasajyete 11 12 A. 13 A. 14 A. 15 A. 16

s.m. duhkhasabdenäbhi0

D. pratisabdasya pakse matam syäd ucyate omits apy. Dkha. äsriyeta A. äsrayeta

W ('bhyutthananarthakyam) udyama evatra na yukta iti yavat / / (K.4b, D.20-3) (2) (tadapaghäta) duhkhäbhighätah / / (K.4b, D.20-4) (3) (punah punar) punah punar iti / vlpsayä bahuso 'py ucchinnä vrttih käranasadbhävät bhaved eveti vrttyucchedah prayäsamätram ity äha / / (K.4b, D.21-1) (4^ (pratividhänam yasya) pratividhänam* yasyeti karmani sasthl / / (K.5a, D.21-2) *D. omits pratividhänam. (5) (äkäramätrena) äkäramätrena sücanämätrenaivety arthah / yadvästäm visesäkärena, sämänyäkärenäpi pratipattum na sakyam ity arthah / / (K.5a, D.21-3)

PRATHAMAM AHNIKAM SKlb

23

tain (21.11) anekapadavyavadhänän 1 na duhkhasabdasya tacchabdenäbhisambandha ity atra brümah: n a a n a b h y u p a g a m ä t / yo hy anantarakrtam sabdasya sabdäntarena saha 2 sambandham äcaste 3 tarn praty ayam upälambhah 4 syät / vayam tv arthakrtam sambandham äcaksmahe / tathä coktam— yasya yenäbhisambandho dürasthasyäpi 5 tasya tat^ 1 ) 6 / arthatas tv 7 asamänänäm änantarye 'py asambhavah / / 8 (cf.e.g. NBh.1.2.9, NVTT on NS. 1.1.4) kirn cänyat / s ä s t r e d a r s a n ä t / sästre ca vyavahitänäm api sarvanämnäm abhisambandho drsyate "yasya, gunasya hi bhäväd dravye sabdanivesas9 tadabhidhäne( 2 ) tvatalau 10 "(cf.Vär.5onPän.5.1.119, MBhäsya.II.366.10) iti / aträrthakrtas 11 ca sambandhah sabdänäm abhyupagatah^ 3 ) 12 / "hyäpprätipadikät"(cf.Pän.4.1.1) "bahusu bahuvacanam"(cf.Pän.l.4.21) "supo dhätuprätipadikayoh"(cf.Pän.2.4.71) "alug uttarapade"(cf.Pän.6.3.1) ity evamädinäm abhisambandhäbhyupagamah 13 / tathä^4) "anadväham 14 udahärini bhagini vahasi yä tvam sirasä 15 kumbham aväcinam abhidhävantam adräksih" (cf.MBhäsya.I.152.26ff.) iti värttike drstäntah / na hy atra saty änantarye sirasänaduho vahanam kumbhasya vä saranam upapadyate / yath ä cätra vyavahitänäm abhisambandhas tathehäpi drastavyah / yat punar etad uktam (21.14) upasarjanatvät padäntarenänabhisambandha 16 iti / etad anupapannam 17 / kasmät / samäsäd 1 8 a p o d d h ä r e b u d X A. °vyavadhonän 2 A. omits saha. 3 A. cäcaste 4 A. ärambhas 5 A. dürasyäpi 6 A. sah 7 A. arthato hy 8 D. asambhavah //, s.m. 9 A. sabdanivasas 10 A. tätaläv 11 A. omits atra. 12 Dkha. abhyupagamah 13 14 D. anudväham, s.m. 15 K., P. and D.: Sirasi 16

5

10

15

20

asambhavah // iti /

K., P. and D.: abhisambandhäbhyupagamät the bottom margin. anadväham

D. reads abhyupagama ity anyädarse päthah in

K. and P.: °sambandhe A. and Dkha.: °sambandha D. °sambandhe, s.m. °sambandha K. etad anupannam (sic) A. anupapannam etat K. and P.: samsäräd D. writes and deletes samsäräd in the left margin.

I1' (tat) tatpadam tasya sambaddham yasya yenabhimukhah sambandho yuktah / / (K.5a, D.22) d-) tacchabdena bahupadavyavahito gunah pratyavamisyate / / (K.5a, D.22-1) ^3'(abhyupagatah) abhyupagama ity anyädars"e päthah / / (K.5a, not found in D.) (4) (tathä) tatra hy ekaväkyatayä vyäkhyänam kriyate / / (K.5a, D.22-1)

24

YUKTIDIPIKA

5

10

dhya vyavasthitasya 1 svatantryopapatteh / satyam upasarjanasya padantarenäbhisambandho nopapadyate / na tu vayam samäsavrtter eva tacchabdenäbhisambandha iti pratipadyämahe / kim tarhi / samäsäd apoddhrtasya buddhivyavasthitasyopajanitasvätantryasya^ 1 ) sabdäntarena sambandham icchäma iti / athaitad anistam ' V ° g a P r a m a n e 2 c a tadabhäve 'darsanam syät" (cf.Pan. 1.2.55) "atha sabdänusäsanam, kesäm sabdänäm"(cf.MBhäsya.1.1.1-2) iti caivamädlnäm 3 prayogänäm virodhah präpnoti / anistam caitat / yat punar et ad uktam(21.17) nityänäm apaghätänupapatter 4 vrttyapaghäte 5 ca tadapaghätaprasahgäd iti / etad apy 6 anupapannam / kasmät / gunasakteh prayojanoparame 7 saty ä t m a k a l p e n a vyavasthänäbhyupagamät / naitad 8 abhyupagamyate gunasyocchittir bhavati vrttir väsyäbhibhüyate / kim tarhi / purusärthanibandhanä caritärthä 9 saktir asya^2) purusärthapravrttau prayojanäsadbhäväd 10 ätmakalpena vyavatisthata ity etad vivaksitam / tasmäd yuktam etat tadapaghätake hetau jijnäsä pravartata iti / DRSTE SÄPÄRTHÄ11 CET / (SKlc) syäd etat / pratyakso 12 duhkhapratikärahetur asti / tasya samatikrame kim prayojanam / tadyathä särlrasya tävad ayam apagamahetur 13 anekadravyarasäyanopayogah^ 3 ) 14 / mänasasyäpi 15 manojiiastrlpänabhoj anavilepanavasträlamkärädivisayasampräptih^ 4 ^ 16 / ädhibhautikasya nitisästräbhyäsah sasträs1 D. buddhyavasthitasya 2 A. yogapramäno 3 A. tathä caivamädlnäm 4 A. anupaghätänu0 5 A. vrttyupaghäte 6 A. omits apy. 7 A. prayojane 'parame 8 A. na tad 9 D. taddhitärthä (?), s.m. caritärthä 10 K., P. and D.: purusam prati pravrttau prayojanäsambhäväd 11 A. samarthä 12 A. pratyakse 13 K. upagamahetur Dkha. apaghätahetur 14 A. ° rasäyanopabhogo 15 Dkha. mänasas tasyäpi 16 0

15

K., P. and D.: °stripänavilepanabhojana A. °ädivisayam asampräptir

hi-) buddhyaiva hi paratantryam kalpitam tathaiva svatantryam prakalpyam tato 'bhisambandha isyata* iti bhävah / / (K.5b, D.23-1) *K. 'bhisambandhah syata D. 'bhisambandha syata, s.m. 'bhisambandha (i)syata (2)(asya) gunasya / / (K.5b i.n., not found in D.) (3) (anekadravyarasäyanopayogah) anekätmakäni dravyäni manimanträdlni sarlraraksänimittäni rasäyanam ca rasäyanopädänam bhedena tasya prädhänyakhyäpanärtham / / (D.24-2, not found in K.) (4) (manojfia-) manojnasabdasya pratyekam sambandhah / / (K.6a, D.24-3)

PRATHAMAM AHNIKAM SKlcd

25

trakusalatä 1 visamasthänänadhyäsanam 2 ca / ädhidaivikasyäpi yathäkälam vividhanivasanästaranagarbhagrhapräsädajäläntaracandanavyajanamanihärädisevävividhausadhamangalastutimantraprayogänusthänam 3 iti / drste 4 hetau sä jijiiäsäpärtheti cet—
NAIKÄNTÄTYANTATO'BHÄVÄT / / (SKld) 5
6 1 7

etac ca naivam / kasmät / e k ä n t ä t y a n t a t o ' b h ä v ä t / ekänto^ ) näma niyamena bhävah / atyantam bhütasyävinäsah / ekäntas cätyantam ca te ekäntätyante tayor abhäva ekäntätyantato'bhävah tasmät / sasthisthäne paficamT / sasthyaiva vä tasih "sasthyä vyäsraye"(cf.Pän.5.4.48) iti yogavibhägät / asamäsakaranam^2) vrttapüranärtham mänasasya ca^3) duhkhasya pratikäre dosäntaropasahgrahärtham 8 / tathä hi stryädinäm 9 saty etasmin dosadvaye 'sakyam 10 arjanam 11 kartum asväbhävikatvät^ 4 )/ saty arjane raksanam asakyam sädhäranatvät / sati ca raksane ksayah krtakatvät / sahgäc cänupasamo bhütopaghätam antarena cäsambhava ity ete dosäh /
X A. °äbhyä$as sästrärthakusalatä 2 A.: visamasthänädhyäsanam D. 0 sthänäsanam 3

5

10

Dkha. nitisästräbhyäsakusalatä visamasthänänadhy0, s.m. visamasthänädhy0 Dkha.

A. yathäkälavividhinisvaranagarbha0 A. and Dkha.: °härädyupasevä0 (this is also possibly the original reading). 4 A. omits drste ... °tyantato'bhävät(25.3-5). 5 A. tac 6 A. ekäntätyantato'bhävah 7 A. omits ekänto näma ... ekäntätyantato'bhävah tasmät(25.6-8). 8 A. °samgrahanärtham 9 D. süträdinäm, s.m. stryädmäm 10 K., P. and D.: na sakyam 11 A. arjanyam

(^(ekanto; atyantam(25.7)) ekanta iti karmadharayah pumlingah / niscayo 'nt<a>bhavah* / atyantam ity avyaylbhävena napumsakenävinäsa ucyate / / (K.6a, D.25-1) * K. pumlingah / niscayah / antäbhävo D. pumlingah antäbhävo, s.m. pumlingah niscayah antäbhävo (2) (asamäsakaranam) asamäsakaranam iti1 / tasipratyayäntena2 saha samäso nästi / tat kasmät tasipratyayo3 'tra4 krtah / ekäntäbhäväd ity eva kasmän na krta ity äsahkyedam värttikam / / (K.6a, D.25-2) 1 The phrase asamäsakaranam iti is not found in D. 2 D. tasya pratyayäntena 3 D. tasya pratyayäntena 4 D. na (3) (mänasasya ca) mänasasya ceti / abhävasabdo hy asamastah svatantro yävat prayuktas tävat tena cänyenäpy abhisambandho 'sya vivaksita iti dhvanyate / tena yo mänasaduhkhapratlkärahetus tasya raksanasaktyabhäväd* anäsaktyabhäväd ahimsäbhäväd ityädayo 'pi hetavo labhyante saty apy ekäntätyantäbhävalaksane dosadvaye / / (K.6a, D.25-3) * D. arjanaraksanasakty0 (4) (asväbhävikatvät) asväbhävikatväd1 <iti /> anäyattatväd ity arthah / sväbhävikatväd iti päthe bhävasabdo hetuväcl / tena2 svahetuprayuktam katham arjayitum sakyam / / (K.6a, D.25-4) 1 D. omits asväbhävikatväd. 2 D. reads svahetuprayuktatvenety arthah in the left margin, seemingly referring to tena.

26

YUKTIDIPIKA

5

aha: katham etad avagamyate yad drstasya hetor anaikantikatvam 1 anatyantikatvam ceti / ucyate: pratyaksata 2 evaitad upalabhyate yad äyurvedasya 3 kriyäkramasyäbhiyuktam ätmavantam bhesajabhisakparicärakasampannam 4 praty änarthakyam / äha ca— sarvesäm vyädhirüpänäm nidänam trividham smrtam / ä h ä r a s ^ ca vihäras^2) ca karma pürvakrtam tathä / / taträhäravihärotthän rogän dravyam apohati / yas tu karmakrto vyädhir 5 maranät sa nivartate / /

10

punar apy äha— sopadravah sarvarüpc^3) balamämsendriyäpahah / säristas caiva yo vyädhis tarn bhisak parivarjayet / / ity evam anaikäntikatvam / anätyantikatvam tu nivrttänäm api vyädhinäm punarutpattidarsanät / mahatä khalv api prayatnena nivartitä 6 vyädhayah punar utpadyante / tathä coktam— punar jvare samutpanne kriyä pürvajvaränugä / iti / tasmäd yathaiväsyäyurvedädeh 7 pratikärahetutvam pratyaksasiddham evam ekäntätyantato'bhävo 8 'pi / tathä mänasasya ca / yathä ca säriraduhkhapratikärahetavo 9 'naikäntikäs tathä stryädayo 'pi 1 0 / kasmät / tatsannidhäne 1 1 visayäntaräbhiläsadarsanät / yadi hi stryädayo visayäh sarvadä duhkhapratikärasamarthä 12 bhaveyuh kirn iti tesu sannihitesu visayino
1 A. anaikantikam 2 K, P. and D.: pratyaksa 3 K., P. and D.: äyurvedavihitasya 4 Dkha. ° paricärasampannam 5 A. omits vyädhir ... caiva yo. 6 Dkha. vivartitä 7 Dkha. yathä väsyäyurvedädeh 8 A. ekäntyato'bhävo 9 A. °pratzghäta° Dkha. °pratighäta° 10

15

20

D. °hetur, s.m. °hetavo Dkha. yathä ca sariraduhkhapratighätahetavas tathä mänasasya ca naikäntikäh stryädayo }p instead of tathä mänasasya ca .... tathä stryädayo }pi 11 A. tätsanni0 12 A. °pratikärahetavo

(^(ähäras) bhojanam* / / (K.6a i.n., D.25-5) *D. ähäro bhojanam (2)(vihäras) vyäyämah* // (K.6a i.n., D.25-5) *D. vihäras ca vyäyämah (3) (sarvarüpo) yasya krtsnäny eva sästroktäni rüpäni drsyante sa sarvarüpah / aristasabdena viparltalaksanayä maranasücakalaksanäny ucyante / / (K.6b, D.25-6)

__

PRATHAMAM AHNIKAM SKld

27

visayäntarajighrksä syät / evam anaikäntikatvam / anätyantikatvam api nivrttecchänäm api 1 bhüyah prärthanäsadbhävät 2 / yadi hi visayopabhogo3 'tyantam eva mänasam duhkham apahanyät kim^1^ präptam yena 4 bhüyas^2^ tarn prati visayino 'bhiläsah 5 syät / kimkäranam / yasmän na hy avidyamäne tamasi devadattasya pradipam praty apeksä6 bhavati / drsyate ca nivrttecchänäm api visayopabhogäd7 visayinäm bhüyo 8 visayäbhiläsah / tena manyämahe näyam hetur 9 duhkham apahanti / kirn tarhi / sutaräm vrddhim karoti / äha ca 10 — na jätu kam ah kämänäm upabhogena sämyati / havisä krsnavartmeva bhüya eväbhivardhate / / (cf.ManuS.2.94, MBh.L693.6pr., 1.840.lpr., XII.app.78.98pr., XII.616.lpr, 426.1pr, app.l5.4001pr.) apara äha— samvedyatväd gurutväc ca ninditatväc 11 ca sädhubhih / sarvaträsannidhänäc ca na drsto hetur 12 isyate / / samvedyatvät / bhogasädhanavikalänäm arthinäm madhye visayinopayujyamänäs 13 taih samvedyante 14 / tesäm^3) apradäyopayujyamänam nairghrnyam äviskuryät / visayinä 15 pradlyamäno värthibhyah^4) parimitatväd avacchidye1 A. omits api. 2 A. prärthanäsambhavät 3 A. visayopayogau P. vistayopabhogo Dkha. visayopayogah 4 A.omits yena. 5 A. abhiläs 6 Dkha. pratiksä 7 A. visayogäd Dkha. visayopayogäd 8 A. bhüyo 'pi 9 K., P. and D.: näyam drsto hetur A. näyam tur Dkha. näyam 10 A. omits ca. 11 A. nirmitatvät 12 A. tur 13 D. °bhujyamäs, s.m. °yujyamänäs 14 Dkha. samvecyante 15

5

10

15

hetur

A. visayinah

kirn anyan nimittam utpannam yena punar abhilasa iti sangatih / / (K.6b, D.26-1) <2)(bhüyas) bahutaram / / (K.6b, D.26-2) tesäm ity anayä sasthyedam äha—yady api sästrlyavidhiprayuktam tän praty ävasyakarn na dänam / ata eva tesäm na sampradänatä / tathäpitair drsyamänam ekäkinä bhujyamänam vastu krpälos cintänusayam karoty eveti / / (K.6b, D.27-1) ^4^ (arthibhyah) arthibhya iti pancaml na tu caturthT / tena dlyamäno 'sau visayas tasmäd arthivargäd yena trutyed ity arthah / / (K.7a, D.27-2)

28

YUKTIDIPIKA

tety 1 anupayo 'yam2 duhkhapaghate 3 buddhimatam / kirn ca gurutvät^ 1 )/ bhogänäm vividhanivasanastripänabhojanavilepanädinäm 4 sämagrye 5 sukham utpadyate / nänyataravaikalye / sämagryarn6 caisäm sväbhävikatväd^2) anupapannam / äha ca 7 — 5 näbhijätim 8 na vijnänam 9 na ca sauryam 10 apeksate / laksmih samskärayogäc^3) ca kvacid evävatisthate / / ity evam anekäsrayatväd 11 gurur visayabhogah 12 / kirn ca ninditatväc 13 ca sädhubhih / ninditah khalv api sädhubhir visayopabhogah 14 / yasmäd äha— 10 äyäsäs(4)ca vighätäs^5) ca 15 vipralambhabhayäni^6) ca / yac cänyad asivam16 loke tat kämebhyah^7) pravartate / / punar apy äha—
1 A. avacchidyatety 2 Dkha. omits 'yarn. 3 Dkha, duhkhäpaghäto 4 A. and Dkha.: ° vilepanälamkärädinäm 5 A. sämärthe 6 A. sämarthyam 7 A. omits ca. 8 D. näbhijätyam 9 A. vijnätim 10 A. moham 11 A. and Dkha.: anekärthäsrayatväd 12 A. and Dkha.: guruvisayabhogah 13 K. and P.: ninditäc 14 D. visayabhogah, s.m. visayopabhogah 15 16

A. äyäsäc ca pratighätä for äyäsäs ca vighätäs ca. ca vighätäs ca K. yac cäsivam for yac cänyad asivam

D. äyäsäc ca vighätäc ca, s.m. äyäsäs

(1)(gurutvat) bhuyastvenarjayitum asakyatvat // (K.7a, D.27-3) (2) (sväbhävikatväd) svahetvasämarthyät // (K.7a i.n., D.27-4) (3) (samskärayogäc) svahetusämarthyäd ity arthah / / (K.7a i.n., not found in D.) (4) (äyäsäs) sarirakhedäh // (K.7a i.n., D.28-1) (5) (vighätäs) labdham labdham idam mayeti ciram samcityäpi yadaläbhe ye manastäpäs te pratlghätäh // (K.7a, D.28-1) (6) (vipralambhabhayäni) vidambanäh träsäh // (K.7a i.n., not found in D.) (7)(kämebhyah) visayäbhiläsebhyah // (K.7a, D.28-2)

PRATHAMAM AHNIKAM SKld ayam sa^1) ksetriyo^2) vyädhir ayam ätyantiko jvar ah / idam äspadam Itlnäm esa yonih sapäpmanäm 1 / / agädham etat pätälam esa panko duruttarah / klesavyädhibhayäkirnam etac chvabhram 2 bhayävaham 3 / / vividhäyäsasokänäm etad äyatanam mahat / dainyasramavisädänäm^ ) etat ksetram apävrtam / / yo 'smäd 4 visayasambhogäd 5 vihagah panjaräd iva / gato vanesu ramate sa sukhäni samasnute 6 / /
3

29

5

tasmät sädhubhir apäkrtatväd asädhur visayopabhogah / kirn ca sarvaträsannidhänät / na hi supratinivistasyäpi 7 käminah sarvatra^4) visayasannidhänena^5) bhavitavyam / no khalv apy(6) ekasmin 8 dese Vasthänam sambhavati visayäbhävaprasangät / tasmäd avasyam viyogena bhavitavyam / viyoge ca sati dhruvo 'nistänubandha iti ko 'rtho visayaparigrahena / tatra yad uktam 9 (25.3f.) drstasya hetoh sadbhäväd apärthakä jijiiäsety etad ayuktam / äha: yady ekäntätyantato'bhäväd drste hetäv 10 aparitosas tena tarhy asty ayam anyo hetur ubhayadosavarjitah sa kasmän na parigrhyate / ko
1 P. 2 A. 3 A. 4 K. 5 A. 6 A. 7 A. 8 A. 9 A. 10

10

15

sapäpmanät chubhram and Dkha.: bhayänakam (this is also possibly the original reading). and P.: yasmäd and Dkha.: visaya samyogäd sukhäbhisamasnute P. $amusnute(?) supratinistasya caikasmin yuktarn Dkha. drstahetäv

I1) (ayam sa) ayam sa ityadibhih sarvanamabhir ayam artho dhvanyate / sruyate taval loke 'sti* maranänto vyädhir ätyantiko jvara ityädi, sa ca nänyat kimcid vastu, api tu visayasariga eveti / / (K.7a, D.28-3) *D. omits 'sti. (2) (ksetriyo) ksetriyo maranänta<h> paraksetre* cikitsyata iti krtvä / / (K.7a,D.28-3 latter half) *K. and D. maranäntaparaksetre (3)(dainya-) dainya<m> sokädi* / / (K.7a, not found in D.) *K. dainyasokädi W (sarvatra) atyantabhogäbhiyukto 'pi yam yam desam yäti tatra tatra / / (K.7a, D.28-4)
(5

> (visaya-) stryädi / / (K.7b, D.28-4 end)

(6) (no khalv apy) nanv ekatraiva tisthatu / maivam / taträpi samcitaksaye 'vasyam visayäbhävah / tad äha—no khalv apTti / / (K.7b, D.28-5)

30

YUKTIDIPIKA

5

10

15

'sau 1 / ucyate sastroktah karmavidhih 2 / sa hy aikantikah / katham / evam hy äha "pasubandhena sarväml lokän jayati" (cf.SPBr.11.7.1.1, SBh. 1.2.4) / na tüktam kadäcij jayati kadäcin neti / phalasya pratyaksanupalabdher 3 anaikäntikatvaW 1 ) iti cet / syän mat am / pratyaksata evedam vihitasya karmanah phalam nopalabhyate / tathä hi putrakäma istim nirupya^2) duhitaram api na präpnoti 4 / arthak am as ca karma krtvä mäsakam api na labhate / tasmän näyam aikäntika 5 iti / etac ca naivam / kasmät^ 3 '/ sädhanavaikalyät tadanupapatteh / anekasädhanasädhyo hi karmavidhih / yatra phalam 6 nopalabhyate tatra sädhanavaikalyam anumätavyam / kasmät / na hy et ad ist am sati kärane käryam na bhavatiti 7 / kirn cänyat^ 4 )/ samsäräbhävaprasaiigät 8 / yadi khalv api karmanah phalavattvam nesyate tena tannimittasya samsärasyäbhävaprasangah 9 / anistam caitat / tasmät siddham asya aikäntikatvam / ätyantikatvam api siddham eva 10 / yasmäd äha "apäma somam amrtä abhüma"(RV.8.48.3a) iti / atra somapänäd amrtatvapräptih 11 srüyate 1 2 / tasmät tad evänusthätavyam / kirn anyena hetunä parikalpiteneti jijnäsäpärthaiveti / ucyate: DRSTAVAD ÄNUSRAVIKAH / (SK2a) anusrüyata ity anusravah / anusrave bhava (cf.Pän.4.3.53) änusravikah / drstena tulyam vartate 13 drstavat (cf.Pän.5.1.115) / kirn asau / anabhipreta iti väkyasesal/ 5 ) /
X K,, P., and D.: ko 'säv iti cet Dkha. ko 'säv ity 2 A. karmavidhas 3 Dkha. pratyaksatänupalabdher 4 Dkha. labhate 5 A. ekäntika 6 A. phalena 7 P. bhavati 8 Dkha. samsärabhävaprasatigät 9 Dkha. samsärasya bhäva0, s.m. samsärabhäva0 10 A. omits eva. 11 Dkha. amrtatväptih 12

20

A. apäma somam amrtä abhüma aganma jyotir avidäma vedän kin nünam asmän krnavada rätih kimu dhürttir amrta marttyast/eü'(cf.AtharvasiraUpanisad 3) somapänäm amrtatväväptih srüyate 13 A. omits vartate.

t1) (anaikantikatvam) kadacid bhavati putra ity abhiprayenanaikantikatvam // (K.7b, D.29-1) (2)(nirupya) nirupyeti nirvaped iti vidhinä nirüpitam, tat sampädyetyarthah / / (K.7b, D.29-2) (3) (kasmät) nanu karmaiva nisphalam astu / kirn iti sämagrlvaikalyam anumlyate / tad äha— kasmäd iti / / (K.7b, D.29-3) (4^(kim cänyat) nanu käranam eva mä bhüd ity äha / / (K.7b, D.29-4) (5) (väkyasesah) väkyasesa ity anenänabhipretadrstatulyatvamätrat<ä>yäm* änusravikasya na hetur ucyata iti darsayati / anusrüyamänam gurusisyaparamparädhyayanakramenänava-

PRATHAMAM AHNIKAM SK2ab

31

äha: kah punar ayam anusravah / ucyate: mantrabrähmanam yävad vä purätanam anusrüyamänam prämänyenäbhyupagamyate tatrabhavadbhir yathä srutinibandhanäh 1 smrtayo 'ngäni ^1) tarkä vä / yathäha— vedavedähgatarkesu vedasamjfiä nirucyate / aha: kirn purvasmad eva hetor ayam anusraviko hetur anabhipreta iti / nety ucyate / kirn tarhi— SA HY3 AVISUDDHIKSAYÄTISAYAYUKTAH4 / (SK2b) y sa ity änusravikasya hetoh pratinirdesah / hisabdo yasmädarthe / avisuddhis ca ksayas 5 cätisayas cävisuddhiksayätisayäs6 tair yukto ' y a m ? s a bhavaty avisuddhiksayätisayayuktah / etad uktam bhavati / yasmäd ayam änusraviko hetur api ca 8 avisuddho^2) 'nityas täratamyaväms cäto drsta ivänabhipretah 9 / tatravisuddhiyuktas tävat himsävidhänät / yad 10 äha brähmane 11 "brähmanam älabheta 12 " (Tai.Br.3.4.1) ityädi / tathä— satsatäni niyujyante pasünäm madhyame 13 'hani / asvamedhasya vacanäd ünäni pasubhis tribhih / / iti / hirnsä cävisuddhih präninäm istasariravyäpädanät / äha: tadanupapattih sästracoditatvät / yadi sästracoditeyam na syän 14 muktasamsayam avisuddhitvam asyäh pratipadyämahe / sästracoditä
X A. ° nibandhanah 2 A. omits iti. 3 A. hi 4 A. omits avisuddhiksayätisayayuktah ... hisabdo yasmädarthe. 5 A. visuddhiksayas 6 K., P. and D. omit avisuddhiksayätisayäs. 7 K., P. and D. omit 'yam sa bhavaty avisuddhiksayätisayayuktah. 8 K., P. and D. omit api ca. 9 A. iva näbhipretah Dkha. (iva) näbhipretah (this is also possibly 10 A. yasmäd 11 A. and Dkha.: brähmano 12 A. älambheta 13 Dkha. prathame 14

5

10

15

20

the original reading).

K., P. and D.: sästre coditeyam hirnsä na syät Dkha. sästracodito 'yam na syät

A. sästrena codyate }yam hirnsä na syän

cchinnena pravartamanam, idamprathamataya <prathamaya> ravartamanam iti yavat / / (K.8a, D.30-1) *K. and D.: °mätratayäm vidanti caturvargesüpäyam yena sa veda iti nirvacanam / / (K.8a, D.30-2) ^2^ (avisuddho) avisuddha iti / änusravikasya hetor yat phalam tat ksayi sät i say am ca / atah sa hetur apy upacärät ksayätisayayuktah / / (K.8a, D.31-1)

32

YUKTIDIPIKA

5

10

15

tu / tasman neyam avisuddhih 1 / tatpramanyanabhyupagamad adosa 2 iti cet / syän matam / vedaprämänyam abhyupagacchatäm asamsayam etad evam syät / hetuvädakusaläs tu 3 vayam / tasmäd abhidhiyatäm 4 yadi kascid asty ubhayapaksaprasiddho hetur yato na samsayapratyayah 5 syäd^1) iti / e t a c cäyuktam / kasmät / abhyupagamavirodhät 6 / "drstam anumänam äptavacanam ca"(SK4ab') iti prämänyatrayam abhyupagatam bhavadbhih / idänim vedasyäptavacanatve 7 saty aprämänyam bruvatah svamatavyäghätas 8 tasmäd ayuktam etat^ 2 )/ vedasyäptavacanatvänupapatter 9 adosa iti cet / syän matam / äptavacanatvam präkprasädhyäsya 10 vedasya pascäd ayam upälambho yuktam abhidhätum syät / tat tv asiddham / tasmäd anupälambho 'yamW iti / etad apy a y u k t a m / kasmät / <apurusabuddhipürvakatvät(?)> / purusabuddhipürvakatve sati rägädiyogäc chabdo vicärärhah syät kirn äptavacanam na veti / apurusabuddhipürvakas tv ämnäyah svatantrah purusanihsreyasärtham pravartate / tasmän naivamvidham anistam vicäram arhati / kirn cänyat / a v i s u d d h i t v ä n u p a p a t t i p r a s a n g ä t / yadi caitasminn arthe bhavän^4) api paryanuyujyeta 11 katham idam nisciyate yad uta präninäm istasariravyäpädanäd avisuddhir himseti / avasyam abhidhäniyam sästrata^5) iti / tad eva ca sästram kratau himsäm^6) äha / tasmät ko 'tra hetur
X A. asuddhih 2 A. avisuddhir 3 A. omits tu. 4 K., P. and D.: adhzyatäm 5 A. nissamsayah pratyayah (this is also possibly the original 6 A. abhyupagavirodhät 7 A. äptavacane 8 A. svapaksavyäghätah 9 A. äptavacanänupapatter Dkha. ° vacanatväd upapatter 10 A. prasadhyasya 11

reading).

A. paryanuyujyate

t1) (-pratyayah syad) pratyayah syad ity etadantam himsaya avisuddhivadino matam / / (K.8a, D.31-2) (2) (tasmäd ayuktam etat) tasmäd ayuktam etad ity etatparyantam* himsäyäh suddhivädino matam // (K.8b, D.31-3) *D. etadantam (3)('yam) avisuddhitvavädi<no>* matam / / (K.8b, D.32-1) *K. and D.: ° vädinäm (4)(bhavän) himsäyä aviäuddhivädl// (K.8b, D.32-2) (5) (abhidhäniyam sästrata) bhavatäbhidhänlyam sästrata ity anvayah / / (K.8b, D.32-3) (6) (tad eva ca sästram kratau himsäm) yena sästrena bhavatävisuddhir himsety abhidhämyam tad eva sästra<m>* kratuhimsäm vaktlti tasyäh suddhitvameva / / (K.8b, D.32-5) *K. tad eva sästrakratuhimsäm D. tad eva kratau himsäm

PRATHAMAM AHNIKAM SK2b

33

anyatra pramänam ihaivaitad^1) apramänam bhavitum 1 arhati himsäto dharma 2 <ititi>3/ anugrahopaghätalaksanatväd ahimsähimsayoh pratyaksasiddhir iti( 2 ) cet / athäpi syät 4 / ahimsätas cänugraho 5 bhavatistasariravyäpädanalaksano 6 himsätas copaghäto bhavaty abhipretasariravyäpädanalaksanah 7 / kriyänurüpam ca phalam anumätum yuktam iti pratyaksasiddham anayor 8 istänistaphalahetutvam / tasmät ko 'tra sästravyäpära iti / etac^3) cänupapannam / kasmät / a n i s t a p r a s a n g ä t / evam hi parikalpyamäne gurubhäryägamane 9 'pi sattväntaränugrahasämarthyäd istaphalasambandhah syät / mänavakam copaniya vratädesasaucabrahmacaryasvädhyäyäbhyäsabhaiksägniparicaranagurususrüsädisu 10 pravartayato 'nistaphalasambandhah syät / tasmäl lokasästraviruddho 'sattarko nesta^4^ iti / ubhayäbhidhänäc chästravirodhaprasanga^ 5 ) iti cet / syän matam / tad 1 1 eva sästram ahirnsäm äha tad eva himsäm / evam sati parasparaviruddhayor 12 arthayos coditatväd ubhayänugrahäsambhave sästravirodhaprasanga iti / tac^6) ca naivam / kasmät / utsargäpavädayor 1 3 visayabhedät / sämänye hi sästram 14 ahimsäm utsrjya 15 visese kratulaksane 16 'pavädam sästi / sämänyavihitam ca visesavihitena bädhyate / tadyathä "dadhi brähmanebhyo diyatäm takram kaundinyäya"(cf.MBhäsya.1.115.2-3 et passim) iti / tasmäd utsargäpavädayor visayaX A. apramänam idam atha pramänam bhavitum 2 K., P. and D.: himso 'dharma 3 All the Mss read iti. 4 A. syät (?) (not clear) 5 A. ahimsätah präninäm anugraho 6 A. reads sariränabhidrohalaks anah, omitting ista. 7 D. °vyäpädalaksanah 8 Dkha. etayor 9 K., P. and D.: gurubhäryänugamane 10 0

5

10

15

A. °bhaiksägnicarana (this is also possibly the original reading). susrüsädi 11 A. yadi tad 12 A. and Dkha.: °virodhinor (this is also possibly the original reading). 13 A. tatsargäpavädayo 14 K., P. and D.: sästre 15 A. utsr 16 D. krta0, s.m. kratu0

K., P. and D.: °guru-

kratuhimsayam / / (K.8b, D.32-6) (2) (iti) avisuddhitvavädinah// (K.8b, D.32-4) (3)(etac) suddhitvavädino matam / / (K.9a, D.32-7) ^4^ ('sattarko nesta) avisuddhitvavädino 'sattarko nesta ity etatparyantam sästrlyä himsä suddhir eveti prativäditam // (K.9a, D.33-1) (5) (ubhayäbhidhänäc chästravirodhaprasanga) himsäyä avisuddhitvavädinah prasnah / / (K.9a, D.33-2) kratuhimsäyäh suddhitvavädina uttaram / / (K.9a, D.33-3)

34

YUKTIDIPIKA

5

10

15

bhedan nasti sastravirodhah 1 / kirn cänyat / känyägamanavat 2 punarvidhäne dosäbhävät / yathä khalv api 3 sästre pratisiddham^1) känyägamanam 4 iti / nedänim abhirüpah pratigrhya täm abhigamyädharmabhäg bhavati / "grhasthah sadrsim bhäryäm vindetänanyapürvikäm" (GDhS. 1.4.1) iti sästräntarasadbhävät / evam sastre pratisiddhä himsä / nedänim kratau himsäyäm pravartamäno 'nistaphalah 5 syät / pürvoktäd eva sästräntarasadbhävät / tatra yad uktam (31.18) präninäm istasariravyäpädanäd avisuddhir himsety etad ayuktam / ucyate: na abhipräyänavabodhät / citram api bahv etad abhidhiyamäno näbhipräyam 6 sprsatlty upeksyate 7 / kirn käranam / [yasmän] 8 na vayam vedasyaprämänyam 9 pratyäcaksmahe 10 / no khalv api brümah sästracoditäyäm 11 himsäyäm pravartamänasyänistaphalasambandho 12 bhavati / kirn tarhi / sati svargapräptinimittatve 13 vedavihitasya karmanah samanusthänam präni<nä>m14 upaghätam antarena na sambhavatiti 15 hitakämair apy upeksyate / yasmän na hy etad uktam yad anyesäm upaghätenätmänugrahah 16 kärya iti / äha— na tat parasya sandadhyät pratikülam yad ätmanah / esa samksepato dharmah kämäd anyah pravartate / / (cf.MBh.V.39.57, XIII.114.8)

20

äha: yady etan näbhyupagamyate katham pürvam uktam präninäm 17 istasariravyäpädanäd avisuddhir himseti 18 / ucyate: kärye käranopacärät / yo 'sau himsänimittakah 19 kärunyän manasi nah paritäpa utpadyate sä khalv avisuddhir abhipretä / tasyäm 20 käraX K., P. and D.: sästre virodha iti 2 K., P. and D.: kanyägamanät 3 A. omits khalv api. 4 K., P. and D.: kanyägamanät 5 A. 'nistaphalabhäk 6 Dkha. abhidhiyamänam no näbhipräyam 7 A. näbhipräyam veda bhavän 8 A. omits kirn käranam yasmät. 9 K., P. and D. omit prämänyam. 10 K. prätyäksmahe 11 A. sästre coditäyäm 12 A. °sambandhä 13 A. svapräptinimittatve 14 All the Mss read pränijam. 15 A. sambhavetiti 16 A. upaghäto 'ntätmänugrahah 17 A. na präninäm 18 A. omits himseti ... sä khalv avisuddhir. (34.21-23) 19 K. and P.: himsänimittikah 20

A. kirn tu tasyäm

(^(pratisiddham) sastroktavidhina* samskararahitakanyagamanam pratisiddham / / (K.9a, D.33-4) *D. omits sastroktavidhina.

PRATHAMAM AHNIKAM SK2b

35

nam upacaryoktam avisuddhir himseti / yathä mudgais trptä gobhih sukhina iti / äha: katham etad avagamyate himsäkaryam paritapamätram avisuddhir äcäryasyäbhipretä 1 na punar himsaiveti / ucyate: prakarsapratyayopalabdheh / vaksyaty uparistät "tadviparitah sreyän" (SK2c) iti / samänajätiyam ca pratiyoginam 2 apeksya prakarsapratyaya utpadyate 3 / yadi cänusravikasya prasasyatä 4 näbhipretä syät prakarsapratyayänupapattiprasangah / tasmän notsütram etat / äha: sannyäsänupapattih^ 1 ) aviyogasravanät 5 / na hi karmanas tyägasannyäsayos ( 2 ) 6 tvam Tsise / kirn tarhi / sästram yad äha tad avasyam kartavyam 7 / tac cä maranät karmabhir aviyogam8 sästi / kasmät / evam hy äha u jarämaryam^ etat sattram 9 yad agnihotradärsapaurnamäsau 10 jarayä ha etasmät 11 satträd vimucyate 12 mrtyunä ca"(cf.SPBr.l2.4.1.1) / punar apy äha— kurvann eveha karmäni jijivisec^4) chatam samäh / (Isä.U.2) tasmäd ä maranät karmanäm atyägah / tasmin sati hetvantarakarmanäm^ ) änarthakyam 14 /
l 5 13

5

10

15

A. äcäryasyäbhissukhina(sic) iti / äha / katham etad avagamyate himsäkaryam paritapamätram avisuddhir äcäryasyäbhipretä (A. repeats sukhina iti ... avisuddhir.) 2 K., P. and D.: cäpratiyoginam 3 P. utpadyeta 4 A. prasasyatä 5 A. aviyogän D. abhiyogasravanät 6 K., P. and D.: karmano Hyägasannyäsayos A. karmanos tyägasayos Dkha. karmanas tyägasannyäse yas 7 K., P. and D..: avasyakartavyam 8 D. abhiyogam 9 A. jaräparyanta etat sütum(?) 10 Dkha. yad agnihotram darsa0 n D. ekasmät 12 A. ha vä etasmät süträd vipramucyate 13 K., P. and D.: hetvantaränäm 14 K., P. and D.: änantaryam A. änarthakyam

(^(sannyasänupapattih) nanv evam samnyaso yo bhavato hrdi parisphurati vaidikanam karmanäm tityaksanlyatvät* sa eva parlksyatäm ity äsayenäha—samnyäsänupapattir iti / / (K.9b, D.35-1) *D. titiksiniyatvät W (tyägasannyäsayos) tyägah karmanäm akaranam samnyäsah phalänabhisandhänam iti visesah // (K.9b, D.35-2) ( ' (jarämaryam).jarämare sädhur jarämaryas tadantam ity arthah // (K.9b, D.35-3) (cf.Pän.4.4. 98)
(4)

(JÜivisec) jlvitum icchet / / (K.lOa, D.35-4)

^ ' (hetvantarakarmanäm) karmanäm phalam dravinäd icchanto na nisedur natüsnlm äsämcakre kecid rsayah prajävanta iti / / (D.35-5, not found in K.)

36

YUKTIDIPIKA

5

10

15

20

ucyate: na sadhananam 1 asvabhavikatvat / patmsamyogadibhir anekaih sädhanair ayam karmavidhih prasädhyate / tesäm cäsväbhävikatväd asakyam arjanam prayogatah 2 pürvam kartum iti pratipäditam (25.12) / tasmäd anityäni karmäni / hetusästravipratipattau sästraballyastväd 3 iti cet / syän matam^1) / yatra hetusästrayor vipratipattir bhavati tatra vipralambhabhüyisthatväd 4 anumänasya ballyah sästram ity avasyam abhyupagantavyam iti / tac cänupannam / kasmät / saktito viniyogät 5 / saktim apeksya sästram agnihoträdini karmäni vidadhat tesäm anityatäm jnäpayati / katham / evam hy äha "yo 'lam sann 6 agnihoträyägnihotram na 7 juhoti tarn 8 esä devatäparuddhäparunaddhy^ 2 ) asmäc ca lokäd 9 amusmäc cobhäbhyäm" (Ai.Br.5.30=25.5.12) / tasmäd anityäni karmäni / kirn cänyat / jarägrahanasämarthyät 1 0 / tvadlya 11 eva jiiäpake 12 jarägrahanam asti / ato 'numiyate saktyapeksam anityam ca karma / kirn cänyat / s ä s t r a h ä n e h / ubhayam hi sästre drstam / karmäni 13 sannyäsas ca / yadi punah karmäni kartavyatayesyante 14 tena sannyäsasästram hiyate / tasmäd visayarägäviskaranam etad vah / äha: na srutiballyastvät / tulyabalayor hi 15 sästrayor ekavisayasannipäte dvayor yugapadanugrahäsämbhave vikalpaparyäyau^3) bhavatah / srutismrtisannipäte ca srutir baliyasl smrtivihitas ca sannyäsah / tasmän nänayor vikalpah / no khalv api paryäyo nyäyyah 16 / ucyate: tad itaratra tulyam / yathaiva karmanäm samanusthänam sästi sästram tathä sannyäsam api / katham / evam hy 17 äha—
1 Dkha. sädhäranam 2 KM P. and D.: niyogatah 3 A. sästrabaliyastvam 4 Dkha. vilambha0 5 K., P. and D.: yasmäc chaktito viniyogah 6 A. omits sann. 7 A. nägnihotram 8 A. tad 9 K., P. and D.: asmäl lokäd. 10 A. °sämarthyä n K., P. and D.: tadiyam 12 K., P. and D. omit jnäpake. 13 A. nirdistakarmäni instead of drstam / karmäni 14

K., P. and D.: nityakartavyatayesyante A. °tayesyate tavyatesyante 15 A. eva 16 K., P. andD.: nyäyah 17 A. omits hy.

D. °kartavyayesyante, s.m. °kar-

(1)(matam) id am tu matam abhipretam ity arthah / / (K.lOa, D.36-1) (2) (aparuddhä) utpannakrodhä // (K.lOa, D.36-2) (aparunaddhy) cyävayati // (K.lOa i.n., D.36-2) (3) (vikalpaparyäyau) vrlhibhir vä yajeta yavair veti vikalpah / paryäyas tuyatra vidhidvayam apy anustheyam kälabhedena / tadyathä därsapaurnamäsäbhyäm yajeteti därsayägavidhih paurnamäsavidhis ca kälabhedenänustheyau / / (K.lOa, D.36-3)

PRATHAMAM AHNIKAM SK2b na karmanä na prajayä dhanena tyägenaikenämrtatvam^1) änasuh / parena näkam' 2 ) nihitam guhäyäm vibhräjate yad yatayo 1 visanti / /

37

(cf.Kai.U.3) tathä— karmanä 2 mrtyum rsayo nisedhuh 3 prajävanto dravinam^3) icchamänäh 4 / athäpara 5 rsayo mamsinah pararn karmabhyo 'mrtatvam änasuh^ 4 )// brähmanam 6 cätra bhavati / "tad ya ittham 7 viduh / ye ceme 'rany<e>8 sraddhätapa 9 ity upäsate / te 'rcisam(5) abhisambhavanti / arciso 'hah / ahna 10 äpüryamänapaksam 11 / äpüryamänapaksäd 12 yän sad udann eti 13 mäsäms tän / mäsebhyah samvatsaram / samvatsaräd ädityam / ädityäc candramasam /
2 A. na karmanä 3 K., P. and D.: niseduh 4 Dkha. düram Thamänä D. düram, s.m. dravinam 5 D. atha väpare Dkha. atha vä pare 6 A. brahmänam 7 K., P and D.: idam 8 All the Mss read 'ranyäh. We follow Chakravarti. 9 Dkha. sraddhä tapä 10 A. ity upäsete 'rcir abhisamvarty arcisah ahah arkah vaty atho Jhar ahna J1 A. äpüryamänapaksas 12 A. tasmäd 13

5

10

a. vibhräjad etad yotayo

Dkha. (ity) upäsate na cäbhisambha-

A. yän tüdanneh(l) ti

(1)(ekena) ekenanyasahakary<a>napeksenety* arthah / / (K.lOb, D.37-1) *K. and D. °sahakäryanapeksenety (2) (parena näkam) parena näkam / näkäd api param svargäd apy utkrstamsarvän praty aprakatatväd bhävanaikagamyam bhräjate cidätmatayä // (K.lOb, D.37-2) (3)(dravinam) karmanäm phalam / / (K.lOb i.n., D.37-3) (4) (änasuh) präpuh / / (K.lOb, not found in D.) (5) (te 'rcisam) te Vcir ityädinä phalam sannyäsasyäha—arcir iti / ädityatejorüpam abhisambhavantTty ävisantlti yävat / arciso 'nantaram jyotissamcayätmakadinarüpatäm, tato dinasamcayätmakatayäpüryamänam paksam, tato 'pi paksair äpüryamänam1 udann <ety>2 uttaräyanarüpamäsasatkam, tato 'pi mäsasamühatayä vitatakälasvarüpasamvatsararüpatäm, <...> tato 'pi prakäsänandaghanam candram, tato 'pi svaprakäsaikamätram paraprakäsänävilam vidyudrüpamabhisam<bhava>nty3 ävisanti, tac ca vidyudrüpam präkrtaprakäsänävilam4 purusah pürakatvän mänavah samvidrüpatvät / sa ca purusas tän viduso 'rcir ädhikyam äpannäd brahma gamayati kevalarüpatäm nayatlty arthah / / (K.lOb, D.37-4) K. äpüryanarn 2 K. paksam äpüryamänäti instead of udann <ety> D. udann iti 3 K. and D.: abhisamvisanti 4 D. präkrtam prakäsänävilam

38

YUKTIDIPIKA

5

10

15

candramaso 1 vidyutam / tat puruso 'manavah / sa etan^ 1 ) 2 brahma gamayati"(Chänd.U.5.10.1-2) / punar apy äha "etam eva viditvä munir bhavati, etam eva pravräjino lokam 3 icchantah pravrajanti / et ad vah sarve 4 pürve vidvärnsah prajäm näkämayanta 5 prajayä kirn6 karisyämo yesäm näyam^2) ätmä näyam loka^3) iti te ha(4) sma putraisanäyäs ca vittaisanäyäs ca lokaisanäyäs 7 cätha 8 bhiksäcaryam caranti"(cf.Brh.U.4.4.25) iti / tasmäd ete tyägasannyäsayor ubhayor9 lihgam / äha: yady apy evam sästram 10 tathäpi samanusthäne vidhir asti / vihitam cävasyam kartavyam / sannyäse tv arthavädamätram ity anayor ayam visesah / tasmin sati samanusthänam jyäyo na tyägah / ucyate: ko 'y a r n vidhih 11 ko ' y a m arthavädah / äha: vidhis tad<a>rthenäpürvopadesah( 5 ) 12 / yo hi vidhyarthena linä lotä krtyair väpürvopadesah 13 kriyate sa vidhih^ 6 )/ yathä 14 "agnihotram juhuyät svargakämah" / "väyavyam svetam [ajam] älabheta bhütikämah"(cf.Tai.S. 2.1.1.1) iti 1 5 / stutir arthavädah / tasya tu vihitasya prarocanärtham 16 yä stutih 1 7 so 'rthavädah / tadyathä "väyur 18 vai ksepisthä^7^ devatä väyum
2 Dkha. etam 3 A. lokam pravräjina 4 A. etad dha sma vai 5 P. prajänäm kämayantu Dkha. prajänärn 6 A. kirn prajayä 7 K., P. and D.: putresanäyäs ca vittesanäyäs 8 A. ca vyutthäyätha 9 A. ubhayo 10 A. and Dkha.: sästravacanam 11 A. vidhir näma 12 13 A. krtyaiväpürvopadesah 14 A. tadyathä 15 Dkha. ityädi 16 K., P. and D.: prayojanärtham 17 A. and Dkha. stutih kriyate 18

*A. candramasä

kämayante ca lokesanäyäs

K., P. and D.: tadarthatvenäpürvopadesah follow Chakravarti.

A. and Dkha.: tadärthenäpürvopadesah We

A. vä

upäsakän / / (K.lOb i.n., D.38-1) (2) (ayam) ^uddhah purusarüpah / / (K.lOb, D.38-2) (3) (näyam loka) näyam loka iti / brahmaprakäsa ity arthah / / (K.lOb, D.38-2) (4) (ha) ha itihäsadyotakah / / (K.lOb, D.38-2) (5)(apürva-) dharmopadeso yadi väpürvasya pramänäntaränadhigatasyety arthah / / (K.lOb, D.38-3) (6) (vidhih) vidhikäryatväd upadeso 'pi vidhir iti yävat / / (K.lOb, D.38-4) (7) (ksepisthä) ksiprataräticaturety arthah* / / (K.lla, D.39-1)

PRATHAMAM AHNIKAM SK2b

39

eva svena1 bhägadheyenopadhävati sa evainam2 bhütim 3 gamayati"(cf.Tai.S.2. 1.1.1) iti 4 / evamvidhäm stutim 5 upasrutya phalärthine 6 hi 7 yajamänäya vidhih prarocate / etasmin hitakämah pravartata iti / ucyate: na ata eva sannyäsasiddhih / evam cen manyase yam ämnäyah sreyämsam artham manyate tarn prarocanäya stauti <iti> tathä sannyäsasiddhih / kasmät / stutatvät / bahulärthinäm 8 sannyäsam ämnäyah stauti / sä kasmän na prarocate / itarathä hy änarthakyam / yadi khalv apy arthavädah stuvann 9 api prarocayed yad uktam(38.15) prarocanärtho 'rthaväda iti tad bhavadbhir 10 häpitavyam syät / anarthako hy evam saty arthavädah, na prarocanärthah / arthäntaravacanam vä / yadi 11 prarocanärthatvam asya nesyate tena tarhy 12 arthäntaram vaktavyam mä bhüd anarthakatvam vedaikadesasyeti 13 / tasmän nänayä vibhisikayä vayam sakyäh sanmärgäd 14 apanetum / kirn cänyat / ubhayathä vikalpe 'nistaprasangät 15 / ihäyam ämnäyo vidheyatvena16 vä sannyäsam stüyäd avidheyatvena vä / kirn cätah / tad yadi tävad 17 vidheyatvena stauti kirn anyad vicäryate / siddhah sannyäsah / athävidheyatvena stutäv asya prayojanam 18 kartavyam 19 / yad dhi kartavyatayä nestam 20 tad apurusabuddhipürvakah^1) svatantrah purusanihsreyasärtham pravartamäna 21 ämnäyah kirn iti prarocayet / tasmäd etäm api kalpanäW 2 ) krtvä krsam evaitat / athavobhayathä vikalpa ity asyäyam anyo 'rthah /
1 K., P., A. and D.: tena 2 A. enam 3 A. bhüvim Dkha. omits bhütim. 4 A. omits iti. 5 K., P. and D.: evamvidhäm hi stutim A. evamvidhä srutim 6 A. phalärthini 7 A. omits hi. 8 K., P., and D.: bahubalärthinäm Dkha. bahuphalärthinäm 9 A. omits stuvann ... prarocanärtho 'rthaväda. 10 A. bhavadbhir eva n A. yadi vä 12 13 A. vaidekadesasyeti 14 A. sarnmärgäd 15 D. °vikalpe anistaprasangah 16 A. vidhayatvena 17 A. omits tävad. 18 A. stutävasyaprayojanam 19 21

5

10

15

20

A. tenerhy(l)

Dkha. ubhayävikalpe 'nistaprasatigah

A. vartavyam D. nistham, s.m. nestam A. pravartamänaSya

*D. ksipratam artha, s.m. ksiprataräcaturety arthah D. reads ksepistha before ksipra0. (^(apurusabuddhipürvakah) anenävipralambhatvam äha / / (K.lla, not found in D.) (2)(kalpanäm) arthavädakalpanäm / / (K.lla i.n., D.40-1)

40

YUKTIDIPIKA

5

10

15

20

ihayam amnayo 1 bhutarthena^ 1 ) va sannyasam prarocayed abhutarthena va / kirn cätah / tad 2 yadi tävad bhütärthena prarocayati tathä saty 3 amrtatvapräpakasya sannyäsasyäparigrahe visayarägäd anyo hetur vaktavyah / athäbhütärthena 4 puruso nihsreyasäd dhiyate 5 / kasmät / na hy et ad yuktam yad asreyasi märge pramänabhüta ämnäyo mätrmodakanyäyena 6 hitärthinah präninah pratärayet 7 / tasmäd ayuktam etat / kirn cänyat / anekäntät / na cäyam ekänto yad vihitam eva kartavyam / tathä ca säbaräh pathanti "grämagamanam bhavatah sobhanam ity aträntarena vidhim stutir eva devadattam grämagamanäya prarocayati" iti / kirn cänyat / äsankäprasangät / yadi khalv api kimcit satyam kimcid anrtam 8 brüyäd vedas tathä sati pauruseyaväkyavad vedaväkyesv apy äsankä prasajyeta 9 / tathä ca sati yad uktam 10 "<mä täri(?)> u srutau bhaktih sahasaiva mahätmanäm" iti tad vyähatam iti / kirn cänyat / <avaisadya>prasangät 12 / yadi khalv api kimcit satyam kimcid anrtam brüyäd vedas tathä sati <avaisadya>prasarigo13 'nistam caitat / kirn ca vidhyanumänam 1 4 vä <t>adekadesabhütatvät 15 / athavä vidhyekadeso16 'rthaväda ity atisrstam^2^17 bhavatä / tatra sannyäse 18 'rthavädam upalabhya vidhir apy astity anumätavyam / anupalambhäd 1 9 adosa^3^ iti cet / syäc caivam yady^4^ asau vidhir upalabhyate / tasmäd anupalambhäd ayam dosän nivartisyata 20 iti / etac c ä n u p a p a n n a m / kasmät / anekabhe1 A. ämnäye 2 A. kirn cätad 3 A. bhütärthe yathä saty 4 K., P. and D.: abhütärthena 5 A. purusanihsreyasärtho hiyate 6 A. modakanyäyena P. mätrmodakanyäyane 7 A. pratorayet 8 Dkha. püritam 9 A. prasajyate 10 K., P. and D. omit <mä täri> .... vedas tathä sati 11 A. mä tari 12

(40.12-15).

A. atha vaisasaprasangät K. ardhavarnsaprasangah P. ava..prasangah A. avaisasyaprasange D. prasarigah, s.m. ardhavamsaprasangah 14 A. buddhyanumänam 15 K., P. and D.: tad evam ekadesabhütatvät A. dadekadesa0 16 A. vidhyaikadesau 17 A. abhisrsta 18 K., P. and D.: nyäse 19 A. upälambhäd 20 A. nivartata (^(bhutarthena) bhutam ksamadav rte 'tita iti kosah // (K.lla, D.40-2) (cf.Amarakosa.3.3.78) (2) (atisrstam) sämänyenoktam ity arthah // (K.llb i.n., D.41-1) (3) (anupalambhäd adosa) anupalambhäd adosa iti / asyärtho nivartisyata ity etatparyantam// (K.llb, D.41-2) (4) (yady) jy^di vidhih syäd upalabhyeta / / (K.llb, D.41-3)

^ _

PRATHAMAM AHNIKAM SK2b

41

datvät^V upalambhau 1 yatnah kriyatäm (cf.MBhäsya.I.9.19ff.) / anekabhedo hi prativedam ämnäyah / tatra yad uktam(38.8f.) vidhisadbhävät kriyäprädhänyam^2^ ity etad apy ayuktam / itikartavyatänupadesät 2 sannyäsänupapattir iti cet / athäpi syät / yadi sannyäsam apy ämnäyo vidheyarn manyeta 3 tena yathä gärhasthyasyetikartavyatäm bhäryodvahanädikäm mantravad(3) upadisati tathä sannyasam apy upadiset / na tüpadistavän / tasrriän nästi sannyäsa iti / etad apy ayuktam / kasrnät / abhävät 4 / itikartavyatänäm hi sarväsäm abhävah sannyäsah / tatra kirn sästram upadeksyati 5 / yävati khalv 6 itikartavyatä sannyäsängam täm upadisati 7 / katham / evam hy äha— tapahsraddhe ye hy upavasanty aranye säntä vidvärpso bhaiksacaryäm 8 carantah / süryadvärena te <virajäh>9 prayänti yaträmrtah sa puruso <hy> avyayätmä 10 / / (Mund.U. 1.2.11) tatra tapahsraddhe ye hy upavasantlty anena sraddhayopetam 1 x yamaniyamalaksanam 12 dharmam äha / aranya iti grhebhyo vinissrtim / säntä itindriyänäm antahkaranasya ca visayäbhiläsäd vinivartanam / vidvämsa iti pürvaräträpararäträdisu kälesv anirvinnasya 13 yogino jnänäbhyäsam / bhaiksacaryäm 14 caranta iti sarlrasthitinimittamparimitam 15 abhyavahäraniyogam 16 /
A A. upalabdho 2 A. ity etän upadesät 3 K., P. and D.: manyate 4 A. abhävatah 5 D. upadiksyati 6 A. ca khalv 7 A. and Dkha.: upadisati sästram 8 A. bhiksäcaryarn 9 K. rajasah A. virajah P. aranah D. 'rajasah, s.m. virajasah 10 A. vyayä 11 K., P. and D. read atropetam instead of anena sraddhayopetam. 12 A. yamaniyamaväcakam laksanam 13 P. kälesu nirvinnasya A. kälasv evisanagasya 14 A. bhiksäcaryäm 15 A. and Dkha. omit parimitam. 16

5

10

15

A. adhyähäraniyogam

^'(anekabhedatvät) anekabheda iti / "navadhatharvano1 <v>edah2 sahasravartma samaveda ekasatam adhvaryusäkhäs3 caturvisamtidhä b<ä>hvrcyam4" iti hi srüyate (cf.MBhäsya. I.9.21ff.)//(K.llb, D.41-4) 1 D. navadhätharvo, s.m. navadhatharvano2 K. and D.: bhedah 3 D. adhvaryasäkhä 4 K. and D.: bahvrcyam W(kriyäprädhänyam) karmana eva prädhänyam / na tu <sannyäsa>sya* / / (K.llb, D.41-5) *K. and D.: sämänyasya *• '(mantravad) mantravad iti / mantrayuktam krtveti kriyävisesanam, samantrakam upadisati / / (K.llb, D.41-6)

42

YUKTIDIPIKA

5

10

15

uttarardhena ca 1 phalam acaste / tannibandhanas^ 1 ) ca vistarah sannyasetikartavyatäyäm 2 manvädibhir abhihitah / srutinirvacanäs^ 2 ) 3 ca smrtayo bhavatäm pramänam iti paksah / tatra yad uktam (41.-3) itikartavyatänupadesän nästi sannyäsa ity etad 4 ayuktam / evam ca na nityäni 5 karmäni / yat tv anenaitad uktam (30.1) änusraviko hetur <ai>käntika6 iti satyam etat / avasyam hi karmanah phalam abhyupagantavyam / itarathä hi tannimittasya samsärasyäbhäväd anist aprasangah / tasmäd anistam 7 evaitad äcäryasya / äha: katham etad anumatavyam^3) iti / ucyate: ksayagrahanasämarthyät / yadi pürvasütroktam^ 4 ) ihänuvartäte ksayagrahanam anarthakam syät( 5 )/ kasmät / atyantäbhävaparyäyo hi ksaya iti krtvä / evam siddho 8 'visuddhiyogah / äha: ksayayoga idänim katham 9 anumätavya iti / ucyate: ksayayogo 'ngaparimänät 10 / ksayayogah punar asya 11 hetor 12 angaparimänäd 13 veditavyah / yäni hi yajer angäni pasupurodäsädini 14 täni parimitäni / parimitänäm 15 sädhanänäm tantvädinäm parimitam käryam
1 A. pha ca 2 A. omits sannyäsetikartavyatä ... itikartavyatänupadesän nästi. 3 K., A. and D.: srutinirvacanäc 4 A. ed 5 A. evam anityäni Dkha. evam cänityäni (this is also possibly the original 6 K., P., D. and A.: anaikäntika Dkha. ekäntika 7 A. ist am 8 A. siddhau 9 A. katham idänim 10 A. angaparinämät 11 A. asye 12 K., P. and D.: hetoh punar 13 A. angam parimänäd 14 A. pasupurodasaprabhrtini 15

reading).

A. and Dkha.: parimitänäm hi

(^(tannibandhanas) abhihitasrutimulah / / (K.12a i.n., D.42-1) (2) (srutinirvacanas) srutyartham nirbhajya vistarena vacanam yäbhis täh pramänam / / (K.12a, D.42-2) (3^ (katham etad anumätavyam) tasmäd anistam evaitad* äcäryasyaikäntikatvam** abhlstam iti katham jnäyata ity arthah // (K.12a, D.42-3) *D. etad **D. °känvikatvam (4) (yadi pürvasütroktam) yadi ca pürvoktahetum apy äcärya icchet ksayagrahanam na kuryäd <arthä>bhäväd* ity atidesenaiva gatärthatväd iti bhävah / / (K.12a, D.42-4) *K. and D.: antäbhäväd (5) (ksayagrahanam anarthakam syät) änusravikasyätraikäntikatvam eväbhlstam na tv anaikäntikatvam / yady atra tad abhlstam syät tarhi pürvoktasütrasyätyantäbhävasyänuvartanena ksayärthopalambhät ksayagrahanam anarthakam syät / / (K.12a, D.42-5)

PRATHAMAM AHNIKAM SK2b

43

patädi drstam / parimitam 1 ksayadharmi drstam 2 / tadvad^1) eva3 <etad> / kim cänyat / s a m s ä r o p a l a m b h ä t / drsyate cäyam vägbuddhisvabhävähäravihärabhedabhinna<h> karma<vipäka>vaicitryanimittah4 samsärah / yadi punah säksätkrtam karmäksayaphalam syät sa^2)5 punarävrttyabhävät präninäm nopalabhyeta 6 / sabdasämarthyän nityatvam iti cet / syäd etat / "sabdapramänakä vayam / yac chabda äha tad asmäkam pramänam" (cf.MBhäsya.I.ll.lff., 1.366.12ff.) / sa cäsya hetor amrtatvam äha "tarati^3) mrtyum tarati päpmänam"(cf.Mund.U.3.2.9) ityädi / tasmäd anicchatäpy etad avasyam abhyupagantavyam / anabhyupagame 7 vä pratijnähänir vedah pramänam iti / e t a c 8 ca naivam / kasmät / sabdänt arena 9 virodhät / anityatvam asya hetoh sabdo 'numanyate / tasyaivam sati virodhah präpnoti / katham / evam hy äha "atha ye ime gräme istäpürte^ 4 ) 10 dattam ity upäsate 11 te dhümam abhisambhavanti / dhümo bhütväbhram bhavati / megho bhütvä pravarsati / ta iha vrihiyavä osadhivanaspatayas tilamäsä 12 iti jäyante / <ato>13 vai yo(5^ <hy>
1 A. and Dkha.: parimitam ca 2 A. stam 3 A. evam 4 All the Mss read °vihärabhedabhinnakarmavihäravaicitryanimittah. 5 A. omits $a, 6 A. °yate 7 A. abhyupagame 8 A. tac (this is also possibly the original reading). 9 Dkha. sabdäntare 10 D. istäpürtt 11

5

10

After upäsate K., P. and D. insert Chänd.U.5.10.5, which reads as follows: athaitam evädhvänam punar nivartante yathetam (D. yathä itam) äkäsam äkäsäd väyum. 12 A. tilamäsä 13 All the Mss read tato.

(^(tadvad) ghatavat / / (K.12b, D.43-1) (2)(sa) samsärah / / (K.12b i.n., not found in D.) (3) (tarati) mrtyutaranäd aksayatvam uktam // (K.12b, D.43-2) ^4) (istapürte) istam antarvedyäm yajfie dattam / pürtam anyatra / tayor dvandve cchändaso dirghah / 1tena ye yajnäyajfiayor dattam / dattam ity upäsate te tatra 2phaläbhisandhänabhävanäm kurvanti, sarlränte dahyamänä dhümam abhyetya kramena meghavrstisasyaretahSarlraparivartanakramena samsäraprabandham anubhavanti / atra5 cävivaksitaväcyatayä punah punah samsärävartane4 malinarüpäsuddhamärgävagähitvam laksyate / anye tu yathästhitam etad väcyam vivaksitam6 ity ähuh / / (K.12b, D.43-3) D. °bhävanänäm1 s.m. °bhävananäm 2D. dahyamänadhümaprabhrtikramena, s.m. dahyamänadhümam abhyetya kramena 3 D. cäviviksitä0 4D. °äravartane 5 K. °märgävigähitvam D. malinarüpä Suddhamärgävigähitvam, s.m. malinarüpä suddhamärgävagähitvam 6 D. viviksitam (y°) y° 'sau tasyausadhyäder annasya bhoktä suklasya sektä ca tadbhävena taddhätvätmakatayäste / tato bhüyo retodvärena bhavati / bhüyo 'pi caivam evestäpürtaphaläbhisambandhäd dhümädikramena bhavatlti samsärasya paunahpunyena prabandha ukto yo 'säv ev<ä>javanjavlbhäva* iti vaksyate / / (K.12b, D.43-6) *K. eva javanjavtbhäva D. eva äjavanjwabhäva

44

YUKTIDIPIKA

5

10

15

annam' 1 ) atti 1 yo retah siiicati tad 2 bhuya eva3 bhavati"(cf.Chand.U.5.10.3,5,6) iti / tatra yad uktam(43.5) sabdasämarthyän nityatvam ity et ad ayuktam / ubhayäbhidhänäc 4 chästravirodhaprasariga iti c e t 5 / syän matam / tad eva sastram nityatvam äha tad evänityatvam / evam sati parasparavirodhinor arthayos coditatväd ubhayänugrahäsambhave sati sästravirodhaprasahga iti / tac ca naivam / kasmät / asambhave saty arthäntaraklpteh / yadi 6 hi pramänabhütä srutir asambhavinam artham codayati taträrthäntaram kalpayati / tadyathä "sa ätmano vapäm^2) udakhidat 7 "(Tai.S.2.1.1.4) / "stenam mano 8 'nrtavädini väk(3)"(cf.!§Bh.l.2.2) ity evamädisu / evam ihäpi nästi sambhavo yad eko 'rtho nityas ca syäd anityas ceti / tasmän nityatvaväcakasya sästräntarasya^ 4 ) 9 bhaktyärthäntaram^ 5 ) parikalpayisyämah / tadvad itaraträplti cet / syän matam / yathaiva bhavatä nityänityayor ekaträsambhavän 10 nityatvasya 11 bhaktyä kalpanä krtä tathaivänityatvasyäpi karisyata iti / etac cäyuktam / kasmät / sarvapramanavirodhaprasangät / vinäse^6) hi 12 bhaktyä kalpyamäne sarvapramänavirodhah 13 prasajyeta / katham / pratyaksa1 A. yannim itta(?) instead of yo <hy> annam atti 2 K., P. and D.: sa 3 A. bhüya eva bhüya eva bhüyariva instead of bhüya 4 A. ubhayathäbhidhänäc 5 A. omits cet / syän ... sästravirodhaprasanga iti. 6 A. and Dkha.: yatra 7 A. udakhindat 8 A. manuh 9 A. sästrasya 10 A. °sambhävän X1 A. nityatvam asya 12 P. vinäso 13

eva

A. sarvapra

(x) (annam) osadhibhäväntaram // (K.12b, D.43-5) (2)(vapäm) "präjäpatyam <tü>param1 ajam älabheta" (cf.Tai.S.2.1.1.5) ity asya vidheh sesah / prajäpatir2 ätmano vapäm udakhidad iti vapähomamähätmyapradarsanärtham ucyate / agnau3 pragrhTtamäträyäm vapäyäm ajas tüpara udagäd(cf.Tai.S.2.1.1.4) iti pasuyoge vapähomaprasamsäyäm4 vrttänta esah / / (K.12b, D.44-1) *K. and D.: tv aparam 2D. prajäpatir 3D. agno 4K. °prasamsäya (3) (stenam mano 'nrtavädinl väg) stenam mano 'nrtavädinl väg iti gauna esa vädah pracchannatayä stenam prajäpatir mana ucyate bähulyäbhipräyena cänrtavädinl väg iti // (K.12b, D.44-2) (4) (sästräntarasya) prajäpatir ätmano vapäm uccikheda / tasmäd anyo 'py utkhided ätmano vapäm iti duradhisthäno 'yam art hah / ko hi nämätmano vapäm utkhidet kasya vä / vapähome sati samanantaram eva hutabhujah pasus tüpara udgacched ity arthäntarakalpanä // (K.13a, D.44-4) (5) (bhaktyä) laksanayä // (K.13a, D.44-3) (6)(vinäse) anityatve // (K.13a, D.44-5)

PRATHAMAM AHNIKAM

S

K

2

b

4

5

tävat samsäropalambhät / anumänavirodW 2 ) 'ngaparimäne 1 saty angino nityatvänupapatteh / sabdavirodhah "te dhümam 2 abhisambhavanti" (cf.Chänd.U.5.10.3) iti 3 vacanät / na tu nityatve bhaktyä kalpyamäne doso 'ya.m upapadyate 4 / tasmäd visamam 5 et at / äha 6 : katham idänim bhaktyä kalpayitavyam sästram iti / ucyate: prakrstärthatayä / yathä khalv api "amrtam vä mrtam 7 atijlvo 8 rhä te 9 häsisur asavah sariram(3)"(AV(S).8.2.26) ity abhidhiyate / na ca präninäm atyantäyäsavo na 10 jahati / kirn tarhi / prakrstam kälam / evam ihäpy ucyate 11 "tarati mrtyum" (cf.Mund.U.3.2.9) iti / nätyantäya mrtyum tarati / kirn tarhi / prakrstam kälam / upacaryate hi 12 lok<e> 'pi 13 prakrste 14 nityasabdah^ 4 )/ tadyathä "nityaprahasito nityaprajalpitah 15 "(cf.MBhäsya.I.7.4) iti / evam siddhah ksayayogah / äha: atisayayoga idänim asya hetoh katham 16 anumätavya iti / ucyate: atisayayogah kriyäbhyäsät / yatra hi kriyä sakrt 17 pravartate yatra cäsakrd ävartate taträtisayo drstah / tadyathä krsyädisu / yajfie ca dravyopädänasaktyapeksä kvacit sakrd eva pravrttih kvacit punah punar ango 'ngaparimäne K. and D.: sabdavirodhate dhümam A. sabdavirodha istäpürtasya dhümam virodhas te dhümam (above this D. reads ga pustake 'pi.) 3 A. abhisambhabhavatiti 4 D. upapadyate iti 5 A. visayam 6 A. omits äha. 7 A. vämrto 8 A. hi jive 9 A. to 10 K., P. and D. omit na. 11 A. omits ucyate. 12 A. omits hi. 13 K., P. and D. omit 'pi. A. loko 'pi 14 A. prakampe Dkha. prakrto 15 A. nityajalpita 16 A. katham asya hetor 17 K. andD.: 'sakrt
l A. 2

5

10

15

Dkha. sabda

(*)(pratyaksavirodhas) pratyaksapramanavirodhah / pratyaksasabdena taddrstah samsaro 'bhidhlyate, tena samsäradarsane tad virudhyate nityatvam karmaphalasyeti yävat / / (K.13a, D.44-6) ^2^ (anumänavirodhah) angäni pasupurodäsädlni / uktam yad anumänam kramikavinasyatphalayogyatayä* karmana uktatväd** iti bhävah // (K.13a, D.44-7) *K. °yogitayd **K. uktatvam ^3^(mä te häsisur asavah sarlram) tava pränäh sariram mä häsisur mä tyäksur amrtam* ca mä tyäksuh / cärthe väsabdah / nanu kirn tad amrtam / tadäha—atisayena jlvanam atijlva evämrtam / evam tava pränä atijlvanaviyuktä etaccharlraviyuktäs ca mä bhüvann ity arthah / / (K.13a, D.45-1) *D. omits amrtam ca mä tyäksuh. '4> (nityasabdah) nityasabda iti / nityavisaye yah prayoktavyah sabdo mrtyum taratltyädih sa ity arthah / / (K.13a, D.45-2)

46

YUKTIDIPIKA

5

10

15

avrttih 1 / tasmad atisayena bhavitavyam / kim canyat / a n g a t i s a y a t ^ 2 / ihängänäm atisayäd angino 'pi ghatäder atisayo drstah / asti cäyam pratiyajnam angänäm daksinädmäm atisayah / tasmäd aträpy atisayena 3 bhavitavyam 4 / devatängabhävagamanät ksayätisayänupapattir iti cet / athäpi 5 syät / yo hi yajfie dravyamätrasya sädhanabhävam anumanyate 6 tarn prati kayätisayayogäv 7 aparihäryau syätäm / vayam tu dravyasamaväyinim devatäm kratäv^2) ahgabhävam upagacchantim vidmah / tasmäd adoso 'yam iti 8 / tac cänupapannam / kasmät / sädhyatvät / devatänäm aparimitatvam sädhyam tadangabhävagamanäc ca <dosäbhävo 'pi sädhyah> 9 / na cätmä kriyängam 10 udäslnatväd iti nah^3) siddhäntah / tasmäd ayuktam etat / upetya vä kratusamanusthänänarthakyaprasangät / yadi dravyasamaväyinim devatäm upalabhya^4) tadangabhävagamanäd 11 aksayo 12 niratisayas ca hetur avagamyata 13 itistam vah 1 4 / tena tarhi yad vä tad vä vedoktakarma 15 krtvä sakyo Väptum arthah / kim pränivinäsahetubhih 16 / katham / na hi kimcit karma vidyate yatra sarirasyängabhävo na syät^ 5 )/ sarvadevatämayam sariram 1 7 yasmäd äha— tasmäd vai vidvän^6) purusam idam brahmeti manyate /
X A. pravrttih 2 Dkha. kim cärigätisayät 3 A. atirekena 4 A. repeats kim cänyat / angätisayät 5 A. atha vä 6 A. upamanyate 7 A. ksayätisaydosäv 8 A. omits iti. 9 All the Mss read dosäbhävah. 10 A. cätmakriyängam n K., P. and D.: tadängabhäva0 12 A. ayaksayo 13 A. and Dkha.: aväpyate (this is also 14 A. ity estavyah 15 A. vedoktam karma 16 K., P. and D.: °hetubhih kratubhih 17

/ ... bhavitavyam.

possibly the original reading).

A. ca sanram

(^(angätigayät) angabhävo hi samhatyakärita / / (K.13b, D.45-3) (2) (kratäv) kratau na vrlhädy arigam kim tu tadadhisthätrl käcid devatä sä ca sarvatra tulyä / / (K.13b, D.46-1) (3)(nah) yadi tävac charlrarüpä devatä tat taträpy atisayena bhävyam / ätmarüpeti cet tasyängabhävänupapattih / angabhävo hi samhatyakäritäsanghätarüpas cätmeti vaksyämah (168.12) / / (K.13b, D.46-*2) (4) (upalabhya) abhyupagamya / / (K.13b, D.46-3) (5) (syät) japamätram api hi kurvato 'vasyam sarlram ahgabhävam eti //(K.13b, D.46-4) (6)(vidvän) vidvän jnäni purusam sartram evedam brahma vetti // (K.13b, D.47-1)

PRATHAMAM AHNIKAM SK2c sarvä hy asmin devatäh sarire 1 'dhisamähitäh^1) / / (cf.Prä.U.3)

47

tatra yad uktam (46.4) devatähgabhävagamanät ksayätisayänupapattir ity etad ayuktam / evam ayam hetus tridosah / tena yah 2 phalaviseso 'bhinirvartyate so 'pi tathäjätlya 3 iti sakyam anumätum / tasmän näsya 4 jijfiäsor atra samädhih( 2 ) 5 / aha: yadi nayam sreyan iti krtvasya jijfiäsor natra samadhis 6 tena tarhi yah sreyän phalavisesah sa upadestavya iti / ucyate: TADVIPARITAH SREYÄN / (SK2c) tad ity anena karmavidhinispäditasya svargapräptilaksanasya phalasyäbhisambandhah / tasmäd vipantah7 suddho 'ksayo niratisaya ity arthah / ko 'säv ity ucyate moksah sreyän^ / etad uktam bhavati / ubhäv apy etau prasasyau svargäpavargäv ämnäyavihitatvät / moksas tu prasasyatarah / kasmät / yathoktadosänupapatteh / sa hy avasyambhävitväd aikäntikah / atlndriyatväd asamvedyah^4)/ svätmany avasthitatväl laghuh 8 sarvatra sannihitas^5) ca / ämnäyastutatvät 9 prasastah / sadbhir äsevitatväd aninditah / ^a^ia^j^ajnavajr^gj^a^ visuddhah / adravyatväd^6) aksayo niratisayas ca /
1 D. sartre devatä instead of devatah sarire 2 A.yat 3 A. and Dkha.: tathäjätiyaka 4 D. nästi 5 D. atra samädhih, s.m. aträsamädhih 6 A. aträsamädhis (this is also possibly the original reading). 7 A. omits viparitah .... prasasyatarah / kasmät (47.11-13). 8 Dkha. avasthitatväc ca laghuh 9 D. and A.: ämnäyas tu tattvät P. ämnäyastutvät 10

5

10

15

A. yamaniyamajnänavairägyäbhyupäyasuddher

(^('dhisamähitäh) adhisthätrtayaikägrlbhütäh / / (K.13b i.n., D.47-2) ^2) (samädhih) asamädhir* anäsväsa ity arthah / / (K.13b, D.47-3) *D. 'samädhir W (äreyän) drstasya tu düräpästatväd atra gananaiva na yuktety äsayena kärikäkärah sreyän ity abhy<a>dhän* na tu sresthah / / (K.14a, D.47-4) *K. and D.: abhidhät (4' (asamvedyah) asamvedyety anena parasamvedyasya visayabhogasyäsvädane saty anyesäm ananugrahe nairghrnyam yad uktam tat parihrtam // (K.14a, D.48-2) ^5^ (sarvatra sannihitaS) sarvatra sannihita ity anenärjanaraksanaksayasahgabhütopaghätädidosäsankäm niräkaroti / / (K.14a, D.48-1) ^6^ (adravyatväd) dravyam dharmisvarüpam* avasthätr, taträvasyam avasthävasäpeksau** ksayätisayau stah / / (K.14a, D.48-2) *D. s.m. dharmisvarüpam **D. s.m. avasthävasäpeksau

48

YUKTIDIPIKA

5

aha: katham punar^1) ayam apavargah prapyata iti / ucyate: s a m y o g ä b h ä v ä t / duhkham ca 1 pradhänam 2 / tathä ca tanträntaresv apy uktam "duhkhahetuh käryakaranasaktih^ 2 ) 3 " iti / tena^3) yadä purusasya 4 samyogas tadävisuddhitvam 5 asya / svasaktivisesayogät^4) tesu tesu jätyantaraparivartesu( 5 ) dharmädinimittasämarthyäd äyäsam anubhavati / yadä tu pradhänasamyogo ]muvartate£ tadä nimittäbhäve naimittikasyäpy abhäva iti krtvä na 7 gunar^dvandväny anubhavati / äha: Jcinwthah^ punar ayam pradhänasya purusena saha samyogah / ucyate: naitad ihäbhidhäniyam / vaksyaty ayam uparistäd äcäryah— purusasya darsanärthah 9 kaivalyärthas tathä pradhänasya / pahgvandhavad ubhayor api samyogah /(SK21abcd > ) iti / äha: viyogas tarhi kasmän nimittäd bhavatiti / ucyate:

10

15 *A. omits ca.

VYAKTÄVYAKTAJNAVIJNÄNÄT / / (SK2d)
2 A. pradhäna 0 3 A. käryakärana 4 A. purusya 5 A. tadävisuddhatvam 6 A. nivartate 7 A. punah 8

Dkha. kimartham A. pradhänärthah

W (katham punar) nanu bhavatv evam tathapy upäyabhävad durlabhatvad asyasakyopadesatvam ity äsayenäha katham punar iti // (K.14a, D.48-3) (2) (käryakaranasaktih) käryasya bhütapancakatanmätrapaiicakätmanah karanasya ca buddhidharmäkhyadasakäntahkaranatrayasvarüpasya yä Saktih pradhänätmikä sä duhkhasya hetuh // (K.14a, D.48-4) (3)(tena) pradhänena / / (K.14a i.n., not found in D.) (4) (svasaktivisesayogät) nanu kah khalüdäslnasya pumso duhkhänubhava ity äha—svasaktivi<se>sayogäd* iti / svaäaktih pumso drgrüpatä svasya pradhänasya saktir drsyatä tayoh saktivisesayor yo yogo drastrdr^yabhävas** tatah / etad uktam bhavati: duhkhänurakte buddhisattve yad etat pumsah pratyayänupasyatvam yena suddham api samvidrüpam duhkhasamvid ity upacaryatesa eväsya duhkhänubhava iti yävat / / (K.14a, D.48-5) *K. svasaktivisayogäd D. s.m. svasaktiviseyogän(l) **D. drstrdrsyabhävah (5) (jätyantara-) kirn tasyävisuddhitvam ity äsarikyäha jätyantareti / brahmädisthävaräntesu * / / (K.14a,*D.48-6) *K. not clear D. indicates a lacuna after brahmädisthävaräntesu.

PRATHAMAM AHNIKAM SK2d

49

vyaktam cävyaktam ca jnas ca vyaktävyaktajfiäh / tesäm vijnänam vyaktävyaktajnavijnänam tasmät 1 / bahusv aniyamäd alpäco 'pi 2 na 3 pürvanipätah (cf.Pän.2.2.34) / athavä jnänasya sädhakatamam 4 vyaktam^1) tatpürvakatväd avyaktasamadhigamasyety 5 abhihitam / yadvä vyaktam cävyaktam ca te 6 vyaktävyakte te vijä,nä,titivyaktävyaktajnas tadvijnänät samyogo nivartate / vaksyati7 caitat— drstä mayety upeksata 8 eko drstäham ity uparamaty 9 anyä 1 0 / (SK66ab) iti / tatra rupapravrttiphalalaksanam^ 2 ) 11 vyaktam / rüpam punar mahän ahamkärah paiica tanmäträny ekädasendriyäni panca mahäbhütäni / sämänyatah pravrttir dvividhä hitakämaprayojanä^ 3 ) cähitapratisedhaprayojanä ca / visesatah paiica karmayonayc/ 4 ) 12 <dh>rtyädyäh 13 / pränädyäs ca panca väyavah 14 / phalam dvividham / drstam adrstam ca / tatra drstam siddhitustyasaktiviparyayalaksanam adrstam brahmädau stambaparyante samsäre sarirapratilambha 15 ity etad vyaktam / esäm 16 gunänäm sattvarajastamasäm arigähgibhävagamanäd visesagrhltih / yadä tv arigabhävam 17 agacchanto
l A. omits tasmät. 2 A. alpasyäpi jnasabdasya 3 A. ornits na. 4 A. jnäsädhakatamam 5 A. omits avyaktasamadhigamasyety ... yadvä vyaktam 6 A. ceti instead of ca te 7 A. iti vaksyati 8 A. upeksa 9 A. omits uparamaty anyä iti. 10 D. uparamaty any ah Dkha. uparataika 11 A. rüpavrttiphala0 12 A. panca yonayah 13 All the Mss read vrttyädyäh. 14 A. pancävayaväh 15 K, P. and D.: karmapratilambha 16 D. yesäm 17

5

10

15

ca (49.4-5).

A. agabhävam

"'(vyaktam) vyaktam hi sukhaduhkhamohanvitam sad avyaktasiddhim karoti tadayatta ca purusasiddhih / svahetusv äyattatäm vadati* // (K.14a, D.48-7) *D. omits svahetusv äyattatäm vadati. (2J(rüpapravrtti-) rüpyate vis"esyate* nirüpyate trayovimSatitattväni / pravrtti^abdena tu rüpänäm eva yo vyäpärah sa ucyate / / (K.14b, D.49-1) *D. visesato W (hitakämaprayojanä) hitasya kämo 'bhiläsa upädänam tat prayojanam yasyäh / / (K.14b, D.49-2) W(panca karmayonayo) panca karmayonaya iti / <dh>rtih* sraddhä sukhä vividisävividisety eva pancadhä karmayonih / samastakaranänäm sämänyarüpä pravrttir äntarlyavätaprerito** väyuh / / (K.14b, D.49-3) *K. and D.: vrttih **D. äntariyayä ta ... prerito

50

YUKTIDIPIKA

5

nirlikhitavisesa^1)1 vyavatisthante tadavyaktam ity ucyante / cetanasaktirupatväc 2 citram gunavrttam jänätiti jiiah / esäm 3 trayänäm bhedam^2) abhedam ca 4 vijnäya samyoganivrttim labhate / kasmät / samyoganivrttipratidvandvibhütatväd 5 viyoganimittasya / iha ya<to> darsananimittah 6 pradhänapurusayoh samyogas tasmäd asya pratidvandvibhütena jnänena viyogahetunä bhavitavyam / ko drstäntah / tamahprakäsavat / yathä tamasä tirohitäni dravyäni ghatädini nopalabhyante tatpratidvandvibhütena tu pradipena 7 prakäsitänäm 8 bhavati tadvad ihäpi drastavyam iti siddham jnänän moksah / uktam ca— vrksägräc^3) cyutapädo yadvad anicchan^4) narah 9 pataty eva / tadvad gunapurusajno 'nicchann api kevali bhavati / / (Paramärthasära [verse] 83) kirn cänyat / ämnäyäbhihitatvät / ämnäyanibandhano hy ayam 10 art ho jnänän moksa iti na yädrcchikah / katham / evam hy äha—

10

15

satyam jiiänam anantam brahma / yo veda nihitam guhäyäm parame vyoman^5)11 / so 'snute sarvän kämän / saha brahmanä vipascitä 12 / / (Tai.U.2.1) yato väco nivartante 'präpya manasä 13 saha / änandam brahmano vidvän 14 na bibheti kutascana / / (Tai.U.2.9)
X K., P. and D.: 'nirlikhitavisesä 2 A. cetanärüpasaktitväc 3 A. etesäm 4 A. omits ca. 5 A. samyoganimittapratidvandvi0 6 K. and D.: yadä 'darsana0 P. yadädarsana0 7 K., P. and D omit pradipena. 8 A. inserts esäm after prakäsitänäm. 9 A. anicchannan narah 10 A. and Dkha.: ämnäyanibandhanas cäyam 11 A. vyomni 12 A. vipascitah 13 A. manaso 14

A. yadadarsananimittakah

A. matvä

t1) (nirlikhitavisesä) lekho likhitam tasman niskranta nirlikhita iti yavat / nirlikhita visesa yesu gunesu te tathoktäh prasäntavisesä iti yävat / / (K.14b, D.49-4) (2) (bhedam) sädharmyavaidharmye ity arthah / / (K.14b, D.49-5) (3) (vrksägräd) härltakärikäm pathati yrksägräd iti / / (K.14b, D.50-1) (4) (anicchan) anicchann ity anenävasyambhävam upodbalayati* / / (K.14b, D.50-1) *D. upodbalati (5) (parame vyoman) parame vyomnlty arthah / / (K.15a, D.50-2)

PRATHAMAM AHNIKAM SK2d tarn 1 eva viditvämrtatvam eti nänyah panthäyanäya vidyate /

51

(cf.Svet.U.3.8, 6.15) tathä brähmane 'py uktam "tarati sokam ätmavit"(Chänd.U.7.1.3) "brahmavid 3 brahmaiva bhavati" iti / tasmäd ämnäyaprämänyäd api manyämahe jiiänän moksa iti / äha: jnänaväcino^ 1 ^ 4 'mrtatvanimittäbhyupagamän mahata ä m näyäntarasyänarthakyam / yadi 5 jnänaväcina ämnäyakhandakäd amrtatvam aväpyata ity etad abhyupagamyate tena kriyäväcino mahata ämnäyäntarasyänarthakyam präptam / kirn käranam / na hy anäyäsenestäväptau 6 satyäm äyäsabhüyisthe karmani pravartamänah krti bhavatiti / äha ca— arke^2)7 cen madhu vindeta kimartham parvatam vrajet 8 / istasyärthasya sampräptau ko vidvän yatnam äcaret / / (cf.e.g.SBh.1.2.4, NVTT. on-NS.1.2.1) ucyate 9 : yadi punah karmäny atyantakartavyatayesyante 10 jnänaväcina ämnäyasya katham 11 arthavattä siddhä bhavati / äha: samuccaye tübhayärthavattvam / jiiänakarmanos tu samuccaye 'bhyupagamyamäne dvayor apy ämnäyärthavattä siddhä bhavati / "vidvän yajeta vidvän yäjayet" iti vacanät / tathä sarvapurusänäm kratäv adhikäro 12 'srotriyasandhasüdravarjam 13 iti nyäyät / tasmäj jnänakarmanoh samuccayäd istaprasiddhih / ucyate: na pürvadosaparihärät / yadi niyamato vidusaiva karmäni kartavyänity abhyupagamyate 14 tena yah pürvokto(30.10) dosah samsäräbhävaprasangastasyäparihärah / omits tarn eva ... ayanäya vidyate. brähmana omits brahmavid brahmaiva bhavati. and D.: jnänavädino K., P. and D. omit yadi ... ämnäyäntarasyänarthakyam. A. yadi jnänaväcino mahata ämnäyäntarasyänarthakyam yadi 6 A. äyäsenestävyäptau 7 K., P. and I).: akke 8 A. caret 9 K., P. and D. omit ucyate. 10 A. antyantakartavya0 11 A. katham ämnäyasya 12 A. anadhikäro 13 A. omits südra. (this is also possibly the original reading). 14 A. omits abhy.
l A. 2 A. 3 A. 4 A. 5 2

5

10

15

20

(^(jnänaväcino) ämnäyasya// (K.15a, D.51-1) <2)(arke; K. akke) grhakone / / (K. i.n., not found in D.) (arke; K. and D.: akke) akkasabdah kakäradvayasamyukto grhakonaväcakah / na tu rephakakärayuktah / tasya hi süryasphatikaväcakatväd iti / yad uktam arkah sphatikasüryayor iti* / / (K.15a, D.51-2) (cf.Amarako^a 3.3.4) (cf.p.51,fn.7) *D. omits iti.

52

YUKTIDIPIKA

5

10

15

20

kim ca sastrahanes ca / yac 1 ca2 sastram "istapurte 3 samupasya te 4 dhumam abhisambhavanti 5 "(cf.Chänd.U.5.10.3) iti tad etasyäm kalpanäyäm hiyate / kim cänyat / bhinnaphalatvät / ihäbhinnaphaläni dravyäni samucciyante tadyathä bhujyahgäni süpädmi / abhinnam tesäm trptilaksanam phalam iti / na 6 caitaj jnänakarmanor abhinnam phalam svargäpavargahetutvät / jiiänasämarthyät kaivalyam abhinnam phalam iti cet pürvenävisesah 7 / yad uktam (30.10) samsäräbhävaprasanga 8 iti tad anapahrtam 9 eva10 bhavati / kim cänyat / srüyamänaphalavirodhas ca / yac ca kriyäyäh phalam 11 srüyate "agnihotram juhuyät svargakämo 12 rästram agnistomena jayati 13 " iti tad virudhyate / <kim cänyat /> karmanas ca sesabhävah svärthopasarjanatve 1 4 saty arthäntaranispädakatvät 1 5 / yathävahanti (cf.Tai.Br.3.2.5.6) ity evamädyäh kriyäh svam phalam upasarjanikrtya taddvärena yajer upakurvantyas tacchesabhütä 16 bhavanty evam kriyäpi jfiänaphalabhütatvät tacchesabhütä syät / vidhisadbhävät kriyäprädhänyam iti cen na uktatvät / katham etat / nästi vidhikrto 17 visesah / upetya vä taträpi^1) tadutpatteh / asti hi jnänasyäpi vidhäyakam sästram / katham / evam hy äha "y a ätmäpahatapäpmä 1 8 vijighatso vipipäso 19 vijaro vimrtyur visokah <satya>samkalpah20 so 'nvestavyah sa jijfiäsitavyah / sa 21 sarväms ca kämän aväpnoti sarväms ca lokän 22 yas tarn 23 ätmänam anuvidya 24 vijänätlti prajäpater vacanam srüyate" (cf.Chänd.U.8.7.1) <iti> / punar apy äha "dve vidye veditavye 25 parä caiväparä ca yä"(cf.Mund. U.l.1.4) <iti> / tasmäd vidhisadbhävät kriyäprädhänyam iti svapaksänürägamätram etat /
X A. yah P. yas 2 A. omits ca. 3 D. istapürtT 4 A. omits te. 5 A. abhisambhavati 6 A. omits na ... abhinnam phalam iti. 7 A. pürvena visesah 8 D. reads in the right margin samsärabhäveti päthah. 9 A. anapakrtam Dkha. apanitam 10 Dkha. omits eva. 11 A. phalam kriyäyäh 12 A. surga* 13 A. yajati 14 A. svargäpasarjanatve 15 A. arthäntaraphalanispädakatvät 16 A. tacchesabhütä 17 A. virodhakrto 18 A. ätmähatapäpmä 19 A. vijighatso pipäsäm 20 K., P. and D.: sannyastasamkalpah A. satyasthasamkalpas 21 K., P. and D. omit sa. 22 K., P. and D. omit sarvämS ca lokän. 23 K., P. and D. omit tarn. 24 A. anuviddhi 25

A. veditavye te

(^(taträpi) jfiäne 'pi / / (K.15b, D.52-1)

PRATHAMAM AHNIKAM SK2d

53

drstärthatväd ity e k e 1 / eke punar äcäryä manyante drstam eva jiiänasyäjnänanivrttilaksanam 2 phalam, tasmän na sästrena 3 vidhiyate / kirn käranam / drstärthasya hi karmano na sästram prayojakam4 svayam evärthitatvät 5 tatra pravrtter bhujyädivat / tesäm jiiänavidhäyakäni väkyäni / täny upäyagunavidhänärtham 6 anuvädabhütäny 7 äsriyante / tadyathä "dadhnä juhoti payasä juhoti" iti / yat tu 8 khalv idam ucyate (51.17) "vidvän yajeta vidvän yäjayet srotriyasya ca karmany adhikärah" iti tasyäyam arthah / adhitya vedam kriyänupürvim ca jnätvä karmani < pravartitavyam pravartayitavyam ca> 9 / evam ca sati na kascid dosah / yadi punar niyamata evätmavidäm karmany adhikäras tena samsäräbhävaprasangah 10 sväbhävikatväd vijnänasya sästrasya sarvädhikäravirodhas <ca(?)> tasmän nästi samuccayo jnänakarmanoh / apara äha: satyam nästy anayoh samuccayah / kirn tarhi / sarvärthä kriyä jnänam pratisiddhärtham / ye hi 11 pandändhabadhirädayah 12 karmano 'tyantam niräkrtäs tesäm jfiänäd äsramäntare^1) 'mrtatväväptih / itaresäm tu müläsrame^2) karmana eveti tasya näyam 13 vädinah parihära iti / ucyate: na svasamayavirodhät / evam bruvänasyäsya vädinah svasamaya eva virudhyate yad uktam "vidvämsah prajäm na kämayante 14 kirn prajayä karisyämah"(Brh.U.4.4.22) atha 15 yad uktam "putraisanäyäs ca 16 vittaisanäyäs ca vyutthäyätha 17 bhaiksacaryam caranti"(cf.Brh.U.3.5.1, 4.4.22) iti / na ca pandänäm putraisanävyutthänam arthavad bhavati daivakrtatvät 18 / kirn cänyat / rahasyabhütatvät / rahasyabhütam hi vedänäm 19 jnänam / yasmäd äha "tad 20 dha smaitad ärunir auddälakir jyesthäya puträya proväca /
1 A. evam 2 A. jnänanivrtti0 3 A. sästre (this is also possibly 4 A. prajojakam 5 A. evärthitvät 6 A. upäguna0 7 A. anuvädapräptäny 8 K., P. and D. omit yat tu. 9

5

10

15

20

the original reading).

Instead of pravartitavyam pravartayitavyam ca K., P. and D. read pravartayitavyam, while A. reads pravartitavyam. 10 K. not clear P. samsa~rapra..sangah D.: samsäräbhävaprasangah 11 A. omits hi. 12 K., P. and D.: sandändha0 A. pandandhabadhiraprabhrtayah 13 K., P. and D.: väyam 14 A. näkämayanta 15 A. omits atha. 16 A. omits ca. A. omits vyutthäyätha ... pandänäm putraisanä. P. omits atha. 18 P. devakrtatvät (this is also possibly the original reading). 19 A. devänäm 20 A. yad

(^(alramantare) sannyasasrame / / (K.16a, D.54-1) ^2^ (müläsrame) grhasthäsrame / sarvair upajlvyamänam gärhasthyam müläsramah / / (K.16a, D.54-2)

54

YUKTIDIPIKA

idam <vava>* jyesthaya putraya 2 pita 3 brahma prabruyat 4 pranayyaya^1) cänteväsine 5 nänyasmai^2) yasmai kasmaicana / ya imäm adbhih parigrhitäm vasunä vasumatlm pürnäm dadyäd etad eva tato bhüyah^3) "(cf.Chänd.U.3.11. 4-6) iti / bhavati cätra^— 5 param rahasyam vedänäm avasänesu pathyate / pandädyartham tad ist am ced distyä saphalatä^4) sruteh / / vidvän karmäni kurvitety etad^5) uktam kila srutau / sa ca pandädir eva syäd 7 yo 'tyantam karmanas cyutah / / sa eva vartyatäm präjfiaih kirn nyäyyo 'tha matibhramah / indriyärthänurägo vä dveso8 vä moksavartmani / / kaivalyapräptihetutväd yä vedavihitä stutih 9 / prasastä yäjnavalkyädyair visistais tattvaniscayät / / seyam visayarägändhair viparitärthavädibhih / vidyä kanyeva pandäya dlyamänä na sobhate / / tasmäd rägänugair uktäm kuhetuprtanäm imäm / apohya matimän yuktyä 10 hy 11 äsramäd äsramam 12 vrajet( 6 )//
1 A. väta K., P. and D. omit <väva>. 2 K., P. and D. jyesthaputräya 3 A. omits pita. 4 A. vrabrüyät 5 A. pranäyyäyäte väsine 6 A. trätra 7 A. reads yä and omits syäd ... indriyärthänurägo 8 A. dvesäm 9 K., P. and D.: stutä 10 A. and Dkha.: apohya yuktyä matimän 11 A. omits hy. 12

10

15

vö(54.8-10).

K., P. and D.: asramam D. s.m. äsramam

(^(pranayyaya) tadekanisthayety arthah / / (K.16b, D.54-3) (2) (nänyasmai) nänyasmaity anena rahasyam uktam / / (K.16a, D.54-4) (3) (ya imäm...bhüyah) ya imäm iti / yah samudräntäm ratnapürnäm vasumatlm dadyät tato 'pi dätur etad brahma bhüyo bahutaram / tena tasmä api na deyam iti tätparyam / / (K.16a, D.54-5) (4) (saphalatä) käkvä nisphalatety arthah / / (K.16b, D.55-1) (5) (vidvän karmäni kurvltety etad) vidvän karmäni kurvitety etac chalamukhena düsanam / jnänam hi tvayä pandädivisayam eva krtam iti chalam / vastutas tu 'nyadevatätmajnänam taih pandädivisayam istam / vidvän iti tu kriyänupürv<y>ädijnänam(?)* anyadevatäbhimatam / / (K.16b, D.55-2) *K. and D.: kriyänupürvt ädijnänam (6)(vrajet) vased vrajed iti päthayor eka evärthah / / (K.16b, D.55-3)

PRATHAMAM AHNIKAM SK2d

55

iti yuktidipikayam saptatipaddhatau1 prathamam ähnikam2/

2

*K., P. and D.: iti ärimadacäryesvarakrmaviracitayäm samkhyasaptatau yuktidtpikanämni vivarane D. ähnikam samäptam /

D v i t i y a m

A h n i k a m

aha 1 : samyag upadistam bhavata 2 vyaktavyaktajnavijnanan mokso 'vapyata iti 3 / idänim 4 upadestavyam katham etat trayam pratipattavyam iti / ucyate: trayasyäsya pratipattim dvedhä 5 samämananti / samäsato vistarat as ca / tad eva^1) trayam paiicabhir adhikaranair bhidyate / käni punar adhikaranäniti / ucyate: prakrtivikäravrttam^ 2 ) käryakäranavrttam atisayänatisayavrttam nimittanaimittikavrttam visayavisayivrttam iti / tatra prakrtivikäravrttapürva*D. atha dvitiyam ahnikam arabhyate / aha s.m. idämm

2 A. bhagavatä 3 K., P. and D. omit iti. 4 A. cedänim D. idädim, 5

A. omits dvedhä.

(*)(tad eva; adhikaranair; nimittanaimittikavrttam) tad eveti / atra evakaro bhinnakramah pancabhir ity anena sambadhyate / paricabhir evety art hah / adhikaranam (57.5) vrttam ucyate 'dhikrtir vartanam iti / nimittanaimittikavrttam*(57.8) tu sahakärisahakäryarüpam präguktacatustayäbhäve 'pi yathä purusärthasya pradhänaparinämasya ca sattvarajastamasäm ca parasparäbhibhavädinä dharmädes caturdasavidhabhütasargasya ca / tac ca** "purusärthahetukam"(SK42a') ityädinä "dharmena gamanam ürdhvam"(SK44a) ityädinä ca vaksyate, evam upädänopädeyabhävah sahakärisahakäryabhävo grähyagrähakabhävaupäyopeyabhävah prakarsäpakarsas cety etävad eva prameyam sambhävyate //(K.löb, D.56-1) *D. nimittanaimittikam vrttam **D. omits ca. W (prakrtivikäravrttam käryakäranavrttam atisayänatisayavrttam visayavisayivrttam; "savisesänäm ?vrttir na") tatra prakrtivikäravrttam upädänopädeyabhävah sa "prakrter mahän" (SK22a ) ityädinä vaksyate / arthasya ca cäturvidhyam "mülaprakrtih" (SK3a?) iti kärikayä nirüpayisyate / käryakäranavrttam(57.7) tu prakrtivikärayor apy äharanadhäranaprakäsanenähäryädisu bhavati tadyathä karanatrayodasasya sve sve gocare tac ca "adhyavasäyo buddhih" (SK23a) ityädinä vaksyate / visayavisayivrttam(57.8) käryakäranavrttäntargatam / aprakrtivikäritve 'pi ca tad dhi dväradväribhäva eva / tac ca "säntahkaranä buddhih sarvam visayam avagähate yasmät tasmät trividham karanam dväri dväräni sesäni" (SK35) iti vaksyate / anye tu "buddhlndriyäni tesäm" (SK34a) ityädinä "sesäny api pancavisayäni" (SK34d) ityantena visayavisayivrttam ähuh / atisayänatis"ayavrttam( 57.7) tv aprakrtivikäratve 'py akäryakaranatve 'py adväridväratve J pi dharmädlnäm buddhidharmänäm prakarsäpakarsayogah / tat tu "sämsiddhikäs ca bhäväh" (SK43a) ityädinä bhavisyati / savisesanänäm vrttir neti(59.3) / nedam väcanikam api tu väkyärthäbhidhäne* yadä

58

YUKTIDIPIKA

5

katvad 1 itaresam adhikarananam tadbhedan vaksyamah / tat punas caturdha bhidyate / kimcit käranam eva na käryam / kimcit käranam ca käryam ca^ 1 )/ kimcit käryam eva na käranam^ 2 ) 2 / kimcin naiva käranam 3 na cäpi 4 käryam 5 iti('3V äha: <sämänyopadistam>(4)6 etan 7 näsmäkam buddhäv avatisthate / tasmäd vivicyopadisyatäm^5)8 kasya padärthasya kirn vrttam iti / ucyate: bädham 9 upadisyate / MÜLAPRAKRTIR AVIKRTIH / (SK3a)

10

mülam ädhärah pratisthety anarthäntaram 1 0 / prakarotiti prakrtih 1 1 / mülam cäsau prakrtis ca 12 mülaprakrtih / mülaprakrtih 13 kasya mülam / mahadädinäm 1 4 / samjnä^6) khalv iyam pradhänasya 15 mülaprakrtir iti / sä cävikrtir16 avikäränutpädyety 17 arthah /
1 A. prakrtivikärapürvakatväd 2 A. omits na käranam. 3 A. käryam 4 A. omits cäpi. 5 A. käranam 6 K, P. and D.: sämänyoddistam A. atisämänyopadistam Dkha. atra 7 A. and Dkha.: iti 8 A. vibhajyopadisyatäm (this is also possibly the original reading). 9 A. suträtum (recte: sütram tu?) 10 K., P. and D.: pratistheyam arthäntaram 11 A. prakrti 12 K., P. and D. omit ca. 13 A. omits mülaprakrtih. 14 A. mähädznäm 15 16

sämänyoddistam

A. pradhänasä Dkha. sä cäsau vikrtir 17 A. vikäränutpädyety D. avikärah anutpädyä ity

samarthyam nasti tada samasabhava ity evam param etat / rddhasya rajapurusa iti samasenarddhärthasya pumsä** sambandho gamyate / na tu räjnah / sa hy rddhasya putro vä mitram veti pratipattih / na tv rdddhasya räjria iti / iha tu väkyärthäbhidhänam vidyata evety etat paksäntaradarsanavyäjenäha—väkyapratipädyasyeti / / (K.17a, D.56-2) *D. väkyärthäbhidhäne, s.m. vigrahaväkyärthäbhidhäne **D. pumsah W (kimcit käranam ca käryam ca) mahadädyah / / (K.17a, not found in D.) (2) (kimcit käryam eva na käranam) sodasakah / / (K.17a, D.56 without number) (3) (kimcin naiva käranam na cäpi käryam) purusah / / (K.17a i.n., D.56 without number) (4)(<sämänyatopadistam>) vyaktävyaktajnety (SK2d') atra / / (K.17a, not found in D.) (5)(vivicya) kasya mülam ityädinä / / (K.17a i.n., D.57 without number*) *D. deletes this note with a horizontal line. (6) (samjnä) nanu mahän ahamkärasya ca mülam prakrte vikrtis cety äsankyäha samjneti / / (K.17a, not found in D.)

DVITIYAM AHNIKAM SK3a

59

äha: s a m ä s ä n u p a p a t t i h visesanäntaropädänät 1 / mülam ity ayam sabdah prakrtivisesanärtham upätto mahadädivisesanäntaram upädatte / tatra "savisesanänäm vrttir na"(MBhäsya.I.361.5 cf.ibid.II.18.7) iti samäsapratisedhah präpnoti / s a m ä s ä n t a r a v i d h ä n ä d adosa iti cet / syän matam / yady etasmin samäse doso ' y a m upapadyate samäsäntaram atra vidhäsyate mülam prakrtinäm mülaprakrtir iti / etac 2 cänupapannam / kasmät / dosäntaropapatteh / evam api "upasarjanam pürvam (Pän.2.2.30) nipatati" (MBhäsya.II.355.9) iti sasthyoktasyopasarjanatvät 3 pürvanipätah / tatraivam 4 bhavitavyam mülam prakrtinäm prakrtimülam iti / tasmäd idam apy asäram 5 iti / ucyate: pürva eva samäso 'stu sambandhisabdah 6 <säpekso>7 nityam vrttau samasyate / yat tüktam(59.1) visesanäntaropädänät samäsänupapattir iti tatra 8 brümah: sambandhisabdänäm sambandhyantaram anapeksya svarüpapratilambha eva nästity äkänksävatäm 9 eva vrttyä bhavitavyam tadyathä devadattasya gurukulam iti sambandhisabdatväd devadattasabdam apeksamäno 'pi gurusabdah kulasabdena saha vrttim^1) pratipadyate (cf.MBhäsya.L361.13fF.) / evamihäpi mülam ity ayam 10 sambandhisabdatvän 11 mahadädyapekso Jpi prakrtisabdena saha vrttim^2) pratipadyata(cf.MBhäsya.I.362.27) iti / kirn cänyat / väkyapratipädyasyärthasya vrttäv upalabdheh / yatra hi väkyapratipädyo 'rtho vrttyä^3) na gamyate 12 yathä rddhasya räjfiah purusa iti / tatra "savisesanänäm vrttir na"(MBhäsya.I.361.5 cf.ibid.II.18.7) iti vyavasthitam 13 sästre / gamyate ceha 14 väkyapratipädyo 15 'rtho vrttau 1 6 satyäm / tasmäd adoso ' y a m iti / kirn ca jnäpakäc ca 1 7 / jnäpakam khalv api "karmavat karmanä tulyakriyah"
1 A. visesanärtham apätto mahadädivisesanäntararopädänät 2 A. tac (this is also possibly the original reading). 3 A. sasthyam tasyopasarjanatvät 4 A. omits tatraivam ... prakrtimülam iti. 5 A. apasäram 6 K., P. and D. omit sambandhisabdhah <säpekso> nityam vrttau samasyate. 7 A. säksepo We follow Pandeya. 8 A. ity atra (this is also possibly the original reading). 9 K., P. and D.: äkänksävata 10 K., P. and D.: ayam sabdah 11 After sambandhisabdatvän A. repeats devadattasabdam ... sambandhisabdatvän. 12 A. labhyate 13 A. vyavasthäpitam 14 A. gamyata eva 15 A. väkyapratipädito 16 A. vrttäv api 17

5

10

15

20

25

K., P. and D. omit ca.

W (vrttir) samäsah / / (K.17a, not found in D.)
(2

)(vrttim) samasam / / (K.17b i.n., D.58-1)

<3) (vrttyä) samäsena// (K.17b, D.58-2)

60

YUKTIDIPIKA

5

10

15

(Pan.3.1.87) tatha "akarasya vivrtopadesah" (cf.MBhasya.I.L2,1.15.2) ityadi / tasmät "näträsüyä 1 kartavyä"(cf.MBhäsya.II.356.1ff.) iti / aha: avayavasya pratyavamarsänupapattih samjnäsabdatvät / samjnäsabdesu hi nävayavasya parämarso bhavati / tadyathä gajakarno 'svakarnah / kasya gajasya kasyäsvasyeti 2 / ucyate: na arthopapatteh / yatra hy artha upapadyate bhavaty eva tatra samjfiäsabdesv avayavesu <p>arämarsah3/ tadyathä sapta parnäny asya parvani parvany astau pad any asya panktau panktau saptaparno 'stäpadam iti / upapadyate cehäyam art hah / tasmäd adoso ' y a m / äha 4 : mülaprakrteh prakrtitvävacanam^ 1 ) 5 / mülaprakrtir 6 avikrtih prakrtir 7 iti vaktavyam 8 / yad äha 9 "mahadädyäh prakrtivikrtayah sapta" (SK3b) iti / ucyate^2): prakrtitvävacanam 1 0 / prakrtitvam ca mülaprakrter na vaktavyam 1 1 / kirn käranam / arthäd äpatteh^ 3 ) 12 / mülaprakrtir avikrtir ity eva siddham 13 / ucyamänam hi 14 tad^4^ anarthakam syät / äha(5)*. prakrtitvänupapattih satkäryavädäbhyupagamät 1 5 / prakarotiti prakrtis tadbhävah prakrtitvam / tac ca sati kärye na ghatate / kasmät 1 6 / na hi sat am ätmädinäm käranam 17 upapadyata iti /
1 A. nanyasuya 2 A. kasyäsväsyati 3 K., P. and D.: avayavesv aparämarsah A. avayavaparämarsah 4 A. and Dkha. omit äha. 5 K., P., D. and Dkha. omit mülaprakrteh prakrtitvävacanam. 6 A. mülaprakrtir mülaprakrtih 7 A. and Dkha. omit prakrtir. 8 Dkha. äha avikrtir na vaktavyam instead of iti vaktavyam 9 A. yathäha 10 A. prakrtivacanam 11 A. avaktavyam (this is also possibly the original reading). 12 K., P. and D.: arthopapatteh 13 K., P. andD.: siddhih 14 K. and P.: sücyamänam hi D. sücyamänam, s.m. sücyamänam 15 A. tatkärya0 16 A. yasmät Dkha. yasmin 17

hi

K., P. and D.: karanam

W (mülaprakrteh prakrtivacanam) rudhitvopayogasya vidyamanatvad asti codyavakasa iti tatparyam // (K.17b, D.58-3) (2) (ucyate) siddhäntavädT// (K.17b, D.59-1) (3) (arthäd äpatteh) arthäpatteh // (K.17b, D.59-2) (4)(tad) prakrtitvam // (K.17b, D.59-3) (5)(äha) pürvapaksah // (K.17b, D.59-4)

DVITIYAM AHNIKAM

S

K

3

a

6

1

tad itaraträpi 1 tulyam / yathaiva hi 2 satäm ätmädinäm käranam nopapannam evam asatäm sasavisänädinäm apiti 3 nästi kascid visesah / trtiyä^2) tuvisädävasthaiva 4 kotih / evam(3)5 ubhayapaksavyudäsät svapaksasiddhir iti cet / athäpi 6 syät / sadasatoh kriyäsambandham praty avisesa7 upadarsyate bhavatä / tenobhayor api paksayor vyudäsah krto bhavati / tena 8 cobhayapaksavyudäsät svapaksasiddhir iti / etac cäyuktam / kasmät / uttaratra pratisedhät / sa^4) khalv esa vädi satkäryavädam pratyäcaste / tasmät svaka evainam adhikäre nivartayisyämah 9 (109.3ff.) / äha: avikrtyabhidhänänarthakyam 1 0 mülaprakrtitvät tatsid11 dheh / yä hi mülam sarväsäm 12 prakrtinäm avikrtyaiva 13 tayä bhavitavyam / itarathä hi mülaprakrtitvänupapattih / yadi khalv api pradhänasyäpi prakrtyantaram syän mülaprakrtitvam nopapannam bhavet 14 / tasmän mülaprakrtitvavacanäd eva tatsiddher avikrtigrahanam anarthakam iti / ucyate: na anavasthäprasanganivrttyarthatvät / yathä hi 15 mülädinäm bijam prakrtis tasyäpy anyat 16 tasyäpy anyad ity anavasthä evam 17 mahadädinäm pradhänam mülaprakrtis tasyäpy anyad ity anavasthä prasajyeta / sä mä bhüd ity 18 atas tannivrttyartham tadabhidhänam / äha: na hetvanupadesät ( 5 ) 1 9 / asamsayam eva syäd etad evam 20 / na tu
X A. omits api. 2 A. yathaiveti 3 A. ceti 4 K., P. and D.: vivädävasthaiva 5 A. iti 6 A. athaväpi 7 A. avasesa 8 K., P., D. and A.: na Dkha. tena 9 A. varttayisyämah 10 A. avikrtyabhidhänärtham n K., R andD.: tatsiddhih 12 A. sarvosäm 13 A. hy avikrtyaiva 14 A. syät 15 A. omits hi. 16 A. omits tasyäpy anyat. 17 A. omits evam ... anyad ity anavasthä. 18 After ity A. repeats anavasthä prasajyeta 19 A. hetvapadesat 20

5

10

15

sa mä bhüd ity.

K., P. and D.: asamsayam etad eva syäd

(^(ucyate) siddhäntavädy äha / / (K.18a, D.59-5) <2)(trtlyä) sadasatpaksah / / (K.18a, D.59-6) (3)(evam) pürvapaksavädl // (K.18a i.n., D.59-7) (4)(sa) ubhayapaksavyudäsät svapaksasiddhir iti vädl // (K.18a, D.60-1) (5> (hetvanupadesät) mülaprakrtir avikrtir eva bhavitum arhati / etasmäd dhetor iti ko 'pi hetur atra noktah / / (K.18a, D.60-2)

62

YUKTIDIPIKA

5

10

15

hetur atropadisto bhavadbhir na canupadistahetukam vipascidbhih pratipattum nyäyyam 1 / tasmäd ayuktam et at / ucyate: käranäntarapratisedhät purusäkartrtväV 1 ) 2 pradhänäkhyänäm gunänäm cävasthäntaränupapatter avikrtitvasiddhih / ihärabhyamänä prakrtih käranäntarair Isvarädibhir ärabhyate purusena vä 3 gunair vä / kirn cätah / tan na tävat käranäntarair Isvarädibhir ärabhyate / kasmät / pratisedhät / yathä käranäntaräni na santi tathottaratra 4 pratisedhah karisyate(154.28ff.) / idänim sattvam rajas tamah purusa iti padärthacatustayam pratijiiäyate / taträpi purusakartrtvam pratyäkhyäyate / tasmin pratyäkhyäte 5 gunänäm evävasthäntaräpeksah käryakäranabhävah / süksmänäm mürtiläbhah käryam / nivrttavisesänäm 6 avibhägätmanävasthänam 7 käranam ity ayam siddhäntah / taträstahgatavisesänäm nivrttaparinämavyäpäränäm ahgängibhävam 8 anupagacchatäm 9 upasamhrtasaktinäm sarvavikärasämyam sarvasaktipralayam nissattäsattam nissadasadavyaktalaksanam avasthäntaram upasampräptänäm(cf.YBh.2.19) nästy anyat süksmataram avasthäntaram yasyedam pradhänalaksanam avasthäntaram käryam syät / tasmät susthücyate mülaprakrtir avikrtir iti / MAHADÄDYÄH PRAKRTIVIKRTAYAH10 SAPTA / (SK3b) mahän ädyo yäsäm tä mahadädyäh / avayavena vigrahah samudäyah samäsärthah / anyathä mahän eväträparigrhitah syät / prakrtayas ca vikrtayas ca prakrtivikrtayah / käranäni 11 käryäni cety arthah / tatra mahän ahamkärasya prakrtih pradhänasya vikrtih 12 / ahamkäro 'pi tanmätrendriyaparvanoh <prakrtir mahato vikrtih) 1 3 / tanmäträni 14 ca bhütaparvanah prakrtir ahamkärasya vikrtih / äha: saptagrahanam kimartham / ucyate: saptagrahanam avadhiparicchedärtham / akriyamäne hi saptagrahane na jiiäyate kiyän prakrtiganah prakrtivikrtisamjiio bhavatiti 15 tatra mahäbhütendriyaparvanor api prakrtitvam prasajyeta 16 /
1 K., P. and D.: nyäyam 2 Dkha. purusasyäkartrtvät 3 A. omits vä. 4 A. tathätra 5 A. omits tasmin pratyäkhyäte. 6 A. nivrttivisesänäm 7 A. abhibhävätmanävasthänam 8 A. angängim 9 A. omits anupagacchatäm. 10 A. omits prakrtivikrtayah ... yäsäm tä 11 D. käranäni ca, s.m. käranäni 12 A. prakrtih 13 14 K., 15 K., 16

20

25

mahadäyäh.

K., P. and D.: prakrtir vikrtir mahatah A. prakrtimahator vikrtih Dkha. vikrtir ahamkärasya P. and D. omit tanmäträni ... ahamkärasya vikrtih. P. and D. omit iti. A. prasajyate

(^(purusäkartrtvät) purusasyäkartrtvät* // (K.18a, D.60-3) *D. purusasyäkrtakatvät

PRATHAMAM AHNIKAM SK3bc

63

äha: naitad asti prayojanam parisesasiddheh / iha bhavatäm pancasikhänäm pancavimsatis tattväni / tatra "mülaprakrtir avikrtih" (SK3a) ity uktam / sodasakas tu vikäro na prakrtir na vikrtih purusah /(SK3cd) iti vaksyati / parisesatah saptaivävasisyante / tasmän närthas tadarthena saptagrahanena / ucyate: ahamkäraparigrahärtham / evam tarhi naivähamkäro vidyata iti patanjalih 1 mahato 'smipratyayarüpatväbhyupagamät 2 / tatparihärärtham 3 etad bhavisyati / äha: na uttaratra parigrahät / etad api nasti prayojanam / vaksyati hi 4 mahatä kanthenoparistäd 5 äcäryah "prakrter 6 mahäms tato 'hamkärah" (SK22ab') iti 7 / tenaivedam siddham 8 / närthas tadarthenäpi saptagrahanena / ucyate: rüpabhede 'pi tattväbhedajnäpanärtham / evam tarhi dharmädiny astau rüpäni buddher vaksyamänäni (cf.SK23), ahamkäras ca vaikärikataijasabhütädirüpatvät^ 1 ) trilaksano 9 vaksyamänah lo (cf.SK25) / tatra rüpabhedät tattvabhedo mä bhüd ity evamartham saptagrahanam kriyate / äha: he turn antarenäpratipatteh / kanthoktam 11 api yuktim antarena na tarkasiläh 12 pratipadyante / kirn punar lesopapäditam 13 / tasmäd atra samädhir väcyah katham anekarüpä buddhir ekaiveti / <ucyate:> na uttaratra vicäranät / uttaratraitad vicärayisyämah 14 (171.25fF.) kirn anekarüpävirbhäve 'pi tad eva tad vastu 15 bhavaty ähosvid rüpabhedät tattvabhedah <iti?> / tasmäd iha tävad drsyatäm iti siddham mahadädyäh prakrtivikrtayah sapteti / SODASAKAS TU VIKÄRAH / (SK3c) sodasaparimänam asya so 'y ar ri 16 sodasakah sanghah / "tad asya 17 parimänam" (Pän.5.1.57) "samkhyäyäh samjnäsanghasüträdhyayanesu"(Pän.5.1.58) iti 1 8 kanpratyayah /
2 A. mahato 'smität pratyaya0 Dkha. mahato asmin pratyaya0 3 A. tatparigrahärtham 4 A. omits hi. 5 A. kanthakenoparistäd 6 A. prakrte 7 A. omits iti. 8 A. tenaiva siddham idam (this is also possibly the original reading). 9 A. and Dkha.: ° bhütädilaksanatvät trirüpo 10 A. vaksyämänah 11 K., P. and D.: kanthoktam 12 D. tarkasüräh 13 A. klesopapäditam 14 A. vicärayisyämih 15 recte. vastu instead of tad vastu 16 K., P. and D. omit so 'yarn. 17 K., P. and D.: tasya 18

5

10

15

20

25

*A. pätänjalih

A. omits iti.

(^(-bhütädi-) tämasa / / (K.19a, not found in D.)

64

YUKTIDIPIKA

5

10

15

20

25

aha: kah punar ayam sodasaka iti / ucyate: panca mahäbhütäny ekädasendriyäni 1 / tusabdo 'vadhäranärthah / äha 2 : sakyah punar ayam artho 'ntarenäpi 3 tusabdam aväptum / katham / mahadädyäh prakrtivikrtayah saptety apadistam 4 purastät / tato 5 'hamkäratanmätrapürvakatve siddhe satmdriyamahäbhütaparvanoh punahsruter niyamo bhavisyati / tadyathä 6 "panca pancanakhä bhaksyäh" (cf.MBhäsya.I.5.15) ity atra ksutpratikärasamarthänäm dravyänäm arthäd 7 eva sarvesäm bhaksane sampräpte punahsruter niyamo bhavati / tadvad idam drastavyam / istato 8 Vadhäranärtha iti cet / syän matam / istato 'vadhäranärthas tarhi tusabdo bhavisyati / katham näma sodasako vikära eveti vijnäyate 9 / sodasakas tu vikära ity evam10 mä jnäyiti 1 1 / yady evam asthäne 12 tarhi tusabdah pathitah sodasako vikäras tv iti vaktavyam / atha matam / vrttaparipüranärtham 1 3 ayam asmin pradese pathitas tusabdah / yatra nirdosas tatraiväyam drastavya iti / etad anupapannam / kasmät / asandehät / mahadädyäh prakrtivikrtayah saptety apadiste kirn iti sämsayikä bhavisyämah / tasmät pelavam asya päthe 14 pray oj an am pasyämah / athäyam 15 abhipräyah syäd yady apy etad arthatah 16 siddham 17 tathäpy ayam äcäryah sphutapratipattyartham avadhäranam pratyädriyate / kirn käranam / yasmäc citräh 18 sütrakäränäm abhipräyagatayah / tadyathä bhagavän päninih "nah kye"(Pän.l.4.15) "rät sasya"(Pän.8.2.24) ity evamädisv antarena 19 prayatnam istato 'vadhärane siddhe 'nyatra "ajädl 20 gunavacanäd eva"(Pän.5.3.58) "stautinyor eva sanyabhyäsät"(Pan.8.3.61) ity evamädisu yatnam 21 karoti / tadvad ihäpi drastavyam iti / etad a n u p a p a n n a m / kasmät / asakyatvät / sati vä punar avadhäranärthatve tusabdasya katham evätra 22 sakyam avadhäranam pratipattum yävatä mahäbhütänäm api sarirädilaksanam käryam upalabhyata iti / tatra kecit samädhim ähuh—sarirädinäm anarthäntara1 A. indriyäny ekädasa 2 K., P. and D. omit äha. 3 -A. arthäntarenäpi 4 K., P. and D.: sapteti hy upadistam 5 A. tatra 6 D. bhavisyati, s.m. bhavisyati tathä 7 A. arthitväd Dkha. arthatväd 8 A. omits istato ... syän matam. 9 A. yathä vijnäyate 10 A. eva 11 A. vijnäyzti D. jnäyi, s.m. vijnäyi Dkha. 12 A. asthänene 13

vijnäyi (iti)

A. vrttapüranärtham (this is also possibly the original reading). D. vrttapürnärtham, s.m. vrttaparipürnärtham 14 A. not clear. 15 A. athäpy ayam 16 A. arthas 17 A. omits siddham. 18 A. viciträh (this is also possibly the original reading). 19 A. eväntarena 20 D. ajäder 21 A. prayatnam 22 A. ivätra

__

DVITIYAM AHNIKAM SK3c

65

bhävät 1 prthivyädlnäm aprakrtitvam yasmät kila prthivyädTnäm sannivesavisesamätram käryam mustigranthikundalädivan närthäntarabhütam ata evaisäm2 aprakrtitvam 3 iti / etac 4 cänupapannam / kasmät / avisesät / sarvam 5 eva hi sämkhyänäm käryam anarthäntarabhütam / tatraitasyäm 6 kalpanäyäm sarvatattvänäm aprakrtitvam prasajyeta / athaitad 7 anistam satkäryavyäghät<ät> 8 / anye punar ähuh—aparinämitvän mahäbhütänäm vikäritvänavadhäranam 9 iti / tad apy a n u p a p a n n a m / kasmät 10 / pratyaksopalabdheh / pratyaksata evopalabhyate mahäbhütänäm kalilänkurakslrädiparinämah 1 1 / anumänagrähyas 12 tu 1 3 tattväntaränäm / tad etad avarottaram 14 bhavati / tasmäd 15 ayuktam etat / [äha] na tarhi 16 pratipattavyam sodasako vikära eveti / ucyate: pratipattavyam / kirn käranam / tattväntaränupapatteh 1 7 / 18 iha purusärthena hetunä sämyät pracyutänäm gunänäm yo ' y a m mahadädivisesänto 19 viparinämah 20 sa tattväntarotpattiniyamena 21 vyavatisthate / na tu prthivyädibhyas tattväntarotpattir asti / tasmäd etesärn vikäratvam eveti / kirn cänyat / grähakäntaräbhävät / yathä tanmätrair ärabdhesu prthivyädisv ahamkärät tadyogyam grähakäntaram indriyalaksanam utpadyate naivam prthivyädivikäränäm ghatädinäm grähakäntaram asti / tasmän na tattväntaram / atas ca 22 prthivyädayo vikärä eveti / kirn cänyat / pradhäne prakrtibhävapratyastamayavat 23 tesu 2 4 vikärabhävapratyastamayät 2 5 / yathä pradhänät süksmataram avasthäntaram nästiti 26 prakrtibhävasya pratyastamayas 27 tathä 2 8 tesu vikärabhävapratyastaJ A. anarthantarabhävät 2 K. and D.: ata esäm P. ata e..säm 3 A. prakrtitvam 4 A. tat 5 A. pürvam 6 A. tatretasyäm 7 A. tathaidad 8 K., P. and D.: anistam satkäryavyäghätah A. anistasatkäryavyäghätah 9 A. vikäritvävadhäranam 10 A. omits kasmät. 11 A. kälamänkuraksträdiviparimänah 12 P. anumänagrahäs 13 A. ta 14 A. and Dkha.: adharottaram (this is also possibly the original reading). 15 A. kasmäd 16 A. and Dkha.: tarhtdam 17 K., P. and D.: tattvänupapatteh 18 A. iha iha 19 A. mahadädir visesänto 20 A. 'pi parinämah 21 A. tattväntero0 22 A. omits ca. 23 A. prakrtibhävah pratyastamayavat Dkha. prakrtibhävapratyastamayät 24 P. °pratyastayamayavartesu 25 K., P. and D.: °pratyastamayah 26 A. nästiti tatra 27 A. stamayah D. pratyastamayah, s.m. pratyastamayät 8

5

10

15

20

A. omits tathä tesu vikärabhävapratyastamayah.

66

YUKTIDIPIKA

mayah / tasmad 1 yuktam ucyate sodasako 'yam vikara eveti / äha: puruse tarhi 2 kä pratipattir iti / ucyate: NA PRAKRTIR NA VIKRTIH PURUSAH / / (SK3d) 5 na hy ayam 3 avasthäntaram pratipadyate / no 4 khalv apy avasthäntarasyävasthäntaram bhavatiti / äha 5 : na tad 6 yuktim antarena sraddhiyate / tasmäd upapädyatäm katham 7 asyäprakrtitvam avikrtitvam ceti / ucyate: prakrtitvänupapattih uttaratra pratividhänät / "tasmäc ca viparyäsät"(SK19a) ity atra yuktim upadeksyämah / tasmät tävad asyäprakrtitvam 8 / avikrtitvam pradhänavat / yathä 9 pradhänam evam ayam api purusah kriyamänah käranäntarair Isvarädibhir 10 närabhyate / kasmät / pratisedhät / yathä käranäntaräni na santi tathottaratra pratisedhah karisyate11(154.28ff.) / käranäntaräni 12 santlti cen na purusäntaraih samat v ä t 1 3 / samäh sarve purusä na ca samänäm käryakäranabhävo drstah / kirn ca niskriyatvät suddhatväc ca / esäm viparinämalaksanä parispandalaksanä vä kriyä vibhutväd anupapannä / kasmät 14 / esäm itaretaränärambhakatvät / na gunair bhinnajätlyakatvät 1 5 / ihäcetanä gunä 16 ity etat pratipädayisyämah / yac ca yenärabhyate tanmayam tad bhavati 1 7 / yadi gunaih purusänäm ärambhah syät 18 tesäm apy acetanatvam syät / cetanäs tu t e 1 9 / tasmän na gunair ärabhyanta iti siddham etat 2 0 / kimcit käranam eva na käryam kimcit käranam ca 21 käryam ca / kimcit käryam eva / kimcin naiva käranam naiva 22 käryam 23 iti caturvidham käryakäranavrttam pratipäditam 24 (58.2) / etat pratijiiäpindasütram / yad 25 apadis1 K., P. and D. omit tasmäd yuktam ... eveti. 2 A. tarhidänim 3 A. omits ayam. 4 A. nau 5 A. omits äha. 6 A. naitad (this is also possibly the original reading). 7 P. kam 8 A. tasmäd asya tävad aprakrtitvam 9 Dkha. yadä 10 D. käranäntaraim(l) isvarä0, s.m. käranäntarair isvarä0 11 A. karisyate äha 12 K., P. and D. omit käranäntaräni santiti cen na. 13 A. purusais sambandhät 14 A. tasmät 15 A. bhinnajätiyatvät 16 A. guna 17 K., P. and D.: tac ca tanmayam bhavati instead of tanmayam tad bhavati 18 A. tadä 19 A. omits te. 20 A. evam etat 21 K., P. andD. omit ca. 22 A. na 23 D. naiva käryam naiva käranam, s.m. naiva käranam naiva käryam 24 A.and Dkha.: vyäkhyätam 25

10

15

20

A. atra yad

DVITIYAM AHNIKAM SK3d,4

67

tarn bhavadbhir 1 asmin sastre 2 <tat(?)> prameyam 3 ity avagantavyam / / 3 / / äha: athasya prameyasya kutah siddhir 4 iti / ucyate: PRAMEYASIDDHIH PRAMÄNÄD DHI / / (SK4d) pramiyate tad 5 iti prameyam / prameyasya siddhih prameyasiddhih / siddhir adhigamo 6 'vabodha ity arthah / pramiyate 'neneti pramänam / karanasädhano 7 lyut (cf.Pän.3.3.117) / tad ekam eva buddher ekatväbhyupagamät / upädhivasät tu bhinnam äsriyate pratyaksam anumänam ityädi / tasya yo 'säv upädhikrto bhedas tarn anäsritya prameyaparicchedakatvam 8 angikrtyaikavacananirdesah kriyate pramänäd iti / etasmät prameyasiddhir 9 ity avagantavyam / katham / vnhyädivat / yathä vrlhyädi prameyam 10 prasthädinä parimänena 11 paricchidyata evam 12 ihäpi vyaktädiprameyam pratyaksädipramänena 13 paricchidyata iti 1 4 / hisabda idänim kimarthah 15 syät / avadhäränärtha iti / äha: yady evam hisabdävacanam 1 6 avadhäranänupapatteh / na hy etasmin sütre kathamcid avadhäranam upapadyate 17 / tasmäd avacanam eva hisabdasya nyäyyam 18 / prameyasyaiveti 1 9 cen na anyasyäsambhavät / sati hi vyabhicärasambhave 20 vastv avadhäryate tadyathä gaur 21 eväyam näsvo devadatta eväyam na yajnadatta iti / na ca prameyäprameyayoh pramänaparicchedyatve 'sti prasahgo 22 yannivrttyartham prameyasyaivety avadhäryate / pramänebhya eva iti cen na ärsajiiänavirodhaprasangät 2 3 / paramarser hi bhagavato jiiänam 24 sämsiddhikam apramänapürvam 25 iti vah paksah /
J A. etad bhavadbhir 2 K., P. and D.: sästram 3 K., P. and D. omit prameyam. 4 P. siddher 5 Dkha. yad 6 K. and P.: avagamo D. avagamo, s.m. adhigamo 7 A. käranasädhano 8 A. prameyaparicchedakatvasämänyam 9 Dkha. püritam 10 A. pramänam 11 A. pramänena 12

5

10

15

20

K. and P. omit evam ... pratyaksädipramänena paricchidyate, which D. adds in the right margin. 13 D. pratyaksädinä pramänena 14 A. iha 15 D. kimarthakah, s.m. kimarthah 16 A. hisabdävacanam A. utpadyate 18 K., P. and D.: nyäyam 19 K., P. and D.: prameyasyeti A. vyabhicärasyasambhave Dkha. vyabhicärasadbhäve 21 A. gor 2 A. omits prasango. K., P. and D.: ätmajnänavirodhaprasangät 24 K., P. and D. omit jnänam. 5 K., P. and D.: apramänapürvakam

68

YUKTIDIPIKA samsiddhikas ca bhavah prakrtika vaikrtas 1 ca dharmadyah / (SK43ab)

5

10

15

20

25

iti vacanät / tad evam sati virudhyeta 2 / ubhayävadhäranam iti cen na ubhayadosaprasangät / ubhayävadhärane saty ubhayor api paksayor ye dosas te prasajyante / tasmäd ayuktam etat / siddhir eveti cen na anekäntät 3 / kadäcid dhy ayam pramätä sannihite 'py ädityädau linge dinniscayädisv4 arthesu pratihanyate / tasmäd anekäntät siddhir evety etad ayuktam avadhäranam / ucyate: yad uktam(67.14) hisabdävacanam avadhäranänupapatter iti / astu pramänebhya evety avadhäranam / yat tüktam (67.20) ärsajnanavirodhaprasanga ity ayam adosah / kasmät / siddharüpatvät / sädhyamänarüpäni hi vastüni näntariyakatvät 5 svarüpanispatteh 6 sädhanasambandham praty äkänksävanti bhavanti, siddharüpam tu 7 bhagavatah paramarser jiiänam / tasmäd asya sädhanasambandham praty äkänksä nopapadyata iti / athavä punar astu siddhir evety avadhäranam / yat tüktam (68.4) anekäntäd iti tad 8 anupapannam / kasmät / sattvädlnäm angängibhäv<ä>niyamät 9 tamahprakarsasäma<rthy>ät 10 pramänavaikalyopapatteh / iha sattvädlnäm aniyato 'ngärigibhävah / desakälanimittasämarthyäd dhi kadäcit sattvam 11 prakrsyate kadäcid rajah kadäcit tamah / sattvaprakars<as>12 ca prakäsarüpatvät pramänam / tatra yadä tamah prakrsyate tadä tenäbhibhütatvät sattvasya tatkäryam anumänam <vikalängam>13 upatisthata ity atah satyäm apy ädityädilingapravrttau dinniscayädisv arthesu pratihanyate / itarathä tu na svarüpahänam / yasya tu nispattivaikalyät pramänapratibandho 14 nestas tasya svarüpahänam pramänänäm präptam / katham / etävad dhi tesäm svarüpam yad uta prameyaparicchedah / tasmäd yuktam etad avadhäranärtho hisabdah <iti> / äha: bahüni pramänäny äcäryair abhyupagamyante / täni sarväni kirn bhavän 15 anumanyate / nety ucyate / kirn tarhi / TRIVIDHAM PRAMÄNAM^1) ISTAM / (SK4c)
1 A. 2 A. 3 A. 4

and D.: vaikrtikäs virudhyate anaikäntät A. dinnidayuktam etat / siddhir eveti cet na / anaikäntät kadäciscyädisv 5 A. näntartyatvät 6 A. svarüpanispattaye 7 A. omits tu. 8 A. anaikäntäd ayuktam tad ity atad 9 K., P. and D.: angäiigibhävaniyamät A. angäiigibhävo We follow Pandeya. 10 K. and P.: tamahprakarsasämagryät A. omits tamahprakarsasämagryät ... aniyato 'rigärig bhävah. D. tatah prakarsasmagryät, s.m. tamahprakarsa0 We follow Chakravarti. X1 K. and P.: satyam D. satyam, s.m. sattvam 12 K., P. and D.: prakäsas A. sattvaprakarsäs 13 All the Mss read trikälängam. We follow Raghavan. 14 A. pramänaprabandho 15 A. bhävän

(1)(TRIVIDHAM PRAMÄNAM)

trividham pramanam pratyaksam anumanam agama iti trividhagra-

__

DVITIYAM AHNIKAM SK3d,4

69

vidhänam vidhä, tisro vidhä asya tat trividham triprakäram ity arthah / anenaitad äcaste: ekam eva buddhilaksanam sattvam nimittäntaränugrahopajanitäbhih käryavisesaparicchinnarüpabhedäbhih saktibhir upakäräd bhinnam iva pratyavabhäsamänam drstädisabdaväcyam bhavati / na tu yathä tanträntariyänäm visayopanipätibhir indriyair upajanitä bahvyo buddhayas tatheha vidyante yäh parikalpyamänäh svatanträni trini 1 pramänäni syuh / syän matam / katham punah pramänalaksanänäm saktinäm ekavastusannivese rüpabhedä 2 bhavantiti / ucyate: sattvädivat / yathä sattvädinäm gunänäm ekasabdädivastusannivese 'pi prakäsädikäryabhedäd rüpasamkaro na bhavati, yathä vä sabdasparsarüparasagandhänäm ekadravyasannivese 'pi grähakäntaragamyatvät 3 , yathä vä kartrkaranädhikaranasampradänäpädänakarmalaksanänäm saktinäm ekadravyasannivese 'pi käryavisesaparicchinnäni svarüpäni na samkiryante, tadvad idam drastavyam / saktyantaropajanane vastvantaropapattir iti cen na anabhyupagamät / na hi ksanabhahgasähasam 4 yuktim ant arena dandabhayäd api pratipadyämahe / na tu <tasyäyam(?) avasara>5 iti sthiyatäm tävat / äha: katham punar etad 6 gamyate yathä trividham eva pramänam na punar anekavidham 7 apiti / ucyate: SARVAPRAMÄNASIDDHATVÄT / (SK4b') sarväni ca täni pramänäni sarvapramänäni / siddhasya bhävah siddhatvam (cf.Pän.5.1.119) / sarvapramänänäm siddhatvam sarvapramänasiddhatvam / siddhatvam antarbhäva ity arthah / tasmät sarvapramänasiddhatvät / tasminn eva trividhe pramäna iti väkyasesah / sarvesäm paraparikalpitänäm pramänänäm asminn eva trividhe pramäne 'ntarbhäväd iti yävad uktam syät tävad
1 A. omits trini. 2 P. ekavastusannivesarüpabhedä 3 A. ° gamyakatvät 4 A. ksanabhaiigisähasam 5 K., P. and D.: tasyäm avasara A. 6 A. eted 7 A. ekavidham 8 8

5

10

15

20

25

tasyävasara

After sarvapramänäni P. reads siddhatvät sarväni ca täni pramänäni sarvapramänäni.

hanam avadharanartham / sarvasam pramanavyaktinam pratyaksadilaksanais tribhir eva sangrhltatvät tathä copamänädlnäm atraiväntarbhävam pratipädayisyämah / pratyaksam evaikam pramänam ity eke / tad api na yuktam pratyaksena pramänenetaravibhägäsiddheh, sukhaduhkhädisädhanäpratipattes1 ca tanmüle pravrttinivrttl api na syätäm / näpratyaksam pramänam astlty abhyupagamya parapratyäyanärtham sästram pranayan väkyam coccärayan sväm eva pravrttim svaväcä vidambayatlty ato bhadram pändityam ätmanah prakatitavän iti / anumänam evaikam pramänam ity eke / tad api na yuktam / pratyaksäbhäve 'numänotthänäsambhavät / sudüram api gatvä hi dharmilihgadistäntänäm anumänapravrttim icchat~avasyam2 pratyaksena grahanam abhyupagantavyam / etenägama evaikam pramänam ity etad api nirastam / taträpi pratyaksenänumänena vä padaväkyädyaprasiddhäv3 ägamärthapratipatter asambhaväd iti / / (Ks.4, D.70-1) 1 D. °sädhanänäm pratipattes 2D. icchatah instead of icchatävasyam 3 D. padaväkyaprasiddhäv

70

YUKTIDIPIKA

5

10

idam ucyate sarvapramanasiddhatvad iti / athava sarvapramanesu siddham sarvapramänasiddham / saptami u siddhasuskapakvabandhaih"(cf.Pän.2.1.41) iti samäsah / yathä sänkäsyasiddhah 1 pätaliputrasiddha iti / tadbhävah sarvapramänasiddhatvam, tasmät sarvapramänasiddhatvät / kasya / trividhasya 2 pramänasyeti väkyasesah / kena punar äkärena trividham pramänam siddham iti / ucyate: paraspar<ä>visesät 3 / anyäni punar asmät trayäd yathäbhinnäni tathä pratipädayisyämah(70.25ff.) / äha: kirn punas tat trividham pramänam iti / ucyate: DRSTAM ANUMÄNAM ÄPTAVACANAM CA / (SK4ab') tatra drstam näma upättavisayendriyavrttyupanipäti yo 'dhyavasäyah / anumänam dvayor avinäbhävinor ekam pratyaksena pramäya tatpürvakam sambandhyantare yat pascän mänam bhavati / äptavacanam tu pramänabhütadvärako 'tyantaparokse J rthe niscaya ity uddesamätram idam / laksanam tv äcäryo vaksyati svayam eva "prativisayädhyavasäyo drstam" (SK5ab?) ityädi / äha: <trai>vidhyänupapattih 4 nyünädhikasravanät / <tanträ>ntari5 yäh kecic catväri pramänänicchanti "pratyaksänumänopamänasabdäh pramänäni" (NS.1.1.3) iti vacanät / tathä sad ity anye / pratyaksam anumänam ca sabda<s>6 copamayä saha / arthäpattir abhävas ca hetavah sädhyasädhakäh / / ity abhidhänät / etäni sambhavaitihyacestäsahitäni navety apare / pratyaksänumäne eveti vaisesikabauddhäh / tatra katham idam nisciyate trividham eva pramänam na punar nyünam adhikam veti / ucyate: kirn punar idam upamänam näma / äha: "prasiddhasädharmyät sädhyasädhanam upamänam"(NS. 1.1.6) / prasiddhah prajfiätah, tena sädharmyät sädhyasyäprasiddhasya sädhanam adhigamo yas tad upamänam / avabodhavidhis tu yenänupalabdho gavayah sa tasyopalabdhyartham adhigatagavayam paryanuyunkte kimrüpo gavaya iti / sa tasmä äcasteyathä gaur evam gavaya iti / tatra pratipatt<ä>tya<n>tänupalaksitagavayasvarüpo 7 vyäkhyätrpratipäditaprasiddhavastusädharmyajnänähitasamskärah pratipadyate nünam evamrüpo gavaya iti / apara äha: prati<pattur> 8 äptavacanopajanitaprasiddhavastusädharmyajnänähitasamskärasyottarakälam pratyaksena tarn upalabhya yä samäkhyäsambandhapratipattir iyam asäv artho Jsya sabdasya samäkheya iti tad upamänam
1 A. samkäsyasiddhah 2 K., P. and D. omit -sya .... cäptopadesabalät 3 A. parasparavisesät 4 A. trividhyänupapattir. We follow Pandeya. 5 A. trtiyäntanyäh. We follow Pandeya. 6 A. sabdam 7 A. pratipattyätyatänupalaksita0 8

15

20

25

30

35

pratipattäprasi- (70.4-71.2).

A. pratir

DVITIYAM AHNIKAM SK3d,4

71

ucyate: yady evam upamaitihyävacanam äptopadesasiddheh / yathä gaur evam gavaya iti cäptopadesabalät pratipattäprasiddham gavayam upalabhate na 1 sädharmyamäträt 2 / tasmän na sabdät prthag upamä / yat tu khalu "iti ha uväca yäjnavalkyah" (Brh.U.2.4.13 et passim) ity et ad aitihyam näma pramänäntaram upakalpyate 3 tad api vaktrvisesäpeksatvän na sabdäd arthäntaram / äha: na sädharmyäpeksatvät / yadi hy äptopadesa upamä syät tena yathä svarge 'psarasa uttaräh kurava ity evamädisv antarena 4 sadharmyopadanam pratipattir bhavati evam ihäpi s y ä t ^ / gavayam tv ayam äkhyätä pratipädayisyan 5 prasiddhasädharmyagarbham sabdam upädatte na kevalam( 2 V pratipattäpi tasmäd eva(3) pratipadyate na sabdamäträt / tasmät prthag eväsyopadesah^4) kartavyah / sabdavyäpärät^ 5 ) tadantarbhäva 6 iti cen na vltävltayor api tatprasangät / syän 7 matam / sabdavyäpärasahito ? yam prasiddhasädharmyalaksan<o> 'rtho 8 gavayapratipattau na kevalah / tasmäd asya taträntarbhäva iti / tad apy anupapannam / kasmät / vltävltayor api tatprasangät / vitävitäv api 9 hetü parapratipädanärtham upadiyamänau sabdavyäpäram apeksete 10 , tayor apy äptavaeanatvaprasangah / anistam caitat / tasmän nopamänam äptopadesah / ucyate: sädharmyävyatirekah 11 upäyabhütatvät / äkhyätrprämä12 nyäd eva 13 pratipattur 14 gavayavijnänam15 upapadyate / sa tu kausaläd
1 K., P. and D. omit na. 2 A. sädhamyemäträt 3 A. upakalpyeta 4 A. antareno 5 Dkha. pratipädayan 6 P. omits tad of tadantarbhäva. 7 8 A. °sädharmyalaksanärtho 9 K., P. and D.: eva 10 D. apeksete, s.m. upeksete 11 D. sädharmyävyatireke 12 D. äkhyätaprä0 13 A. omits eva. 14 A. pratipattir 15

5

10

15

20

K., P. and D. omit syän matam / gät (71.13-16).

apy anupapannam / kasmät / vitävitayor api tatprasan-

A. gavaye vijnänam

'*' (ihapi syat) sabdavat sadharmyopadanam antarenapy upamane 'pi pratipattih syat / / (K.23a, D.71-1) ^(kevalam) kevalam iti prasiddhasädharmyarahitam sabdamätram / / (K.23a, D.71-2) ' 3 ' (tasmäd eva) tasmäd eveti sabdavat sadharmyopadanam antarenäpy upamäne 'pi pratipattih syät // (K.23a, D.71-3)
(4

^(asya) upamänasya// (K.23a, D.71-2) ) sabdäntara- / / (K.23a, not found in D.)

72

YUKTIDIPIKA

5

10

15

20

durupapado 1 ' y a m artha iti krtva 2 prasiddhasadharmyam upadatte / tasmad äkhyätur gavayapratipädanärtham upäyabhütam sädharmyam upädadänasya 3 sabdäd anarthäntaram udbhavati 4 / athaivamjätiyakänäm api pramänäntaratvam isyate / tenätyalpam 5 idam ucyate catväri pramänäniti / kirn tarhi / pänivihäräksinikocaprabhrtinäm apy upasamkhyänam kartavyam 6 / kirn ca vaktrvisesapeksatvät / yatra hy arthavasät pratipattir utpadyate na 7 tatra pratipattä vaktrvisesam 8 apeksate drstärtho ' y a m adrstärtho 'yam iti tadyathänumäne / asti 9 copamäne vaktrvisesäpeksä / tasmän na sabdäd arthäntaram tat / avasyam caitad evam 10 vijiieyam / yo hi manyate prasiddhasädharmyäd eva tasya yä 11 pratipattir 12 yathäsvas tathä gavaya ity etasmäd api sampratipattih 13 syän na cärhati bhavitum mithyäjfiänatvät 14 / yat tu khalv idam ucyate yatah samäkhyäsambandhapratipattir iti 15 tad 1 6 upamänam ity etad 17 anupapannam / kasmät 18 / anavasthäprasahgät / yathä 19 bahusu nisannesu 20 ko 'tra devadatta ity ukte yo mukuti kundall vyüdhoraskas tämräyatäksa(cf.MBhäsya.I.259.20fF.) iti pratyäha tatas ca samäkhyasambandhapratipattir iti pramänäntaraprasanga 21 ity evam anavasthä pramänänäm syät / anistam caitat / evam hi 22 na 2 3 tävat parata upamänam pramänäntaram / yadä svayam eva gäm gavayam copalabhya vikalpayati yathäyam tathäyam iti tadä tasyärthasya pramänäntarenädhigatatvät^ 1 ) pramänam eva tan na bhavatiti / tasmät susthüktam(71.1) upamaitihyävacanam 24 äptopadesät siddher 25 iti / kirn cänyat / arthäpattisambhaväbhävacestänäm anumänasiddheh /
1 A. durapasado 2 K. and R: krtvät 3 A. upädadhänasya 4 A. na sabdäd arthäntaram bhavati 5 A. tenälpam (this is also possibly the original reading). 6 A. kartavyam syät 7 K., P. and D. omit na. 8 K., P. and D.: prativaktrvisesam D. s.m. pratipattih vaktrvisesam 9 P. omits asti. 10 K., P. andD.: eva 11 A. omits tasya yä. 12 A. gavayapratipattir iti 13 A. api tasya sampratipattih 14 D. °jnänatvät, s.m. °jnänatvam 15 A. omits iti. 16 A. tadvad 17 A. not clear 18 A. omits kasmät. 19 A. tadyathä 20 D. nisasyesu^), s.m. nisannesu 21 A. pramänäntaratva0 22 D. encircles hi 23 A. omits hi na. 24 P. ay am aithyävacanam 25

A. äptopadesasiddher

(x) (pramanantarena) pratyaksa- / / (K.23b i.n., not found in D.)

DVITIYAM AHNIKAM SK3d,4

73

avacanam ity anuvartate / taträrthäpattir 1 näma yaträrthayoh pürvam avyabhicäram upalabhya^1) pascäd anyatarasya darsanäc 2 chravanäd vänyatarasmin pratipattir bhavati / darsanäd yathä 3 gudam upalabhya mädhuryam indriyäntaravisayam pratipadyate / sravanäd yathä gudasabdam srutvä mädhuryam asabdakam^2) pratipadyata^ 3 ) iti / aparä khalv arthäpattih / yatra dharmayor avyabhicäram upalabhya tatpratidvandvinor api sähacaryakalpanä / sä tu dvividhä vyabhicärinl cävyabhicärinl ca 4 / tatra vyabhicärinT yathä sävayavam anityam ity ukte 'rthäd äpannam 5 niravayavam6 nityam iti / tac ca karmädisv adrstam 7 ity esänaikäntikatvät pramänam eva na bhavatiti / yä tv avinäbhäviny avyabhicärinl8 yathä kesarivarähayor upahvare 9 sannipätam upalabhyottarakälam kevalam kesarinam 10 varähavranänkitasanram prayäntam upalabhya 11 pratipadyate jito^4) varäha iti tad anumänam / katham / yasmät kesarivarähayor12 yau jayaparäjayau tayor avyabhicär! 13 sambandhah / tatra yadä kesarino jayam upalabhyävyabhicärinam itarasya 14 paräjayam pratipadyate kirn any at syäd rte 'numänät / adhigatobhayasambandhisamudäyasya hi pratipattuh pratyakslbhütänyatarasambandhino 15 yä sambandhyantarapratipattis tad anumänam / ittham cärthäpattir ato na tasmät prthag 16 bhavitum arhati 1 7 / sambhavo näma / dronah 18 prastha ity ukte 'rdhadronädinäm sannidhänam avasiyate / iyam 19 api sähacaryakalpanayärthäpattir eva / katham / yasmäd
1 A. taträrthäpatti 2 D. anyatarasyopalambhanät, s.m. anyatarasya darsanät 3 A. tadyathä 4 A. omits ca. 5 D. äpannam, s.m. äpatitam 6 A. niravayamvam 7 A. karmädistadrstam 8 A. omits avyabhicärinT. 9 A. kesaravarähayor upagahvare 10 P. kesarivarähayor upahvare instead of kesarinam 11 A. pratiyäntam upalabhyamänah 12 A. kaisarivarähayor 13 A. avyabhicäre 14 K., P. and D.: uttarasya 15 A. pratyakse bhütä0 16 A. omits prthag. 17 18 A. 19

5

10

15

20

A. arhati bhavitum omits dronah prastha ity ukte 'rdha-. A. ity ayam

(^(upalabhya) caksusa / / (K.23b, not found in D.) (2) (asabdakam) madhurasabdarahitam // (K.23b i.n., not found in D.) (3) (pratipadyata) gudasya mädhuryenävyabhicärät / kevalagudasabdasravanenäpi mädhuryam pratipadyate// (K.23b, D.74-1*) *D. reads kevalaguda0... pratipadyate before gudasya mädhuryenävyabhicärät. <4)(jito) simheneti / / (K.23b, D.75-1)

74

YUKTIDIPIKA

5

10

15

20

uktaparimane dravye dronasabdo vartate 1 na nyune nadhike 2 / tatra drona ity ukte yad atyantasahabhuväm tadavayavänäm anyasabdaväcyänäm 3 api sannidhänam tad arthäpattir iti 4 / sä 5 cänumänam ity uktam 6 / abhävo näma / tadyathä dhümasya bhäväd agnibhävah 7 pratiyate evam dhümäbhäväd agnyabhäva ity ayam 8 pratidvandvisähacaryakalpanayärthäpattir 9 abhihitah / tatra yadä vyabhicärasähacaryakalpanä tadä pramänäbhäva eva tadyathä [hy]10 ayogudängärädisu 11 dhümäbhävo nägnyabhävah / yatra tu kvacid ekäntah 12 syäd yathäkrtakatvän nitya iti tatränumänam / katham / sähacaryopapatteh 13 krtakatvänityatvavat 14 / anye tv abhävam anyathä varnayanti tadyathä gehe nästi caitra ity ukte bahir astlti sampratyayo bhavati / tatra gehäbhävo bahirbhävasampratipattihetur arthäpattir 15 eva pratidvandvisähacaryakalpanayä / katham / yathaiva hi divä na bhunkte devadatta ity 16 aträbhojanapratiyogino 17 meduratvasyopalambhäd diväpratiyogini käle bhujir 18 avaslyata evam ihäpi gehäbhäväbhidhänasämarthyät tatpratiyogini viparyayah kalpyate / anyathä tu yady abhäva eväbhipretah syän nästi caitra eveti brüyät / arthäpattis cänumänam / cestä närnäbhipräyasücakah kascid evodaratädanänjalikaranädih 19 sariravyäpärah / sa hi bubhuksädiny apratlyamänäny api 20 pratipädayatlti 21 pramänam ity 22 ucyate / sa cänumänam eva / kasmät 23 / yasmäd bhojanecchädisahacaro 24 hi vyäpäro 'nusthlyamäno yadi sahacärinam gamayati 25 tadä 2 6 nänumänät prthag iti sakyam pratijfiätum / äha: pratibhä tarhi pramänäntaram bhavisyati / ucyate: key am pratibhä näma /
1 A. 'nuvartate 2 A. nyünädhike 3 A. asabdaväcyänäm 4 A. eva 5 A. sa 6 A. and Dkha.: uktaprakäram 7 K., P. and D.: agner bhävah 8 A. aya 9

Dkha. °kalpanä arthäpattir A. omits -k alp an ay arthäpattir abhihitah / tatra yadä vyabhicärasähacarya-. 10 D. encircles hy. 11 A. ayogudänkärädisu 12 A. aikäntas 13 A. sähacaryäpapatteh 14 A. krtakatvän nityatvavat 15 A. ity ayam apy arthäntaräpattir ***A. devadattah pina ity 17 K., P. and D.: atra bhojanapratiyogino 18 A. käle rätrau bhujir 19 A. evodaratänunänjalikaranädih Dkha. °karanädibhir 20 K., P. and D.: api pratiyamänäni 21 A. omits pratipädayatiti. 22 A. omits ity. 23 A. katham (this is also possibly the original reading). 24 A. omits di of bhojanecchädisahacaro. 25 A. 'nusthiyamäno bhavati sahacärinam ca yadi gamayati 26 A. katham tad

DVITIYAM AHNIKAM SK3d,4

75

äha: yo ' y a m anädau samsäre devamanusyatirascäm 1 abhinne 'rthe bähye stryädau pratyaye pürväbhyäsaväsanäpeksah kunapakäminibhaksyädyäkärabhedabhinnapratyaya itikartavyatängam utpadyate sä hi pratibhä / tathä coktam— yathäbhyäsam hi väkyebhyo vinäpy arthena jäyate / svapratyayänukärena pratipattir anekadhä / / (PS.5.47; PSV.:Peking.Ce.82b6,168b3; Derge.Ce.77a5) yena hi yo 'rtho 'bhyastah sukhäditvena tasya vinäpi tenärthena sabdamäträt pratipattir utpadyate / tadyathä vyäghro 'tra prativasatity ukte vinäpi bähyenärthenäbhyäsavasäd eva svedavepathuprabhrtayo bhavanti / tasmät pratibhaiva devamanusyatirascäm 2 itikartavyatängatvät pramänam iti / äha ca 3 — pramänatvena täm 4 lokah sarvah samanugacchati / vyavahäräh pravartante tirascäm api tadvasät / / (cf.VP.II.147) ucyate: pratibhäyä drstädivyatirekena rüpäntaränupapatteh / avacanam ity anuvartate / yadi pürväbhyäsaväsanäpeksah pratyayah pratibhety 5 upagamyate 6 tena tarhy asau pratyaksam anumänam äptavacanam 7 <v>ety8 et ad äpannam / kasmät / yato na hi drstädivyatirekena 9 pratyayarüpam kadäcid apy 10 upalabhämahe / tasmän na 11 tebhyo 'rthäntaram pratibhä / ärsapratyayasambhaväd ayuktam iti cet / syäd etat 1 2 / asty ärso 13 hi 14 drstädivyatirekena sarvapadärthesu sämsiddhikah pratyayah sa prätibho 15 bhavisyatiti / etac cäpy ayuktam / kasmät / uktatvät / uktam(68.12) etat siddharüpam bhagavatah paramarser jnänam / ato na pramänäpeksam iti 1 6 / yoginäm iti cen na anabhyupagamät / na hi yoginäm apramänapürvakam jnänam iti yathä tathä vaksyämah / sa laukika iti cen na aniscitatvät 1 7 / syäd etat / asti laukikah pratyayo drstädivyatirekena 18 / tadyathä santamase vrajato dräg iti vijnänam 19 utpadyate ?sti me pratighäti 20 dravyam purastäd
1 K., P. and D. omit devamanusyatirascäm ... bhavanti / tasmät pratibhaiva(75.1-11). 2 A. davamanusya0 3 K., P. and D. omit ca. 4 A. täml 5 D. pratibhocyate, s.m. pratibhety 6 K., P., and D.: abhyupagamyate 7 D. pratyaksam äptavacanam anumänam, s.m. pratyaksam anumänam äptavacanam 8 All the Mss read cety. 9 A. and Dkha.: ° vyatiriktam 10 A. omits apy. n D. ne(?), s.m. te 12 A. syän matam 13 K., P. and D.: ärse 14 K., P. and D. omit hi. 15

5

10

15

20

25

A. pratibhä A. pramänäpeksäni bhavanti 17 A. niscitatvät 18 A. drstädivyatirekena tu 19 D. jnänam, s.m. vijnänam °Dkha. pratighätäd

76

YUKTIDIPIKA

5

10

urdhvam avasthitam iti / tac ca naivam / kasmat / aniscitatvat / na hi tatra niscaya utpadyate idam tad dravyam asti purato vä vyaktam astiti / na cäniscitam pramänajnänam isyate / kirn cänyat / anavasthäprasangät / yadi caivamjätlyako 'pi pratyayah pramänam 1 abhyupagamyate tenänavasthä präpnoti / kirn käranam / anavasthänäd 2 dhi 3 vikärasya 4 <kämakrodhalobhabhayavisädädidvärako>5 vikalpah samyan mithyä vä yasmäd aneka utpadyate tasmän na laukikah pratyayah pratibhä / yat tu khalv idam ucyate(75.8) arthäbhyäsaväsanäpeksäsatsv 6 api vyäghrädisu pratipattir utpadyata iti / satyam etat / sä tu mithyäjfiänatvät pramänatvena na parigrhyata ity ayam adosah / tasmät siddham drstädivyatirekena 7 rüpäntaränupapatteh pratibhäyäh prthaganabhidhänam 8 / tatas ca "sarvapramänasiddhatvät trividham pramänam istam"(SK4b'c) iti 9 sthitam etat INI' äha: astv evam etat / laksanäna<vasthänät> 10 tadapratipattih tasmät t a dab hid liän am / anavasthitam hi drstädlnäm laksanam 11 drstivaicitryät 1 2 / "indriyärthasannikarsotpannam jiiänam avyapadesyam avyabhicäri vyavasäyätmakam pratyaksam"(NS.1.1.4) iti kecit / tathä "ätmendriyamano'rthasannikarsäd yan nispadyate tad anyat 13 "(VS.3.1.13) ity eke / u satsamprayoge 14 purusasyendriyänäm buddhijanma tat 1 5 pratyaksam"(MS.1.1.4) ity apare / a sroträdivrttih"(cf.5.11) iti värsaganäh / "kalpanäpodham" (cf.PS.1.3) ity anye / ittham anavasthitam laksanam iti drstädTnäm apratipattih / tasmäl laksanam abhidhämyam / ucyate: PRATIVISAYÄDHYAVASÄYO DRSTAM / (SK5ab') visinvantiti 16 visayäh sabdädayah 17 / athavä visiyanta upalabhyanta ity arthah / te ca dvividhäh / visistä avisistäs ca / visistäh 18 prthivyädilaksanä asmadädi1 D. 'pi pramanam, s.m. 'pi pratyayah pramänam 2 A. anavasthitatväd 3 A. omits dhi. 4 K., P. and D.: karanasya 5 K., P. and D. omit -ädi-, A. omits -lobha-, 6

15

20

25

A. abhyäsaväsanäpeksäsatsv D. °väsanäpeksä satsv A. drstävyatirekena 8 A. prthagabhidhänam 9 A. iti cestam 10 All the Mss read laksanänabhidhänät. 11 A. omits laksanam. 12 A. drstavaicitryät 13 A. adhyaksam 14 A. tatsamyoge 15 A. tah 16 D. prativisunvanti iti, s.m. visinvanti iti 17 A. omits sabdädayah / athavä visiyanta. 18 A. visistäs ca

DVITIYAM AHNIKAM SK5

77

gamyäh / avisistäs ca tanmätralaksanä yoginäm ürdhvasrotasäm 1 ca gamyäh / vaksyati caitad uparistät— buddhlndriyäni tesäm pafica visesävisesavisayäni2/ (SK34ab) "adhyavasäyo buddhih" (SK23a) iti ca vaksyati / visayam visayam prati vartata iti prativisayam / kirn tat / indriyam / tasmin yo 'dhyavasäyah sa prativisayädhyavasäyah / upättavisayänäm indriyänäm vrttyupanipäti sattvodrekäd 3 arajastamasam 4 yat prakäsarüpam [yad5 drstam iti yävat] tad drstam / pratyaksam ity arthah / etat 6 pramänam / anena yas cetanäsakter 7 anugrahas tat phalam / prameyäh sabdädayah / evam uttaraträpi pramänaphalabhävo drastavyah / äha: kirn punar idam pramänät phalam arthäntaram ähosvid anarthäntaram / <ucyate(?):> <ka>tham tävad 8 bhavitum arhati / anarthäntaram ity äha / kasmät / adhigamarüpatvät / adhigamarüpam hi jiiänam, tasyotpattyaivädhigato 'rtha iti kutah phalabheda iti / ucyate: karanabhäva 9 idänim katharn syät / äha: 10 karanabhävas 11 tu prasiddhivasät 12 / visayanirbhäsä^1) hi jfiänasyotpattih / adhigamarüpäpi 13 loke savyäpäreva <pratltir iti(?)> 14 kalpanayä karanabhävo 15 'bhyupagamyate na paramärthatah / ^2) phalasyärthäntarabhävah 16 adhikaranabhedät / bud1 2

5

10

15

20

A. ürdhvaretasäm P. pancavisesäh visesavisayäni Dkha. buddhindriyäni panca ca kati varnäh santo visesävisayäni (this reading of Dkha. is deleted with a wavy line across the word). 3 A. sattvotsedhäd P. not clear. 4 K., P. and D.: arajastamaskam 5 A. tad 6 A. tat 7 P. cetanäsaktair 8 A. kakathams(l) tävad K., P. and D. omit <ka>tham tävad ... kutah phalabheda iti(77.1315). We follow Pandeya. 9 K., P. and D.: karanabhäva 10 K. and P. omit äha. D. adds äha in the right margin. 11 K., P. and D.: karanabhävas 12 D. prasiddhivasät, s.m. prasiddhavadhät 13 A. adhigamarupä hi 14 K., P. and D.: pratiteti A. pratiti 15 D. karanabhävo, s.m. karanabhävo 16 K., P. and D.: °ntarbhävah

(x) (visesanirbhasa) visayakarataiva pramanatvam / karanatvam vastutah phalasvabhavety arthah / / (K.25b, D.80-1) ^ (ucyate) ayam äsayah / visayäkäram vä yad idam jnänam bhavadbhir ucyate tat sukhaduhkhamohabhedena vartata <ity asmäkam(?)>* tävat siddhäntah / atas ca sukhädisvabhävatväd yogyatvena jadatvam, tatra pramänarüpatayävasthite viruddham cidrüpatvam iti tadvyatiriktam cetanänugrahah phalam itikatham pramänaphalayor abhedah syät / / (K.25b, D.81-1) *K. and D.: iti bhavatäm

78

YUKTIDIPIKA

5

dhyasrayam hi pramänam adhyavasayakhyam1 purusasrayam 2 phalam anugrahalaksanam / na ca bhinnädhikaranayor ekatvam arhati bhavitum / yat tüktam (77.14) adhigamarüpatväj jnänam eva phalam iti tad anupapannam / kasmät / asiddhatvät / yathaiva hi ghatädayo 'rthä jnänam 3 antarena na tadrüpä nätadrüpä 4 iti na 5 sakyam pratipattum evam jnänam api purusapratyayam 6 antarena na visayarüpam nävisayarüpam / tathä ca sästram— tasmät 7 tatsamyogäd 8 acetanam cetanävad 9 iva Ungarn / (SK20ab) iti vaksyati 10 / atah purusapratyayam 11 antarena jnänam adhigamarüpam iti sämkhyam praty asiddham 12 et at / ubhayapaksaprasiddhena ca vyavahärah / purusäbhäväd ayuktam iti cen na uttaratra pratipädanät / "sanghätaparärthatvät"(SK17a) ity atra purusästitvam pratipädayisyämah / tasmät siddham adhyavasäyapramänavädinah 13 pramänät phalam arthäntaram iti / äha: yadi tarhy 14 adhyavasäyah pramänam katham laukikah prayogo 'rthavän bhavati pratyaksam vastv 15 iti / ucyate: visaye pratyaksasabdah tatpramitatvät tatkäranatväc ca 1 6 / yathä prasthapramito vrihiräsih prasthasabdaväcyo bhavati / evam pratyaksapramito 'rthah pratyaksasabdaväcyah 17 syät / äha: n a 1 8 anyaträpi tatprasangät / yadi pratyaksapramitatväd visaye pratyaksasabdas tena tarhy anumänapramito 'rtho 19 'numänamiti syät / sabdapramito 'rthah sabda iti / na cägnisvargädayah20 pramänasabdaväcyä bhavanti / tasmäd visamam etat / etena tatkäranabhävah pratyuktah / yo 'pi hi manyate pratyaksopadesas 21 tatkäranesv apratisedhya iti visaye22 pratyaksasabdas tasyäpy anumänaprasango ?säv avasthita iti 2 3 / ucyate 24 : käranatulyatvät 2 5 tu sabdatulyatvam 2 6 / evam tarhy
1 A. adhyavasäyasädhyam 2 Dkha. purusasrayam hi 3 A. ghatädyarthajnänarn 4 D. na tadrüpä nätadrüpä, s.m. tadrüpena tadrüpä 5 A. omits na. 6 A. purusasya pratyayam 7 K., P. and D. omit tasmät. 8 A. taratsamyogäd(l) 9 A. cetanäd 10 A. vacanät 11 Dkha. purusasya pratyayam 12 A. sädhyapratyaksasiddham Dkha. {sämkhyam) prati siddham 13 K., P. and D.: °'väcinah A. adhyavasäyah pramänavädinah We follow 14 K., P. andD.: hy 15 A. idam vastu 16 K., P. and D. omit tatkäranatväc ca. 17 D. pratyaksaväcyah, s.m. pratyaksasabdaväcyah 18 A. omits na. 19 A. 'tha 'rtho 20 A. cägnisvargädayo 'rthah 21 22 A. 23

10

15

20

Pandeya.

A. pratyaksavyapadesas ato visaye A. anumänaprasango (')sü eveti 24 A. omits ucyate. 25 K., P. and D.: käranatulyatvam D. s.m. käranatulyatvät 26 K., P. and D. omit tu sabdatulyatvam.

DVITIYAM AHNIKAM SK5

79

aksam aksam prati vartata iti pratyaksam ucyate / dvayam cäksam prati vartate visayo 'dhyavasäyas ca / visayo 'nugrähakatvenänugrähyatvenetarah 1 / tenobhayor api tulyam nimittam iti krtvä tulyasabdaväcyatä bhavisyati / äha: itaratra katham / ucyate: tadabhäväd itaraträpravrttih / pramänäntare tu nästi sämänyam nimittam / katham / anumiyate 'nenety anumänam / na cägnyädibhih 2 kascid anumiyata ity atas tulyasabdaväcyatä na bhavati / äha: adhyavasäyagrahanam kimartham / ucyate: atiprasanganivrttyartham / prativisayam drstam itiyaty ucyamäne yävat kimcit prativisayam 3 vartate 'nugrähakatvenopaghätakatvena vä tat sarvam drstam ity etad äpadyate / adhyavasäyagrahane punah kriyamäne na doso bhavati 4 / äha: na 5 pramänädhikärät / nädhyavasäyasabdasya pray oj an am / kutah / pramänädhikäro ? y a m / n a cädhyavasäyäd rte yat kimcid visayam prati vartate 6 tena kimcit 7 pramiyate 8 / tena 9 vayam sämarthyäd adhyavasäyam eväbhisambhantsyämah 10 / tadyathädhyayanädhikäre brähmanä änlyantäm ity ukte ya evädhiyante ta eväniyante 11 / ucyate: karanäntaränäm 12 t u sandehanivrttyartham / evam tarhi sroträdinäm 13 anyatamam antahkaranam cety etad 14 dväradväribhävena catustayam visayam prati vartate / tasmäd adhyavasäyagrahanam kriyate sandeho mä bhüd iti / äha: astv atra sandehah / naikena kenacit kascid15 visaya 16 upädiyate 1 7 / 18 tena vayam sarvesäm pratyaksatvam pratipatsyämahe / ucyate: sarväbhyupagame hi s ä s t r a h ä n i h 1 9 / yadi punah sarvesäm eva pramänatvam abhyupagamyate tena yac chästram "ekam eva darsanam khyätir eva darsanam" (cf.YBh. on YS. 1.4) iti tad dhiyate / vaksyati cäcäryah 20 a ete pradipakalpäh"(SK36a), sarvam praty upabhogarn yasmät purusasya sädhayati buddhih / (SK37ab)
1 A. 2 D. 3 A. 4 A. 5

5

10

15

20

25

° anugrähyakatvene0 cäjnädibhih visayam prati bhati K., P. and D. omit na. ^A. visayam pratipadyate 7 D. kimcit, s.m. kimcit ca 8 P. pratiyate »A.te 10 D.: eväbhisambhatsyämah A. cäbhisamdhäsyämah 1 A. tesäm evänyayanam bhavati na brähmanam änamya instead of ya evädhiyante ta eväniyante 12 A. karanäntare Dkha. karanäntaram 13 D. süträdinäm 14 A. caitad 15 A. and Dkha.: na kascid instead of naikena kenacit kascid 16 A. visesa 17 A. upädhiyate 18 A. and Dkha.: te 19 K., P. and D.: sästrahänih pramänam A. cäyam äcäryah

80

YUKTIDIPIKA

5

10

15

20

iti tad virudhyate / tasmad adhyavasayagrahanam kartavyam sandeho ma bhud iti / äha: "sandehamätram 1 etad bhavati / sarvasandehesu cedam 2 upatisthate" (MBhäsya.L42.11ff., I.119.23fF. et passim) "vyäkhyänato visesapratipattir na 3 hi sandehäd alaksanam"(MBhäsya.I.6.26 et passim) iti 4 / taträdhyavasäyo drstam iti vyäkhyäsyämah 5 / ucyate 6 : muktasamsayam cendriyavrttipratipattih 7 / syäd etad yady atra sandehah syät / naiva tv atra 8 sandehah präptah 9 / kim tarhi / sroträdivrtter eva grahanam / äha: kim punah käranam 10 sroträdivrtter 11 evätra 12 grahanam präpnoti näntahkaranasyaiva pratyaksatvam / ucyate: tatra ca 13 mukhyä sroträdivrttih / kasmät / säksäd 14 visayagrahanasämarthyät / näntahkaranam taddvärena pratipatteh / gaunamukhyayos ca 15 mukhye sampratipattih 16 / tadyathä "gaur anubandhyo 'jo 'gnlsomiya iti 1 7 na bählko 'nubadhyate18"(cf.MBhäsya.I.71.18ff. et passim) / äha: yadiyam 19 sroträdivrttir eva20 pratyaksam ity 21 abhyupeyate 22 ka evam sati dosah syät 2 3 / ucyate: rägädivisayam 24 yad vijiiänamlingalingipürvakam 25 yoginäm 26 ca dhyänabhümikäsu 27 viharatäm prätibham 28 yad vijnänam utpadyate tad 2 9 upasamkhyeyam 30 syät / na 31 hi sukhädayah sroträdivrttigrähyäh yoginäm cätlnd1 A. na sandehamätram 2 K., P. and D.: caitad 3 A. omits na hy sandehäd alaksanam. 4 K., P. and D. omit iti. 5 A. evam vyäkhyämah 6 A. omits ucyate. 7 K., P. and D.: °pratipatteh 8 A. naiva vä punar atra 9 A. präpnoti 10 A. karanarn 11 A. yena nimittävisese 'pi sroträdivrtter (this is also possibly the original reading). 12 A. eva 13 A. taträpi 14 A. paksäd 15 A. omits ca. 16 Dkha. sampratyayah 17 A. anübandhyeti D. anübandhyä, ajo 'gni°, s.m. anübandhyah, ajo 'gni° 18 K., P. and D.: bähiko nänubadhyeta 19 A. yadi punar iyam 20 A. eva hi 21 A. omits iti. 22 A. abhyupagamyate 23 A. omits syät. (this is also possibly the original reading). 24 D. rägä0, s.m. sukhä0 D. reads pätha above the corrected sukhä in the right margin. 25 A. Ungarn / lingipürvakam 26 A. tathä yoginäm 27 A. °bhümisu (this is also possibly the original reading). 28 A. inserts anumänägamätitam before prätibham. 29 A. tatra 30 A. pramänäntaratvam upasarnkhyätam 31

K., P. andD.: kuto na

DVITIYAM AHNIKAM SK5

81

riyam jnänam iti / yathänyäsam tu kriyamäne te 'pi visayäh / tesäm 1 yo 'dhyavasäyas tasya pratyaksatvam kena väryate / äha: prativisayagrahanam tarhi 2 kimartham / ucyate: prativisayagrahanam asadvyudäsärtham / adhyavasäyo drstam itiyaty 3 ucyamäne mrgatrsnikälätacakragandharvanagarädisu yo 4 'dhyavasäyas tad drstam iti syät / prativisayagrahanät tu 5 tesäm vyudäsah krto bhavati / äha 6 : yady evam visayädhyavasäya7 ity evocyatäm 8 / kirn pratigrahanena / ucyate: pratigrahanam sannikarsärtham / visayädhyavasäyo drstam itiyaty ucyamäne visayamätre sampratyayah syät / pratigra<hane> punah kriyamäne pratir äbhimukhye vartate 9 (see NM.partl.p.100.17) / tena sannikrstendriyavrttyupanipäti yo 'dhyavasäyas tad drstam ity etal labhyate 10 / äha: kasya punar atlndriyasannikarse 11 pratyaksatvam präpnoti 1 2 / ucyate 13 : anumänasya / kasmät / tad dhi lingadarsanäd asannikrste visa14 ye bhavati / äha: anumänasyäprasangah sämänyavihitasya visesavihitena bädhanät (cf.MBhäsya.I.383.24fF. et passim) / sämäny<e>15 hi 16 visayamätre 17 'dhyavasäyasya pratyaksatvam vidhäya visese18 lingalirigipürvake 'numänam sästi / sämänyavihitam ca 19 visesavihitena bädhyate (cf.MBhäsya.I.383.25f. et passim) yathä "dadhi brähmanebhyo 20 diyatäm takram kaundinyäya" (cf.MBhäsya. 1.115.2-3 et passim) iti 2 1 / ucyate: smrtes tarhi pratyaksatvam präpnoti 22 / taträyam 2 3 apavädo näbhinivisata iti / <äha:> na smrteh pramänädhikärät / pramänädhikäro 'yarn / na ca smrtyä kimcit pramiyate smrteh pramite 'rthe prädurbhävät 24 /
1 A. tesu 2 A. omits tarhi. 3 A. ity 4 A. ° ädisv apt yo 5 A. omits tu. 6 K., P. and D. omit äha. 7 A. omits visayädhyavasäya 8

5

10

15

20

25

pratigrahanam sannikarsärtham(81.7-9). P. eva cocyatäm 9 K., P. and D.: pratinä tv äbhimukhyam dyotyate instead0 of pratigra<hane> punah kriyamäne pratir äbhimukhye vartate A. pratigrahe punah kriya We follow Pandeya. 10 K., P. and D.: ity upalabhyate A. ity etal labya bhavati Dkha. (ity) etal labhyate 11 A. punah kasya asatmdriyasannikarse 12 A. pratyaksatvam jfiatvam präpnoti 13 A. inserts yadartho yatnah kriyata iti before ucyate. 14 A. 'gnyädau 15 K., P. and D.: sämänyam A. syamänye We follow Pandeya. 16 K., P. and D. omit hi. 17 A. visesamätre 18 A. viseso 19 A. omits ca. 20 A. tadyathä brähmanebhyo dadhi 21 D. omits iti. 22 A. omits präpnoti ,.. astu tarhindriyänäm prati-(81.22-82.20). 23 Dkha. yaträyam 24 D. smrteh pramityarthe prädurbhävät, s.m. smrtipramite 'rthaprädhurbhävät

82

YUKTIDIPIKA

5

10

15

20

25

ucyate: samsayasya tarhi prapnoti / <äha:> na samsayasya adhyavasäyagrahanät 1 / adhyavasäyo hi drs2 tam ity ucyate / na ca samsayo 'dhyavasäyo 'niscitatvät / ucyate: indriyäntaräkütavisaye tu prasangah 3 / evam tarhmdriyärthasannikrstendriyavrttyupanipätiti doso na bhavati 4 / äha: rägädyupasamkhyänam / yadi sannikrstendriyavrttyupanipäti yo 'dhyavasäyas tad drstam ity abhyupeyate tena rägädivisayam vijnänam atmdriyatvät pratyaksam na präpnoti / tasyopasamkhyänam kartavyam 5 / ucyate: na 6 tarhidam pratigrahanam indriyavisesanam visayam visayam prati yo vartate tasmin yo 'dhyavasäyas tad drstam iti / kirn tarhi / adhyavasäyavisesanam visayam visayam prati yo 'dhyavasäya iti / äha: adhyavasäyavisesanam iti cet sabdä^y upasamkhyänam / sabdädlnäm eva tena pratyaksatvam na 7 präpnoti / tesäm upasamkhyänam kartavyam präpnoti / kirn käranam / antahkaranasya taih sannikarsänupapat t e h / pratigrahanam sannikarsärtham iti pürvam atisrstam(81.9) bhavatä / tac cedänim antahkaranavisesanam / na cäntahkaranasya sabdädibhih sannikarsa upapadyate sroträdivaiyarthyaprasarigäd 8 dväridvärabhävasyäpaghätaprasangäc ca / tasmät sudüram api gatvä pratigrahanam pratyäkhyänän na mucyate rägädyupasamkhyänäd veti / ucyate: astu tarhindriyänäm prativisayagrahanam visesanam / yat tüktam(82.6) rägädlnäm upasamkhyänam kartavyam iti tatra 9 brümah: ekasesanirdesät 10 (cf .MBhäsya.I.88.25 et passim) siddham / evam tarhi prativisayädhyavasäyas ca prativisayädhyavasäyas ca 11 prativisayädhyavasäya iti sarüpänäm ekasesah(cf.Pän.l.2.64) karisyate / tatraikena bahirarigasyendriyasya parigrahah 1 2 / dvitlyenäntarangasya 13 prätibhasyeti 14 rägädivisayam yoginäm ca yad vijnänam tat sangrhitam 15 bhavatlti vyäkhyätam pratyaksam / äha: anumänam idänim vaktavyam 16 / ucyate: TRIVIDHAM ANUMÄNAM ÄKHYÄTAM17 / (SK5b')
1 Dkha. samsaye 'dhyavasaya? 2 D. drsyam, s.m. drstam 3

Dkha. ° akute tu visayaprasangah D. ° akut avis aye tu prasangah, s.m. ° äküte tu visayaprasangah 4 D. doso na bhavati, s.m. nädoso bhavati 5 D. adds präpnoti after kartavyam in the right margin. 6 Dkha. nanu 7 K., P. and D. omit na.0 8 D. süträdivaiyarthya , s.m. sroträdivaiyarthya0 9 A. ity atra 10 A. ekadesanirdesät 11 A. omits prativisayädhyavasäyas ca. D. adds this phrase in the top margin. 12 A. bahirangasya indriyakasya pratyaksasya parigrahah Dkha. ekenendriyasya bahirang parigrahah 13 A. dvitiyantarangasya 14 D. repeats pratibhasya and deletes the second pratibhasya. 15 A. and Dkha.: tat sarvam sangrhitam (this is also possibly the original reading). 16 A. vaktavyam iti 17 A. anumäkhyätam instead of anumänam äkhyätam

DVITIYAM AHNIKAM SK5

83

anumänam triprakäram äcäryair äkhyätam1 / pürvavac chesavat sämänyatodrstam^1) ca 2 / tatra pürvam iti käranam ucyate 3 / yasya hi yat käranam sa loke tatpürvaka 4 ity ucyate yathä 5 tantupürvakah pato devadattapürvako 6 yajnadatta iti / pürvam asyästlti pürvavat / sesa iti vikäranäma / sisyata iti krtvä / tathä coktam 7 "na seso <'gne>8 'nyajätam 9 <asti"(RV.7.4.7c; cf.Nir.3.2) iti> 10 / näpatyam anyena jätam 1 1 sambhavatity arthah / seso 'syästlti sesavat / tatra pürvavad yadä käranam 12 abhyuditam drstvä bhavisyattvam käryasya pratipadyate yathä meghodaye bhavitavya<tä>13 vrsteh / äha: naitad asty udäharanam anekäntät 1 4 / na hi meghodayo 'vasyam vrsteh käranam bhavati 15 väyvädinimittapratibandhasambhavät 16 / ucyate: yadi 17 tarhi käranasaktim sahakärisaktyantaränugrhltäm apratiyoginim drstvä käryasya vyaktim 18 pratipadyate 19 tadyathä 20 yadä <cakrodaka2 A. vä 3 A. käranaparyäyo 'yam instead of käranam ucyate 4 A. yasya hi loke yat käranam sa tatpürvaka instead of yasya 5 A. tadyathä 6 A. devadattakapürvako 7 K., P. and D. omit tatha coktam. 8 K., P. and D.: 'gre A. 'gneh 9 A. 'nyasya jätam 10 K., P., D. and A.: ity asti Dkha. asti n Dkha. omits jätam. 12 K., P. and D.: käranatvam 13 14 A. anaikäntät 15 A. na hi meghodayam vrster avasyam 16 A. väyvädinimittapratibandhät 17 K., P. and D.: yadä 18 P. vyaktih 19 20

5

10

*K., P. and D.: vyäkhyätam

hi yat käranam sa loke tatpürvaka

K. P. and D.: bhavitavyam A. tadyathä meghodayam drstvä bhavisyattvam for yathä meghodaye bhavitavya<tä> We follow Chakravarti. käranam bhavati

A. pratipadyante K., P. and D. omit tadyathä ... käranasadbhävam pratipadyate (83.12—84.3).

(^(pürvavac chesavat samanyatodrstam) kecit tu purvavad iti kevalanvayy anumänam, sesavad iti kevalavyatireki, sämänyatodistam ity anvayavyatireklti / katham / pürvasabdenänvaya upadisyate prägadhyavasiyamänatvät / na hi yävan nägnibhäve dhümabhävo 'dhyavaslyate tävad agnyabhäve dhümabhävo drsto 'py <adhy>avasätum1 sakyate vidhyadhyavasäyapürvakatvät / nisedhädhyavasäyasya pürvam eva vidyate 'nvaya evästi yasyänumänasya tat pürvavat / seso vyatirekah / sa eva yasyästi tac chesavat / bädhakopakrtasya kevalavyatirekasya gamakatvam na vyatirekamätrasyeti pradarsanärtham sesavad ity uktam na vyatirekavad iti / anvayavyatirekayoh sädhanähgayoh sämänyena yad anumänam 2 drstam tatsämänyatodistam / etad uktam bhavati: yathänvayenaitad anumänam up<a>krtam tathä vyatirekenäpy anvayavyatirek<i>vad3 itarayor api gamakatvam astlti nyäyabhüsane / gäkyäh khalu kevalänvayinah kevalavyatirekinas ca gamakatvam nästlty ähuh / (see NBhüs.p.190.16-26) apare tu pürvavadädipadäni laksanärthatvena varnayanti kila / pürvam upädänät paksah pürvasabdenocyate / so <*stv eva>4 yasya tat pürvavat paksavyäpakam Ungarn ucyate / sesa iti sapaksa uktät paksäc chisyamänatväd atah sesavad iti / sapaksavad iti uktam bhavati / sämänyatodistam iti vipaksa ity adhyähäryam / sämänyen<ä>drstam5 vipaksasabdäbhidheye sarvaträdrstam ity arthah //(K.28a, D.88-1) (see NBhüs.p.191.21-26) 1 K. and D.: avasätum 2 K. and D.: upäkrtam 3 K. and D.: anvayavyatirekavad 4 K. and D.: fsya 'vayavasya 5 K. and D.: sämänyena drstam

84

YUKTIDIPIKA

5

10

15

20

dandadisadhanasampannena) 1 vyaparavata kumbhakarenadhisthitam mrdam upalabhya ghatasya tadä pürvavat / sesavat yadä käryani<r>vrttim2 drstvä käranasadbhävam pratipadyate tadyathä kumärakam drstvä dvayasamäpattim / äha: naitad apy 3 asty udäharanam anekäntät 4 / na hi dvayasamäpattipürvaka eva pränabhrtäm 5 prädurbhävo dronädinäm 6 anyathotpattivisesasravanät / ucyate: yadä tarhi prabhänuranjitam antariksam drstvä candrärkayor udayam pratipadyate tadä sesavat / äha: 7 etad 8 api nästy udäharanam anekäntät 9 / na hi prabhänurägo 'ntarikse 10 candrärkanimitta eva bhavati / kirn tarhi / digdähädinimitto 11 'pi / ucyate: yadä tarhi 12 nadipüram drstvä 13 vrstim pratipadyate 14 tadä sesavat / äha: 15 etad api nästy udäharanam anekäntät 1 6 / nadipürasya hi nimittam anekavidham bhavatiti 17 himavilayanasetubhangagajakridädi / tasmäd ayuktam etat / ucyate: yadä tarhi parnam drstvä sälükam pratipadyate 'rikuram vä drstvä bijam iti tadä sesavat / athavä punar astu pürv<am>18 evodäharanam / yat tüktam(83.9) anekäntäd 19 ity atra brümah: vltävltasämarthyät / vitävitäbhyäm hetubhütäbhyäm abhipretärthasiddhir iti vaksyämah / prasahgidharmäntaranivrttirnukhena cävitaprayogah 20 / tatra yadä prasanginäm himavilayanädinäm 21 desakälalingaih pratisedhah kriyate tadä muktasarnsayarn pratipattir 22 bhavati / desatas tävat tadyathä 2 3 daksinäpathe nästi himavilayanasambhavah 24 / kälato yathä 25 prävrtkäle 26 / lingato Jpi yasmän mudga1 A. candälaudidandädisädhanasampannena 2 A. käryanivrttim. We follow Pandeya. 3 A. omits apy. 4 A. anaikäntät 5 A. p ram an ab hr tarn 6 A. dronädinäm hy 7 KM P. and D. omit äha. 8 9 A. anaikäntät 10 A. 'tariksasya 11 A. tarhy utpätädinimitto (this is also possibly 12 K., P. andD.: tu 13 A. navapravrddhajaläm nadirn drstvä 14 A. bhütatvam varsasya pratipadyate 15 K., P. and D. omit äha. 16 A. anaikäntät 17 D. bhavati, s.m. bhavatiti 18 All the Mss read pürvakam. 19 A. anaikäntät 20 A. °prasangah 21 A. himavilayädinäm 22 A. muktasamsayapratipattir 23 P. yathä 24 A. himasambhavah 25 A. omits kälato yathä. 26

D. etad, s.m. tat

the original reading).

A. prävrtkäle ca

DVITIYAM AHNIKAM SK5

85

gavedhukasyämäkakästhatrnamütrasakrtprabhrtinäm 1 anupalambhas 2 tathosmakalusatvädinäm 3 upalambhah / tasmät parisesato meghyä 4 eväpa iti / tasmän nänekäntah 5 / evam krtvä pürväny apy 6 udäharanäny upapannäni bhavanti desädivicärasämarthyät 7 / sämänyatodrstam näma 8 yatraikadärthay<o>r9 avyabhicäram upalabhya desäntare käläntare ca tajjätiyayor avyabhicäram pratipadyate tadyathä kvacid dhümägnisambandham drstvä kvacid dhümäntarenägnyantarasyästitvam pratipadyate / äha: naitad asty udäharanam avisesaprasangät / sarvatraiva hy 10 anumäne kvacid arthayor avyabhicäram 11 upalabhyänyatra tajjätiyayor arthayor avyabhicäram pratipadyate tadyathä kvacit sädhanavato 12 mrtpindäd ghatanispattim upalabhyänyatra sädhanavatah pindäntaräd ghatäntaranispattim pratipadyate / tathaikatra 13 nadipüräd vrstim upalabhyänyatra nadipüräd 14 vrstyantaram avaslyate / tathä ca sati trayänäm avisesaprasangah / ucyate: yadä tarhi 15 sahabhuväm ekasya visistagunam 16 upalabhya sesä17 näm api tadvattvam 18 anumiyate 19 tadä sämänyatodrstam tadyathä vrksäd ekasya phalasya 20 päkam upalabhya sesänäm phalänäm vrksäntaränäm 21 ca päko 'numiyate / äha: etad api nästy udäharanam anekäntät 2 2 / na hi sarvesäm phalänäm tulyakälam päko bhavati pürväparakälanispannatvän nimittabhedäc ca / ucyate: yadä tarhi samudräd ekam udabindum 23 präsya sesasya lavanatänumiyate 24 , sthälyäm 25 vaikam puläkam upalabhya sesänäm päko 'numiyate tadä sämänyatodrstam / äha: naitad apy asty 2 6 udäharanam akrtsnasangrahät / vaksyaty
X P. ° trnasutrasakrtprabhrtinam 2 A. anupalambhot(7) (tatho0) 3 K., D. and A.: tathosnakalusatvädtnäm 4 P. meghä 5 A. nänaikäntah D. nänekäntäh, s.m. nänekäntah 6 D. omits apy. 0 7 D. desädivikära , s.m. desädivicära0 8 K., P. and D. omit näma. 9

5

10

15

20

K., P. and D.: yaträrthayor A. yatraikadärthayaur Dkha. yatraikärthayor We follow Pandeya. 10 A. omits hy. 11 A. omits avyabhicäram upalabhyänyatra tajjätiyayor arthayor. 12 A. sädhanato 13 A. tatraikatra 14 A. nadipüräntaräd 15 A. tahim 16 A. visistagunayogam A. sesänäm 18 A. tattvena Dkha. tadvat tena 19 A. grahanam Dkha. omits anumiyate. 20 Dkha. vrksädeh phalasya K., P. and D.: sesänäm vrksäntaränäm Dkha. sesänäm phalänäm 22 A. anaikäntah 23 A. udakabindum 24 A. lavanavatäm anumiyate 25 A. sthälyä 6 K., P. and D.: naitad asty A. etad api nästy

86 ayam uparistad acaryah

YUKTIDIPIKA

sämänyatas tu drstäd atindriyänäm prasiddhir 1 anumänät / (SK6ab) iti / tatraivam pramäne parikalpyamäne käryakäranayos 2 tatsanghätänäm ca sukhaduhkhamohasvabhävopalambhät tanmäträhamkäramahatpradhänänäm 3 samadhigamah 4 syät na purusasya tajjätiyärthänupalambhät / ucyate: yadä 5 tarhi kvacid dharmena dharmäntarasyävyabhicäram upalabhyaikadharmopalambhäd 6 bhinnajätiye 7 'tyantänupalabdhasya dharmäntarasya pratipattis tadä sämänyatodrstam tadyathä devadatte gamanäd desäntarapräptim upalabhyätyantädrstam jyotisäm 8 desäntarapräpter gamanam 9 anumiyate / tathä präsädädinäm vrddhipürvakam dlrghatvam upalabhyausadhivanaspatmäm dirghatvadarsanäd vrddhir anumiyate / äha: naitad apy asty 1 0 udäharanam pürvenävisesät / käryät käranasyädhigamah sesavad11 iti pürvam atisrstam bhavatä 1 2 / aträpi ca 13 desäntarapräptilaksanät käryäd gatilaksanasya käranasyädhigamah / tasmäc chesavatsämänyatodrstayor abhedaprasahgah / ucyate: na aniyamät / yatra hi niyamatah 14 käryena käranam adhigamyate tac chesavad ity ayam asmadabhisandhih 15 / na tu tad asti sämänyatodrste 1 6 / kasmät / sanghätatvasämänyät pärärthyasämänyasädhanam 17 api drsyate / yathäha 18 — <vya>bhicäräd19 visesäs tu pratltäh pratipädakäh / / (PS.2.19cd; PSV.:Peking.Ce.32a8-32bl,113b5-6; Derge.Ce.31a7) iti / sädhyasädhanasämänyayor api drsyate / yathänityah sabdah krtakatväd iti / tatraivam sati niyamavädinah pratijnähänih / etenäsiddhaviruddhänaikäntikasädhanäbhäsäh 20 pratyuktäh / te hi samsayaviparyayäjfiänahetutväd 21 agamakä 22 iti vyäkhyätam anumänam /
X K., P. and D.: pratitir 2 A. käryakäranayäs 3 K., P. and D. omit -mahat-, D. °lambhäc ca tanmätra0, s.m. °lambhät tanmätra0 4 A.hy adhigamas 5 A. yadi 6 K., P. and D.: upalabhyaivam dharmopalambhäd 7 A. bhinnajätiyo 8 K. and P.: ° ätyantädrstajyotisäm D. ° ätyantädrsta0, s.m. ° ätyantadrsta0 9 A. °präpte 'rtham instead of °präpter gamanam 10 A. etad api nästy 11

5

10

15

20

25

A. sesaväd A. bhagavatä 13 A. omits ca. 14 K., P. and D.: niyamah 15 K., P. and D.: asmäd abhisamdhih 16 A. samsayatodrste 17 A. pärthyasädhanasämänyam 18 A. yathä 19 All the Mss read avyabhicäräd 20 A. sädhyavacanenäniruddhänaikäntikäbhäsäh 21 K., P. and D.: °viparyayajnänahetukatväd 22 A. ägamakä

DVITIYAM AHNIKAM SK5,6 äha: äptavacanasya kirn laksanam iti / ucyate: ÄPTASRUTIR ÄPTAVACANAM TU / / (SK5d)

87

äptä näma rägädiviyuktasyägrhyamänakäranä parärthä vyährtih / sravanam srutih / äptä cäsau srutis ca 1 äptasrutih / athaväptäsyästity 2 äptah / akäro matvarthiyah (cf.Pän.5.2.127) / tadyathä tundo ghata 3 iti / äptebhyah srutir äptasrutih / äptasrutis cäptasrutis cäptasrutih / sarüpänäm ity ekasesah4 (cf.Pän.1.2.64) / tatra pürvenäptasrutigrahanenedam pratipädayati 5 / apurusabuddhipürvaka ämnäyah svatantrah 6 purusanihsreyasärtham pravartamäno nihsamsayam pramänam iti / dvitiyena manvädinibandhanänäm ca 7 smrtlnäm vedängatarketihäsapuränänäm sistänäm 8 nänäsilpäbhiyuktänäm 9 cädustamanasäm yad 10 vacas tat pramänam ity etat 1 1 siddham bhavati / tusabdo Vadhäranärthah / äptasrutir eva12 äptavacanam na 1 3 sabdamätram / evam sati yad uktam tanträntariyaih "simsapädisabdänäm nirvikalpam anumäne 'ntarbhävas trilaksanatvät" iti tad ayatnatah pratiksiptam bhavatiti vyäkhyätäni pramänäni / etaih 14 pürvoktam prameyam yathäsvam pratipattavyam

5

10

15

äha: astu tävad aksasannikarsabhäjäm 15 arthänäm pratyaksenopalabdhih / asannikarsabhäjäm api copalabdhasambandhänäm anumänena / ye tv atindriyäbhäväs tesäm ubhayavailaksanyän nästi pratyaksänumänäbhyäm upalabdhih / ägamikatve 16 sarvavädasiddhiprasanga ity ato 'tyantam 17 evägrahanam präptam 1 8 / tatra yad uktam (67.10?) etävadbhih pramänaih sakalapadärthävabodha ity et ad 19 ayuktam / ucyate: syäd etad evam yady 20 ekarüpam evänumänam adhitam 21 syät / kirn tarhi / trividham / tatra satyam eva pürvavacchesavati22 präganubhüta1 K.J P. and D. omit ca. 2 K., P. and D.: athaväpto 'syästity 3 A. mutra 4 A. sarüpänäm ekasesa ekavibhaktäv ity ekasesah 5 A. pratipädayatv 6 K., P. and D.: sa instead of svatantrah 7 A. omits ca. 8 A. tathä sistänäm 9 A. nänätisilpäbhiyuktänäm 10 A. ca yad 11 A. caitat 12 K., P. and D. omit eva. 13 K., P. and D. omit na. 14 A. anyaih 15 D. aksasamkarsabhäjäm, s.m. aksasannikarsabhäjäm 16 A. ägamikatve ca 17 D. iti tv atyantam 18 A. evägrahanapräptam 19 A. ed 20 A. eva yedy 1 A. evänumadhttam P. evänumänum adhitam 22

20

25

A. pürvavacchesavat D. pürvavacchesavatt, s.m. pürvavacchesavat te

88

YUKTIDIPIKA

sanbandhavisayaphale iti krtva na tabhyam asesapadarthadhigamo 'bhyupagamyate / SÄMÄNYATAS TU DRSTÄD1 ATINDRIYÄNÄM PRASIDDHIR2 ANUMÄNÄT3/ (SK6ab) 5 yat tv etat sämänyatodrstam 4 anumänam tasmäd 5 atindriyänäm arthänäm samadhigamah pratyavagantavyah / katham / yathä hi krtakatvänityatvayor 6 ghate sahabhävam upalabhyänyatra sabdädau krtakatvadarsanäd anityatvam anumiyate / evam sakalädlnäm tajjätlyatayä candanädipürvakatvasiddheh käryak<a>ranasya7 sukhädijätlyatayä 8 tatpürvakatvasiddhih 9 / sayanädinäm ca sanghätatvät pärärthyasiddheh kärya<ka>ranasyäpi10 sahghätatvät pärärthyasiddhir iti sarvam istam sangrhitam bhavatlti / yesäm tu sesavad eva sämänyatodrstam tesäm 11 tasya käryadvärena 12 samadhigamahetutvät purusasyägrahanaprasahgah 13 / vrttau käryopacäräd adosa iti cet / syän matam / yady api purusasya käryäbhävas 14 tathäpi purusävyaktamahadahamkär<ä>visesänäm 15 sämprate käle 16 svavrttibhyas tesäm grahanam ity uktam / tasmäd 1 7 vrttisaktir 18 esäm käryatvenopacaritä svam ätmänam 19 <vy>anaktiti(?) 2 0 / tac cäyuktam / kasmät / hetvantaräbhidhänät 2 1 / yadi vrttyä grahanam purusasya süpapädam abhavisyat samhatapärärthyam äcäryo hetutvena 22 nävaksyat 23 / tac cävrttibhütam ity avasyam sesavatsämänyatodrstayor arthäntarabhävo 24 'bhyupagantavyah 25 / tasmät siddham sämänyatodrstäd atindriyänäm 26 arthänäm 27 samadhigamah / tasya 28 prayogamätrabhedäd
1 A. städ 2 Dkha. pratitir 3 D. anumänät, s.m. anumänam 4 A. drstam sämänyato 5 K., P. and D.: anumänam etasmät 6 A. krtakatvänityayor 7 All the Mss read käryakäranasya. 8 D. mukhädi0, s.m. sukhädi0 9 A. °siddheh 10 K., P. and D.: käryakäranasyäpi A. akäryakäranasyäpi 11 A. tu tesäm tu 12 A. tasya käryasesavatah käryadvärena 13 A. purusasya grahanaprasangah 14 A. käryäbhävas Dkha. käryatä bhavet 15 16 A. sampratikäle 17 K., P. and D.: kasmät 18 A. vrttir 19 A. ätmänä 20 All the Mss read yunaktiti. 21 A. na hetvantaräbhidhänät 22 Dkha. hetunä 23 A. novaksyat 24 A. bhedo' 25 A. 'py avagantavyah 26 A. evätmdriyänäm 27 Dkha. sämänyatodrstänäm 28

10

15

20

K., P. and D.: purusävyaktamahadahamkäravisesanägrahanesu A. purusavyaktamahad ahamkäräd avisesänäm

arthänäm instead of sämänyatodrstäd atindriyänäm arthänäm

A. tüsya

DVITIYAM AHNIKAM SK6 dvaividhyam vita^avlta^ iti / tayor laksanam ämananti— yadä hetuh svarüpena sädhyasiddhau prayujyate / sa vlto 'rthäntar<a>ksepäd 2 itarah parisesatah 3 //

89

svarüpam hi sädhanasya dvividham sädhäranam asädhäranam ca / tatra sädhäranam sädhyasahabhävi 4 tatpratipattihetutvena yathävad äsriyamäno 'rthätmä / asädhäranam punah "parimänam anvayah"(cf.SK15a'b') "sanghätaparärthatvam"(cf.SK17a) ityädi 5 / tatra yadä hetuh parapaksam <an>apeksya6 yathärthena 7 svarüpena sädhyasiddhäv apadisyate 8 tadä vitäkhyo bhavati / yadä tu svasädhyäd arthäntarabhütänäm prasanginäm 9 ksepam apoham krtvä parisesatah sädhyasiddhäv apadisyate tadävitäkhyo bhavati tadyathä 10 na cet paramänupurusesvarakarmadaivakälasvabhävayadrcchäbhyo j agadutpattih sambhavati parisesatah pradhänäd iti tadä punar avitäkhyo bhavati / tatra yadä vito hetuh svabuddhäv avahitavijnänasvarüpam 11 vijiiänäntaram ädadhänena 12 vakträ pratipädyädau väkyabhävam upaniyate—väkyam antarenärthasya 13 buddhyantare samkrämayitum 14 asakyatvät—tadävayaviväkyam parikalpyate / tasya punar avayaväjijnäsäsamsayaprayojanasakyapräptisamsayavyudäsalaksanäs 15 ca vyäkhyängam / pratijnähetudrstäntopasamhäranigamanäni 16 parapratipädanängam 17 iti / tatra jfiätum icchä jijnäsä / kascit 18 kamcid upasadyäha—purusam 19 jfiätum 20 icchämi 21 kirn asti 22 nästiti / kutah samsaya iti paryanuyuktah pratyäha—anupalabhyamänasyobhayathädrstatvät / ihänupalabhyamänam ubhayathädrstam sadbhütam asadbhütam ceti 2 3 / sadbhütam ca 24 arkenduX A. avita 2 All the Mss read 'rthäntaräksepäd. 3 K., P. and D.: parisesitah 4 D. sädhyasahabhäve 5 A. iti 6 All the Mss read apeksya. 7 A. yathoktena 8 A. upadisyate 9 K. and P.: präsangikänäm D. präsangikänäm, s.m. °känäm 10 A. omits tadyathä ... tadä punar avitäkhyo bhavati (89.10-12). 11

5

10

15

20

A. ähitavijnänasarüpam D. ädadänena A. ändadhänena A. arthäntarenärthasya 14 A. samkrämayitum K. and P.: °samsayavyudänalaksanäs D. °samsayavidänalaksanäs laksanec 16 A.: pratijnähetudrstäntopanayanigamanäni A. ca parapratipädanängam 18 A. yathä kascit 19 D. puruse, s.m. purusam 20 A. samjnätum 21 D. icchä me 22 A. kisti 23 A. omits iti. A. omits sadbhütam ca.

A. °samsayavyudäsa-

90

YUKTIDIPIKA

5

10

15

20

mandalaparabhagadi / asadbhutam ca 1 sasavisanadi / ayam api catma 2 nopalabhyate 'tah samsayah kim 3 astinästiti 4 / kirn asyäs 5 cintäyäh prayojanam iti prsto vyäcaste—sästrasatattvädhigamah tatas ca moksäväptih / katham iti / yadi tävad ayam ätmästi tato 6 'syäprakrtitvaudäsinyavibhutvädisatattvavijnänän nairätmyabhräntivipaksabhütäd apavargapräptir avasyambhävimti 7 / yad uktam "vyaktävyaktajnavijiiänän mokso Väpyate" (cf.SK2d) iti tac chästram arthavad bhavati 8 / atha nästiti nisciyatetena 9 sämänyatodrstäd anumänät 10 tadvad anye 'pi padärthä na santiti vipralambhabhüyistham ärsam darsanam apahäyätmagrahadrstivigamäl lokottaram anavalambana<m> sünyam dhyänavisayam 11 upasampräptas traidhätukaklesaniro dhalaksanam 12 ätyantikam nirvänam aväpsyämiti 13 / sakyas cäyam 14 artho niscetum 15 pramänatrayaparigrahäd 16 iti vyavasthite vyudasya 17 samsayam / sädhyävadhäranam pratijnä / sädhyasya 18 yad avadhäranam asti purusa iti sä pratijnä / sädhanasamäsavacanam hetuh / sädhyate 'neneti 19 sädhanam lingam 20 / samäsah samksepah sädhanasya samäsavacanam sädhanasamäsavacanam / sädhanagrahanam tadäbhäsapratisedhärtham / na hi täni sädhanam samsayaviparyayahetutvät / samäsagrahanam avayaväntarävakäsapradänärtham 21 / linganirdesamätram hetuh / yas tu tasya sädhyasahabhävitvalaksanah prapancah 22 so Vayaväntaränity uktam bhavati / udäharanam tu tannidarsanam drstäntah 2 4 / tasya sädhanasya sädhyena sahabhävitvanidarsanam yad asau drstäntas tadyathä samhatyakärinäm parärthatvam drstam yathä sayanäsanarathasaranänäm 25 / vyatirekas tv avitasya 26
2 A. cätma 3 A. kemm 4 A. vä nästiti 5 P. asyä 6 A. ätmä sthito instead of 7 A. omits iti. 8 K., P. and D.: bhavatiti 9 A. yena 10 A. anumänas 11

*A. omits ca.

ätmästi tato

K., P. andD.: avalambanasünyam dhyänavisayam A. anabalambanam sünyadhyänavisayam We follow Pandeya. 12 A. traidhätukaklesanirodhe laksanam 13 K., P. and D.: aväpsyasyasiti 14 A. has an unreadable aksara after cäyam. 15 A. niscatum 16 A. pramänät trayaparigrahäd 17 P. vyudasya 18 K., P. and D. omit sädhyasya ... iti sä pratijnä. 19 A. naneti 20 A. Ungarn 21 A. avayavävakäsadänärtham 22 A. laksanaprapancah 23 K., P. and D.: udäharanam tv atra nidarsanam D. s.m. udäharanatvanidarsanam 24 K. and P. repeat drstäntah sahabhävitvanidarsanam. D. adds the same phrase in the bottom margin, but deletes with a wavy line. 25 K., P. andD.: °rathacaranänäm D. °rathacaranänäm, s.m. °rathasaranänäm 26 A. tävitasya

DVITIYAM AHNIKAM SK6

91

prasangidharmäntaranivrttirüpatväd antarbhüta 1 iti na tadartham vaidharmyadrstänta ucyate / sädhyadrstäntayor ekakriyopasamhära upanayah / sädhyasya2 caksurädipärärthyalaksanasya drstäntasya ca sayanäder ekakriyopasamhärah 3 / taträrthäntarabhütatvät sädhyadrstäntayor afijasä naikakriyopapadyate tenaiva tasyänidarsanäd ity ato dharmasämänyäd^ 1 ) yathedam tathedam ity ekakriyopacaryate / yathä sayanädayah samhatatvät parärthä 4 evam caksurädibhir api parärthair 5 bhavitavyam / yo 'sau parah sa purusah / tadvasät pratijiiäbhyäso nigamanam / hetudrstäntopasamhäräpeksayä yah pratijiiäyäh 6 punar abhyäsas tan nigamanam tadyathä tasmäd asti purusa ity esäm avayavänäm 7 parasparasambandhäd 8 visistärthah samudäyo 9 väkyam 10 ity apadisyate^ 2 ) 11 / väkyam apy anekam yadä gunibhütasvärtham 12 arthäntaropakäritväd itarena 13 samsrjyate tadä sästram apy ekam väkyam 14 ity avasiyate 15 / äha: jijfiäsädyanabhidhänam tadvyatirekenapi svayam arthagateh svaniscayavac ca parapratipädanät / yathä hi svayam utpadyate 16 niscetuh pratyayas tathaivänyah pratyäyya 17 ity etan nyäyyam / na ca svayam evärtham pratipadyamänasya 18 jijnäsädinäm tatra vyäpärah / tasmät parärtham apy esäm upädänam 19 na kalpyate / samsayavacanänarthakyam ca pratltärthatvät / niscitau hi vädiprativädinau svapaksayoh 20 / tayor itaretarasamsayaparyanuyoge 21 nästi prayojanam /
X A. tadantarbhuta 2 A. sädhyasya ca 3 A. ekakriyopahärah 4 A. parä 5 A. padäsärther 6 K., P. and D. omit yah pratijnäyäh. 7 A. asäm arayavänäm(?) 8 K., P. and D. omit parasparasambandhäd. 9 K., P. and D.: visistärthasamudäyo 10 D. samudäyo väkyam, s.m. samudäyaväkyam n K., P. and D.: atidisyate cf.p.91,fn.(2) 12 K., P. and D.: gunibhütam svärtham 13 A. omits itarena. 14 A. ekaväkyam 15

5

10

15

20

A. adasiyate After adasiyate A. repeats väkyam apy anekam yadä gunibhütasvärtham arthäntaropakäritväd itarena samsrjyate tadä sästram apy ekam väkyam ity avasiyate. 16 A. utpadyata 17 D. pratyäya 18 A. evärthapratipadyamänasya 19 A. upädhänam °A. svaparapaksayoh 1 A. itas samsayaparyanuyoge

(^(dharma-) kriyadharma-* / / (K.31b i.n., D.99 without number in the right margin) *D. paryäya; kriyädharmasämänyä
(2

> (apadisyate) atiricyate* / / (K.32a, D.99 without number) *This note presupposes atidisyate, a variant of apadisyate.

92

YUKTIDIPIKA

5

kirn canyat / prayojanasakyapraptyavacanam ca sadhanabhyupagamäd eva tatpratlteh / na hi mahatäm nisprayojanä pravrttir upapadyate / na cäsakye 'rthe himavatsamlkaranädisv apravrtteh 1 / tasmäd anarthakam tadabhidhänam / tadbhäve bhäväd iti cet / syäd etat / satsu jijnäsädisu satattvädhigamam 2 pratipravrttir bhavaty asatsu na bhavati / tasmäd etäny api sädhanam bhavisyantiti / etac cänupapannam / kasmät / atiprasangät / satsv ätmäntahkaranendriyälokavisayesu 3 pravrttidarsanät tesäm api sädhanatvam syät / anistam caitat / tasmäj jijiiäsädayo 'narthakäh / pratijiiädayo durvihitäh / katham 4 / sädhyävadhäranasyävayaväntaresv apy upapatteh / yadi sädhyävadhäranam pratijnety ucyate tena sädhyasya hetor drstäntasya vä 5 yad avadhäranam tad api pratijnä präpnoti nimittävisesät / sädhyasabdo hy ayam sämänyavrttir na yatnam 6 antarena visese 'vasthäpayitum sakyata iti / kirn ca hetulaksanänupapattis 7 ca sädhanänupadesät / yo hi sädhanasamäsavacanam hetur ity etal laksanam äcaste tena 8 präk sädhanam abhidheyam 9 syät / tato vaktavyam amusya samäsavacanam hetur iti / na caivam uktam / tasmäd alaksanam etat / kirn cänyat / samäs<ä>vacanam 10 ca vistaranisedhaprasangät 1 1 / yadi hi samäsagrahanam kriyate kirn präptam / yo ' y a m ädhyätmikänäm bhedänäm käryak<a>ranätmakänäm 12 caikajätisamanvayo drsta ity evamädih sädhanaprapancah so 'hetur 13 ity uktam bhavati / tasmät samäsagrahanam anistam / lingäbhidhänäd adosa iti cet / syän matam / Ungarn hi nah sädhanam / tasyätra nirdesah 14 krtah / tasmät svamatijädyäd idam anistam adhyäropyate na tv asmatpramädäd 15 iti / etad apy ayuktam / kasmät / tasya dvidhä bhinnasya paiicadhä 16 sädhanabhävät 1 7 / tad dhi lingam vitävltatvenestam, tena dvidhä bhinnam / taträpi vltah pancaprabheda ity atah samudäyän niskrstasyaikasya lingatvam asakyam vaktum iti /
X P. °adisu pravrtteh 2 A. tattvädhigamam 3 Dkha. tatsvätmäntahkarane0 4 5 A. ca 6 D. netaram 7

10

15

20

25

After katham A. reads sädhyäbhidhäyinah pratijnäbhyupagamäd dhetudrstäntayor api tatpr sanga. (cf.95.1)

8 A. äcastate na 9 A. abhidhänzyam 10 All the Mss read samäsavacanam. 11 A. vistarapratisedhaprasangät 12 All the Mss read käryakäranätmakänäm. 13 D. svah ahetuh, s.m. either so 'hetuh or sahetuh. Dkha. sa hetur 14 A. tasya nirdesah Dkha. tasyänirdesah 15 A. and Dkha.: asmatprasädäd D. °prasädäd, s.m. °pramädäd 16 K., P. and D.: bhinnapancadhä 17

instead of na yatnam K., P. and D.: ahetu0

A. and Dkha.: sädhanabhävät D. bhinnapancadhä sädhanabhävät, s.m. bhinnapancasädha näbhävät vä sädhanabhävät

DVITIYAM AHNIKAM SK6

93

kirn cänyat / drstäntalaksanäyogas ca^1) sabdärthalaksane 1 'nistaprasangät / tannidarsanam drstänta ity atra sabdo värtho 2 vä yena sädhyasädhane nidarsyete 3 sa drstäntah syät / [artho vä yatra 4 nidarsyate /] kim cätah / tad yadi tävac chabdah parigrhyate tata upanayalaksanam 5 bädhyate 6 / kasmät / na hi 7 yathäbhidhänam tathä sädhyam ity ekakriyä yujyata iti / athärthah 8 parigrhyate tenäbhidheyasya 9 väkyänavayavatvät pancävayavatvavirodhah 10 / kim cänyat / drstäntopanayanigamanäbhedas^ 2 ) 11 ca hetupratijfiärthäbhidhänät 1 2 / sädhanatvam 13 eva sädhyävinäbhävitvalaksanam drstäntopanayayoh 14 pratyäy<y>ate 15 / pratijnärtham ca nigamanasya nävayaväntaratvam yujyate / ucyate: yad ucyate(91.15f.) svaniscaye 'nangabhävagamanät^ 3 ) 16 parapratyäyanärtham jijiiäsädyanabhidhänam 17 ity atra brümah: na uktatvät / uktam(89.16ff.) etat purastäd vyäkhyängam jijnäsädayah <iti> / sarvasya cänugrahah kartavya ity evamartham 18 sästravyäkhyänam vipascidbhih pratäyate 19 na svärtham svasadrsabuddhyartham 20 vä / tatraivam 21 kalpyamäne ye vyutpädyäs tän prati <naisäm änarthakyam(?)> 22 / athaitad anistam yad
1 A. sabdarthakalpane 2 A. omits värtho. D. encircles värtho. 3 P. nidarsyate A. nirdesyete D. nida..yate(!) 4 A. yo yatra instead of yatra 5 A. upanayanalaksanam 6 A. bädhyeta 7 K., P. and D. omit na hi. 8 A. ayathärthah Dkha. athätah 9 Dkha. näbhidheyasya 10 Dkha. °virodhäd D. °yogah, s.m. °virodhah 11 A. °nigamanabhedas 12 A. hetupratijnänäbhidhänät 13 A. sädhanadharmam Dkha. sädhanam 14 D. drstäntovinäbhävinam, s.m. drstäntopanayayoh 15 K., P. and D.: pratyäyate A. and Dkha.: pratyäyayatoh 16 K. 'nängabhävagamanät Dkha. nängabhävagamanät 17 Dkha. jijnäsäbhidhänam 18 A. iti caivam artham 19 K. and P.: pratäyyate D. pratäyate, s.m. pratyäyate 20 A. svasadrsabuddhärtham 21 A. tatraiva 22

5

10

15

K., P. and D.: vaisäm äkulyam Dkha. vaisamyäkulyam

(^(ca) agra etadartham karoti / / (K.32b, D.102-1) (2) (drstäntopanayanigamana-) drstäntopanayau hetvartham pratyäyatah / nigamanam ca pratijfiärtham bodhayati / / (K.32b, D.102-2) ^3'(svaniscaye, 'nängabhävagamanät) jijnäsädyanabhidhänam tadvyatirekenäpi svayam arthagater (91.15) ityäder düsanam äha svaniscaye 'nangabhäva iti // (K.33a, D.102-3) ('nängabhävagamanät) jijnäsädinäm // (K.33a, not found in D.)

94

YUKTIDIPIKA

5

10

15

uktam sandigdhaviparyastavyutpannabuddhyanugrahartho 1 hi satam viniscayah sastrakathety asya vyäghätah 2 / kirn ca niyamänabhyupagamät / na hi vayam esäm ävasyakam 3 abhidhänam äcaksmahe 4 / kirn tarhi / yadä 5 prativädi paryanuyunkte kirn6 jijnäsasa ity avasyam abhidhäniyam sabdam 7 iti / kena dharmena / kirn8 nityo 'nitya iti / kutah samsayah / amürtatvät / yas tu na paryanuyunkte na tarn praty ete väcyäh / kvacid änarthakyät sarvatra prasanga^1) iti cen na itaresam api tatprasangät( 2 )/ pratijnädmäm api tarhi kvacid an abhidhänam 9 , atas tesäm api sarvaträvacanam prasajyate / tathä ca bhavatoktam 10 kasyacit tu kimcit prasiddham eva bhavatity 11 anyataroktir 12 api sädhanam bhavati sabda ivärthadvayapratitatväd 13 ubhayänabhidhänam iti / yad apy(3) uktam(91.19) niscitatvät samsayävacanam ity asad etat / kasmät / uktatvät / uktam (89.20) etat sati paryanuyoge tadvacanam iti / etena prayojanasakyapräpt! pratyukte 1 4 / yo hi paryanuyunjita kimprayojano 'yain 15 sakyo väyam artha iti tarn prati väcyam 16 etat / yad apy uktam(92.4f.) tadbhäve^4) bhäväd iti / na anabhyupagamät / na brümo yasmät satsu jijnäsädisu satattvadhigamasadbhävah 17 tasmäd etesäm avayavatvamiti / kirn tarhi / yam 18 praty esäm pratipattäv angabhävagamanam tarn praty etäni sädhanam iti /
X A. sandehakhavipary0 (?) Dkha. sandehaviparyastav utpanna0 2 K., P. and D.: vyäkhyätah 3 A. avasyam 4 D. ävasyakam äcaksmahe, s.m. ävasyakam abhidhänam äcaksmahe 5 K., P. and D. omit yadä. 6 A. omits kirn. 7 K., P. and D. omit sabdam. 8 A. omits kirn. 9 A. anabhidhänät 10 Dkha. bhavatoktasya 11 A. bhavatiti cety 12 D. anyatroktir, s.m. anyataroktir 13 A. ° pratitavyatväd 14 A. prayukteh 15 A. kirnprayojanam 16 A. bädhyam 17 A. tattvädhigama0 18

A. ye

(^(prasanga) aparyanuyoktaram prati yady avacyatvam tarhi paryanuyoktaram praty aväcyatvam eva / / (K.33a, D. 103-1) (2) (tatprasangät) yam praty aväcyäs tarn praty aväcyatve 'pi nänyapratyaväcyatvaprasangah // (K.33a,D.103-2) ( api) samsayavacanänarthakyam pratxtärthatväd (91.19) ity asya düsanam äha—yad aplti // (K.33a, D.103-3) (4) (tadbhäve) tadbhäve bhäväd(92A) ity asya düsanam äha—tadbhäva iti / / (K.33a, D.104-1)

DVITIYAM AHNIKAM SK6

95

yad apy uktamW (92.9) sädhyäbhidhäyinah pratijn<äbhy>upagamäd1 dhetudrstäntayor api tatprasahga iti / ayuktam 2 etat / kasmät / jijnäsädeh sadbhäve sati tatpratlteh / yady api sädhyasabdo ' y a m avisesena siddhatväd arthäntaram^ 2 ) 3 äcaste tathäpi yam prati jijnasäsarpsayaprayojanasakyapräptayas tasya vyudasya samsayam sädhyasyävadhäranam^3) pratijfiä, na hetudrstäntayos tadastlty 4 asad etat 5 / kirn cänyat / tadbhäve cävirodhät 6 / yadä tu 7 jijnäsädayo 8 hetau drstänte vä bhavanti tadä 9 kirn krtakah sabdo ? tha na krtako 'tha buddhir nityä ksanikä veti bhavaty eva tadavadhäranam 10 pratijfiä / yad apy uktam(92.14) sädhanänupadesäd dhetulaksanäyoga ity asad etat 1 1 / kasmät / lokaprasiddhatvät / yathä sädhyatvenepsitah paksa iti 12 pratijfiälaksanam^4) äcaksäno bhavän na sädhyalaksanam äcaste / kasmät / sädhaniyam sädhyam iti loke siddhatväd / evam sädhanasamäsavacanam hetur iti 1 3 hetulaksanam äcaksänä vayam na sädhanam äcaksmahe / kasmät / sädhyate 'neneti loke14 siddhatvät / upetya 1 5 vänumänanirdesät / lihgam hi nah

5

10

*K. and P.: pratijnayutatvabhyupagamad A. pratijnävyupagamad Dkha. pratijnaya tattväbhyupagamäd (cf.p.92,fn.4.) 2 K., P. and D.: uktam 3 A. avisesena siddhäd arthäntaram Dkha. avisesinah siddhärthäntaram 4 A. and Dkha.: tad astit(y) 5 A. etad asat 6 A. tadbhävenävirodhät 7 A. $a yadä tu *After jijnäsädayo A. repeats hetu drstäntayos tad astity etad asat jijnäsädayo. In the repeated phrase tu of yadä tu is omitted. 9 A. omits tadä. 10 A. tadä tadavadhäranam 11 A. etad asat 12 D. omits iti. 13 K., fP. and D. omit hetur iti. 14 A. neneti krtvä sädhanam iti loke 15 D. upeti, s.m. upetya

apy uktam) hetulaksananupapattis ca sadhananupadesad (92.14) ity asya dusanam yad apy uktam ityädinä // (K.33b, D.104-2) (2) (sädhyasabdo 'yai« avisesena siddhatväd arthäntaram) sädhyasabdo1 'y a m avisesanah siddhärthäntaram ity anyädarse2 päthah3 / siddhäd anyah sädhyah4 // (K.33b, Dl04 in the right margin) 1 D. starts this note with pam°ta(l). 2 D. omits anyädarse. 3 cf.p.95,fn.3 4 D. has siddhäd anyah sädhyah in the left margin, while the preceding passage of this note is written in the right margin. (3) (sädhyasya) sädhyasya hetor drstäntasya vä yad avadhäranam tad api pratijfiä präpnoty <ity>äder* düsanam / / (K.33b, D.104-3) *K. and D.: äder '4) (yathä sädhyavattvenepsitah paksa iti pratijnälaksanam) yathä bhavatä sädhyavattvena ya Ipsitah paksah sä pratijfieti pratijnälaksanam sädhyopadesam vinaivoktam tathäsmäbhir api sädhanasamäsavacanam hetur iti sädhanopadesam vinaivoktam sädhanasya lokaprasiddhatvät / / (K.33b, D.104-4)

96

YUKTIDIPIKA

5

10

15

20

25

sadhanam 1 tac ca2 nirdistam iti 3 / yat tüktam 4 (92.24f.) vitävltabhede 5 sati paiicadhä sädhanabhäväd ity atra brümah: ayuktam etat / kasmät / samäsagrahanasämarthyät / ata eva sämäsagrahanam kriyate / sädhanasvarüpäbhidhänamätram 6 hetur iti yathä vijnäyate 7 / prapaiicas tv avayaväntaränlty etena vistarapratisedhaprasangah pratyuktah / katham / na hi samäsasabdasyäyam artha iti krtvä 8 / yat punar etad uktam (93.1) sabdärthakalpane 'nistaprasangäd drstäntalaksanäyoga iti / astu tävac chabdo drstäntah / yat tüktam(93.4) upanayalaksanam 9 badhyata ity anupapannam etat / kasmät / asambhave sati sambandhyantare käryavijnänät / sabde^1) 'sambhaväd arthe käryam 10 vijnäsyämah / athavä punar astv artho drstäntah / yat tüktam (93.6) abhidheyasya väkyänavayavatvät paficävayavatvavirodha ity arthe 'sambhaväc chabde käryam vijnäsyämah / yad apy uktam (93.8) pratijnähetvarthäbhidhänäd drstäntopanayanigamanänäm nävayaväntaratvam ity ayam adosah 11 / kasmät / apratijnänät / na hy etad asmäbhih pratijnäyate / kirn tarhi / prameyavacanam pratijnä / pramänarüpamätravacanam hetuh / tasya prameyasahabhävitvanidarsanam 12 drstäntah / sädhyadrstäntayor dharmasämänyäd ekakriyopasamhära upanayah / samudäyasya sädhyasiddhaye vyäpäranirdeso nigamanam / tasmäd ayuktam etat / kirn cänyat / ekasya sädhyasädhanabhävaparikalpanävat 13 tatparikalpane dosäbhävat / yathä väkyam e<k>am ca 14 tadarthas ca mukhyau sabdärthau, tayor abhinnärthatväd 15 ity upagamäd 16 ekam evärtham abhägam akramam ca buddhäv avasthäpya srotragrähyatvänityatvakrtakatvaprameyatvädilaksanänäm 1 7 saktlnäm apoddhärät sädhyasädhanasamsayarüpäpannam vaktäro bhinnam äcaksate na caikärthadharmatvät sädhyasädhanasamsayäbhidhänänäm
1 A. sadhanam 2 A. tas ca 3 A. omits iti. 4 A. tükta 5 P. vitävite bhede 6 D. sädhanasvarüpänabhidhäna0 , s.m. sädhanasvarüpäbhidhäna0 7 A. has a blank space instead of yathä vijnäyate. 8 A. iti vistarnsC!) krrntvä 9 A. upanayanalaksanarn 10 A. arthakäryam 11 A. ayam dosah 12 K., P. and D.: prameyasahabhävinidarsanam 13 14 K., P. and D.: evam ca A. eca 15 Dkha. abhinnatväd 16 K., P., D. and Dkha.: abhyupagamäd 17

K., P. and D.: ekasya sädhanabhävaparikalpanä A. evam asya sädhyasädhanabhävaparik panävat

A. srotragrähyatvän nityatväkrtakatvaprameyatädilaksanänäm

( ) sabdarthayoh parasparam sambandhitvad / yadi* canayoh sabda uktam karyam na sambhavati sambandhyantare 'rthe 'pi käryam vijfiäyeta / athavärtha uktam käryam na sambhavati tarhi tatsambandhini vijfiäyeta iti / / (K.33b, D.105-1) *D. iti

DVITIYAM AHNIKAM SK7

97

ekatvam anusajyate tathaikasya sädhanasya sädhyadharmatatsahabhävitvalaksanänäm saktmäm abhidhänam hetudrstäntädinävayaväntaram 1 nah syät / tatra yad uktam(93.8) pratijnähetvarthäbhidhänäd drstäntopanayanigamanänäm nävayaväntaratvam ity etad ayuktam / tasmät süktam dasävayavo vitah / tasya purastät prayogam nyäyyam 2 äcäryä manyante / kirn käranam 3 / avltalaksanävirodhät 4 / avitasya 5 hi laksanam parisesatah sädhyänugrahah / tatränvayädinä^1) svarüpenädhigate 6 pradhänalaksane dharmini parapaksapratisedhamätrenopasamhäre kriyamäne parisesalaksanam bädhyate / kasmät / iha pratisedhamätram ädäv ucyate / tena yathä hetuvirodhät paramänvädibhyo na vyaktam utpadyate tathä hetvabhävät pradhänäd api notpadyata iti sakyam kalpayitum / atas 7 tadvyavacchedo 'pi <n>ävitäd8 gamyate / tathä sati kah parisesah syät / svarüpena^2) tu paricchinne dharminy upasamhäro yathävad avakalpyate 9 / na cet paramänvädibhya utpadyate 10 parisesatah 11 pradhänäd eva vyaktam utpadyate / parisesata iti yathoktebhyo 'nvayädibhya^3) ity uktam bhavati / tasmät präg vitaprayoga iti siddham sämänyatodrstäd anumänäd atindriyänäm arthänäm samadhigama iti / äha 12 : na käranäntarato 1 3 'nupalabhyamänänäm agrahanät^ 4 )/ 5 yadi^ ^ sämänyatodrstäd anumänät sarvam paroksam adhigamyata ity [adhigamyate] 14 präptam idam yesäm apy arthänäm käranäntarato 15 'nupalabdhis
1 D. hetuh / drstantadina avayaväntaram 2 K., P. and D.: nyäyam 3 A. kikäranam 4 A. ävita0 5 A. ävitasya 6 K., P. and D.: svarüpenänadhigate 7 A. tas 8 K., P. and D.: cävitäd A. ävitäd 9 A. avakalpate 10 A. paramänvädibhya na vyaktam utpadyate 11 A. omits parisesatah pradhänäd eva vyaktam utpadyate. 12 K., P. and D. omit äha. 13 D. käranatah, s.m. käranäntaratah 14 K., P. and D.: adhigamyate ity adhigamyate A. adhigamyata 15

5

10

15

20

ity abhyupagamyate

D. käranatah, s.m. käranäntaratah

( > (anvayadina) "samanvayac chaktitah pravrttes ca" (SKl5b) ityadi vaksyamanenanvayadina // * (K.34a, D.107-1)
(2

) (svarüpena) anvayädinä / / (K.34b, D.107-2)

(3) ('nvayädibhya) hetubhyah / / (K.34b i.n., D.107-3) ^ ( n a käranäntarato 'nupalabhyamänänäm agrahanät) värttikam / / (K.34b, not found in D.) <5)(yadi) värttikärthah / / (K.34b i.n., not found in D.)

98

YUKTIDIPIKA

tesam api tasmad eva grahanam^1) <iti>/ tadyatha— ATIDÜRÄT^2) SÄMIPYÄD INDRIYAGHÄTÄN MANO'NAVASTHÄNÄT / SAUKSMYÄD VYAVADHÄNÄD ABHIBHAVÄT SAMÄNÄBHIHÄRÄC CA / / (SK7) 5 taträtidürät 1 tävat 2 tadyathä proddinasya 3 sakuneh / atisämipyäd anjanaprabhrtinäm / indriyaghätäc chabdädinäm 4 / ma.no'navasthänäc chakatädmäm / sauksmyät trutyädmäm 5 / vyavadhänäd dhiranyädinäm / abhibhavät süryaprakäsäd grahädmäm / samänäbhihäräd anekapradipaprabhänäm 6 / casabdäd aisvaryayogäd devädinäm 7 / na cärhati bhavitum dharmasämänyänupapatteh^ 3 ) 8 / tasmäd ayuktam sarvam atindriyam anumänagrähyam 9 iti / ucyate: sakyam tävat käranäntarato 'nupalabhyamänam kimcit sämänyatodrstäd anumänäd adhigantum tadyathä samipävasthitasya sakuner ayatnena caksurgrahanam 10 / yathä yathä tu viprakarsam pratipadyate tathä tathä 1 1 pranidhäya caksur grhyate tävad yävat kramenädarsanam upasampräptah / tatra desaviprakarse pra<c>iyamäne12 darsanam upaciyamänam avagamyätyantädarsanam api pascät taddhetukam anumlyate / tathä nätisamipävasthitasya dravyasyäsphutam äkäram avadhärya 13 pascäd yathä yathä
1 A. tatratidura 2 A. omits tävat. 3 A. protinasya 4 K., P. and D.: °ätäd badhirädinäm 5 D. not clear. 6 A. anekadipaprabhänäm D. samänäbhihäräd 7 A. aisvaryayogäc ca devyädtnäm 8 9 Dkha. anumänagrähyam 10 A. caksusä grahanam U K., P. and D. omit tathä tathä. 12 13

10

15

aneka0, s.m. samänäbhihäräneka0

K., P. and D.: dharmasämänyäd anupapatteh A. dharmasämänyäpatteh The phrase "dharmasämänyänupatteh" is attested by the marginal note of K.(cf.p.98,fn.(3))

K. and D.: desaviprakarsam practyamänam P. °karsam pradTyamänam A. desaviprakarse pradiyamäne K., P. and D.: dravyasyäsphuta äkäro 'vadhäryate

'*' (grahanam) na cärhati bhavitum (98.9) ity anena sambandhah // (K.34b, not found in D.) (2) (ATIDÜRÄT) atidüratvam darsanasyäbhäve nimittam / Tsaddüratvam iva sprstasya darsanasyety evam anyatra väcyam // (K.34b, D.108-1) (3) (dharmasämänyänupapatteh) yesäm api vastünäm atidüratvädikaranäntarato 'nupalabdhis tesäm api sämänyatodistäd anumänäd eva grahanam präpnoti / na ca tesäm sämänyatodrstäd anumänäd grahanam arhati / atra hetum äha—dharmasämänyänupapatter iti / (K.34b, D. 108-2 1st half) yatra hi dharmasämanyam tatraiva sämänyatodistasya pravrttih / atra tu tadabhävät tatpravrttyabhäva iti käranäntarato 'pi yad atindriyam tasyäpi cet sämänyatodrstän na grahanam, tarhi pradhänädinäm api mä bhüd iti pürvapaksäbhipräyah / / (D.108-2 2nd half, not found in K.)

DVITIYAM AHNIKAM SK6.7

99

upasampadyate 1 tathä tathä pratipadyamänadarsanasaktayo 2 'numätärah krsnasäräiijanaprabhrtinäm^ 2 ) 3 agrahanam atisämipyäd anumimate / tathä girisaritsamudrasamlpavartinam 4 sravanapratighätinam^ 3 ) 5 präk sabdam upalabhya pascät tasminn eva dese sabdam agrhnänäh sravanopaghätam anumimate / TASMÄD API CÄSIDDHAM6 PAROKSAM ÄPTÄGAMÄT SÄDHYAM7// (SK6cd) tasmäd api cäsiddham ity anenägamavisaye8 sämänyatodrstasyänavatäram 9 äcaste / paroksam iti visayam pratinirdisati 10 , äptägamät sädhyam11 iti visayinam äha / etad uktam bhavati: tasmäd api sämänyatodrstäd anumänäd yan na siddhyati pratyaksagrähyarrr 4 ) api svayam adrstam käranäntarapratibaddhavisayabhävam 12 atyantaparoksam^5) vä svargäpavargadevatädi dharmasämänyarahitam tad äptägamät 1 3 sädhyam / sarvavädasiddhiprasangäd 14 aprämänyam iti cet / syäd etat 1 5 / yadi tarhy ägamah 16 pramänlkriyate tena pratisästram ye 'bhiyuktäs tesäm prämänyam ity avasyam abhyupagantavyam / evam sati sarväcäryaprämänyäd anekavikalpaviciträ 17 tarkavrttir ity D. has ärad upasarpatiti pathah / samipam upasarpati in the right margin without referring to any other manuscript. 2 A. pratipädyamänasaktayo 3 P. and D.: krsnasäränjana0 4 A. girisaritsamipaparivartinam 5 A. dravinapratighätinan 6 A. api siddham 7 K. and P.: siddham D. siddham, s.m. sädhyam D. writes sädhyam below the title indication of ga.pu in the right margin. 8 A. anena visaye 9 Dkha. anavaratäm 10 A. pratininditasya n D . siddham, s.m. sädhyam 12 K., P. and D.: käranäntarapratibandha0 13 A. ätmägatät 14 A. sarvavädisiddhiprasangäd (this is also possibly the original reading). 15 K., P. and D.: tat instead of syäd etat 16 A. cägamah 17 A. anekavikalpaviditrä
X

5

10

15

(^(arad) samipam upasarpati / / (K.35a i.n., D.109 without number) (2) (krsnasära-) netratärästhakisnasära- / / (K.35a i.n., D.109 without number) (3) (sravanapratighätinam) tlvrah sabdah srotram pratihanti tlvram rüpam caksus tathävidhadhvanirüpägrahanät / / (K.35a i.n,, D.109-1) (4) (pratyaksagrähyam) tajjätlyasya pramätrantarasyeti sesah / / (K.35a, D.109-2) (5) (atyantaparoksam) asmajjätlyasya pramätuh / / (K.35a i.n., not found in D.)

100

YUKTIDIPIKA

5

10

15

20

apariniscitatvad 1 bhrantih^1) prasajyeta / tatha ca sati jijnasunam apavarg<ä>präptih 2 / tasmäd bhisajeva bhavatä paropadeso prayukto 3 näsmän ayam prinätlti 4 / etac cäyuktarn / kasmät / aptalaksanasyänavadhäritatvät / vyapagatarägädidosänäm asandigdhamatlnäm 5 atlndriyärthadrsvanäm Isvaramaharslnäm äptatvam äcaksmahe na sarvesäm / yadi vänyo 'py evamdharmo 'sti bhavatu 6 pramänam / kirn cänyat / svavisaye 7 ca 8 tatprämänyasyädosavattvät / yasya khalv apiyo visayas tasya tasmin visaye vaco 'ntarenäpi sädhanam pramänam 9 ity avasyam abhyupagantavyam / itarathä pratisästram äcärasthitiniyamänäm adrstärthänäm apratipattih syät / etenäkhilalingäd 10 <an>arthäntaratvam 11 pratyuktam / yasmän mahatäbhidhänena yuktir anvisyate tasmäd yuktyapeksälingäd 12 ägamo 'rthäntaram iti / äha: na anvayavyatirekäbhyäm adhigamahetutvät / yathä krtakatvädir dharmo 13 'nityatvädau 14 visaye drstas tadabhäve cädrsta ity anitye 'rthe niscayam ädadhäty 15 evam 16 sabdo 'pi svärthe drsto ? nyatra tajjätiye 17 na drstah pratipattihetur 18 bhavati / tasmäd anumänäd abhinna 19 eväyam iti / ucyate: candrädisv idänim asädhäranavisayesu kä pratipattih syäd iti / äha: avayaväpeksatvät / candrasabdo hy anekesv avayavesu20 vartate 21 jätidravyagunakriyäsu 22 ca / tathä 2 3 ditthädisabdah / tasmäd evamjätiyakänäm api cänumänäd 24 abhedah / ucyate: svargädlnäm tarhi katham anumänatvam iti / äha: äptav<ädä>visamvädasämänyät 2 5 / yathä hairanyakaprabhrtiX A. atra pariniscitatväd 2 K., P. and D.: apavargapräptih A. apavargapräptivighätah 3 K., P. and D. omit prayukto. 4 K., P., D. and A.: omit prtnäti Dkha. prinätiti 5 A. asandigdhabuddhinäm 6 A. bhavitum 7 K., P. and D.: avisaye 8 A. tu 9 A. sädhanam anumänam pramänam 10 A. etenäkhiläl lingäd D. etena aksaralingät 11

syät

K., P. and D.: arthäntaratvam pratyuktam A. omits <an>arthäntaratvarn pratyuktam / ... anvisyate tasmäd yuktyapeksä. The emendation is suggested by Raghavan. 12 Dkha. yuktyapeksäl lingäd 13 A. krtakatvädivetso 14 D. nityavädau 15 A. ädadäti 16 P. eva 17 A. 'nyatra cätajjätiye Dkha. yatra tajjätiye 18 K., P. and D.: na drstapratipattir 19 K., P. and D.: bhinna 20 K., P. and D.: anekesu vacanesu 21 A. vattate 22 D. jätiguna0, s.m. jätidravyaguna0 23 K., P. and D.: tadä 24 A. apy anumänäd 25 K., P. and D.: äptavaco 'visamvädasämarthyät A. äptavädävisamvädävagamät

(^(bhrantih) apramanyam // (K.35a i.n., not found in D.)

DVITIYAM AHNIKAM SK6.7

101

näm 1 äptänäm väkyam avyabhicäry evam Tsvaramaharsayo 'pi cäptäh 2 / tasmäd esäm api väkyam avyabhicäriti sakyam aträpi sämänyavisayatvam kalpayitum / evam anumänam evägama 3 iti / ucyate: yad uktam (100.12) anvayavyatirekäbhyäm adhigamahetutväc 4 chabdo 'numänam ity atra brümah: na 5 a p r a t i j n ä n ä t ^ V na hi vayam vyavahäränupätinäm vrksädinäm^2)6 ägamatvam 7 äcaksmahe / kirn tarhi / svargädinäm akgantag^^ tasmäd apratijnänäd anupälambho ' y a r n 9 iti / upetya vä vaktrapeksatvät / athavopetyäpi 10 sarvasabdänäm ägamatvam evänumänäd 11 arthäntarabhävam brümah / tathä hi krtakatväd iti Ungarn candälakäpälikair api pray uj yam an am sähacaryäpeksam^3) niscayam ädadhäti 1 2 / na vaktrvisesam apeksate / vaktrvisesäpeksas tu sabdah / tasmän na Ungarn / kirn cänyat / viparyayät / na hi Ungarn desäntare viparyeti / sabdasya tu drsto viparyayah 13 / sa eva hi sabdo desäntare [käläntare tu] svärtham na 14 pratyäyayaty arthäntaram ca prasamsati / s a m b a n d h ä n u p a l a b d h e r iti cet / syäd etat / sambandhäntaram 15 desäntare 'nupalaksitam 16 / tasmäc chabdärthaviparyaya 17 iti / et ad anupapannam lingavaidharmyät / na hi pratya5

10

15

1 Dkha. hiranyakaprabhrtinam 2 A. °maharsayo 'tyäptah 3 K., P. and D.: evam ägama 4 A. anvayavyatirekäbhyäm api cädhigama0 5 K., P. and D. omit na. 6 A. vrksädisabdänäm 7 Dkha. ägamatvam 8 A. atyantaparoksavisayänäm 9 Dkha. vaktrapeksatatvät 10 Dkha. athavopetyädi 11 A. anumänäd 12 A. ädadäti 13 K., P. and D.: drsto viparyayo drstah 14 Dkha. omits na. 15 A. sambandho 16 A 'nupalaksitas 17

K., P. and D.: ° ärthavisayam

^^(apratijiianat) apratijnänäd iti / yadi hi tesam pramanyam abhyupagamyate tadanumanantarbhävacintä sävakäsä / na tv evam svargädisabdesu, nänvayavyatirekau sto 'tlndriyärthavisayatväd iti bhävah / / (K.36a, D.112-1) ^2) (vrksädlnäm) sabdänäm / / (K.36a, D.112 in the left margin) <3) (sähacarya-) sähacaryam iti / avinäbhävabalenety arthah / / (K.36a, D.112-2)

102

YUKTIDIPIKA

5

10

15

ksabhimatasya lingina upalabdhau gavader^1) Ungarn nopalabhyate 1 / sabdas tüpalabhyamäne 2 gavädau nopalabhyate / tasmän na Ungarn / kirn cänyat / desaniyamät / na hi lihgasya desaniyamo drstah / asti tu sabdasya desaniyamah / tadyathä savatir gatikarmä 3 kämbojesv4 eva bhäsyate / ramhatih präcyesu5 tathä dätir 6 lavanartho 7 < präcyesu > dätram udicyesu (cf.MBhäsya.I.9.25ff.) nänyatra / tasmän na sabdo Ungarn / kirn cänyat / istato viniyogät / sväbhävikam Ungarn / na hi dhümo 'gner apakrsya sakyate 'psu väyäv äkäse 'nyatra 8 vä 9 vinivesayitum^ 2 ) 10 / sabdas tu yatra yatra vaktur 11 abhipräyas tatra tatra vinivesyate 12 yathä 1 3 vrddhyädayah 14 sabdäh svängäbhyuccayädisu 15 prasiddhä ädaiksu^ (cf.Pän. 1.1.1) vinivesyante 16 / tasmän na te 1 7 Ungarn / sarväbhidhänasaktitväc chabdasyädosa iti cet / syän matam / sarväbhidhänasaktih sabdah sarväbhidheyasaktis cärthah / tayoh purusavyäpärena saktyavacchedah kriyate / katham / ayam eva sabdo 'syärthasya pratyäyako bhavatu / ayam eva cärtho 'nena sabdenäbhidhiyatäm / etävati 18 purusavyäpärah / tasmäc chabdasya sväbhävikah sambandho vaktrapeksayä vyajyata 19 iti / etad apy 2 0 a n u p a p a n n a m /
2 K. and P.: tüpalabhyamäno 3 A. savatitikarmä 4 A. cäko sv 5 A. präcyabharatesu 6 A. tathä da 7 A. lavanärthe 8 A. äkäsa ity atra 9 A. omits vä. 10 K., P. and D.: nivesayitum 11 A. vaktar yatra yatra 12 A. nivesyate 13 A. tadyathä 14 A. buddhyädayas 15 0

*A. gavade linginopalabhyate

K. and P.: svärthäbhyu A. svätyu0 D. svärthäbhyu0, s.m. svärigäbhyu0 We follow the emendation suggested by D. 16 A. nivesyante 17 A. naitad 18 A. eva tävati 19 D. yujyate 20 A. omits apy.

(1)(gavader) gavader iti / visanadilingam yatnena pariksyamanam iti sesah / anyatha visanädy api kadäcid anavadhänädinä nopalabhyetaiva / nanu sabdo lingy arthavattayänumlyamänatvät / maivam / samayakalpito hy ayam art hah / lokas tu sabdäd art ham pratipadyate / pratipattihetor änjasam lihgatvam loke prasiddham iti bhävah / pratyaksasya visänädilihgavato gaväder upalabdhau satyäm api tadlyam visanadilingam na nopalabhyate 'pi tüpalabhyate / tathä yadi sabdasyalingatvam syät tarhy upalabhyamäne gavädäv art he upalabdhih syät / na tv evam iti lihgavaidharmyam / / (K.36a, D.I 13-1) (2) (vinivesayitum) vini<vesayi>tum* iti / pratipädakatayeti sesah // (K.36a, D.113-2) *K. and D.: viniscetum (3)(ädaiksu) "vrddhir ädaic" iti päninisütram (Pän.1.1.1) / / (K.36b, D.113-3)

DVITIYAM AHNIKAM SK6.7

103

kasmät / sutaräm anumänäd arthäntaratvaprasangät / evam api kalpayitvänumänät sutaräm sabdasyärthäntaratvam äpadyate / kasmät / na hi yathä 1 vaktrapeksayä sarvärthasya 2 satah sabdasya saktyavacchedas tathä sarvärtham Ungarn vaktrapeksayärthäntaräd avacchidyate / yathä caikah sabdo jagaty 3 evam uditah purusaviniyogäpeksah sarvam artham abhidhätum samartho <na> tathaikam^1) Ungarn kayäcid4 yuktyä sarvärthapratyäyanasam art harn 5 / tasmän 6 na sabdo Ungarn / yat punar etad uktam(100.17) candrädlnäm^2) avayaväpeksam sämänyavisayatvam 7 iti / etad asat / kasmät / sv<a>mativyäghätät 8 / yadi khalv api candrädinäm sabdänäm avayaväpeksam sämänyavisayatvam abhyupagamyate yad uktam 9 asädhäranatväd anumänäbhäve sabdaprasiddho 'rtha iti tasya 10 vyäghätah^ 3 )/ kirn cänyat / jätyädisädhyatvät / jätidravyagunakriyänäm 11 ca parasparato 'rthäntaratvam samudäyas ca sädhyah / tasmäd ayuktam esäm tadapeksayä^4) sämänyavisayatvam / yad apy uktam 12 (100.22) äptavädävisamvädasämänyät 13 svargädisabdänäm anumänatvam 14 ity atra brümah: etad apy
X A. 2 A. 3 A. 4 A. 5 A. 6

5

10

15

yatra savärthasya trag ad ity na kayäcid sarvärthapratyayana0 P. smä sabdo Ungarn kayäcid yuktyä sarvärthapratyäyanasamartham / tasmän na sabdo Ungarn in place of tasmän na sabdo Ungarn 7 K., P. and D. omit visayatvam iti / ... avayaväpeksam sämänyavisayatva-. 8 A. svämativyäghätät 9 K., P. and D.: tad ayuktam 10 K., P. and D. omits tasya. 11 K., P. and D.: jätigunadravyakriyänäm 12 A. aktam 13 K., P. and D.: äptavädävisamvädanasämänyät 14 A. anumänatä

'1)(<na> tathaikam) na* ^tathaikam^iti / anvitatvenapi hy ekakaranapurvakatvamatram anumlyate na sarve dharmäh / / (K.36b, D.114-1) *D. omits na. (2)(candra-) candrasabdasyäsädhäranatvenaikasminn arthe pravrtter drstäntäbhävenänvayasünyatvät / tasmäc candrasabdaväcyatvasyäsädhäranatväd ekadharmini yatatväd drstäntadharminy abhäväd anumeyatväbhävena säbdyaiva vikalpätmikayä prasiddhyä prasiddho 'y a m artho ya^ candrah sa saslti tasmät prasiddhibädhita eväyam pakso nänumänabädhitah / ittham vadadbhir bhavadbhte candrädaya ekärthaniyatä upagatäh / idänlm tu sämänyavisayatvena sädhäianavisayä iti vyäghätah* / / (K.36b, D.114-2) *K. omits iti vyäghätah. W (asädhäranatväd anumänäbhäve Sabdaprasiddho 'rtha iti tasya vyäghätah) asädhäranatväd anumänäbhäve Sabdaprasiddho Vtha iti yat svarüpam bhavadbhih saugatair uktam tasya vyäghäta iti sambandhah / / (K.36b, D.114-1) '4^ (tadapeksayä) tadapeksayeti / avayavasamudäyädyapeksayä / na ca tesäm arthäntaratvam bauddhamate sämkhyamate vä siddham iti bhävah / / (K.36b, D. 115-1)

104

YUKTIDIPIKA

5

10

a n u p a p a n n a m / kasmat / pramanavisayatvat^ 1 )/ satyam asty esam samanyaparikalpanä / sä tu pramänavisayä na 1 prameyavisayä / prameyam tu sämänyam anumänasyety ayam abhyupagamo vah / tac cäsädhäranatvät svargädinäm pratisiddham / tasmät tyajyatäm 2 iyam äsankänumänam evägama iti / anyah punar anumänägamayor abhedapratijrW 2 ) idam aha / svargädayah sabdä na 3 p r a m ä n a m / kasmät / pramänäntarena tadarthänupalabdheh / yasya hi sabdasyärthah pratyaksato 'numänato vä nopalabhyate sa na pramänam / itaras tu pramänam 4 tadyathä nadyäs tire pakvam ämravanam 5 pathi gudasakatam 6 viparyastam iti / na ca svargädisabdänäm arthah pramänäntarenopalabhyate / tasmäd yathä vibhur ätmä sarvatra sukhädisambhaväd ity evamädayo bauddham prati dharmyasiddhatväd 7 ayathärth<ä>s 8 tathä vedasabdä api präyeneti / etat W 3 ) na yuktarüpam / kasmät / anyäyena^4) sarvasabdäpavädät / kä hy atra yuktir yad asmadädibhir
X K., P. andD.: 2 A. tyajatäm 3

na tu,

5 A. ämravanam 6 A. gudasarkaräm 7 K., P. and D.: dharmayasiddhatvädayo 8

A. svargädayo na sabdäh A. na pramänam

K. and P.: yathärthäs A. ayathärthas D. °siddhädayo yathä arthäh, s.m. °siddhä na yathärthäh

t1) (pramanavisayatvat) pramanavisayatvad iti / pramanye sadhya aptoktatvam anumanam / na tu svargädisabdänäm svärge pratyaye 'numänatvam iyatä bädhitam bhavati / yathoktam— janmatulyam hi buddhlnäm äptänäptagiräm srutau / j^mnädikop^ogam^ca nänumäne trilaksanah // iti // (K.36b, D.115-2) (2) (abhedapratijfia) abhedapratijna iti / svargädisabdäs tävan na pramänam, ye tu sabdäh pramänam pramänäntarasamvädyarthapratipädakäs te 'numänam upacäräd anumänavat paroksärthavisayatvät / anyas tu vyäcaste anumänägamayor ity anumanam upalaksanam / tena yasya vacanasya pramänena samvädam arthah pratipadyate tad vacanam tatah pramänät pratyaksäd anumänäd väbhinnam upacärät / siddhäntl tv anumänasamvädän mukhyam anumanam uktam ity anirdistadvayam upanyasyati / evam saty apramänatvam ca syäd iti na hy anumänasamvädät pramänätvam bhavaty anumänatvam vä / tato hi pramänatvam nisclyatäm näma / bhavati tu tatpramänäkaranäd eva caityavandanät svarga ityädlnäm aprämänyam yady api sa icchati tathäpy adhyäruhyaivam abhidhänam / asmadguravas tv abhedapratijna iti prasajyapratisedho 'y a m / tenänumänägamayor yo bhedam na pratijänlte / evam hy anumänägamayor bhedah syäd yady ägamo bhavadabhimato vedäbhidhänah syät / na caiva<m>* / tathä hi dvividha ägamah / nadyäs tire phaläni santltyädir laukikas tasya cäptoktatväd eva prämänyam / atas tesäm eväptavädäd avisamvädasämänyäd anumänatä / äptoktam pramänam iti ca pramänäntarasamvädän niscitam / anyah punar ägamah pramänam eva na bhavatlti pürvapaksäbhipräyah / präk tu vedavacasäm api prämänyam abhyupagamyänumänäd abheda ukta iti visesah // (D.115-3, not found in K.) *D.: caiva (3)(etat tu) evam pürvapaksavitvä siddhäntam äha etat tv iti / / (K.37a, D.116-1) (4) (anyäyena) anyäyeneti / anyäyena tävac chabdänäm kesämcit prämänyam yuktam bhavi-

__

DVITIYAM ÄHNIKAM SK6,7,8

105

anupalabhyamänärtham pramänabhütänäm api väkyam ayathärtham 1 syät / sarvena cävasyam2 kascid äpto 'bhyupagantavyah 3 / ato 'yam taträpi samänah prasangah / na ca pramänam svärthasiddhaye pramänäntaram 4 apeksate / tatra yadi sabdasya pramänäntaräpeksam yathärthatvam äsriyate tena na 5 kevalam svargädayah / kirn tarhi / sabdä eväpramänam iti präptam / anumänasya ca pramänäntaranirapeksasya gamakatvänabhyupagamäd 6 ägamasya tato 'rthäntaratvam 7 sutaräm prasajyate 8 / tasmäd yukty ägamavirodhina evamvidhä nästikavädäh 9 sreyo'rthibhir düräd apohyä iti sthitam etad anumänäd asiddham vastu 10 yat tad äptägamät sädhyam iti 1 1 / evam asya trividhasya pramänasya aindriyikam^1) käranäntarato^ 2 ) 12 'nupalabhyamänam ca prameyam vyäkhyätam / etasmät tu yad anyad tad asad iti pratyavagantavyam / / 6 - 7 / / äha: yady 1 3 evam pradhänasyäsattvaprasangah anupalabdhau 1 4 käranäntaratvänupalabdheh 1 5 / tad dhi pratyaksävisayatve 16 saty atidürädibhir anupalabdhikäranair nopalabhyate / tan na tävad atidürät sämipyäd vyavadhänäc cäsyägrahanam / kasmät / vibhutvät / nendriyaghätäd avikalendriyair17 agrahanät 18 / na 19 mano'navasthänäd avasthitamanobhir agrahanät / na sauksmyät 20 sasavisänädinäm sattvaprasangät 21 / näbhibhaväd
X P. ayatharthyam A. athartha 2 A. cäyasyam 3 A. äptas tasya ca väkyam adrstärtham ity abhyupagantavyam 4 A. na ca pramänäntaram 5 A. omits na. 6 A. gamakatväbhyupagamäd 7 K., P. and D.: 'rthäntaram 8 K., P. and D.: prasajyeta 9 A. nästiväcakäh 10 A. asiddhavastu 11 A. omits iti. 12 K., P. and D.: aindriyakakäranäntarato 13 D. ity 14 A. °sattvaprasangopalabdhau 15 A. käranäntaränupalabdheh 16 K., P. and D.: pratyayävisayatve 17 Dkha. avikalpendriyair D. aviklavaindriyair, s.m. aviklavendriyair 18 A. anumänän 19 A. ne 20 A. abhävät 21

5

10

15

A. sasavisänavad asattvaprasangät

turn iti visamvadakatvat / tvadiyena tv anena yatha<rthanam(?)>* sabdanam apramanatvam syät // (K.37a, D. 116-2) *K. and D.: yathä (^(aindriyikam) pratyaksasya // (K.37a. not found in D.) (2) (käranäntarato) anumänägamayoh // (K.37a, not found in D.)

106

YUKTIDIPIKA

5

asambhavat / na samanabhiharad ekatvat / tasmat 1 karanantarabhavato 'nupalabhyamänasyäsattvam 2 icchatah pradhänasya 3 sasavisänavad asattvaprasangah / athaitan nesyate / käranäntaram tarhy anupalabdhau vaktavyam iti / ucyate: yat tävad uktam(105.13) anupalabdhau käranäntaränupapatteh 4 pradhänasyäsattvaprasanga ity aträstu 5 — SAUKSMYÄT TADANUPALABDHIR NÄBHÄVÄT^/ (SK8ab') yat tüktam(105.18) sasavisänädinäm api sattvaprasahga 6 iti tad ayuktam / kasmät / s ä d h a n o p a p a t t e h / asti hi pradhänasya sauksmyät tadanupalabdhau sädhanam na sasavisänädinäm / kirn tat / ucyate:

10

KÄRYATAS TADUPALABDHIH / (SK8b') pradhänasya hi käryata7 upalabdhir ity etad uparistät pratipädayisyämah 8 (SK9) / na tu sasavisänädinäm käryam asti / tasmäd visamo 'ya-m upanyäsah (cf.MBhäsya.1.16.13, U8.18 et passim) / äha: evam api pratijnän<ya>taränarthakyam 9 ekena krtatvät / sauksmyät tadanupalabdhir10 ity ukte gamyata etan näbhäväd iti / tasmät tadvacanam anarthakam^2) iti / ucyate: na vltävltaparigrahärthatvät 1 1 / evam siddhe 12 yat pratijnädvayam karoti taj jfiäpayaty äcäryo(cf.MBhäsya.I.33.17, 1.35.9 et passim) vitävitäbhyäm abhipretärthasiddhih <iti> / präk ca 13 sauksmyätisayät 14 tadanupalabdhir ity äcaksänah pratipädayati purastäd vitah prayoktavya iti /
1 D. kasmat, s.m. tasmät 2 A. °mänasya sattvam 3 K., P. and D.: pradhänasyäpi 4 K., P. and D.: käranäntaränupapattih 5

15

20

K., P. and D.: atas tu ^A. sasavisänädivad asattvaprasanga 7 A. kärya 8 A. pradatipädayisyämah 9 K., P. and D.: pratijnäntaränarthakyam A. pratijnännatarä0 10 A. sauksmyäksadanupalabdhir 11 D. °parigrahärthatvät, s.m. °parigrahärtham 12 A. siddhe satt 13 K., P. andD.: tat 14 A. sauksmyät

(*) (SAUKSMYÄT T D N P L B HR NÄBHAVÄT; K R A A TADUPALABDHIH) sauksmyät tadA A UA A D I ÄYTS anupalabdhir iti / vltaprayoge vihite 'bhäväd eva tadanupalabdhir bhavatu* / na sauksmyäd iti prasarigidharmäntaram, tannivrttir näbhäväd ity avltena kriyate / sauksmyät tadanupalabdhir ity asyä vltapratijfiäyä hetuh käryatas tadupalabdher(SK8b?) iti / tathä näbhävät tadanupalabdhir ity asyä avltapratijnäyä api hetuh käryata upalabdher iti / evam pratijnädvayayogy eka eva hetur ity abhinavaguptakrte sämkhyanirnaye / / (K.37b, D.117i) *K. bhavitum D. bhavitum, s.m. bhavatu (2) (tadvacanam anarthakam) näbhäväd iti vacanam anarthakam sauksmyagrahanad eva näbhäväd ity asyopalabdher iti / / (K.37b, D.117-2)

DVITIYAM AHNIKAM SK8

107

ekasmims ca visaye dvau 1 prayunjänah samuccayena siddhim dyotayati / kim siddham bhavati / yad uktam tanträntariyaih "na prthakpratipattihetü vltävitau" iti tad istam eva2 sangrhitam bhavati / tatra vitasya pratijnä 3 sauksmyät tadanupalabdhih tatra 4 cävitasya prasangidharmäntaranivrttirüpena 5 näbhävät 6 / hetur ubhayayogi / katham / yasya pratyaksato 'nupalabhyamänasya "käryatas tadupalabdhih 7 "(SK8b') tasya "sauksmyät tadanupalabdhih" (SK8a) drstä 8 tadyathendriyänäm / yadi punar asyäbhävad anupalabdhih syät, käryato 'nupalabdhiprasangah / asti ceyam käryata upalabdhih / tasmät "näbhävät"(SK8b') / na ced abhävät parisesatah "sauksmyät tadanupalabdhih" (SK8a) iti / äha: kim punah tat käryam yad bhavän pradhänasyästitve Ungarn9 äcasta iti / ucyate: MAHADÄDI TAC CA KÄRYAM PRAKRTIVIRÜPAM SARÜPAM CA 1 0 // (SK8cd) tad dhi mahad ahamkärendriyavisesävisesalaksanam käryam11 pradhänena visadrsam sadrsam cety uparistät(SK10,ll) pravedayisyämah 12 / äha: prastäväbhäväd ayuktam etat / kim punar adhikrtyedam ucyate prakrtivirüpam sarüpam ca mahadädi käryam iti / ucyate: 13 "vyaktävyaktajnavijiiänän mokso Väpyate" (cf.SK2d) ity etat prakrtam / etäni 14 ca parasparavaidharmyasädharmyapratipattim 15 antarena na sakyam 16 vijnätum 17 ity evamartham idam 18 prastüyate / t asm an näkasmiko vairüpyasärüpyopanyäsa iti / iti yuktidipikäyäm saptatipaddhatau 19 dvitiyam ähnikam /

5

10

15

20

X K., P. and D. dvau 2 A. evam 3 A. omits pratijnä. 4 K., P., D., and A.: tasya Dkha. tatra 5 A. prasiddhidharmäntara0 6 Dkha. ° rüpenäbhävät 7 A. omits tad. 8 K., P. and D. omit drstä ... parisesatah sauksymät tadanupalabdhih(107.7-10). 9 A. astitvalingam 10 A. ca sarüpam 11 A. mahadahamkärendriyävisesavisesalaksanakäryam 12 A. pratipädayisyämah 13 K., P. and D. omit ucyate. 14 A. täni 15 D. °sädharmyapratipaksam, s.m. °sädharmyapratipattim 16 A. sakyäni 17 A. jnätum 18 K., P. and D. omit idam. 19

D. iti srimadäcäryesvarakrsnaviracitäyäm sämkhyasaptatau yuktidtpikänämni vivarane P. iti sriyuktidipikäyäm saptatipaddhatau

T r t i y a m

A h n i k a m

[om namah sivaya 1 /] äha: ästäm tävad vairüpyasärüpyacintä 2 / käryam idam eva tävan 3 mahadädi pariksisyämahe — kirn präg utpatter asti nästiti / kutah samsaya iti cet / syän^1) mat am / asangatärtham prakaranäntaram 4 upaksipyate bhavatä / na cävidyamänasambandhasya samsayasya5 prakaranäntare 'bhidhlyamänasya nirnitim sädhvlm äcäryä manyante 'vakäsäsambhaväd iti / ucyate asti samsayävakäsah / kasmät / acäryavipratipatteh / präg utpatteh käryam asad ity äcäryäh kanädäksapädaprabhrtayo 6 manyante / sad asad iti bauddhäh / naiva san näsad ity anye / tasmäd upapannah samsayah / tatredämm bhavatah kä pratipattir iti / ucyate: nävidyamänasya mahadäder vikärasya pradhänäd ävirbhäva iti pratijänimahe / kasmät 7 / sanniveSavisesamäträbhyupagamät / na hi nah käranäd arthäntarabhütam käryam utpadyata ity abhyupagamah / kirn tarhi / visvätmakänäm sattvarajastamasäm apagatavisesävisesäh sanmätralaksanopacayäh 8 pratinivrttaparinämavyäpäräh paramavibhägam upasampräptäh süksmäh saktayah / täsäm 9 adhikärasämarthyäd upajätaparinämavyäpäränäm sanmätränukramena pracayam upasampadyamänänäm sannivesavisesamätram vyaktam 1 0 / etasyäm kalpanäyäm asata utpattau kah prasanga iti / etenaiva bähyänäm tantvädikäryänäm patädlnäm sannivesavisesamätratväd 11 asata utpattih 1 2 pratisiddhä boddhavyä /

5

10

15

20

1 D. atha trtiyam ahnikam ärabhyate No word of salutation is found in A. 2 Dkha. vairüpyacintä 3 A. and Dkha.: idam etävan 4 K. and P.: asarigatärthaprakaranäntaram D. asangatät prakara0, s.m. asangatärthaprakara0 5 K., P. and 0 omit samsayasya. D. 6 P. känädä A. känäda0 7 A. pratijänimahaikasmät 0 8 A. apagatavisesäs sanmätra D. apagatavisesävisesäh sanmätralaksano0, s.m. apagatavisesävisesasanmätropalaksano0 9 A. tesäm 10 A. omits vyaktam. 11 A. sannivesamätratväd 12

Dkha. asadutpattih (this is also possibly the original reading).

syad iti / sambhavanam pradarsayann abhyupagamamatram etat / / (K.38b, D.120-1)

110

YUKTIDIPIKA

5

10

15

20

aha: avidyamanam 1 etat / kasmat / asiddhenarthantarasiddheh 2 / yadi hi sannivesavisesamätratvam käryasya siddham syäd ata 3 et ad yujyate vaktum tadabhyupagamäd asadutpatter aprasanga iti / tat tv asiddham dravyäntarabhütasyävayavino nispattipratijiiänät / tasmät käkavisänäc chasavisänasiddhivad ayuktam sannivesavisesamäträbhyupagamät 4 satkäryasiddhir iti / it as cäsat käryam / a g r a h a n ä t / iha sroträdinäm visayabhütasya^1) tatsannidhänäd^2) avasyam grahanena bhavitavyam / yadi ca präg utpatteh sat käryam syät tad api sroträdisannidhänäd grhyeta 5 na tu grhyate / tasmäd asat käryam / anupalabdhikäranasadbhäväd 6 iti cet / tatraitat syät / asti präg utpatteh käryasyänupalabdhikäranam / tasmäd asya 7 sato 8 'py agrahanam 9 bhavati / uttarakälam tadvigamäd grahanam iti / etac cänup a p a n n a m / kasmät / asambhavät 1 0 / tad dhi pratyaksavisayatve 11 saty atidürädibhir anupalabdhikäranair(cf.SK7) nopalabhyate / na caisäm tatra sambhavah / tasmäd asad etat / <kim cänyat /> käranäntaränabhidhän ä t 1 2 / na cätidürädivyatiriktam anupalabdhau käranäntaram adhidhve yato J syagrahanam syät / atas cäsad eva / kirn cänyat / käranänupalabdhiprasangät / anupalabdhikäranasadbhävät käryasyägrahanam icchatah käranägrahanaprasangah / kasmät / abhinnadesatväd ekendriyagrähyatvät sthülatväc ca / tat( 3 ) tv anistam / tasmäd ayuktam anupalabdhikäranasadbhävät satah käryasyägrahanam iti / pramänäntaranivrttiprasangäd ayuktam^4^ iti cet / syäd etad / yadi tarhi pratyaksavisayam^5) evästi tato 'nyan nästity etad upagamyate 13 tenätmdriyavisayasyänumänasya nivrttiprasangah / anistam cai1 A. 2

apadyamanam K., P. and D.: siddhenärthäntaräsiddheh A. asiddhenarthantarasiddheh Dkha. asiddhena rthantarasiddheh 3 P. tata A. omits ata. 4 K., P. and D.: sannivesamätrabhyu0 5 P. grhyate 6 A. anupalabdhikäranam sad° 7 Dkha. yasya 8 D. svato, s.m. sato 9 A. api grahanam 10 A. anupasambhavät 11 K., P. and A. pratyaksavisayatve D. pratyaksavisayatve, s.m. pratyaksavisayatve 12 K., P. and D. omit käranäntaränabhidhänät ... atas cäsad eva. 13 A. abhyupagamyate D. upagamyate, s.m. abhyupagamyate

(^(visayabhutasya) sabdasyety arthah / / (K.39a, D.121-1) (2) (tatsannidhänäd) tasya srotrasya sannidhänät / / (K.39a, D. 121-2) (3) (tat) tat käranägrahanam / / (K.39a, D.122-1) (4) (pramänäntaranivrttiprasangäd ayuktam) satkäryavädyuktih / / (K. 39a7 D.122-2) (5) (pratyaksavisayam) pratyaksavisayasyaivästlti pratyayo nänyasya / / (K.39a, D. 122-3)

TRTIYAM AHNIKAM SK9

111

tat / tasmän nänupalabdher asat käryam iti / et ad apy ayuktamW/ kasmät / kriyägunavyapadesäsambhavät / yad dhi pratyaksato nopalabhyate tat 1 kriyayästiti samsücyate yathä harmy ävast hit änäm trnänäm udvahanäd 2 väyuh, gunena yathä mälatHatä gandhena 3 , vyapadesena vä käryädinä yathendriyäni / na 4 präg utpatteh käryasya kriyägunavyapadesasambhavah (cf.VS.9.1) / tasmäd asat käryam / itas 5 cäsat käryam / kartrprayäsasäphalyät / iha präg vyäpäropakramät^2) kartäras tasmät phalam upalipsamänäh käryavisesaniyatasämarthyam sädhanam upädäya vyäpriyante / tac cet präg api vyäpärät syät tadarthasya parispandasya änarthakyam präptam / anist am caitat / tasmät kartrprayäsasäphalyäd asat käryam / parinamädyupapatter adosa 6 iti cet / syän matam / käranasya parinämavyühasamslesavyaktipracayalaksanän dharmän yasmät 7 karträdlni kurvanti nänarthakäni syuh / sattvam ca 8 käryasya na nirudhyate / ka evam sati dosah syäd iti / ucyate na sakyam evam kalpayitum / kasmät / märgäntaränupapatteh / parimäno hi nämävasthitasya dravyasya9 dharmäntaranivrttir 10 dharmäntarapravrttis ca (cf.AKBh.p.159.19, YBh.on YS.3.13) / tatra sato 11 dharmäntarasya nirodhäbhyupagamäd asatas cotpattipratijiiänän 12 nedam märgäntaram 13 ärabhyate / evam vyühädayo 'py upasamhartavyäh / tasmät parinämädibhir abhibhaväc 14 [ca] karträdinäm arthavattväd asat käryam iti 1 5 / tathä coktam— jahad dharmäntaram pürvam upädatte yadä par am / tattväd apracyuto dharml parinämah sa ucyate / / <itas>16 ca na sat käryam / ärambhoparamayor ädyantävisesaprasangät 1 7 / yadi sat käryam syät tena yah kriyärthah sädhanänäm ädau parispandah
2 A. tad dhi 2 K., P. and D.: gunodvahanäd 3 A. gandhana 4 A. na tu 5 K., P. and D.: kutas 6 K., P. and D.: na dosa 7 A. api 8 K., P. and D. omit ca. 9 K., P. and D. omit dravyasya. 10 A, omits dharmäntaranivrttir. K., P. and D.: °nivrttih 11 D. svato, s.m. sato 12 K. and D.: °jnänäc ca P. °jnänän ca 13 A. arthäntaram 14 K., P. and D.: abhävas 15 K., P. and D. omit iti tathä coktam ... parinämah sa ucyate 16 K., P. and D.: kutas A. tac 17 0

5

10

15

20

//.

A. atyantävisesa

(1

)(etad apy ayuktam) asatkaryavädy äha / / (K.39a, D.122-4)

(2) (vyäpäropakramät) samarthät sädhanäd ity arthah / / (K.39b, D.123-1)

112

YUKTIDIPIKA

5

10

15

20

25

so 'nte 1 'pi syat, yo vante 2 viramah sa adav api syat / kasmat / sadavisesat / na tu tad asti / tasmäd asat käryam 3 / <itas>4 casat käryam / utpattidharmasyädyantayor 5 avisesaprasangät / yadi sat käryam syät tena yathä 6 nispannasyotpattidharmenäbhisambandhas tathädäv api 7 syät / yathaivädäv abhisambandhas 8 tathänte 'pi syät / drstas tv abhisambandho näbhisambandhas cädyantayoh / tasmäd asat käryam / itas 9 cäsat käryam / janmasacchabdayor virodhät / iha janmasabdah prägabhütasyärthasya 10 bhävaprakramam 11 äha / sacchabdas tu kriyäntarahetutvam 1 2 / yadi 13 sato janma syäd aikärthyam anayoh syät / na tv etad 14 asti / tasmäd ayuktam saj jäyata iti / ucyate: yad uktam (110.3) dravyäntarabhütasyävayavino nisjDattipratijnänän 15 na sannivesavisesamätratvät sat käryam ity atra brümah: tadasiddhih bhedenägrahanät / yadi tantvädibhyo dravyäntarabhütasyävayavino nispattih syät tena yathä tantukaläpe patas tatraiva vä 16 patäntaram ähitam bhedenopalabhyate tathaivopalabhyeta 17 / na tüpalabhyate / tasmän na dravyäntaram / samaväyäd agrahanam iti cet / syäd etat / samyoginor dravyayoh saty ädhärädheyabhäve bhedena grahanam bhavati / samaväyalaksanä 1 8 tu präptis tantupatayoh / tasmän nästi bhedena grahanam iti / tac cänupapannam / kasmät / asiddhatvät / siddhe saty arthäntarabhäve 19 Vayavinas tatpräptau ca samaväye sarvam etat syät / tat tv asiddham ubhayam / tasmäd ayuktam etat / kirn cänyat / drstäntäbhävät / mahäparimänam 20 dravyam anyaträhitam samaväyäd bhedena nopalabhyata 21 ity etasminn arthe 22 paryanuyuktasya kas te drstäntah / na cästy anudährto vädah / vyäpter agrahanam 2 3 iti cet / syän matam / akäryakäranabhütam dravyam 24 saty api sambandhe na dravyäntaram vyasnuta ity ato bhedena grhya2 K., P. and D.: vä yo 'nte 3 A. kärya iti 4 K., P. and D.: kutas A. tac 5 A. ° dharmasyätyantayor 6 A. tathä tena 7 A. omits tathädäv api. 8 A. yathaiväbhisambandhah 9 K., P. and D.: kutas 0 10 A. präg na bhütasyä Dkha. prädurbhütasyä0 11 K., P. and D.: bhävakramam 12 K., P. and D.: °hetutvam äha 13 A. yadi ca 14 A. aitad 15 K., P. and D. omit nispattipratijnänän ... tantvädibhyo 16 K., P. and D. omit vä. 17 A. omits tathaivopalabhyeta / na tüpalabhyate. 18 A. samaväyalaksanät 19 A. arthäbhäve 20 A. samhäraparimänam 21 Dkha. bhedenopalabhyate 22 A. etan matam instead of etasminn arthe 23 A. vyäpte na grahanam 24

dravyäntarabhütasyävayavino.

K., P. and D. omit dravyam.

TRTIYAM AHNIKAM SK9

113

te / tantupatayos tu käryakäranabhütatväd vyäptih / tasmän nästi bhedena grahanam iti / etad apy ayuktam / kasmät / sädhyatvät / saty arthäntarabhäve 'vayavidravyäntaravat käryakäranabhävah 1 sädhyah samaväyas ca / ata iyam vyäptih syät / sä cäprasiddhety ato na samyag etat / vemädivad 2 iti cet / syäd etat / yathä 3 saty arthäntarabhäve vemädayo 4 Vayavinah käranam evam tantavo 'pi <iti> / etad 5 anupapannam / kasmät / anabhyupagamät / karanam 6 vemädayah 7 patasya 8 na käranam ity ayam abhyupagamo 9 nah 1 0 / tasmäd visamo ' y a m drstäntah / kirn cänyat / tadvad avyäptiprasangät / vemädivad 11 arthäntaram patät 1 2 tantava ity evam bruvatas tadvad avyäptiprasangah / kirn cänyat / sparsakriyämürtigurutväntaravatas tadvati pratlghätät / iha 13 sparsäntaravati sparsäntaravatah 14 pratighäto drstah / tadyathä ghatasyäsmani / sparsäntaraväms ca te patas tantubhya ity ato 'sya 15 tadvyäpitvam 16 ayuktam / evam ca kriyädayo vaktavyäh / tasmäd yuktam etad bhedenägrahanän 17 nävayavi dravyäntaram iti 1 8 / itas ca 19 nävayavi dravyäntaram / krtsnaikadesavrttyanupapatteh / sa hy avayavesu vartamänah krtsnesu vä 20 vartate pratyavayavam vä / kirn cätah / tan na tävat krtsnesu vartate / kasmät 2 1 / ekadesagrahane grahanäbhävaprasangät 2 2 / yad anekesu vartate tasya krtsnädhäragrahane sati grahanam 23 spastam 2 4 / tadyathä dvitvädlnäm / evam ca sati visänädigrahane gograhan<äbhäva>prasangah25 / kirn ca avayavänavasthäprasangät / sa hy avayavän vyäpnuvams 26 tadvyatirekenävayaväntaräbhävät kena vyäpnuyät / avayaväntaräbhyupagame cänavasthäprasangah 27 / krtsnaikadesavrttiprasarigas 28 ca samänah / tasmän na sarvesu parisamäpyate /
1 A. karmakäranabhävah 2 D. vimädivad, s.m. vemädivad 3 K., P. and D.: tadyathä 4 D. vTmädayo, s.m. vemädayo 5 A. etad apy 6 A. käranam D. karanam, s.m. karä 7 D. vimädayah, s.m. vemädayah 8 A. omits patasya. 9 Dkha. abhyupagamo 'yarn 10 K. and P.: vah A. na D. vah, s.m. nah 11 D. vtmädivaa1, s.m. vemädivad 12 P. patä 13 K., P. and D.: iti 14 K., P. and D. omit sparsäntaravatah. 15 A. has a lacuna in the place of bhya ity ato 'sya. 16 18 A.ita 19 A. omits 20 A. omits 21

5

10

15

20

A. tadvyäptitvam K. and P.: bhedänäm grahanän D. bhedänäm grahanän, s.m. bhedenägrahanän

itas ca. vä. A. tasmäd 22 A. omits grahanäbhävaprasangät / yad anekesu vartate tasya krtsnädhäragrahane. A. (ekadesagrahane) saty agrahanam A. and Dkha.: drstam (this is also possibly the original reading). 25 All the Mss read gograhanaprasangah. 26 A. avayavät präpnuvams A. °prasangät 28 A. krtsnaikavrttidesaprasangäc

114

YUKTIDIPIKA

5

10

15

na 1 pratyekam / anekatvaprasangad / anekadharaparisamaptam hy anekam rüpädi drstam iti / kirn cänyat / sästrahäneh / pratyavayavam parisamäpto VayavTty etad icchato mürtimatävayavena samänadesah 2 syät / tatas ca yac chästram "mürtimatäm asamänadesatvam" iti tasya vyäghätah / avayavaparimänam ca p r ä p n o t i ^ mahattvädiparisamäptatvät 3 / ekadravyam ca 4 präpnoti( 2 V tatas ca yac chästram "dravyam anekadravyam adravyam vä" (cf.Vyo.p.231.5-6;VSC.onVS.2.1.11) <iti> tasya hänir etävatä cäsya vrttir 5 bhayaiiti^ bhavet / sarvathä ca dosah / tasmän nävayavi dravyäntaram / arthäntarävasthäne^ 3 ) 'rthäntarotpattivinä^adarsanäd anyatvam' 4 ' 6 iti cet / syäd etat / vidyamänesu 7 tantusu pato na bhavati samyogalaksanasya käranäntarasyänutpatteh / samyogottarakälam tu 8 bhavati^ 5 )/ käranasämagryä 9 vidyamänesv eva ca tantusu vinäsam upayäti 1 0 / vibhägäd^6) arthäntarävasthäne 11 cärthäntarotpattivinäsau drstau / tadyathä himavadavasthäne davägneh 12 / tasmäd arthäntaram 13 pat as tantubhya iti / etad apy ayuktam / kasmät / sädhyatvät / sädhyam tävad etat kirn aträrthäntaram 1 4 utpadyate vinasyati vähosvit tantusv eva samavasthänavisesäpeksasya patäbhidhänasya pravrttinivrtti senävanavad bhavatah / tasmäd etad api nävayavino 15 dravyäntarabhäve Ungarn / tatpurusabahuvrihidvandvasamäsopapatter anya iti cet 1 6 / syän matam / ihärthäntaratve sati tat1 D. tena, s.m. na 2 A. na samänadesah 3 A. na mahattvädisamäptatvät 4 K., P. and D.: na ca 5 K., P. and D.: etävatz vrttir 6 A. anyathätvam 7 A. dvidyä0 8 A. omits tu. 9 K., P. and D.: °sämagryäd 10 A. upayänti 11 D. ° ävasthone, s.m. ° ävasthäne 12 A. dävägnes 13 P. athäntaram 14 A. omits atra. 15 K., P. and D.: apy avayavino 16

K., P. and D.: ° dvandvasamäse instead of °dvandvasamäsopapatter anya iti cet

(^(prapnoti) pratyavayavam parisamaptipakse / / (K.40b, D.127 without number) (2) (präpnoti) avayavl// (K.40b i.n., D.127 without number) (3) (arthäntarävasthäne) asatkäryavädy ähärthäntareti // (K.40b, D.127-3) (4) (anyatvam) patasya / / (K.40b i.n., not found in D.) (5) (bhavati) patah / / (K.41a, D.127-4) (6) (vibhägäd) prthag arthäntaratvenävasthänät / na tv evam satkäryavädipakse patasya tantubhyah prthagavasthänam iti / / (K.41a, D.127-5)

TRTIYAM AHNIKAM SK9

115

puruso drstah / tadyathä räjnah puruso räjapurusa 1 iti / bahuvrihis ca citraguh sabalagur iti 2 / dvandvas ca plaksanyagrodhäv iti / asti cehäpi tatpurusas tantünäm patah / bahuvrihis ca drdhatantuh suklatantuh 3 / dvandvas ca tantupatäv iti / tasmäd avayavy4 arthäntaram iti 5 / etac cäyuktam 6 / kasmät / anekäntät 7 / ananyatve 'pi hi 8 tatpuruso drstah / tadyathä senägajah känanavrksa iti / bahuvrihis ca virapurusä 9 mattagajä seneti^ 1 ) 10 / dvandvas tu yadi syät satyam evärthäntaram 11 avayavi syät / na tu kascit patävasthäyäm evam 12 prayunkte 13 tantupatäv änayeti / tasmän manorathamätram etat / etena samäkhyäsämarthyabhedäh pratyuktäh / te cäpi cänarthän<tara>tve 14 sati senädisu drst<ä>h 15 / tasmän nävayavi dravyäntaram / dravyäntarabhütasyävayavino <nispattipratijnänän na tu sannivesavisesamätratvät> 16 sat käryam ity etad ayuktam / yat punar etad uktam (110.10) anupalabdher asat käryam ity atra brümah: etad apy ayuktam / kasmät / samsayakäranatvät / sa<d>asadvisayänupalabdhir 17 ity etasmäd eva hetoh sämsayikä vayam / täm eva tu niscayärtham avalambamäno na yuktimärgam anuyäti / yat punar etad uktam(110.15) käranäntaränabhidhänäd ity etad apy anupapannam / kasmät / abhipräyänavabodhät / yo hi yathä künde bad<a>räny 18 arthäntarabhütäny <ä>hitäni19 tathä kärane käryam astlty äcaste tarn praty ayam upälambhah syät / vayam tv anekasaktadharminah sahakärisaktyantarä<nu>grhitasya 20 pürvasyäh saktes tirobhävam uttarasyäs cävirbhävam upädadhänäh käranam eva käryam ity anumanyämahe / tayos tu saktyor yugapad agrahanam itaretarapratibandhahetutvät / vastrasyäyämavistäravat kürmängam iva drastavyam / yathä vastrasyopasamhärapratibandhäd äyämavistärau na grahanavisayatäm pratipadyete sattäm vä na jahitah
1 K., P. and D.: rajnah purusa iti 2 K., P. and D. omit iti. 3 A. suklam tantuh 4 K., P. and D.: tasmäc cävayavo 5 K., P. and D. omit iti. 6 A. etad apy ayuktam (this is also possibly the original reading). 7 A. anaikäntät 8 K., P. and D. omit hi. 9 A. drsto virapurusä 10 D. mattgajä send iti, s.m. mattagajasenä iti 11 K. and P.: evävayaväntaram D. avayaväntaram, s.m. arthäntaram 12 K., P. and D.: eva.... 13 K., P. and D. omit prayunkte ... präg utpatteh käryasya samadhigamam 14 A. cänarthänatve 15 16

5

10

15

20

25

(115.8-116.15).

A. drstas We follow Pandeya. A. nispattipratijnänänänusannivesavisesamätratvät A. sa ca sadvisayä0 18 A. badiräny We follow Pandeya. 19 A. ahitäni We follow Pandeya. 20 A. ° saktyantarägrhitasya We follow the suggestion of Pandeya.

(*) (mattagajasena) matta gaja yasyam senayam sa gajadinam senangatvenasenatvat / / (K.41a, D.I28 without number)

116

YUKTIDIPIKA

5

10

15

20

kurmasyevangani tatha tantvadmam api bhavanam karanabhimata karyabhimatä cävasthä / <kramena tv ävis tiras ca bhavanti>1 / tannimittas tadgrahanägrahanavikalpah / etena käran<ä>grahanam2 pratyuktam (110.17) / yad apy uktam(110.21) pramänäntaranivrttiprasangäd iti satyam etat / yat tüktam(111.2) kriyägunavyapades<ä>sambhaväd anumän<ä>bhäva3 iti tad anupapannam / kasmät / prthaktvänabhyupagamät / käryakäranaprthaktvavädinas tatkriyägunänäm prthaktvam anumätum yuktam ity <atas> tantvavasthäne 4 patakriyägunagrahanäd anumänäbhäva ity ayara upälambhah sävakäsah syät / asmäkam tu käranamätrasyaiva sanghätäd äkäräntaraparigrahäd vä kriyägunänäm pracitir vyaktiviseso bhavatiti bruvatäm adosah / vyapadesas tu käryakäranaparyäyah / so 'y u ktah / kasmät / anekäntät / dravyagunatvakarmatvädinäm kriyägunakäryakäranabhävo 'tha ca sattvam isyate bhavadbhir atha lingaparyäyah / na tarhi vayam paryanuyojyä vyapadesäbhäväd asat käryam iti / kirn käranam / prakaranät / vipratipattau hi satyäm lingatah präg utpatteh käryasya samadhigamam karisyäma 5 iti prakrtam evait a t 6 / anaikäntikatvam ca 7 samänam nispattyanantaram dravyasyästitväbhyupagamät / "agunavato dravyasya gunärambhä<t>( 1 ) 8 karmagunä agunäh 9 " (VS.7.1.12) iti vacanäd utpannamätram dravyam niskriyam nirgunam avatisthata iti vah paksah / na cäsya tathäbhütasya^ 2 ) lingam asti / atha cästitvam bhavadbhir abhyupagamyate / siddher^3) grahanät sadbhäva 10 iti cen na sarvavivädasiddhiprasangät / drstäntaviruddham^ 4 ) artham pratijiiäya prati<s>idhyamänena11 siddhabuddhivisayatä smartavyetyt 5 ) 12 etasyäm kalpanäyäm sarvavädasiddhiprasangah syät / kirn cänyat / pratipakse
l A. kramena vä sthiras ca bhavan 2 A. käranagrahanam 3 A. kriyägunavyapadesasambhaväd anumänäbhäva We follow Pandeya. 4 A. atantvavasthäne We follow Pandeya. 5 K., P. and D. read pürayisyäma instead of karisyäma after a lacuna (cf.p.H5,fn.l3). 6 A. evetad 7 K., P. and D. omit ca. 8 K., P. and D.: gunärambhah A. gunärambhäh 9 A. akarmagunä instead of agunäh 10 A. grahanäsadbhäva 11 K., P. and D.: pratividhyamänena A. pratipädyamäna We follow Raghavan. 12

A. siddhabuddhivis ayanämantavyety

(1)(gunarambha<t>) prathame pakse / / (K.41a i.n., D.129-1) (2) (tathäbhütasya) agunavato dravyasyotpattau / / (K.41a, D.129-2) (3) (siddher) utpannamätrasyadravyasyasiddhihsarvajnairgrhyataiti tasyästitvasambhavah// (K.41a, D.129-2) (4) (drstäntaviruddham) drstäntaviruddham pramänaviruddham ity art hah / bhüyodarsane vyäptipakse vä drstänta eva yuktimülam iti yuktiviruddham ity arthah / / (K.41a, D.1293) (5) (siddhabuddhivisayatä smartavyä) ärtatränakärinl devatä käcid evety upahäsah / / (K.41b, D.129-4)

TRTIYAM AHNIKAM SK9

117

ca 1 s a m ä n a t v ä t / asmatpakse 'pi tarhi bhagavatpancasikhädmäm pratyaksat v ä t ^ sat käryam 2 abhyupagantavyam / tasmän na kriyägunavyapadesasambhaväd asat käryam / yat punar etad uktam(111.7) kartrprayäsasäphalyäd asat käryam ity atra brümah: etad apy ayuktam / kasmät / ASADAKARANÄT / (SK9a') yady ubhayapaksaprasiddhasyäsatah kriyäyogah syäd ata etad yujyate vaktum kärye sati kartuh prayäso 'narthaka iti / tat tv asatah karanam 3 anupapannam / tasmäd ayuktam etat / h e t v a n a b h i d h ä n ä d a s i d d h i r (2) iti cet / syäd etat / yathä 4 nispannatvän madhvädinäm dhäranasamartho ghato na kriyata 5 ity ayam apadisto hetur asmäbhir evam 6 ittham käryasyäsatah 7 k<a>ranam8 nopapannam^3) iti noktam bhavatä / tasmäd asiddhir iti / etac c ä n u p a p a n n a m / kasmät / saty asati v ä s a m b a n d h e d o s a p r a s a n g ä t / tad dhi kriyamänam sati vä sambandhe kärakaih kriyate 'sati vä / sambandhas cäsya bhavan 9 pravrttikäle^ 4 ) 10 vä kärakänäm 11 syän nivrttikäle 12 vä / kirn cätah / tan na tävat pravrttikäle 13 sambandho yuktah / kasmät / a d r a v y a t v ä t / pravrttikäle karträdinäm kriyägunavyapadesäbhäväd avastubhütam sasavisänasthäniyam 14
1 K.f P. and D. omit ca. 2 D. satkäryavädam 3 A. käranam 4 A. omits yathä. 5 A. ghatah kriyata. 6 7 K., P. and D.: käryasya satah Dkha.(?) käryasy äs at ah(cf.p.117,fn.(3)) 8 All the Mss read käranam. 9 A. bhavat 10 D. pravrttikäri, s.m. pravrttikäle 11 A. käranänäm 12 A. nispattikäle D. nivrttikärt, s.m. nivrttikäle 13 D. pravrttikärT, s.m. pravrttikäle 14 0

5

10

15

A. eva

K., P. and D.: avastubhütasasavisäna

(^(pratyaksatvat) yad dhi pratyaksato nopalabhyate tat kriyayasüti samsucyat a (111.2) ityadina pürvoktena kriyägunavyapadesäsambhaväd(111.2) asat käryam uktam tan* neti / / (K.41b, D.129-5) *D. san, s.m. tan (2) (hetvanabhidhänäd asiddhir) hetvanabhidhänäd asiddhir ity atroktä yäsiddhih / / (K.41b, D.130 without number) (3) (käryasyäsatah k<a>ranam nopapannam) käryasyäsatah käranam nopapannam* ity anyädarse** / / (K.41b, D.129 in the right margin) * D. omits nopapannam. ** D. anyädarse päthah <4) (pravrttikäle) kärakapravrttikäle / / (K.41b, D.130 without number)

118

YUKTIDIPIKA

5

vah karyam na casti tathabhutasya^ 1 ) vastubhutena^2) sambandhah / atha 1 nivrttikäle^ 3 ) 2 'bhisambadhyate 3 yad uktam(111.7) sato 4 nispannatvät kriyänutpattir iti tasya vyäghätah / atha 5 matam asaty api sambandhe nispattir 6 bhavatiti tena kärakavyäparavaiyarthyaprasangah / präg api ca 7 kärakopädänät käryanispattiprasanga 8 iti / uktam ca— asattvän nästi sambandhah kärakaih sattvasangibhih / asambandhasya cotpattim icchato na vyavasthitih^4)9 / / iti 1 0 / (see SKT. on SK9)

10

äha: nanu ca madhyame käle karträdibhih käryam kriyate / kah punar asau madhyamah käla iti / äha— ärambhäya prasrtä yasmin käle bhavanti kartärah / käryasyä nis<n>ätäs11 tarn madhyamam kälam icchanti 12 / / yadä hetavah pravrttärambhä 13 bhavanty uddisya käryam na ca tävan 14 naimittikasyätmaläbhah samvartate sa madhyamah kälah / tasmin kriyate kärakaih käryam iti / ucyate: na avasthäntaränupapatteh / prän nispatter asattä nispannasya 15 sattety avasthädvayam 16 / sadasadrüpä cävasthä 17 nästi yo madhyamah syät / ato na yuktam et ad iti / kirn cänyat / pürvadosaparihärät 1 8 / uddisya
1 A. sarnbandhätha 2 A. nispattikäle 3 A. sambadhyate 4 D. svato, s.m. sato 5 A. vyäghätätha 6 A. sambandhanispattir 7 A. omits ca. 8 A. omits kärya. 9 A. mativibhramah instead of 10 A. omits iti. 11 P. käryasyä nisna~ta~s{7) 12 K., R and D.: icchantiti 13 K., P. and D.: pravrttä 14 A. täva 15 A. nispannasya ca 16 A. avasthyadvayam 17 K., P. and D.: ca sattä 18

15

na vyavasthitih (cf.p.H8,fn.(4)) A. käryasyänistätas

A. pürvadosänapahäräd

t1) (tathabhutasya) avastubhutasya / / (K.41b, D.130 without number) (2) (vastubhütena) käranarüpena // (K.41b, D.130 without number) (3) (nivrttikäle) karträdlnäm / / (K.41b, D.130 without number) (4) (na vyavasthitih) mativibhrama iti ca päthah* / / (K.42a, D.130 without number) *D. kha pustake 'pi ca mativibhramah iti ca päthah

TRTIYAM AHNIKAM SK9

119

käryam tasyätmano läbhät kena saha sambandha ity aträpy ayam paryanuyogo naiva nivartata iti / tasmäc citram api väkyam prasärya na kimcit parihrtam bhavatä / tasmäd yuktam etat saty asati vä sambandhe dosaprasangäd asan na kriyata iti / yasya punah sat käryarn tasya doso nästi / kasmät / UPÄDÄNAGRAHANÄT / (SK9aV) upädänam iti käranam tantvädy äcaksmahe / tad^1) dhi tasya^2) kärakair^3) grhyate 1 'bhisambadhyata ity arthah / tasmäc ca närthäntaram 2 käryam ity atah käranenäbhisambaddhänäm 3 kärakänäm käryenaiva sambandho bhavatity adosah / äha: nanu ca yasyäpi sat käryam tasyopädänäd arthäntaram 4 tat käryam syät / kasmät / käryärthibhir upädänät / yad yadartham^ 4 ) upädiyate tat 5 tasmäd arthäntaram tadyathä vemädibhyah patas tantavas ca patä<rth>ibhir6 upädlya<n>te 7 / tasmät tebhyo 'py arthäntaram 8 patah / etena sattvam pratyuktam / yad yadartham upädiyate tat tasminn asad yathä vemädisu pata iti / ucyate: na avayavipratisedhät / pratisiddhas tävad avayavi dravyäntarabhütah / tasmäd anupapannärtham etat / kirn cänyat / SARVASAMBHAVÄBHÄVÄT / (SK9b') upädänasämänyäd vemädivad arthäntaram 9 patas tantubhya iti bruvato 'rthäntaratvasämänyät 10 tantuvat sarvasmät käranät käryasya sambhavah 11 syät / na tv evam asti / tasmät sarvasambhaväbhäväd asamyag etat / kirn cänyat / jätibhedaprasangäd 1 2 arthäntarärambhaprasangäc ca / upädänasämänyäd vemädivad 13 arthäntaram patas tantubhya iti bruvato
1 A. kriyate 2 A. tasmäd anarthäntaram 3 K., P. and D.: kärakenäbhisam0 A. käranenäbhisambandhänä 4 A. anantararn 5 K., P. and D. omit tat tasmäd ... pratyuktam / yad yadartham upädiyate. 6 A. patädibhir 7 A. upädiyate We follow Pandeya. 8 A. arthyantaram 9 D. vtmädivat padärthäntaram, s.m. vemädivad arthäntaram 10 K., P. and D.: 'rthäntarasämänyät 11 A. sadbhävah 0 12 13

5

10

15

20

A. jätiprabheda D. vimädivatäd1 s.m. vemädivad

(x)(tad) tantvädi / / (K.42a, D.131 without number) (2) (tasya) patasya / / (K.42a, D.131 without number) (3) (kärakair) kärakaih / patasya nimittakäranaih kuvindaturlvemädibhih* / / (K.42a, D.131-2) *D. °turtya° (4) (yadartham) yannispattaye* / / (K.42a, D.132 without number) *D. nispattaye

120

YUKTIDIPIKA

5

10

15

20

yatha vemadibhyo 1 bhinnajatiyc^1) bhinnadesas ca tatha 2 tantubhyah patah syät / yathä cävasthite pate vemädayah patäntaram kurvanti tathä hy avasthite pate tantavo 'pi patäntaram ärabheran / na caitad istam / na tarhy upädänasämänyäd vemädivat tantubhyah patasyärthäntaratvam / yat punar etad uktam(l 19.15) yad yadartham upädiyate na tat taträstity atra brümah: ayuktam etat / kasmät / ädhärädheyabhävänabhyupagam ä t 3 / asakrd uktam asmäbhir na tantusu pato näma kascid asti / kirn tarhi / tantava eva patah <iti(?)> / tat tu sanmärgavidvesäd bhavatä na grhyate / kirn cänyat / anekäntät 4 / upetya^2) vä brümah: katham tävat tiläs tailärtham upädiyante bhavati cätra tailam / mrdvikä rasärtham upädiyate bhavati cäsyäm rasah / godhuk ca payo'rtham 5 gäm ädatte 6 bhavati ca tasyäm 7 ksiram / sälikaläpas ca tandulärtham upädiyate santi cätra tandulä ity 8 anaikäntiko hetuh / äha: ävaranopalabdher ayuktam / tilädisv ävaranam pratyaksata upalabhyate tatpratibandhät tailädinäm agrahanam / vyäpäras 9 ca kartus tadvigamärtho 10 na tu käryasyävaranam asti^3) / tasmäd visamo drstäntah / ucyate: na märgäntaratvät 1 1 / yad yaträsti 12 na tat 1 3 tadartham upädiyata 14 iti pürvam bhavatätisrstam (119.15) / idänlm tv ägamavigamärtham^ 4 ) 15 sato 16 'py upädänam iti bruvato märgäntaragamanam pürvavädatyägo 'naikäntikasya cäparihära iti 1 7 / yat punar etad uktam (111.11) parinämädyupapatter adosa iti tathä tad
1 D. vimadibhyo, s.rn. vemadibhyo 2 K., P. and D.: tathävasthite instead of tathä tantubhyah patah syät yathäcävasthite 3 A. ädhärädheyänabhyupagamät 4 A. anaikäntät 5 A. payo 6 A. upädatte 7 A. cäsyäm 8 A. ity ayam 9 K., P. and D.: agrahanavyäpäras 10 K. and P.: tadvirägärtho A. tadvigamo D. tadvirägärtho, s.m. tadvigamärtho 11 A. nämärthäntaratväd 12 A. yatra nästi 13 A. tan na 14 A. upädhiyate 15 A. avagamavigamärtham 16 D. svato, s.m. sato 17

A. omits iti.

(^(bhinnajEtlyo) patah / / (K.42b, D.132 i.n.) (2)(upetya) bhavanmatam / / (K.42b, D.133-1) (3) (na tu käryasyävaranam asti) na tu tathä käryasya patäder ävaranam asti yena tadvigamärthah kartur vyäpärah / / (K.42b, D.133-2) (4) (ägamavigamärtham) pratibandhavigamärtham / / (K.42b, D.133 in the right margin)

TRTIYAM AHNIKAM SK9

121

astu / yat tüktam(111.15) märgäntaränupapatter ity atra brümah^ 1 ): etad apy ayuktam / kasmät / parinämadharmänavabodhät / sato dharmäntarasya nirodham asatas cotpattim parinämam abhidadhato vyaktam ayam upälambhah syät / na tv anayä kusrtyä 1 pratisthämahe / kirn tarhi / sädhanänugrhitasya dharmino dharmäntarasyävirbhävah pürvasya ca tirobhävah parinämah / na cävirbhävatirobhäväv utpattinirodhau 2 / vyühasarnslesavyaktipracayas tu kim asato 3 dharmä uta svayam 4 asanta iti vicäryam / kirn cätah / yadi 5 tävad asato dharmäh yathä kasyeti väcyam / atha svayam asantah pascäd bhavanti / tad apy ayuktam / kasmät / anarthäntaratvät 6 / saty arthäntarabhäve präg asantah pascäd upalabhyamänäh satkäryavädam niräkuryuh 7 / sa caisäm arthäntarabhävo na prasiddhah / tasmät kim atrotpannam / grahanägrahanavikalpe coktah parihärah / kim cänyat / dravyäntarotpattivyäghätät 8 / upetya vaisäm^2) utpattim brümah: yadi hi parinämavyühasamslesavyaktipracayamätram käryam isyate yad uktam "dravyäni dravyäntaram 9 ärabhante" (VS.1.1.8) iti tasya vyäghätah / kasmät / na hy ete bhävä dravyäntaram / tasmäd dinakarakiranapratäpamürcchitasyeva 10 dävägnyupasarpanadoso 'nutäpäyaiva 11 bhavatah pratipattih / etenärambhoparamotpatty<ädyantä>visesaprasango 12 janmasacchabda<virodhas>(?) 13 ca pratyuktah 14 (111.23, 112.8) / katham / ätmabhütam hi tantünäm 15 patäkhyam vyühasthämyam 16 sannivesavisesam yadä kärakäni svena svena vyäpärenäviskurvanti tadä kriyata utpadyate jäyata 1 7 ity evamädir lokasya vyavahärah pravartate / yadä tu kärakäni saktyantarävirbhävät samsthänäntarenautsukyavartitäm 18 avasthäm upasam1 A. anayänusrtyä 2 A. °tirobhävau cotpattinirodhau 3 K. and P.: sato D. svato, s.m. sato 4 K. and P.: svato (this is also possibly the original 5 A. tad yadi 6 Dkha. arthäntaratvät 7 A. niräkuyuh 8 A. dravyäntarotpattivyät 9 A. omits dravyäntaram ... na hy ete bhävä. 10 P. °mürcchitasyaiva X1

5

10

15

20

reading). D. svato, s.m. svayam

K., P. and D.: dävägnyupasarpanadosänutäpäyaiva A. davägnyupasarpanam doso 'nupaghätäyaiva We follow Pandeya. 12 K., P. and D.: etenärambhoparamotpattyavisesaprasango A. etenärambhe parama utpattyavisesaprasarigo 13 K., P. and D.: janmasacchabdas A. janmasasabdas 14 P. janmasacchabdapratyuktah 15 A. omits tantünäm. 16 A. vyahasthämyam A. jantünäyata 18 Dkha. saktyantarävirbhävätmasthänä0

' '(atra brumah) tatra sato dharmäntarasya nirodhabhyupagamäd asatas cotpattipratijnanan nedam märgäntaram ärabhyata (111.17-18) ityädy asatkäryavädyuktam düsayitum äha — atra brüma iti / / (K.42b*, D.133-3) *Though found in the margin of K42b, this note refers to atra brümah of K43a. (2)(esäm) vyühädlnäm / / (K.43a i.n., D.134 without number)

122

YUKTIDIPIKA

5

10

haranti tada prag upalabdham samsthanam vinasasabdavacyatam pratipadyate / paramärthatas tu na kasyacid utpädo 'sti 1 na vinäsah / yat punar et ad uktam (112.8) janmasabdah prägabhütasyärthasya bhävaprakramam 2 äheti tad apicchämätram / kasmät 3 / vivädät / sadasadvisayam 4 janmeti viväde 'nusakte janmasabdah 5 prägabhütasya sadbhävam äcasta iti bruvato 'nuktasamam / purusadäv adrstatväd asiddhir iti cet / syäd etat / yadi tarhi 6 kriyata utpadyate jäyata ity eso 'rthah sadvisayah kalpyate 7 pradhänapurusayor api tatprasangah sadavisesäd^ 8 ity atas ca vivädävastham evaitat prakaranam iti / e t a c cayuktam^ 2 )/ kasmät / samsthänavisayat v ä t 9 / yadä bhävah svato 'narthäntarabhütam samsthanam bhajate tadaite 10 sabdäh pravartanta ity uktam / drstam ca loke tadyathä mustigranthikundaläni karoti janayaty utpädayati / abhivyaktätmasujcajmü^Jbkädisu^11 bhavaty utpannam jätam iti / ubhayapaksaprasiddhe 12 tu sasavisänädau naite sabdäh pravartante / tasmäd bhavata evänistaprasahga iti / uktam ca— yady asattvam ghatädinäm utpattau hetur isyate / sasasrnge 'pi tulyatväd utpattis te prasajyate / / iti siddham sat käryam / itas ca sat käryam / SAKTASYA SAKYAKARANÄT / (SK9c)

15

20

sakyam idam asya saktas cäyam asyety ayam niyamah satäm drstah / tadyathä caksuso rüpasya ca 1 3 / asti cäyam pat asya vemädinäm ca 14 niyamah / tasmäc
1 A. kasyacido 'sti 2 K., P. and D.: bhävopakramam 3 D. tasmät, s.m. kasmät 4 K., P. and D.: sadvisayam0 5 A. janmasabdeh D. jarma , s.m. 6 A. tahi 7 P. kalpyeta 8

janma0

K. and P.: sadasadavisesäd A. sadasadvisesäd D. sadasadavisesäd, s.m. sadavisesäd The reading of sadavisesäd is attested by the marginal note of K (cf.p.l22,fn.(l)). samsthävisayatvät not clear.' A. and Dkha.: ca mülodakädisu K indicates a lacuna with three dots, while P. does so with four and D. with three dots and two dashes. D. reads in the top margin that kha. pustake trutir nästi, and in the bottom margin that kha. pu° camülokädisu ity evam päthah na tu madhye camüpadäntaram trutih. 12 A. °prasiddhes 13 K. and P. omit ca. D. rüpasya, s.m. rüpasya ca 14 K., P. andD. omit ca.
9 P. 10 A. 11

(1)(sadavisesat) sadavisesat sattvavisesat / / (K.43b, D.135 without number) (2) (vivädävastham evaitat prakaranam iti / etac cäyuktam) saty* eva janmasabdah prayujyata ity etad vivädapatitam purusadäv adrstatvät / atra parihäram äha—etac cäyuktam iti / kramavicitrasvabhäve bhäve tathä kramaviciträdhyavasäye visaye** 'mlsäm s ab d an am avakäsah / purusas tu na tathä cinmätrasvabhävatvät / / (K.43b, D.135 without number) *D. etat prakaranam iti saty. **D. ° ähyavasäy avis aye

TRTIYAM AHNIKAM SK9

123

ca sat käryam / sahakärivat tanniyama iti cet / syän matam / yathäpo bijänkurasyotpattau 1 samarthä bhavanti na kästhäd agner vä^ 1 ) 2 / ubhayam ca^2)3 tat täsu na vidyate bijäd apäm 4 vicchinnatvät / yathä ca 5 süryah süryakäntäd agnim utpädayitum samartho na candrakäntäc ca päniyam / ubhayam ca 6 tat tatra^ 3 ) na vidyate / tathä^4) ca tantvädmäm patasyaiva 7 saktiniyamah syät / na ca patasya tantusu sattvam syäd iti / e t a c c ä y u k t a m / kasmät / sädhyatvät^ 5 )/ ankurädayo 'pi käryam abädinäm / <a>tah8 sädhyam 9 kirn apsv 10 ankuro 'sty atha 1 1 nasty eva / tathä süryakänte 'gnih / tadartham eva cäyam vivädo 'nusaktah 12 / yat tüktam (123.3) apäm vicchinnatvän na täsv ankuro 13 'stiti taträpi yäsäm apäm bijänupravesäd ankurabhävena viparinämas täbhyas 14 tasyänyatvam 15 sädhyam / ato na kimcid etat / kirn
2 A. agnair utpattau samartho vä instead of 3 A. vobhayarn instead of ubhayam ca 4 A. apä 5 A. omits ca. 6 K., P. and D. omit ca. 7 A. patasauva 8 K., P. and D.: nätah We follow Raghavan. 9 10 K., P. and D. 11 A. atha vä 12 A. 'nukto 13 14 A. 15

5

10

*A. btjäd ankurasyotpattau

agner vä

A. reads käryam nabhas sädhyam instead of käryam abädinäm / <a>tah sädhyam with a lacuna between käryam and nabhas. omit apsv.

K. and P.: vicchinnatvam ankuro instead of vicchinnatvän na täsv ankuro D. ankurah, s.m. a nkure syäd yas instead of täbhyas A. tasyänanyatvam

(^(va) utpattav apah samartha bhavantiti sambandhah / / (K.43b, D.136 without number) (2) (ubhayam ca) ubhayam ceti / täsv apsu nänkuro nägnir atha cäsattvävisese 'py ankuram janayanti nägnis tasmäd upädänäd apy evam vyavasthäplti* bhävah / / (K.43b, D.136 without number) *D. vyavasthä apiti, s.m. vyavasthä bhavisyatt apiti (3)(tatra) tatreti*- / sürye nägnir na pänlyam ity art hah / / (K.43b, D.136 without number) *D. omits tatreti. ^ '(tathä) cakrädäv api ghatasya vartulatvädikäryämsamätram sesalaksanam vidyata eva / sesänugrahakäritvät tu sahakärinäm upädänaparatantratayaiva käryakäranatvam iti käranatä1 tesäm näkäranatä / tathä saktipratiniyamät sväbhävikäd adhunopädänapäratantryam2 eväsritya sahakäriny asadbhävam käryasya / na hi3 sa kascit svatantra upädänäsamlagnah / / (K.43b, D.136 without number) 1 D. karanatä, s.m. käranatä 2 K. °parantantryam D. adhvanopädänapara tantryam, s.m. adhunopädänapäratantryam 3 D. na nahi, s.m. na hi ^' (sädhyatvät) sädhyatväd iti / na hi sarvathaiväpsu na vidyate 'hkuro yä hy* äpo byadeäänupravesenäslnäd upädänäd antarviparivarttitayänkuramjanayantlti täsv apy ankuro 'sty eveti** / / (K.44a, D.136 without number) *D. yä hi yä hi **D. eva.

124

YUKTIDIPIKA

5

canyat / rupavyavasthanac 1 ca / tadyatha rup<a>vijiianotpattihetutve 2 sati caks<ü>rüpam(1)3 drstam iti nedänim tatsämänyäd rüpam apy arüpam 4 bhavati / evam5 patakäranatväd vemädayo na pata iti nedänim tantavo 'py apatah / tasmäd yuktam etac chaktasya 6 sakyakaranät sat käryam <iti(?)> / it as ca sat käryam 7 / KÄRANABHÄVÄC CA SAT KÄRYAM8// (SK9d) ihasati kärye käranabhävo nästi tadyathä vandhyäyäh 9 / asti ceha käranabhävas tantupatayoh / tasmät sat10 käryam / käranäntarät käryäntarotpattidarsanäd 1 1 anyatra tadbuddhir iti cet / syän matam / präk käranäntarät käryäntarasyäsata utpattim upalabhya pascät käranäntare käranabuddhir bhavatiti / e t a c c ä y u k t a m / kasmät / anabhyupagamät / asatah käryasyotpattir eva na siddhä 12 sasavisänädisv asiddhatvät 13 / kutah punas tannimittäkärabuddhih 14 / käranabhäväd iti cet / syäd etat / asattvävisese 'pi patasya käranam samaväyyasamaväyinimittalaksanam 15 asti / tasmät 16 pata utpadyate 17 na sasavisänam iti / etac cäyuktam / kutah / hetvabhavät / asattvävisese 'pi patasya käranam asti na sasavisänasyety atra 1 8 hetur anuktah / purusavad iti cet / syäd etat / yathä tuly<e>19 sattve patasya käranam asti na purusasya, evam asattve patasya käranam asti na sasavisänasyeti / etad apy ayuktam / kasmät / uktatvät / samsthänam käryam / patasya 20 samsthänam na purusasyoktam 21 präk (122.9) / samsthänavat tadvisesa iti cet / syän matam / yathä sattvävisese patah samsthänam 22
1 A. rüpavad vyavasthänäc 2 All the Mss read rüpam vijnänotpattihetutve. 3 K., P. and D.: na rüpam instead of caks<ü>rüpam A. caksurüpam 4 D. api rüpam, s.m. apy arüpam 5 K., P. and D.: eva 6 K. and P. repeat chaktasya. D. saktasya, s.m. sakyasya 7 K., P. and D. omit Has ca sat käryam. 8 A. omits sat käryam. 9 A. vadhyäyäh 10 A. omits sat. 11 K., P. and D.: käryotpattidarsanäd 12 A. tävad asiddhya instead of na siddhä 13 A. °disu siddhatvät 14 A. ° äkäranabuddhih 15 A. omits samaväyyasamaväyinimittalaksanam. D. samaväyäsamaväyanimitta0, väyyasamaväyinimitta0 16 A. omits tasmät ... asattvävisese }pi patasya käranam asti. 17 K., P. and D.: ucyate 18 K., P. and D. omit atra ... käranam asti na sasavisänasyeti. 19 All the Mss read tulyatve. 20 A. paräsä 21 A. na purusa ity uktam 22

10

15

20

s.m. sama-

A. omits samsthänam na purusah, evam asattvävisese patah.

(1)(caks<u>rupam) na hi rupasvabhavam caksuh, rupam tu svarupasvabhavasvarupam eva, yas tu rüpasabdena karmasakter grähyatäm vyäcaste tasya spastärthatyäge 'bhipräyam na vidmo yathä caksur vijnänotpattihetutve sati nlrüpam drstam / na hi caksü rüpasvabhävam nedänim rüpam api vijnänotpattihetutväd arüpam bhavitum arhati / / (K.44a, D.137)

TRTIYAM AHNIKAM SK9

125

na purusah, evam asattvävisese patah käryam na sasavisänam iti / etad 1 a p y ayuktain / kasmät / s ä m ä n y a v i s e s ä b h ä v ä t 2 / sämänyasya hi visesaparigrahah samsthänam / na tv ayam asti cetanäsaktau 3 vikalpah / tasmän na purusah samsthänam / asatas tu nirätmakatväd viseso durupapädah 4 / tadupapattau 5 vä sattvaprasanga iti / äha ca— nirätmakatväd asatäm sarvesäm avisist at ä / visesanam ced bhinnam te sattvam abhyupagamyatäm / / tasmäd yuktam etat käranabhäväc ca sat käryam (SK9d) <iti(?)> / evam tävad vaisesikamatenäsatkäryavädo na vimardasahah 6 / bauddhapakse tu bhüyän dosah / katham tarhi 7 dravyäntaram pato nesyate / tantusv eva tathästhesu pata ityädibuddhaya ity evamädinä nyäyenävayavipratisedhät samyogo 'pi na samyogibhyas8 tesäm arthäntaram istah / tatraitävati parikalpanä syäd yad 9 uta tantusamyogo vä patah, samyogakäranam 10 vä dravyäntaram / ubhayam ca tesäm närthäntaram / athotpattivinäsau kasyäpiti mäyäkäracestitam / tad api citrataro ' y a m upanyäsah / känädänäm 11 tu dravyäntarotpattivinäsäbhyupagamän na tärkikasadrso vicärah / tasmät päramarsa eva pakso jyäyän / yathä cäsat käryam na sambhavati tathä casabdät 12 (SK9d) sad asat käryam api parasparavirodhät / naiva san näsad ity eke 1 3 / etad 14 apy anupapannam / kasmät / sattvahetvabhidhänät 15 / niscitah präg utpatteh käryasya sadbhävah

5

10

15

20

prakrtam idanim vaksyamah / kirn ca prakrtam / mahadädi tac ca käryam 16 prakrtivirüpam sarüpam 17 ca / (SK8cd) iti vacanäd <v>airüpyam18/
X A. tad (this is also possibly 2 A.: ° visesäbhävät 3 A. cetanäsaktau 4 A. durapasädas 5 A. tadutpatto 6

the original reading).

A. vimardaks amah A. deletes tarhi. K. and P.: samyogopasamyogibhyas D. samyogopasamyogibhyas, s.m. samyogo 'pi samyogibhyas 9 A. omits yad. °K., P. and D.: samyogakäranam *K., P. and D.: käranopädänam 12 A. tathä sabdät 13 K., P. and D. omit eke. 14 A. tad (this is also possibly the original reading). 15 K., P. and D.: sattve hetvabhidhänän 16 K., P. and D. omit käryam 17 A. omits sarüpam. K. and A.: vacanäd dvairüpyam. P. not clear D. vacanät dvairüpyam We follow Chakravarti.

126

YUKTIDIPIKA

5

10

15

20

prak sarupyagrahanam sukhapratipattihetutvat / adhigatasärüpyasya hi sukham vairüpyapratipattir 2 bhavatiti präk sarupyagrahanam kartavyam / yathä tanträntarlyänäm "sad anityam dravyavat kärya<m> käranam 3 sämänyavisesavad iti dravyagunakarmanäm avisesam4" (cf.VS. 1.1.7) uktvä "dravyäni dravyäntaram ärabhante" (VS.1.1.8) "gunäs ca gunäntaram" (VS.1.1.9) ity evamädi<r> viseso5 'bhidhiyate / ucyate: tadanupapattih avisesät / yathaivädhigatasärüpyasya laghiyasi vairüpyapratipattir evam adhigatavairüpyasya laghiyasl särüpyapratipattih / kasmät / parasparäpeksatvät 6 / vairüpyäpeksam hi särüpyam, särüpyäpeksam ca vairüpyam iti / äha^2) : evam api vairüpyasya prägabhidhäne prayojanavacanam / dvayor 7 apy avisese 'nyatarasya prägabhidhäne niyamahetur vaktavya iti / ucyate: na vairüpyasya prakaranänangabhävät / vicchinnam hi vairüpyam / atas tat pürvam abhidhäya prakaranängam särüpyam sukham abhidhätum ity evamartham äcäryenaivam8 kriyate / katham särüpyasya prakaranängatvam iti cet / traigunyäbhidhänadvärena^ 3 ) gunalaksanopadesät tatsiddhau cävivekyädmäm 9 vyaktasiddheh käranagunätmakatväc ca käryasya pradhäne traigunyädipratipatteh, käryakäranabhäväsandehäc ca pradhänästitvaprasiddhyapadesät 10 tatsiddhau ca bhogyasya 11 bhoktrapeksatvät purusasiddher adhigatabhoktrbhogyasya ca 12 tatsamyogasya 13 sukhapratipädyatvät tädarthyäc ca tattvabhütabhävasargänäm 14 / tasmäd yuktam etat prakaranäiigatvät 15 särüpyam pascän nirdisyate tadasambandhäd itarat^4) präg iti / äha: yadi tarhi bhavän präg 16 vairüpyäbhidhänam nyäyyam 17 manyate
X A. äha ca 2 K., P. and D.: vairüpyasya pratipattir 3 All the Mss read käryakäranam. We follow Pandeya. 4 A. avisesasämänyam 5 All the Mss read evamädiviseso. We follow Pandeya. 6 A. kasmäd apeksyatvät 7 K., P. and D. omit apy. 8 K., P. and D.: äcäryenaiva 9 A. omits cävivekyädinäm ....°prasiddhyapadesät tatsiddhau ca. 10 D. pradhänästitvaprasiddhyapadesät, s.m. pradhänam asti prasiddhyapa0 11 A. bhogyasd 12 K., P. and D. omit ca. Dkha. °bhoktrbhogyäsrayasya 13 A. tatsamyogasya ca 14 A. tattvabhävabhütasargänäm (this is also possibly the original reading). 15 A. prakaranatvät 16 A. bhäväd instead of bhavän präg 17

K., P. and D.: nyäyam

(x)(aha) purvapaksah / / (D.139 i.n., not found in K.) (2)(äha) purvapaksah / / (D.140 i.n., not foujid in K.) (3) (traigunyäbhidhänadvärena) "trigunam aviveki visayah" (SKIla) ityädinä / / (K.45a, D.140 without number) (4)(itarat) vairüpyam / / (D.141 i.n., not found in K.)

TRTIYAM AHNIKAM SKIP tad vaktavyam kim punar idam vairüpyam iti / ucyate: 1

127

HETUMAD ANITYAM AVYÄPI2 SAKRIYAM ANEKAM ÄSRITAM LINGAM / SÄVAYAVAM PARATANTRAM VYAKTAM3 VIPARITAM AVYAKTAM4// (SK10) tatra hetuh käranam ity anarthäntaram / tad asyästlti hetumat / nityam dhruvam / na nityam anityam / vyäpnotiti vyäpi / na vyäpy avyäpi / asarvagatam ity arthah / saha kriyayä sakriyam5/ anekam bhinnam / äsritam ädheyam / Ungarn tallaksanopapannam / avayüyanta ity avayaväh / prthag upalabhyanta ity arthah / sahävayavaih sävayavam / paratantram anyädhinam / ete hetumadädayah paratanträntä nirapavädä vyaktasyäsädhäranäh pradhänapurusäbhyäm dharmäh / äha: hetumad ity avisesah sarvatra sadbhävät 6 / vyaktävyaktapurusänäm hi sarvesäm hetur^1) astlty avisesa eväyam pathitavyah <iti> / ucyate: na kärakaparigrahät 7 / yady api 8 vyaktävyaktapurusänäm avisistam hetumattvam tathäpi 9 Visist asya kärakasya 10 hetoh parigraham karisyämah / sa ca vyaktasyaiva nänyasyeti näyam aviseso bhavisyati / äha: tadanupapattih visesänupädänät / hetur iti sämänyasabdo 'yarn / sämänyasabdas 11 ca närthaprakaranasabdäntaräbhisambandham antarena visese 'vatisthata 12 iti visesa upädeyah syät / sa 13 tu nopädiyate / tasmät te 'visesa eväyam iti 1 4 / ucyate: na sarvasambhavino 'bhidhänasya prakarsärthatvät / iha yah sarvasambhavi dharma ekavisaya upädiyate tasmät prakarso vijfiäyate / tadyathä bhoktä mänavaka ity ukte sarvesäm bhoktrtvasya sambhaväd evam vijiiäyate prakarsenäyam bhokteti / evam ihäpi sarvasambhav<iny> äha 15 äcäryo vyaktam hetumad iti / tena 16 vayam asmät prakarsam 17 vijnäsyämah /
1 A. omits ucyate. 2 A. asyäpi 3 A. vaktavyam 4 A. omits viparitam avyaktam. 5 D. sakiyä sakriyam, s.m. sakriyam 6 K., P. and D.: sarvaträsambhävät Dkha. 7 A. kärakapratigrahät 8 A. yaträpi 9

5

10

15

20

25

sarvatra sambhavät

A. taträpi D. repeats kärakasya hetoh parigraham karisyämah, and deletes the repeated phrase. 11 A. sämänyasabdäc 12 A. 'vatisthanta 13 A. sä 14 A. eva instead of eväyam iti K., P. and D.: sarvasambhavity äha A. sarvasambhave saty 16 A. and Dkha.: te D. tena, s.m. te A. asmäkarsam

W (hetur) siddhau / / (D.141 i.n., not found in K.)

128

YUKTIDIPIKA

5

10

15

20

kas ca prakarsah / karakajnapakayor ubhayor api sambhave karakasyaiva grahanam / anityasabdasambandhäd 1 vä / athaväyam äcäryo hetumad ity uktvänityam iti pathati / sabdäntaräbhisambandhäd yo 'nityasahacaro 2 hetus tasyeha grahanam gamyate / kas 3 cänityasahacaro hetuh / kärakah / äha: evam apy a n u p a p a n n a m etat / kasmät / ubhayatra tatsambhavät / utpädyavyangyayor 4 hi vinäsam 5 patädisu drstatväd avyabhicärät tanträntariyä manyante / tasya vä parihäro vaktavyo na vä vaktavyo visese sthitir astiti / ucyate: na ekäntavädaprasangät / sarvena hi vädinävasyam 6 kimcin7 nityam abhyupagantavyam / antato vinäse 8 'pi na kascid arthah sabdabuddhibhyäm na vyajyate / tathä ca9 saty ekäntavädo 'yam syät / sa ca yuktimadbhir nesyate / tathä ca 10 samskrtam apy evam kalpyamäne 11 vinäsi syät / tasmäd 12 utpädyavyangyayor vinäsam bruvato 'tisähasam / äha: anityatvänupapattih satkaryavädäbhyupagamät / yathaiva hi näsata utpattir asty evam sato 'pi vinäsena na bhavitavyam / atha sato 1 3 vinäso 'bhyupagamyate tena pralayakäle vinastänäm tattvädinäm 14 pascäd asatäm utpattih satkäryavädam 15 niräkuryät / tasmäd anityam vyaktam 16 ity ayuktam iti 1 7 / ucyate: na vyaktyapagamapratijnänät 1 8 / satyam eva 19 vayam sato vinäsam äcaksänäh satkäryavädam 20 pratyäcaksimahi 21 / käranänäm tu yah parasparasamsargät 22 samsthänavisesaparigrahas tasya virodhisaktyantarävirbhäväd 23 vyaktis tirodhiyata ity etad vinäsasabdena vivaksitam / tathä ca värsaganäh 24 pathanti a tad etat trailokyam 25 vyakter apaiti na sattvät / D.: anityah sabdah sambandhad sahacaro Instead of kas cänityasahacaro hetuh K., P. and D. read tasmän nityasahacaro hetuh, and Dkha. reads kasmäd anitye sahacare hetuh. 4 A. utpädyavyarigayor 5 K., P. and D.: vinäsah 6 A. vädino 'vasyam 7 K. not clear. 8 P. vinäso 9 K., P. and D. omit ca. 10 K., P. and D.: tathyam (this is also possibly the original reading). Dkha. omits ca. 11 P. kalpamäne 12 A. omits tasmäd. 13 K., P. andD.: sato 'pi 14 D. tattvädmäm, s.m. tantvädinäm 15 A. satkäryavodam 16 P. yuktam 17 K., P. and D.: anityam eveti instead of iti 18 D. vyaktyapagapratijnänät, s.m. vyaktyapagamapratijnänät 19 K., P. and D.: sadä instead of satyam eva 20 A. satkäryaväda 21 D. pratyäcakhimahi(?), s.m. pratyäcaksimahi 22 K., P. and D.: parasparam samsargät 23 A. virodhasaktyantarä0 24 A. värsaganoh 25 A. trailokam
1 K., P. and 2 A. 'nityas 3

TRTIYAM AHNIKAM SKIP

129

apetarn^1) apy asti 1 vinäsapratisedhät 2 / samsargäc 3 cäsya sauksmyam 4 sauksmyäc cänupalabdhih / tasmäd vyaktyapagamo 5 vinäsah / sa tu dvividhah / ä sargapralayät tattvänäm kimcitkälävasthänäd 6 itaresäm" (cf.YBh.onYS.3.13, NBh.1.2.6) iti 7 / äha: ayuktam etat / kasmät / vipratipatteh 8 / sarvam eva ksanikam 9 buddhibodhyam äkäsanirodhavarjitam 10 iti säkyaputriyäh pratipannäh / tesäm pratisedho 11 vaktavyo na vä 12 vaktavyo dvividham anityam iti / ucyate: na hetvanupagamät / pratiksanam ucchidyate trailokyam ity atra Ungarn abhiyuktä api nopalabhämahe / tasmän naitad asmäkam 13 buddhäv avatisthata iti / äha: ante ksayadarsanät / iha yasyänte ksayas tasya ksanikatvam drstam tadyathä pradipajväläbuddhisabdänäm 14 / asti cänte ksayah samskäränäm 1 5 / tasmät ksanikäh / uc<ya>te16: tadanupapattih sädhyatvät / iha tu siddhenätideso 17 bhavati / tadyathä gavä gavayasya / na tu pradipajväläbuddhisabdänäm ksanikatvam prasiddham / ato na kimcid etat / äha: naitad aprasiddham / kasmät / vrddhyadarsanät^ 2 ) 18 / yadi hy avinastäyäm jväläyäm indhanäntare 19 jväläntaram utpadyate vrddhih 20 syät / na tu drsyate / tasmäd anavasthitä pradipajvälä / kirn ca äsrayäbhävät / yadäsrayä jvälotpattis tad utpadyamänaiväsau nirunaddhiti na yuktam asyä vinäsrayenävasthätum / upayuktendhanäyä 21 <apy> avasthänaprasangät 22 /
J A. esti 2 A. vinäcapratisedhät 3 A. asamsargäc 4 A. sauksmäm 5 A. vyaktyapagamo 6 K., P. and D.: kimcitkäläntarävasthänäd 7 A. api 8 A. vipratipattaih 9 A. ksanikatvam 10 A. buddhir bodhyasakäsanirodhavarjitam 11 A. pratisedhä 12 K., P. and D.: vä na 13 A. yuktam asmäkam 14 A. omits buddhi. 15 A. samskäronäm 16 All the Mss read ucyante. 17 A. siddhatvenätideso 18 Dkha. vrddhyäv adarsanät vrstyäv adarsanät 19 K., P. and D.: indhanäntaräle 20

5

10

15

20

K., P. and D.: vrddhäv api A. upayunktendhanäyä 22 K., P. and D.: avyavasthänaprasangät A. avasthänaprasangät We follow Chakravarti.

(^(apetam) vyakter apetam apy* asti vidyata ity arthah / / (K.46a, D.144 without number) *D. omits apy. W (vrddhyadarSanät) vrddhäv adarsanät // (K.46b, D.145 without number)

130

YUKTIDIPIKA

5

10

15

20

25

kim ca avaranopanipatena 1 prabhabhedaprasangat / jvalanam avasthänam icchata uparistäd ävaranopanipätät prabhäyäs tantor 2 iva dvaidhikaranam syät / anistam caitat / tasmän na dlpajvälänäm 3 avasthitir astiti / etena sabdo 'pi pratyuktah / katham / tasyäpi yadi vinäso na syäd 4 drutapavanämbudhäräbhighätät pratiksanam apürvasabdävirbhävät pürvas a b d a v i n ä s ä c 5 ca vrddhih syät / adrstä cäsau / kim ca pratyaksata upalabdheh 6 / pänyupaghätajo 7 hi sabda utpatter ürdhvam na bhavatiti pratyaksasiddham idam / abhivyakter 8 iti cen na niyamädarsanät / sabdänäm hi 9 väcyavaktrbhedabhinnänäm kärananiyamo drstah / na caitad asti samänendriyagrähyänäm / kim ca prthaksruteh / abhivyaktikäranadesäc ca prthak srüyate sabdah / na caitad abhivyaktänäm 10 ghatädinäm drstam iti ksanikäh / buddhes 11 tu präg evoktä 12 näsahetavah / tatra yad uktam(129.14) sädhyatvät pradipajväläbuddhisabdädinäm ksanikatvasya na samskäräh ksanikä ity et ad ayuktam / ucyate: yad uktam(129.17) vrddhyadarsanäd ity atra brümah: ayuktam etat / kasmät / visesapratipatteh / ksanikam 13 ity uktaparimäno 14 'yam kälanirdesa äsriyate / vrddhyabhävädibhyas ca kadäcid vinäsamätram pratlyate / sa tu vinäsa 15 ekam ksanam 16 avasthitänäm jvälänäm bhavati na punah ksanadvayam trayam 17 vä paryusitänäm ity atra <hetur noktah> 18 / tasmäd yuktarn apy etad anuktam / yat punar etad uktam(129.18) indhanänavasthänäj jvälänavasthänam ity atra brümah: etad apy anupapannam / <kasmät /> sädhyatvät / ksanam avasthitasyendhanasya <ni>rodho19 na punah <ksanadvayam avasthitasya> ity etad 20 apramänakam / äjnämäträd agrhltasiksäkah 21 kah 22 pratipattum utsahate / yat tüktam (130.1) ävaranopanipätät prabhäbhedaprasanga ity etad apy
1 K., P. and D.: ävaranopanipäte 2 Dkha. tanor 3 A. dipe jvälänäm 4 A. vinäsas syäd 5

A. ävaranaipanipätena

K., P. and D.: apürvasabdävirbhävät pürvasabdavinäsäc A. apürvasabdävirbhävät pür sabdavinäsät pürvasabdavinäsäc We follow Pandeya. 6 A. upalabdhaih 7 A. pränyupa0 8 K., P. and D.: abhivyaktir 9 K., P. and D. omit hi. 10 K., P. and D.: abhivyangyänäm 11 K., P. and D.: iti ksanikabuddhes 12 A. eva 13 A. ksanikatvam 14 K. aktaparimäno D. atyaktaparimäno 15 K., P. and D. omit vinäsa. 16 D. ksanam ekam, s.m. ekam ksanam A. has a blank space between vinäsa and mavasthitänäm instead of ekam ksanam. 17 K., P. and D. omit trayam ... na punah <ksanadvayam avasthita$ya>(130.19—23). 18 A. hetu After hetu A. has a blank space instead of <r noktah>. 19 A. virodhah We follow Pandeya. 20 After na punah A. has a blank space instead of <ksanadvayam avasthitasya> ity eta-, 21 K., P. and D.: äjnämäträ ca grhttasiksäkah 22 A. omits kah.

TRTIYAM AHNIKAM SKIP

131

ayuktam / kasmät / ubhayathänupapatteh / kirn tävad yasya dvaidhibhävo drstas tadaksanikam 1 ähosvid yasya na drstas tat ksanikam iti / kirn cätah / tad yadi taväd evam abhyupagamyate yasya dvaidhibhävas tad aksanikam iti tantor aksanikatvaprasangah / atha matam / yasya dvaidhikaranam na drstam tat ksanikam iti yathä kirn ity udähäryam 2 / kutah / yasmän na hy asty 3 anudährto 4 vädah / etena sabdavrddhih pratyuktä / yat punar etad uktam(130.7) pänyupaghätajasabdänavasthänäd 5 iti tatra bhavataivoktam vyangyatväd 6 iti / yat tüktam(130.8) niyamädarsanän 7 na vyangyah sabda iti tad ayuktam / anekäntät 8 / yathä suklakrsnau niyamatah suklakrsnasabdäbhyäm pratyäy<y>ete na 9 ca tau tayor na vyangyau 10 , evam sabdasyäpi vaktrvä<c>y~adiniyamah n syän na cävyangyah syät / yad apy uktam(130.10) vyangyavyanjakayor desabhedänupapatter na 12 vyangyah sabda iti tad apy ayuktam / kasmät / caksurvat tatsiddheh 1 3 / tadyathä caksuso rüpasya ca desabhede 'pi vyangyavyanjakabhäva evam 14 sabdasyäpi syät / tasmän na sabdo 'pi ksanikah / buddhes tu svädhikära eva ksanikatvahetuniräkaranam 15 vaksyämah(189.19) / tatra yad uktam (129.11) ante ksayadarsanät pradipajväläbuddhisabdavat ksanikah samskärä ity etad ayuktam iti / äha: itas tarhi pradlpädinäm 16 anyesäm ca bhävänäm ksanikatvam / kutah / avasthäne hetvabhävät 1 7 / nast<as>18 ced artho 'bhyupagamyate 19 nanu 20 präptam id am utpannamätrasyäsya vinäsavighno nästiti tävaty 21 eva vin<ä>sena22 bhavitavyam / athäsati pratibandhe na <vinäsah syäd iti> 23 kautasthyam sarvabhävänäm präptam iti / ucyate: na käranopapatteh / adhikäro hi sarva<bhävä>näm24 samskärä1 A. aksanikatvam 2 K., P. and D.: kirn atrodäharanam 3 K., P. and D. omit asty. 4 D. anuhrto 5 A. pränyupaghätasabdänavasthänäd 6 A. vyangatväd 7 A. niyamädarsanän 8 A. anaikäntät 9 K., P. and D.: pratyäyete na A. pratäyo tena We follow 10 A. vyangau 11 K., P. and D.: vaktrvädiniyamah A. vakrväkyädiniyamah 12 A. ne 13 K., P. and D.: tadasiddheh 14 P. eva 15 K., P. and D.: ksanikatvahetur iti karane 16 A. pradipänäm 17 A. hetyabhävät 18 All the Mss read nastä. We follow Pandeya. 1

5

10

15

20

25

Pandeya. We follow Raghavan.

K. and D.: anavasthänahetvabhäva ... stä ced artho 'bhyup agamy ate P. ° hetubhäva ... drstäd artho 'bhyupagamyate 20 AT"tat K., P. and D. omit tävaty ... vinäso <syäd iti>. 2 A. vinosena 23 A. vinäso sviti We follow Pandeya. All the Mss read sarvabhütänäm.

132

YUKTIDIPIKA

5

10

15

20

vasad utpattih / tasmat tadavasthanam 1 eva tesam alam sthitaye / sati vinasvaratve samskäropayoge tu sthityapabhramsa ity ato 'sti kamcit kälam avasthänam bhävänäm 2 / na ca kautasthyaprasangah / kirn cänyat / santativinäsaprasangät/ namstus 3 ced utpattisamanantaram vinäsa isyate santatir apy ante ksayadarsanän namstri 4 / tasyä api tathaiva vinäsah präptah / tatas ca tadidvilasitavat ksanadrstanastasya 5 trailokyasyäbhäve6 samsärocchedaprasangah / tasmäd ayuktam namstur 7 utpattisamakälam eva vinäsa iti / käranänavasthänän 8 na dosa iti cet / syän matam / asti käranam pürvotpanno bhäva uttarasyotpattau, sa cäpy uttarasyety evam santater anucchedah / virodhibhäväntarasarpsargät 9 tübhayatas 1 0 tathotpatter bhramsa 11 iti / etad apy ayuktam / kasmät / pürvahetutyägät / präg uktam yena namstavyam 12 asau mantrausadhamahgalaprayogair 13 api ksanäd ürdhvam 14 nävatisthate / sämpratam tu narnstri santatih käranavasäd avatisthata iti 15 so 'y a r n pürvahetutyägah / vinäsahetvabhävät ksanikatvam iti cet / syäd et at / nästi bhävänäm vinäsahetor upalambha ity atah sväbhävikah pradhvamsah / tasmäd utpattisamakälam 16 asau kena väryate <iti> / tad 1 7 apy ayuktam / kasmät / anabhyupagamät / ko hy etad <eva> mamsyaty ahetuko 18 vinäsah <iti> / kirn tarhi / präg evoktam (131.25) <samskära>vasäd19 bhävänäm sthitis <tadavasthitänäm cäpabhramso> virodhidravyäntarasambandhenädhyätmikädinä 20 bhavatlti / vinäsasya vinäsaprasangäd ayuktam iti cet / syäd etat 2 1 / yadi tarhy abhävo 'pi hetumän parikalpyate präptam asyäpi vinäsitvam 22 / anistam 23 caitat / tasmäd ahetuko vinäsa iti / etad apy 2 4 ayuktam / kasmät / vyaktyapagamapratijiiänät / bhävavinäsavädinam 25 prati satyam eväyam 26 upälambhah syät / vyaktyapa2 A. bhävänäm 3 A. nastus 4 A. nastri 5 K., P. and D.: ksanadrstinastasya D. deletes an unclear word between ksana and drsti. 6 K., P. and D.: trailokyasyäbhävah 7 A. nastur 8 A. käranävasthäntän 9 A. viro dhib h äväntara samp ark ät 10 A. tu bhüyas 11 A. bhümsa 12 A. nastävyam 13 A. asausadhamangalaprayogair 14 A. ürdhva 15 A. eva tisthati instead of avatisthata iti 16 A. utpattisamayakälam 17 K., P. and D.: idam 18 K., P. and D.: ko hy e .... ahetuko. A. ko hy etad avamamsyati ahetuko 19 All the Mss read arthavasäd. 20 K., P. and D.: sthitis tad ava....virodhi° A. sthitis ta....mänam cäpabhraso virodhi0 21 K., P. and D. omit syäd etat 22 A. ghatavad vinäsitvam 23 A. anist a 24 K., P. and D. omit apy. 25 K., P. and D.: abhävavinäsinam 26

*K. and P.: ta....d instead of tasmät tadavasthänam D. ta

d eva sthänam

A. corrects eva väyam into eväyam.

TRTIYAM AHNIKAM SKIP

133

gamas tu no vinäsah 1 / sa ca2 hetumattvena katham virotsyata iti 3 / tasmän na vinäsahetvabhävät ksanikam samskrtam iti / it as ca na ksanikam / kasmät / agrahanaprasaiigät 4 / ihäsato 'grahanam drstam tadyathä dvitlyasya sirasah / ksanäd ürdhvam ca te ghatädayo na bhavanti / tasmat tesäm apy agrahanaprasangah / tatsadrs<o>tpatter 5 adosa iti cet / syäd etat / utpattisamakäla<m> <n>irodhe6 'pi ghatasyänyasya tädrsasyotpattir bhavati tannirodhe 'nyasyety evam avicchedena grahanam bhavati jvälänadisroto'nusandhänavad iti / etad apy ayuktam / kutah / käranäbhävät / syäd etad evam yadi tadänim sadrsotpattau käranam syät / na tu tad asti präg eva nirodhät / tasmäd asad etat / pürvotpannasya käranabhävät tatsiddhir iti cen na upädänät tannispattiprasiddheh / ihopädänän mrtpindakasamjnakäl loke ghatanispattih prasiddhä na ca tadänim asti mrtpindah / kirn ca kramänupalabdheh / iha siv<a>kädinänukramena 7 ghatotpattir upalabhyate / na cänukramo 'sti / kirn ca kärakasäma<gr>yäbhävät 8 / iha kumbhakäradandacakrasütropalasämagryäd ghatanispattih prasiddhä / na cästy esäm tatra sambhavah / kirn ca <tadupädänät tadupädänasyänispatteh(?)> 9 / iha ghatäd ghatanirvr<tt>ir 10 na prasiddhä loke / na cäprasiddho 'sti drstäntah / buddhisabdavad iti cet / syäd etat / yathä buddhir buddhyantaram sadrsam süte sabdas ca sabdäntaram evam ghatäd ghatanispattir bhavatiti / etad apy asat / kasmät / <siddhatvät(?)/> siddham hi buddher buddhyantaram sabdäc ca sabdäntaram jäyata iti / etad apy asmäkam prasiddham / tasmät praläpamätram etat / tatra yad uktam (133.5) sadrsotpatteh so ' y a m iti grahanam avicchinnam ksanikatve 'pi bhävänäm ity etad ayuktam / kirn cänyat / käryotpattikäle kärananivrtteh / yadä [na] käranam asti na tadä käryam utpadyate dvayor ghatayor yugapadupalabdhiprasarigät / yadä tu käryam utpadyate tadä käranam <niruddham>11 iti ni<r>bijah12 prädurbhävah präpnoti / anistam caitat satatotpattiprasarigät / anutpanne hetusämarthyäd adosa iti cet / syäd <e>tat 13 / anutpanne kärye käranena pray oj an am utpanne tadvyäpäränarthakyät, asti cänutpanne kärye käranam / ato na nirbijah prädurbhäva iti / tad apy ayuktam / kasmät / abhäve 'pi tadutpattiprasangät / ahga tävad anuso vibhajyantäm agnau vä ksipyantäm tantavas tadäpi prasiddhavinäsänäm abhüvann iti sakyam upadestum yad <e>tebhyah14 pata utpadyate / tasmäd bhrän1 A. nävinäsah 2 K., P. and D.: tu 3 A. has a lacuna instead of virotsyata iti. 4 K., P. and D. omit agrahanaprasaiigät tadabhäväd 5 A. tatsadrsautpatter 6 A. utpattisamakälavirodhe We follow Pandeya. 7 A. sivikädinä0 8 A. kärakasämarthyäbhävät We follow Pandeya. 9 A. tadupädhyänurupädhyasyänispatteh 10 A. ghatanirvrtir 11 A. virodham We follow Pandeya. 12 A. nibijah We follow Pandeya. 13 A. syät tad 14

5

10

15

20

25

30

asiddho 'syai mie(133.3-134.18).

A. yadi tebhyah

134

YUKTIDIPIKA

5

10

15

tir iyam / yugapat karyakaranayor utpattinirodhau tulanatonnatavad iti cet / syäd etat / yathänämonnämau tulänta<yor>1 <yau>gapadyena 2 bhavata evam utpattivinäsau karyakaranayor iti / tad apy ayuktam / kasmät / k ä r y a k ä r a n a b h ä v ä d a r s a n ä t / kim idam udake nimajjadbhih phenam avalambyate / tulyä [tasya] hy ekasyävanatir avasthä taddvitiyasyonnataye hetur bhavati / bhavatah käranavinäsah käryotpattis ca yaugapadyena bhavatah / na ca tayor hetumadbhävah sakyah kalpayitum / tasmäd ayuktam etat / visesagrahanät ksanikatvasiddhir iti cet / syän matam / yady utpannamätroparatir nästi bhävänäm kimkrtah sarirädlnäm pränäpän<a>sramarüpädikrto 3 'bjäsmaprabhrtinäm ca sitosnasparsakrto bhedah / ghantädinäm cäsabdakänäm pascäc chabdavatäm grahanam / tasmäd anisiddhah ksanabhanga iti / etac cäyuktam / kasmät / uktatvät / uktam (133.10) atrottaram käranäbhäve 'nutpattiprasangäd iti / kim ca <samsthänäntaränupalabdheh) 4 / na hy atra pürvasamsthänaviparltam samsthänäntaram grhnlmahe / tasmäd avisistäs ta ity evam avagamyatäm / visesagrahanam tv avasthäntaränugrah<ah>5 saktyantarävirbhävät / uktam(132.23) ca vyakt<e>r6 apagamo 'bhistah pürvasamsthänahänitah / tadabhäväd asiddho V vise... 7 / / 1 0 / /

20

25

<aha8 : > nasahacarabhavo drstas tamahprakasavat / tasmäd anyonyamithunatvam anupapannam / ucyate: yat tävad uktam gunänäm nänätv<ä>bhävah9 svabhävavyatikaropalambhäd ity atra brümah: yadi khalv idam isyate 10 svabhävavyatikaragrahanäd gunänäm nästi nänätvam iti kim präptam / yady esäm samklrnah 11 svabhäva upalabhyeta 12 na syäd esäm nänätvam / asti caisäm asamkirnasvabhävopalambhah / katham iti / ucyate— SATTVAM LAGHU PRAKÄSAKAM ISTAM UPASTAMBHAKAM13 CALAM CA RAJAH / GURU VARANAKAM EVA TAMAH / (SK13abc) eva sabdah pratyekam parisamäpyate / sattvam laghu prakäsakam evestam / yat kimcit käryakarane laghu prakäsakam ca tat sattvarüpam iti pratyaJ A. 2 A. 3 A. 4 A. 5 A. 6 A. 7 A. 8

tuläntaryär yogapadyena We 0 follow Pandeya. pränäpänäsrama We follow Pandeya. sthänänvaränupalabdher We follow Pandeya. avastvantardnugrahe vyaktar We follow Pandeya. ends here. A11 the Mss omit <äha....> nasahacarabhavo .... katham iti / ucyate(134.19-25). D. introduces this phrase by: kha°pu$take esa adhiko 'sti päthah, and corrects nämäha carabhävo into näsahacara0 in the left margin. 9 Dkha. nänätvabhävah 10 Dkha. idam ucyate sva isyate, s.m. idam isyate 11 Dkha. esäm asamkirnah, s.m. esäm samkirnah 12 Dkha. svabhävah pra upalabhyeta, s.m. svabhävah upalabhyeta 13 D. prakäsakam, s.m. prakäsakam istam

TRTIYAM AHNIKAM SK13

135

vagantavyam / tatra käryasya tävad udgamanahetur 1 dharmo laghutvam, karanasya vrttipatutvahetuh / prakäsas 2 tu prthividharmasya cchäyälaksanasya tamasas tiraskärena dravyäntaraprakäsanam, karanasyäpi grahanam samkalpäbhimänädhyavasäyavisayesu yathäsvam pravartamänam 3 / upastambhakam calam eva rajah / yah kascid upastambhas calatä copalabhyate tad rajorüpam ity avagantavyam / tatropastambhah prayatnas calatä kriyä / sä ca dvividhä parinämalaksanä praspandalaksanä ca / tatra parinämalaksanayä sahakäribhäväntaränugrhitasya dharminah pürvadharmät pracyutih / praspandalaksanä pränädayah karmendriyavrttayas 4 ca vacanädyäh / bähyänäm dravyänäm 5 utpatananipatanabhramanädini / guru varanakam eva tamah / yat kimcid gauravam varanam copalabhyate tat tamorüpam iti pratyavagantavyarti / tatra gurutvam käryasyädhogamanahetur 6 dharmah, karanasya vrttimandatä / varanam api käryagatam ca dravyäntaratirodhänam / karanagatä cäsuddhih prakäsapratidvand<vi>bhütä 7 / ity esa sattvädinäm avyatikarena^1) svabhävopalambho yata 8 esäm nänätvam avasiyate / yat punar etad uktam striksatrameghesu 9 svabhävavyatikaropalambhäd ekogunas trirüpah, sarve vä sarvarüpäh, rüpäntarasya väsata utpattir ity atra brümah: na gunabhütasya bhaktita upakärät pradhänarüpopapatteh / iha gunabhütasya bhaktitah pradhänopakäritve sati bhaktitas tadrüp<opa>pattir 10 drstä tadyathä ksirädeh / tad dhi 11 mukhädisu drstapratilabdhapravrtt<i>( 2 ) 12 pittasya svena rüpenängabhävam^3) gaccha<t>13 tasyopakärät tiktam sampadyate na ca tathä^4) sad eva / sattvam api straina<m>
X D. udgamahetur, s.m. udgamanahetur Dkha. udgamanahetur 2 Dkha. prakäsakas 3 D. pravartanam Dkha. pravartamänam 4 D. karmendriyavrttais 5 D. vacanadravyänam, s.m. dravyänäm 6 Dkha. käryasyänumänähetur 7 All the Mss read ° dvandvibhütä. 8 D. ita 9 D. sütre ksatrameghesu 10 All the Mss read tadrüpäpattir We follow Pandeya. n D . sad dhi, s.m. tad dhi 12 All the Mss read °pravrttih. 13

5

10

15

20

All the Mss read gacchams(n).

(^(avyatikarena) vyatikarah svabhavabhedah / / (K.48b, D.150 without number) (2)(tad dhi mukhädisu drstapratilabdhapravrtt<i>) tad dhlti / kslraghrtädi / mukhädisv iti kslram mukhe ghrtam caksusoh karpüram triputikäyäm* ityädi / drsteti drstapürvävalokitaiva** pratilabdhä vrttir yena, na tasya kslrasya mukhe pratiksiptasyänyä käcid vrttih svarüpam, api tu pürvadistam eva tasya rüpam iti yävat / / (K.49a, D.151 without number) *K. tripratikäyäm **D. drsteti drstä pürvävalokitaiva (3) (svena rüpena) < pit tasya > bahirmukhibhavanasamarthyenety* arthah / / (K.49a, D.151 without number) *K. and D.: pittabahirmukhtbhavana0 ^4^(na ca) na ceti / na hi kslram sat tiktatvena* / anenäsamklrnatvam drstänte darsitam / /

136

YUKTIDIPIKA

5

10

15

gunabhutam 1 sapatmrajasah svena rupenangabhavam gaccha<t>2 tasyopakaräd duhkham sampadyate / tamaso mohah^ 1 )/ evam ksätram raja^2) äryadäralaksanasya sattvasya dasyulaksanasya ca tamasah / evam meghyam tamah kär<sakasya> sattvasya 3 prositadayitäyäs ca rajasah / tasmän nästi gunänäm svabhävavyatikarah / kirn cänyat / agunabhütänäm^ 3 ) svabhävagrahanät / yadä caite 'ngabhävam upagacchanto madhyasthäs tulyasamskäräs ca pratipadyante^4) tadä <...> svarüpenaiva (5) <...> / tasmäd asamkirnam gunarüpam / äha: na sandehät / ubhayathä hi rüpäntaragrahanam kslrädisu drstam / tädrüpyät tais ca 4 viparinatänäm gunabhäväc ca yathoktam / tatra katham idam ekäntena nisciyate gunabhävät sattvädinäm rüpäntaragrahanam na punas tädrüpyäd eveti / ucyate: grahanavikalpopalambhät / yadi strainam sattvam tädrüpyäd eva sapatnyä <duhkhena(?)>5 grhyate tena bhartur api tathä grahanaprasahgo madhyasthänäm^6^ tulyasamskäränäm ca / anistam caitat / tasmäd bhäkto ' y a m <grahana>vikalpopalambhah6/ kirn cänyat / uttarakälam svarüpagrahanät / nivrttänusayäbhis caikärthatäm upagatäbhih sapatnibhih svenaiva rüpena strainasya sattvasya grahanam upalabhyate svagrhasamavasthitais cäryadäraih ksatriyänäm, nispannasasyais ca krsivalair meghänäm /
1 A11 the Mss read strainagunabhutam. 2 A11 the Mss read gacchams(n). 3 All the Mss read kärsikasattvasya. 4 recte: tesäm(l) instead of tais ca 5 All the Mss read tena. 6

All the Mss read gunavikalpopalambhah.

(K.49a, D.151 without number) *D. sattyaktena, s.m. tiktatve sat (na ca tathä) na tu kslram tiktam (tl°) // (D.151 in the left margin, not found in K.) '*' (tamaso mohah) sapatnlsambandhinas tamaso <'ngabhävam gacchat>* sattvam mohah sampadyate moha iva sampadyate bhatlti sambandhah // (K.49a, D.151 without number) *K. and D.: 'hamkäram gacchan (2) (ksätram raja) ksätram raja äryadäralaksanasyähgabhävam gaccha<d>* ityädinä sahgltaevam tamasa ity at ret i / / (K.49a, D.151 without number) *K. and D.: gacchann (3) (agunabhütänänäm) pradhänänäm // (K.49a, not found in D.) (4) (agunabhütänänäm) tl° nanu sattvädirüpam asamklrnam tarhi katham nirbhäsata ity äha—agunabhütänäm iti // (D.151 in the right margin, not found in K.) (5) (svarüpenaiva) sattväkärena // (K.49a, not found in D.) (6) (madhyasthänäm) madhyasthä ye na raktä na dvistä ity arthah / madhyasthä ity ukte kasyacid vltarägasahkä syät, na ca vltarägasya striyäh sattvätmatayä pratibhäsas tadartham tulyasamskäräs ceti visesanam / tenäyam arthah—ye tulyasamskärä avltarägä atha ca tasyäm striyäm madhyasthä na raktä na dvistä iti / / (D.152-1, not found in K.)

TRTIYAM AHNIKAM SK13

137

tasmäd bhäkto 'yam grahanavikalpopalambhah / tasmäd yuktam etad anyo nyajananavrttayo gunä na ca samkirnasvabhävä iti / yat punar etad uktam anyonyamithunatvänupapattih sattvasy<e>taraviro dhäd 1 ity atra brümah: asti cäyam virodho gunänäm— PRADIPAVAC CÄRTHATO VRTTIH / / (SK13d) kim / upapadyata iti väkyasesah / tadyathä vartijyotistailänäm parasparavirodhe 'pi pradipakaranaikakäryasädhanabhävopagatänäm vrttaya ekatra sammürchitäh sahabhävam prakrstam api kälam anubhavanti / evam sattvarajastamasäm sati virodhe mahadädyekakäryasädhanabhävopagatänäm vrttaya ekatra mürchitäh^1) saha bhavantiti / yuktyabhäväd asiddhir iti cet / syän matam / kä punar atra yuktir yena virodhinäm ekakäryatä bhavatiti / ucyate gunapradhänabhävät / gunabhüto hi pratiyogl^2) pradhänabhütena tadupakärakatvän na virudhyata iti samsargena vartitum utsahate / tulyabalayos tu dvayoh satyam eva sahävasthänasya nästi sambandhah / tathä ca bhagavän värsaganyah pathati "rüpätisayä vrttyatisayäs 2 ca virudhyante / sämänyäni tv atisayaih saha vartante" (cf.YBh.onYS.2.15,3.13) / tadyathä jalägni pacaniyasvedaniyesu käryesu, chäyätapau ca süksmarüpaprakäsane 3 , sitosne ca prajävasthitau 4 / evam tatsiddhah pradipavat sattvarajastamasäm virodhe 'pi sahabhävah / äha: yad uktam laghvädibhävasvabhävabhedäd^3) gunanänätvam ity atra brümah: bhinnä laksanabhedäs cen mithah sattvädayo gunäh / tarhi laksanayuktatvät 5 sad gunäh präpnuvanti te / / yadi laghvädilaksanabhedät sattvädinäm nänätvam mitho 'bhyupagamyate tena laghutvaprakäsatvayor api bhedo 'sti <iti> gunadvayaprasangah / evam upastambhacalatäbhyäm gauravavaranäbhyäm 6 ca dvayam dvayam iti sad
J A11 the Mss read sattvasyottaravirodhäd. We follow Pandeya. 2 K. and D.: rüpätisayäd vrttyatisayäc P. rüpätisayäd vrttyatisayäs 3 P. prakäsanena 4 K. and P.: vrajävasthitau D. vrajävasthitau, s.m. prajästhitau 5

5

10

15

20

25

We follow Pandeya.

D. tarhi laksanayuktatvät, s.m. bhinnalaksanayuktatvät D. gauravavarnäbhyäm, s.m. gauravävarnäbhyäm

(^(murchitah) misrikrtah / / (K.49b, D.153 without number) (2) (pratiyogl) virodhl// (K.49b, not found in D.) (3)(laghvädibhävasvabhävabhedäd) laghutvasya laksanasya prakäsakatvasya <ca> laksanasya yadi bhedo 'sti tarhi laksanabhedäd gunadvayaprasangah, evam anyayor api gunayoh / atha laghutvam eva prakäsakatvam ity anayor abhedas tarhi laghusabdenaiva prakäsatväbhidhänän na prthakprakäsasabdagrahanam käryam / yadi tücyate laghutvaprakäsakatvayor bhede saty api sattvasya na bhedas tarhi laghutvaprakäsakatvopastambakatvacalatvagauravävaranabhede 'pi na gunabhedah syät / kim tv eka eva gunah syän na tu tritvam / / (K.50a, D.153 without number)

138

YUKTIDIPIKA

5

gunah prapnuvanti / atha matam / laghutvaprakasatvayor 1 abheda iti prthaganabhidhänam präptam / tadbhede vä grahanabhedam anicchatah präpto laghutvädibhede 'pi <gunäbhedas>2 tathä caiko guna iti präptam / yat punar etad uktam (135.18) gunabhütasya bhaktita upakärät pradhänarüpäpattir ity <atra brümah:(?)> angabhävam vrajat sattvam duhkham sampadyate yadi / <trai>rüpyasyopasamhärät3 pürvadosänivartanam / / yadi hi rajaso 'ngabhävam upagacchat sattvam upakärät tadrüpam^ 1 ) bhavati tena <pra>tijnätasya4 rüpäntarasyopasamhärät^ 2 ) trairüpyam gunänäm ekaikasya präptam rüpäntarasya vä sata utpattih / tasmät pürvadosäparihärät pratijnämätram eväyam samädhih 5 / yad apy uktam (136.5) agunabhütänäm svabhävagrahanäd ity <atra brümah:(?)> angabhävänapeksam <tu> grahanam 6 nästy rser api /

10

15

20

25

paramarser api gunänäm käryam eva pratyaksam na saktimätratvena 7 avasthänam asamvedyatvät / tatra cängängibhävagamanam aniväryam / tasmäd dosam anicchatä gunä eva vä parityäjyäh 8 , nästi vä sudüram api gatvä tatsamkaradosaparihärah / ucyate: yat tävad uktam(137.24) lakasanabhedäd gunanänätvavädino laksanadvayayogäd ekaikasya gunasattvaprasanga iti <tad ayuktam /> kasmät / dvayor^3) gunapradhänabhävänupapatt <eh>9/ ihärthäntarasyärthäntarena gunapradhänabhävo bhavati / yathä striksatrameghesu 10 vyäkhyätam (135.16ff.) / na ca laghutvaprakäsayor upastambhacala<tä>yor 11 gauravavaranayos 12 ca mitho gunapradhänabhävo 'sti / <tasmäd>13 anarthäntaram dharmäs ta iti nästi sattvaprasariga iti / kirn ca aprasiddhatvät / na hy etat
1 K. and P.: °prakäsayor D. °prakäsayor1 s.m. °prakäsatvayor 2 All the Mss read gunabhedas. We follow Pandeya. 3 All the Mss read vairüpyasyopasamhärät. 4 All the Mss read tenäpratijnätasya. We follow Pandeya. 5 Dkha. ayam na samädhih 6 A11 the Mss read grahanam instead of tu grahanam. We follow Pandeya. 7 K., P. and D.: saktimätrena We have accepted the reading of Dkha. 8 K., P. and D.: eväparityäjyä Dkha. eva väparityäjyä 9 All the Mss read gunapradhänabhävänupapattih. We follow Pandeya. 10 D. sütre ksatra0, s.m. striksatra0 We have accepted the reading of Dkha. 11 All the Mss read ° calanayor. 12 D. gauravavarnayos 13

All the Mss read tad.

(^(tadrupam) tadrupam rajorupam // (D.154-1, not found in K.) (2) (rüpäntarasya) sattvavisaye rajorüpasya rüpäntarasya // (D.154-2, not found in K.) (3)(dvayor) tl° laksanayor iti sesah // (D.155 in the left margin, not foundin K.)

TRTIYAM AHNIKAM SK13

139

kvacit prasiddham yathä yävanto dharmäs tävanto dharmina iti na cäprasiddhena vyavahärah / kirn ca prthaktvaikäntaprasangät / laksanabhedän nänätvapratijnasya sarvärthänäm svasämänyalaksanayogät^1) svato 'rthäntaram iti prthaktvaikäntaprasahgah / athaitad anistam na tarhi vaktavyam laksanabhedäd gunänäm sattvam iti / yat punar etad uktam (138.7) angabhütasya pradhänarüpäpatteh pürvadosänivrttir iti / tad apy ayuktam / kasmät / bhaktyabhidhänät / asakrd abh<ihi>tam1 asmäbhir bhäkto ' y a m gunänäm grahanavikalpa iti / na ca bhaktih paramärtha ity asthäne yatnah / yat punar etad uktam (138.15) agunabhütänäm sattvädinäm rser apy avisayatvam iti / satyam etat / yat tüktam(138.16) käryasya visayabhütatväd angängibhävagamanam gunänäm 2 <...> sakalam satkäryam 3 apeksate / <...> tathä striksatrameghäh^ 2 ) 4 prakrtäh, tesv angabhävam <upa>gacchanta^3)5 iti vijnäyataW iti / sämänyasabdänäm hi prakaranäd visese 'vasthänam bhavati / tadyathä bhojanakäle saindhavam änayety ukte lavane sampratipattir näsvädisu / tasmät prakaranam anapeksya mahati tantre dosäbhidhänam bälaväkyasthäniyam / evam gunalaksanopadesät siddham traigunyam / / 1 3 / /

5

10

15

aha: avivekyadir idanim ganah katham pratipattavya iti / ucyate: AVIVEKYÄDIH SIDDHAS TRAIGUNYÄT / (SK14ab?) yat trigunam tad "aviveki visayah sämänyam acetanam prasavadharmi" (SKlla'b) iti / katham avagamyata iti cet— TADVIPARYAYÄBHÄVÄT / (SK14b')
1 K. 2 D. 3 K. 4 D. 5

20

and D.: adhitam P. abhitam gunam, s.m. gunänäm and P. sakalasatkäryam D. sakalasatkäryam, s.m. sakalam satkäryam sütre ksatrameghäh We have accepted the reading of Dkha. AU the Mss read agacchata. D. reads in the footnote upagacchantv iti päthah.

(^(svasamanyalaksanayogat) ti° samanyavisesalaksanadvayayogat sarvam prthag iti na kimcid ekam iti syät / / (D.I56 in the right margin, not found in K.) (2) (striksatrameghäh) tl° sattvakäryam striksätram rajahkäryam meghas tamahkäryam / / (D.I56 in the right margin, not found in K.) (3) (-bhavam <upagacchanta>) bhävam upagacchantv iti päthah / / (D.156 in the bottom margin, not found in K.) (4) (sakalam satkäryam; strlksätrameghyäh prakrtäh, tesu; vijiiäyata) tl° sakalam satkäryam kartr yady apy gunänäm angähgibhävam apeksate tayä vinä na bhavatlty arthah / tathäpiha gunagatenängängibhävena na kimcid virudhyate / yatah strlksätrameghyäh prakrtäh, tesu ca prakrtesu satsu / vijnäyata iti pürvoktam ni^clyate / kirn tat / angabhävam agacchata iti / / (D.156 in the bottom margin, not found in K.)

140

YUKTIDIPIKA

5

yasmad gunaviparyayah ksetrajnah, tatra visayatvam acetanatvam prasavadharmitvam ca na bhavatity uparistät 1 pratipädayisyämah(169.18) / tasmät parisesato vyakta 2 etesäm dharmänäm avirodhah / äha: "tathä pradhänam" (SKllc') iti präg uktam bhavatä / tad idänlm katham pratipattavyam pradhänam api trigunädiy uktam iti / ucyate: KÄRANAGUNÄTMAKATVÄT KÄRYASYÄVYAKTAM API SIDDHAM / (SK14cd)

10

15

20

25

iha käranagunätmakam käryam drstam / patädivyakte ca traigunyädy upalabhyate / tasmät käranam apy asya tathäjätlyakam iti sakyam anumätum / siddhäntamätropadarsanam etad äcäryah karoti / nyäyam tu yathoktesu pradesesüpapädayisyämah (cf.SK15) / äha: käryadharmasya käranopalabdhau 3 hetumadädiprasangah avisesät / yadi kärye drstasya dharmasya kärane sadbhävo 'bhyupagamyate präpto hetumadädinäm api dharmänäm käryadrstatvät pradhäne prasahgah / atha käryopalabdhau tulyäyäm hetumadädayo nesyante na tarhitaresäm api käranävasthitir astiti / ucyate: na svarüpavirodhitve tadapavädavijiiänät / käranagunätmakatvät käryasyety anena lingena hetumadädayo 'pi kärane prasajyante / tesäm tu käryakäranarüpavirodhitväd apavädo vijfiäyate / katham / yadi tävad dhetumadädayo vyakte drstatvät 4 pradhäne <pras>ajyante5 krtakatvät käryam eva tan na^1) käranam iti präptam, anityatväc ca svayam ucchidyamänam ananugrähakam avyäpitvädibhis cänantavikärotpädanasaktihlnam / ahetumadäyah pradhäne 'bhyupagamäd vyakt<e>'pi6 präpyante tädrsäh / käranäsambhavät käryam eva tan na <käranam> bhavatiti präptam / avivekyädayas tübhayaträpi bhavanto netaretarasvarüpavirodhinah / tasmät käryakäranabhäväbhyupagamäd dhetumadädyapaväda itaresäm ca käranasadbhävah siddhah / yad uktam— käranagunätmakatvät käryasyävyaktam api siddham / (SK14cd) iti tad ayuktam / kasmät / vyaktävyaktayoh käryakäranabhäväprasiddheh / siddhe hi vyaktävyaktayoh <kärya>käranatve7 etad eva<m>8 syät / tat tv asiddham / tasmäd ayuktam etat / visesänabhidhänad ubhayasämyam
X K. and P.: bhavatiti purastat D. bhavatiti purastat, 2 D. 'vyakte, s.m. vyakte 3 P. karanopa0 4 D. vyakte drstatvät, s.m. vyaktadrstatvät 5 K. and D.: vyajyante P. vyanjante 6 All the Mss read vyakter api. 7 A11 the Mss read käranatve. We follow Raghavan. 8

30

s.m. bhavatity uparistät

All the Mss read eva. We follow Raghavan.

(x)(tan na) na tat sarvagrahakatvena mulakaranam bhaved ity arthah //(K.51b, D.158)

TRTIYAM AHNIKAM

S

K

1

5

1

4

1

iti cet^ 1 )/ syän matam / yathä bhavän äha vyaktävyaktayoh käryakäranabhävo 'prasiddha 1 evam vayam vaksyämas tayoh käryakäranabhäväprasiddhir apy asiddhä, na ca kvacid viseso 'sti / ubhayasämyam bhavisyatiti^ 2 )/ tac cäyuktam / kasmät / sadbhäväsiddheh / satyam anabhidhlyamäne visese syäd ubhayasämyam / avyaktasya tu sadbhäva eväsiddha ity ayam visesah / tasmäd ayuktam etad apiti^ 3 )/ käryasya käranapürvakatväd vyaktasya ca käryatväd avyaktasadbhäve pratipattir iti cet / syäd etat / käryam käranapürvakam drstam / ghatädikäryam ced<am> vyaktam 2 pramitatvät / tasmäd idam api käranapürvakam bhavitum arhati yac ca tasya käranam tad avyaktam iti / tac cänupapannam / kasmät / anekäntät / ihäkasmiki 3 ca käryasyotpattir drstä tadyathendradhanusah^ / asatas ca bhräntimäträt tadyathä^5) mäyäsvapnedrajälamrgatrsnikälätacakragandharvanagaränäm / satas ca käranät tadyathä^ 6 ) mrdädibhyo ghatädlnäm / käryam ced<am> vyaktam 4 / atah samsayah kirn indradhanurvad akasmäd asya prädurbhävo ? tha mäyädivad asato 'tha käranät sato ghatavad iti / ucyate: näkasmikam asatpürvam vyaktam / kasmät / BHEDÄNÄM PARIMÄNÄT / (SK15a) yat parimitam tasya sata utpattir drstä / tadyathä mülänkuraparnanäladandabusatusasükapuspaksiratandulakanänäm / parimitäs ca5 mahadahamkärendriyatanmätramahäbhütalaksanabhedäh / tasmät satkäranapürvakäh 6 / yad esäm käranam 7 tad avyaktam / iti yuktidlpikäyäm sämkhyasaptatipaddhatau trtiyam ähnikam 8 prathamam
1 D. na siddhah 2 KM P. and D.: ced avyaktam Dkha. ced vyaktam 3 D. ihäkasmike 4 K., P. and D.: ced avyaktam D. reads ced vyaktam iti ca päthah in the right margin. 5 K. and P.: parimitä D. parimitä, s.m. parimitäs ca Dkha. parimitäs ca 6 D. satkäranapürvakäh s.m. tasmät käranapürvakä Dkha. tasmät käranapürvakä 7 Dkha. käranam 8

5

10

15

20

D. iti srimadäcäryesvarakrsnäviracitäyäm sämkhyasaptätau yuktidipikänämni vivarane trtiyam ähnikam / 3 /

(^(viSesanabhidhänäd ubhayasämyam iti cet) samkhyamukhena prasnah // (K.52a, D.159 in the right margin) (2) (ubhayasämyam bhavisyatlti) tl° samkhyamukhena pürvapaksavädyuktih / / (D.159 in the right margin, not found in K.) (3)(iti) tl° pürvapaksah // (D.159 in the right margin, not found in K.) <4) (tadyathä) tl° ekah paksah // (D.160 in the top margin, not found in K.) (5) (tadyathä) tl° dvitlyah / / (D.160 in the left margin, not found in K.) (6) (tadyathä) tl° tritlyah / / (D.160 in the right margin, not found in K.)

142 ca prakaranam samaptam 1 /

YUKTIDIPIKA

1

D. prathamam prakaranam ca samaptam / I / , s.m. prathamam ca prakaranam samäptam / I /

C

a t u s t a y a

m

A h n i k a m

[aha1 : kasmad asty avyaktam] asadbhedanam api parimanadarsanad a n e känta iti cet / syän matam / asti hi mäyäsvapnendrajälänuvidhäyinäm api bhedänäm parimänam iti tasmäd anaikäntiko hetur iti / tac ca naivam / kasmät / <aniyamät(?) /> na hi tesäm niyamo 'sti etävadbhir evotpattavyam nänyair iti / mahadädayas tu pralayakälatirobhütäs tävanta evotpadyante / tasmän nänekän<ta>h 2 / äha: parimänänavasthänam käladvayänupalabdheh / satyam sämprate käle mahadädayo yuktaparimänäh pratyaksänumänopalabdheh / atitänägatayos tu kälayor nästi prasiddhih / tasmäd ayuktam etat / ucyate: na viparyaye pramänänupalabdheh / idänim etävanto bhedä ity etac chakyam anumätum / atitänägatayos tu kälayor nästi prasiddhih / tasmän na bhedänavasthäprasangah / äha: bhedäbhedänavasthänät 3 / mahadädinäm ye bhedä devamanusyatiryanco ghatädayas ca tesäm asakyam parimänam paricchettum / s ä m ä n y e 'ntarbhäväd <yu>ktam 4 iti cet / syän matam / asti sarlränäm mahäbhütasämänyam ghatädlnäm ca prthivisämänyam tatparimänäd ete Jpi parimitä iti / tad ayuktam / kasmät / abhävät / na hi vah sämänyam dravyäd arthäntarabhütam asti särüpyamätre sämänyaparikalpanät / ucyate: na tattväntaränupapatteh / tattv<ä>bhedena5 parimitä bhedä ity etad vivaksitam yathoktam asmäbhir uktam ca / yady asti tattväntaram ucyatäm / yat punar etad uktam(143.18) sämänyasyärthäntarabhütasya bhavatpakse 'nupapattir iti satyam etat / tathävidhenäpi tu tena samvyavahäro na pratisidhyata iti vaksyämah(164.16) / tasmät siddham bhedänäm parimänäd asty avyaktam / kirn cänyat /

5

10

15

20

25

SAMANVAYÄT / (SK15b')

D. atha samkhyasaptatipaddhau yuktidipikanamni vivarane dvitiyam prakaranam prarabhyate tatredam caturtham ähnikam / äha (D. caturthaprathamam ähnikam, s.m. caturtham ähnikam) P. om / äha 2 K. and D.: nänekäntäh P. nekäntah 3 D. bhedäbhedä0, s.m.'bhedabhedä0 4 All the Mss read ayuktam. 5 All the Mss read tattvabhedena. We follow Raghavan.

1

144

YUKTIDIPIKA

5

10

15

20

25

30

iha yena bhedanam samanugatis tasya sattvam drstam tadyatha mrda ghatadinäm / asti ceyam sukhaduhkhamohaih sabdädmäm samanugatih / tasmät te 'pi santi / ye ca sukhädayo 'stamitavisesäs tad avyaktam / tasmäd asty avyaktam / äha: na asiddhatvät / sukhädibhih sabdädayo 'nugamyanta ity etad aprasiddham / kena käranena pratipattavyam iti / ucyate: tadbuddhinimittatvät / iha sabdasparsarüparasagandhänäm sannidhäne svasarnskäravisesayogät sukhaduhkhamohäkäräh präninäm buddhaya utpadyante / yac ca yädrsim buddhim utpädayati tat tenänvitam 1 tadyathä candanädibhih sakalädayah / tasmän näsiddhih samanvayasyeti / äha: asiddha eväyam samanvayah / kasmät / vilaksanakäryotpattidarsanät 2 / na hy ayam niyamah käranasadrsam eva käryam utpadyate / kirn tarhi / vilaksanam agnidhümasabdädi / katham / na hy agnis trnädisvabhävako 'gnisvabhävako vä dhümah / na ca bherldandädisvabhävah sabdah / tasmät sukhädyanugatäh sabdädaya iticchämätram / ucyate: na visesitatvät / sukhädisvarüpäh sabdädayah tatsannidhäne sukhädyäkärapratyayotpatt<er> 3 ity etad ädita eväsmäbhir visesitam / tasmän na bhinnajätiyäs ta iti / yat tu khalv idam ucyate(144.10) 'gnyädlnäm vilaksanänäm utpattidarsanät pradhänabhedänäm atajjätiyaprasanga iti tad ayuktam / kasmät / abhipräyänavabodhät 4 / naiva brümo yo yasya vikärah sa tajjätlyaka iti / kirn tarhi / yo yajjätlyakah sa tasya vikära iti / tasmäd ayuktam etat / kirn cänyat / udäharanäprasiddheh 5 / na caitad udäharanam prasiddham agnyädayah svakäranajätim nänuvidadhatiti / kasmät / balaviryänuvidhänät tadyathä agner dhümasya ca tvakcandananalikädisnigdhatänuvrttes 6 taiksn<y>ädyanuvrttes7 ca / bherivikärah sabdah, na tu yathä bherlrüpam avasthitam, pradipeneva tu dandäbhighätena vyajyata iti sädhyam etat / na caikaiko rüpädlnäm dravyäkärah samudäyadharmatvät / tasmän na bherivikärah sabdah^1^ / tatra yad uktam(144.10) vilaksanakäryotpattidarsanäd asiddho 'nvaya ity etad ayuktam / tasmäd yuktam etat samanvayäd asty avyaktam iti / kirn cänyat / SAKTITAH PRAVRTTES CA / (SK15b') iha yävati käcil loke pravrttir upalabhyate sä sarvä saktitas tadyathä kumbhakärasya, dandädisädhanavinyäsalaksanäyäs ca sakteh sannidhänäd ghataX D. tenänyatvam Dkha. tenänvitam 2 D. vilaksanakäryotpattidarsanät, s.m. 3 All the Mss read ° pratyayotpattir. 4 Dkha. °navabodhanäd 5 6

vilaksanotpattikäryadarsanät

K., P. and D.: udäharanäprasiddheh Dkha. udäharanäsiddheh D. corrects udäharanäsi ddheh of Dkha. into udäharanäprasiddheh. D. reads in the right margin: digdhänuvrtteh iti päthah / digdhah mämsety prasiddhah gandhah /. 7 All the Mss read taiksnädyanuvrttes. We follow Chakravarti.

t1) (na bherivikärah sabdah) rupadipancakavyatiriktam tavad dravyam nasti / na ca rupam eva vä gandho vä rasa eva vä sparsa eva vä bherl yena tadvikärah sabdo bhavet / / (D.164, not found in K.)

CATUSTAYAM ÄHNIKAM SK15

145

karanepravrttir asti / vyaktasya^1) ceyam käryatvät tadbhävena pravrttir ity 1 atas tasyäpi saktyä bhavitavyam / yasau saktis tad avyaktam / tasmäd asty avyaktam iti / äha: präk pravrtteh saktyabhävah pravrttyanupalabdheh / yadi saktipürvikä pravrttir iti manyadhvam tena yävat pravrttir nopalabhyate tävac chaktir nästity etad äpannam / kasmät / satyäm saktau käryäbhäve 2 svarüpäbhävaprasangät / yadi khalv api vidyamänä saktih kenacit pratibandhena käryam notpädayec chaktir asaktety etad äpannam / tasmät 3 sahakäribhäväntarasannidhänät pravrttisamakälam evärthänäm saktaya utpadyante täs ca tävad^2) eva pradhvamsante / tatra yad uktam(144.31) präk pravrtteh saktidarsänäd vyaktasyäpi nispädikä saktir astity etad ayuktam / kirn cänyat / bhedäbhedakalpanänupapatteh / iha pradhänam eva vä saktihsyät pradhänäd vä bhinnä / kirn cätah / tad yadi tävat pradhänam eva saktis^3) tena käryabhedäc 4 chaktibhedo 'vasiyata iti saktibhedät pradhänanänätvaprasangah / pradhänaikatväd vä tadavyatiriktänäm saktinäm ekatvaprasangah / tatas ca käryanänätväbhävah / atha mä bhüd ayam dosa iti pradhänäd arthäntarabhävah saktinäm abhyupagamyate / tena bhinnänäm saktinäm pravrttitah siddhau pradhänasiddhir nästity etad äpannam^ 4 )/ kirn cänyat / svarüpä<na>bhidhänam 5 ca / pradhänasya saktimäträd apy(5^ arthäntaratvam abhyupagamya rüpam Idrk pradhänam svävasthäyäm iti <abhidhämyam> / tac cäsakyam abhidhätum / tasmäd bhedäbhedakalpanänupapatter akalpaniyä saktir iti / ucyate: yad uktam(145.4) präk pravrtteh saktyabhävah pravrttyanupalabdher ity atra brümah: n a aprasiddhatvät / [käranam saktih käryam
1 K. and D. omit ity. 2 KM P. and D.: saktyärn 3 D. tasmät, s.m. kasmät 4 P. kärye bhedäc 5

5

10

15

20

käryäbhäve Dkha. saktau käryäbhäve D. s.m. saktyäm käryäbhäve

All the Mss read svarüpäbhidhänam.

(^(vyaktasya) purvoktamahadadeh / / (D.165 without number, not found in K.) (2)(tavad) tasminn eva ksana ity art hah / / (K.54b, D.165 without number) (3) (tad yadi tävat pradhänam eva saktis) pradhänam eva saktir iti darsanesaktyätmakam pradhänam pradhänätmikä vä saktaya iti vidhyanuvädabhedena düsanadvayam dadäti tad yadltyädinä / / (K.54b, D.165 without number) (4) (etad äpannam) etad äpannam iti / na hy anyasya siddhäv anyasya siddhili saktayas ca prasiddhäh pradhänäd arthäntarabhütä iti bhävah / / (K.54b, D.l66 without number) ^5^ (Saktimäträd apy) saktimäträd aplti pürvam ca tvayoktam yä saktis tat pradhänam iti vadatä saktimätrapradhänarüpam iti tad dhrdaye nänuvisati, adhunä tu tato 'pi kimcid arthäntaram pradhänam ity ukte nirupäkhyam eva kimcit tad abhihitam syät / kä hi tasya pradhänasya svä dasä svam rüpam iti yävat / / (K.54b, D.166 without number)

146

YUKTIDIPIKA

5

10

15

20

pravrttih /] na ca karyanupalabdhau karanabhava 1 ity etal loke prasiddham^ 1 )/ yat punar uktam( 145.6) käry<ä>nispattau2 sakteh svarüpahänam 3 ity atra brümah: na pradlpadrst antat / tadyathä pradipasya ghatädiprakäsanasaktir^2) asti / atha ca kudyädyävaranasämarthyän na ghatädln prakäsayiturn saknoti / na ca sakyate vaktum pradipasya prakäsanasaktir asakteti / evam anyesäm api bhävänäm präk pravrtter api saktih syät / na ca pravrttyadarsanäd 4 asyäh svarüpahänam 5 syät / yat tüktam( 145.8) sahakäribhäväntarasannidhänät pravrttisamakälam evärthänäm saktiprädurbhäva ity atra brümah: tadaprasiddhih saktyapeksatvät / iha sarvah kartä svagatäm saktim apeksya tadyogyatayä sahakäribhäväntaram upädatte / sä cet präk pravrtter na syät sädhanänäm visayasvabhävänavadhäranäd anupädänaprasangah / anistam caitat / tasmät präk 6 pravrtteh saktih / yat punar etad uktam(145.10) tävad eva pradhvarnsa7 ity atra brümah: na käryanisthädarsanät^ 3 )/ yadi pravrttisamakälam eva pradhvarnsah 8 syät käryanisthaiva na syät tannimittatvät käryasya / asti tv asau / tasmän na pravrttisamakälam eva saktipradhvarpsah / sadrsasantänotpattyä 9 käryanistheti cen na vinäsakälotpattyasambhavät 1 0 / athäpi syät / ekasyäm saktau ksanasädhyam 11 amsam avasäya vinastäyäm 12 anyat tatsadrsam saktyantaram utpadyate tasmin vinaste 'nyad ity evam saktisantänät käryanisthä bhavatiti / etad apy ayuktam / kasmät / vinäsakälotpattyasambhavät / ko hy atra hetur yena vinäsasamakälam anyac chaktirüpam käryam avasäyayati na punah präktanam evävasthitam iti / kirn cänyat / kautasthyadosaparihärät / ksanottarakälävasthäne 13 ca bhävänäm yo dosa upättah kautasthyaprasanga iti tasya parihära uktah / tasmän nästi saktlnäm pravrttikäle vinäsah / pravrttyuttarakälam api nästi /
1 K., P. and D.: käryäbhäva Dkha. käranäbhäva 2 K., P. and D.: käryanispattau Dkha. käyänispattau 3 D. svarüpahänir, s.m. svarüpahänam 4

K. na na pravrttidarsanäd P. na ca(l) pravrttidarsanäd D.: na pravrttidarsanät, s.m. na na pravrttidarsanät D. reads in the right margin: na ca pravrttyadarsanät asyäh svarüpahänam syät iti ca päthah. 5 D. svarüpahänam, s.m. asyäh svarüpahänam 6 D.: tasmät kä, s.m. tasmät präk 7 D. pradhvamsa1 s.m. pradhvamsante 8 Dkha. saktipradhvamsah 0 9 K. and P.: sadrsasandhäno0 D. sadrsasandhäno0, s.m. sadrsasantäno0 10 K. and P.: vinäsasamakälo Dkha. vinäsakälo0 D. vigä(1)sasamakälo°, s.m. vinäsasamakälo0 11 Dkha. laksanasädhyam 12 D. vinasthäyam, s.m. vinisthäyam 13 D. °ävasäne

(*) (prasiddham) na hi ghate bhavati kulalasyoktam samarthyam nasti svasamvedanasiddhatvad iti bhävah / / (K.55a, D.166 without number) (2) (pradlpasya ghatädiprakäsanasaktir) na hy ävrtasyäpi kudyädibhih pradlpasya prakäsanasämarthyam nästi, evam hy asau pradlpa evändhatamasädivivikta iti / / (K.55a, D.167 without number) <3) (-nisthä-) tl° sthitih // (D.167 i.n., not found in K.)

CATUSTAYAM AHNIKAM SK15

147

kasmät / punahpravrttidarsanät / saktyantarotpattau pravrttyantarasadbhäva iti cen na hetvabhävät / ko hy atra nirbandhah tasyäm vinastäyäm anyä pravrttyantarahetur bhavati naiva punah <saiveti>1/ krtärthatväd iti cen na anabhyupagamät / na hy ekaghatärthä saktir abhyupagamyate / tatra yenaiva hetunaikam ghatam ävasäya na vinasyati tenaiva yävanti kartavyäniti / tasmät trisu kälesu saktayo 'vatisthante / yat punar etad uktam(145.11) bhedäbhedakalpanänupapattir ity atra brümah: astu pradhänäd abhinnä saktih / na tasya nänätvam saktyekatvam vä prasajyate / kasmät / samkhyävyavahärasya buddhyapeksatväd buddhinimittasya cägajtkäxenaj)radhänasaktisvabhävät / ihäyam samkhyävyavahäro buddhyapeksah / katham / yad abhinnäm buddhim utpädayati tad ekam / pradhänävasthäyäm ca saktayo 'stamitavisesatväd abhinnäm buddhim utpädayanti / tasmäd ekam / tatpravrttikäle visesävagrahena bhedam pratipadyate 2 devasaktir manusyasaktir ityädi / tasmän näsäm ekatvam / ato na bhedäbhedakalpanänupapattir 3 iti / vyakte darsanäc 4 chaktlnäm avyakte <'>pratipattir 5 iti cet / syäd etat / vyakte saktipravrtti 6 drste na cävyakte 7 kvacid <ity> ato 8 vyaktam evaitasmäd dhetoh siddhyati nävyaktam ity / etac cäyuktam / kasmät / sämänyato<drstät> 9 siddheh / yathaiva hi devadattädhärayä kriyayä tasya desäntarapräptim upalabhyätyantädrstam jyotisäm desäntarapräpter gamanam anumiyate, evam pravrtteh saktiniyamitatväd vyaktasya ca pravrttibhütatväd avasyam atyantädrstä saktir abhyupagantavyeti siddham saktitah pravrtter asty avyaktam / kirn cänyat / KÄRANAKÄRYAVIBHÄGÄT / (SK15c) käranam ca käryam ca käranakärye tayor vibhägah käranakäryavibhägah / idam käranam idam käryam iti buddhyä dvidhävasthäpanam vibhägo yah sa käranakäryavibhägah / tad avasthitabhävapürvakam drstam tadyathä sayanäsanaratha<sa>ranädih 10 / asti cäyam vyaktasyakäranakäryavibhägah 11 / tasmäd idam apy avasthitabhävapürvakam / yo 'säv avasthito bhävas tad avyaktam 12 / äha: tadanupalabdher ayuktam / na hi sayanädinäm käranakäryavibhägah kascid upalabhyate / tasmäd ayuktam etat / ucyate: na käryakäranayor upakärakopakäryaparyäyatvät / <na hi> käranam 13 käryam iti nirvartyanirvartakabhävo 'bhipretah / kirn tarhi /
1 All the Mss read saiva sett. We follow Pandeya. 2 D. pratipadyate, s.m. pratipadyante 3 D. papattir, s.m. °papatter 4 D. vyakte darsanäc, s.m. vyaktadarsanäc Dkha. vyaktadarsanäc 5 K., P. and D. avyakte pratipattir Dkha. avyaktapratipattir 6 D. saktipravrtte, s.m. saktipravrtti 7 D. cävrkte1 s.m. cävyakte 8 A11 the Mss read anyato instead of <ity> ato. 9 All the Mss read sämänyatodrstäntät. We follow Chakravarti. 10 All the Mss read sayanäsanarathacaranädih 11 D. käryakärana0, s.m. käranakärya0 12 D. avyaktam, s.m. avyaktam; tasmäd asti avyaktam. 13

5

10

15

20

25

30

P. käranam

148

YUKTIDIPIKA

5

10

15

upakarakopakaryabhavah / sa casti sayanadmam vyaktasya ca / ato na pramadäbhidhänam etat / äha: kah punar vyaktasya paraspa<ra>käryakäranabhäva 1 iti / ucyate: gunänäm tävat sattvarajastamasäm prakäsapravrttiniyamalaksanair dharmair itararetaropakärena yathä pravrttir bhavati tathä "prityapritivisädätmakäh"(SK12a) ity etasmin sütre vyäkhyätam / tathä sabd adln am prthivyädisu parasparärtham ekädhäratvam^ 1 )/ sroträdlnäm itaretarärjanaraksanasamskäräh^ 2 )/ käranasya^3)2 käryät sthänasädhanaprakhyäpanä<ni> 3 / käryasya^4) karanäd^5^ vrddhiksatabhangasamrohanasam<po>sanaparipälanäni 4 / prthivyädlnäm <dhrtisangrahapakti>vyühävakäsadänair 5 gavädibhävah(cf.NS.3.1.26(c)) / devamänusatirascäm yathartuvidhänejyäposanäbhyavahärasamvyavahärair itaretarädhlna<tvam> 6 / varnänäm svadharmapravrttivisayabhävah / anyac ca lokäd yathäsambhavam drastavya<m> 7 / äha: tadanupapattih kramayaugapadyäsambhavät / yo ' y a m Sul>änäm prakäsapravrttiniyamair itaretaropakäro ? bhyupagamyate sa khalu kramena vä syäd yugapad vä / kirn cätah / tan na tävat kramena sambhavati / kasmät / ekasya nirapeksasya pravrttäv itarayor api tatprasangät / yadi tävat sattvam pürvam gunäntaranirapeksam svasaktita eva prakäsate tayor 8 upakärakam ity äsriyeta 9 tena yathä sattvam evam itaräv apy upakäranirapeksau
2 D. käranasya 3 All the Mss read ° prakhyäpanädi. 4 All the Mss read vrttiksatabharigasamrohanasamsosana0. 5 K. and D.: vrttisamgrahapaktivyühä0 P. vrttisamgrahapanthivyühä0 6

the Mss read parasparasya käryakäranabhäva. We follow Chakravarti.

K. ° vyavahärair itaretarädhyayanam P. ° vyavahäraititeratarädhyayanam D. ° vyavahär itaretarädhinam 7 A11 the Mss read drastavyah. We follow Chakravarti. 8 P. prakäseta tayor Dkha. prakäsetarayor 9 K. and P.: äsriyate D. äsriyate, s.m. äsriyeta

(^(ekadharatvam) ekadharatvam iti / sabdadayah pafica prthivim upakurvate gandharahitä jalam, gandharasarahitäs teja evam anyesv api jneyam / evam bhütäni sabdädln dhärayanti* / / (K.56b, D.171 without number) * After dhärayanti D. adds iti parasparam upakäri by a different hand.

(2) (itaretara-) itaretarasabdena visayo vä svarüpam vä yathäyogam srotrasrutaäabdänusärena caksuh pravartata iti tasya visayah srotrenärjitaä caksusä niskantake märge 'nviste pädasya raksä caksusä kantakoddharanena hastaparimärjane pädädeh* samskärah** / / (K.56b, D.170 without number) *D. hastaparimärjane pädeh, s.m. hastaparimärjane na pädeh **After samskärah D. adds evam anyaträpy ühyam by a different hand. (3) (käranasya) indriyasargasya käryäc charlrät sthitih / tatra hi täni tisthanti santi svakäryam sädhayitum saktäni bhavanti svakäryasiddhidvärena ca tesärn anumänapravrttau svätmä prakhyäpitas tair indriyair bhavatlti // (K.56b, D.171 without number*) *This footnote of D. is marked by a sign similar to an asterisk. (4) (käryasya) sarlrasya // (K.56b, D.171-2) (5)(karanäd) tl° hastagateh // (D.171, not found in K.)

CATUSTAYAM ÄHNIKAM SK15

149

svakäryam karisyata ity upakäränarthakyam / atha mä bhüd ayam dosa ity ato yaugapadyam äsriyate / tad apy anupapannam / kasmät / <saha>bhütänäm1 anupakärakatväd govisänavat / kirn cänyat / sadasadvikalpänupapatteh / iha sattvam prakäsamänam rajastamasor vidyamänam vä prakäsam äviskuryäd avidyamänam vä / kirn cätah / tad yadi tävad vidyamänam abhivyanakti tena sarvesäm ekasväbhävyäd <eka>gunatvaprasangah2/ kirn ca sattvavac cetarayoh svätantryaprasangah / yathäsattvasya prakäsasaktir astity atas tad gunäntaranirapeksam prakäsate tadvad itaräv aplti <dosah>3/ athavävidyamänä 4 prakäsasaktih sattvasambandhäd rajastamasor upajäyate / tena yad uktam(146.12) präk pravrtter avatisthante 5 saktaya iti tad dhinam / tatas ca satkäryavädavyäghätah / kirn cä<nyat>6 / anekäntät / na hy ayam ekäntah parasparopakärinäm avasthitabhävapürvakatvam iti / tathä hi sattvädayah parasparopakärino na cävasthitabhävapürvakäh / tena yad uktam(147.24) käranakäryavibhägäd 7 bhedänäm avyaktam asti <ity> et ad ayuktam / ucyate: yad uktam (148.14) upakäräbhävah kramayaugapadyäsambhaväd iti / astu yugapadupakärah / yat tüktam(149.2) sahabhütänäm 8 anupakärakatvam govisänädivad ity atra brümah: na anyathänupapatteh / na hi govisänayoh sahabhütatväd upakäränupapattih / kirn tarhi / ekakäryäbhävät / yesäm tu käryam ekam sahabhäve tu tesäm upakäro na pratisidhyate tadyathä prthivyädinäm dhrtisangraha<pa>ktivyühävakäsadänaih 9 sarirasthitau 10 / kramabhävinor api khuravisänayor nästi parasparopakärah / tasmän na sahabhävasahabhäväv upakäränupakärahetü / kirn ca drstatvät / drstah khalu^ bhogenordhvagamane väyvor ardhacandädinäm yugapadupakärah 11 [na ca kascid dosah] / tathä gunänäm api syät / samyoganimitta iti cet sädhyam / kirn arthäntarabhütam uta präptimätram samyoga iti <sädhyam> / yat punar etad uktam(149.4) sadasadvikalpänupapatter ity atra brümah: ayuktam 12 etat / kasmät / pangvandhavat tadupakäre dosänupapatteh / tadyathä pangvandhayor itaretarasamban<dhäc ca>13 vidyamänayor drggatisaktyor anyonyätmani vyaktir na cävidyamänayor atha caikakäryasiddhih 14 / yathä ca prthivyädinäm parasparopakäritvam saktayor abhivyajyate na parasakt<yä>15 evam gunänäm aplti / yat punar etad uktam (149.12) anekäntäd iti tad ayuktam / kasmät /
1 A\\ the Mss read mahäbhütänäm. We follow Chakravarti. 2 All the Mss read gunatvaprasangah. We follow Raghavan. 3 All the Mss read ado sah. 4 D. athavä vidyamänä, s.m. athavävidyamänä 5 P. eva tisthante 6 All the Mss read cäyam. 7 D. käranakäryabhägäd, s.m. käranakäryavibhägäd 8 D. sahabhütänäm, s.m. mahäbhütänäm 0 9 All the Mss read dhrtisamgrahasaktivyühä . 10 P. sanrasthito 1Ji P. yugadupakärah 12 D. avyaktam Dkha. ayuktam 13 All the Mss read itaretarasambandhän na. 14 D. caikakäryayoh siddhih, s.m. caikakäryasiddhih 15

5

10

15

20

25

30

All the Mss read parasaktaya. We follow Pandeya.

150

YUKTIDIPIKA

5

10

15

sastranavabodhat / ihasmakam karyakaranayor 1 <arthantaratvana>bhyupagamäd 2 gunänäm avasthäntaram evävasthäntar<ä>peksam3 käryakäranasabdaväcyatäm labhate / tatra ye tävat 4 pradhänävasthänubhävino gunäs tesäm saktimätrarüpatväd anirdesyaprakäsädisvabhävänäm nästi tannibandhana upakärah / yadä vaisamyam äpadyante tadä niväritaprakäsädirüpäs tannimittam upakäram pratipadyante / tasmäd vyaktänäm upakäräbhyupagamäd avasthitabhävapürvakatvam na virudhyata iti sästram anavagamyaivam ucyate 'naikäntiko 'y ar P hetuh <iti> / pradhänävasthäyäm upakäränabhyupagamäd uttarakälam api tatprasanga iti cet / syän matam / yadi gunänäm ädye prakope svasämarthyäd eva pürvasmät pracyutis tenottarakälam api tadvad eva bhavisyati / atha pradhänävasthäyäm api copakäro na tarhy <an>aikäntiko 5 hetur iti / tac ca naivam / kasmät / agnivat svasaktinimittatvät / tadyathä süksmo 'gnih sükmam prakäsam svayam eva karoti / ghatädiprakäsane tu tailavartyädy apeksate / tadvad gunänäm ädyah prakopah svasaktitah mahadädyapeksas tüpakäratah 6 / tasmäd yuktam etat käranakäryavibhägäd 7 asty avyaktam iti / kirn cänyat / AVIBHÄGÄD VAISVARÜPYASYA / / (SK15d)

20

25

iha yad visvarüpam tasyävibhägo drstas tadyathä sälädlnäm 8 jalabhüml 9 (cf. YBh.onYS.3.14) / visvarüpäs ca 10 mahadädayah / tasmäd esäm apy avibhägena bhavitavyam / yo 'säv avibhägas tad avyaktam / tasmäd asty avyaktam / sälädlnäm 11 jalabhümyor avibhägatvenäprasiddhatväd <a>yuktam 1 2 iti cen na / tan na / tatpürva<ka>tvät 13 / yo hi tatpürvakas ta<danu>bhävy 14 asau drstas tadyathä kapälapürvako ghatah kapälävasthänubhävT / jalabhümipürvakäs ca säläh / tasmät te Jpi tadavasthänubhävinah / yathä ca sälädayas tathä visesatanmäträhamkäramahatäm uttarottarapadäX D. karyakaranayor, s.m. käryakäranayor 2 K. and P.: arthänabhyupagamäd D. arthäbhyupagamäd, s.m. arthänabhyupagamäd 3 All the Mss read evävasthäntaränapeksam. We follow Raghavan. 4 D. tatraitävat 5 All the Mss read tarhi nänaikäntiko. 6 D. tüpakäratah, s.m. tüpakärah 7 D. käryakäranavibhägäd, s.m. käranakäryavibhägäd 8 D. writes and deletes: sälädinämf jalabhümer visvarüpäc ca mahadädayah tasmäd esäm

apy avibhägena bhavitavyam yo säv avibhägas tad avyaktam tasmäd asty avyaktam (150.19 21) äha kirn punas tad vaisvarüpyam ko vä visvarüpa iti ucyate vaisvarüpyam iti visistam avasthänam äcaksmahe astamitavisesatvam avibhäga iti visesasya sämänyapürvakatväd yo frthas tad uktam bhavati avibhägäd vaisvarüpyasyeti(154.8—11). 9 D. jalabhümer, s.m. jalabhüme 10 D. visvarüpäc ca, s.m. visvarüpäs ca 11 K., P. and D. omit sälädinäm .... nästiti flokatarkaviruddham efa*(150.22-154.7). To introduce this portion D. reads: nimnalikhito yam bhägah kha°pu°kät püritah. See Introduction p.XI. 12 Dkha. yuktam 13 Dkha. tatpürvatvät 14 Dkha. tanubhävy D. corrects tanubhävy into tadanubhävy. We follow the emendation suggested by D.

CATUSTAYAM ÄHNIKAM SK15

151

rthapürva<katvät> 1 tadavasthänubhävah siddhah / sämänyatodrstäd anumänän 2 mahatas cävyaktävasthänubhävah / tatpürvakatväsiddher ayuktam iti cet / syän matam / präk pradhänam asiddham sädhayisyämlti bhavatä vaisvarüpyasyävibhägäd iti het<o>h3 sälädidrstänta upättah / tatah sälädinäm avibhägo 'siddha 4 iti tatpürvakam upättam / yävat tävad apy asiddham sa bha<vän>5 svapnasopänaparamparayäkäsam ärüdho 'pi dharanisthita eva / tasmäd asiddham pradhänam iti / etac cäyuktam / kasmät / vrddhidarsanät / käranänvayinl hi sälädinäm vrddhir upalabhyate / täm drstvä grhnimahe nünam bhaumäs caudakäs cävayaväh käranävayavasahakärinäm pari<mänam>6 pratipadyante, tathaisäm vrddhir bhavatiti / kirn cänyat / tadanuvidhänäc ca / drsyate khalv api drdhadurbalatvasnehar<au>ksyänäm 7 jalabhümigatänäm sälädibhir anuvidhänam na cäprakrter anuvidhänam drstam / ato 'pi manyämahe tatpürvak<ä>h 8 sälädayah / prthaggrahanäd ayuktam iti cet / syäd etat / jalabhümyoh sälädinäm prthaggrahanam drstam na ca tat prakrtivikära<yor>9 astiti / etad a y u k t a m / kasmät / sädhyatvät / ye jalabhürriyor avayaväh sälädibhävam äpadyante tebhyas tesäm prthaggrahanam sädhyam / ato na kimcit <etat>10 / atyantavinäsäd avibhä<gä>nupapattir 11 iti cet / syäd <etat> / iyam punar abuddhimatäm äsahkä / yad idam j alabhümyavasthä<nubhävitvam>12 sälädinäm punah punar apy <agrahlsmahi>13 .... tadamrsyamänänäm XätSjä^ sJJ^dajah^svakäranavibhägavinäsino <'>sad14 iti bhütapratyaksäbhäväd bhütasmrter virödhapratya<ksatväc>15 cety(cf.VS.9.6) evamädibhir <a>pi16 hetubhir närabh<ya>käranävasthänubhävina 17 iti / tad apy ayuktam / kasmät / pratisedhät / asato hi janma präg vistarena nisiddham(122.3ff.) satas ca tasya <vyakty>apagamäd18 anyo vinäsah syät / punaruktabhayän na kimcid abhi2 Dkha. anumänä(t) 3 Dkha. hetuh 4 Dkha. avibhägo siddha 5 6 Dkha. 7 Dkha. 8 Dkha. 9

5

10

15

20

25

a. °pürvat

Dkha. sabhävät D. corrects sabhävät into sabhavän (sa bhavän?). We follow the emendation suggested by D. parinämam °sneharüroksyänäm D. corrects °sneharüroksyänäm into °sneharoksyänäm. tatpürvakah Dkha. prakrtivikäro D. corrects prakrtivikäro into prakrtivikärayoh. We follow the emendation suggested by D. 10 Dkha. syät ^Dkha. avibhägäd anupapattir D. corrects avibhägäd anupapattir into avibhägänupa0. We follow the emendation suggested by D. 12 Dkha. ° avasthäbhävitum D. corrects ° avasthäbhävitum into ° avasthänubhävitvam. We follow the emendation suggested by D. 13 Dkha. agrtsmahi D. corrects agrismahi into agismahi. 14 Dkha. °vibhägavinäsinah sad 15 Dkha. °pratyanvac D. corrects °pratyanvac into °pratyaksatväc. We follow the emendation suggested by D. 16 Dkha. °ädibhiripi D. corrects ° ädibhiripi into ° ädibhir api. We follow the emendation suggested by D. Dkha. närabhikäranävasthänubhävina 18 Dkha. tasya kam(l) vaktrapagamäd D. corrects tasya kam(7) vaktrapagamäd into tasya

152

YUKTIDIPIKA

5

10

15

20

dhiyate / [tena] tenetarah pratyukto yo 'pi hi manyate prag utpatteh karyasyäsattvät pr<a>krtäv1 avibhägo 'nupapanna iti tenäpy "asadakaranät" (SK9a') ity <etat>2 prakaranam apeksyam / desängasvabhävavibhägänupapatter ayuktam iti cet / athäpi syät / vaisvarü<pya>syävibhägäbhyanujnänäd3 vibhägo 'py anujnäta 4 eveti sakyam anumätum / sa ca <vi>bhägo5 vyaktasya [desavibhägäd vä syät] iksu<ksodarasavad>6 desavibhägäd vä syät, <...angavibhägäd vä syät,> bhojanäntararasavat svabhävabhedäd vä syät / kirn cätah / tad yadi tävad desavibhägät käryakärananänä<tva>prasango 7 gaväsvavat, athängavibhägä<t> 8 gradhäiia^ ca JtmS&a^^ > a t h a svabhäva10 bhedat tathapi karyakaranananatvaprasangah sitosnavat / etavams ca vibhagavikalpah syät / sarvathä ca dosa iti tasmäd asad eta<d> n iti / tac cänupapannaiii / kasmät / vise<sita>tvät 12 / pürvam eväsmäbhir visesitam yathaikam eva no vastu ni<vrtta>visesam13 avibhägaity ucyate samupajätavisesam vibhäga iti / kasmät / vibhägavisesayor arthäbhedät / evam ca sati desä<nga>vibhägayoh 14 kah prasangah, svabhävabhedo 'pi nästi traiguny<ädya>visesät 15 / saktibhedäd iti cen na anekä<ntät> 16 / asti hi senävanädeh samsthänasya samsthänibhyah saktibhedo na ca nänätvam / anekakäranapürvakesv 17 <anvaya>parimänädidarsanäd 18 asiddhir iti cet / syän matam / anekakäranapürvakesv avigarbhakädisv anvayaparimän<äv> upalabdhäv 19 anekakartrkesu sayanädyangesu käryakäranavibhägah /
1 Dkha. präkrtäv 2 3 Dkha. 4 Dkha. 5

vyaktyapagamäd. We follow the emendation suggested by D.

Dkha. et vaisvarüpasyä0 anujnätah D. corrects anujnätah into anujnäta. Dkha. cävibhägo D. corrects cävibhägo into ca vibhägo. We follow the emendation suggested by D. 6 Dkha. iksüdarasave D. corrects iksudarasave into iksuksodarasavat. We follow the emendation suggested by D. 7 Dkha. käryakärananänäprasarigo 8 Dkha. °vibhägä 9 Dkha. amsänäm nätmätävayavatvaprasangas (not clear) D. corrects amsänäm nätmätävayavatvaprasangas into amsänäm ätmävayavaprasatigas, and again corrects into amsanän sätmävayavatvaprasangas. 10 Dkha. käryakäranam nänätvaprasangah D. encircles the sign of anusvära. n Dkha. etam(d) (D. seems to suggest to read etad.) 12 Dkha. visesatvät D. corrects visesatvät into visesitatvät. We follow the emendation suggested by D. 13 Dkha. nirlitavisesam 14 Dkha. desämsavibhägayoh 15 Dkha. traigunyädivisesät D. corrects traigunyädivisesät into traigunyädyavisesät. We follow the emendation suggested by D. 16 Dkha. anekät D. corrects anekät into anekäntät. We follow the emendation suggested by D. 17 Dkha. °pürvakesu arbhakädisu D. inserts after °pürvakesu the following passage: °pürvakesv äparimänädidarsanäd asiddhir iti cet syät matam anekakäranapürvakesv avigarbha kädisu. We accept the inserted passage. 18 D. äparimänädidarsanäd (cf.p.l52,fn.l9.) 19 Dkha. anvayaparimänänupalabdhau D. corrects anvayaparimänänupalabdhau into °parim nau upalabdhau. We follow the emendation suggested by D.

CATUSTAYAM ÄHNIKAM SK15

153

tasmäd anekäntäd asädhanam parimänädaya iti / etac cäyuktam / kasmät / hetvantaratas tatsiddheh / syäd etat / yadi na tasyaikatvam ata eva sädhyate / kirn tarhi / abhinnabuddhinimittatvät / upetya vä sarvesäm taddhetutväd avigarbhakädmäm anvayaparimänasambha<ve>1 parasparo pakäro nästi sayanädyangänäm caikasminn avibhägah / sarvavitasambhave hi käranatvam / bhinnajätlyanivrttyartho 'py ayam ekasabdo drsyate <na>2 vastvantaranivrttyartho brähmana eko varnah sälaya ekam sasyam iti / apaksadharmatvät pradhänäsiddhir iti cet / syän matam / pari<mänä>dayo3 vyakter drstatvät taddha<rmo> na cänyadharmo 4 'nyasiddhaye samarthah / kas<mät>5/ käkasya käsa<b>däd6 api pradhänästitvaprasarigät / tasmät parimänädibhih pradhänasyeti / <tac ca> 7 naivam / kasmät / prthaktvänabhyupagamät / käryakäranaprthaktvavädino hi käryadharmäh käranäsambandhin<a>8 iti krtvä yuktam abhidhätum syät / na tv et an matam asmäkam / tasmät suvikalpa<h>9 pratisedho ' y a m / kirn ca svapaksa<tat>pratipaksasiddheh 1 0 / idam tävad ayam sarvasästrapariksäkärah <pra>stavyo 11 'tha bhava<to>12 'gnir atra dhümäd usna<h>13 sarvo 'trägnir ity asmin prayoge katham dhümägnyor agnisparsayos ca lih<ga>lingibhävah14/ gamakatväd ity äha / na hi no gunaguni<tve>na15 dharmavyavasthä / kirn tarhi / sädhyatväpeksayä sädhyo lingi sädhanam Ungarn ity ucyate / lihgatvam gamakatve svapakse 'bhyupagacchatah 16 parapakse kayä yuktyä na lingagama<ko>17 'nvayah / asädhäranatvät pradhänasvarüpasyänumänäd aprasiddhir iti cen na anabhyupagamät / yatra vipratipattis tatpratyaksatvävisayatve 'numänasya gocara ity ayam abhyupagamo nah / tasmäd etad apy abädhakam /

5

10

15

20

a. °sambhavo D. corrects °sambhavo into °sambhave. We follow the emendation suggested by D. 2 Dkha. tena D. corrects tena into na. We follow the emendation suggested by D. 3 Dkha. parinämädayo 4 Dkha. taddharmänanyadharmo D. corrects taddharmänanyadharmo into taddharma na cänyadharmo. 5 Dkha. kasmät käsärdät(?) D. corrects kasmät käsärdät into kasmät. We follow the emendation suggested by D. 6 Dkha. käsardäd 7 Dkha. tatas ca D. corrects tatas ca into tac ca. We follow the emendation suggested by D. 8 Dkha. käranäsambandhinam D. corrects käranäsambandhinam into käranäsambandhinah. We follow the emendation suggested by D. 9 Dkha. suvikalpam D. encircles the sign of anusvära. 10 Dkha. svapaksapratipaksa0 D. corrects svapaksapratipaksa0 into svapaksatatpratipaksa0. We follow the emendation suggested by D. J1 Dkha. prstavyah 12 Dkha. bhavatu D. corrects bhavatu into bhavato. We follow the emendation suggested by D. 13 Dkha. usna 14 Dkha. Ungarn lingibhävo D. corrects Ungarn lingibhävo into lingalingibhävo. We follow the emendation suggested by D. 15 Dkha. gunaganitena D. corrects gunaganitena into gunagunitvena. We follow the emendation suggested by D. 16 Dkha. 'bhyu(pa)gacchatah 17 Dkha. lingagamake D. corrects °gamake into °gamako. We follow the emendation suggested by D.

154

YUKTIDIPIKA

kim canyat / a t y a n t a g i a h a n a p r a s a n g a t / atmdriyasya dharminah svarupam pratyaksasyävisayah / tatränumänam api pratisedlKato) 1 'tyantägrahanam präptam pramäntaräbhävät / drstam ca loke ditthädlnäm gatyädibhir anumänam dittho ' y a m vyaktam ägacchati 2 <iti> / äha ca— 5 tad evaitac chirognvam tau bähü parighopamau / tad eva cäsya vikräntam näyam anyo dhananjayät //(MBh.IV.36.31) tasmäd asädharanavisayamänam nastiti lokatarkaviruddham etat / <...> äha: kim punas tad vaisvarüpyam ko vä visvarüpa iti / ucyate: vaisvarüpyam iti visistam avasthänam äcaksmahe 'stamitavisesatvam avibhäga iti / visesasya sämänyapürvakatväd iti yo 'rthas tad uktam bhavaty avibhägäd vaisvarüpyasyeti / evam etaih pancabhir vltair vyaktasya käranam asty avyaktam iti siddham / äha: vipratisedhaprasangah karanäntarapratisedhävacanät / yathä bhavän äha pradhänam jagadutpattisamartham käranam asti, evam tanträntariyäh paramänupurusesvarakarmadaivasvabhävakälayadrcchäbhävän käranatvenäbhidadhati / tesäm ca pratisedho nocyata ity ato vipratisedhah präpnoti / kim pradhänam eva käranam ähosvid etäny eva <atha>vobhayam iti / anvayadarsanat tadanupapattir iti cet / syän matam / pradhänänvaya eva prthivyädisu sukhädilaksana upalabhyate / yac ca yenänvitam 3 tasyäsau vikära iti yuktam etat präg apadistam (144.20?) / tasmät pradhänavikära eva vyaktam iti / tac cänupapannam / kasmät / anekänvayasa<d>bhäv ä t 4 / paramänvanvayo 'pi hi vyakta 5 upalabhyate rüpädisattvät / purusänvayah karanasya samvedakatvät / Isvaränvayah saktivisesayuktänäm upalabdheh / karmadaivänvayo jagadvaicitryopalambhät(cf.AK.p. 192.5) / svabhävänvayo dravyäntarasamsarge 'pi bhävänäm tasmäd apracyuteh / kälänvayo yugädyanuvidhänät / yadrcchänvayo niyamäbhävät / abhävänvayo gavädlnäm parasparätmasv adarsanät 6 / itaretaräni pratyuktäni / käranäntarapürvakatve 7 J pi khalu vyaktasya sakyäh 8 parimänädayah pürvam eva kalpayitum / tasmäd ayuktam 9 anvayädibhyah 10 käranam asty avyaktam iti / ucyate: yat tävad uktam(154.13) paramänünäm apratisedhäd vipratisedhaprasanga 11 ity atra brümah: tadanupapattir 1 2 astitvänabhyupagam a t 1 3 / astitve hi paramänünäm abhyupagamyamäne sati satyam evam syäd
2 After ägacchati Dkha. writes and deletes: tad evaitac chirogriva. 3 D. yac cethenänvitam, s.m. yac ca yenänvitam 4 All the Mss read: °nvayasambhavät. 5 D. vyakta, s.m. vyakte 6 D. °ätmasv adarsanäd, s.m. °ätmasva 'darsanäd 7 D. kärakäntara0, s.m. käranäntara0 8 P. saktyäh 9 Dkha. püritam 10 D. ayuktam anvayädibhyh, s.m. ayuktam etat anvayädibhyah 11 D. apratisedhä .... vipratisedhaprasariga, s.m. apratisedhäd vipratisedhaprasanga 12 D. anupapattih, s.m. anupapatteh 13

10

15

20

25

30

pratisedho D. corrects pratisedho into pratisedhatah. We follow the emendation suggested by D.

D. astitvänabhyupagamät, s.m. astitväbhyupagamät

CATUSTAYAM AHNIKAM SK15

155

iyam äsankä kirn paramänupürvakam idam visvam1 at ha pradhänapürvakam iti / na tu tesäm sadbhävo niscitah / tasmäd ayuktam etat / yat tu khalv idam ucyate(154.18) prthivyädisu rüpädyupalambhäd anvaya<da>rsanäd2 anünäm sadbhävah pradhänavad eva kalpayitavya iti / etad api cänupapannam / kasmät / anyathäpi tadupapatteh / tanmätrapürvakatve 'pi hi prthivyädinäm kalpyamäne rüpädisattväd ato na yuktam etat / sukhädlnäm ätmagunatvenäbhyupagamät pradhäne 'pi tatprasanga iti cet / athäpi 3 syät / yathä tanmätränäm rüpädimattvam kalpyate tatpürvakatvam ca prthivyädinäm drsyam api tesu rüpädisattvalingena 4 paramänubhyo niskrsyate, evam asmäbhih sukhädlnäm ätmagunatväbhyupagamät tadbuddhinimittatve prthivyädinäm pradhänapürvatväksepah karisyata iti / etac cänupapannam / kasmät / ätmagunatvapratisedhät / "tasmäc ca viparyäsät"(SK19a) ity atra sukhädlnäm ätmagunatvapratisedham 5 karisyämah / tasmäd asamyag etat / äha: yadi punas tanmätränäm eva paramänutvam abhyupagamyate ka evam sati dosah syät / ucyate: na sakyam evam bhavitum / kirn käranam / vrddhimatyas tanmätralaksanäh prakrtayo 'smäbhir abhyupagamyante / kasmät / svakäryäd dhi prathiyasi prakrtir bhavatiti ca nah samayah / mahänti ca prthivyädini mahäbhütäni / tasmät tesäm tadatiriktayä <prakrtyä>6 bhavitavyam / paricchinnadesäs ca paramänavah / tasmän na tanmäträbhyupagamät tesäm abhyupagamah / upetya vä tadasambhavah krtakatvät / astu vä paramänünäm sadbhävas tathäpi tebhyo jagadutpatter asambhavam brümah / kirn käranam / krtakatvät / akrtakena hi jagatkäranena yuktam bhavitum / krtakäs ca paramänavah / tasmät saty api sadbhäve na tesäm jagatkäranatvam upapadyate / hetvanupadesäd ayuktam iti cet / athäpi syät / kirn punar atra käranam yenäkrtakam jagatkäranam isyata iti / ucyate tasyaiva käranatvaprasangät / yad dhi tat paramänünäm käranam tad eva jagatkäranatvena yuktam kalpayitum syän na tannispäditäh paramänavah / krtakatväsiddher ayuktam iti cet / syän matam / yadi paramänünäm krtakatvam prasiddham ata etad yujyate vaktum amusmäd dhetor akäranam paramänava iti / tat tv asiddham / tasmän na kimcid etat <iti> / ucyate paricchinnadesatvät / iha yät paricchinnadesam tat krtakam drstam tadyathä ghatah / paricchinnades<ä>s7 ca <paramänavah> / tasmät [paramänavah] krtakäh / kirn cänyat / rüpädimattvät / iha yad rüpädimat tat krtakam drstam tadyathä ghatah / rüpädimantas ca paramänavah / tasmät krtakäh / kirn cänyat / ausnyayogät / iha yad ausnyayuktam 8 tat krtakam tadyathä pradipah / tadvantas cägneyäh paramänavah / tasmät krtakäh / kirn ca vegavattvät / iha yad vegavat tat krtakam tadyathä isur [vegavän] /
1 D. visvam, s.m. visvapadam 2 All the Mss read anvayasparsanäd. We follow Pandeya. 3 D. athäpi, s.m. anyathäpi 4 D. rüpädimattvalirigena, s.m. rüpädimattvalingatvena 5 D. °pratisedhe(?), s.m. °pratisedham 6 All the Mss read prthivyä. 7 AU the Mss read paricchinnadesas. 8

5

10

15

20

25

30

35

K. and P.: ausnyam uktam D. ausnyam uktam, s.m. ausnyayuktam

156

YUKTIDIPIKA

5

10

15

20

25

30

35

tadvanto vayaviyah paramanavah / tasmat krtakah / kirn ca snehadravatvayogät / iha yat snehadvravatvayuktam tat krtakam yathä kedärädisv äpah / ittham cäpyäh paramänavah / tasmät krtakäh / kirn ca ädheyatvät / iha yad anyasminn ädhlyate tat krtakam tadyathä badaram 1 / ädhiyante ca paramänavah prthivyäm / tasmät krtakäh / kirn ca arthäntarädhäratvät / iha yad arthäntarasyädhäratvam pratipadyate tat krtakam tadyathä ghatah / arthäntarasya ca dvyanukäder ädhäratvam anavah pratipadyante / tasmät krtakäh / kirn ca präptivyavadhänät / iha yayor madhye 'ntarä dravyam avasthitam präpter vyavadhäyakam bhavati tau krtakau tadyathä dvyariguli / tathä cänü dväv antaränvantaram 2 avasthitam yayoh3 präpter vyavadhäyakam tau krtakau / tasmät täv api krtakau / kirn ca dravyäntarärambhakatvät / iha yad dravyäntarärambhakam tat krtakam vah(cf.VS.1.1.8) tadyathä tantuh / dravyärambhakäs ca paramädnavah / tasmät krtakäh / kirn ca pratyaksatvät / iha yat pratyaksam tat krtakam drstam tadyathä ghatah / pratyaksäs ca yoginäm paramänavah / tasmät krtakäh 4 / ata ev<ä>krtakatvam 5 iti cet / syän matam / yata eva yoginäm pratyaksäh paramänavas tata ev<ä>krtakäh 6 / kirn käranam / asmadädipratyaksam ghatadi hi krtakam drstam iti krtvä / etad apy anupapannam / kasmät / sarlräkrtakatvaprasangät 7 / sarlram api hi yoginäm pratyaksam, kämam tad apy akrtakam astu 8 / atha naitad evam tarhi näkrtakäh paramänavah / pradhänädisu prasanga iti cen na anabhyupagamät / srlkapilabrähmanair api pradhänapurusäv apratyaksäv iti nah sästram / tasmäd yat kimcid etat / sattädivad iti cet / syän matam / yathä sattägunatvarüpatvädlnäm 9 sati pratyaksatve 'krtakatvam evam paramänünäm bhavisyatiti / tad apy ayuktam / kasmät / sädhyatvät / paramänvakrtakatvavat sattädmäm sadbhävo siddhah / tasmäc chasavisänät 10 purusavisänasiddhivad agrähyam etat / sauksmyäd anünäm krtakatväprasanga iti cet / syän matam / na hi paramänubhyah süksmataram anyad bhäväntaram asti yad esäm ärambhakam syät / parä khalv esä kästhä sauksmyasya ^atj)aramänavah / tasmäd esäm krtakatvam anupapannam iti / etac cäyuktam / kasmät / päkajesv atiprasangät 1 1 / sauksmyäd akrtakatvam icchatah pärthivesu tu paramänusv agnisamyogäc chyämatäm apamrdya ye päkajä ädhiyante tesäm akrtakatvaprasangah / te 'pi paramänavah süksmäh / yat tu khalv atisauksmyät pradhänapurusayor akrtakatvam drstam tat sati vibhutve / na ca yathä pradhänapurusäv evam anavo 'pi visvam badharam P. vadharam D. vadaram, s.m. badaram antaräväntaramC?), s.m. antaränvantaram yo yah D. yayoh, s.m. tayoh and P.: tat krtakäh D. tat krtakäh, s.m. tasmät krtakäh All the Mss read eva krtakatvam. We follow Raghavan. 6 All the Mss read eva krtakäh. 7 K. and P.: sanrakrtakatva0 D. sartrakrtakatva0, s.m. sariräkrtakatva0 8 P. akrtakas tu 9 D. sattä gunatva0 10 D. chasavisänät, s.m. chasavisänavat n D . atiprasangät, s.m. aprasarigät
1 K. 2 D. 3 P. 4 K. 5

CATUSTAYAM AHNIKAM SK15

157

vyasnuvate / tasmät sati sauksmye päkajavad esäm krtakatvam 1 aniväryam / yesäm tu käryadravyarn pacyata 2 iti paksas tesäm ayam anupälambha ity atah paramänusamavetam karmodähäryam / tad dhi 3 süksmam atindriyam krtakam ceti siddham krtakäh paramänavah / krtakatväc caisäm anityatäpy 4 anupätiniti 5 krtväntarälapralayamahäpralayesu pradhvamsät paramänünäm "käranäbhävät käryäbhävah" (VS. 1.2.1) iti svasästrasiddhäd anumänäj jagaducchittidosaprasangah / tathä bhoginäm upacitasya svakarmano ? nupabhogät krtasya vipranäsah / anistam caitat / tasmän na jagatkäranam paramänavah / yäpi khalv iyam äsankä purusäj jagadutpattir bhavisyatiti säpy ayuktä / kasmät / pratisedhät / "tasmäc ca viparyäsät"(SK19a) ity atra purusasyäkartrtvam upapädayisyämah / caitanyävisesäd Isvarasyäpi sa eva vidhih käranatvapratisedhe boddhavyah / äha: asty evam Isvara iti päsupatavaisesikäh / kasmät / käryavisesasyätisayabuddhipürvakatvät / iha käryavisesah präsädavimänädir atisayabuddhipürvako drstah / asti cäyam mahäbhütendriyabhuvanavinyäsädilaksanah käryavisesah / tasmäd anenäpy atisayabuddhipürvakena bhavitavyam / yatpürvako ' y a m sa Isvarah / tasmäd astisvara iti / kirn cänyat / cetanäcetanayor abhisambandhasya cetanakrtatvät / iha cetanäcetanayor abhisambandhas cetanakrto drstas tadyathä gosakatayoh / asti cäyam cetanäcetanayoh sarirasaririnor abhisambandhah / tasmäd anenäpi cetanakrtena bhavitavyam / yatkrto V a m s a isvarah / tasmäd astlsvarah käranam / ucyate: yat tävad uktam(157.13) käryavisesasyätisayabuddhipürvakatväd Isvarasadbhävasiddhir ity atra brümah: na sädhyatvät / asmadädibuddhipürvakäh präsädädayo 'tisayabuddhipürvakä veti sädhyam etat / tasmäd anuttaram / kirn ca präk pradhänapravrtter buddhyasambhavät käranäntarapratisedhät / pradhänäd ayam buddhipürvakam käryavisesam kurvita / präk ca pradhänaviparinämäd buddhir eva nästlty anupapannam 6 etat / saktimattvät svata iti cet / syät punar etat / sarvasaktipracita Isvarah / tasya präg api pradhänaviparinämät svata evecchäyogäd buddhimadbhävo na 7 pratisidhyata iti / etad apy a n u p a p a n n a m / kasmät / drstäntäbhävät / buddhih svata evety atra paryanuyuktasya kas 8 te drstäntah / tasmäd asad etat / saktivisesäd adosa iti cet / athäpi syät / nänyesäm buddhimatäm Isvaratulyä saktih / ata esäm pradhänäc chariravyühasamakälam ätmädisannikarsäd vä buddhaya utpadyanta [iti] Isvarasya tu svata iti / etad apy a n u papannam / kasmät / sarvavädasiddhiprasangät / drstäntaviruddham artham ädäya 9 pratibadhyamänena saktivisesah smartavya ity etasyäm kalpanäyäm sarvavädasiddhiprasangah syät / tasmäd grahamätram etat / evam svata
J D, krtakatvam, s.m. akrtakatvam 2 P. pasyata 3 D. tad dhi, s.m. buddhi 4 D. anyatäpy, s.m. anityatäpy 5 P. anapätiniti 6 K., P. and D.: upapannam Dkha. anupapannam 7 D. buddhisadbhävo na, s.m. buddhisadbhävena 8 P. paryanuyuktakas 9

5

10

15

20

25

30

35

D. artham ädäya, s.m. artham pratijnäya

158

YUKTIDIPIKA

5

10

15

20

25

30

35

lsvarasya buddhisambhavo na ced bhaved yuktam ucyate prak pradhanapravrtter buddhyasambhavän na buddhimatpürvako ' y a m käryavisesah <iti>/ kirn ca phalänupapatteh / drstam adrstam vä phalam uddisya buddhimantah käryavisesän präsädavimänädln ärabhamänä drsyante / anupahatas cäyam aisvaryät / kirn ca prayojakänupapatteh / anyena khalu prayuktä buddhimantah käryavisesam ärabhamänä drsyante / tac cänupapannam / Isvarasya tadvisistänupapatteh / kirn ca anekäntät / na ca sarvah käryaviseso buddhipürvako vrksädlnäm tadvyatirekenotpatteh / sarvasyesvarabuddhipürvakatväbhyupagame drstäntäbhävah / na cästy anudährto vädah / tasmäd anekäntän na buddhimatpürvakam vyaktam / kirn ca duhkhottaratvät / buddhipürvakas 1 ced <ayam>2 käryavisesah syät kartur duhkhottaravidhäne prayojanam nästi saktimäms cäyam iti sukhottaram eva vidadhyät / duhkhottaras cäyam / tasmän na buddhipürvakah käryavisesah / kirn ca duhkhopäyatvät / buddhipürvakas ced ayam käryavisesah syäd dharmärthakämamoksapräptayah sukhopäyäh syuh / duhkhopäyäs ca <...> / tasmäd abuddhipürvakah / dharmädharmanimittatväd adosa iti cet / syän matam / yady aplsvarapürvako ' y a m käryavisesas tathäpy ädisarge sukhottaränäm <asmäd> utpannänäm 3 präninäm dharmädharmaparigrahäd dhlnamadhyamotkrstavayojätisvabhävädiyogo bhavati / tat as ca näparädho 'yarn 4 Tsvarasyeti / etad apy ayuktam / kasmät / adharmotpattihetvabhävät 5 / Isvaras ced dharmädharmayor utpattäv Tste dharmam eva präninäm sukhahetutväd utpädayet / nädharmam prayojanäbhävät / atha matam sväbhäviki dharmädharmayoh svakäranäd utpattih / yad uktam(157.16) sarvam Tsvarabuddhipürvakam vyaktam iti [tu] tasya vyäghätah / tasmäd Isvaro na käranam / yat punar etad uktam(157.17) cetanäcetanayor abhisambandhasya cetanakrtatväd lsvarasya sadbhäva ity atra brümah: ayuktam etat / kasmät / sädhyatvät / yo ' y a m cetanäcetanayor gosakatayor abhisambandhah sa kena cetanena krtah / yadi caitrena tasya käryakäranasanghätatväd <acai>tanyam6/ atha caitrasabdaväcyasya pindasyopadrastä ksetrajnas tatkrta isyate / tad ayuktam / sädhyatvät / na hi purusakartrtvam asmatpakse prasiddham / ubhayapaksaprasiddhena vyavahärah / kirn cänyat / anavasthaprasangät / cetanäcetanayor abhisambandhasya cetanakrtatvam bruvatah präptamlsvarakäryak<a>ranayor 7 abhisambandhasya cetanakrtatvam / tathä cänavasthäprasahgah / atha mä bhüd ayam dosa iti sväbhävika lsvarasya käryakaranayor abhisambandha isyate / na tarhy aikänti1 D. buddhipürvakas, s.m. buddhimatpürvakas 2 All the Mss read asya. 3 All the Mss read asmadutpannänäm. 4 Dkha. aparädho 'yam 5 Dkha. °hetubhäväd 6 All the Mss read äcetanyam. 7

Dkha.: buddhimatpürvakas

All the Mss read °käryakaranayor. We follow the emendation suggested by G.Chemparathy, in "The Testimony of the YuktidTpikä concerning the Isvara Doctrine of the P äs u pat as and Vaisesikas", WZKSO.vol.9 (1965) p.l40,fn.74.

CATUSTAYAM AHNIKAM SK15

159

ko hetuh / tayor <api caitanyäcb 1 adosa iti cet / syät punar etat / Isvarasya yat käryakaranam tad api cetanam Isvaro 'pi / tasmät sambandhe na 2 pratyudäharanam upapadyata iti / etad ayuktam / kasmät / asambandhaprasangät / caitanyävisesäd ätmana 3 ätmäntarenäbhisambandho nästi / evam Isvarakärya<ka>ranayor4 api na syät / anistam caitat / kirn ca <v>iparyayaprasangät 5 / ubhayacaitanyapratijnasya 6 yathesvarasya karanam buddhyädaya evam Isvaro 'pi buddhyädlnäm karanam syät / kasmät / avisesät / athaitad anistam / na tarhy ubhayos caitanyam / kärya<ka>ranavattänabhyupagamäd 7 adosa iti cet / <syäd etat> / vyäpi (cf.Svet.U.3.11 et passim) niravayavo 'nantasaktih (cf.Mait.U.7.2) süksmebhyah süksmatamo mahadbhyo mahattamo (cf.Kath.U.2.20) Nihjka^in^^ (cf.Mait.U.7.2) ity evam anantalaksanam Isvarapadärtham tadvido vyäcaksate / tasya kutah käryakaranam avalambyedam adhyäropitam iti / etad apy a n u p a p a n n a m / kasmät / a n u mänavirodhät / ittham ced Isvaro yad idam anumänam käryavisesasyätisayabuddhipürvakatväc [ca] cetanäcetanayor abhisambandhasya cetanakrtatväd iti tad vyähanyate / kasmät / na hy 8 etävad Idrsärthena sahaitad drstam iti / upetya vä mürtiparigrahavyäghätät / yady ekäntenaivam rüpa Isvarah ksityädimürtiparigraho vyähanyate 9 / kirn cänyat / sruteh / srutir api cäsya mürtim äcaste "krttiväsäh pinäkahasto vitatadhanvä nHasikhandi"(cf.Tai.S.1.8.6.2) ityädi / tadabhyupagamät svapaksahanir iti cet / syän matam / yadi tarhi srutivacanän mürtimän Isvarah parigrhyate tena siddham asyästitvam / kasmät / na hy asato mürtimattvam upapadyata iti krtvä / etad apy ayuktam / <kasmät /> abhipräyänavabodhät / na hy ekäntena vayam bhagavatah 10 saktivisesam pratyäcaksmahe mähätmyasarlrädiparigrahät / yathä [tu] bhavatocyate / pradhänapurusavyatiriktas tayoh prayoktä nästlty ayam asmadabhipräyah / tasmäd etasya bädhakam / ato na pradhänapurusayor abhisambandho 'nyakrtah / kirn cänyat / asakyatvät / kurvänah khalv apy ayam abhisambandham sariramätrena vä 11 sarlrinah kuryät sarlrakäranena vä / kirn cätah / tan na tävac charlramätrena karoti / kasmät 12 / anapeksasya sarirotpattau nimittäbhävät / na sarlrakäranena vibhutvät / paricchinnayor gosakatayor abhisambandho 'nyakrtah / vibhü ca pradhänapurusau / kirn ca pärärthyät / gosakatayor abhisambandhah parärtho drstah / na tu pradhänapurusayor abhisambandhah parärtha iti / Isvarärtha iti cen na
X A11 the Mss read acetanyad. 2 D. sambandhe na, s.m. sambandho na 3 D. ätmana, s.m. cait any avisesät ätmana 4 All the Mss read °käryakäranayor. 5 A11 the Mss read aviparyayaprasarigät. 6 D. ° caitanyapratijnasya, s.m. ° caitanyäpratijnasya 7 All the Mss read käryakärana0. 8 D. na hy, s.m. tarhi 9 K. and P.: vyähanyeta D. vyähanyeta, s.m. vyähanyate 10 Dkha. vayam saktivisesavantah 11 D. encircles vä. 12

5

10

15

20

25

30

35

Dkha. vyähanyate

Dkha. tasmäd

160

YUKTIDIPIKA

5

10

15

20

25

30

35

uktatvat / drstadrstartha lsvarasyanupapanna ity adav evoktam (158.3) etat 1 / [evam tävat päsupatänäm Isvaraparigrahe dosah / vaisesikänäm cäyam dosah /] kirn ca dravyädipadärthäntarabhäväbhävaparikalpanänupapatt < es >2 ca / [tair] Isvaro dravyagunakarmasämänyavisesasamaväyabhüto vä parikalpyamänah parikalpyeta padärthäntarabhüto vä / kirn cätah / tan na tävad dravyädibhütah / kasmät / dvividham hi dravyam anekadravyam adravyam ca(cf.VSC.onVS.2.1.11) / tatra nänekadravyam Tsvarah krtakatvädidosaprasangät / nädravyam parisamkhyänät / prthivyädlni manahparyantäni navaiva dravyäni(cf.VS.1.1.4) iti vah siddhäntah / itikaranasya parisamäptyarthatvät / kirn ca gunakarm<ä>nirdesät 3 / sati cäsya dravyatve vaisesikagunanirdesa äcäryena krtah syät / käranäntaraprayogasamarthasya ca karma nirdistam syät / na tu tathä / tasmän na dravyagunädayah / äsrayaparatanträ hi gunädayah pa<d>ärthäh4 / evam na dravyädibhüto näpi padärthäntarabhütah / padärthatve hi sati dravyädival laksanam uktam abhavisyad äcäryena / na tüktam 5 / tasmät sütrakäramate nästisvarah / lingäd iti cet / syän matam / "samjiiäkarma <tv>6 asmadvisistänäm lingam"(VS.2.1.18) / "pratyaksapürvakatväd vä samjfiäkarmanah"(VS.2.1.19) ity etasmäl lingäd Tsvaraparigraha äcäryasya siddha iti / tad apy ayuktam / kasmät / abhipretäsiddheh / satyam anena lingenäsmadädibhyo visistasakteh kasyacid eva mähätmyasarirasyänyasya vä pratipattih syät / samjnämätram tu / yathä bhavadbhih sarvakäranänäm srstyupasamhärapravrttihetur ekah svatantra isyate tathä <nä>smäl7 lingät pratipattih / kirn cänyat / präganupadese 'kausalaprasangät 8 / Isvaraparatantre ced anünäm pravrttinivrtti syätäm tarn eva präg upadised dharmavat (cf.VS. 1.1.1) / pradhänapadärthasya vä präg anupadesäd akusalah sütrakära ity etad äpadyate 9 / na caitad <i>stam10 ubhayam / kirn cänyat / asamklrtanät / sästrapradese cäyam Isvaro na kasmimscid apy äcäryena samkirtitah / na cäsya vadhvä iva svasuranämasamkirtane dosopapattih syät / dosasamvibhägärtham idam äcäryasyänistam adhyäropyat e 1 1 / na tu matam asyaitat / fevam känädänäm Isvaro 'stiti päsupatopajnam etat / 1 tasmäd Isvaro Jpy akäranam / karmänubhir vyäkhyätam / katham / yathä krtakatvän na jagatkäranam anava evam karmäpi na sarlranimittam / tasmät tad apy akäranam / itaretaranimittatväd adosa iti cet / syän matam / yathäntarena sarlram karma notpadyamänam drstam evam antarena karma sarlrasyäpi käranäntaram asakyam kalpayitum iti parasparanimittatvän näsya parivartanasya pürvakotih praMss read °nupapattis. Mss read gunakarmanirdesät. All the Mss read parärthäh. We follow the emendation suggested by G.Chemparathy, op.cit., p.l45,fn.l01. (cf.p.l58,fn.V.) 5 K. and P.: tu noktam D. tu noktam, s.m. nau tüktam 6 All the Mss read samjnäkarmatvam. 7 All the Mss read cäsmäL We follow the emendation suggested by G.Chemparathy, op.cit., p.l45,fn.lO3a. (cf.p.l58,fn.7.) 8 P. kausala0 9 D. äpadyate, s.m. äpadyeta 10 All the Mss read anistam. We follow Chakravarti. 11 D. adhyaropyate, s.m. adhyäropyate
1 D. et 2 All the 3 All the 4

CATUSTAYAM AHNIKAM SK15

161

jnäyate 1 / tasmän nästy anayoh käranäntaram iti / etac cäyuktam / kasmät / anavasthänänäm avasthänapürvakatvadarsanät / tadyathä sukrasonitäc chariram sariräc chukrasonitam ity asya parivartasya pürvakotir adrstä, pratijfiäyate cäyonijatvam Isvarasariränäm ädisarge [ca] / tathä ca bijäd ankurädayo 'nkurädibhyo bijam ity anavasthä, bhavati cäträdisarge paramänumäträd api bijaprädurbhävah / tathä sarirakarmanor 2 anavasthedänim api cädisarge cädhikäramätravasäc charirotpattih syät / sädhäranavigrahatvaprasanga iti cet / syäd etat / yady adhikäranimittä sarirotpattir ädisarge 'bhyupagamyate präptam ekena sarlrena sarvapurusänäm abhisambandho niyamahetvabhävät / tat as ca sariräntaränarthakyam / tenaiva sarvesäm upabhogasämarthyäd 3 iti / etad a n u p a p a n n a m / kasmät / pratyaksavirodhät / satyam etad anumänatah / pratyaksatas tu sariräni pratipurusam / tasmän näyam prasangah / apavarganiyamaprasaiiga iti cet / syän matam / yady adhikäramätravasäc charirotpattih paramarser eväpavargasädhanam sarlräd utpadyeteti / ucyate na tasyaiva kirn tarhi sarvesäm / gunänäm prädhänyät tannimittäni sariräny ädisarge sämsiddhikäny utpadyante / tatra yasya sattvapradhänam käryakaranam sa paramarsih / yasya sattvarajobahulam 4 sa mähätmyasarirah / evam gunasamparkäd gunapradhänäpradhänabhävena yävat sthävarasariraprädurbhäva ity ato nästi gunänäm sariraviniyogapaksapätah / tasmäd yuktam etat krtakatvän na karma jagatkäranam iti / etena <d>aivam5 vyäkhyätam / tad api hi karmanäm eva präptaparipäkänäm abhidhänam / arthäntaram eveti cet sädhyam / tasmäd 6 apy akalpaniyam iti / <... /> yad apy uktam käläj jagadutpattir bhavisyatiti tad anupapannam / kasmät / k<a>ranaparispandasyaiva 7 tadabhidhänasannivesät / na hi nah kälo näma kascid asti / kirn tarhi / kriyamänakriyänäm evädityagatigodohaghantästanitädinäm 8 visistävadhisarüpapratyayanimittatvam / paräparädilingasadbhävät (cf.VS.2.2.6) pratipattir iti cen na akrtakesu tadanupapatteh / yad eva krtakam tatraiva param aparam ityädih pratyayo drstah / sa yadi kriyävyatiriktanimittah syäd avisesän nityänityesu syät / kvacit sämarthyäd <p>äkajavad9 adosa iti cet / syän matam / yathägnisamyogah päkajahetus tathä cävisese 'pi prthivyäm eva päkajotpattinimittam bhavati näkäsädisu, evam kälo 'pi paräparädihetur atha cänityesv10 eva syän na nityesv iti / tac cäyuktam / kasmät / visesopapatteh / rüpädivikriyähetur agnis tadyuktam yad asau tadvati dravye päkajän ädadyät <nä>tadvaty n äkäsädau /
X D. prajnayate, s.m. pratijnayate 2 D. sarirakarmanor, s.m. sartrasarirakarm an or 3 D. upacäbhoga0 (?), s.m. upabhoga0 4 K. and P.: sattvam rajobahulam D. sattvam rajobahulam, 5 All the Mss read caivam. We follow Raghavan. 6 D. tasmäd, s.m. tasmät0 tad 7 All the Mss read kärana . 8 P. °godohaghatästanitädinäm 9

5

10

15

20

25

30

35

s.m. sattvarajobahulam

All the Mss read apäkajavad, °D. atha ca atha cänityesv, s.m. atha cänityesv *K. and P.: tadvaty D. tadvaty, s.m. na tadvaty We follow the emendation suggested by Pandeya.

162

YUKTIDIPIKA

5

10

kalas tu sambandhamatropakan, na vikriyahetuh / tasmad asad etat 1 / evam yadi kriyäbhyo 'nyah käla isyate käranaparispandasya jagatkäranatvam athänyat sädhyam / yadrcchäpi na käranam karmavat / käryakäranabhävät / käryakäranabhütam hidam vyaktam iti präg (147.28) vyäkhyätam / sa ca käryakäranabhävah preksäpürvakrtänäm sayanädinäm upalabdhau yädrcchikesu cänupalabdhau na tasyä lihgam iti sakyam vaktum / abhävo 'py akäranam / parimänadidarsanät / na hi tata utpannänäm parimänam upapadyata ity ato näpy anvayah sätmakanirätmakayor atyantajätibhedät / näpi saktis tadabhävät / nopakäro 2 'navasthänät / na vibhägo nirätmakatvät / tasmän na paramänupurusesvarakarmadaivakälasvabhävayadrcchäbhävebhyo vyaktam utpadyate 3 / na ced ebhyah parisesatah pradhänasyaivastitvalingam idam / tasmäd yuktam etat bhedänäm parimänädibhyah— KÄRANAM ASTY AVYAKTAM / (SK16a)

15

iti / / 1 5 / / äha: evam apy asya vyaktahetutvam anupapannam ekatvät / bahünäm käryärambho drstas tantvädinäm / ekam pradhänam / tasmän na tad ärambhasaktiyuktam iti / ucyate: yady api gunänäm pradhänalaksanam avasthäntaram abhinnabuddhinimittatväd ekam <evam> api käryakäle kimcid vaisamyopajanitavyapadesyarüpäbhir itaretaropakärinibhih saktibhih samudäyatvam äpadyate / tasmäd idänlm— PRAVARTATE TRIGUNATAH SAMUDAYÄC CA / (SK16b)

20

25

30

pravartata ity anenotpattim äcaste / trigunata* ity avyapadesyarüpänäm pradhänäpradhänabhävena gunasaktinäm vaisamyäd vyapadesyarüpäntaram äha / yatraitac chakyate vaktum trayah sattvädaya iti tad avasthä<ntaram>5 käryärambhakam iti / samudayäd6 ity anena parasparäpeksänäm ärambhasaktim avadyotayati / etad uktam bhavati: käryakäle gunäh parityaktapürvävasthä bhedam pratilabhya parasparopakärena samhanyante samhatäs ca vyaktam 7 utpädayanti / tasmän nävasthäntarasyäbhinnabuddhinimittatvät 8 pradhänaikatvadosah / gunabhedän naikasya käryärambha iti / äha: niskriyatvät tarhi prakrteh käryärambho 'nupapannah / <nis>kriyatvänabhyupagame 9 vä vyaktavaidharmyavirodha iti /
1 Dkha. asatyam 2 D. no upakäro, 3 D. upapadyate 4

etat s.m. nopakäro

D. trigunasaktinäm, s.m. trigunata ity avyapadesyarüpänäm pradhänäpradhänabhävena gu saktinäm 5 All the Mss read avasthänam. 6 D. samudayäd 7 D. vyaktim Dkha. vyaktam 8 D. °nimittatvätvät, s.m. °nimittatvät 9 All the Mss read kriyätvänabhyupagame.

CATURTHAM AHNIKAM SK15,16

163

ucyate: na kriyävaidharmyabhedät / dvividhä hi kriyä praspandalaksanä parinämalaksanä ca / tatra praspandah pradhänasya sauksmyät pratisidhyate / PARINÄMA<TA>S1 (SK16c') tu tatkäryam ärabhata iti / äha: nanu ca parinämo 'pi sauksmyät pradhänasya nopapadyate / kasmät / na hi sauksmyät süksmasyäkäsäder viparinämo drsta iti / ucyate: samskärasya sauksmye 'pi parinämo 'bhyupagantavyah 2 / tasmäd <yu>ktah3 süksma<h> parinämiti 4 / äha: kah punar ayam parinämo näma / ucyate: jahad dharmäntaram 5 pürvam upädatte yadä param / tattväd apracyuto dharmi parinämah sa ucyate / / iti / yadä saktyantaränugrahät pürvadharma<m>6 tirobhävya svarüpäd apracyuto dharmi dharmäntarenävirbhavati tad avasthänam asmäkam parinäma ity ucyate / äha: naitad abhidhänamätram drstäntam antarena pratipadyämahe / tasmäd yathä kim iti vaktavyam / ucyate: yathä p<a>läsam7 paläsäd apracyuta<m> nimittäntarasyätapä8 der anugrahäc chyämatäm tirobhävya pit at am vrajati tathedam drastavyam / äha: na anyathotpatter apratisedhät / katham punar etad avagamyate p<a>läsam9 svarüpäd apracyutam dharmäntarasya parityägam upädänam ca karoti / na punar anyathä cänyathä cotpadyata iti / ucyate: ksanabhangapratisedhät / präg eva ksanabhang<e> nirdistam lo (133.8) vinastänäm 11 bhävänäm punarutpattau nästi käranam / tadabhäve cotpattir ayukteti / äha: dharmadharminor ananyatväbhyupagamäd 1 2 dharmotpattivinäse dharmyutpattivinäsaprasarigah (cf.AKBh.p. 159.24) / na hi vo dharmebhyo 'nyo dharmi / tatra yadi dharmasya nivrttir abhyupagamyate dharmino ? pi nivrttir ananyatvät präptä dharmotpattau tadutpatt<eh> 13 / tatra yad uktam (163.14) dharmotpattivi<näse> 14 dharmisvarüpävasthänam ity etad ayuktam /
X A11 the 2

5

10

15

20

25

30

Mss read parinämas. We follow Pandeya. D. viparinämo 'bhyupagantavyah, s.m. viparinämo drsta ity ucyate, samskärasya sauksmye 'pi parinämo 'bhyupagantavyah 3 A11 the Mss read ayuktah. We follow Chakravarti. 4 All the Mss read süksmaparinämtti. We follow Chakravarti. 5 Dkha. jagaddharmä0 6 All the Mss read pürvadharmi. We follow Raghavan. 7 All the Mss read päläsam. 8 All the Mss read apracyutanimittä0. We follow Raghavan. 9 All the Mss read päläsam. 10 All the Mss read ksanabhanganirdistam. 11 D. vina$th(J!)änäm, s.m. vinastänäm 12 D. ananyatvä0, s.m. anyatvä0 13 AH the Mss read tadutpattih. 14 All the Mss read dharmotpattivirodhe.

164

YUKTIDIPIKA

5

10

15

20

25

30

35

ucyate: na senadivad vyavasthanopapatteh / tadyatha senangebhyo 'nanyatvam senäyäh / na ca senäng<a>vinäse1 senävinäsah / tathä tantubhyo nänyah patah bauddhänäm samyogävayavipratisedhät / na ca patavinäse tantuvinäsah / tatra yad uktam(163.29) dharmavinäse dharmivinäsa ity etad ayuktarn / äha: evam apy ayuktam <e>tat 2 / kasmät / sämänyavisesayor dharmisvarüpaparikalpanänupapatteh / iha rüpädisämänyam vä dharmirüpatvena parikalpyamänam parikalpyeta rüpädiviseso vä / kirn cätah / tan na tävad rüpädisämänyam dharmisvarüpam iti sakyam kalpayitum / kasmät / asambhavät / yadi tävat prthivTsämänyam ghatädir visesas3 tena prthivy api tanmäträpeksayä visesah / yävat pradhänam iti nästi sämänyam / tadabhäväd 4 dharmisvarüpäbhävah / atha visesä ghatädayas tesäm visesäntarena sahävasthänäd dharmisvarüpänavasthä<nam> 5 / tatas ca yad uktam(163.15) svarüpäd apracyuto dharmi dharmäntaram vijahäti dharmäntaram upädatta iti tad vyähanyata iti / ucyate: yad uktam(164.8) rüpädisämänyavisesayor dharmisvarüpaparikalpanänupapattir iti / astu sämänyam / yat 6 tüktam(164.12) sämänyam sämänyäntaräpeksam visesatväm iti <atra brümah:> na pratyay<ä>nivrttau 7 sämäny<a>bhävävasthites 8 tatas ca dharmisvarüpasiddheh / yävat prthivlty ayam pratyayo na nivartate tävat prthivi sämänyam ghatädir visesah <dravyatvam>9 cäsau dharmäntaraparivartesu tadäkärapratyayotpattitah svarüpävasthänasiddher dharmä ghatädayah / yadä tu prthivipratyayanivrttis tadä tanmätränäm sämänyabhävo dravyatvam ca viseso dharma iti yävat pradhänam / tasya tu sämänyäntaränupapatteh kautasthyam eva / yatra sarvavisesäbhävas tat pradhänam / yadi tu prthivyädinäm nityam avyävrttam syät sämänyarüpam evam sati kautasthyam esäm präptam / tasmän na dharmisvarüpäbhävah / sakter vä sämänyabhäväbhyupagamät / athavä sukhaduhkhamohasaktaya eveha mahadadinä visesäntena lingena parinämam pratipadyante / täsäm ca satatam sämänyapratyayanimittatvät svarüpäd apracyuter dravyatvam 10 lingasya <ca> dharmatvam / aprasiddher ayuktam iti cen na uktatvät / präg uktam (144.3?) etat 11 sukhädipürvakam idam visvam iti / äha: evam api vaisvarüpyänupapattih käranävisesät / yadi sukhädisaktaya eva parinäminyo yad idam brahmädisthävaräntam vaisvarüpyam tan nopapadyate / kasmät / na hy abhinnam käryam utpadyata iti / ucyate: saktitas ca parinämim bhavati tena vaisvarüpyam / katham /
1 AU the Mss read senangebhyo vinäse. 2 All the Mss read tat. 3 P. ghatädivisesas 4 D. tadabhäd, s.m. tadabhäväd 5 All the Mss read dharmisvarüpänavasthänät. 6 D. sämänyam, sämänyam yat, s.m. sämänyam, yat 7 All the Mss read pratyayanivrttau. 8 A11 the Mss read sämänyäbhävävastites. We follow Raghavan. 9 All the Mss read drastavyam. We follow Pandeya. 10 P. apracyute tad dravyatam n

K . et

CATURTHAM AHNIKAM SK16 SALILAVAT PRATIPRATIGUNASRAYAVISESAT1// (SK16c'd)

165

yathäntariksäd avisistasyämbhasah pracyutir äsray<änä>m2 gobhujangamosträdinäm visesät kslramütravisädivaisvarüpyam <prati>padyate3, tathä gunasaktayo 'visistäh parasparäsrayavisesäd brahmädistambäntamjätyäkrtivägbuddhisvabhävähäravihärarüpam vaisvarüpyam pratipadyante / tasmät siddham etat prakrtir eva sarvabhävänäm prasavitri na ca kascid dosa iti / / 1 6 / / yuktidlpikäyäm sämkhyasaptatipaddhatau caturtham ähnikam /

2 All 3

salilavat pratigunä0 the Mss read äsrayanam. All the Mss read copapadyate. We follow Chakravarti.

P a n c a m a m

A h n i k a m

aha: samadhigatam pradhanam / purusa idanim karyakaranavyatirikto 'stity etat pratipädyam / kutah samsaya iti ced anupalabhyamänasyobhayathä drstatväd ity uktam (89.21) / kirn cänyat / ä c ä r y a v i p r a t i p a t t e h / vijnänaskandhavyatirikto nästi kascid artha iti säkyaputnyäh pratipannäh / kasmät / sarvapramänänupalabdheh / iha yad asti tat pratyaksädinä pramänenopalabhyate tadyathä rüpädi / tatas ca tävad 1 ayam ätmä na pratyaksata upalabhyate / kasmät / asat>dädilaksanatvät / näntahpratyaksatah / kasmät / trigunädiviparitasya tadavisayatvät / na pürvavacchesavadbhyäm käryakäranänupapatteh / na ca sämänyatodrstäd 2 dharmasämänyäbhävät 3 / näptavacanäd 4 anabhyupagamät / na hi bauddhänäm srutismrtipuränetihäsäh 5 pramänam / yas caisäm ägamah sa evam äha— ätmaiva hy ätmano nästi viparitena kalpyate / naiveha sattvam ätmästi dharmäs tv ete sahetukäh / / dvädasaiva <bh>avängäni6 skandhäyatanadhätavah / vicintya sarväny etäni pudgalo nopalabhyate 7 / / (cf.AKBh.p.466.8-11) sünyam ädhyätmikam pasya 8 sünyam pasya bahirgatam / na drsyate so ?pi kascid yo bhävayati sünyatäm / / (cf.AKBh.p.466.12-13, MV.18.3(p.348.12-13)) punar apy äha "asti 9 karmästi vipäkah kärakas tu nopalabhyate ya <imäms ca skandhän niksipaty>10 anyäms ca pratisandadhäty anyatra dharmasamketät"(cf.AKBh.p.468.20-22, TSP.p.173.6-7) / tasmät sarvapramänänupalabdher nästy ätmeti /
1 D. tatas ca tavad, s.m. tac ca tävat 2 D. sämänyato drstäd 3 D. dharmasämänyäbhävät^ s.m. dharmasämänyäbhävät 4 Dkha. näpyavacanäd 5 D. °puräranetihäsäh, s.m. °pramänetihäsäh (?) 6 All the Mss read tavätigäni 7 D. pudgalenopalabhyate, s.m. pudgalo nopalabhyate 8 K. and P.: viddhi Dkha. pasya D. viddhi, s.m. pasya 9 Dkha. nästi D. ash, s.m. nästi 10

5

10

15

20

All the Mss read imän svän dharmän äksipati.

168

YUKTIDIPIKA

ucyate: yat tavad uktam (167.7) pratyaksatah purvavacchesavadbhyam cätmano 'nupalabdhir 1 iti satyam etat / yat tüktam(167.10) sämänyatodrstäd 2 anupalabdhir ätmasämänyänupapatter iti tad ayuktam / kasmät / SANGHÄTAPARÄRTHATVÄT / (SK17a) 5 iha sanghätäh parärthä drstäs 3 tadyathä sayanäsanarathasaranädayah 4 / asti cäyam sariralaksanah sanghätäh / tasmäd anenäpi parärthena bhavitavyam / yo 'sau parah sa purusah 5 / tasmäd asti purusah / äha: <na> sahghätärthatvopalabdheh / sayanädayo hi saty api parärthatve sanghätärthäh / yadi ca tair atidesah käryak<a>ranasanghätasya 6 kriyate präptam asya tadvat sahghätärthatvam / evam purusaviparit<ä>rthasiddhiprasangah 7 / athaitad anist am na tarhi caksurädayah parärthäh / ucyate: na sakyam etad äpädayitum / kasmät / asamhatatvasiddhau vädapravrtteh / siddhe saty asamhatatve purusasyäyam vädah pravrttah / tasmän na pärärthyam 8 anena bädhyate / katham avagamyata iti cet pratyaksato 'nupalabdheh / sati hi sanghätatve devadattädivad ayam purusah pratyaksata evopalabhyeta 9 / tathä ca sati samsayäbhävät pravrttir eväsya vädasya na syät / tasmäd ayuktam samhatärthäh sayanädivac caksurädayah / äha: <na> parasparopakäritvät <päratantryäsiddhih> 10 / iha ksetrodakasüryädayah sasyädlnäm upakärakäh / tathä käryak<a>ranasanghätas 11 ca yathoktam / tasmäd ayuktam etesäm päratantryam iti / ucyate: na sayanädivat tato 'nyenärthavattvät / tadyathä sayanädyangänäm sati parasparopakäritve tato 'nyenärthavattvät 12 tadabhäve cärthänarthakyam 1 3 / evam 14 caksurädinäm sati parasparopakäritve tato 'nyenärthavattvam bhavitum arhati tadabhäve^1^ cärthänarthakyam [iti] / äha: sayanädlnäm devadattärthatvät tasya ca bhedäbahirbhävät parasparärthatvaprasangah / evam 15 sayanädayo devadattärthäh käryaP. catmanopalabdhir(7) D. catmananopalabdhir, s.m. catmanonupalabdhir D. sämanyato drstäd 3 D. parärthädrstäh 4 D. °rathacaranädayah, s.m. °rathasaranädayah 5 D. parah purusah, s.m. parah sa purusah 6 All the Mss read käryakärana0. We follow Chakravarti. 7 A11 the Mss read purusaviparito frthasiddhiprasangah. We follow Pandeya. 8 D. paramärtham, s.m. pärärthyam 9 D. °labhyeta, s.m. °labhyate 10 All the Mss read pärärthyasiddhih J1 K. and P. read käryakäranatvät sarighätas. D. °sanghätäs, s.m. °sanghätäc 12 D. ° ärthavattvät, s.m.0arthavattvät (bha)vittum arhati(l) D. seems again to correct (bha)vittum into (bha)vittam. 13 D. ° narthakyam iti 14 D. writes evam ... tadabhäve cärthänarthakyam iti in the right margin and corrects evam into pürvam. 15 D. evam, s.m. evam api
1

10

15

20

25

(*) (tato 'nyenarthavattvam bhavitum arhati tadabhäve) tato narthavattvam bhavet — tadabhave° päthah / (D.201-1, not found in K.)

PANCAMAM AHNIKAM SK17

169

k<a>ranasanghätas1 ca devadattasabdaväcyah / tatra bhedänäm eva bhedärthatvät purusärth<ä>siddhih 2 / drstäntäbhävo vä / atha matam / sayanädayo na devadattärthäh / kirn tarhi / ksetrajfiärthäh / tathä sati sädhyasamo drstänta iti / ucyate: na prasiddhyanurodhät / satyam käryak<a>ranasanghätasya 3 pärärthyam bhoktrtvam <ca> nopapadyate / loke tu devadattärthatvam sayanädlnäm prasiddham / atas tad anugacchanto 4 vayam apy evam brümah / kasmät / prasiddheh / prasiddhena hy aprasiddham taddharmatäm äpadyate / pascät tu dvayor apy ekadharmänugamäd dharmäntarenäpi tadvattänümlyate / tathä ca ksanabhangädhikäre 5 bhavadbhir apy uktam "yasya hi pratiksanam anyathätvam nästi tasya bähyapratyayo bhedah / pascäd visesagrahane nästi tadyathä bhümer apacyamänäyäh päkajänäm / na ca bhümeh pratiksanam anyathätvam 6 nästy aksanikatvaprasangät" <iti> / sauksmyäd duradhigamo bheda iti drstäntah pratyuktah 7 / tasmät siddham sanghätaparärthatväd asti purusah <iti> / itas ca— TRIGUNÄDIVIPARYAYÄT / (SK17b') "trigunam aviveki visayah sämänyam acetanam prasavadharmi"(SKllab) ca bähyädhyätmikam "tathä pradhänam" (SKllc') / tatra yady etävad etat syät kirn apeksya vyaktävyaktayos traigunyädlti 8 / kirn cänyat / ADHISTHÄNÄT9 / (SK17b') ihäkasmikyäm pradhänapravrttäv arthavasah 10 sannivesavisesaniyamo na syät, sroträdiprthivyädinäm devamänusatiryaksu hitayogärthas cähitapratisedhärthas ca / sa <cästi(?)> / tasmäd asti tadvyatirikto yadadhisthitänäm gunänäm ayam citrarüpo viparinämah / kartrtvaprasangäd adhisthänänupapattir iti cet / syän matam / yadi gunänäm purusädhisthitänäm pravrttir abhyupagamyate kartrtvam asya präptam / athäkartä 11 na tarhy asty adhisthätrtvam iti / etac cäyuktam / kasmät / art he tadupacärät / yathä purusärthah 12 sidhyati tathä gunäh käryakäranabhävena 13 vyühyanta ity atas tatpäratantryäd
1 A\\ the Mss read käryakärana0. 2 A11 the Mss read purusärthasiddhih. We follow Raghavan. 3 All the Mss read käryakärana0. 4 D. atas tadanugacchanto, s.m. atadanugacchanto 5 6 D. anyatvathätvam, s.m. anyathätvam 7 D. pratyuktah, s.m. prayuktah 8 Dkha. traigunyäd iti D. traigunyädlti, 9 D. adhisthänät, s.m. anisthänät 10

5

10

15

20

25

30

This might refer to the missing portion of the argument against ksanikaväda in the Yuktidlpikä. s.m. traigunyäd iti

D.(fn.) pradhänasya pravrttäd arthavasät sannivesanivesa0 This seems to be a variant for pradhänapravrttäv arthavasah. U D. athäkartä, s.m. atha kartä 12 K. and P.: athäpurusärthah D. athäpurusärthah, s.m. yathä purusärthah Dkha. yathä purusärthah 13 D. writes and deletes kärana before käryakäranabhävena.

170

YUKTIDIPIKA

esam adhisthitatvam upapadyate purusasya cadhisthatrtvam / ato nasya 1 kartrtvaprasangah / tasmäd yuktam etat / adhisthänät purusah 2 / kirn cänyat / PURUSO 'STI3 BHOKTRBHÄVÄT / (SK17c) 5 iha sukhaduhkhamohätmakatväd acetanam vyaktam avyaktam ca / tasmäd asya parasparena bhogo nopapadyata ity avasyam bhokträ bhavitavyam / yo 'sau bhoktä sa purusah / äha: kah punar ayam bhogo näma / ucyate: bhoga <...> <äha: na vijnäne> upalabdhisadbhävät / vijnänam eva hi visayopalabdhisamartham ity atas tävanmätram evästu / kirn purusena 4 parikalpiteneti / ucyate: kirn punar idam vijnänam 5 nämeti / äha: cittam mano vijnänam iti(Vims.p.3.3, AKBh.p.62.1-2) / tac ca sadvidham jnänam caksur vijnänam srotravijnänam ghränavijnänam jihvävijnänam käyavijnänam manovijnänam iti / tatra rüpam pratltya caksus cotpadyate caksur vijnänam / evam srotrasabdaghränagandhajihvärasamanodharmäs 6 cittam utpädayanti / tasya dharmä vedanä samjfiä cetanä sparso <manaskära>7 evamädayah(cf.AK.II.24) / tasmäd vijnänaskandhasyaivopabhogasämarthyän nästy ätmeti / ucyate: na acetanavikärasya 8 c e t a n ä n u p a p a t t e h / yat tu khalv idam isyate (170.16) rüpam pratltya caksus cotpadyate caksurvijfiänam ityädi tenäcetanavikäratvät 9 tad acetanam ghatädivad ity äpannam / tasmän manodharmas cetaneti manorathamätram etat / vilaksanakäryotpattidarsanät tatsiddhir iti cet / syän matam / näyam niyamo yad uta yajjätlyam käranam tajjätiyakena käryena bhavitavyam / kirn tarhi / vilaksanakäryotpattir api bhävänäm upalabhyate / tadyathä srngäc charo jäyate, golomävilomabhyo dürvä, vatsatarän mu..kayah 10 , candrakäntendusamyogät salilam, süryakäntagomayärkasamparkät sudhodakasamparkäd araninirmathanäc cägnih / evam acetanebhyo rüpädibhyas cetanam utpadyata iti / etac c ä y u k t a m cetan ä c e t a n o t p a t t i n i y a m a v a t t a n n i y a m ä t / yathä saty etasmin vilaksanakäryaprädurbhäve bhavatas cetanäc cittän näcetanam ghatädy utpadyata iti niyamas tathä saty 11 etasmin vilaksanakäryaprädurbhäve näcetanebhyo rüpädibhyas cetanam cittam utpadyata ity ayam niyamo nah / tasmäd esäm
X D. etenäsya, s.m. ato näsya 2 D. adhisthänät purusah, s.m. adhisthänät asti purusah 3 D. puts puruso 'sti in parentheses. 4 D. purusena, s.m. purusena 5 D. punar vijnänam, s.m. punar idam vijnänam 6 P. °dharmäc 7 A11 the Mss read manah samskäram. 8 K. and P.: acetanavikärasya D. acetanavikärasya, s.m. 9 Dkha. ityädi cetanäcetanavikära0 10 n

10

15

20

25

30

acetanavikärasya

D. mu. ka. yac, s.m. mukayas Dkha. mukayas D. reads in the bottom margin: kha° pu° mukayas candrakänteti päthah na tv atra ka°pustakasyeva trutih /. D . tathä sati, s.m. tathäsati (without space)

PANCAMAM AHNIKAM SK17

171

drstänäm sati bahutve mäyäkäranagaravinyäsavad ayathärthajnänavisayatväd asädhiyastvam / pradlpavat tadvyavastheti cet / syäd etat / yathä cetanebhyah 1 sattvädibhyo 'vyavasäyakam2 ghatädy utpadyata iti nedänim vyavasäyako mahän notpadyata evam rüpädibhyo <>>cetanam3 ghatädy utpadyata iti nedänim cetanam cittam notpadyata iti / etad apy a n u p a p a n n a m / kasmät / saktibhedät / prakäsasväbhävyäd vyavasäyätmakam sattvam / tad yuktam <yad(?)>4 tatprädhänyäd vyavasäyätmako mahän utpadyate / tamahprädhänyäd avyavasäyakä ghatädayah / bhavatas tv ekäkär<ä>rüpädayah 5 / tasmäd ayam asamah samädhir iti / äha: kirn vyavasäyacaitanyayoh kascid rüpabhedo 'sti na veti / ucyate: <... /(?)> kim tarhi / traigunyät sati pratyayarüpatve samvedyä 6 buddhir yathä tu vyavasäyarüpam tathä caitanyarüpam iti / tathä ca värsaganäh pathanti "buddhivrttyävisto 7 hi pratyayatvenänuvartamänäm anuyäti purusah" iti / äha ca— arthäkära iväbhäti yathä buddhis tathä pumän / äbhäsamäno buddhyäto boddhä manivad ucyate // yathä yathä manovrttih puruso 'pi tathä tathä / buddhirüpam aväpnoti cetanatvät paräsrayam / / äha: rüpäbhedät purusäntahkaranayor anyataraparikalpanänarthakyam / yadi tarhi yathä vyavasä<ya>rüpam10 tathä caitanyarüpam evam sati vyavasäyamätram parikalpanlyam caitanyamätram vä / kasmät / na hy ekä<rtha>kärinor11 yugapatkalpane 12 sämarthyam asti rüpäntaräbhidhänam vä / atha vyavasäyacaitanyayoh padärthäntaram eveti nityato 13 visesyate tarhi vaktavyam idam amusyaivam rüpam nämusyeti / ucyate: ya evam äha rüpäbhedäd 14 arthäbheda iti sa tävad idam prastavyah / atha kim /bhavatah kim vijfiänavisayayor äkärabhedo 15 'sty uta nästlti / nety äha / kasmät / äkäräntare sati visayaparicchedänupapatteh / na hi visasyasya vijnänapratyavabhäsam antarena sakyam svarüpam paricchettum / tatra yad anyäkäro gaur anyäkäram 16 govijnänam syät tena yathä1 D. yatha cetanebhyah 2 K. and D. 'dhyavasäyakam 3 A11 the Mss read rüpädibhyo cetanam. We follow Raghavan. 4 All the Mss read yadi. 5 All the Mss read ekäkärarüpädayah. 6 D. pratyayarüpatve samvedyä, s.m. pratyayarüpam tu asamvedyä 7 D. buddhivrttyävistä Dkha. buddhivrttivistä 8 D. boddhä, s.m. bauddhä 9 Dkha. manir yad ucyate D. manivad ucyate, s.m. manir yad ucyate 10 K. and D.: yathädhyavasäyaka0 P. yathä vyavasäyaka0 We follow Pandeya. 11 All the Mss read ekäntakärinor 12 D. yugapatkalpane, s.m. yugapatkalpamäne 13 D. nityato, s.m. nirbandho 14 Dkha. rüpäbhedäd 15 D. äkärabhede, s.m. äkäre bhedo 16 8 9

5

10

15

20

25

Dkha. ananyäkäro gaur ananyäkäram

172

YUKTIDIPIKA

5

nyakarenasvavijnanenanyakarasya gor apariccheda1 evam 2 anyakarena govijnänenänyäkärasya 3 gor aparicchedah 4 syät / tasmän nasti visayavijnänayor äkärabheda iti / ucyate: tayor idänim visayavijnänayoh kim ubhayatvam ut<ä>bhedah5 / bheda ity äha / kasmät / jnapyajnäpakabhäväd [iti] / ucyate— jnänavijneyayor yadvad 6 rüp<ä>bhede7 'pi bhinnatä / grähyagrähakabhävena tathaivätmaprakäsayoh / / yathaiva tarhi bhava<tah>8 saty apy äkär<ä>bhede9 jnänavijneyayor grähyagrähakabhävaparikalpanäd bheda evam purusäntahkaranayor aplti^/ grähyagrähakabhäväsiddher ayuktam iti cet / syäd etat / yathä gotadvijnänayor 10 grähyagrähakabhävo niscito naivam purusäntahkaranayoh / tasmäd vaisamyam iti / etad anupapamiam / kasmät / märgäntaragamanät / präg uktam(171.19) yesäm äkärabhedo nästi tesäm ekatvam / idänim tu rüpäbhede 'pi grähyagrähakabhäväd evam bruvato märgäntararn / jnänamäträbhyupagamäd aSäkylyam iti cet / syän matam / jfiänam eväntaräsadbhütavisayänuranjitam 11 visayavisayirüpena pratyavabhäsate / na tu kimcid bähyam kimcid grähyarüpäpannam asti / tasmäj jnänavijneyayor grähyagrähakabhedäd bheda ity asäkylyam etad iti / tad apy ayuktam / kasmät / siddhäntabhedät / yesäm bähyo visayo 'sti tatpakse ' y a m dosah / itaresäm tu jnänamätrasya visayavisayibhävam pratisetsyäma [iti] / äha: evam api visayänavasthäprasangah visayino visayatvapratijnänät / yadi visayino 'py adhyavasäyasya visayabhävah pratijnäyate tena purusasyäpi visayino 'nyo visayiti präptam / tasyäpy anya ity anavasthä / atha mä bhüd ayam dosa iti puruso niscayarüpatvän na visayah, na tarhy adhyavasäyäd api niscetur 12 arthäntaram kalpayitavyam iti / ucyate: cetanatvät puruse tadanupapattih / indriyäni tävad grahanamätrarüpatväd apratyayänlti pratyayava<tas>13 tävat karanam parikalpyate / antahkaranam apy upättavisayendriyavrttyupanipätät tadrüpäpattäv api satyäm 14 acetanatvät svayam upalabdhum asamartham evam visayam ity ato bhoktäram cetanam purusam apeksate / purusasya tu cetanatväd drastrantaram asakyam kalpayitum / tasmän nänavasthäprasaiigah /
1 P. gaupariccheda 2 Dkha. apariccheda eva evam 3 P. gavijnänenä0 4 Dkha. goparicchedah 5 All the Mss read uta bhedah. We follow Raghavan. 6 K. and D. writes r yadvad ... apy äkärabhede jnänavijneyayo in 7 All the Mss read rüpäbhede. We follow Raghavan. 8 All the Mss read bhavatä. We follow Pandeya. 9 All the Mss read äkärabhede. We follow Raghavan. 10 P. gatodvijnänayor D. goto dvijnänayor, s.m. gotadvijnänayor n 12 D. niscetur, s.m. nisceturn 13 All the Mss read pratyayavadantas. 14

10

15

20

25

30

the right margin.

K. and P.:eväntaräsadvisayabhütänuranjitam D. satyäm, s.m. satyäyäm

PANCAMAM AHNIKAM SK17

173

äha: purusasyädhyavasäyakartrtvaprasangah 1 caitanyät / yady acetanä buddhis tena tasyä adhyavasäyo vrttir ghatädivan na präpnoti / atah purusasyädhyavasäyah präptas tatas ca buddhyabhäva iti / ucyate: na kaivalyäd apratibandhaprasangät / anämisrarüpam purusatattvam ity etad uparistäd vaksyämah(179.12,180.6) / sa yadi vyavasäyakah syäd apratibandhena dinniscayädisu <...(?)> suptamattamürcchitänäm ca vyavasäyah syät / drstas tv evamavasthasya vyavasäyapratibandhah / tasmän na purusasya vyavasäyah / yasya punar antahkaranam vyavasäyakam tasyaivam doso nästi / kasmät / traigunyät / sattvädisamsthänaviseso hi buddhih käranäntarapratisedhät / tatra yadädhyavasäyalaksanam sattvam gun<a>bhävät2 pradhänabhütena tamasä tiraskrtasakti bhavati tadädhyavasäyapratibandhah / äha: katham punar etad gamyate sarvam idam acetanam iti / ucyate: prakrtivikärabhütatvät / iha yat prakrtivikärabhütam tad acetanam tadyathä tantupatädayah / prakrtivikärabhütam <sarvam) / tasmäd acetanam 3 / äkäSe 'dar^anän naikänta iti cen na asiddhatvät / n a hy äkäsasyätmapakse 4 prakrtivikäratväbhävah siddhah / tasmäd yuktam etat prakrtivikärabhütatväd acetanam sarvam / ata eva ca cetanasyäprakrtivikärabhütatvam parasparavaidharmyät / tasmän nänyasya pa<dä>rthasya5 bhoktrtvam äcetanyjd^ upapadyate 7 / na cet süktam bhoktrbhäväd asti purusah / KAIVALYÄRTHAM PRAVRTTES8 CA / / (SK17d) iha pravrttimatäm nimittam antarena <pra>vrttir9 nopapadyate / pradhänam api ca pravrttimad vyaktadarsanät / tasmäd yasya kaivalyam pradhänapravrttihetuh sa purusah / pradhänänabhyupagamäd ubhayäprasiddhir iti cet / syäd etat / pradhänam cetanavad asmäkam aprasiddham / <yac ca>10 tasya kaivalyärtham pravrttir 11 bhavatä purusästitve lingam 12 apadisyate tad idam asiddham na siddham pratipädyata iti / etac cäyuktam / kasmät / pürvam tatpratipädanät / präk pradhänam apratipädyaivam äcaksänah satyam evam paryanuyogärhah syät / prasädhitam 13 tu pradhänam parimänädibhir 14 (cf.SK15ab) iti / ato na kimcid etat / sarväcäryavipratipatteh purusäsiddhir 15 iti cet / syän matam / yadi purusasya sattvam eva syät tena tarn praty äcäryänäm na dharmavivädah syät / asti cäsau / tathä hi kesämcin nirgunah
1 D. purusasyadhyava0, s.m. purusädhyava0 2 All the Mss read gunäbhävät. We follow Raghavan. 3

5

10

15

20

25

30

4 Dkha. äkärasyä0 5 All the Mss read paramärthasya. 6 D. äcetanyäd, s.m. äcetanyäm 7 K. upapadyeta D. upapadyeta, s.m. upapadyate 8 Dkha. kaivalyärthapravrttes 9 A the Mss read nivrttir. H 10 All the Mss read yävat. U D. kaivalyärthapravrttir 12 D. purusästitve lingam, s.m. purusästitvalingam 13 K. and P.: sädhayitum D. sädhayitum, s.m. prasädhitam 14 D. parimänädibhir, s.m. parinämädibhir 15

D. writes and deletes tad acetanam before tasmäd acetanam.

Dkha. prasäditam

K. and P.: purusärthasiddhir D. purusärthasiddhir, s.m. purusäsiddhir

174

YUKTIDIPIKA

5

10

kesamcit Kgunavan)1/ atah paresam 2 vibhuh parimito 'nyesam tathaiko naika 3 iti / tasmäd bhräntimätram purusakalpaneti / etad anupapannam / kasmät / sarvapadärthäbhävaprasangät rüpädisv api <vi>pratipatteh 4 / kesämcit ksanikäh kesämcit käläntarävasthäyinas tathäsritäh svatanträ ityädi / tathä sroträdini bhautikäny ähamkärikäni ^ajmisäniti^vipratipattih / evam sarvapadärthäbhävah syät / tasmäd asti purusah / tatra yad uktam 5 (167.6) sarvapramänänupalabdher nästi purusa ity etad ayuktam / yad apy uktam(167.18) sünyam ädhyätmikam pasyeti 6 tasya pascät pratisedham vaksyämah(SK19) / yat punar etad uktam(167.21) asti karmästi vipäkah kärakas tu nopalabhyata iti satyam etat / na hi purusa<h> skandhänäm 7 niksepe pratisandhäne 'nyatra vä käraka iti nah paksah / tasmäc chreyo'rthibhih 8 sarvägamatarkaviruddhäm nairätmyavädaparikalpanäbhräntim asamanjasäm apohya purusasattvaparijnänäd eva jananamaranädisarvopadravapratipaksabhütam param amrtam dhruvam sthänam aväptavyam iti / / 1 7 / / äha: grhnlmahe tävad asty ayam ätmeti / idänlm aneko 'thaika iti vicäryam / kutah samsaya iti cet / sambandhinäm ubhayathä drstatvät / iha kasyacid anekasyänekena sambandha upalabhyate tadyathä sroträdinä sarirasya / kasyacid ekasyänekena tadyathäkäsasya ghatädinä 9 / ayam api cätmä käryak<a>ranasambandhity 10 atah samsayah kirn sroträdivad anekah, äkäsavad eko veti / kirn cänyat / äcäryavipratipatteh / aupanisadäh khalv eka ätmeti pratipannäh / känädäksapädärhataprabhrtayah punar aneka iti / yathä caikänekatvarn praty ätmano vipratipattir evam säksitvaudäsinyadrastrtväkartrtvesu / tasmäd vaktavyam katham ete dharmäh puruse Vatisthanta iti/ ucyate: yat tävad uktam(174.16) sambandhitväd ätmapadärthe 11 sandehah kirn aneko 'tha eka ity atra 12 brümah: bahavah purusä iti pratijnä / kasmät / JANMAMARANAKARANÄNÄM13 PRATINIYAMÄT / (SK18ab')

15

20

25

30

janmeti mahadädeh süksmasariräsritasya lingasya yathäsamskäram bähyena sanrena sambandhah / maranam iti pürvakrtasya karmanah phalabhogapari2 K. 3 D. 4

*A11 the Mss read paravän. and P.: sarvesäm D. sarvesäm, s.m. paresärn Dkha. paresäm tathaiko naika, s.m. tathaiko 'neka K. and P.: rüpädisv api pratipatteh D. rüpädisv api pratipatteh, s.m. rüpädipratipatteh Dkha. rüpädipratipatter We follow Pandeya. 5 P. tatra yuktam 6 D. 'sünyam ädhyätmikam pasya ' iti 7 A11 the Mss read purusaskandhänäm. We follow Raghavan. 8 K. and P.: sreyobhih D. Sreyobhih, s.m. sreyo'rthibhih 9 D. ghatädinä, s.m. gavädinä(7) 10 All the Mss read käryakärana0. 11 D. ätmaparodärtheC?), s.m. ätmaparärthe 12 D. ata, s.m. atra 13 K. and P.: jananamaranakaranänäm D. jananamaranakaranänäm, s.m. janmakaranamara

PANCAMAM ÄHNIKAM SK17,18

175

samäpteh sämpratasya ca phalabhogasya pratyupasthäne lingasya pürvasarlratyägah / "karanam trayodasavidham" (SK32a) iti vaksyati / janma ca maranam ca karanäni ca janmamaranakaranäni tesäm pratipurusam niyamah / etasmäl lingäd ätmano bahutvam avasiyate / et ad uktam bhavati / janmalaksanam ca maranalaksanam ca käryak<a>ranasyävasthänta<re>1 parasparavirodhi<nl>2 tamahprakäsavat / tatra yady eka ätmä syät tena yathaikam dravyam tamahprakäsäv ekapradesopanipätinau na saknoty anubhavitum asambhavät, evam ayam janmamarane 'pi na saknuyäd upabhoktum / asti cäyam kenacit käryakaranena janmopabhogah kenacin maranopabhogah / tena manyämahe nänä ätmäno yesäm virodhidharmopabhogasämarthyam iti / tathä karanänäm prakäsätisayo visayagrahanalaksan<o> 'suddhyatisayas 3 cästävimsatidhäsaktih (cf.SK47c) / tayoh parasparavirodhäd ekenätmanä yugapadupabhogo nopapadyate 4 / na hi sakyam ekenätmanä prakäsätisayo visayagrahanalaksano 'suddhyatisayas 5 cäsaktilaksano virodhitväd yugapad upabhoktum / asti cäyam karananimittah pratipurusam niyamah / tena manyämahe nänä ätmäna iti / kirn cänyat / AYUGAPATPRAVRTTES CA / PURUSABAHUTVAM SIDDHAM / (SK18b'c) kasyäyugapatpravrtteh6/ pradhänasyeti sesah / yasya pravrttir upapadyate / [kasya7 pravrttir upapadyate / pradhänasya] / katham iti / ucyate: yady eka ätmä syät tenaikapurusädhikäranibaddham pradhänam saktas cäsau yugapad anekäni sariräny upabhoktum 8 ity ato yävadbhih sarirair apacitäsu 9 kälamäträsv asmin bhavaparivarte bhavitavyam sarvesäm utpattim prati yugapat 10 pravarteta / drstä tu pradhänasyäyugapac charirabhävena pravrttih / tasmäd ayugapatpravrttes ca nänä ätmäna iti / anye punar ähuh: bahiskaranänäm eväyugapatpravrtteh / katham / yady eka ätmä syät tena tatsamskäropanibaddhäny eva sarväni karanänity atah pratipindam avasthitaih karanair yugapad visayän grhniyät / bädhiryädyupaghäte vä sati pindäntarasambandhinä karanenänyasya sabdädi<graha>nam 11 apratisiddham syät / na tu tathä bhavati / tasmät karanänäm ayugapatpravrtter 12 nänä ätmäna iti / tad ayuktam / kasmät / pürvenävi1 A11 the 2 All the 3

5

10

15

20

25

30

Mss read käryakäranasyävasthäntaram. Mss read parasparavirodhinau. We follow Pandeya. K. and P.: °laksanäsuddhyatisaya$ D. °laksanä suddhy0, s.m. °laksanasuddhy° We follow Chakravarti. 4 D. °upabhogenopapadyate, s.m. °upabhogo nopapadyate 5 D. suddhyatisayas 6 K. and P.: kasmät / ayugapatpravrtteh D. kasmäd ayugapatpravrtteh, s.m. kasyäyugapatpravrtteh 7 D. writes kasya pravrttir upapadyate in the right margin and corrects kasya into kasyacid. 8 D. anekäni upabhoktum, s.m. anekäni sarträni upabhoktum 9 D. upacitäsu 10 D. pratiyugapat, s.m. prati yugapat 11 All the Mss read sabdädikaranam. 12 D. ayupatpravrtter, s.m. ayugapatpravrtter

176

YUKTIDIPIKA

sesat / karananam pratiniyamad ity anenayam upasangrhito 'rthah / tasmad yathoktam evastu / kim canyat / TRIGUNÄDIVIPARYAYÄC CAIVA / / (SK18d) 5 iha— trigunam aviveki visayah sämänyam acetanam prasavadharmi / (SKIlab) ity ete dharmäh pratipindam upalabhyante / yathä caite tathä tatpratiyogino nairgunyädayah purusadharmäh / tatra yathaiva gunasvabhävaviparitasvabhävasyopalambhäd ekasmät pindäd ekapurusasiddhir evam pratipindam gunasvabhävaviparltasvabhävasyopalambhät 1 purusanänätvam avaseyam / tasmäd avasthitam et an nänä ätmäna iti / / 1 8 / / äha: siddham ätmano nänätvam / säksitvakaivalyamädhyasthyadrastrtväkartrtvänäm 2 idänim kasmäd dhetoh pratipattir iti / ucyate: 15 TASMÄC CA VIPARYÄSÄT SIDDHAM SÄKSITVAM ASYA PURUSASYA / KAIVALYAM MÄDHYASTHYAM DRASTRTVAM AKARTRBHÄVAS CA / / (SK19) tasmäd ity anena hetusämänyam äcaste / casabdo 'vadhärane / viparyäsäd iti sämänyena hetum upättam visese Vasthäpayati / siddham säksitvam asya purusasyety evamädinä sädhyadharmanirdesam karoti / tatra säksitvam ity anena gunänäm pravrttäv asvätantryam khyäpayati / pradhänasya tadarthanibandhanatvät 3 pravrtteh / adhisthätrtvam katham iti / ucyate: yathä hi kriyäsäksini kasmimscid avasthite kartä tadicchänuvidhäyi käryam nirvartayati na svatantrah, evam pradhänam api / pravrttinivrttyor yathä purusasyärthah sidhyati tathä mahadahamkäratanmätrendriyabhütadevamanusyatiryaksthävarabhävena vyühate na yadrcchätah / tasmät purusas t ad arthapar at antrat vät pradhänapravrttinivrttyoh säksl / kaivalyam ity anena samsargadharmatvam ätmano nivartayati / na yathä sattvädinäm parasparena prakäsädidharmäpeksänäm samsarga evam purusasya tair bhavati / mädhyasthyam ity anenätisayanirhräsänupapatteh purusasya gunaih saha bädhänugrahänupapattim svakäryapravrttau cäpaksapätam darsayati / drastrtvam ity anenodäsinasya käryakaranapindavyühasamakälam 4 caitanyasaktisadbhävät sukhaduhkhamohasvabhävänäm gunacestänäm <anir> vrttärthänäm 5 sannidhänamäträd upalabdhimätram pratijänäti / akartrbhävas cety anena
1 D, 2 D. 3 D. 4 K. 5

10

20

25

30

35

°svabhävasya upalambhat, s.m. °svabhavopalambhät °kaivalyasädhyasthyä°, s.m. °kaivalyamädhyasthyä° pradhänasya tadartha0, s.m. purusatadartha0 and P.: käryakärana0 All the Mss read anivrttärthänäm.

PANCAMAM AHNIKAM SK18,19

177

saptavidham akartrtvam äsrayati / na hy ayam visayesu bähyäntahkaranasännidhye 'dhyavasäyam kurute / na ca sattvädinäm prakäsapravrttiniyamalaksanair dharmair itaretaropakärena pravartamänänäm svena caitanyalaksanena dharmenängabhävam pratipadyate näpy angibhävam / evam saha gunaih käryam na kurute <dhä>trikumäravat 1 / sthitaprayogam na kurute rathasakatayantraprerakavat / na svätmano mrtpindavat / na paratah 2 kumbhakäravat / näpy ädesän 3 mäyäkäravat / nobhayato mätrpitrvat / tad evam anena sütrenäcäryah purusasyädhisthätrtvam nairgunyam audäsinyam bhoktrtvam akartrtvam ca sädhyatäm äpädya trigunädiviparyayam sädh<ana>tvenopanyasyati 4 / taih pancabhis trigunädiviparitaih <dha>rmabhih5 paficänäm esäm yathäsambhavam pravrttir avagantavyä / tatra nairgunyät säksitvam / yasmäd ayam sukhädibhyo 'rthäntarabhütas [tasmäd ayam sukhädibhyo 'rthäntaras] tasmät tatkriyäsaksi / äha: tadasiddh<i>h 6 nairgunyäsiddheh / yady asya sukhädidharma<rahita>tvam7 ätmanah prasiddham syäd ata etad yujyate vaktum / tat tv asiddham / tasmäd ayuktam etat / visesänabhidhänäd itaräsiddhir 8 aplti cet / syän matam / ätmagunäh sukhädayo na sabdagunä ity aträpi bhavatä viseso näbhidhiyate / tasmäd etad apy asiddham <iti> / etad apy ayukt a m 9 / kasmät / <ahamkärenaikaväkyatvät / ...(?)> ahamkärenaikaväkyatve <5>bhinnädhikaranatvam10 syät / drstam tu sukhito 'harn duhkhito ?ham iti / tasmät sukhaduhkhayoh sabdädyätmabhävo na yuktah / ucyate: na gaurädisv anekäntät / tadyathä <gauro 'harn) 11 krsno 'harn iti sariradharmair ätmano bhinnädhikaranatvam ahamkärenaivam sukhaduhkhayor api syät / na cätmagunatvam syäd iti / äha: prthagupalabdher ayuktam / yady api gaurädlnäm avibhaktam ahamkärena grahanam tathäpi prthag [ayam] präg etän ätmano grhltvä pascäd avibhaktän grhnan saknoti vyavasthäpayitum amusyaite na 12 punar amusyeti / na tv evam sukhaduhkhayoh prthagupalabdhih / tasmäd asad etad iti / ucyate: naivam upapadyate 1 3 / kasmät / märgäntaragamanät / ahamkärenävibhaktagrahanäd ätmagunatvam iti präg apadistam 14 / idänim tu saty api tasmin prthaggrahanäd abhävam bruvato märgäntaragamanam anaikäntikasya cäparihärah / kirn cänyat / samsayävyatirekät / yata eva gaurädayah prthag upalabhyante na sukhädayo 'ta eva samsayah / na ca yata eva samsayas tata eva nirnayo yuktah / tasmäd yuktam etad gaurädivad
2 K. and P.ipuratah D. purutah, s.m. paratah 3 D. näpy ädesän, s.m. näpy adesän 4 All the Mss read sädhyatveno0. We follow Raghavan. 5 All the Mss read karmabhih. 6 All the Mss read tadasiddheh. 7 All the Mss read sukhädidharmatvam. 8 P. itarät siddhir 9 D. etad apy ukta, s.m. etad apy ayuktam 10 11 All the Mss read gaurah. 12 D. amusya etena 13 Dkha. tenaivam upapadyate 14

5

10

15

20

25

30

*A11 the Mss read strikumäravat.

All the Mss read bhinnädhikaranatvam. We follow Raghavan.

D. upadistam, s.m. apadistam

178

YUKTIDIPIKA

5

10

15

20

25

30

ahamkarenapy abhinnagrahanac chabdadyatmabhutah 1 sukhadayah <iti> / kim cänyat / svabhävänavadhäranäd anupädänaprasangät 2 / sukhädy<an>ätmakäh 3 sabdädaya ity evam bruvatah sabdädlnäm svabhävänavadhäranäd anupädänaprasangah / nimittatvenopädänäd agnivad adosa iti cet / syän matam / yathägnih päkajanimittam upädlyate 'tha caisäm pärthivatvam evam sabdädayo 'pi sukhädinimittatvenopädlyerann atha caisäm ätmagunatvam eva syäd iti / tad apy anupapannam / kasmät / sämänädhikaranyadarsanät / yathä nimittasyägner na päkajaih sämänädhikaranyam pakvo 'gnih pacyate 'gnir ity evam sabdädlnäm nimittatvän na sämänädhikaranyam syät sukha<h> sabdo <'>duhkha(?)4 iti / drstam tu / tasmän na tesäm nimittärthenopädänam iti/ äha: evam api sukhädlnäm sabdädyätmabhävo na yuktah / kasmät / vipratipatteh / yathä hi sabdäh sabdätmakä iti sarvaih sabdarüpena grhyanta evam sukhätmako V a m iti sarvais tadrüpena grhyeta 5 / drstä tu vipratipattih / tasmäd ätmagunä iti / ucyate: na samskäravisesanimittatvät / tadyathä pittädisämarthyän mädhuryädisu vipratipattir na caisäm asabdädigunatvasamskäravisesayogät 6 sukhädisu vipratipattih <... evam ...> na caisäm asabdädigunatvam iti / kim cänyat / nimittatve 'pi t a t p r a s a n g ä t / nimittavädino 'py etat samänam 7 / na hi nimittanaimittikayor vipratipattir asti / tadyathä pradipaprakäsayos tatas ca vipratipatter nimittatvam api sabdädlnäm akalpamyam syät / yas 8 ca dvayor doso na tarn ekas codyata iti / ätmagunäkänksitväd adosa iti cet / syän matam / nimittam apradhänatväd anyaparipäkavasena sukhaduhkhe <u>tpädayati 9 / ätmanas tanmayatve tu niräkänksatvät pradhänasya vyavasthäbhedo na yukta iti / tac ca naivam / kasmät / uktatvät / tanmayatve 'pi gunabhävän mädhuryädisu vipratipattir ity ädäv evoktam (178.16) etat / tasmät tanmayatve prädhänyam iti cäniscitäbhidhänam etat / äha: evam apy ayuktam etat / kasmät / atltänägatesv api <tad>drst e h 1 0 / <...> tasmät sukhädlnäm sabdädyätmabhävo na yukta iti / ucyate: na smrtinimittatväd buddheh / ayam atltänägatesv api sabdädisu smärtasukhaduhkhayogo 11 bhavati / tatsamparkät tu purusena tathänubhüyate / purusagunatve tu päkajavan nimittäd utpannänäm sukhädlnäm visesabhävät tivramandatänupapattih syät / tasmät sukhaduhkhayoh sabdädyätmabhävo <nä>yuktah 12 /
X D. abhinnagrahanacchadädyatmabhutah, s.m. 2 D. encircles da of ° änavadhäranädanupädäna0. 3 All the Mss read sukhädyätmakäh. 4 5 P. 6 D. 7

abhinnagrahanac chabdadadyatmabhutah

All the Mss read sukhasabdo duhkha. Another possible emendation would be: sukhah sabdo duhkhah sabda. grhyate °vise$ayogät, s.m. °vise$äyogät Dkha. °vädino 'py atat samänam 8 D. yac 9 All the Mss read notpädayati. 10 All the Mss read tu drsteh. U D. °yogo, s.m. °yoge 12 All the Mss read na yuktah.

PANCAMAM AHNIKAM SK19

179

kirn cänyat / anirmoksaprasangät / dravyasya gunair aviprayogät sukhaduhkhayor ätmagunatve saty ätmanas täbhyäm anirmoksaprasangah / tasmät tayor ätmagunatvam ayuktam iti / syämädivat tadvinivrttir iti cet / syän matam / yathä syämagunatve saty anor agnisambandhät tadvinivrttih 1 sabdädigunatve cäkäsasyäsabdakasyävasthänam evam ätmano 'piti / etad ayuktam / kasmät / visesopädänaprasangät sädhyatväc ca / yathä hy anuh syämatäm parityajya rüpavisesam eva raktalaksanam upädatte na rüpavattäm tyajati, evam ätmäpi bähyanimittasämarthyät sukhät sukhäntaram duhkhäd duhkhäntaram upädadita na te 2 atyantam jahyät / tathäkäsam sabdalaksanam kasyämcid avasthäyäm asabdakam bhavatity asmän prati sädhyo ' y a m arthah / bheryädisabdäs tu tadguna eveti pratipädayisyämah(225.15) / tasmät sukhaduhkhayoh sabdädyätmabhävo yuktah / evam anämisrarüpa ätmä / tatas cecchädvesaprayatnadharmädharmajnänasamskäränäm (cf .NS .1.1.10) anekasvabhävänäm parasparavirodhinäm ca tadgunatvam anupapannam / tasmäd yuktam et an nirguna ätmä, nairgunyäc ca säksimätra iti / kevalo viviktatvät / <y>asmäd3 ayam gunebhyah prthagbhütas tasmät kevalo na taih saha samsargena vartate / äha: kah punar asyätmano gunebhyah prthagbhävo 'bhipreta iti / ucyate: tadupakäranirapeksänäm sattvädinäm svakäryasämarthyam prthagbhävah 4 / na hi sattvädayah prakäsädibhir dharmair itaretaropakärena vartamänäh purusakrtam upakäram apeksante / prakäsädidharmasannidhänamäträd eva tu pravartante / tathä ca värsaganäh pathanti "pradhänapravrttir apratyayä purusenäparigrhyamänä ädisarge vartate" iti / yasmäd gunäs tadupakäranirapeksäh pravartante tasmäd asäv api tatsamsargam nänubhavati / drstä tu loke 'py ekakärya<tväbhävät>5 [prthak] ßr^h^gbhäyaparikalpanä / tadyatheme bhrätarah prthag <y>esäm6 naikam käryam, na prthag ime yesäm <e>kam7 iti/ madhyastho visayitvät / yasmäd ayam puruso visayi tasmän madhyasthah / kirn käranam / visayänäm hy atulyabalatvät nyü<natä>tisayopapattes 8 ca parasparena bädhänugrahäv upapannau / visayi cäyam / tasmän nästi nyünatädyupapattih / tatas <ca(?)> cetan<a>bhävah9 / <anä>misrarüpatvät 10 / sangadvesau gunavisayau, ato madhyasthah / drastrtvam caitanyät / prakrtivikärabhütatvät sattvädibhyas caitanyam apoddhrtya 11 puruse vyavasthäpaniyam 12 / na cäcetanänäm 13 drastrtvam upapadyata ity atah purusa eva caitanyäd drastä nänyat tattväntaram /
1 D. tadvinipri, s.m. tadvinivrttih 2 Dkha. te na 3 All the Mss read tasmäd. 4 D. °sämarthyaprthag0, s.m. °sämarthyam prthag0 5 All the Mss read ekakäryatvät. 6 All the Mss read esäm. 7 All the Mss read naikam. We follow Pandeya. 8

5

10

15

20

25

30

35

All the Mss read nyünätisayopapattes. the Mss read tatas cetanäbhävah. K. and P.: na cämisrarüpatvät D. na cämisrarüpatvät, s.m. na cänämisrarüpatvät 11 D. apoddhrtya, s.m. uddhrtya 12 D. vyavasthäpamyam, s.m. vyavasthäpitam 13 D. cäcetanäm, s.m. cäcetanänärn(?)
9 All 10

180

YUKTIDIPIKA

5

10

15

20

25

akartrbhavo 'prasavadharmitvat / prasavartho dharmah / prasavadharmah so 'syästi(cf.Pän.4.3.120) iti prasavadharmT / kah punar asau prasavartho dharma ity ucyate / praspandanaparinämau / niskriyatväd akarteti yävat tad idam aprasavadharmitväd akarteti / kathain asya niskriyatvam iti cet caitanyät / acetanänäm hi ksirädinäm kriyävattvam upalabdham cetanasya na kasyacid ity ato niskriyah purusah / kim ca anämisrarüpatvät / ämisrarüpam hi kriyädivat ksirädi / anämisrarüpas cäyam / tasmän niskriyah / vibhutväd iti cet / syäd etat / yathä vibhutve sati pradhänasya sakriyatvam evam purusasya sati vibhutve sakriyatvena bhavitavyam iti / tac ca naivam / kasmät / dharmadvayasahitasya sähacaryopalabdheh / tad vibhutvam <acaitanyädy>anekarüpatvasahitam1 kriyävati drstam na kevalam / na tu tathä puruse / tasmäd visamam etat / evam niskriyah puruso niskriyatväc ca <parasmät(?)>2 käryakaranam na kurute / kasmät 3 / kriyävatah kumbhakärasya mrtpindät käryanispattisämarthyadarsanät / syäd etat / utpäditasyänyena sthitim kurute dhätrikumäravat / sthitasya vä prayogam rathasakatayantraprerakavad iti / etad apy anupapannam / pürvasmäd eva hetoh / athäpi syät svatah purusah käryakaranam kuruta iti / tad apy ayuktam / cetanäcetanayor atyantabhedät prakrtivikärabhävänupapatteh / atha matam ubhayata iti / tad api naiva sambhavaty ubhayadosaprasangät / syät punar etad avyapadisya yonim puruso 'bhidhyänamätrena käryakaranam kuruta iti / asad etat / kasmät / anutpattäv 4 abhidhyänänupapatteh / Isvarakäranapratisedhe 'bhihitam( 157.28) präk pradhänaviparinämäd buddhimato buddhir nästi / na ca buddhim antarenäbhidhyänam upapadyate tadvrttibhütatvät / tathä buddhimatpürvakasrstipratisedhah krtah / sa ihäpi yojyah / adhyavasäyakartrtvam ca präk pratisiddham (173.4) / evam saptavidhenäkartrtvenäkartä purusah / uktam ca— nädhyavasäyam kurute puruso naiva sthitim prayogam vä / na svätmano na parato <na> vyapadesän 5 na cobhayatah / / tad yuktam etat—

30 iti / / / /

tasmäc ca viparyäsät siddham säksitvam asya purusasya / kaivalyam mädhyasthyam drastrtvam akartrbhävas ca //(SK19)

yatas cetanäsaktisambandhät purusa eva drastä nänyat tattväntaram gunäs ca kartäro na purusah— 35 TASMÄT TATSAMYOGÄD ACETANAM CETANÄVAD IVA LINGAM / GUNAKARTRTVE CA TATHÄ KARTEVA BHAVATY UDÄSINAH / / (SK20)
1 A\\ the Mss read äcetanyänekarüpatva0. 2 All the Mss read pradhänät. 3 D. kasmät, s.m. tasmät 4 D. anutpattäv, s,m. anupapattau 5

All the Mss read nävyapadesän. We follow Raghavan.

PANCAMAM AHNIKAM SK19,20

181

purusasamparkäd dhi grahanadhäranavijiiänavacanohäpohakriyäKnäm) 1 yakhär nyä^äbhini^ pratyayarüpänäm ivopalabdh<is>2 cetanäsaktes cädhyavasäyavrttim anurudhyamänäyäs tadbhävasannivesinäm sattvädinäm vyäpäravatäm 3 abhisambandhäd vyäpärävistäyä ivopalabdhih / yatas taträyam anekakälapravrttamithyäpratyayäbhyäsaväsanäpekso bhavabijahetur jnänavisesah pränabhrtäm avabhäsate srotram upalabhate 4 tvakcaksurjihväghränam ityädi tathä purusah karmanäm kartä, purusah sukhaduhkhayor iti, tasmät karanasya 5 grahanarüpatä purusasya ca kartrrüpatä, sambandhyantarasamparkäd anyagatänyatropalabhyamänä bhaktyädhyavasätavyä, na paramärthatah / uktam ca— cetanädhisthitä buddhis cetaneva vibhävyate / kartrsv avasthitas cätmä bhoktä karteva laksyate / / äha: samyogät pararüpatäpattäv atiprasangah avisesät / yadi cetanasamyogäd buddhyädinäm pratyayavad upacäro vyäpitväd asya ghatädibhir api samyogo na pratisidhyata ity at ah präptas tesäm api pratyayavad upacärah / atha samyog<a>visesät6 karanänäm eva pratyayavad upacäro na ghatädinäm vises as tarhi vaktavya iti / ucyate: tadaprasangah saktyapeksatvät sphatikädivat / yathopadhänasamyog<ä>visese7 saty äkäsasphatikayoh sphätikam evopadhänasarüpam 8 pratyavabhäsate saktito näkäsam evam purusasamyogävisese buddhighatayoh saktito buddhir eva cetanärüpäpannevopalabhyate na ghatah / äha: purusasya vikäryatvaprasangah rüpäntaropädanät / yadi tarhi karanasambandhät purusah kartrtvopacäram visayasarüpatäm ca pratipadyate, präptam asyäpi sphatikavad rüpäntaropädänäd vikäryatvam / atha näsya visayarüpäpattir na tarhi karanasarüpah purusa iti / ucyate: na bhaktito 'bhyupagamät / buddhir upättavisayendriyavrttyupanipätät tädrüpyam pratipadyate / buddhirüpam tu sannidhänamäträc chaktivisesayogät phalabhoktrtväc ca räjani bhrtyajayaparäjayopacäravat purusa upacaryate / na tv asau buddhisamparkät tadrüpo bhavati / ata eväsya satyäm 9 cetanäsaktau vyavasäyakartrtvam pratisidhyate / mä bhüd visayarüpäpattau satyäm anekasvabhävatväd <v>ikäryatvaprasangah10/ tasmäd visayasamparkäd apy avikäryah purusah / na hy asya nityatvät kimcid anugrahäya näpaghätäya / äha ca— mustir yathä vikirnah sücyagre sarsapädinäm /
1 All the Mss read ° vacanohapohakriya. 2 K. and P.: ivopalabdhes D. ivopolabdhes, s.m. ivopalabdhes 3 D. vyäpäravatäm 4 P. upalabhyate 5 P. karanasya 6 K. and P.: samyogävisesät D. samyogävisesät, s.m. samyogävisese 7 A11 the Mss read yathopadhänasamyogavisese. 8 D. evopodhänasarüpam, s.m. eväpodhänasarüpam 9

5

10

15

20

25

30

D. $attyäm(t), s.m. satyäm. °A11 the Mss read anekasvabhävatvädikäryatvaprasangah.

182

YUKTIDIPIKA tisthati na suksmabhavat tadvad dvandvani sarvajfie1 / /

iti / cetanäsaktiyogät tu drastrtvam asya sväbhävikam / evam ced yad varsätapäbhyänr 2 ) kirn vyomnas carmany asti tayoh phalam / 5 carmopamas cet so 'nityah khatulyas ced asatsamah 2 / / (see AKV.p.699.25, SDS.p.22.3, NVTT. on NS.1.1.22, NM.part 2. p.16.17) iti tad ayuktam / kirn käranam / yasmäd <yathä> avikäryarüpasyäkäsasya sannidhänamäträn meghätaparajodhümaprabhrtibhir 3 abhinnadesatväd atyantasuddhasyäpi malinam iva rüpam upalaksy<eta>4 na ca vikäryatvam evam ätmano 'pi syät / tad yuktam etat purusasamyogät karanasya 5 pratyayopacärah purusasya ca gunasamyogät kartrtvopacära 6 iti / äha: ayuktam etat / kasmät / s a m y o g ä n u p a p a t t e h / purusasya hi gunänäm ca samyogah parikalpyamäno 'nyatarakarmajo vä parikalpyate yathä sthänusyenayoh, ubhayakarmajo 7 vä yathä mesayoh, samyogajo vä <yathä> dvyanguläkäsayoh, sväbhäviko vä yathägnyausnayoh 8 , saktinimitto vä yathä caksürüpayoh, yogyatälaksano vä yathängusthopänaddravyayoh, yädrcchiko9 vä yathä svabhratatpätinoh, visayavisayinimitto vä yathä matsyodakayor iti / tan na tävad anyatarakarmaja ubhayakarmajas ca samyoga e s ä m upapadyate / kasmät / vibhutvät / paricchinnadesänäm apräptau satyäm asau drsto 10 yathodährtam / na caitad gunänäm purusasya ca sambhavati vibhutvät / na sväbhävikah anirmoksaprasangät / yathägneh sväbhävikäd ausnyän 11 mokso na bhavaty evam nätmanah / sväbhävikatväd gunasamyogäd
J D. sarvajnahj s.m. sarvajfie 2 Dkha. asatphalam D. asatsamah, s.m. asatphalam 0 3 P. meghäparajo0 K. meghätaparajo0 D. meghäparajo , 4 All the Mss read upalaksyate. 5 P. karanasya 6

10

15

20

s.m. meghätaparajo0

D. purusasamyogät kartrtvopacärah, s.m. purusasamyogät pratyayopacärah purusasya gunasamyogät kartrtvopacärah 7 P. ubhakarmajo 8 P. agnyusmayoh 9 Dkha. yästiko(i) 10 P. satyäm adrstah n P . ausmyän

bauddh<ai>h* // (K79a, not found in D.) *K. bauddhäh (2) (varsätapäbhyäm) nityas tv ätmäbhyupagamyamäno yadi sukhädijanmanä vikrtim anubhavati tad ayam anitya eva dharmädivad uktah syät, nirvikäratve tu satäsatä vä sukhaduhkhädinä karmaphalena kas tasya visesa iti karmavaiphalyam eva tad uktam varsätapäbhyäm ityädi* bauddhäh / / (K.79a, D.233 without number) *D. iti

PANCAMAM ÄHNIKAM SK20,21

183

anirmoksaprasangah 1 syät / saktinimittas ca / kirn / anirmoksaprasangäd eva sa na bhavatity anuvartate / svasvämisaktinimitte hi samyoge parikalpyamäne saktyoh satatävasthänäd anirmoksa eva prasajyeta / n a 2 yogyatälaksanah saktimätrarüpatvät / asamvedya<h>3/ atas tadasiddhih / kim ca prayojanäntaränupapatteh / pravrttyanugunam hiyogyam ity ucyate / tagyjj^eva tu pravrtteh purusärtham apohya 4 nimittäntaram asakyam 5 kalpayitum / [äkasmikatve ca niyamadvaitänupapattih] / tasmäd ayuktam purusasya gunänäm ca yogyatälaksanah sambandhah / na yädrcchikah moksakärananiyamänupapatteh / samyogakäranapratidvandvam kaivalyakäranam 6 / yadi ca yädrcchiko gunapurusasamyogah syät tasyäjnänän 7 nivrttir nästiti tadarthasyäbhyutthänasyänarthakyam präptam visesänupapattes ca käranäntaram kalpayitum / ata etad apy ayuktam 8 [iti] / na vaisayikah anirmoksaprasang ä t 9 / satatam eva hi purusasya visayitvam avyävrttam gunänäm ca visayatvam ity anirmoksaprasanga eva syät / etäväms ca samyogah parikalpyamänah parikalpyeta 10 sarvathä ca nopapadyate / tasmät tatsamyogäd ity ayuktam abhidhätum iti / ucyate: samyogän<eka>tväd 11 iha caupacärikaparikalpanäd adosah / ihänekavidhah samyogah [tadyathä präptipürvikä präptih] yathodährtam anyatarakarmaja 12 ubhayakarmajah samyoga ityädi / yaträsau na sambhavati tatra sannidhimätrasämänyäd 13 bhaktyä kalpyate tadyathäkäsasya gavädibhih / pradesair iti cen na abhävät / te 'pi hi niravayavatväd äkäsasya bhaktyä kalpyante / mäbhüt krtakatvänityatvadosaprasangah / tasmät pradesopacärät käryam apy upacaritam / anyas tu sästrlyah samyogo 'rthanimittah / tatränekasamyogopapatter iha purusäntahkaranayor abhinnadesatvät sannidhimätrasämänyäd bhäktam samyogam parikalpyaivam 14 ucyata ity adosah//20// äha: vijnätam samyogadvayam / ayam tv anyo 'rthanimittah sästrlyah samyogo bhavatä paribhäsyate / tatra vaktavyam kimartho 'säv iti / ucyate: PURUSASYA DARSANÄRTHAH / (SK21a) *D. °sarnyogad anirmoksa0, s.m. samyogät nirmoksa0 2 P. omits na. 3 A11 the Mss read asamvedyam. We follow Raghavan. 4 P. upohya 5 P. nimittäntarasakyam 6 D. kaivalyakäranam, s.m. hi kaivalyakäranam 7
8 D. apy aktam, s.m. apy ayuktam 9 D. encircles the initial a of anirmoksa0. 10 D. parikalpyeta, s.m. parikalpyate 11 All the Mss read samyogänityatväd. 12 K. and P.: anyataraja D. anyataraja, s.m. anyatarakarmaja 13 D. sannidhimätrasämäd, s.m. sannidhimätrasämänyäd 14

5

10

15

20

25

30

D. tasyäjnänän, s.m. tasya jnänän

D. samyogo parikalpyaivam, s.m. samyogam parikalpyaivam

184

YUKTIDIPIKA

5

drstir darsanam / arthasabdo 1 nimittavacanah / darsanam artho 'syasau darsanärthah / darsananimitto darsanahetur darsanakärana ity arthah / etad uktam bhavati: sannidhänävisese sati 2 ätmana äkäsädes ca yasmäd drksaktiyuktah purusas tasmät käryakäranatäm 3 äpannena pradhänena saha bhoktrtvena sambadhyate näcaitanyäd 4 äkäsädaya iti / athavärthasabdah phalavacano yathä trptyarthä bhujikriyä / trptau satyäm nivartate / präptyarthä gamikriyä präptau 5 satyäm / evam purusasya pradhänena darsanärthah samyogah darsane 6 sati nivartate / tathä ca vaksyati— drstä mayety upeksaka eko drstäham ity uparataikä / (SK66ab)

10

iti / äha: evam api sabdädyupalabdhisamakälam eva nivrttiprasangah / kirn käranam / tasyäm apy avasthäyäm sakyam vaktum drstä prakrtir iti / ucyate: yady apy etad evam tathäpi yathä purusasya darsanärthah samyo/

15

KAIVALYÄRTHAS TATHÄ PRADHÄNASYA / (SK21b) kaivalyam iti vivekaparicchinnam sattvädibhir asamsargadharmitvam ätmanah, so 'rtho ?sya7, so 'y a m kaivalyärthah / saty api hi darsanävisese pradhänam purusasya kaivalyärtham pravartate / yadäsya buddhis tamaso 'hgitväd ye gunäh käryarüpäpannäh sirahpänyädaya ädhyätmikä bähyäs ca gavädayah k<a>ranarüpäpannäs 8 cälocanakriyäsamkalpäbhimänädhyavasäyalaksanäh so 'harn 9 ity avisistapratyayopasamhäram karoti tadä pravartata eva / yadä tv anye gunäh prakrtibhütä vikärabhütäh käryabhütäh k<a>ranabhütä 10 acetanäh parärthä anyo 'harn na prakrtir na vikrtir na käryam na k<a>ranam11 näcetanah 12 svärtha iti bhinnapratyayopasamhäram karoti tadä nivartate / so ' y a m purusasya drksaktinimittah pradhänasya ca kaivalyävadhiparicchinnah purusärthah / saty api päribhäsikatve— PANGVANDHAVAD UBHAYOR API SAMYOGAH / (SK21cd') etad uktam bhavati: präg api käryakaranasambandhät 13 puruse caitanyam avasthitam <...> tadyathä agner dahanam parasos chedanam <ca>(?) asati dähye 14 chedye ca na vyajyate / tatsannidhänasamakälam eva tu vyajyata ity
X D. arthadarsanam sabdo, s.m. arthasabdo 2 D. sati, s.m. 'pi sati 3 D. käryakäranatäm, s.m. käryakäranatäm 4 D. näcaitanyäd, s.m. na caitanyäd 5 D. gamikriyäpräptau 6 D. ca(l) darsane, s.m. darsane 7 D. 'rthasya 8 All the Mss read käranarüpäpannäs. 9 Dkha. so 'yarn 10 All the Mss read käranabhütä. 11 All the Mss read käranam. 12 All the Mss read na cetanah. We follow Raghavan. 13 K. and P.: käryakärana0 D. käryakärana0, s.m. käryakarana0 14

20

25

30

K. and P.: bähye D. bähye, s.m. dähye

PANCAMAM AHNIKAM SK21

185

atah pradhänam apeksate / tathä pradhänam apy antarena purusopakäram svakäry<ä>samartham1 anispannakäryasamam ceti <tad>2 anarthakam syäd ity atah purusam apeksate / tatra yasäv anayor 3 itaretaräpeksä tarn samyogam adhikärabandham ähur äcäryäh / parigvandhadrstäntas tu näntariyakamätrapradarsanärtham 4 / yathä pangur näntarenändham drksaktyä visistenärthenärthavän bhavaty andhas ca näntarena pangum gamanasaktyä 5 visistenärthena, evam pradhänam näntarena purusam krtam api käryam drastum saktam anavadhikam ca pravartamänam visesäbhävän naiva nivartate / tathä purusah saty api cetanatve näntarena 6 pradhänam upalabhyäbhäväd 7 upalabdhä bhaved iti pradhänam apeksate / tasmäd itaretaräpeksayä samyoge 8 kalpyamäne 9 yad uktam— vinä sargena bandho hi purusasya na yujyate / sargas tasyaiva moksärtham aho sämkhyasya süktatä / / iti tad ayuktam / kasmät / na hy asau vinä sargena na yujyata iti / äha ca— drsyadarsanabhävena prakrteh purusasya ca / apeksä sästratattvajfiair
10

5

10

15

bandha ity abhidhiyate / /

evam vinäpi sargena yasmäd baddhah 11 pumän gunaih / tasmäd viphalatäm yätu manorathimanorathah / / iti siddhah samyogah / TATKRTAH SARGAH / / (SK21d?) pradhänapurusayor hi bhoktrbhogyabhäväpeksanimitto 'yam tattvasargo mahadädir bhävasargas ca dharmädir bhütasargas ca brähmädih 12 pravartate / sä 13 cäpeksäpurusänantyän 14 na nivartata ity ato 'rthavatmäm hi prakrtinäm tadaparisamäpter na nivrttir asti 1 5 / 20

and D.: svakaryasamartham P. svakad asamartham K. and P.: tarn D. anispannakäryasamam cetitam, s.m. anispannam asamcetam(?) We follow Raghavan. 3 P. sävävayor(l) 4 D. näntariyakamätrapra0, s.m. näntariyakatäpra0 5 K. and P. omit gamanasaktyä. Dkha. gamanasaktyä D. adds gamanasaktyä in the left margin. 6 D. cetanatvenäntarena, s.m. cetanatve näntarena 7 D. upalabhyätrabhäväd(l), s.m. upalabhyäbhäväd 8 K. and P.: samyogatve D. samyogatve, s.m. samyoge 9 P. kalpamäne 10 D. sästratattvajfiair, s.m. $ ästras attvajnair U P. bandhah 12 D. brähmädih 13 D. sä, s.m. sa 14 D. encircles purusänantyä. 15 Dkha. tad api samäpter anivrttir asti

J K. 2

186

YUKTIDIPIKA

iti yuktidipikayam 1 saptatipaddhatau pancamam ahnikam dvitiyam ca prakaranam /

1

P. snyuktidipikayam

S a s t a m a m

A h n i k a m

evam karanantarapratisedhat prakrteh purusartho ' y a m vyaktabhavena viparinäma iti sthitam / tatredänim vipratipattir äcäryänäm / kecid ähuh pradhänäd anirdesyasvarüpam tattväntaram utpadyate tato mahän iti / patanjalipancädhikaranavärsaganänäm tu pradhänän mahän utpadyata iti / tadanyesäm puränetihäsapranetfnäm mahato >hamkä<ra>1 <utpadyate / patanjales tu naivähamkäro> vidyata iti pakso mahato 'smipratyayakartrtväbhyupagamät / aharnkärät panca tanmäträniti sarve / m ah at ah sad avisesäh srjyante panca tanmäträny ahamkäras ceti vindhyaväsimatam / tathähamkäräd indriyänlti sarve / bhautikänlndriyänlti pancädhikaranamatam / ekarüpäni tanmätränity anye, ekottaräniti värsaganyah / indriyäni samskäravisesayogät parigrhitarüpämti kecit, paricchinnaparimänänity apare, vibhünlti vindhyaväsimatam / adhikaranam api kecit trayodasavidham ähuh, ekädasakam iti vindhyaväsi / tathänyesäm mahati sarvärthopalabdhih, manasi 2 vindhyaväsinah / samkalpäbhimänädhyavasäyanänätvam anyesäm, ekatvam vindhyaväsinah / tathä karanam nirlikhitasvarüpam sünyagrämanadikalpam / präkrtavaikrtikäni tu jiiänäni prerakängasangrhitäni pradhänäd ägacchanti ceti pancädhikaranah 3 , na tu tathety anye / k<a>ranänäm4 mahati svabhävätivrttih pradhänät svalpä ca svata iti värsaganyah, sarvä svata iti patanjalih, sarvä parat a iti pancädhikaranah / buddhih ksaniketi <eke>5, käläntarävasthäyinity apare / evam anekaniscayesv äcäryesu ye tävat 6 pradhänamahator antaräle tattväntaram icchanti tatpratiksepäyäcäryah svamatam upanyasyati—

5

10

15

20

PRAKRTER MAHAN / (SK22a') prakrter mahan utpadyate / mahan buddhir matir brahma purtih 7 khyatir lsvaro vikhara iti paryäyäh / sa tu desamahattvät kälamahattväc ca mahän / sarvotpädyebhyo mahäparimänayuktatvän 8 mahän / anyasya tu pakse naivähamkäro vidyata iti tatpratisedhavivaksayedam äha—

25

l PA\ the Mss read 'hamkaro. 2 D. mahasi, s.m. manasi 3 D. pancädhikarani, s.m. pancädhikaranah 4 All the Mss read käranänäm. We follow Chakravarti. 5 All the Mss read ca. 6 D. etävat instead of ye tävat 7

K. and D.: pütih recte. mahattaraparimänayuktatvän(?)

188

YUKTIDIPIKA TATO 'HAMKÄRAH / (SK22a'b')

tasmän mahato 'hamkära utpadyate / yah punar äha(187.8) mahatah sad avisesäh srjyante pancatanmäträny ahamkäras ceti tanniräsärtham äha— 5 TASMÄD GANAS CA SODASAKAH / (SK22b') tasmäd ahamkärät sodasako gana utpadyate / pafica tanmäträny ekädasendriyäni ca / anenaiva ca bhautikendriyavädi pratiksipto boddhavyah / TASMÄD API SODASAKÄT PANCABHYAH PANCA BHÜTÄNI / / (SK22cd) 10 tasmäd api sodasakäd ganäd yah paficako ganas tatah panca mah&bhütäny utpadyante / pürvapadalopenätra mahäbhütänlti vaktavye bhütänity ucyate / bhütasamjnä hi tanmätränäm na prthivyädlnäm / atra tu sämkhyäcäryänäm avipratipattih / bhütakautasthyavädinas 1 tu mimämsakä ärhatäs ca / tatpratiksepenedam ucyata|ti^//22// äha: uktam pradhänäd buddhir utpadyata iti / tatra vaktavyam kimlaksanä punar buddhir iti / ucyate: ADHYAVASÄYO BUDDHIH / (SK23a) ko ' y a m adhyavasäyah j gaur eväyam purusa eväyam iti yah pratyayo niscayo 'rthagrahanam so 'dhyavasäyah / atra ksanikavädy äha: yady arthagrahanam buddhir anityä / kasmät / hetvapeksanät / arthagrahanam hindriyädivisayasannidhänam ävaranädyabhävam cäpeksate na ca nityasya käranäpeksopapadyate / tasmäd anityä buddhih / abhivyakter adosa iti cet / syäd etat / nendriyasannidhänädibhir arthagrahanam janyate / kirn tarhi / abhivyajyata iti / tac ca naivam dvidhä dosät / sä hy abhivyaktih svarüpaläbho vä syät grahanapratibandhavyudäso vä / kirn cätah / tad yadi tävat svarüpaläbhah <na> kriyate 'rthagrahanam iti präptam / <atha> grahanapratibandhasyändhakärasya 2 vyudäsah / tad apy ayuktam / vipratisedhät / grahanam ca syät tatpratibandhas ceti vipratisiddham / kirn ca bhedät / vyangyam hi ghatädi candrärkausadhimaniratnapradipabhedän [na] bhidyate / asti buddhinäm arthabhedäd bhedah / vrttibhedäd adoso mrdvad iti cet / syän matam / yathä mrddravyasya ghatädisamsthänavrttibhede 'py abheda evam buddher iti / tad apy ayuktam ananyatvät / yadä buddhir ananyä vrttibhyah präptas tadbhede buddhibhedah / kirn ca drstäntäsiddheh / sädhyam caitat kirn tad eva mrddravyam ghatädivrttibhedam anubhavati, ähosvit pratyayäntaravasäd anyac cänyac cotpadyata iti / avayavabhedäc
J 2

15

20

25

30

35

D. bhutakausta(7), s.m. bhutakautasthya vadinas All the Mss read arthagrahana0.

SASTHAM AHNIKAM SK22,23

189

copetya vänuvrttim brümo na hi tad ekam mrddravyam / kim tarhi / bahavo mrtparamänavo 'nekadesävacchinnavrttaya iti / kim cänyat / vrttivibhaktigrahanät 1 / tad dhi mrddravyam samsthänam apeksyäpi grhyate na tv arthagrahanam anapeksya buddher grahanam asti / tasmäd visamo drstäntah / parinämäd adosa iti cet / syän matam / sattvädlnäm angängibhävaniyamät tena tenärthagrahanätmanä viparinämo vrttir iti / etac cäyuktam ubhayakalpane dosaprasangät / yadi dharmäntaropädänaparityägau vyaktyavyakti dattottara esa paksah(111.16) / atha näsotpädau tena dharmadharminor ananyatväd dharmänäm näsotpädäd buddher api näsotpädaprasangah / tadanabhyupagame vänyatvam iti dosah / äha ca— nastotpannam ananyatväd anityam nityam eva vä / nastotpannävinastänäm nityam no nästi 2 caikadä / / yad apy uktam(189.5) sattvädlnäm angängibhävaniyamäd iti tad ayuktam / ata evänityatvasiddhes tulyänäm gunapradhänabhävänupapatteh / sattvädlnäm angähgibhäväbhyupagamäd vrddhiksayäv abhyupagantavyau / tat as ca buddhir anityeti präptam tebhyo 'nanyatvät / atha matam tadavasthäpy asau nityeti, na tarhi sattvädyätmabhütä buddhir iti präptam / tatas ca käryakäranayor aviveka3 ity asya virodhah / tasmäd anityä buddhir iti / ucyate: yat tävad uktam(188.21) hetvapeksanäd anityä buddhir iti tad ayuktam / kasmät / siddhasädhanät / kasyätra vipratipattir anityä vä buddhih syän nityä veti / kim tarhi / "hetumad anityam vyaktam"(SK lOa'd') iti vacanäd anityaiva / tasmäd istam evaitat sangrhitam / ata eva ksanikatvam iti cet / athäpi syät / hetvapeksä hi samskrtatvam / samskrtam ca ksanikam tadyathä pradipa iti / tasmäd anitye saty api visesänabhidhäne ksanikatvam evänena hetunä buddheh pratipädyata iti / <tad ayuktam /> kasmät / uttaravacanavirodhaprasaiigät / evam api yad uttara<m> ksanikatvaprasiddhyartham 4 ucyate pratyarthagrahananyatväd anityetyädi(188.20f.) tasyänarthakyam / tasmät pürvottaraviruddhatvät sakalam evedam prakaranam nädhyayanam na prakhyänam 5 arhati / paresäm tv abhinivistä buddhir atrety asangatärthottaräpavädadosam anapeksyäpi ££§r^ ty^kam^agy^ etad asädhanam / vrttivisayatvät / svakäranaparinispannäyä hi buddher 6 vyäpäro 'rthagrahanasamjnaka indriyädisannidhänäpekso na buddhih / tadananyatvät prasang<ä>nivrttir 7 iti cet / atha matam / vrttivrttimator ananyatväd ittham api kalpayitväyam prasango na nivartate / tathä coktam "svälaksanyam vrttis trayasya"(SK29ab') iti / tad apy abädhakam / kasmät / upacärät / satyam ananyä vrttir vrttimato 8 bhedenägrahanät / tathäpy uparatavyäpärasyäpi parasväder vrttimatah svarüpam
X K., P. and D.: nivrttivibhakti0 Dkha. vrttivibhakti0 2 D. nastotpannä vinastänäm nityam no nästi, s.m. nastotpannä 3 D. avivekä 4 All the Mss read uttaraksanika0. We follow Pandeya. 5 P. pratyäkhyänam 6 D. °nispanäyä buddher, s.m. ° nispanäyä hi buddher 7 AU the Mss read prasanganivrttir. We follow Pandeya. 8

5

10

15

20

25

30

35

vinastajam nityam nänä 'sti

P. vrttivrttimator instead of vrttir vrttimato

190

YUKTIDIPIKA

5

10

15

20

25

noparamatiti bhedam upacarya vyavaharo 1 nanakaryavisayah pravartate / ata evanyatv<a>prasanga 2 iti cet / syäd etat / yato vrttyuparame vrttimato 'nuparamah käryanänätvam cäta evänyatvam api syäd iti / tad ayuktam <an>ekäntät 3 / tadyathä senäpanktisenäkundalädyuparame na tatsannivesinäm uparamah käryabhedas ca / na cänyatvam / evam vrttitadvator api ca syät / tasmäd yuktam etad dhetvapeksanasya vrttivisayatvän na buddher <n>ityatvam4 iti / etena vyaktivikalpah pratyuktah / so 'pi vrttivisaya iti krtvä / <yad>5 apy uktam (188.29) indriyädibhede bhedäd iti tad apy anenaiva <praty>uktam(?) 6 vrttibhedo 'tra na <vrttimad>bheda7 iti / <... / > kirn ca a n e k ä n tat / yathodakädibhedät pratibimbabhedo na ca <vya>hgyatvam8 evam anyaträpi syät / dravyäntarotpatter adosa iti cet / syän matam / udakasyänanasamyogäd dravyäntaram eva pratibimbalaksanam utpadyate / na tu mukham bhidyata iti / asad etat / kasmät / ubhayoh käranatvena kalpanänupapatteh / na hi mukham nimittam sakyam vaktum viprakrstatvän näbädayo 9 mukhäpagame 'py upalabdhiprasangät päkajavat / <yat> punar etad uktam(188.31) vrttibhedäd adoso mrdvad iti tathä tad astu / yat tüktam (188.33) ananyatväd drstäntäsiddhes ceti vrttyananyatvam idänim eva pratyuktam / ksanabhangapratisedhe coktam na prthvyädlnäm anyathä cänyathäcotpattih / yat punar etad uktam(189.1) naikam mrddravyam 10 iti / tatra buddhih pramänam / yad ekabuddhinimittam tad ekam / tatra yadi mrdo 'nekatvena prayojanam buddhir upalabhyate . ^ ^ j ^ a m j t i ^ / yat punar etad uktam(189.3) mrddravyasya sarnsthänavyatirekena svabhävo 'vadhäryate na tu buddher arthagrahanam antarena svarüpagrahanam iti tad ayuktam / <sva>bhävasyärüpatvät 11 / upetya vä— yathä bähyädyavasthäsu vyäkärä cittasantatih / vidyate bijamäträ vas tathä dhir iti grhyatäm / / yathä bähyärthäkärava<ti> 12 cittasantatih, atha ca suptamürchitavirodhasamäpannänäm artharüpäd rte bijamäträstity upagamyate, säcit<t>ikäpi13 vävastheti vacanän na ca grhyate, tathä buddhir apiti kasmän na parikalpyate / yat punar etad uktam(189.7) yadi dharmäntaropädänaparityägau vyaktyavyakti dattottara esa paksa iti tad itaratra tulyam / asmäbhir api tarhy
X D. upacaryavyavahäro, s.m. upacarya vyavaharo 2 A11 the Mss read evänyatväprasatiga. We follow Pandeya. 3 All the Mss read ekäntät. 4 All the Mss read anityatvam. 5 A11 the Mss read tad. We follow Raghavan. 6 All the Mss read anenaivoktam. 7 A11 the Mss read bheda. 8 9 P. not clear. 10 D. prthivyam 11 All the Mss read 12 All the Mss read 13

30

All the Mss read cävyangyatvam.

abhäva0. °äkäravac. All the Mss read sä citi käpi.

SASTHAM ÄHNIKAM SK23

191

asatkäryapratyäkhyäne dattottara esa pakso vyaktir na kriyata iti (121.9) / näsotpädau tv anistäv eveti na parihäram praty ädarah kriyate / yad apy uktam(189.11) nastäd utpannäc cänastam anutpannam 1 cänyan nastlti tad ayuktam / anabhyupagamät / näsotpädau kah pratijänite yam praty etad arthavat syät / kirn ca tvatpaksapräpteh / bhavata eva nastotpannebhyah skan<dh>ebhyo2 nänyä santatir atha ca nästi dosah / kayäpi yuktyä syäd etad anyaiväsäv iti / tatas caikä santatir iti hinam / yad apy uktam(189.15) gunavrddhiksaye 'nityatvam 3 iti tad anupapannam / kasmät / rüpäntaräpyäyanät / sattvam hi prakarsam anubhavad rajastamasl ca nyünatäm dharmädirüpam buddher äpyäyayanti närthäntaram kurvanti no khalv apy abhävam / evam rajas tamo vä prakarsam anubhavat sattvam ca nyünatäm adharmädirüpam 4 buddher äpyäyayanti närthäntaram kurvanti näbhävam / evam gunavrddhiksaye 'pi rüpäntaräpyäyanän nästi ksayo buddheh / tatra yad uktam(188.21) hetvapeksanäd anityä buddhir ity etad ayuktam / yat punar etad uktam(189.27) pratya<rtha>grahanänyatvät 5 pratiksanam dipäditailadhäräsu sabdabhedäc ca ksanikety atra brümah: grahanänyatve coktam vrttibhedo na vrttimadbheda <iti> / kirn cänyat / bhinnärthagrahanaikatvät / upetya vä brümah: yadi pratyartham anyad anyad grahanam kalpyate vikalpabädhasamuccayasamsayadvitvätisayaniväranesu tathä kalmäsam sabalam citram ity an^käTtharüßajn^ekam grahanam na syät / drstam tat / tasmän näyam ksanikatve hetuh / evam avasthitam idam adhyavasäyo buddhir na ca ksaniketi / buddhes tu trigunätmakatvät tasya tasya gunasya prakarse tat tad rüpäntaram utpadyata iti / äha: kasya gunasya prakarse buddheh kimlaksanam rüpäntaram upajäyata iti / ucyate: DHARMO JNÄNAM VIRÄGA AISVARYAM / SÄTTVIKAM ETAD RÜPAM / (SK23bc) atra tv etad rüpam iti saty api dharmädibhede buddhir ity abhedavivaksävisaya ekavacananirdesah kriyate / etad uktam bhavati: yadä rajastamasl vasam 6 äpädya buddhigatam sattvam utkrstam bhavati tadä dharmo jiiänam viräga aisvaryam ity etad rüpam bhavati / tatra srutismrtivihitänäm karmanäm anusthänäd buddhyavasthah 7 sattvävayava äsayabhüto dharma ity ucyate / sa tu dvividhah / brahmädisthänesv abhipretasarirendriyavisayopabhogani<r>vartako8 jnänädyahgabhütas ca prathamah / agnihotrahavanädikriyänusthänasädhano yamaniyamasädhanah <ca> itarah / taträhimsä satyam aste1 D. utpannarn 2 All the Mss read 3 D. nityatvam 4 All the Mss read 5

5

10

15

20

25

30

35

skandebhyo. We follow Chakravarti.

nyünatädharmädi0 . We follow Raghavan. K. and P.: pratyaksagrahanänyatvät D. °grahanänyatvä 6 D. vasyam 7 D. buddhyavasthä 8 All the Mss read ° bhoganivartako. We follow Raghavan.

192

YUKTIDIPIKA

5

10

yam akalkata brahmacaryam iti pafica yam ah (cf.YS.2.30) / akrodho gurususrüsä saucam ähäraläghavam apramäda iti pafica niyamäh 1 / etesäm avilo penänusthänäd yater evamvidhottarane sattvadharma äsayatäm pratipadyate yo jnänädlnäm rüpänäm äpyäyanam karoti / et ad abhyudayanihsreyasayoh sopänabhütam prathamam parva 2 yaträyam avasthito 3 yatir itaresäm parvanäm anusthäne yogyo bhavati / jhänam dvividham sabdädyupalabdhilaksanam gunapurusäntaropalabdhilaksanam ca / tatra sabdädyupalabdhilaksanam pratyaksänumänägamarüpam 4 / gunapurusäntaropalabdhilaksanam ca dvividham apürvam abhyäsajam ca 5 / tayor apürvam "ühah sabdo 'dhyayanam"(SK51a) iti siddhikändänupatitäni pramänäni / abhyäsajam punar vairägyaparvävajayaprsthalabdham säntam amalam dhruvam sakalabhaväbhavapratipaksabhütam / yad äcäryo vaksyati— evam tattväbhyäsän näsmi na me näham ity aparisesam / aviparyayäd visuddham kevalam utpadyate jnänam //(SK64) iti /

15

20

25

30

virägas tu rägapratipaksabhüto jnänäbhyäsopajanito buddheh prasädah / tasya tu yatamänavyatirekaikendriyavasikäralaksanäs 6 catasro Vasthä bhavanti / tatrendriyänäm visayäbhiläsalaksanakasäyapäcanam prati yah prayatna utsähah sä yatamänasamjnä / yatamänako hy ayam asmin parvany avasthito yatir bhavati / yadä tu kesämcid indriyänäm paripakvam sä vyatirekasamjiiä / vyatiricyante hi tadä yater indriyäni paripakväny aparipakvebhyo visistataräni bhavantity arthah / viparipakvasarvendriyas 7 tu samkalpamäträvasthitakasäyo yadä bhavati tadaikendriyasamjfiä / nivrttasarvendriyavisayecchasya yater ekam eva manolaksanam indriyam tadä <p>aripakvam8 bhavati / samkalpamäträvasthitasyäpi 9 paripäko vasikärasamjiiä / samkalpamülocchinnavisayamrgatrsno hy ayam 10 yatir 11 indriyänäm antahkaranasya ca pravrttinivrttyor iste / ekägra ekärämo 'vidyäparvano 'tikräntah parasya brahmanah praty anantaro bhavati / tad evam caturavastham vairägyaparva vijfläya tadanusthänäya 12 yatih prayateta / tasyopäyo drstänusravikavisayapratyäkhyäne ya upadisto(SKld) yas ca tustisu vaksyamänas (SK50) tarn ekikrtyottarottaräm tattvabhümim vijiiänasya visaylkurvan pürvasyäm tattvabhümau madhyasthah syät /
X

D. treats akrodho gurususrusa saucam ähäraläghavam apramäda as a verse, and, adding thre dots after apramäda, starts a new line with iti. 2 D. patha, s.m. parva 3 D. avasthitau(l), s.m. avasthito 4 D. praksänumänä0, s.m. praktyasänumänä0 5 D. writes and erases ca. 6 K.and0P.: yatamänavyatireka ekendriyavasikäravasikäralaksanäs D. yatamana0, s.m. yatamäna Dkha. yatamänendriyavasikäralaksanäs 7 D. encircles vi of viparipakva0. 8 K. and P.: tadä 'paripakvam D. tadä aparipakvam We follow Chakravarti. 9 Dkha. samkalpamätrasyäpi 10 Dkha. hrdayam n D . iti 12 K. and P.: tadanusthäya

SASTHAM AHNIKAM SK23

193

aisvaryam apratighätalaksanam / <t>atx punar astavidham animä mahimä laghimä garimä präptih präkämyam Isitvam vasitvam2 yatrakämävasäyitvam iti / tatränimä 3 mahimä laghimä garimeti bhütavaisesikam / buddhes tu präptyädi / evam etac caturvidham mahatah sättvikam rüpam 4 iti / äha: atha gunäntararüpam kirn / ucyate: TÄMASAM ASMÄD VIPARYASTAM / (SK23d) etad^ asmäd dharmädeh sattvarüpäd viparyastam tämasam tamahprakarsopajanitam ity arthah / atra sästracoditänusthänäd 5 äsayanispannasattvävayavo dharma ity uktam / sästracoditasya 6 nityasya karmano 'nanusthänäd 7 buddhyavasthas tamo'vayava äsayatäm pratipanno 'dharmah 8 / sa cäpi dvividhah / anistasarirendriyavisayopabhoganirvartakah 9 khyätivärakas ca / yathä ca jfiänam dvividham sabdädyupalabdhilaksanam gunapurusäntaropalabdhilaksanam caivam ajiiänam api viparyayena väcyam / yathä ca caturavastham vairägyam tathäyatamänädikas caturavastho rägo yathä cästagunam aisvaryam animädi tathästagunam anaisvaryam / evam etat tämasam mahato rüpam / yac caitad adharmädinimittabhütam utkrstam tamorüpam tad rajasä sahävirodhäd 10 ekatäm iväpannam asuddhir ity äcäryaih pathyate / sattvarüpam tu prakäsa ity anayos cäbhidhänäd yah paficädhikaranapaksah präkrtavaikrtänäm jnänänäm pradhän<äc>11 chuskanadisthäniyäntahkarane bähye ca prerakajnänämsakakrta upanipätah / tathä sättyjka^thrty^j^ iti tat pratiksiptam bhavati / kirn käranam / yasmäd asuddhir eva prakäsam alam atipravrttam 13 nivartayitum 14 ^rakarsä^a^m^n^äbh^ ca pravartayitum 16 iti / evam astarüpä buddhir vyäkhyätä / yas tv asäv anantaram ukto 17 'hamkäras tarn vyäkhyäsyämah / / 2 3 / / äha: yady evam tasmäd idam eva tävad ucyatäm kirn asyähamkärasya laksanam iti /
1 A\\ the Mss read yat. 2 D. vasitvam ap?(?), s.m. vasitvam 3 K. and P.: atränimä 4 D. omits 0rüpam. 5 D. säsva (?), s.m. sästra0 6 D. 6ästratroditasya(l), s.m. sästracoditasya 7

5

10

15

20

25

P. first wrongly writes nispannasattvävayavo, and then corrects it to read nityasya karmano 'na-. The previous editors insert ca after nityasya. 8 P. dharmah D. encircles the avagraha of 'dharmah. 9 P. °nivartakah D. °nivartakah, s.m. ° nirvartakah 10 P. mahävirodhäd 11 All the Mss read pradhänavac. 12 Dkha. sättvikam ity ätmakrtam apratyayasthävasthänam 13 D. prakäsamana matipravrttam(l), s.m. prakäsam alam atipravrttam 14 Dkha. yasmäd asuddhir eva malamatipravartanivarta(yitum) 15 Dkha. (°äpannä) nyagbhütä D. ° äpannänyäbhütä, s.m. ° äpannä nyagbhütä 16 Dkha. pravartayitur 17 D. anantarmukto

194 ucyate:

YUKTIDIPIKA

ABHIMÄNO 'HAMKÄRAH / (SK24a) kartuh svätmapratyavamarsätmako yo ' y a m aham iti pratyaya utpadyate sa khalv ahamkärah / mahatas tattväntaram / kasmät / tasya sarvavisayädhyavasäyarüpatvät, asya tu 1 svätmapratyavamarsa<rüpatv>ät 2 / na tv arthäntaram / kasmät / prakrtivikärayor ananyatväbhyupagamät / na hi nah prakrter arthäntarabhüto vikära iti präg vistarena pratipäditam(109.12ff.) / sa ca mürtipratyayäbhyäm mahatah sthülatarah / kasmät / avibhägät / vibhäg<ä>nispatteh3 kälädivat / trigunasya ca mahato vikäratväd asäv api trigunah / kasmät / prakrtirüpasya 4 vikäre drstatvät tantupatavat / tadbhävasannivistäs 5 tu ye sattvädayas 6 ta äcäryair vaikärikataijasabhütädisabdenäkhyäyante / tathä ca sästram äha "etasmäd dhi mahata ätmana ime traya 7 ätmänah srjyante vaikärikataijasabhütädayo 'hamkäralaksanäh / aham ity evaisäm sämänyalaksanam 8 bhavati / gunapravrttau ca punar visesalaksanam 9 " iti / äha: kä punar gunapravrttir yasyäm asmipratyayaikarüpasyähamkärasya visesapratipattir bhavatlti / ucyate: yo ' y a m — TASMÄD DVIVIDHAH PRAVARTATE SARGAH / (SK24b) 20 dvividha, indriyalaksanas tanmätralaksanas ca sä gunapravrttir ity ucyate / kasmät / tatkäryatvät / gunapravrttikäryo hi sargah / drsyate [sa]10 ca khalu loke kärye käranam 11 upacaryamänam 12 tadyathä sälin bhuhkta iti / äha: präg uktam (188.6) ahamkärät sodasako gana utpadyate / idänim 13 punar ucyate "tasmäd dvividhah pravartate sargah"(SK24b) / tad idam pürvottaravyäghätäd ayuktam iti / ucyate: na s ä m ä n y e n a vivaksitatvät / abhedavivaksäyäm hi krtvä käryakäranalaksanam evam asmäbhir upadistam dvividhah sarga iti / bhedavivaksäyäm punah— AINDRIYA EKÄDASAKAS T<Ä>NMÄTRAH14 PANCAKAS CAIVA / / (SK24cd)
2 A11 the Mss read svätmapratyavamarSät 3 All the Mss read vibhäganispatteh. 4 D. prakrtirüpasya, s.m. prakrtivirüpasya 5 D. tadbhäda0, s.m. tadbhäna0(?) 6 Dkha. taddhätusannivistäs tu ye tattvädayas 7 Dkha. ime tu ye 8 D. sämänyalaksanam, s.m. sämänyam laksanam 9 Dkha. punar avisesalaksanam 10 All the Mss read sa. We follow Pandeya. 11 D. kärye käranam, s.m. kärane käryam 12 D. °mänam, s.m. °mänah 13 D. indicates a lacuna before idänim. 14

5

10

15

25

ca

All the Mss read tanmätrah. We follow Pandeya.

SASTHAM ÄHNIKAM SK24,25

195

indriyänäm ayam aindriyah / ekädasa parimänam asya ekädasakah / evam tanmätresu vaktavyam / tanmätränäm sabdasparsädinäm ayam tänmätrah sargah / paiicakas ca panca parimänam 1 asyeti(cf.Pän.5.1.57) pancakah / asya tu sodasakasya vikärasya samjnälaksanaprayojanäny uttaratra vaksyati (SK25ff.) / esä gunapravrttir vyäkhyätä yasyäm asmipratyayasya visesagrahanam bhavati sabde 'ham sparse 'hamrüpe 'ham rase 'hamgandhe 'ham iti (cf.Mäth.onSK24; TSV.p.76.1)/ äha: ahamkäre sattvädlnäm samjnäntarävacanam änarthakyät / yad idam ahamkäre sattvädlnäm samjnäntaram ärabhyate vaikärikas taijaso bhütädir iti tan na vaktavyam / kasmät / änarthakyät / na hi tattväntarasannivesinäm sattvädlnäm samjfiäntaräbhidhäne kimcit prayojanam asti [iti] / samjnäbhüyastvät / athäyam nirbandhas tattvänta<re> 2 samjnäntaram vaktavyam / evam sati 3 tattvabhüyastvät samjnäbhüyastvam präpnoti / prayojanäbhidhänam va visistayatnänäm anäkasmikatvät / athavä prayojanam vaktavyam evamartham ahamkäre samjiiäntaräbhidhänam iti / kasmät / na hi visistayatnänäm äkasmikatvam upapadyata iti / ucyate: na käryavisesahetutvät / mahadädilaksanänäm hi gunänäm anekarüpas tattvärambha iti [hi] na samjnäntaram 4 ärabhyate / ahamkäras tu sattvatamobahulayor indriyatanmätraparvanoh prakrtih / tadartham äcäryänäm yatnavisesah / dharmädivisesäbhyupagamän mahati p r a s a n g a iti cen na visesitatvät / tattväntarärambha iti visesitam / na tu dharmädayas tattväntaram / ato na mahati prasangah / v i s e s ä n a b h i d h ä n ä d ayuktam iti cet / syäd etat / kah punar atra viseso yena dharmädi na tattväntaram tattväntaram tu sroträditi / e t a c ca naivam / kutah / vrttimätre tadupacärät / vrttimätre hi mahato dharmädyupacärah / tathä ca tanträntare 'py uktam "prakäsavrttir dharmah" iti / vrttinispäditas tu samsthänaviseso vrttimatas tattväntaram ity anayor visesah / tasmäd yuktam etat käryavisesahetutvam iti / / 2 4 / / äha: yady evam idam tarhi vaktavyam amusya 5 käryavisesasyaivam samjnakäd ahamkärät pravrttir iti / ucyate: SÄTTVIKA EKÄDASAKAH PRAVARTATE VAIKRTÄD AHAMKÄRÄT / (SK25ab) sarga ity anuvartate / ekädasendriyäni sattvabahuläni vaikrtäd ahamkärät pravartante nispadyanta ity arthah / ekädasäbhidhänäd eva cendriyapratitih purvasütre tatsämänädhikaranyät 6 / ato na punar indriyagrahanam /
1 2 All the Mss read ° äntaram. 3 D. evam mati, s.m. evam sati Dkha. evam 4 Dkha. ity ato na samjnäntaram 5 Dkha. tarhi vaktavyam avasyam amusya 6

5

10

15

20

25

30

35

D. pancakas ca parimanam, s.m. paiicakas ca panca parimänam sati

P. °dhikäranyät

196

YUKTIDIPIKA aha: tanmatrasargah punah kimgunah kasmac cahamkarat 1 pravartata

iti / ucyate: BHÜTÄDES TÄNMÄTRAH SA TÄMASAH / (SK25cd') 5 bhütäder bhütädisamjnakät tamahpradhänät tänmätrah sargah / tänmätras tu tamobahulo bhütädisamjnakäd ahamkärät pravartate / tatra punas tanmätragrahanät samkhyä sasyata 2 iti nocyate / äha: prakrtivisesanirdesänarthakyam / präg uktam(194.11) sattvädinäm ahamkärävasthitänäm vaikärikädyäh 3 samjfiä ucyante <iti> / tad yadi sattvam vaikärikasabdenocyate vaikärikä<c>4 caindriya ekädasakah sargah pravartata ity ukte gamyata etat sättviko 'sau, bhütädes tänmätra ity ukte gamyata etat tämasa iti / kasmät / na hy asti sambhavo yat sattvät tamobahulah sargah syät tamasas ca sattvabahula iti / ucyate: na aprasiddhatvajnäpanät / yasyaivärthasya <aprasiddhis tasya> jfiäpanärtham evam iha kriyate / katham gamyate / sattvam vaikärikasabdenocyate tamo bhütädisabdena / rajas taijasasabdena / aprasiddhärthä hi täntrikl paribhäseyam anirnitä na gamyata iti / äha: taijasasamjnänarthakyam iti / ucyate: na— TAIJASÄD UBHAYAM / / (SK25d') ubhayatra tatsämarthyät / syäd etad evam yady asya käryasämarthyam eva na syät / asmät tu taijasäd 5 ubhayam apy etat tanmätrendriyasamjfiakam pravartata ity anuvartate / katham / yadä hi vaikäriko 'hamkära indriyabhävena pravartate tadä niskriyatvät taijasam pravartakatvenäkänksati, bhütädi bhedakatvena / kasmät / tenaiva tadbhedät 6 / tadyathägnir agnau praksipto 'gnir eva bhavaty äpo väpsu praksiptä äpa eva bhavanty evam sattvam eva sattve na 7 bhedam janayati / gunäntarasamsargam apeksate / bhütädilaksanasya tu tamasah samsargäd bhidyamänam taijasena ca rajasä kriyätmakenänugrhitam ekädasendriyabhävam 8 äpadyate 9 / tathä bhütädilaksanam tamo 'hamkärät tanmätrabhävena pravartamänam pravrttyartham taijasam äkänksati vaikärikam bheda<ka>tvena 10 / kasmät / tenaiva tasya bhedäd 11 iti yojyam / sästram caivam äha a tad etasmin vaikärike cähamkärah D. samkhyäm sasyata, s.m. samkhyä sasyata Dkha. sasyata D. corrects sasyata of Dkha. into sasyata. 3 D. vaikäryakädyäh 4 All the Mss read vaikärikäni. 5 D. asmät taija0, s.m. asmät tu taija0 6 K. and D.: tenaivaitad abhedäd P. tenaiva tad abhedäd We follow Pandeya. 7 A11 the Mss read sattvena. The previous editors write sattvena and sattve tu respectively. We follow the interpretation suggested by Raghavan. 8 D. °grhitame ekä°(7), s.m. °grhitam ekä 9 K., P. and D.: apeksate Dkha. äpadyate 10 All the Mss read bhedatvena. We follow Raghavan. 11 K. and P.: tenaiva tasyäbhedäd D. tenaivaitasya bhedäd We follow Chakravarti.
X D. 2

10

15

20

25

30

SASTHAM ÄHNIKAM SK25,26

197

sraksyamäna esa bhütädis taijasenopastabdha etam vaikärikam abhidhävati / tathaiva tasmin bhütädau sraksyamäna esa <vaikärikas>1 taijasenopastabdha etam bhütädim abhibhavati 2 " iti / anena nyäyena taijasäd ubhayanispattih / iti vyäkhyäto 'hamkärah / / 2 5 / / äha: präg apadista 3 aindriya "ekädasakah pravartate vaikrtäd ahamkärät" (SK25a'b) iti / tat sämänyäbhidhänän na pratipadyämahe / tasmäd vaktavyam känmdriyäni bhavato 'bhipretäni / ucyate: dvividhänindriyäni buddhindriyäni karmendriyäni ca / tatra— BUDDHINDRIYÄNI KARNATVAKCAKSÜRASANANÄSIKÄKHYÄNI / (SK26ab) karnau tvak caksusl ca rasanam ca näsikä ca karnatvakcaksürasananäsikäh / äkhyänam äkhyä pratyäyanam ity arthah / etaih sabdair äkhyä yesäm tänimäni karnatvakcaksürasananäsikäkhyäni / adhisthänabhedäd dvivacanena vigrahah kriyate / etäni buddhindriyäni pratyavagantavyäni / buddher indriyäni buddhindriyäni / <äha:> kirn punar etäni buddher iti / ucyate: sabdädivisayapratipattau dväram / kasmät / abahirvrttitvät / antahkaranasya nästi bahirvrttir ity ato 4 nälam etat säksäc chabdädin arthän pratipattum / tasmäc chroträdilaksanam säksädbähyavisayaprakäsanasamartham k<a>ranäntaram 5 apeksate / tatpranälikayä tasyä visayagrahanam / tasmäd yuktam uktam buddher bähyavisayapratipattau dvärabhütatväd 6 buddhindriyäniti / äha: karmendriyäni punah käniti / < ucyate :> VÄKPÄNIPÄDAPÄYÜPASTHÄH KARMENDRIYÄNY ÄHUH //(SK26cd) väk ca päni ca pädau ca päyus copasthas ca väkpänipädapäyüpasthäh / etäni karmendriyäny ähur äcaksate / karmärthänindriyäni karmendriyäni / kirn punah karma / vacanädi vaksyamänam / etad dhi kurvantiti karmendriyäni / äha: katham etad upalabhyate 'dhisthänäd arthäntarabhütänmdriyäni na punar adhisthänamätram iti / ucyate: adhisthänäd indriyaprthaktvam saktivisesopalambhat / yathä sariräsambhavino visayavyavasäyalaksanasya saktivisesasyopalambhäd arthäntaram buddhir 7 anumiyata evam adhisthänäsambhavino visayagrahanalaksanasya saktivisesasyopalambhäd arthäntaram indriyam iti /
X A11 the Mss read bhütädis. 2 D. abhibhavati, s.m. abhidhävati 3 Dkha. präg upadista 4 D. iti tyato, s.m. ity ato 5 All the Mss read käranäntaram. 6 D. dvärabhütäd, s.m. dvärabhütatväd 7

5

10

15

20

25

30

K. and P.: arthäntarabuddhir

198

YUKTIDIPIKA

5

10

15

20

25

aha: na asambhavasiddheh / adhisthanamatrasya visayagrahanam na sambhavaty arthäntarasya ca sambhavatlty etad ubhayam api cäprasiddham iti / ucyate: naitad aprasiddham tulyajätlyesu tadanupapatteh / yasmäd bhautikesv anyesu ghatädisu visayagrahanasämarthyam 1 nopalabhyate bhautikam ca sravanabilädyadhisthänam ato manyämahe tasyäpi visayagrahanasämarthyäsambhavah /<...> <a> hamkäravikära< t vät>2 tatsämarthyäpratisedhän nendriyänäm nas tatpratisedho 'numätavya iti / etac cäyuktam / kasmät / saktibhedä<nu>papatteh 3 / vaikärikam4 sattvam ähamkärikam prakäsarüpam, tacchaktivisesäd indriyäni notpadyante / bhütädilaksanasya 5 tamasah sämarthyät tanmäträni / gaiasya? prthivyädlnäm ekarüpatvät / tasmäd ayam asamah samädhir iti / etena bhautikatvam pratyuktam^ 1 )/ äha: bhavatu 7 tävad idam abhautikatvam indriyänäm / idam tu katham avagamyate bahümndriyäni na punar ekam evendriyam manovat sarvärtham 8 anekädhisthänam syäd iti 9 / ucyate: na yugapatpravrttyapravrttiprasangät / yady ekam evendriyam manovat sarvärtham anekädhisthänam syäd, ekavisayapratipattau vä sarvavisayapratipattih <...> / drstas tu 1 0 grahanabhedah / tasmän naikam indriyam iti / bhautikair anugrahopaghätadarsanäd indriyänäm bhautikatvani iti cet / syän matam / iha bhautikänäm ghatädlnäm bhautikair mrddandacakrasütrodakamudgarädibhir 11 anugrahopaghäto drsto yadi ca bhautikänindriyäni na syuh / naisäm bhautikair anjanädibhir anugrahah kriyata upaghätas ca rajahprabhrtibhir iti / e t a c c ä y u k t a m / kasmät / anekäntät / tadyathä bhautikair vadanädibhir 12 antahkaranasya grahanadhäranasmrtilaksano 'nugrahah kriyata upaghätas copalädibhir na cäsya bhautikatvam evam indriyasyäpi syät / vaisesikagunavyafijakatväd vikärapratltir iti cet / atha matam / prthivyädivaisesiko gandho ghränenäbhivyajyata audako raso rasanena ca, ägneyam rüpam vlksa1

K. and P. omit rthyam nopalabhyate bhautikam ... tasyäpi visayagrahanasäma, which D. adds in the right margin. 2 K. and P.: ähamkäravikäravat D. ahamkäravikäravat K. has a mark like L before ä of äham0. 3 All the Mss read saktibhedäpatteh. 4 K. vai .. kärikam 5 D. bhütalädi0, s.m. bhütädi0 6 recte. tasya? 7 K., P. and D. omit bhavatu ... idam tu. This portion is found in Dkha. (cf.p.l99,fn.4.) 8 D. savärtham 9 D. anekädhisthänam iti, s.m. 0anekädhisthänam syäd iti 10 Dkha. kha°pustake drstas tu ity asmät süträd anantaram yathä ghatädinäm ity ärabhya mantavya ity ant ah pätho maulah na tu paryäyarüpah (cf.p.l98,fn.(l)) 11 P. mrddandäcakra0 12 D. vadanädibhir, s.m. vacanädibhir

(1)(pratyuktam) yatha ghatadinam bhautikanam visayagrahakatvad adhisthanasyendriyatvam pratisiddham evam esäm agrähakatväd indriyänäm bhautikatvapratisedhah krto mantavyah / / (K.89b, D.259 without number)

SASTAMAM ÄHNIKAM SK26,27

199

nena 1 , väyaviyah sparsastvacä, äkäsiyah sabdah srotrena / yena ca yasya vaisesikagunäbhivyaktis tasya tadvikäratvam drstam tadyathä pradipasya rüpäbhivyanjakatve sati taijasatvam 2 iti / etac cänupapannam / kasmät / anistaprasangät / vaisesikagunavyanjakänäm tadvikäratvam 3 icchatah präptam apäm gandhäbhivyaktihetutvät pärthivatvam / athaitad anistam na tarhy aikäntiko hetur iti / tatra yad uktam(199.2) vaisesikagunäbhivyanjakatväd bhautikänindriyämty etad ayuktam 4 / / 2 6 / / äha: ekädasendriyäny ahamkäräd utpadyanta iti präg apadistam(195. 34) / idänim buddhindriyakarmendriyäni dasäpadisyante / tad idam padärthanyünam iti / ucyate: syäd etad evam yady etävad indriyaparva syät / kirn tarhiti— SAMKALPAKAM ATRA MANAH / (SK27a) atrendriyaparvani mano bhavadbhih pratyavagantavyam / tatra samkalpakam iti laksanam äcaksmahe / samkalpo 'bhiläsa icchä trsnetyädy 5 anarthäntaram / samkalpayatiti samkalpakam 6 / etan manaso laksanam / tasmäd asya pratyaksato 'nupalabhyamänasyästitvam avasiyate / kasmät / vyastasamastänäm indriyäntaränäm tadasambhavät / apohya hi manah samkalpam vyastänäm indriyäntaränäm bhavän parikalpayet samastänäm vä / kirn cätah / tan na tävad vyastänäm indriyänäm samkalpo bhavati / kirn käranam / aniyatavisayatvät / niyato 7 hi sroträdlnäm sabdädir visayah / aniyatavisayas 8 ca samkalpah / kirn ca trikälavisayatvät / vartamänavisayä sroträdivrttih / trikälavisayas ca samkalpah / tasmän na vyastänäm / näpi samastänäm / badhirädisu tadabhävaprasangät / yadi samastendriyavrttih samkalpah <anyataravaikalye tadabhävah(?) > syät / pränädivad iti cet / syän matam / yathä samastendriyavrttih pränädayo na cänyataravaikalye tadabhäva evam samastendriyavrttih samkalpah syän na cänyataravaikalye tadabhävah syäd iti / etac cänupapannam visesitatvät / nirvisayäpränädivrttih sabdädivisayas tu samkalpa iti visesitam / tasmäd vyastasamastänäm indriyänäm samkalpänupapatter manaso Ungarn etad astitva iti siddham / äha: tad avadhäranlyam indriyadvaividhyät / dviprakäräni hindriyäni purastäd upadistäni (197.8) / tatra mano 'py avadhäramyam kirn buddhindriyam atha karmendriyam iti /
J D. 2 D. 3

5

10

15

20

25

30

viksanena, s.m. hiksanena taijasam, s.m. taijasatvam K. and P.: tadvikäritvam D. tadvikäratvam, s.m. tadvikäritvam Dkha. tadvikäratvam 4 After ayuktam D. inserts the following passage: äha bhavatu tävad idam abhautikatvam indriyänäm idam tu katham avagamyate bahüny etäni na punar ekam evendriyam manovat sarvärtham anenädhisthänam syäd iti, ucyate na yugapatpratipattyapratifpra?)sangät yady ekam evendriyam manovat sarvärtham anekärthädhisthänam syäd ekavisayapratipattau vä sarvavisayapratipattir drstas tu grahanabhedas tasmän naikam indriyam iti / iti kha°pustakasthah pätho 'dhiko drsyate 5 P. icchä tyasyetyädy(l) 6 P. sakalpakam 7 D. niyato, s.m. aniyato 8 D. aniyata0 D. encircles the initial a of aniyata0.

200 ucyate:

YUKTIDIPIKA

TAC CENDRIYAM UBHAYATHÄ SAMÄKHYÄTAM / (SK27b) hyarthe cah pathitah / tad dhlndriyam 1 ubhayathety arthah / mano na kevalam buddhindriyam api tu karmendriyam api / niyamahetvabhäväd ayuktam iti cet / syät punar etat / ko 'tra niyamahetur yad indriyatvävisese manasa evobhayapracäratvam abhyupagamyate nänyesäm iti / ucyate: ANTAS TRIKÄLAVISAYAM TASMÄD UBHAYAPRACÄRAM TAT / / (SK27cd) 10 [trikälavisayatväd] iha yasyäntas trisu ca kälesu karanasya vrttis tad ubhayapracäram tadyathä buddhih / säksäd 2 visayänabhisandhänäd atitänägatavartamänavisayatväc ca mano 'ntas tnkala.visa.yam tasmäd ubhayapracäram ta.d iti siddham//27// iti 3 yuktidipikäyäm sämkhyasaptatipaddhatau 4 sastham ähnikam /

5

1

2 D. 3 P. 4

D. tad dhindriyam, s.m. tad buddhindriyam karmendriyam Dkha. tad buddhmdriyam (D. corrects tad buddhindriyam into tad buddhindriyam karmendriyam.) säksäd, s.m. säksäd api omits iti. P. sämsaptatipaddhatau

S a p t a m a m

A h n i k a m

samadhigatam karanaparva / tasyedanim vyastasamastavrttayo vaktavyah / sati cobhayäbhidhäne vyastavrttir eva tävad ucyate na samastavrttih / kim käranam / prakaranasesabhütatvät / sroträdinäm hi sadbhävaprakaranam idam anukräntam / sa caisäm sadbhävah saktivisesop<a>lambhäd1 ity uktam / idänim asau saktiviseso 'smäkam vyastavrttir ity ucyate / tasmät tadanukramanam karisyämah / äha: yady evam tasmäd ucyatäm kasya2 karanasya kasminn arthe vrttih kimlaksanä 3 veti / ucyate: yad uktam kasya4 kasminn arthe vrttir ity atra brümah: RÜPÄDISU PANCÄNÄM ÄLOCANAMÄTRAM ISYATE VRTTIH / (SK28ab) rüpädisu sabdasparsarüparasagandhesu svabhedabhinnesu pancänäm srotrat vakcaksurj ihväghr änänäm^1) sravanasparsanadarsanarasanaghr änalaksano vyäpäro vrttir ity ucyate / tatra karananirdese srotrendriyasya präkpäthät tadvisayanirdesätilahghane prayojanam nästiti krtvä sabdädisu pancänäm ity eva pathitavyam / präktanas tu pramädapäthah / yat punar etad uktam(201.9) kimlaksanety atra brümah: älocanamätram isyate / älocanam grahanam 5 ity anarthäntaram 6 / mätrasabdo visesanivrttyarthas tadyathä bhaiksamätram 7 asmin gräme labhyata ity ukte nänyo visesa iti jfiäyate, chandomätram adhlte mänavaka ity ukte nänyad adhita iti / evam älocanamätram indriyänäm isyate 8 vrttir ity ukte nänyo visesa iti gamyate / tena kim siddham bhavati / yad uktam anyair äcäryaih "sämänyajnänam indriyänäm visesajnänam buddheh" iti tat pratisiddham bhavati / All the Mss read saktivisesopälambhäd. D. sadbhävah saktiviseso0, s.m. sadbhavayuktiviseso0 2 K., P. and D: tasya Dkha. kasya 3 P. kimlaksanä D. kirn laksanä 4 K. and P.: tasya D. tasya, s.m. kasya 5 D. älocanagrahanam, s.m. älocanam grahanam 6 D. arthäntaram 7 D. bhaiksyamätram 8 Dkha. manyate D. deletes manyate of Dkha.
1

5

10

15

20

(tvak-) sparsanam iti vaktavye tvaggrahanam upacarat prayuktam paficah krosantitivat tadadhisthänatvam darsayitum / smoty aneneti srotram caste 'neneti caksur jighraty aneneti ghränam / / (K91a, D.263 without number)

202

YUKTIDIPIKA

5

10

15

20

25

30

aha: kah punar asmin darsane doso yata etat pratisidhyata iti / ucyate: sämänyavisesayor itaretaräpeksatve saty ekasminn avirodhäd anyataraparikalpanänarthakyam / yadi khalv indriyasya sämänyajnänam syät 1 tena visesäpeksam sämänyam sämänyäpeksas ca visesa iti yatra sämänyajnänam tatra visesajnänam api na pratisidhyata ity ubhayam aplndriyasya syät / tatas cäntahkaranaparikalpanänarthakyam / visesavato väntahkaranasya kah sämänyena virodha ity ubhayasyäpi tatra sambhaväd indriyänarthakyam / tasmäd apratyayam indriyam iti / kirn ca svavisayätiprasangät 2 / indriyasya cet pratyayah syäd yathä pratyayavato 'ntahkaranasyäniyatavisayatvam evam asyäpi syät / na tu tad asti / tasmäd apratyayam indriyam iti / kirn ca kälätivrttiprasangät 3 / indriyasya cet pratyayah syäd yathä pratyayavato 'ntahkaranasya trikälavisayatvam evam asyäpi syät / na tu tad asti / tasmäd apratyayam indriyam iti / kirn cänyat / smrtyadarsanät 4 / indriyasya cet pratyayah syäd yathä pratyayavato 5 'ntahkaranasya <smrti>rüpopapattir6 evam aträpi syät / na tu tad asti / tasmäd apratyayam indriyam siddham 7 / äha: bhavatu tävad apratyayam indriyam / tat tu grahanarüpam na tu prakäsakam pradipavad ity atra ko hetur iti / ucyate: na k<a>ranäntaraprasangät 8 / yadi pradipavad indriyam prakäsakam syät tena yathä tatprakäsitesu ghatädisv arthesu karanäntaramärganam 9 evam aträpi syät / na caitad istam / ato na pradipavad indriyam prakäsakam iti / antahkaranasadbhäväd ayuktam iti cet / syän matam / asti karanäntaram 10 buddhilaksanam yad indriyena pradlpavat prakäsitam artham grhnäti / tasmät paravädänuvädo ' y a m kriyate 11 na pratisedha iti 1 2 / tac ca naivam / kasmät / pradlpendriyayor anyataränupädänaprasangät / indriyam api prakäsakam pradipo 'pi / tatränyatarasyänupädänam prasaktam / kasmät / na hy ekärthakärinor 13 yugapatkarane 14 sämarthyam astiti / kirn cänyat / antahkaranahäneh / indriyena pradlpavat 15 prakäsitän bähyän arthän säksäd antahkaranam grhnätiti vadato 'ntahkaranam eva hiyate / tasmäd ayuktam antahkaranasya grahanasämarthyam / purusasyeti cen na karanänarthakyaprasangät / säksäd visayagrahanasamartham purusam icchatah karanänarthakyam prasajyate / tasmäd yuktam et ad grähaand P.: na syät D. puts na of na syät in parentheses. and P. omit kirn ca svavisayätiprasangät, which D. adds in the right margin. adds kirn ca kälätivrttiprasangät ....tasmäd apratyayam indriyam iti in the bottom margin. smrtidarsanät After pratyayavato D. goes back to 'ntahkaranasyäniyatavisayatvam(202.9), and after it repeats the same phrase and reads pratyayato in the repeated phrase instead of pratyayavato. 6 All the Mss read 'ntahkaranasyädirüpopapattir. 7 D. siddham iti. 8 All the Mss read käranäntara0. We follow Raghavan. 9 D. käranäntara0 10 Dkha. käranam 11 D. °vädo kriyate, s.m. °vädo 'yam kriyate 12 D. pratisedhayati 13 P. °kärino 14 Dkha. yugapatkalpane 15 D. indriye pradipavat, s.m. indriyena pradlpavat
l K. 2 K. 3 D. 4 D. 5

SAPTAMAM AHNIKAM SK28

203

kam indriyam na tu pradipavat prakäsakam iti / äha: bhavatu tävad grahanamätram indriyavrttir apratyayä / grahanapratyayaprakäsänäm idänim ko bhedah / ucyate: visayasamparkät tädrüpyäpattir indriyavrtti<r> grahan a m 1 / tathä visayendriyavrttyanukärena niscayo gaur ayam suklo dhävatity evamädih pratyayah / tathä visayasamparkäpagame sroträdivrttes tädrüpyäpagamo <iti> vartamänakälatä grahanasya / anubhavät tu samskärädhänam tatpürvikä ca smrtir iti trikälavisayatä 2 pratyayasyety ayam 3 anayor visesah / bähyas tu prakäso na visayarüpäpannah / samskärät tu ghatädinäm vyavadhänarüpam pärthivam chäyälaksanam dharmam apahatya vyafijakatväya kalpate caksuso4 'nugrahäyobhayor vä caksurvisayayor ity apare / tasmäd upapannam etat prakäsakam pradipädi grähakam sroträdi vyavasäyakam antahkaranam iti / [äha 5 : atha karmendriyänäm kä vrttir iti / ucyate 6 ] naiyäyikäs tv evam ähuh "ghränarasanacaksustvaksrotränindriyäni 7 bhütebhyah8"(cf.NS.1.1.12) <iti> / bhütebhya ity anena svavisayopalabdhilaksanatvam hlndriyänäm bhütaprakrtitve sati nirvahati 9 nänyathä / <bhü>täni(?)10 punar indriyakäranäni / prthivyaptejo väyur äkäsam iti bhütäni(cf.NS.1.1.13) / ebhyah pancabhyo yathäsamkhyam ghränarasanacaksustvaksroträni pancendriyäni bhavanti / bhütaprakrtitvam iti bhütasvabhävam vyäkhyäyamänam paficasv api sambhavati / bhütakäranatvam tv anyesu catursu tathaiva / srotre tu kathamcit karnasaskulyavacchinnanabhobhägäbhipräyena vyavahäratah 11 samarthaniyam / evam bhautikänindriyäni svasvavisayam adhigantum utsahanta iti 12 tallaksanatvam esäm sidhyatity ato bhütebhya ity uktam / etat tu sämkhyäcäryänäm nestam / evam hi sämkhyavrddhä ähuh "ähamkärikänlndriyäny artham sädhayitum arhanti nänyathä" <iti > / tathä hi kärakam kärakatväd eva präpyakäri bhavati / bhautikäni cendriyäni 13 katham präpyakärini düravartini visaye bhaveyuh / ähamkärikänäm tu tesäm vyäpakatväd visayäkäraparinämätmikä vrttir vrttimato 'nanyä sati sambhavaty eveti suvacam präpyakäritvam / api ca mahadanugrahanam 14 ähamkärikatve tesäm kalpate na bhautikatve / bhautikatve hi yatparimänam <graha>nam15 tatparimänam grähyam 16 grhniyät <iti> (see NM.part2,p.49.5-10) / A\\ the Mss read indriyavrttigrahanam. We follow Raghavan. K., P. and D.: trikälavisayä Dkha. trikälavisayatä 3 D. pratyayasya treyam 4 D. caksusor 5 K., P. and D. omit äha. Dkha. äha D. deletes äha of Dkha. 6 D. ute, s.m. ucyate 7 D. ghrätiarasanacaksutvaksroträ0 8 D. omits bhütebhyah. 9 P. nirdhahati 10 All the Mss read «am. 11 D. vyavahäratä 12 D. omits iti. 13 D. bhautikänindriyäni, s.m. bhautikäni cendriyäni 14 D. mahadanugrahanam 15 All the Mss read karanam. 16 D. writes and erases karana before grähyam.
1

5

10

15

20

25

30

204

YUKTIDIPIKA aha: atha karmendriyanäm ka vrttir iti / ucyate: VACANÄDÄNAVIHARANOTSARGÄNANDÄS CA PANCÄNÄM / (SK28cd)

5

10

15

väkpänipädapäyüpasthänäm tu vacanädänaviharanotsargänanda\aksa,nä, yathäkramam vrttayah pratyavagantavyäh / tatrocyate 'nena(cf.Pän.3.3.117) iti vacanam / tasmäd ya evärthapratyäyanasamartho varnasamudäyah padaväkyaslokagranthalaksanah sa vägindriyasyärtho nänyah / ädlyate 'nenety ädänam 1 / an abhividhyarthe 2 (cf.Pän.2.1.13) prayujyate / tatas ca yad eva praksälanaparimärjanopasparsanädhyayanapraharanasilpavyäyämädikrtsnamgrahanam sa indriyärtho nänyah / [evam utkrstah sarga utsarga] visistam haranam viharanam / atas ca yad eva samavisamanimnonnatacahkramanaparivartananätyavyäyämädih sa indriyärtho nänyah / evam utkrstah sarga utsargah / atas ca ya eväsitapltaviparinämasya samyaksroto märgänusärino visargah sa indriyärtho nänyah / evam <api vyäpya nandanam) 3 änandah / tatas ca ya eväsädhäranapritinayanäbhinispattilaksanah 4 sa indriyärtho nänyah / ittham 5 upasargaprayogenärthavisesasya karmendriyavrttitvena parigrahäc charlrapradesäntaräsädh<ära>nakriyävisesasampü<rn>äni6 santi karmendriyämti nirdistä sroträdivrttih <...> / / 2 8 / / äha: präg antahkaranavrttinirdesah sargakramänugamät / pürvam buddhyahamkäramanasäm vrttinirdesah kartavyah / kirn käranam / evam hi sargakramo 'nugato bhavati / kramabhede vä prayojanam vaktavyam iti / ucyate: na indriyavrttipürvakatvät / antahkaranasya hindriyavrttipürvakah pratyayah / tathä ca vaksyati— drste tathäpy adrste trayasya 7 tatpürvikä vrttih / (SK30cd)

20

25

iti / tasmät sargakramam atilanghya 8 tannirdesah präg äcäryena kriyata iti / äha: tadasambhavah sästre prägabhimänäbhidhänät / sästram 9 hy evam äha "kä nu bhoh samjnä mätur udare Vasthitam kumäram pratyabhinivisata 10 iti / asmity esä mähätmi samvid iti / tathä käryak<a>ranavyühasamakälam 11 mähätmyasariro 'smiti pratibudhyate / pravrttäs <cäbhi>vyaktä(?)12
1 D. ädhanam 2 D. abhidhyarthe, s.m. abhividhyarthe 3 All the Mss read abhivyäpyänandanam. 4 D. iväsädhäranapritinayanäbhi0 5 6

K., P. and D. omit ittham ... nirdistä sroträdivrttih.(204.16-18) The passage beginning with ittham is supplied by Dkha. D. reads kha pustakät pürito 'yam bhägah after sroträdivrttih. Dkha. charirapradesäntaräsädhanakriyävisesasampüjitäni D. corrects °sädhana0 into °sädhärana0. We follow the emendation suggested by D. 7 D. 'tra yasya 8 K., P. and D.: sargakramena vinä Dkha. sargakramam atilanghya 9 Dkha. sästre 10 P. pratyabhinirvisata D. pratyabhinivesata, s.m. pratyabhinivisata 11 All the Mss read käryakärana0. 12 All the Mss read caiva hy avyaktä.

SAPTAMAM AHNIKAM SK28,29

205

bhavanty asmity asmitämäträh" <iti> / pramänam ca sästram / tasmät präg antahkarananirdesah kartavyah / ucyate: <na> tannimitt<atv>ena 1 vivaksitatvät / satyam etat käryak<a>ranavyühanispattisamakälam 2 asmity esä mähätmi samvit pratyupadhiyate 3 / sabdädivisayas tv antahkaranapratyayah sroträdinimitta ity etat pürvasabdena vivaksitam / na ca nimittam atikramya naimittikäbhidhänam nyäyyam 4 / athavä naiva vayam idam 5 prastavyä 6 yathä präg antahkaranavrttinirdesah kartavya iti / kirn käranam / yasmät— SVÄLAKSANYAM VRTTIS TRAYASYA7/ (SK29ab') svalaksanam 8 eva svälaksanyam / svärthe taddhitavrttih "<änyabhävyam>9 tu kälasabdavyaväyät 10 " (Vär.ll on Sivasütra 1, MBhäsy a. I.18.5) iti yathä / buddhyahamkäramanasäm 11 hi sauksmyän na sakyam svarüpam abhidhätum ity ato vrttir eva laksanabhävenopadisyate / sroträdinäm api ca sauksmyäl laksanam apadestum asakyam iti vrttir evocyate na laksanam / tad eva caisäm laksanam bhavati / yac chabdälocanasamartham tac chrotram / evam itaresv api vaktavyam / buddhyahamkäramanasäm ca laksanam adhyavasäyädy uktam / tad eva vrttitvenäcaksänah sroträdinäm eva <sabdädyälocanam>12 laksanam cäpy äcaksäno vrttivrttimator ananyatvam 13 jnäpayati / anyathä 14 tu yathä vyavasäyädi laksanam evam rüpädisu pancänäm älocanamätram laksanam ity ucyate, na tu vrttir iti / sroträdivadbuddhyädlnäm api vyavasäyädayo vrttir ity ucyate na tu laksanam / tasmäd anyathä nirdeso jnäpakam vrttivrttimator <an>anyatvasyeti15 vyäkhyätä karanavrttih / SAISÄ BHAVATY ASÄMÄNYÄ / (SK29b') seti pürvakrtäm vrttim abhisambadhnäti / eseti sarvanämnä pratyäkrstäm täm eva pratyaksam pratinirdisati / bhavatiti vaksyamänena dharmäntarenäsyäs tadvattänubhävitvam khyäpayati / asämänyeti dharmam äcaste / sämänyä sädhäranety arthah / na sämänyäsämänyä / pratikaranam niyatety uktam bhavati / yä hiyam anukräntä kara^a^ary^no^'dhyavasäyädikä vrttir iyam vyastänäm karanänäm pratisvam niyatä / tatas caisäm buddhyädinäm käryavisesanimittabhävasamsücitasya svarüpasyäsamkarah siddhah /
1 All the Mss read tannimittarthena. 2 All the Mss read käryakärana0. 3 D. pratyupadiyate 4 K. and P.: nyäyam 5 D. naivedam, s.m. naiva vayam idam 6 D. prastavyah 7 D. vrttitrasyasya 8 D. svalanam, s.m. svalaksanam 9 K. and P.: anyabhävas D. anyäbhävas 10 Dkha. °vyavasäyäd 11 D. ° manämsi, s.m. °manasäm 12

5

10

15

20

25

30

All the Mss read cäbhidadhänam. D. °vrttimato 'nanyatvam 14 D. has an unclear letter before anyathä. All the Mss read anyatvasyeti. We follow Raghavan.

206

YUKTIDIPIKA

aha: samanyavisesayor itaretarapeksatvad asamanyabhidhanena 1 samanyasyäpy abhidhänäd adhyavasäyädikä karanänäm asämänyä vrttir ity ukte 'rthäd äpannam esäm sämänyäpi vrttir astiti / tasmäd asäv api vaktavyeti / ucyate: 5 SÄMÄNYAKARANAVRTTIH PRÄNÄDYÄ VÄYAVAH PANCA / / (SK29cd) sämänyä cäsau karanavrttis <ca> sämänyakaranavrttih / präna ädyo yesäm te pränädyäh pränäpänasamänodänavyänäh panca <väyavah (?)> samastakaranavrttih pratyavagantavyeti / taih sarvaih sahitah 2 präna iti vedäntesv api / äha: ayuktam etat / kasmät / dharmino dharmyantaravrttibhävänupapatteh / vrttir ity ayam sabdo vyäpäram äcaste / na ca dharmyantaram dharmyantarasya vyäpäro bhavitum arhatiti / ucyate: na kärye 3 käranopacärät / satyam etad dharmi dharmyantarasya vrttitvenäsakyah parikalpayitum / kirn tu sämänyakaranavrttyä preryamäno väyus tatpravanatvät tatkäryatäm pratipadyate / tatra pränädikärye väyau pränopacäram krtvaivam ucyate pränädyä väyavah panca <iti> / tatpreranäsiddher ayuktam iti cet / syäd etat / katham etad avagamyate 'rthäntarapreritasya väyor iyam kriyä bhavati na punah svatantrasyeti / ucyate na svatas tadvyatiriktatvänupapatteh 4 / iheyam <aneka>bhinnä5 kriyä väyoh svato vä syät karanavrttivyatiriktäd vä / kirn cätah / tan na tävat svata upapadyate / kasmät / sarvatra prasangät / sväbhävike hi väyor diksamcäre 6 'bhyupagamyamäne sarvatra tatsambhavah syät / tatas ca tiryakpätädivrttir hanyeta / na cänyatah / kasmät / adarsanät / na hi prthivyädinäm väyupreranasämarthyam kvacid upalabdham / bhasträdisu drstam iti cen na anyanimittatvät / aträpi caitravyäpära upalabhyata ity avasyam anyan nimittam upalabhyata ity abhyupagantavyam / ätmeti cen na kriyäpratisedhät / upapäditam etat pürvam(180.3) ätmä niskriya iti / na ca niskriyasya preranam upapadyate / na ca nirnimittä 7 svabhävabhedänäm anäkasmikatvät / tasmäd yat tannimittam sä samastakaranavrttih / sa cäyam väyur eka eva sthänasamcäravisesän 8 nänäkhyo bhavati yathaiko devadattah päcako lävaka iti kvacit / tad ayuktam / kasmät / yugapatparasparätisayavirodhät / pürvasmät pürvasmäd uttara uttaro väyur baliyän iti hy abhyupagamah / tad etad ekasyaikasmin käle nopapadyate / tasmäd upapannam pränädyä väyavah panca / kirn punar esäm pränädmäm laksanam iti / ucyate: dvividhäh pränädayah / antarvrttayo bahirvrttayas ca / tatra mukhanäsikäbhyäm pragamanät pranates ca pränah / yo ' y a m mukhanäsikäbhyäm samcarati so 'ntarvrttir 9 väyuh präna ity abhidhiyate / yä käcit
X K. and D.: asämänyäbhidhäne 2 D. sahitä 3 D. käryena D. puts na of käryena in parentheses. 4 D. tadvyatiriktänupapatteh 5 All the Mss read akasmäd bhinnä. 6 D. väyor diksamcäre, s.m. väyor bhinnadiksamcäre 7 D. nirnimittah 8 D. °visesah 9

10

15

20

25

30

35

D. santo vrttir, s.m. so 'ntarvrttir

SAPTAMAM AHNIKAM SK29

207

pranatir näma bhütesu tadyathä pranateyam senä, pranato ' y a m vrksah, pranato ' y a m dharme, pranato ' y a m arthe, pranato 'yam käme, pranato 'yam vidyäyäm, tadviparitesu vä bähyapränavrttir esä / prän<a>visaya1 evais<a>2 bhavati / sa khalv ayam aträbhivyakto bhavati tadyathä mahatä vä duhkhenäbhiplutasya mahatä vä bandhunä viyuktasya sahitasya vä saurabheyasya nipänävatlrnasya vä mahisasya / avagater 3 apakramanäc cäpänah / yo ' y a m rasam dhätün sukram mütram purisam 4 vätärtavagarbhärns cäkarsann adhogacchann ayam antarvrttir väyur apäna ity abhidhiyate / yac cäpi kimcid apakramanam näma bhütesu tadyathäpakränto 'yam dharmädibhyas tadviparitebhyo veti bähyä khalv apänavrttir esä / apänavisaya evaisa bhavati / balavattaras cäyam pränäd väyoh / kasmät / es<a>5 hy etam pränam ürdhvam vartamänam arväg 6 eva sanniyacchati, arväg 7 eva sannirunaddhi / <sa caiso>8 'träbhivyakto bhavati / tadyathöpaküpam upasvabhram vä parivartamäna<syäpakräntih (?)> satapadim 9 langhayatah / hrdy avasthänät sahabhäväc ca samänah 10 / yas tv ayam pränäpänayor madhye hrdy avatisthate sa 11 samäno väyur antarvrttih / yas cäpi kascit sahabhävo näma bhütesu [dvandvärämatä] 12 tadyathä saha däsye, saha yaksye, saha tapas carisyämi, saha bhäryäputrair bandhubhih suhrdbhis ca vartisya iti bähyä samänavrttir esä / samänavisaya evaisa bhavati / balavattarah khalv ayam pränäpänäbhyäm / esa hy etau pränäpänäv ürdhvam aväk 13 ca vartamänau madhya eva sanniyacchati, madhya eva sannirunaddhi / sa caiso 'träbhivyakto bhavati / tadyathä srutasärasya vä särameyasya. anaduho vodhalüi^jnnLaDnitaDtaya yaiuaKayan _ aranargnaKayam saKasaKetii nte sarvapraninam pranapanav utsrjyordhvam adhas ca muktayoktrau hayav iva visamam samcärayan sariram sa 16 paräsyati / mürdhärohanäd ätmotkarsanäc 17 codänah / yas tv ayam pränäpänasamänänäm sthänäny atikramya rasam dhätüms cädäya mürdhänam ärohati tatas ca pratihato nivrttah sthänakaranänupradänavisesäd varnapadaväkyaslokagranthalaksanasya sabdasyäbhivyaktinimittam bhavaty ayam antarvrttir 18 väyur udäna ity ucyate / yas cäpi kascid ätmotkarso näma bhütesu tadyathä hinäd
X A11 the Mss read pranivisaya. We follow Raghavan. 2 All the Mss read evaisa. 3 D. vävagateh recte: apagateh(1) 4 P. purirtsam 5 All the Mss read esä. 6 D. arväg, s.m. aväg 7 D. arväg, s.m. aväg 8 All the Mss read eso. 9 K. and P.: parivartamänasyä ... satapadim D. parivartamänasyäham 10 D. ca samänah, s.m. ca sa samänah 11 D. omits «a. 12 D. dvandvämatah 13 D. arväk, s.m. aväk 16 17 Dkha. 18

5

10

15

20

25

30

satapadim

D. omits «a. mürdhärohanät samkarsanäc P. antavrttir

208

YUKTIDIPIKA

5

10

15

20

asmi sreyan, sadrsena va sadrsah, sadrsad asmi sreyan, sreyasa va sadrsah 1 , sreyaso vä sreyän2 etasmims tathärüpäbhimäno vä präptavidyasya 3 tadyathä bahvantaravisesäd 4 alpäntaraviseso 'smi, agunavato vä gunavän asmlti bähyodänavrttir 5 esä / udänavisaya evaisa6 bhavati / balavattarah khalv ayam pürvebhyah / katham / esa hy etän pränädm ürdhvam avän 7 madhye ca vartamänän ürdhvam evonnayati, ürdhvam evotkarsati / sa caiso 'träbhivyakto bhavati sltodakena vä paryuksitasya präsam asim vikosam codyatam 8 abhipasyatah / sarlravyäpter atyantävinäbhäväc ca vyänah / yas tv ayam ä lomanakhäc chariram vyäpya rasädinäm dhätünäm prthivyädlnäm vyüham marmanäm ca praspandanam pränädinäm ca sthitim karoti so 'ntarvrttir vyänah / yas cäpi kascid atyantävinäbhävo 9 näma bhütesu tadyathä pativratä bhartäram mrtam apy anugacchati bhaväntare 'py ayam eva bhartä syät tathä dharmädibhis tadviparltais ceti <bähyä vyänavrttir esä> 10 / vyänavisaya evaisa bhavati 1 1 / balavattamas cäyam sarvebhyah / katham / anena hi vyäpte sariradandake tadvaslkrtänäm pränädinäm samästhitir bhavati / sa eso 'ntakäle pränabhrtäm avinäbhävena 12 vartamäno 'bhivyajyate tadyathä hä tarhi pädau <hä imau>(?) 13 sltibhütau gulphe janghe ürü katir udaram urah kanthe 'sya <ghuru>ghuro14 vartate hü ity evaiso15 bähyo vyäna iti / evam ete pränädyäh sthänakäryavisesasücitäh panca väyavo vyäkhyätäh / tesäm prerikä sämänyakaranavrttih / esä ca tanträntaresu prayatna ity ucyate / sa ca dharmädisamskärabhävanävasäd anuparato jivanam / äha ca— vrttir 16 antah samastänäm karanänäm pradipavat / agrakäsä^kriyärüpä jivanam käyadhärikä / /

25

sä yävad aniruddhä tu hanti väyum rajo'dhikä 17 / dharmädyajiävrttiyasät 18 tävaj jivati mänavah / / atra ca sämänyakaranavrttigrahanasämarthyät pränädyäh panca väyavah, buddhindriyäni sastham, karmendriyäni saptamam, pur astamam / pur ity
X D. väsadrsah 2 D. väsreyän 3 P. präptavidyas tu D, präptavidyasva, s.m. präptavidyasya 4 Dkha. °visesa$ya 5 D. bähya udänavrttir 6 D. evaitad 7 D. arvän 8 D. coditam 9 D. atyavinäbhävo, s.m. atyantävinäbhävo 10 All theMss read bähyo. 11 P. prabhavati 12 D. °bhrtäm avinäbhävena, s.m. °bhrtärn vinäbhävena 13 K. he 'sau P. hesau D. hemau, s.m. himau 14 All the Mss read khuraghuro. We follow Chakravarti. 15 D. huyate vaiso 16 D. first treats the following verses as prose, which is then corrected 17 D. rajodikä 18

into verses.

D. dharmädinä vrttivasät

SAPTAMAM AHNIKAM SK29 ahamkärävasthäsamvidam adhikurute / yasmäd 1 äha tatra—

209

samvid ahamkäragat<ä>2 käryam k<a>ranam <ca>3 pürayati yasmät / tasmät pur ity 4 uktä pratyavabhäsästamam bhoktuh / / sä cähamkäragatä samvid buddhigataiva purusenopalabhyate / yasmäd 5 vaksyati— ete pradipakalpäh parasparavilaksanä gunavisesäh / krtsnam purusasyärtham prakäsya buddhau 7 prayacchanti //(SK36) sarvam praty upabhogam yasmät purusasya sädhayati buddhih / (SK37ab) tasmät saiva pur 8 iti / sästram caivam äha "pränäpänasamänodänavyänäh panca väyavah, sastham manah, saptami 9 püh, astami 10 väk" <iti> / väggrahanena karmendriyaparvano grahanam manograhanena buddhindriyaparvanah / tad etat pränästa<k>am 11 vaikärikam gunasarlrasya paridrastuh ksetrajfiasya sarlram ädadänasya nityam stambhasthäniyam pratyangam bhavaty acchedyam abhedyam adähyam avinäsyam avikampyam 12 / anityäni punar bhautikäni bähyäni sanräni kusamrttikästhänlyäny upaciyante ceti / äha: kutah punar iyam pränädivrttih pravartata iti / ucyate: sä karmayonibhyah / mahatah pracyutam hi rajo vikrtam andasthäniyäh paiica karmayonayo bhavanti dhrtih sraddhä sukhä vividisävividiseti / äha ca— pracyuto mahato yas tu na präpto jnänalaksanam / vyäpäro jfiänayonitvät sä yonih kukkutändavat / / täsäm laksanavisayasatattvagunasamanvayä bhavanti / tatra laksanam tävad vyavasäyäd apracyavanam dhrtih / phalam anabhisandhäya sästroktesu käryesv avasyakartavyatäbijabhävah 13 sraddhä / drstänusravikaphaläbhiläsadvärako 14 hi buddher äbhogah sukhä / vettum icchä vividisä / tannivrttir avividisä / tatra yadäyam jantuh subhäsubhesu käryesu vrttyanusäri jijnäsur ajijnäsur vä sarlram parityajati täm eva karmayonim upapadyate / tasyäm upapannas täm eva bhävayati / etat täval laksanasatattvam / äha ca—
1 D. tasmäd 2 All the Mss read ahamkäragatam. 3 A11 the Mss read käranam instead of k<a>ranam <ca>. 4 D. pürayaty, s.m. pur ity 5 D. °bhyate na yasmäd, s.m. °bhyate yasmäd 6 D. ete, s.m. te te 7 D. prakäsabuddhau 8 D. treats tasmät saiva püh as a beginning of a lost verse. 9 D. saptame 10 D. astame 11 All the Mss read pränästamam. We follow Chakravarti. 12 D. avikalpyam, s.m. avikampyam 13 D. avasyakartavyatä bijabhävah 14 6

5

10

15

20

25

30

D. °äbhiläsadhärako

210

YUKTIDIPIKA vaci karmani 1 samkalpe pratijnam yo <'nu>raksati 2 / tannisthas tatpratijiias 3 ca dhrter etad dhi laksanam / / (see TSV.p.82.15-16) anasüyä brahmacaryam yajanam yäjanam tapah /

5

dänam pratigrahah saucam sraddhäyä laksanam smrtam / / (see TSV.p.82.17-18) sukhärthl yas 4 tu seveta vidyäm karma tapämsi vä / präyascittaparo nityam sukhäyäm sa tu vartate / / (see TSV.p.82.19-20; MBh.App.I.No,29b,145ff)

10

dvitvaikatvaprthaktvam nityam cetanam acetanam süksmam / satkäryam asatkäryam vividisitavyam5 vividisäyäh / / (see TSV.p.82.23-24) visapltasuptamattavad avividisä dhyäninäm sadä yonih / käryakaranaksayakari präkrtik<a>gatih7 samäkhyätä / /
6

15

visayasatattvam punah sarvavisayinl dhrtih, äsramavisayini sraddhä, drstänusravikavisayinl sukhä, vyaktavisayini vividisä, avyaktavisayiny avividisä / gunasamanvayas tu rajastamobahulä dhrtih, sattvarajobahulä sraddhä, sattvatamobahulä sukhä, rajobahulä vividisä, tamobahulävividiseti / uktam ca— laksanavisayasatattvam traigunyasamanvayam ca paiicänäm /

20

yoninäm yo vidyäd yativrsabham tarn tv aham manye / / ity uktäh pränädayo yonayas ca / etad dvayam adhigamya samyanmärgänugamanam 8 kuryät / rajastamodharmädisädhanabhävavinivrttitas tu / atra pränänäm antarvrttir anupädhikatväd anivartyä / bahirvrttis tu märgämärgavisayatayä prayoktavyä / katham ity ucyate / pränavisayä tävat pranatir dharmädivisaya evä<v>aroddhavyä9/ tato hy asya sattvavrddhih / sattvavrddhes cottarottarabuddhirüpädhigamah / apänavisaya<m>10 tv apakramanam <a>dharmädivisaya11 evä<v>aroddhavyam 12 / evam hy asya khyätivisayä<v>ärakasya13 tamaso nirhräsah / tatas cottarottarabuddhirüpädhiga1 D. väcyakarmani 2 All the Mss read na raksati. 3 K. and P.: tatpratijnäs 4 D.: sukhärtham(?) yas, s.m, sukhärthi yas 5 D. vividisitam 6 Dkha. viparitasupta0 7 A11 the Mss read präkrtikä gatih. 8 D. samyak märgänugamanam 9 AH the Mss read eväparoddhavyä. We follow 10 All the Mss read apänavisayas. 11 All the Mss read dharmädivisaya. 12 13

25

Chakravarti.

All the Mss read eväparoddhavyam. We follow Chakravarti. All the Mss read khyätivisayäkärakasya.

SAPTAMAM AHNIKAM SK29,30

211

mah / tathä samänavisayam sähacaryam sattvadharmänugunam kuryät / yasmäc chästram äha "sattvärämah sattvamithunas ca sadä syät" iti / ätmotkarsam tüdänavisayam avidyäparvano 'ntyam rüpam vivarjya tatpratipaksair nivartayet 1 / atyantävinäbhävam ca 2 vyänavisayam 3 jiiänavisaya eva bhävayet / yoninämcatasrnäm dhar<ma>bijatäm4 evädadyät 5 / avividisäm apy anistaphalahetusu bhävayet / so ' y a m dharmädisu pravanas tatpratipaksäpakräntah sattvärämo vinivrttäbhimäno jnänanisthah savisuddhayonir acirena param brahmopapadyata 6 iti / äha ca— bähyäm pränavivrttim samyahmärge budhah pratisthäpya / vinivrttavikharakaluso dhruvam amrtam sthänam abhyeti / / pancänäm yoninäm dharmädinimittatäm ca samsthäpya / paripakvam ity adhastän na punas 9 tadbhävito gacchet / / iti vyäkhyätä vyastasamastä karanänäm vrttih / / 2 9 / / äha: yeyam ekaikasmin rüpädäv arthe karanacatustayasya vrttih sä kirn10 yugapad ähosvit krameneti / kutah samsaya iti ced ubhayathä drstatvät / ihaikärthavisayänäm yugapad api vrttir drstä tadyathä candramandale caksusäm manaso vä kramasas ca tadyathä ghate madhüdakapayasäm / ekärthavisayam ca karanacatustayam / ato nah 11 samsayah kirn caksurmanovad yugapad asya vrttih, ähosvin madhvädivat krameneti / ucyate: yathädarsanam api tävad ucyatäm / kirn atra yuktam bhavän manyate / sa cet samyag upadeksyasi ko nirbandhas tad eva pratipadyämaha 12 iti / yady evam tasmäd idam asmaddarsanam— YUGAPAC CATUSTAYASYA TU VRTTIH / (SK30ab') tusabdo Vadhäranärthah / yugapad evety arthah / buddhyahamkäramanasäm 13 hi buddhindriyänäm ca samänadesatvam / tatra na sakyata etad vaktum sati saktisadbhäve visayasambandhe ca kasyacit tatra vrttih kasyacin neti / kirn cänyat / meghastanitädisu kramänupalabdheh / yadi hi kramena sroträdmäm antahkaranasya ca bähye 'rthe vrttih syäd agi tarhi meghastanita1 P. nirvartayet 2 After ca D. writes and erases jnänavisaya 3 Dkha. dhyänavisayam 4 AU the Mss read dharmatäbijatäm. 5 D. evädadhyät 6 7 8

5

10

15

20

25

eva.

7 D. dharmädinimittam täm, s.m. dharmädinimittatäm 8 D., in the footnote, reads samsthäpyety at ah param kha. 9 D. adhastät punas, s.m. adhastän na punas 10 D. not clear, s.m. kim 11 D. na, s.m. nah 12 D. manyämahe, s.m. pratipadyämahe 13

Dkha. (brahma) upasampadyata

pustakasyäbhävah.

D. °manänamsi, s.m. °manasäm

212

YUKTIDIPIKA

krsnasarpalocanadisv 1 apy upalabhyeta kramah / na tupalabhyate / tasmad yugapad eva bähye 'rthe catustayavrttir iti / ucyate: yad uktam(211.24) sroträdinäm antahkaranasya cäbhinnakälam vrttir ity atra brümah: ayuktam etat / kirn käranam / yasmäd asmäkam— 5 KRAMASAS CA TASYA NIRDISTÄ / (SK30b') tasyeti catustayam abhisambadhyate / casabdo 'vadhäranärthah / kramasa evety arthah / kramasa eva hi bähyäntahkaranavrttyor ekärthopanipätah 2 / yat tüktam(211.26) samänadesänäm saktisambandhasadbhäve vrttyabhävänupapattir ity atra brümah: caksurädivad etat syät / tadyathä caksustvacoh samänadesatve saktivisayasambandhopapattau rajodhümätapädhigatah 3 sparsa evopalabhyate na rüpam evam ihäpi syät / tasmät— DRSTE TATHÄPY ADRSTE4/ (SK30c) kramasa eva catustayasya vrttih / adrstagrahanena punar aträtitänägatavyavahitavisayagrahanam / taträtitam dvividham drstavisayam adrstavisayam ca / aträpi drstavisayam pratyabhijnänam ity abhipretam / adrstavisayam smrtih / sä tu lingägamäbhyäm akasmäd vä bhavati / tathä ca vrsaganavirenäpy 5 uktam bhavati "animitto 6 'py evam avasthitasya jiiänasya vrttih pratyayah prädus tiras ca <bhavati) vrttyarthe na bhavaty animitto 'pity anägatavyavahitavisayajnänam tu lingägamäbhyäm" <iti> / äha ca— visayendriyasamyogät pratyaksajnänam ucyate / tad evätindriyam jätam punar bhävanayä smrtih / / tad eva bhävanäpeksajnänam käläntare punah / tatraiva sendriyam jätam pratyabhijnänam ucyate / / 25 tatra drste kramam prati nästi sandehah / yat punar etad uktam(211.28) drste meghastanitakrsnasarpälocanädau 7 kramänupalabdher yugapac catustayasya vrttir ity atra brümah: etad apy ayuktam / kirn käranam / yasmät— TRAYASYA TATPÜRVIKAW VRTTIH / / (SK30d) na tävad buddhyahamkäramanasäm säksäd bähyärthagrahanasämarthyam 8 asty antahkaranänupapattiprasangät sroträdivaiyarthyaprasangäd dväridvärabhävavyäghätaprasahgäc ca / tasmät pürvam sroträdinäm arthasambandho
1 D. 2 P. 3 D. 4 D. 5 D. 6

10

15

20

30

°krsnasarpädisv, s.m. °krsnasarpalocanadisv not clear. adhigatah(7), s.m. adhigatah tah not clear, s.m. adrste vrsiganavirenäpy K. and P. indicate a lacuna in place of animitto apy animitto apity (212.18). This portion, which is omitted in the main text of D., is written in its bottom margin as being from ga.pu. 7 D. °sarpälocanädau, s.m. °sarpädyälocanädau 8 D. bähyärthe grahana0

(^(TRAYASYA TATPÜRVIKÄ)

trayasya buddhyades tatpurvika bahyakaranapurvika / / (K.98b,

D.282 without number)

SAPTAMAM AHNIKAM SK30,31

213

'sti / meghastanitädäv apy avasyam etad abhyupagantavyam / pascät tu tadvrttyupanipätäd antahkaranasyety asti kramo 'träpi / tatra yad uktam(211.28) meghastanitädisukramänanugater 1 yugapac catustayasya vrttir ity etad ayuktam / anyais tv anyathänvayo darsitah / tadyathä cat us tayasyeti mano'hamkärabuddhlnäm antahkaranänäm bähyenaikena karanena srotrena vä caksusä vä saha catustayasyety arthah / asya2 drste vartamäne yugapad vrttih pürväcäryair nirdistä / äcäryena tu kramenety arthah / adrste 'tltädäv api kramasas ca kramenaivayatas trayasyäntahkaranasya tatpürvikä bähyendriyapürvikä vrttih / [yadä] yathänubhavas tathä samskärah yathä ca samskäras tathä smrtir ity evam vrttir bähyendriyapürviketi / / 3 0 / / äha: kirn punar esäm karanänäm svavisayaniyamena vrttir bhavaty ähosvid vyatikareneti / ucyate: nanu ca präg eva— rüpädisu pancänäm älocanamätram isyate vrttih /(SK28ab) iti coktväcäryenänte 'padistam "saisä bhavaty asämänyä"(SK29b') iti / tatraivamgate bhavatah samsayah kuta [ity ucyate] / <äha:> satyam evaitat / tathäpi jäyate samsayah / kutah / karanäntarena svavisayopalabdhau karanäntarautsukyadarsanät / iha karanäntarena caksusämradädimädirüpopalabdhau 3 satyäm karanäntarasya jihvälaksanasyautsukyam pravrttis copalabdhä / tad yadi svavisayaniyatämndriyäni naisäm karanäntaravisayopalambhät 4 tatsähacaryäpeksah svavisayagrahanabhävah syät / asti ca / tasmäd upapannah samsayas tatredänlm bhavatah kä pratipattir iti / ucyate: aträpi nästlndriyänäm svavisayagrahanavyatikarah / kim tarhi / SVÄM SVÄM PRATIPADYANTE PARASPARÄKÜTAHETUKIM VRTTIM / PURUSÄRTHA EVA HETUR NA KENACIT KÄRYATE KARANAM / / (SK31) yasya karanasya yä vrttir apadistä 5 tadyathä srotrasya sabdagrahanam caksuso rüpagrahanam ityädi täm eva pratipadyante svavisayajighrksayävalambanta ity arthah / parasparasyäkütam parasparäkütam / äkütam abhipräyo 'bhisandhir ity arthah / parasparäkütam hetuh pratipatter asyäh seyam (cf.Pän. 5.4.154) parasparäkütahetuki / parasparäkütam pratipatteh käranam iti krtvä täcchabdyam labhate "tadyathä dadhitrapusam <pratyakso> jvarah 6 " (cf.MBhäsya.1.156.8)/ etad uktam bhavati: yadä caksusämradädimädirüpam 7
1 P. kramanctnugate 2 D. adds in the right margin asya drste vartamäne ... tu kramenety arthah. 3 D. ca caksusä mra d ätim ä dirüp opapal ab dh au, s.m. caksusämradädimädirüpopalabdhau 4 D. karanäntara0, s.m. käranäntara0 5 D. upadistä, s.m. apadistä 6 A11 the Mss read dadhitrapusam jvarah. 7

5

10

15

20

25

30

D. caksusämradätimätirüpam, s.m. caksusämradädimädirüpam

214

YUKTIDIPIKA

5

10

15

20

25

upalabdham bhavati tada rasanendriyam upattavisayasya caksuso vrttim samvedya svavisayajighrksayautsukhyavad1 vikärarri äpadyate / rasanasya vrttim samvedya pädau viharanam ärabhete hastäv ädänam tävad yävad asau visayo rasanedriyayogyatäm <ä>nitah2 / tato rasanam svavisaye pravartate / evam itaresv api vaktavyam / äha: yady evam tena tarhlndriyäntaravrttisamvedane 'ksapratyayavattvaprasangah / yadi tarhmdriyäntarenendriyäntarasya 3 vrttih samvedyate präptam asya pratyayavattvam / athäpratyayam indriyam parasparäkütasamvedanam tarhi na väcyam [iti] / kirn ca parasparadväridvärabhävaprasangas ca / indriyäntaram ced indriyäntarasya vrttim samvedya svärtham 4 äkänkset präptam asya dväritvam itarasya ca dväratvam / ta<smäd>5 ayuktam indriyänäm parasparäkütasamvedanam iti / ucyate: na upacärät / präg evopadistam asmäbhir apratyayam indriyam iti(202.8) / kirn tarhi / svavisayasya patoh sahacärinam artham indriyäntaravisayatäm äpannam samsprsya svabhävata indriyäntaram svavisayam prati säkänksam 6 bhavati / tatsannidhau vikriyädarsanät 7 tatra samvedanam upacaryaivam ucyata 8 ity adosah / kirn cänyat / bhautikävayavapratyayavivrttivat tadvivrtteh / yathä buddheh prasädasamanantaram bhautikänäm avayavänäm mukhanayanädinäm prasädo bhavati na caisäm pratyayavattvam, evam ihäpi syät / na ca pratyayavattvam / etena dväridvärabhävah <ca(?)> pratyuktah / mano'dhisthänasämarthyäd vä / athavä parasparavisayam äkütam parasparäkütam yathä jalavisayah purusah jalapurusah 9 / äkütam icchä samkalpo mana ity arthah / sa hetur asyäh seyam parasparäkütahetuki täm 1 0 / etad uktam bhavati: yadä kimcid indriyam visaye pravrttam bhavati tadä taddvärena samastam artham upalabhya <manas>tatsahacäri<nam>11 arthäntaram äkähksad indriyäntaram vrtty<ädhi>tisthate 12 / tenäkänksävatä manasädhisthitam indriyam vikriyäm äpadyate / tathä ca tanträntare 'py uktam "yasys, yasyendriyasya visayam mano dhyäyaty abhisampattyarthena tasya tasyautsukyam pravrttis ca bhavati" iti / etad uktam— sväm sväm pratipadyante parasparäkütahetukim vrttim / (SK31ab) iti / kirn indriyam mano vrttyädhisthäya svavisaye pravartayati yathä parasvädims caitra iti / nety ucyate / kirn tarhi / svavisayasamkalpänugrhltasya manasah samsparsät svayam evendriyam svavisayam pratipadyate / kasmät / prayogasaktyasiddheh / na hi yathä caitrasya parasvädiprayogasaktih siddhaivam
X D. samvedyasvavisaya° 2 All the Mss read °yatäm nitah. 3 D. indriyäntarena, s.m. indriyäntarasya 4 D. samvedyasvartham 5 A11 the Mss read tad. 6 D. pratisäkänksam 7 D. vikriyä0, s.m. visakriyä0 8 D. upacaryaiva mucyate, s.m. upacaryaivam 9 D. adds jalapurusah in the left margin. 10 11 All 12

30

35

ucyate

D. °hetukitäm, s.m. °hetuki täm the Mss read tatsahacärinäm. We follow Chakravarti. All the Mss read vrttyä pratitisthate.

SAPTAMAM AHNIKAM SK31,32

215

manasa indriyaprayogasaktih / tasmäd ayuktam indriyasya manah prerakam iti / raja iti cet / syän mat am / rajaso hindriyäntaraprayogasämarthyam vidyate / tasmäd ayuktam uktam(214.34) prayogasaktyasiddher nendriyänäm manah prayojakam iti / etac cäyuktam / kasmät / avisesät / indriyäntare 'pi hi tarhi rajo 'stity ata ätmabhütenaiväsya nimittena pravrttir apratisiddhä / kirn manasä parikalpiteneti / kirn cänyat / karanäntaranupapatteh 1 / caitro hi parasvädinäm prayogam karanäntarena karoti na tu manasah karanäntaram 2 astity asamänam / pänivad iti cen na caitravyäpäräpeksatvät / tad api hi caitravyäpäräpeksam pravartate na svatah / kirn ca tadvyatirekena pravrttyupalabdheh / yasya hi prayojakäntaräpeksä pravrttir na tasya kadäcid api svatantrasya bhavati / asti tu samkalpavyatirekena meghastanitädisv indriyasya pravrttih / tasmän nendriyäntarasya manah kärakam 3 / na cet kärakam yathä maulänäm gunänäm evam ihäpi purusärtha eva hetur na kenacit käryate karanam iti siddham / / 3 1 / / äha: karanam praty äcäryavipratipattes tadavadhäranam [kartavyam] / ihäcäryänäm 4 karanam prati vipratipattih / ekädasavidham iti värsaganäh, dasavidham iti täntrikäh paficädhikaranaprabhrtayah, dvädasavidham iti patanjalih / tasmäd bhavatah katividham karanam abhipretam iti vaktavyam etat / ucyate: KARANAM TRAYODASAVIDHAM TAD ÄHARANADHÄRANAPRAKÄSAKARAM / (SK32ab) panca karmendriyäni paiica buddhindriyäni mano 'hamkäro buddhis cety etat sarvam purusärthopayogikaranam / kasmät / apurusärthopayogitve tattväntaränupapattiprasangät / yadi yathä värsaganä ähur "lihgamätr<o>5 mahän asamvedyah käryak<a>ranarüpenävisist<o> visistalaksanena 6 " tathä syät tattväntaram 7 / tan na syäd anarthakatvät / <.... / atha matam /> 8 pradhänalaksanänäm gunänäm vaisamyamätrarüpatve 'pi tattväntaram asau bhavisyatiti / kasmät / sämyäd vaisamyam upäkhyäntaram iti / etac cäyuktam / kasmät / tattvänavasthäprasangät / evam hi parikalpyamäne pradhänamahator yad antarälam tattväntaränäm tad api ca kriyärüpatväd akriyävata upäkhyäntaram iti tattväntaränavasthäprasahgah / abhyupaga<me>9 vä mahatas tattväntaränäm ca kriyäkälavirodhah / tasmät tattväntaränupapattir anavasthä vä [trayodasavidham karanam 10 ity] anyatara<d> n avasyam
X D. käranäntarä0 2 D. karanäntaram 3 D. karanam, s.m. kärakam 4 K. and P.: äcäryänäm 5 All the Mss read lingamätre. We follow Chakravarti. 6 All the Mss read käryakäranarüpenävisistävisistalaksanena. 7 D. syä tattväntaram, s.m. syät tattväntaram 8 K. and P.: äha satyam D. äha satyam, s.m. äha matam 9 All the Mss read 'bhyupagamo. We follow Pandeya. 10 D. karanänäm, s.m. karanam 11

5

10

15

20

25

30

We follow Chakravarti.

AH the Mss read anyataravad.

216

YUKTIDIPIKA

5

10

abhyupagantavyam / tatra casmatpratijnatam eva nirdosam laksyate / tasmad upapannam etat trayodasavidham karanam iti / äha: karanam iti kriyäkärakasambandhagarbho ' y a m nirdesah / katham / yena <kriyate> tat karanam(cf.Pän.3.3.117) iti / tatra vaktavyam kä kriyä, kirn ca tat kriyate yad apeksya buddhyädinäm karanatvam iti / ucyate: yad uktam (216.4) kä kriyety atra brümah: tannirvartakam 1 ihäbhipretam na dandädivat / kim tarhi / tad äharanadhäranaprakäsakaram / taträharanam karmendriyäni kurvanti visayärjanasamarthatvät / dhäranam buddhindriyäni 2 kurvanti visayasannidhäne sati sroträdivrttes tadrüpäpatteh / prakäsam antahkaranam karoti niscayasämarthyät / apara äha "äharanam karmendriyäni kurvanti, dhäranam mano 'hamkäras ca, prakäsanam buddhindriyäni buddhis ca" iti / etad abhisandhäya buddhyädinäm karanatvam ucyata iti 3 / yat tüktam(216.4) kim käryam iti / ucyate— KÄRYAM CA TASYA DASADHÄ / (SK32c) dasadheti paiica visesäh paficävisesäh (cf.SK38) / tad apy ata eva käryasabdam labhate / ÄHÄRYAM DHÄRYAM PRAKÄSYAM CA / / (SK32d) tad dhy ähartavyam dhäranlyam prakäsayitavyam ca / atah käryam ity ucyate na nirvartyatvät / / 3 2 / /

15

20

etasmims trayodasavidhe tu karane tra<yam>4 katarad iti / ucyate: buddhir ahamkäro man as ca / tasmät— ANTAHKARANAM TRIVIDHAM / (SK33a) kasmät / visayänabhisandhänät sroträdipranälikayä ca visayasampratipatteh / avisesäbhidhänäd buddhyädipratipattir ayukteti cet / syän matam / avisesenedam uktam äcäryenantahkaranam trividham iti / tatra katham idam avagamyate buddhyahamkäramanasäm grahanam ihäbhipretam na punar anyesäm iti / ucyate: na prathainasamkhyävyatikrarnahetvanupapatteh / buddhyädisamkhyäm hi vyatikramamänasya pratipattau nästi hetuh / tasmät tesäm eva grahanam yathä "vasantäya kapifijalän älabhate" (e.g.Väj.Sam.24.20) iti / srotrasyäntahkaranatvaprasangäd ayuktam iti cet / syäd etat / buddhim ahamkäram coktvä tata äha— buddhindriyäni karnatvakcaksürasananäsikäkhyäni / (SK26ab) iti tasmäc chrotram antahkaranam prasajyata iti / etad a n u p a p a n n a m / kasmät / manasah prthagabhidhänät / ata evedam äcäryenäpeksya manaso 'ntahkaranatvam prthag uktam "tac cendriyam ubhayathä samäkhyätam antas trikälavisayam" (SK27bc) iti / tasmäd upapannam antahkaranam trividham buddhyäditi /
J D. 2 D. 3 D. 4

25

30

35

tannivartakam, s.m. tannirvartakam dhäranabuddhindriyäni, s.m. dhäranam buddhindriyäni ucyate iti, s.m. ucyate nivrttir iti All the Mss read trayodasam.

SAPTAMAM AHNIKAM SK32,33,34 DASADHÄ BÄHYAM / (SK33b')

217

panca buddhindriyäni panca karmendriyänity etad bähyam dasaprakäram äcäryair äkhyäyate / äha: dasadhä bähyam ity asyänarthakyam / parisesabuddher antahkaranam trividham ity ukte gamyata etat parisesäd eva dasadhä bähyam iti / tasmät tadgrahanam anarthakam iti / ucyate: n a v i s a y ä r t h a t v ä t / "trayasya visayäkhyam" (SK33b') ity evarn vaksyämlty äcärya ärabhate / akriyamäne tv asmin kirn tat trayasya visayäkhyam iti na jnäyate / äha: evam api visayagrahanät siddher bähyagrahanam apärthakam iti / ucyate: vaktavyam tävad idam avasyam visayabhävapratipattyartham / tatra sese vä yathänyäsam 1 vocyamäne na 2 kascid visesah / athavä nedam bähyasamjnäpratipattyartham ärabhyate / kirn tarhi / niyamärtham / katham / dasadhä bähyarn sabdädivisayagrahanabhütam eva trayasyäpi visayäkhyam yathä syät, mä bhüd antah pränädibhütam / athavä dasadhaiva bähyam bhedavisayam bähyam ity arthah / pränädibhütasya tu bhedo nästity adosah / tad etat— TRAYASYA3 VISAYÄKHYAM / (SK33b') buddhyahamkäramanolaksanasya hi trayasyopättavisayä buddhindriyakarmendriyavrttayah samparkäd visayarüpapratyavabhäsanimittatäm upagacchantyo visayäkhyatäm labhante / tathä mano'hamkäräv api buddheh / buddhis tu niscayarüpatvät karanäntaranirapeksä sarvam artham 4 pravrtt<im>5 prati niscayarüpenädhy<avasi>tam6 purusäyopasamharati / tatra sabdädisannidhäne vrttinäm tädrüpyäpattes tadapagame ca tädrüpyäpagamät präpyakäri— SÄMPRATAKÄLAM BÄHYAM / (SK33c) upättavisayendriyavrttisannidhänät tu tadäkärasamskärädhänanimittasmrtipratyayavasät— TRIKÄLAM ÄBHYANTARAM KARANAM / / (SK33d)

5

10

15

20

25

äha: präk "sabdädisu sroträdinäm älocanamätram vrttih" (cf.SK28ab) ity avisesenoktam / tatra kirn tathaiva pratipattavyam athendriyänäm visayaviseso 'stiti / atha coktam "käryam ca tasya dasadhä" (SK32c) visesalaksanam avisesalaksanam ca <iti> / tatra kena karanena kasya visayasya grahanam iti / ucyate:
1 D. yathä nyäsarn 2 D. vocyamänena, s.m. vocyamäne na 3 D. triyasya 4 D. ° äntaranipeksäsarvam, s.m. ° äntaranipeksä 5 All the Mss read pravrttau. 6

30

sarvam

All the Mss read ° ädhyastam.

218

YUKTIDIPIKA BUDDHINDRIYANI TESAM PANCA VISESÄVISESAVISAYANI / (SK34ab)

5

tesäm pürvoktänäm indriyänäm yäni buddhindriyäni panca sroträdmi täni visesävisesavisayäni pratipattrbhedena 1 / tatra devänäm yänmdriyäni täni dharmotkarsäd visuddhäny avisesän api grhnanti [präg eva visesät] / yoginäm ca sampräptavisesänäm / asmadädlnäm tu visesän eva tamasä parivrtatvät / äha: kirn karmendriyänäm api pratipattrbhedäd 2 grahanabhedo bhavati / nety ucyate / kirn tarhi / sarvesäm eva— VÄG BHAVATI SABDAVISAYÄ / (SK34c)

10

vägindriyasya väyvabhihatesu vadanapradesesu tälvädisu dhvaner varnapadaväkyaslokagranthabhävena vikäräpädanam sarvapräninäm avisist am / äha: athetaräni karmendriyäni katham iti / ucyate: SESÄNY API PANCAVISAYÄNI3 / / (SK34d)

15

20

25

30

pänipädapäyüpasthäs tv ädänaviharanotsargänandalaksanaih karmabhih sabdasparsarasarüpagandhasamudäyarüpä mürtir vikurvantiti / äha: yadi pancavisayäny 4 <eväpi sesäniti>5 niyamo 'bhyupagamyate tenaikaikävaranesv <ädä>nädikriyänupapattiprasahga 6 iti / ucyate: na niyamapratisedhärthatvät / svavisayaniyamo buddhmdriyavat karmendriyänäm api mä 7 vijnäyity ato niyamapratisedhärtham idam ärabhyate / tadartham eva cäpi sabdam äcäryo 'dhijage sambhävanärtham api ca pancavisayäny 8 etäni präg eva tu catustrivisayämti / äha: katham etad avagamyate visesävisesavisayämndriyäni na punar asadvisayäniti / ucyate: visesänäm asattväsiddheh / pratyaksatas tävad visesä upalabhyante / tasmäd esäm asattvam asakyam pratijnätum / <sadhyam iti cet /> athäpi syät / sädhyam etat pratyaksam evaitad anavadyam bähyavastuvisaya<m> mrgatrsnikädivijfiänavat9 pratyaksäbhäsam <veti> / etac cäyukt a m / kasmät / vikalpänupapatteh / sarvam abhütam abhyupagantavyam yato nästi kimcid bhütärthena pratyaksam yad apeksyetarat pratyaksäbhäsam 10 syät / uktas tv ayam vikalpah / tasmäd ayuktam jnänamätram idam iti / kirn cänyat / viparltadarsanaprasangät / mrgatrsnikäsvapnavisayair asadbhih satäm asattvam icchatas tadvad eva vipantadarsanaprasangah / tathä hi gandharvanagarädisu kadäcit tarn evärtham gäm pasyati / kadäcid 11 pratipattyabhedena, s.m. pratipattrbhedena pratipattyabhedäd, s.m. pratipattrbhedäd panca visayäni D. panca visayäny 5 All the Mss read evävisesäniti. 6 All the Mss read anädikriyä0. We follow Chakravarti. 7 P. sä 8 D. panca visayäny 9 All the Mss read bähyavastuvisayamayamrgatrsnikädi0. 10 D. pratyaksävabhäsam 11 K. and P.: kascid D. kascid, s.m. kadäcid
1 D. 2 D. 3 D. 4

SAPTAMAM AHNIKAM SK34

219

gajam pasyati / kadäcit patäkäm / svapne caikamürtipatitänäm gopurusäsvaräsabhanadivrksaprabhrtinäm darsanam <jäg>arane1 viparyayena drstam / tathä vätäyanena hastiyüthapravesane....vicchinnänäm 2 cävayavänäm punah sandhänam, äkäsagamanam, anlsvarasyänimittam räjyaläbha iti tad itaraträpi syät / na tv asti / tasmäd ayuktam mrgatrsnikäsvapnädivad asattvam bhävänäm / arthakriyä ca na syät (cf.Vims.3,4) / yathä svapne 3 snätänuliptäsitapitavasträcchäditänäm aphalatvam drstam evam ihäpi syät / sukravisargavad iti cet / syäd etat / yathä dvayasamäpattipürvakah sukravisargah sa ca tadabhäve 'pi svapne bhavaty evam itarat syäd iti / tad ayuktam rägädinimittatvät / tathä hi jägrato 'pi tat dvayasamäpattim antarena bhavati / tasmän manoranjan<a>nimittam 4 tat / pretavad iti cet / syäd <etat /> iyam mama sadbuddhih / yathä pretänäm asadbhih <püyanady>ädibhir5 arthakriyä narakapälais ca bädhanam evam aträpi syäd iti / tad ayuktam asiddhatvät / na hy etad asad iti siddham / kirn ca p r a t y a k s e n a cäpratyaksabädhanät 6 / iha pratyaksam baliya ity apratyaksasya tena pratyäkhyänam upapadyate / bhava<n>tas7 tv apratyaksena pratyaksam pratyäcaksate / tasmäd ayuktam narakapälädivad asatäm arthakriyeti / svabhävabhedät tad a s a t t v a m iti cet / syäd etat / yadi paramärthato narakapäläh syus tesäm api duhkhasambandhah syät mürtimattvävisesät / na tu tesäm bädhästi / tasmäd bhräntir asäv iti / etad ayuktam / kasmät / karmasaktivaicitryät / pratyaksam eva tävat karmanimitto vägbuddhisvabhävähäravihärasaktibhedabhinno vicitrah samsära upalabhyate / sa nipunam aveksitum asakyo gambhiratvät / kirn punar apratyaksakarmanäm vipäkavaisvarüpyam atarkagocaram asmadädibuddhayah paricchetsyanti / tasmän manorathamätram etat / dharmädharmänupapattis ca syät / yathä svapne brahmahatyäsuräpänägamyagamanädinäm aphalatvam evam itaraträpi syäd asadavisesät / middhopaghätät 8 tadvisesa(cf.Vims.l8) iti cen na avisesät / asattve tulye kvacid upaghätah kvacin neticchämätram etat / evam cen näsantah prthivyädayah / na ced asanto yuktam upadistam buddhindriyäni tesäm pafica visesävisesavisayämti / / 3 4 / / iti yuktidipikäyäm 9 saptamam ähnikam 10 /

5

10

15

20

25

30

1 A\\ the Mss read smarane. 2 D. ... vicchinänäm, s.m. ... sambhavivicchinänäm 3 D. yathä svapne, s.m. tathä hi 4 All the Mss read ° ranjanänimitttam. 5 All the Mss read prayänädyädibhir. We follow Chakravarti. 6 D. cäpratyaksam bädhanäd 7 AU the Mss read bhavatas. We follow Chakravarti. 8 D. siddhopaghätät P. siddhaupaghätät 9 P. sriyuktidipikäyäm 10

D deletes yuktidipikäyäm saptamam ähnikam.

A s t a m a m

A h n i k a m

dvaridvarabhavam esam idanim vaksyamah / tatra bahyam karanam dvaram antahkaranam dväriti / äha: karanävisesäd ayuktam / antahkaranasya hlndriyänäm ca karanatvam avisistam / tatra ko hetur antahkaranam dväri dväränindriyäniti 1 / ucyate: SÄNTAHKARANÄ BUDDHIH SARVAM VISAYAM AVAGÄHATE YASMÄT / TASMÄT TRIVIDHAM KARANAM DVÄRI DVÄRÄNI SESÄNI //(SK35) sahäntahkaranena vartate(cf.Pän.2.2.28) yä <sä> säntahkaranä buddhih / ahamkäramanobhyäm sahitä buddhir ity arthah / atra cäntahkaranagrahanenaiva buddher grahane siddhe bhüyo buddhigrahanam prädhänyakhyäpanärtham / bhavati hi pradhänasya sämänye 'ntarbhütasyäpi prthagupadesah / tadyathä— jagäma tarn vanoddesam vyasah saha maharsibhih / iti maharsigrahane vyäso 'py antarbhütah prädhänyät prthag ucyate / evam säntahkaranä buddhih sarvam visayam avagähate / visistän avisistäms ca sabdädln sannikrstaviprakrstavyavahitän pramänabalena svavrtte visaylkarotity arthah / etad uktam bhavati: aniyatavisayo dväri niyatavisayäni dväräni tadyathä präsädasya pürvottaradaksinapascimänäm <dväränäm> svadinniyamo na pürvam uttaram daksinam pascimam vä kadäcid bhavati tathetaräny api dvär<ä>ni2 / <dvän tv aniyatah> 3 sarvadigavasthitair dväraih pravarta<te> 4 / evam ihäpi sroträdlni svavisayaniyatäni, säntahkaranä tu buddhih sarvam visayam avagähate yasmät tasmäd aniyatavisayatväd upapannam etat trividham karanam dväri dväräni sesäni ti / äha 5 : dvaridvärabhävänabhidhänam süträntarena tatsiddheh / "trayasya visayäkhyam" (SK33bJ) ity ukte gamyata [ity] etad antahkaranam dväri dväränlndriyäni <iti> / tasmät tadvacanam anarthakam iti /
1 D. dvaridväraniti, s.m. dväridväräni 2 All the Mss read dvärtni. 3 A11 the Mss read taträniyatäh. 4 All the Mss read pravartanta. 5

5

10

15

20

25

indriyäniti

D. adds äha ... °sämarthyam syät / kirn tarhi te(22l.24-222.16) by a different hand. This portion is found neither in K. nor in P.

222

YUKTIDIPIKA

5

10

ucyate: na hetvabhidhanat 1 / pratijnamatram tatra darsitam na tuktam ko hetur <iti> / iha tu hetvabhidhänam / ato na punaruktam etat / äha: dväränäm anekatväc chästravirodhaprasangah / yadi buddhyahamkäramanasäm sarvesäm dväritvam abhyupagamyate tena yac chästram "ekam eva darsanam khyätir eva darsanam" (cf.YBh.onYS.1.4) ity asya virodhah / kirn ca svätantrye ca sambandhänupapattih / trayänäm hi dväränäm svätantryam abhyupagamyate svätantrye ca parasparänapeksänäm sambandhänupapattih / kirn ca samuccayäbhävah / ekaikas ca svatantrah svärthamätram purusäyopaharatity abhyupagacchato nästi sarvagrahanavrttigrähakam ekam karanam / tatas ca dasänäm dasasv arthesu vrttayas trayodasänäm trayodasa iti samuccayäbhävah / purusasya tatsämarthyäd 2 adosa iti cen na akartrtvät / na hi purusah pratyayam karoti darsitavisayatvät / yatah samuccayam kuryät säksätkärini vä tasmin k<a>ranänarthakyam 3 / tasmäd ayuktam trividham karanam dväriti / / 3 5 / / ucyate: syäd etad evam yadi sarvesäm dvärinäm svätantryena purusärthopahärasämarthyam syät / kirn tarhi / [te4] ETE PRADIPAKALPÄH PARASPARAVILAKSANÄ GUNAVISESÄH / KRTSNAM PURUSASYÄRTHAM PRAKÄSYA BUDDHAU5 PRAYACCHANTI / / (SK36)

15

20

25

30

eta ity anena trayam abhisambadhnäti sroträdmäm anyatamam rnano 'harnkäras ca / pradipakalpä ity anena prakäsasämyam karanaparvana äcaste / yathä pradipah prakäsaka evam karanam api tadvyäpäre 'sati visayävirbhävänupapatteh / parasparavilaksanä ity anena vyastavrttim pürvoktäm (cf.SK28) äkarsati / tayä hy esäm vailaksanyam anumiyata älocanasamkalpäbhimänabhedät / gunavisesä ity anena sattvädinäm purusavijnänam 6 uddisya tadbhävena parinämam khyäpayati / krtsnam purusasyärtham iti visesävisesalaksanam käryam ähäryadhäryaprakäsyatayä yathäsambhavam prakäsya svavrttyanugunam krtvä visayatvam äpädyety arthah / buddhau prayacchanti buddhäv ädadhati / etad uktam bhavati: yadä sroträdinäm anyatamam karanam sabdädau visaye pravartate tadä taddvärenähamkäro mano vä tarn visayam svavyäpärenänubhüya buddhäv ädhatte tadvisayatäm äpädayatlty arthah / kadäcit tu buddhir eva bähyakaranasamkalpäbhimänän niscinoti visayam kadäcit 7 samkalpäbhimänän niscinoti visayam tävat kadäcit samkalpäbhimänagrhitam / sarvathä tv ayam sästrärthah / yena vä <...(?)>
l D. hetvanabhidhänät, s.m. hetvabhidhanat 2 D. purusasyätat$ämarthyäd(7), s.m. purusasya 3 D. käranänarthakyam. 4 After te D. writes and deletes pradipakalpah. 5 D. prakäsabuddhau 6 D. puruso vijnänam 7

tatsämarthyäd

D. repeats kadäcit samkalpäbhimänänän niscinoti visayam, and puts kadäcit samkalpäbhimänänän visayam tävat in parentheses, deleting the repeated portion.

AST AM AM AHNIKAM SK35,36,37

223

tena karanena visayam upättam buddhir adhyavasyati / tayä 1 cädhyavasäyarüpäpannayä cetanäsaktir anugrhyate / na karanäntarasya purusena sambandho 'sti / tatas ca dvärinäm bahutväd darsanavisesasvätantryasamuccayäntahkaranapurusakartrtvadosänäm aprasangah / / 3 6 / / äha: kah punar atra hetur 2 yena dväritvävisese saty ahamkäramanasl buddhau visayädhänam kuruto na punar anayoh säksät purusena sambandha iti / ucyate: SARVAM PRATY UPABHOGAM YASMÄT PURUSASYA SÄDHAYATI BUDDHIH / (SK37ab) ahamkäramanasor hi nästi niscayarüpatä samkalpäbhimänamätrarüpatvät / aniscitavisayayä ca karanavrttyä purusasya sambandho 'narthakah syät, svayam vä niscetur asya kartrtvam syät / tatas cämisraniscayakaranatväd 3 ayam apy ämisrarüpah syät / sarvam caitad uktottaram(cf.SK20) / niscayarüpä hi buddhih / atas tadvrttyupanipäti visayah sannidhänamäträt purusena samcetito näsyaudäsinyam 4 bädhitum utsahate no khalv apy änarthakyam anusajyate / etad uktam sarvam praty upabhogam yasmät purusasya sädhayati buddhir iti / äha: evam api sabdädilaksano visayah prakrtah sa ca buddhyä sarvah pratipädyate / tatra visayäntaram apy asti pradhänapurusäntaralaksanam / tathä cähuh "upabhogasya sabdädyupalabdhir ädih, gunapurusopalabdhir antah" <iti> / tasmät tatpratipattyartham karanäntaram vaktavyam iti / ucyate: na vaktavyam / kirn käranam / yasmät— SAIVA CA VISINASTI <YAT>AH5 PRADHÄNAPURUSÄNTARAM SÜKSMAM / / (SK37cd) yato yasmät käranät sä buddhir eva hi kästhäpannena tamasäbhibhütatväd dharmädinäm sattvadharmänäm prakrtibhütän vikärabhütän paratanträn upakäryänupakärakän acetanän samsargadharminas 6 ca gunän ätmatvenädhyavasya purusäyopaharati / sa ca mithyäjnänäbhyäsaväsanänuranjitam buddhipratyayam anurudhyamäno darsitavisayatvät tathaiva pratipädyate / yadä tu dharmädyabhyäsät tamorüpäpagame saty uttarottaränäm sattvadharmänäm utkarsas tadä vinivrttamithyäpratyayä vrttih / na prakrtivikärabhütah svatantro ?nupakäryo 'nupakärakas cetano 'samsargadharmä ca / tato viparitäs ca gunä iti suddhädhyavasäyam karoti / purusas ca paropahrtavrttitvät tathaiva pratipädyate / tad etad 7 gunänäm purusasya cäntaram dvayor api niscayasvabhävatväd asmät pürvoktadharmabhede 'pi sati süksmam gambhiram durjneyam /
1 D. tathä, s.m. tayä 2 P. punar ahetur 3 K. and P.: ° niscayakäranatväd 4 D. näsyaudausinyam P. näsyädausinyam 5 All the Mss read punah. 6 K. and P.: samsargidhar0 D. samsargidhar0, 7

5

10

15

20

25

30

35

s.m. samsargadhar0

D. tad ed, s.m. tad etad

224

YUKTIDIPIKA

5

atas ca suksmam yad buddhimatram avalambya tad avisist ay as cetanasakter grähyagrähakabhävavyavasthäbhede 1 'pi sati cetanasakter abhävo 'bhyupagatah / tathopalaksitasästrair apy anekakäläbhyaste gunätmabhävagrähaparivestitavikharaih pratyaksaniscitabhedäbhya<sta>mätrpitrdärabhojanädibhyo 2 'bhiläso na nivartate / tasmät pradhänapurusäntaram süksmam atarkagamyam / atyantavisuddher bhagavatah paramarser vi<jneyam>3 anyesäm ca sattväbhyäsopajanitavimalajnänanirastavidyänäm nänätvadharmabhäjäm iti / evam buddheh sar<v>apratyupabhogasädhanabhävät 4 sarvakaranebhyah pr<ä>dhänyam 5 siddham / / 3 7 / / [iti yuktidipikäyäm saptatipaddhatau saptamam ähnikam samäptam iti /] [sriganesäya namah 6 /] vyäkhyätam karanaparva / käryaparvedänim vaktavyam / tasya ca purastäd uddesah krtah a käryam ca tasya dasadhä" (SK32c) "panca visesä<visesäh>7" (SK34b?) iti / sämpratam tu nirdesam karisyämah / äha: yady evam tasmäd idam eva tävad 8 ucyatäm ke visesäh ke 'visesä iti / ucyate: TANMÄTRÄNY AVISESÄH / (SK38a) yäni tanmäträni pancähamkäräd 9 utpadyanta iti präg(SK25) apadistam 10 te khalv avisesäh / käni punas tanmäträniti / ucyate: sabdatanmätram sparsatanmätram rüpatanmätram rasatanmätram gandhatanmätram 11 iti / katham punas tanmäträniti / ucyate: tulyajätiyavisesänupapatteh / anye sabdajätyabhede 'pi sati visesä udättänudättasvaritänunäsikädayas(cf.Pän.l.2.29-31, 1.1.8) tatra 1 2 na santi / tasmäc chabdatanmätram / evam sparsatanmätre mrdukathinädayah / evam rüpatanmätre suklakrsnädayah / evam rasatanmätre madhurämlädayah / After grähyagrähaka K. and P. have a blank space and a blank folio. The portion from bhävavyavasthäbhede 'pi to ähnikam samäptam iti (224.2-10) is written only in the bottom margin of D. by a different hand. 2 D. °niscitabhedäbhya..mätrpitr0 3 D. vinäyo. 4 D. sargapratyupabhoga0 5 D. pradhänyam 6 P. om Sri ganesäya om Here B. starts. Reading om namo näräyaniya in the centre of the top line, it starts with <o> svasti prajäbhyahsrtganesäya om. (cf.Introduction, p.XIII,fn.l6; p.XVII,fn.29) 7 All the Mss read visesä. 8 D. eva tävad, s.m. etävad 9 B. pancatanmäträny ahamkäräd D. adds panca before tanmäträni, and deletes it. 10 D. apadistam, s.m. upadistam 11 B. gandhamätram 12 D. tatra, s.m. te 'tra
1

10

15

20

25

ASTAMAM AHNIKAM SK37,38

225

evam gandhatanmätre surabhyädayah / tasmät tasya tasya 1 gunasya sämänyam 2 evätra na visesa iti tanmäträny ete 'visesäh / äha: atha ke punar visesä iti / ucyate: yäni khalu— TEBHYO BHÜTÄNI PANCA PANCABHYAH /(SK38b) utpadyante / ETE SMRTÄ VISESÄH /(SK38c) tatra sabdatanmäträd äkäsam / sparsatanmäträd väyuh / rüpatanmäträt tejah / rasatanmäträd äpah / gandhatanmäträt prthivT / tebhyo bhütämty etävati vaktavye panca pancabhya iti grahanam samasamkhyäkatas 3 tadutpattijnäpanärtham / tenaikaikasmät tanmäträd ekaikasya visesasyotpattih siddhä / tatas ca yad anyesäm äcäryänäm abhipretam ekalaksanebhyas tanmätrebhyah parasparänupravesäd ekottarä visesäh4 srjyanta iti(cf.l87.11) tat pratisiddham bhavati / kirn tarhi / antarenäpi tanmätränupravesam ekottarebhyo bhütebhya ekottaränäm bhütavisesänämutpattih 5 / tatra sabdagunäc chabdatanmäträd äkäsam ekagunam / sabdasparsagunät 6 sparsatanmäträd dviguno väyuh / sabdasparsarüpagunäd rüpatanmäträt trigunam tejah / sabdasparsarüparasagunäd rasatanmäträc caturgunä äpah / sabdasparsarüparasagandhagunäd 7 gandhatanmäträt paficagunä prthivi / atra ca väyoh sitah sparsah, apäm ca / tejasa usnah / anusnäsitah prthivyäh / rüpam ca suklam bhäsvaram ca tejaso 8 ?päm ca / krsnam prthivyäh / raso madhuro 'päm, sädhäranah prthivyäh / gandhas tu pärthiva eva / tadavayavänupravesäd 9 bhütäntaresüpalabhyata ity ete prthivyädinäm dharmäh / anye ca parasparänugrähakäh / ke punas ta ity äha— äkäro gauravam rauksyam varanam sthairyam eva ca / sthitir bhedah ksamä 10 krsnacchäyä 11 sarvopabhogyatä 12 // (see TV. and YV. on YS.3.44) iti te
13

5

10

15

20

25

pärthiva dharmäs tadvisistäs tathäpare / (see TV. and YV. on YS.3.44)

jalägnipavanäkäsavyäpakäs 14 tän nibodhata / /
1 D. 2 D. 3 D. 4 D. 5 K. 6 D. 7 B. 8 B. 9 D. 10 B. 11 D. 12 K. 13

encircles tasya. gunasya sämänyam, s.m. gunasämänyam samkhyäkatas, s.m. sarnkhyätas ekottarävisesäh utpatteh, s.m. utpattih sabdasparsagunäc chabdatanmäträt, s.m. sabdasparsagunät °rasarüpa° jyotisah D. tejasah, s.m. jyotisah tadavayavänupravesäd, s.m. tadavayaväntaränupravesäd ksapä ksamäkrsnacchäyä, s.m. ksamärauksmyam cchäyä and P.: sarvopabhogyate D. ity ete P. ti iti te 4 D. °vyäpakäms

226

YUKTIDIPIKA snehah sauksmyam prabha sauklyam mardavam gauravam ca yat / saityam raksä pavitratvam santänas 1 caudakä gunäh / / (see TV. and YV. on YS.3.44) 2 ürdhva<gam> pävakam dagdhr päcakam laghu bhäsvaram / pradhvamsy ojasvitä jyotih pürväbhyäm <sa>vilaksanam3 / / tiryakpätah pavitratvam äksepo nodanam balam / rauksyam acchäyatä saityam väyor dharmäh prthagvidhäh / / (see TV. and YV. on YS.3.44) sarvatogatir avyüho 'viskambhas ceti te trayah / äkäsadharmä 4 vijfieyäh pürvadharmavirodhinah / / (see TV. and YV. on YS.3.44, NS.4.2.22) samhatänäm tu yat käryam sämänyam te gavädayah / itaretaradharmebhyo visesän nätra samsayah / / (see TV. and YV. on YS.3.44)

5

10

15

20

25

30

taträkärädibhir dharmaih prthivyä lokasya copa<kärah> kriyate 5 bhütäntaränäm ca / taträkärät tävat gavädinäm ghatädmäm cäkäranirvrttih 6 / gauraväd esäm avasthänam / rauksyäd apäm sangraho vaisadyam ca bhütänäm / varanäd anabhipretänäm chädanam / sthairyäd vrttih prajänäm bhütäntaränäm ca / sthiter mäträdisannidhänädyanugrahah / bhedäd ghatädinispattir vyühas cävayavänäm / ksänter upabhogayogyatä 7 / krsnacchäyatväd rätrisampac chäyäkäryaprasiddhis ca / sarvopabhogyatvät sarvabhütänugrahah / evam snehädibhir 8 lokasyopakärah kriyate bhütäntaränäm ca / snehäd rüpasampad väyupratikäro 'gni<s>amanam9 samgrahas ca prthivyäh / sauksmyäd anupravesah / sauklyäc candrädinirvrttih / märdavät snänävagähanam 10 ekakriyä kathinänäm cävanämanam / gauravät santänäc ca bhütänugrahärtham srotastvam / saityäd usnapratikärah / raksätah prajäsu ghorasamanam / pavitratväd dharmopacayah saucavidhir alaksmyupaghätas 11 ca / santänäd dravyasahghätah / tathordhvagatyädibhir dharmamätrais tejasä 12 lokasya copa<kärah> kriya13 te bhütäntaränäm ca / ürdhvagateh päkaprakäsasiddhih 14 / pävakatväd dra1 B. «a santänas 2 All the Mss read ürdhvabhäk. We follow Pandeya. 3 All the Mss read suvilaksanam. We follow Chakravarti. 4 B. äkäradharmä 5 All the Mss read copakriyate. 6 K. and D.: °nivrttih 7 D. upabhogayogyatä, s.m. upabhojyatä 8 D. snehädibhir, s.m. snehädir adbhih 9 A11 the Mss read 'gnigamanam. We follow Chakravarti. 10 D. snänävagähanam, s.m. pänävagähanam 11 K. P. and B.: alaksyopaghätas D. alaksyopaghätas, 12 K. and P.: tejasäm D. tejasäm, s.m. tejasah 13 All the Mss read copakriyate. 14

s.m. alaksmyupaghätas

B. päkapratikärasiddhih D. päkaprakäsasiddhih, s.m. päkapratikärasiddhih

ASTAMAM AHNIKAM SK38,39

227

vyasaucam ca / dähakatvät ksärotpattih sitapratikäro nabhasas cosnatvam sabdanispattyartham / päcakatvät svedyasvedanam1 annapaktih 2 prthivyavayavänäm ca 3 kriyäyogyatä tathä bähyäntaraparinämo rasalohitamämsasnäyvasthimajjäsukränäm / läghaväd dähyätikramah / bhäsvaratväd dravyäntaraprakäsanam / pradhvamsitväd dagdhapakvänäm upabhogah / ojasah 4 prajäpälanam / tathä tiryakpätädibhir dharmair väyunä lokasya copakärah kriyate bhütäntaränäm ca / tiryakpätäd drstiviksepo gandhasamvahanam 5 ca / pavitratvät pütidravyapavanam / äksepanodanäbhyäm 6 utkarsah prathanam <gha>rmämbhasah 7 vyühas ca sarire rasädinäm dhätünäm ca, agnes copadhmänam abhighätas cäkäsasya / balät samiranam sarvesäm / rauksyäd visosanam 8 / acchäyatväd 9 ahorätraprasiddhih / saityäd usnapratikärah / tathä sarvatogatyädibhir dharmair nabhasä lokasyopakärah kriyate bhütäntaränäm ca / sarvatogateh 10 samantät tulyadesasravanänäm ekasrutitvam / avyüh<ä>viskambhäbhyäm 11 sarvesäm avakäsatädänam ity uktäh prthivyädayah / ete visesä ity ucyanta iti / äha: katham punar ete visesä iti / ucya<t>e12: yasmät— SANTA GHORÄS CA MÜDHÄS CA //(SK38d) tatra säntäs tävat svasamskäravisesayogät tatsannidhau pr<a>sädädidharmotpatteh 1 3 / ghoräs tu <bhi>sädidharmanimittatvät 14 / müdhäs ca varanädidharmahetutvät / tanmäträni punar asäntaghoramüdhäni / ato Visesä ity ucyante 15 / tad ete yathä vyäkhyätä avisesä visesäh purusärthasiddhyartham bahudhä vyavatisthante / kasmät / na hy etesäm ekadhävasthäne purusärthah siddhyatiti / / 3 8 / / ' aha: atisamanyoktam idam ity ato na pratipadyamahe / tasmad vaktavyam katham 16 visesänäm avasthänam iti /
1 K. and P.: vedyasvedanam D. vedyasvedanam, s.m. svedyasvedanam 2 D. annapanktih, s.m. annapaktih 3 K. and P. omit ca. D. adds ca. 4 K. and P.: taijasah D. taijasah, s.m. ojasah 5 D. gandhasamvahanam, s.m. gandhasamvahanam 6 P. °pavanasäksepano0 7 K., P. and B.: dharmämbhasah D. dharmä0, s.m. varsä0 We follow Chakravarti. 8 K. and P.: visesanam D. visesanam, s.m. visosanam 9 D. acchäyatväd, s.m. ucchäyatväd 10 D. sarvato gateh n K. and P.: avyühaviskambhäbhyäm D. avyühaviskam0, s.m. vyühaviskam0 12 All the Mss read ucyante. 0 13 All the Mss read präsädädi . We follow Chakravarti. 14 All the Mss read sesädidharma0. 15 B. ity abhidhiyante 16

5

10

15

20

25

D. katham, s.m. katidhä

228 ucyate:

YUKTIDIPIKA

SÜKSMÄ MÄTÄPITRJÄH SAHA PRABHÜTAIS TRIDHÄ VISESÄH SYUH / (SK39ab) 5 tatra süksmä näma cestäsritam 1 pränästakam 2 samsarati 3 / mätäpitrjäs* tu dvividhäh / jaräyujä andajäs ca / tesäm kosopahrtäh / kosä lomarudhiramämsästhisnäyusukralaksanäh / tatra lomarudhiramämsänäm mätrtah sambhavah / asthisnäyusukränäm pitrtah / tatraiväsitapitädhyäsäd 5 astau kosän apare vyäcaksate / katham punar esäm kosatvam / ävestanasämarthyät / yathä kosakärah kosenävestito 'svatantra evam süksmasariram sapränam etair ävestitam asvatantram tat tat 6 karmopacinoti / prabhütäs7 tüdbhijjäh svedajäs ca / tad etais trividhair visesair daivamänavatairyagyonalaksanas trividho bhütasarga ärabhyate / tatra devänäm caturvidham sariram pradhänänugrahäd yathä paramarser virincasya ca 8 , tatsiddhibhyo yathä brahmanah putränäm tatputraputränäm ca, mätäpitrto yathäditeh 9 kasyapasya ca putränäm kevaläd vä yathä pitrto miträvarunäbhyäm vasisthasya / manusyänäm 10 tu jaräyujam / dharmasaktivisesät tu kasyacid anyathäpi bhavati yathä dronakrpakrpidhrstadyumnädinäm / tiryagyoninäm 11 api caturvidham— jaräyujam gavädinäm andajam caiva paksinäm / trnädes codbhijjam ksudrajantünäm svedajam smrtam / / 20 evam trividhä visesä vyäkhyätäh / tatra kecin niyatäh kecid aniyatä iti / äha: ke punar atra niyatäh ke väniyatä iti / ucyate: SÜKSMÄS TESÄM NIYATÄ MÄTÄPITRJÄ NIVARTANTE //(SK39cd) 25 süksmää sargapralayän nityäh / mätäpitrjä nivartante / saha prabhütair iti vartäte 1 2 / kecit tu prabhütagrahanena bähyänäm eva visesänäm grahanam icchanti / tesäm udbhijjasvedajayor 13 agrahanam / tasmäd ubhayathä prabhütä ity etad anavadyam /
1 2 D. s.m. pränästakam 3 D. samsarati, s.m. samharati 4 K., P. and 0 mätrpitrjäs B.: 5 B. atraivä D. tatraiväsitapitä0, 6 P. tut 7

10

15

D. corrects cestastakam(?) into cestasrikam, which is again corrected into cestarthesu asritam.

s.m. tatraiväsitapttä0

8 D. virancasya, s.m. virancasya ca 9 P. repeats yathä brahmanah putränäm tatputraputränäm 10 B. manusyänäm K. manusyänäm, s.m. manusyänäm 11 B. tairyagyoninäm 12 D. vartante 13

B. daivasämänusatairyagyonilaksanas D. pravamänavatairyagyeno laksanas, s.m. prabhü tüdbhijjäh svedajäs ca tad etais tridhair visesair daivamänavatairyagyonalaksanas in the place of yathäditeh

B. udbhijasvedajayor

ASTAMAM ÄHNIKAM SK39

229

äha: süksmänabhidhänam 1 aprasiddhatvät / mätäpitrjäs ca prabhütäs ca2 prasiddhä ity ato yukta esäm parigrahah / süksmäs tv aprasiddhäh 3 / tasmäd vaktavyam katham esäm utpattir astitvam veti / ucyate: <...(?)> pürvasarge prakrter utpannänäm präninäm sattvadharmotkarsäd antarena dvayasamäpattim manasaiväpatyam anyad vä yathepsitarn prädurbabhüva / tad etad adyäpi cänuvartate 4 yat kacchapikä nirüpitenändadhäranam 5 karoti / priyam khalv api caksusä ninksya krtärtham ätmänam manyate 6 / tasyäm api ksinäyäm väksiddhir 7 babhüva / abhibhäsya 8 pränino yad icchanti tadäpädayanti / tad adyäpy anuvartate yac chahkhl vitatenäpatyam 9 bibharti / priyam khalv api sambhäsya mahatim prltim anubhavati 1 0 / tasyäm upakslnäyäm hastasiddhir babhüva / samsprsya pänim Tpsitam artham upapädayanti / tad etad adyäpy anuvartate yat priyam ciräd älokya pänau samsprsya pritir bhavati 1 1 / tasyäm 12 upakslnäyäm äslesasiddhir 13 babhüva / älinganena 14 pränina Ipsitam labhante / tad etad adyäpy anuvartate yat priyam älihgya nirvrtir 15 bhavati / tasyäm upakslnäyäm dvandvasiddhir ärabdhä / stripumsau sahghrsyäpatyam utpädayetäm 16 mamedam mamedam iti ca parigrahah pravrttäh / etasminn evävasare 17 samsäro varnyate / tatra cäcäryänäm vipratipattih / paiicädhikaranasya tävad vaivartam sariram mätäpitrsamsargakäle karanävistam 18 sukrasonitam anupravisati / tadanupravesäc 19 ca kalalädibhävena vivardhate / vyüdhävayavam 20 tüpalabdhapratyayam mätur udarän nihsrtya yau dharmädharmau satsiddhyupabhogakäle krtau tadvasäd avatisthate yävat tatksayäc charirapätah / tatra 2 1 yadi dharmasamskrtam karanam tato dyudesam 22 süksmasarirena präpyate tadviparyayät tu yätanästhänam tiryagyonim vä misrlbhävena mänusyam / evam ätivähikam süksmasanram indriyänäm dhäranapräpanasamartham nityam bähyenäpäyinä parivestyate parityajyate ca /
1 K., P. and B.: süksmabhidhänam D. suksmabhidhanam, s.m. süksmänabhidhänam 2 D. adds prabhütäs ca in the right margin. 3 D. apratisiddhäh 4 B. apy anuvartate 5 B. kacchapikä niriksitenä0 D. kacchapikänirüpitenä0, s.m. kacchapikä niriksitenä0 6 B. manyante 7 D. vävaksiddhir(?), s.m. väksiddhir 8 D. abhibhäsya, s.m. abhilusya 9 K. and B.: vikrtenä0 D. vikrtenä0, s.m. vitatenä0 10 D. mahatim pritim anubhavati, s.m. mahati pritir bhavati 1X

5

10

15

20

25

D. bhavati, s.m. bhavatiti After bhavati D. repeats and deletes asyäm upaksinäyäm hastasiddhir babhüva ... pänau samsprsya pritir bhavati. 12 K., P. and B.: asyäm D. asyäm, s.m. tasyäm 13 D. äslesasiddhir, s.m. evesabuddhir 14 D. aliriganena 5 D. nirvrtir, s.m. nirvrto D. utpäyetäm, s.m. utpädayeta 17 B. avasare D. karanävistam, s.m. karanänupravistam 19 D. tadanupravesäc ca, s.m. tadävesas ca 20 D. °vayavam, s.m. °vayavä 21 K. and P.: tava D. tava, s.m. tatra D. tato dyudesam, s.m. tato 'nyadesam

230

YUKTIDIPIKA

5

p<a>taiijales1 tu suksmasariram <satsiddhiksaye(?)>2 purvam indriyani bijadesam nayati tatra tatkrtäsayavasäd dyudesam yätanästhänam vä karanäni [vä] präpayya nivartate / tatra caiva yuktäsayasya karmavasäd anyad utpadyate yad indriyäni bij adesam nayati tad api nivartate / sarirapäte cänyad utpadyate / evam anekäni sariräni / vindhyaväsinas tu vibhutväd indriyänäm bijadese vrttyä janma tattyägo maranam / tasmän nästi süksmasarIram(cf.SV.ätmaväda62) / tasmän nirvisesah samsära iti paksah / esä süksmasarirotpattih 3 / / 3 9 / / äha: evam anekaniscayesv äcäryesu bhavatah kä pratipattir iti / ucyate: yat tävat patanjalir äha "süksmasariram vinivartate punas cänyad utpadyate" tat "süksmäs tesäm niyatäh" (SK39c) iti vacanäd asmäbhir näbhyupagamyate / tasmät— PÜRVOTPANNAM ASAKTAM NIYATAM MAHADÄDI SÜKSMAPARYANTAM / SAMSARATI NIRUPABHOGAM BHÄVAIR ADHIVÄSITAM LINGAM //(SK40)

10

15

20

25

30

tatra pürvotpannam ity anena mahadädeh süksmaparyantasya lingasyä 4 sargapralayän nityatvam äha / asaktam ity anena güdhasthirabijänupravesam äcaste / na hi lihgam kvacid vyähanyate / kirn tarhi / liksädibljam apy ävisati, badaragolam 5 api bhittvä pravisati / niyatam ity anena pratipurusavyavasthäm 6 pratijänäti / sädhärano hi mahän prakrtitväd iti värsaganänäm paksah / mahadädity anena pränästakam parigrhnäti <pür vän manah> 7 pränädyäs ca panca väyava iti / süksmaparyantam iti tattväntarapratisedham 8 ähaitävad eva näto 'nyad iti / samsaratiti gatim äcaste / tatas cävibhutväd bijävesatyägau pra<ty>äkhyätau9 bhavatah / nirupabhogam iti sariräntarasyävakäsam karoti / süksmasarirasya hy upabhogasämarthye 'bhyupagamyamäne sariräntarasya niravakäsatväd anutpattiprasangah syät / bhävair adhiväsitam ity anena bhävästakaparigraham dyotayati / buddhirüpair iha dharmädibhir adhiväsitam / tatsämarthyät sarvaträpratihatam pränästakam süksmasarire Vasthänagamanamätraphale vyavasthitam / dyutiryakpretesu samsaratiti tenaiva cärthasiddhau sariräntaraparikalpanänarthakyam / ato na bahüni sariräni / / 4 0 / / yat punar etad uktam(187.12, 230.6) vibhutväd indriyänäm svätmany avasthä<ne>10 vrttiläbho vrttinirodhas ca samsära ity ayuktam etat / kas1 A\\ the Mss read pätanjales. We follow Pandeya. 2 All the Mss read yatsiddhikäle. 3 K., P. and B.: süksmasarirasyotpattih (this is also 4 D. lingasyä, s.m. lingasya 5 D. badaragalomam, s.m. badaragolakam 6 D. pratipurusasya vyavasthäm 7 All the Mss read pürvätmänah. 8 D. tattväntaram pratisedham 9 All the Mss read prakhydtau. 10

possibly the original reading).

All the Mss read avasthänam.

ASTAMAM AHNIKAM SK39,40,41

23J.

mat / vibhutväsiddheh / na hi vibhutvam indriyänäm kascid abhyupagacchati / kirn käranam / sat at opalab dhiprasangät yugapadupalabdhiprasangäc ca / <karanänäm>1 hi vibhutve satatopalabdhiprasango visayänäm pratibandhäbhävät / [prasajyeta] präptyavisesäc ca sarvavisesänäm yugapadupalabdhiprasangah, vyavahitavisayagrahanam ca / sarvatra sannidhänät sannikrstaviprakrstayoh pratyaksänumänägamänäm cävisesah prasajyeta 2 / vrttivisesät tadvisesa iti cen na hetvabhävät / vibhünäm ihästi vrttivisesa ity atra hetur anuktah / tasmän na karanänäm 3 vibhutvam upapadyate / tasmät— CITRAM YATHÄSRAYAM RTE STHÄNVÄDIBHYO VINÄ YATHÄ CHÄYÄ4 / TADVAD VINÄ VISESAIR NA TISTHATI NIRÄSRAYAM LINGAM //(SK41) yathä hi citrasya, kudyam rte 'vasthänam nästi sthäiiupurusädibhyo vä vinä chäyäyäh / tadvad vinä visesair na tisthati niräsrayam Ungarn / tasmäd upapannam etat savisesah samsärah <iti> / äha: yadi savisesah samsäro bijadesagamane sariram upalabheta / na tv evam / tasmäd ayuktam etad iti 5 / ucyate: na visesitatvät / süksmam tac chariram iti 6 visesitam / tato näsyähetukam agrahanam iti / äha: süksmasanrayogät <sa>rvesvaratvaprasahgah7 / tasmäd ayuktam tannimittam asyägrahanam iti / ucyate: na anekäntät / tadyathä ksudrajantünäm süksmasariram laghimä [ca] / na caisäm Isvaratvam evam sarvapräninäm syät / <...> atha matam / agrhyamänena sambandhät sthülasyäpi sarirasyagrahanam pretänjanasiddhamälyädivat <iti> / tad apy anupapannam anekäntät / tadyathä karanair agrhyamänaih sarirasya sambandhah, na cägrahanam, pisäcädibhir vä tathaitad api syät / kirn ca antahkaranänuvidhäne caisvaryäbhimänät / yasya cadhyavasäyam anuvidadhaty animädini tasyaisvaryam abhipretam / na tu yasya svabhävasiddhäni / anyathä tu pipHikädinäm8 apy äkäsagamanäd aisvaryam syät / äha: na sarlränupapattiprasangät / süksmasarirotpattau tarhi caritärthayoh <dharmädharmayoh> sariräntarasämarthyam virudhyate / tasmäd ayuktam savisesah samsärah <iti> / ucyate: na anabhyupagamät / na dharmädharmanimittam vaivartam sariram / kirn tarhi / ädhikärikam ity adosah / na cänekasariratvam abhyupagamyate / tasmät paksäntaropälambho 7 y a m / kirn ca krtsnäsayaparinämäpratijnänät / krtsnasyäsayasya parinämam <pratixjänann9 evam upälabhyah syät / ekadesas tu no viparinämi / tasmän na kimcid
2 P. 3

5

10

15

20

25

30

35

K., P. and B.: käryakaranapurusanam D. s.m. käryakaranapurusanarn andB.: °yate D. tasminn akaranänäm, s.m. tasmän na karanänäm D. yathächäyä, s.m. yathä chäyä 5 K., P. and D. omit iti. 6 After iti D. repeats viSesitatvät süksmam tacchariram iti. 7 A11 the Mss read pürvesvaratva0. 8 B. pipilakädinäm 9 All the Mss read jänann.

232

YUKTIDIPIKA

5

10

15

etat / nimittav<i>sesad 1 asayaikadesabhivyaktir ayukteti cet / syan matam / iha nimittänäm alpabahutvavisesäd äsayäbhivyaktiviseso drstas tadyathä väyvädikrodhädisu / präyanakälas cäyam phaläbhivyaktau nimittam / avisistas cäsau / tasmäd äsayaikadesaparinämo 'nupapanna iti / etac cäyuktam / kasmät / naimittikatvät / pürvakrtasya karmanah phalabhogaparisamäptih sämpratasya ca phalopabhogärtham viparinämah präyanasya nimittam, na tu präyano 2 viparinämasyeti 3 / kirn ca sariräntaräbhävas ca / krtsnasyäsayasyäsyäbhivyaktim icchatah sariräntaräbhävo nimittäntaräbhävät 4 präpnoti / tatra krteneti cen na kalalädyavasthänäse 5 tadasambhavät / tatra krtäbhyäm <dharmädharmäbhyäm> hi bijävesah karanasya nispädito yävat kalalädyavasthäyam eva / taccharlram vinastam iti tatra krtäsayäsambhaväc chariräntaränupapattiprasangah / kirn ca sthävaränäm ca sarlräntaräsambhavah / äsayasya sthävarasarirärambhe caritärthatvät sthävarasarirena cäsayopädänäsambhavät tasya samsäräbhävah präptah / tasmäd upapannam etat purusärtham ädisargotpannam süksmasariram samsarati yävac ca sa purusärtho na parisamäpyate tävat tisthata iti / / 4 1 / / äha: yadi purusärthä lingasyotpattir abhyupagamyate tatsamanantaram evänena purusärtho Vasäyayitavyah 6 , na punar devamänusatiryagbhävena punah punar äjavanjavibhävo(cf.MV.25.9) 'nusthätavya iti / ucyate: PURUSÄRTHAHETUKAM7 IDAM NIMITTANAIMITTIKAPRASANGENA / PRAKRTER VIBHUTVAYOGÄN NATAVAD VYAVATISTHATE LINGAM //(SK42) yady api purusärthasiddhyartham lingam utpadyate tathäpi sattvarajastamasäm trayänäm api <sämyäd>8 rajastamobhyäm abhibhüte sattve tatpreritanimittanaimittikasanrendriyavisayopabhoganirvartakam 9 srnoti, tadyathä "agnihotram juhuyät svargakämah" a y a m a r ä j y a m agnistomenäbhijayati" iti / tatra phalepsayä 10 yonih pränädims ca sammukhikrtya kriyäm ärabhate / gunavrtt<i>vaicitryäc11 ca prayatnavän api manovägdehair malinam api karma karoti / tatas ca prakrter vibhutvayogät tena tena nimittenopasthäpitam devamanusyatiryakpretädisarlram 12 ekasvabhävam api san natavad vyavatisthate Ungarn äkrtivisesopädänatyägasämyatah / vibhutvam gunänäm trayänäm api sämyäd itaretaräbhibhavo drstah 1 3 / tasmäd bhävanimittah samsärah /
1 2 B. präyeno 3 P. viparinämasyeyana...(not clear) 4 B. nimittäbhävät 5 B. ° avasthävinäse 6 B. 'vasäyitavyo 7 D. purusärthe hetukam B. purusärthakahetukam 8 All the Mss read prädhänyäd. 9 D. ° nivartakam 10 K., P. and B.:'phalecchayä 11 All the Mss read gunavrttavaicitryäc. 12 B. devamänusatiryak0 (this is also possibly the original 13

20

25

30

A\\ the Mss read nimittävasesäd. We follow Raghavan.

reading).

B. 'bhipretah

ASTAMAM AHNIKAM SK41,42,43 tannimittänupädänän moksah / / 4 2 / /

233

äha: bhävä iti tatrabhavatäbhidhiyate / na cäsya sabdasyärtham pratipadyämahe / tasmäd vaktavyam idam ke punar ami bhävä iti / ucyate: dharmädyä bhäväh / dharmo jnänam vairägyam aisvaryam adharmo 'jnänam avairägyam anaisvaryam ity ete bhäväh / taträcäryänäm vipratipattih / pancädhikaranasya tävad dvividham jnänam präkrtikam vaikrtikam ca / präkrtikam trividham tattvasamakälam sämsiddhikam äbhisyandikam ca / tatra tattvasamakälam samhatas ca mahärns tattvätmanä mahati ca 1 pratyayo bhavati / utpannakäryakaranasya 2 tu sämsiddhikam äbhisyandikam ca bhavati / sämsiddhikam yat samhatavyühasamakälam nispadyate yathä paramarser jnänam / äbhisyandikam ca 3 samsiddhakäryakaranasya käranäntarenotpadyate / vaikrtam tu dvividham / svavaikrtam paravaikrtam ca / svavaikrtam tärakam / paravaikrtam siddhyantaräni / äha ca— tattvasamam vaivartam taträbhisyandikam dvitiyam syät / vaikrtam atas trtiyam sätk<au>sikam4 etad äkhyätam / / atra tu tattvaih sahotpattyavisesät sämsiddhikam abhedenäha— vaikrtam api ca dvividham svavaikrtam tatra tärakam bhavati / syät saptavidham paravaikrtam <su>tärädi5 nirdistam / / iti / yathä jnänam evam dharmädayo 'piti / vindhyaväsinas tu nästi tattvasamam sämsiddhikam ca / kirn tarhi / siddh<a>rüpam6 eva / tatra paramarser api sargasamghätavyühottarakälam eva jnänam nispadyate yasmäd gurumukhäbhipratipatteh pratipatsyata ity <etad apy>7 äha "siddham nimittam naimittakasyänugraham kurute näpürvam utpädayati" iti(cf.YBh.onYS.4.12) / nimittanaimittikabhäväc caivam upapadyate / tatra paramarseh patur üho 'nyesäm klista ity ayam visesah / sarvesäm eva tu tärakädyavisistam / äcärya äha "trividhä bhäväh sämsiddhikäh präkrtikä vaikrtikäs 8 ca" (cf.SK 43ab) iti / tatra sämsiddhikagrahanät tattvasamakälam pratyäcaste naiva tad astiti / katham / yadi hi tathä syät tattväntaränutpatti<h> / sanghäto 9 vyühas cänarthakah syät / mahaty ütpannam jnänam tatraivopalabdham iti kah sanghätärthah / tathä carser 10 üho nopapadyate / pratibandhäbhävät / na and D. omit ca. K. adds ca above the line. K., P. and D.: utpannakäryakaranasya B. omits ca. K., P. and D.: sätkosikam B. satkosikam. We follow Chakravarti. 5 All the Mss read svatärädi. 6 All the Mss read siddhirüpam. 7 All the Mss read apity. 8 B. omits vaikrtikäs. 9 All the Mss read ° änutpattisamghäto. We follow Raghavan. 10r\ u. cersa, s.m. carser
J P. 2

5

10

15

20

25

30

234

YUKTIDIPIKA

5

10

15

hy asya karyakaranavyuhasamakalajnanotpattau 1 kascit pratibandho 'sti / aparivrtakhalatväd 2 yatah käläntaram pratikseta 3 / tasmäd asya 4 sahaiva käryakaranäbhyäm 5 jiiänam abhinispadyate pradlpaprakäsavat / ity at ah sämsiddhikam / anyesäm tu sattvasyäpatutvät käläntarena prakrtyabhisyandäd <yad> dräg iti bhavati krsnasarpadarsanavat tat präkrtam / vaikrtam 6 tu dvividham pürvavat / yathä ca paramarser jiiänam sämsiddhikam evam mähätmyasarlrasyaisvaryam bhrgvädinäm dharmah sanakädmäm vairägyam, adharmo yaksaraksahprabhrtmäm, anaisvaryam satsiddhiksayakälotpannänäm mänusänäm tirascäm ca, rägo 'jnänam <ca> paramarsivarjyänäm 7 / präkrtäs tu tadyathä vairägyam bhagavadäsureh / tasya hi paramarsisambhävanäd 8 utpanno dharmo 'suddhim pratidvandvibhäväd apaja<ghäna>9 / tasyäm apahatäyäm prakrteh 10 suddhisrotah pravrttam yenänugrhito duhkhatrayäbhighätäd utpannajijiiäsah pravrajitah / tathä mahesvarasamparkän nandina aisvaryam, nahusasyägastyasamparkäd dharma ityädi / vaikrtäs tu bhävä asmadädinäm / evam trividhabhävaparigrahät tv äcäryasya na sarvam svatah patanjalivat 11 , na sarvam paratah pancädhikaranavat / kirn tarhi / mahati svabhävätivrttih prakrtito 'lpä svato vikrtitah / evam— SÄMSIDDHIKÄS CA BHÄVÄH PRÄKRTIKÄ VAIKRTÄS CA DHARMÄDYÄH12 / DRSTÄH KARANÄSRAYINAH /(SK43abc)

20

yathä caite tathä— KÄRYÄSRAYINAS CA KALALÄDYÄH //(SK43d) trividhaiveti / taialädigrahanena sariräny äha / tesäm äkrtivaisvarüpyam caturdasavidhe samsäre trividham / tatra sämsiddhikas tävat vaivartänäm grahanaksatratärädlnäm 13 / jätikrtas ca visesah <yathä(?)> hamsänäm sauklyarn tittirimayürädinäm 14 citracchadatvam iti / präkrtam yathä mähätmy<a>sarlräbhi<dhy>änät15 tasya hy abhi<dhy>äno16 bhavati "hantäham puträn <sra>ksye17 ye me karma karisyanti ye mäm param <cäparam> ca jiiäsyanti (cf.239.13) / sa yädrk sargam abhidhyäyati tädrk pradhänäd utpadyate tadyathä mahesvarasya rudrakotisrstau" iti / vaikrtäs tu kalalädyä yathä bhisagvede
2 D. aparivrtakhalutväd 3 K. and P.: pratiksate 4 D. tasmät sahaiväsya, s.m. tasmäd asya 5 B. käryakaranäbhyäm 6 D. vaikrti, s.m. vaikrtam 7 D. °varyäna(r!)1 s.m. °varjyänäm 8 B. °sambhäsanäd 9 All the Mss read apajagäma. 10 D. prakrte J1 B. patanjalivat 12 B. reads sämsiddhikäh präkrtikä vaikrtikäs ca bhävä, 13 B. ° täräprabhrtinäm 14 D. titirimayürädinäm 15 All the Mss read mähätmyam sanräbhimänät 16 All the Mss read abhimäno. 17

25

^ . . P . a n d D . : °kärana°

omitting dharmädyäh. .

All the Mss read draksye. We follow Chakravarti.

ASTAMAM AHNIKAM SK43,44

235

'bhihitam "kslram pitvä garbhini gauram putram janayati" (cf.Brh.U.6.4.14) iti / ete bhävä vyäkhyätäh / esäm vaisvarüpyäl lingasya gativisesah samsäro bhavatiti 1 / / 4 3 / / äha: kasya punar bhävasyänusthänät ko gamanaviseso lingasya nispadyata iti / ucyate: DHARMENA GAMANAM ÜRDHVAM /(SK44a) ukto dharmah / tadanusthänäd astavikalpäyäm devabhümäv utpattir bhavati / GAMANAM ADHASTÄD BHAVATY ADHARMENA /(SK44b) adharmo 'py uktah / tadanusthänät pancavikalpäyäm2 tiryagbhümäv utpattir bhavati / äha: ekabhümivisesanupapattih gativisesät / yadi bhävänäm bhümivisesanimittatvam niyamyate tenaikasyäm bhümau hmamadhyamotkrstatvam jätyäkrtisvabhävänugrahopaghätänämna präpnoti / ucyate: na tarhy anena bhümiviseso niyamyate / kirn tarhi / ürdhvasabda utkrstavacanah / dharmena devesu mänusesu 3 tiryaksu cordhvagamanam 4 utkrstam janma bhavati / tathädharmäd adhogamanam apakrstam janma bhavatiti 5 / JNÄNENA CÄPAVARGAH /(SK44c) casabdo 6 'vadhäranärthah / jüänenaiväpavargah na bhäväntareneti / yad uktam anyair äcäryäih "väirägyät purusakaivalyamjnänavairägyäbhyämca" iti tatpratisiddham bhavati / äha: yadi punar väirägyät purusakaivalyam abhyupagamyate 7 ka evam sati dosah syäd iti 8 / ucyate: na sakyam evam pratipattum / kasmät / samsäranimittäpratipaksatvät / yadi rägädinimittah pradhänapurusasamyogah 9 syät präptam idam tatpratipaksena vairägyena viyogo bhavisyatiti / na tv evam / kutah / samyogakrte käryakaranasarge sati nispatteh 1 0 / käryakaranavyühottarakälam hi rägo 11 bhavati / tasmän näsau käryakarananispatter nimittam iti sakyam äsrayitum / yasya tu jfiänän moksa iti paksas tasya pratipaksäd ajnänäd
X D. omits iti. 2 D. pancavikaläyäm, s.m. pancavikalpäyäm 3 D. mänusyesu P. mänavesu (this is also possibly the original reading). 4 B. cotkrstagamanam D. ca ürdhvagamanam, s.m. ca utkrstagamanam 5 P. omits iti. 6 8

5

10

15

20

25

30

D. ca sabdo D. °upagamyate, s.m. °upagamyeta K., P. and D. omit iti. P. °puru$am samyogah 10 D. puts nispatteh in parentheses. D. ägamo, s.m. rägo

236

YUKTIDIPIKA

bandha 1 iti praptam asti / <sa>2 casau prag api karyakarananispatteh / tasman na vairägyän moksah / ata eva na 3 jnänavairägyäbhyäm mokso 'sty ubhayanimittasambhavät / tasmät süktam jnänenaiväpavargah <iti(?)> / VIPARYAYÄD ISYATE BANDHAH //(SK44d) 5 jfiänaviparyayo 'jfiänam, tasmäd bandhasA trividho bhavati / prakrtibandho daksinäbandho vaikärikabandhas ceti / / 4 4 / / äha: kasmäd bhävät prakrtibandho bhavati <iti> / ucyate: VAIRÄGYÄT PRAKRTILAYAH /(SK45a) 10 vairägyäd astasu 5 prakrtisu layam gacchati / asäv ucyate prakrtibandha iti / äha: yadi vairägyät prakrtilayah <syät> präpt<am idam>6 prakrtau vairägyam änjasam anyä prakrtis trigunä käranabhütä käryabhütä käryakäranabhütäkäryakäranabhütäcetanä paratanträ ceti / anyah puruso nirguno na käryam na käranam na käryakäranam tadviparitas 7 cetanah 8 svatantras ceti tato 'pi prakrtilayah 9 , tatas cänirmoksaprasahga iti 1 0 / ucyate: viparyayäd iti vartate / tad ihäbhisambhantsyämah / tatas ca viparltam yad eva vairägyam tustikändänupatitam prakrtyädisu paratväbhimänah / tata eva prakrtilayo bhavati nänyasmät / athaväträpi yat tat prakrtäv anyatvajnänam tata eva mokso na vairägyät / kutah / bhavabljäpratipaksatväd iti hy 1 1 uktam ämbhasikasya ca moksaprasangät / tulyä hy asya nänätvasamvid 12 ä sangadosanivrtteh 13 / na caitad istam / tasmäd yuktam etad vairägyät prakrtilaya iti / äha 14 : atha daksinäbandhah kutah / ucyate: SAMSÄRO BHAVATI RÄJASÄD RÄGÄT /(SK45b) yo 'yam drstänusravikavisayäbhiläsah sa rägah / tatra drstavisayarägät 15 tatpräptinirvartakam 16 karma karoti tatas ca tatropapadyate / änusravika1 D. bandha, s.m. dharmah 2 All the Mss read na. 3 D. encircles na. 4 D. tasmät tri bandhas(l), s.m. tasmäd bandhas 5 B. astäsu 6 AU the Mss read präpto yad etat. 7 K. and P.: na tadviparitah D. na ca tadviparitah 8 D. cetanä 9 K. and P.: prakrtau layah D. prakrtau layah, s.m. prakrtilayah 10 B. eva iti D. iti, s.m. eva iti 1J B. omits hy. 12 B. nänätvam samvid D. nänätvasamvidah 13 B. sangadvesa0 D. sangadosa0, s.m. sangadvesa0 14 D. changes the position of äha to the beginning of the new line. 15 D. drstavisaye rägät 16

15

20

25

K., P. and D.: °nivartakam

ASTAMAM AHNIKAM SK44,45

237

visayäbhiläsäd1 agnihoträdisu pravartate tatas ca svargädisüpapattir bhavati / asau daksinäbandhah / drstänusravikavisayäbhiläsadvärena tannirvartake karmani pravartamäno gunavrttivaicitryäd anistaphalanirvartakam 2 api karma karoti / evam mänusye gatyantare yopapattih sarväsau 3 rägät / äha: räjasagrahanänarthakyam tatpürvakatväd 4 rägasya / rajonimitta eva hi rägah / tatra samsäro rägäd ity eva5 vaktavyam / räjasagrahanam anarthakam iti / ucyate: na visayavisesanatvät / visaye6 yo rägah sa 7 samsärahetur 8 ity asyärthasya jnäpanärtham idam ucyate / anyathä yo yateh sättviko yamaniyamadhyänädyanusthänarägah 9 pravacanarägo vä so 'pi samsäräya syät / AISVARYÄD AVIGHÄTAH10 / (SK45c) yad astagunam aisvaryam animädi präg upadistam (193.1) tasmät sve sve 11 visaye Vighäta 12 utpadyate / tadabhiratir vaikäriko bandhah / äha: yadi 13 [tribhis] tribhir nimittair vairägyädibhis trividho bandho nirvartyate yad uktam(236.5) ajnänäd bandha iti tad ayuktam / bhäväntaram hy ajnänam / atah phaläntarena bhavitavyam iti / ucyate: na mülakäranatvät / jnänavarjitänäm hi bhävänäm yat phalam taträjnänam mülam tannimittatvät sarvesäm / na hi jnänivairägyam alam prakrtilayäya, tathetaräni paramarsyädäv adrstatvät / vicitram käryam ekasmät käranäd ayuktam iti vairägyädiny asädhäranäni prthak kalpyante / sädhäranam tv ajnänam / ato na kascid dosah / VIPARYAYÄT TADVIPARYÄSAH //(SK45d) anaisvaryät tv animäder astavidhäd avighätaviparyayo vighäto bhavati / tad evam etad astavidham dharmädividhänam 14 upädäyästavidham naimittikam upapadyate / evam esa tattvasargo bhävasargas ca vyäkhyätah / etac ca vyaktasya rüpam pravrttis ca parikalpyate / phalam idänim vaksyämah / / 4 5 / / iti 15 yuktidipikäyäm astamam ähnikam trtiyam ca 16 prakaranam /
1 D. corrects °visa °(not clear) into 2 P. ° nivartakam 3 D. sarväsau, s.m. sä sarväsau 4 D. tatpürvaga0 5 B. evam 6 D. visaye, s.m. visayesu 7 B. omits sa. 8

5

10

15

20

25

°visayä° in the right margin.

D. samsäre hetur P. ° anusthänänurägah D. aisvaryäd avighätah, s.m. aisvaryädivighätah 11 D. sve sve, s.m. svapne 12 D. vighäta 13 D. yat 14 D. dharmädividhänam, s.m. dharmädivicäram 15 B. omits iti. B. ähnikam ca trtiyam

N a v a m a m

A h n i k a m

aha: kim punas tatphalam iti / ucyate: yah khalu— ESA PRATYAYASARGO VIPARYAYÄSAKTITUSTISIDDHYÄKHYAH1/ (SK46ab)

tatphalam iti vakyasesah / esa iti vaksyamanasya sammukhikaranartham ucyate / pratyayasarga iti pratyayah padärtho laksanam iti paryäyäh / pratyayänäm sargah pratyayasargah padärthasargo laksanasarga ity arthah / athavä pratyayo buddhih niscayo 'dhyavasäya iti paryäyäh / tasya sargo 'y am > at ah pratyayasargah pratyayakäryam pratyayavyäpära ity arthah / athavä pratyayapürvakah sargah pratyayasargah / buddhipürvaka ity uktah / katham / evam hi sästram "mahadädivisesäntahsargo buddhipürvakatvät / utpannakäryakaranas 2 tu mähätmyasarira ekäkinam ätmänam aveksyäbhidadhyau 'hantäham puträn sraksye 3 ye me karma karisyanti / ye mäm param cäparam ca jnäsyanti>(cf.234.26) / tasyäbhidhyäyatah pafica mukhyasrotaso deväh prädurbabhüvuh / tesütpannesu 4 na tustim lebhe 5 / tato 'nye tiryaksrotaso 'stävimsatih 6 prajajfie / tesv apy asya matir naiva 7 tasthe / athäparena vordhvasrotaso deväh prädurbabhüvuh / tesv apy utpannesu naiva krtärtham ätmänam mene / tato 'nye 'stäv 8 arväksrotasa utpeduh" / evam tasmäd brahmano 'bhidhyänäd utpannah, tasmät pratyayasargah / sa viparyayäkhyo }saktyäkhyas tustyäkhyah siddhyäkhyas ceti / taträsreyasah sreyastvenäbhidhänam viparyayah 9 / vaikalyäd10 asämarthyam asaktih / cikirsitäd ünena nirvr<t>islx tustih / yathestasya sädhanam siddhih / tadyathä dharmärthapravrtto 'gnistomädin parityajya samkaram kurvita so 'sya viparyayah, sädhanavaikalyäd asämarthyam asaktih, ädhänamätrasantosas tustih,

5

10

15

20

*D. pratyayasargo viparyaya0, s.m. pratyayasargaviparyaya0 utpannakäryakäranas D. °käryakarana$, s.m. °käryakäranas and D.: draksye tesütpannesu, s.m. tesv apy utpannesu D. corrects na tustim lebhe into naiva krtam ätmänam mene, and deletes the corrected phrase. ^Before fstävimsatih D. writes and deletes deväh prädurbabhübuh, tesütpannesu na tustim la. B. na ve 8 D. omits 'stäv in the text, but adds astau in the left margin. P. °bhidhänaviparyayah 10 B. kaivalyäd K. and D.: nivrttis P. nirvrttis B. not clear.
2 B. 3 B. 4 D. 5

240

YUKTIDIPIKA

krtsnasya kriyavisesasyanusthanam siddhih / evam <anya>rthadisu1 yojyam / yas cäyam caturvidhah phalaviseso2 viparyayädir äkhyätah— GUNAVAISAMYAVIMARDÄT TASYA CA BHEDÄS TU PANCÄSAT / / (SK46cd) 5 gunänäm vaisamyam gunavaisamyam / gunavaisamyam prädhänyagunabhävayoga ity art hah / gunavaisamyäd vimardo gunavaisamyavimardah pratyayaparyäyena sattvarajastamasäm itaretaräbhibhavah 3 / tannimittä esäm pratyayänäm pancäsad bhedä bhavanti / katham iti / ucyate: PANCA VIPARYAYABHEDÄ BHAVANTI / (SK47ab') tamo moho mahämohas tämisro 'ndhatämisra iti / tatra sreyasi pravrttasya pratyay<ä>vare4 sreyo 'bhimäne ädyo 5 viparyayas tamaity abhidhiyate / bhautikesv äkäresu sirahpänyädisv ätmagraho yo ' y a m vyüdhoraskah sitadasanas tämräksah pralambabähuh so 'ham iti / tathä sravanasparsanadarsanarasanaghränavacanädänaviharanotsargänandasamkalpäbhimänädhyavasäyalaksanäsu6 karanavrttisv aham srotä drastä cety evamädir 7 ädyakälapravrtto grahah pürvasmäd a<v>aro8 moha ity ucyate / katham punar ayam avara iti / ucyate: pürva<h>9 sarirendriyavyatiriktam upalabdhum icchan sauksmyät tadanadhigame bhütäkäram abhütam pra<dhänam>10 paraparikalpitam vänumanyeta svayam vä parikalpayed iti na märgäd düräpagatam etat / ayam tu pratyaksädhigatotpattisthitivinäsesv anekarüpesu 11 käryakaranesv 12 aham ity abhimanyate / tasmät pürvasmäd avarah / bähye tu visaye mamedam ity abhinivesah pürvasmäd avaro 13 mahämohah / katham pürvasmäd avara iti / ucyate: pürvah saririno 'pratyaksatvät karanavrttyavisesäd 14 vätmavrtteh käryakarane 15 kuryäd ätmabuddhim iti sakyam etat / bhinnanimittäkäradesasvabhävaprayojanänugrahopaghätotpattisthitivinäsäms ca mätrpitr[putra]bhrätr<svasr(?)>putradäragohiranyavasanäcchädanädln 16 ayam akasmäd
1 All the Mss read arthädisu. 2 D. phalaviseso, s.rn. phale viseso 3 K. and P.: itaretarabhävah D. itaretarabhävah, s.m. itaretaräbhibhavah 4 All the Mss read pratyayavare. We follow Chakravarti. 5 D. ärso 6 P. omits -darsana-. 7 D. evamädir, s.m. evamädinä 8 All the Mss read adharo. We follow Chakravarti. 9 All the Mss read pürvam 10 K., P. and B.: pramänam D. pramänam, s.m. pränam 11 K., P. and B.: anekarüpakesu D. anekarüpakesu, s.m. anekarüpesu 12 D. käryakaranesu, s.m. käryakäranesu 13 14 D. 15 D. 16

10

15

20

25

K., P. and B. omit avaro mahämohah katham pürvasmäd. D. adds this phrase in the right margin. °vrttivesesäd, s.m. ° vrttyavisesäd käryakaranesu, s.m. käryakäranesu K., P. and D.: mätrpitrputrabhrätrputradära0 D. parenthesizes putra of mätrpitrputra.

NAVAMAM AHNIKAM SK46,47,48

241.

ätmatvena pasyati / tasmät 1 pürvasmäd avarah / krodhas caturtho viparyayah pürvasmäd avarah tämisra ity abhidhlyate / katham punar ayam pürvasmäd avara iti / ucyate: pürvo 'bhinivesapratisedham abhyanujänäti 2 / yadäsya bähyadravyaviyoge kascit kusalasamsrsta evam braviti samsärasya ... buddhäv avasthäpya vimrsatäm yävad ayam kälo yadi 3 kascit priyenäviyuktapürvah / tasmäd 4 ägamäpäyisu bähyesu dravyesu vidusä näbhinivesah kärya iti, tadä pratyäha satyam evam etad iti / sannikrstas tu viyogakäla iti <...(?)> na buddhir avasthäpayitum sakyate / krodhävistas tu svavikalpitagrähaviparitabuddhir asakyo dandenäpi nivartayitum / tasmät pürvasmäd avarah / maranavisädah paficamo viparyayah / pürvasmäd avaro 'ndhatämisra ity abhidhlyate / katham punar ayam pürvasmäd avara iti / ucyate: pürvo 'bhinivesät pratisidhyamänah pratlkäram antato jihmäksiniriksitenäpi 5 tävad 6 ärabhate / na tu brahmädau stambaparyante samsäre svanimittaniyata<sarlra(?)>pätasya 7 vinäsasya kenacit pratikärah krtah / tasmäd aparihäryam maranam anusocan pürvasmäd avarah / ity ete pafica viparyayabhedä bhavanti / ASAKTIS CA KARANAVAIKALYÄT / ASTÄVIMSATIBHEDÄ /(SK47b'c) bhavatity anuvartate / tatra bähyakaranavaikalyam saha manasaikädasaprakäram / saptadasavidham buddhivaikalyam / ete 'saktibhedäh 8 / TUSTIR NAVADHÄSTADHÄ SIDDHIH / / (SK47d) evam caturvidhasya pratyayasargasya gunavaisamyavimardanena pancäsad bhedä bhavanti / vistarena tu padärthasatasähasram änantyam vä laksanänäm / katham iti / ucyate: yasmät 9 — BHEDAS TAMASO 'STAVIDHAH / (SK48a) ya ete panca viparyayabhedä vyäkhyätäs tesu tamaso 'stavidho bhedah / katham / paravijfiänam äsritya pravrttasyästäsu prakrtisv aparäsu paräbhimänagrahät 10 /
1

5

10

15

20

25

30

D. tasmät pürvasmäd avarah krodhas caturtho viparyayah pürvasmäd avarah tamisra ity abhidhiyate , s.m. tanmoksam asmäd avarah tämisra ity abhidhiyate 2 B. atyanujänäti 3 D. kälo yadi, s.m. kälopaciti 4 B. tasmä 5 P. jihmäksinirtksito näpi 6 D. not clear, s.m. tävad K., P. and B.: svanimittaniyatatamapätasya D. svanimittaniyatatamapätasya, s.m. svanimittaniyatatap ätasya 8 D. saktibhedäh 9 B. yasmät / mohasya ca D. °grahät, s.m. °grahanät

242

YUKTIDIPIKA MOHASYA CA / (SK48b')

kim / astavidho bheda iti / casabdät käryakaranasämarthye 1 'stavidhe 'nimädäv aham iti pratyayah / DASAVIDHO MAHÄMOHAH / (SK48b') 5 mätrpitrbhrätrsvasrpatniputraduhitrgurumitropakärilaksane 2 dasavidhe kutumbe yo ' y a m mamety abhinivesah [drstänusravikesu vä sabdädisv ity apare] sa dasavidho mahämohah parisamkhyäyate / TÄMISRO 'STÄDASADHÄ / (SK48c) 10 astavidhe käryakaranasämarthye 3 dasavidhe ca kutumbe visayesu vä yah pratihanyamänasyävesah 4 / TATHÄ BHAVATY ANDHATÄMISRAH / / (SK48d) tatheti sämänyätidesärthah / andhatämisro 'städasadhaiveti / katham / asäv apy astavidhät käryakaranasämarthyäd 5 dasavidhäc ca kutumbät pratyava<sitasya(?)>6 visädah / evam ete panca viparyayabhedäh 7 svalaksanato visayavisesä laksitäh 8 / taträpi cästäsu prakrtisu sattvarajastamasäm samhataviviktaparinatavyastasamastänäm 9 paratväbhimänabhedäd ekaikä prakrtih pancadasabhedä / ata 1 0 eva te 'stau paiicadasa vimsam 11 sat am ca bhavanti / yathä mokse pravrttasyaivam dharmakämesv api / ekah padärtho vistarena parisamkhyäyamäno 'nantabhedah sampadyate / nidarsanamätram etad äcäryena krtam / evam asaktyädisv api laksanäntaresu yojyam / seyam avidyä paiicaparvä saprapancä vyäkhyätä / tadanantaroddistän asaktibhedän vaksyämah / / 4 8 / / äha: ativyäsäbhihitam idam iti näsmäkam buddhäv avatisthate / tasmäd viparyayoktam bhedäbhidhänam parityajya vaktavyam katham asaktir 12 astävimsatibhedeti / ucyate: EKÄDASENDRIYAVADHÄH SAHA BUDDHIVADHAIR ASAKTIR UDDISTÄ13/ (SK49ab)
1 B. kayakarana0 2 K. and P. omit -putra-. D. adds putra above the line. 3 D. and B.: käryakärana0 4 B. prakrtih any a° 5 P. and D.: käryakärana0 6 K., P. and B.: pratyavasänasya D. pratyavamänasya, 7 D. °bhedäh bhavanti, s.m. °bhedäh 8 B. has a lacuna for laksitäh. 9 D. sarnhatavivikta0, s.m, samhatavibhakta0 10 B. ta ' 11 D. pancadasavimsam 12 B. asaktim 13

15

20

25

s.m. pratyavasänasya ca

D. uddistah

NAVAMAM AHNIKAM SK48,49

243

indriyänäm vadhä indriyavadhäh1 svasamskäravisesayogät2 prakarsäpannena tamasä grahanarüpasya sattvasyäbhibhavät svavisayesv apravrttayah 3 / tadyathä— bädhiryam ändhyam aghratvam 4 mükatä jadatä ca yä / unmädakausthyakaunyäni klaibyodävartapangutäh / / (see e.g.STK.onSK49) tatra bädhiryam srotrasya, ändhyam caksusah, aghratvam näsikäyäh, mükatä väco, jadatä rasanasya, unmädo manasah, kausthyam tvacah, kaunyam päneh, klaibyam upasthasya, udävartah päyoh, pahgutä pädayor ity evam indriyavadhä ekädasa / anye tu— SAPTADASAVADHÄ5 BUDDHIR VIPARYAYÄT TUSTISIDDHINÄM / / (SK49cd) tatra tustayah prakrtyädyä vaksyamänäh, täsäm dvididho viparyayah / avyutpannasya yogadharmena tasyäm bhümäv apravrttih / vyutpannasya 6 cottarabhümyaparijnänät pürvasyäm bhümau <k>semarüpena7 grahanam / ätmavido vä sarväsu bhümisu / tesu yat pürvam tad asaktibhäväbhipretam, yan madhyamam tadäpeksikam / katham / tanmätrabhümyavastho hi yogy asmitädibhümyanavajayät tusto mahäbhütätikramät siddhah / tathä vijitäsmitärüpo mahadädyavasthäpeksayä tustah pürvabhümyapeksayä 8 siddhah / evam mahadavasthah 9 pradhänäpeksayä 10 pürväpeksayä ca / pradhänävasthah 11 purusäpeksayä pürväpeksayä ca / gunapurusäntarajnas tu siddha eva / tasmäd avyutpannasyämbhahprabhrtisu navänambhahprabhrtayo buddhivadhäs 12 tärakädiviparyayenästäv atärakädayah / esä khalv asaktir astävimsatibhedä / tustis tu sannihitavisayasantosäc cikirsitäd arthäd ünena ni<r>vrtih13 sämänyata ekaiva / pratyartham anantä satena tustah sahasreneti 14 / sästre tu bähyädhyätmikänäm sukhaduhkhamohänäm präptisv apagamesu <vä> väcävyavasthyalaksanä 15 upäyanavatvän nava tustayo bhavanti / täsäm—
1 D. vadha indriyavadhah 2 K., P. and D.: svasamskäravisayayogät 3 D. apravrttayä 4 D. aghratvam, s.m. aghratvam 5 B. saptadasavidhä ca 6 D. vyutpannasya 7 All the Mss read bhümäv aksemarüpena. 8 P. pürvam bhümy0 9 D. mahadavasthä 10 D. pradhänäpeksayä, s.m. pradhänädyapeksayä 11 D. pradhänävasthä 12 B. buddhibädhäh D. buddhivadhäh, s.m. buddhibädhäh 13 All the Mss read nivrttih. 14 D. sahasreneti, s.m. sahasrena tusteti 0 0

5

10

15

20

25

K., P. and B.: väcävyavasthya D. väcä vyavasthya

244

YUKTIDIPIKA

ADHYÄTMIK<YAS>1 CATASRAH PRAKRTYUPÄDANAKALABHAGYÄKHYAH2/ (SK50ab) ädhyätmik<ya>3 iti sarirasaririnor visesam upalipsamänena yoginä yadänätmany 4 ätmabuddhir avasthäpyate sä khalv ädhyätmik! 5 tustih, santosah ksema ity arthah / täsäm prakrtyäkhyä / yadä vitävitaih pradhänam adhigamya tatpürvakatvam ca mahadädinäm vikäränäm, änantyäc ca pradhänätmanah krtsnasya mahadädibhävena viparinämäsambhaväd ekadesasyäprakrtivikärabhütasya bhoktrtvam akartrtvam 6 cädhyavasya sangad<o>sanivrttim 7 labhate sädyä tustir ambha ity abhidhiyate / kasmät / amitarn hi pradhänatattvam bhäti jagadbijabhütatvän mahadädibhävaparinämena nyünasyaikadesasyätmana eväpürät tadvyatirekena cänyasyaikadesasyobhayadharmino 8 bhoktrbhütasya sadbhävät sampraksälane 'pi copasamhrtam vaisvarüpyasyänucchedät / tathä ca sästram äha "ambha iti gunalingasannicayam evädhikurute 9 " <iti> / gunäs ca sattvarajastamärpsi / Ungarn ca mahadädi, atra sannihitam bhavati / tad idam pradhänam amitam bhäty 10 amitam 1 1 upalabhyata ity ambhah / sa 12 khalv ayam yogi pradhänalaksanäm bhümim avajitya tanmahimnäca <jagad>13 asünyam drstvä vyatiriktasya padärthäntarasyäbhävam manyamänas täm eva bhümim kaivalyam iti grhnäti / bhinne ca dehe prakrtau layam gacchati tatas ca punar ävartate / tasyäm ca 14 tustäv anye saptamahadädikäranino Varuddhä 15 drastavyäh / tatra yathä prädhänikasya puruse nästi vijiiänam evam itaresäm uttaresu tattvesu / mahatkäraninah pradhäne, asmitäkäranino mahati, tanmätrakäranino 16 'hamkäre / tadekadesäs caisäm bhoktärah pürvavat / aträpi ca sattvädinäm samhataviviktaparinatavyastasamastänäm bhedäd avidyävacchedänantyam 17 avaseyam / äha: tustyavidyayor abhedah laksanaikatvät / astäsu prakrtisv ätmabuddhis tustih / tad eva ca tama ity avidyäkände nirdistam / tasmät padärthasamkara iti / ucyate: na pratyayavisesat / tamah pradhänapurusopadese satyapräy<a>nirdidhärayisayä18 tayoh pradhänam eva jyäyo na purusa ity abhi1 A\\ the Mss read ädhyatmika. We follow Chakravarti. 2 B. °kälabhägäkhyäh 3 All the Mss read ädhyätmikä. 4 K., P. and D.: yad anätmany 5 K., P. and D. read siddhih after ädhyätmiki. 6 D. adds akartrtvam in the left margin. 7 K., P. and B.: sangadvesanivrttim D. sangadesanivrttim 8 D. °dharminor 9 B. eva kurute 10 D. adds amitam bhäti in the right margin. 11 B. amita 12 P. has only a horizontal line instead of sa. 13 All the Mss read tad. 14 D. adds ca in the left margin. 15 D. mahadädikäranino 'varuddhä, s.m. mahadädikäranaviruddhä 16 D. adds mahati; tanmätrakäranino in the right margin. 17 D. avidyävacchedänantyam, s.m. 0avidyävad bhedänantyam 0 18

5

10

15

20

25

K., P. and B.: satyapräyänirdidhä

D. satyapräyä nirdidhä

NAVAMAM AHNIKAM SK50

245

nivisate 1 / tustis tu kirn param ity äsritya pravrttah 2 pradhänajnänamätre santosät padärthäntaram vijiiätum eva nädriyate / kirn ca prahänavisesät / nirüdhamülo hy anätmany ätmagraho 'jnänottarakälabhävanayäprahätavyah / tamobahulatvät tama ity abhidhiyate / pelavas tu 3 sattvabahulo darsanapranayas tustih / kirn ca tattväbhijayät / vijitabhümikasya hi yoginas tan<mahima>vasikrtatväd 4 bhümyantare 'pravrttis tustih / itarasya tv abhinivesamätram evety5 anayor visesah / tasmän na padärthasamkara iti vyäkhyätä prakrtyäkhyä tustih / yadä tu saty api prakrtisämarthye nänapeksya yathäsvam 6 upädänam bhävänäm utpattih sambhavati prakrtyavisese sarvakälam utpattiprasangät / prakrtikrtam evedam visvam ity abhyupagacchatas tadavisesäd goh 7 purusäd utpattiprasangah 8 , purusasya vä mahisät 9 / kirn ca jätyabhedaprasangät 1 0 / prakrtikrtam idam visvam ity abhyupagacchato jätibhedo na syät tadavisesät, drstam tüpädänäj jätyanuvidhänam 11 bhävänäm / tasmät tad eva käranatvena parikalpayitum nyäy<y>am12/ upädänaikadesa 13 eva ca käryakäranavidharmä 14 bhoktety etasmäd darsanät sangad<o>sanivrttim15 labhate / sä dvitiyä tustih salilam ity abhidhiyate / katham punar etat salilam / saty upädäne vikäro liyata iti / tathä ca krtvä sästram äha "salilam salilam iti vaikärikopanipätam evädhikurute sati tasmiml llyate jagat" iti / sa khalv ayam yogi pärthivän 16 avajitya tanmahimnäjagad asünyam drstvä padärthäntarasyäbhävam manyamänas täm eva bhümim kaivalyam iti 1 7 grhnäti / bhinne ca dehe prthivyädisu liyate / tatas ca punar ävartate / yadä ca saty upädänasämarthye na 18 tävataiva bhävänäm prädurbhävah / kirn tarhi / sannihitasädhanänäm api kälam praty a<p>eksä19 bhavati / kälavisesäd bijäd ankuro 20 jäyate 'nkurän nälam nälät kändam kändät prasava ityädi / anyathä tüpädänänäm sannidhänamäträt ksanenaivämisäm avasthävisesänäm abhivyaktih syät / kirn ca kälaviparyayenotpattiprasaiil K. and P.: abhiniviseta D. abhiniviseta, s.m. abhinivisate 2 D. pravrttä 3 D. piluvas tu, s.m. pevalas tu 4 All the Mss read tanmähätmyavasikrtatvät. 5 D. abhinivesamätrasevä ity, s.m. abhinivesamätram eva ity 6 D. yathä svam 7 D. tadavisät dgoh, s.m. tadavisäd goh 8 B. utpattih prasangah 9 D. mahisyät 0 10 D. jätibheda n B . jätyanabhidhänam 12 All the Mss read nyäyam. We follow Chakravarti. 13 P. upädänekadesa 14 K., P. and B.: käryakäranavidhätmä D. °vidhätmä, s.m. °vidharmä 15 All the Mss read sangadvesanivrttim. 16 B. prthivyän D. pärthivän, s.m. prthivyädin 17 D. adds iti in the left margin. 18 D. upädänasämarthyena 19 All the Mss read pratyaveksä. We follow Chakravarti. 20

5

10

15

20

25

B. bijänkuro

246

YUKTIDIPIKA

5

10

g a t 1 / upadanapurvakam visvam2 ity abhyupagacchatah saradi yavanam vasante vrihlnäm utpattih präpnoti / na caitad istam / kim ca tadanuvidhänät / drsyante ca präninäm kälänurüpäh svabhävähäravihäravyavasthäh / tasmäd asäv eva käranam / tadekadesas cäprakrtivikärabhüto bhoktety etasmäd darsanät sangad<o>sanivrttim3 labhate / sä trtiyä tustir ogha ity abhidhlyate / katham punar ayam käla ogha iti / ucyate: salilaughavat sarväbhyävahanät 4 tadyathä salilaughas trnam 5 kästham asmänam präninäm vä svamürtisamsrstam sarvam eväbhyävahati 6 / evam ayam kälo garbhäd bälyam bälyät kaumäram kaumäräd yauvanam yauvanät sthäviryam sthäviryän maranam tathä bijän mülam müläd ankuram iti vahati 7 / tathä cäha— yäm eva prathamäm rätrim garbhe bhavati purusah / samprasthitas täm bhavati sa gacchan na nivartate / / tasmäd oghasämänyäd 8 oghah kälah / sa khalv ayam yogi kälam avajitya padärthäntaräbhävam manyamänas täm eva bhümim kaivalyam iti manyate 9 / dehabhede ca kälam anupravisati tatas ca punar ävartate / yadä tu saty api kälasämarthye bhävänäm utpattir bhägyäny apeksate / kasmät / tatsannidhäne 'py aprädurbhävät / saty api sädhanasämarthye kälavisese ca kasyacid utpattir bhavati kasyacin neti / tasmäd asti käranäntaram yad apeksya bhävänäm utpattir anutpattis ca / kim ca abhyutthänänupapattiprasangät / kälamäträt phalam bhavatlty etad icchatah sästroktesu kriyävisesesv abhisecanavratopaväsägnihoträdisv abhyutthänam na syät / kasmät / änarthakyät 1 0 / asti ca / t asm an na kälanimittä bhävänäm 11 utpattih / kim ca tadanuvidhänät / drsyante khalv api prakrtyupädänakälävisese 'pi 12 bhägyavisesät phalavisesäh / tasmät tatsamskära eva käranam 1 3 / tadekadesas cäprakrtivikärabhüto bhoktety etasmäd darsanät sangad<o>sanivrttim 14 labhate / sä caturthl tustir vrstir ity abhidhlyate / katham punar vrstir iti / ucyate: sarvasattväpyäyanät / yathä hi jirnänäm 15 api trnalatädinäm vrstim präpya punar äpyäyanam bhavaty evam eva 16 sarvesäm präni1 B. kärya0 2 Before visvam D. writes and deletes bandha. 3 All the Mss read sangadvesanivrttim. 4 B. reads sarväbhyävaranät above sarväbhyävahanät 5 D. salilaughasütranam, s.m. salilaughas trnam 6

15

20

25

30

D. ° ävahanät, s.m. ° ävaranät

D. eväbhyävahati, s.m. eväbhyavaharati D. vahati, s.m. vadanti 8 K. and P.: osasämänyäd D. dosasämänyäd 9 B. grhnäti D. manyate, s.m. grhnäti 10 P. änarthakyät n D . kälanimittäbhävänäm 12 D. °kälavisese 'pi 13 P. käranam 14 All the Mss read sangadvesanivrttim. 15 P. not clear. 16 D. evam eva, s.m. evam esäm

NAVAMAM AHNIKAM SK50

247

näm bhägyaviparinämät punar äpyäyänam bhavati / tasmäd vrstisämyäd 1 bhägyäkhyä tustir vrstir ity abhidhiyate / sästram apy äha "vrstir vrstir iti sriya evopanipätam adhikurute / sä hi vrstivat 2 sarvam äpyäyati" iti / sa khalv ayam yogi bhägyäny 3 avajitya tanmahimnä jagad asünyam drstvä padärthäntarasyäbhävam manyamänas täm eva bhümim kaivalyam iti grhnäti / sa tasyäm eva dehabhede liyate tatas ca punar ävartata iti / äha: kälabhägyayor apratipattih samäkhyäparijnänät / prakrtyätmakasya tävad yogino 'stau prakrtayo visaya ity uktam purastät / upädänätmakasya ca prthivyädmi mahäbhütäni / kälabhägyayos tu na tathoktam / tasmäd vaktavyam kasya tattvasyaisä samäkhyeti / ucyate: na uktatvät / präg evaitad apadistam 4 (161.25) na kälo näma kascit padärtho 'sti / kirn tarhi / kriyäsu kälasamjnä 5 / täs ca6 karanavrttir iti pratipäditam / na cänyä vrttir vrttimatah / tasmät k<a>ranacaitanyapratijnäh 7 kälätmakä 8 iti / bhägyasamjnä tu dharmädharmayoh / tau ca buddhidharmäv iti präg apadistam(SK23) / tasmäd bhägyavädl buddhicaitanika iti / äha: na tustyantaratvät 9 / prakrtitvän mahän pürvam prakrtyäkhyäyäm tustäv avaruddhah / tasyedänim tustyantaratvena parikalpanam nätisamafijasam iti / ucyate: mahäms tarhi pürvatustivisayabhäväd apakrsyata iti / athavä käryakaranavrtti<m> kriyärüpäm 10 <vrttimadbhyo bhinnäm> n parikalpya tasyäm 12 kälatvam ayam äha / mahatas ca rüpam dharmädikam 13 mahato 'rthäntaram bhägyam iti [bhägyavän] / athavä bähya eväyam kälah karmakäranam nirdisyate / tatra cänye 'pi svamatiparikalpitapadärthäntarätmabhävagrähä 14 evätisämkhyäh pravädinah 15 pratiksiptä boddhavyä iti / apara äha: prakrticaitanikah 16 pradhäna<bhävavädl> / upädänakälabhägyavädino 17 mahadahamkäratanmätravädina iti / tad etad ap<r>asiddhatväd 18 ayuktam / na hi mahadahamkäratanmätralaksanäh prakrtaya upädänakälabhägyabhävena prasiddhäh / tasmäd idam apy ayuktam / evam etä ädhyätmikäs catasras tustayah /
1 D. vrstisämyäd, s.m. vrstisamanyad 2 D. vrstivat, s.m. vrstih sa 3 D. bhägyäny, s.m. bhägyäny 4 D. upadistam(7), s.m. apadistam 5 D. kälasamkhyä, s.m. kälasamjnä 6 D. täs ca, s.m. sä ca 7 All the Mss read kärana0. 8 P. and B.: kälätmakä 9 D. tustyantaratvät, s.m. tustyantaram 10

5

10

15

20

25

All the Mss read käryakaranavrttikriyärüpäm. K., P. and B.: vrttimaddyotyäm D. vrttimaddyotyäm, s.m. vrttimadbhyo 'tyäm(?) 12 D. tasyäm, s.m. asyäm 13 D. rupäm dharmädikam, s.m. rüpam adharmädikam 14 B. ° ätmakabhävagrähä 15 D. evätisämkhyäh pravädinah, s.m. eväbhisamkhyäpravädinah 16 D. prakrticaitanikah, s.m. präkrtikah 17 K. and P.: pradhänabhäväsädyupädäna0 B. prädhänabhäväsädyupadäna0 D. pradhänabhäväsädyupädäna0, s.m. pradhänätmabhavavädyupädäna0 18 All the Mss read apasiddhatväd. We follow Raghavan.

248

YUKTIDIPIKA BAHYÄ VISAYOPARAMAT PANCA CA1 NAVA TUSTAYO 'BHIHITAH / / (SK50cd)

5

10

casabdo 'vadhäranärthah / avyutpannätmavicärasya yogino visayadosadarsanamäträt sangadosanivrttir 4 bähyä tustih / tatra yadärjanadosam avagacchati na tävat sarvasyäbhijätir astity arthinävasyam visayärjane vartitavyam / tesäm asvabhävikatvät kvacid evävasthitir ity uktam präk (25.12, 36.1) / kirn ca sapratyanikatvät 5 / sväbhävikam avasthänam visayänäm aparikalpyäpi yadä pratigrahädibhir arjanam pratyädriyate / tad apy ayuktam / kutah / sapratyanikatvät 6 / evam api nästi kascid apratyaniko visayärjanopäyaiti 7 / tadvighäte 'vasyam pray at it avy am / sa ca yadi prayatamänah 8 pratyanikivighätam kuryät paropaghätenätmänugrahänusthänäc chästravirodhah / yasmäd äha— na tat parasya sandadhyä 9 pratikülam yad ätmanah / esa samksepato dharmah kämäd anyah pravartate / / punar apy äha—

2

3

15

präninäm upaghätena yo 'rthah samupajäyate / so 'napeksaih 10 prahätavyo lokäntaravighätakrt / / tasmät sanghätamätratvät sattvädinäm ghatädivat / ä brahmanah parijiiäya dehänäm anavasthitim / / itas tyam sadbhir ädiptam trnolkäcapalam 11 sukham /

20

sudrdhair na nipätavyam 12 duhkhair dehäntarodbhavaih / / atha punar ayam pratyanlkair vihanyate / tato ?sya visayäbhävah / sukhärtham ca pravrttasya bhüyistham duhkham evety etasmad darsanän mädhyasthyam labhate / sä 13 paficamT tustih sutäram ity abhidhlyate / katham punah sutäram iti / ucyate: sukham anenopäyena taranti visayasamkaicim iti sutäram / yadä tu yogi 14 pürvadosädhigame 'bhijätyä vä yatnärjitavisayatve 15 sati raksädosam upanyasyati / katham / bhoktrbhogyabhävävyatirekät 16 sarvapränisädhäranä
X B. °ramac ca panca 2 D. 'dhäranärthah, s.m. 'vadhäranärthah 3 D. avyutpannätmavicärasya, s.m. avyutpannätmanätmavicärasya 4 B. sangadvesanivrttir D. sangadosanivrttir, s.m. sangadvesanivrttir 5 D. samprati anekatvät, s.m. sapratyanekatvät 6 D. sampratyanekatvät, s.m. sapratyanekatvät 7 B. ity atas 8 K., P. and D.: pratiyatamänah 9 D. } sandadyät 10 D. py apeksaih, s.m. 'napeksaih n D . trnolkä ca palam, s.m. trnolkä capalam 12 D. nipätavyam, s.m. nimätavyam 13 D. adds sä pancami tustih ... mädhyasthyam labhate(249A) in the bottom 14 D. yogi, s.m. yogi sati 15 B. °visayatve ca 16

25

margin.

D. °bhävävi, s.m. ° bhävävyatirekät

NAVAMAM AHNIKAM SK50

249

visayäh, tasmät tesäm raksä vidheyä / tasyäm ca pravartamäno yadi param upahanyät 1 pürvoktadosah 2 , athätmänam visayäbhävah / rätrindivam ca tadekägramanasah sukhärtham pravrttasya bhüyistham duhkham evety etasmäd darsanän mädhyasthyam labhate / sä sasthl tustih supäram ity abhidhlyate / katham punah supäram iti / ucyate: sukham anena päram visayärnavasya prayäntiti / yadä tu sati pürvadose <'>sati3 vä grämanagaranigamasannivesäd vaprapräkäraparikhänusthänät praharanävaranasämnidhyät sämädyupäyänusthänäd vä 4 krtavisayarakso yogi ksayadosam upanyasyati / katham— yena dravyena mohändhä 5 rantum icchanti dehinah / tad evaisäm vinäsitväd bhavaty aratikäranam / / yatnopättäh suguptäs ca visayä visayaisinäm / pasyatäm eva nasyanti budbu<d>äh6 salile yathä / / na tad asti jagaty asmin bhütam sthävarajangamam / pratyaksato 'numänäd vä vinäso yasya neksyate / / tasmäd vinäsisv äsaktäm 7 putradäragrhädisu / mameti buddhim yatnena buddhimän vinivartayet / / iti 8 / etasmäd darsanän mädhyasthyam labhate / sä saptami tustih sunetram ity ucyate 9 / katham punah sunetram iti / ucyate: sukham anenätmänam kaivalyävasthäm nayantiti sunetram / yadä tu satsu pürvadosesu prasangadosam upanyasyati / katham / yä präptavisayänam 10 indriyänäm tadabhiläsän nivrttis tat sukham / visayajighrksayä ca duhkham / präptir apy esäm anupasäntaye tadupabhogakausaläya ca / yasmäd äha— yadä prabandhäd visayi visayän upasevate / tadäsya <tesv>11 abhipräyah sutaräm sampravartate / / ato 'pi yena 12 purusah samayed vadavänalam 13 /
X P. uparunyat 2 K., P. and D.: tadä pürvoktadosah 3 A11 the Mss read sati. We follow Raghavan. 4

5

10

15

20

25

All the Mss read grämanagaranigamasannivesädyupäyänusthänäd vä. D. adds in the right margin the following passage: (°sannivesäd) vaprapräkäraparikhänusthänät praharanävaranasämnidhyät sämä(dyupäyänu°). 5 D. writes and deletes yena dravyena mo after katham, and starts a new line with yena dravyen a mohändhä. 6 A11 the Mss read budbudhäh. D. budbudhäh iva dehinah, s.m. budbudhäh 7 K. and P.: äsaktänäm D. äsaktänäm, s.m. äsaktäm 8 D. adds iti in the left margin. B. upadisyate 10 P. omits yä. D. yä präpta0, s.m. cäpräpta0 11 K., D. and B.: tadäsyate tv P. tadäsyeta tv 12 B. te yena B. badavänalam

250

YUKTIDIPIKA nendriyany upabhogena visayebhyo nivartayet / / tasmäd visayasamparkam asamartham nivartane / indriyänäm parijnäya niräsangamatis caret / /

5

10

15

iti / etasmäd darsanän mädhyasthyam labhate / säst ami tustih sumäricam ity ucyate 1 / katham sumäricam iti / ucyate: arcateh püjärthasya sobhanam arcitam visayasahganivrttasya yogino Vasthänam bhavati / yadä tu <satsu(?)> pürvadosesu himsädosam upanyasyati / katham / anupahatyänyabhütäni 2 visayabhogänupapatteh / upabhogo hi näma manojnäbhyavahärah strisevä hayagajanarädibhir yänam ity evamädi / tatra manojnäbhyavahäraciklrsunä tadangänäm go'jävibalivardastripurusädmäm avasyam upaghätah käryah / anupaghäte vä visayänupapattiprasangah / striyam 3 äsevamänenänyäsäm strinäm mätrpitrbhrätrprabhrtinäm ca <...> anyathä tadabhävohayädinäm / tasmäd upabhogärthinävasyam anyopaghätah käryo nihitadandena 4 vä visayopabhogas tyäjya iti / äha ca— yathä 5 yathä hi visayo vrddhim gacchati 6 dehinäm /apaghätas tadangänäm tathaiväsya vivardhate / / tasmäd anicchann anyesäm präninäm dehapidanam / santosenaiva varteta tyaktasarvaparicchadah / /

20

satyaväcah prasäntasya sarvabhütäny anicchatah / bhavändhakäräntajnänam 7 acirena pravartate / / iti / etasmäd darsanän mädhyasthyam labhate / sä navami tustir uttamäbhayam ity apadisyate / katham / uttamam hi präninäm sarvebhyo bhayebhyo himsäbhayam iti 8 tadapagamäd uttamäbhayam 9 iti / äha: arjanaraksanalaksanayor api tustyoh paropaghätados<a>h / apadisto 'syäm 10 api ca / tatra katham anayor visesah pratipattavya iti / ucyate: na visayabhedät / tatra yesäm arjanaraksane pratyädriyate
X B. upadisyate 2 D. anapahatyä0 3 B. striyäm 4 B. nihata0 5 D. writes and deletes ya after äha ca, and starts a new line with yathä. 6 K., P. and B.: grhnäti D., grhnäti, s.m. gacchati 7 K. and P.: bhävändhakärä0 B. bhävändhakäräntarajnänam D. bhävändhakärä0, vändhakärä0 8 B. omits iti. 9 D. uttamä bhayam 10

25

s.m. bha-

K., P. and B.: paropaghätadosäh apadisto 'syäm D. puropaghätadosäh apadisto 'syäm, s.m puropaghätadoso 'syäm

NAVAMAM AHNIKAM SK50,51 visayi tadarthinäm 1 pratyanikänäm 2 avasyam abhighäto 'nusthätavya ity ädäv uktam / iha tu yesäm evärjanaraksane tadanupaghätenäsakyo visayopabhoga ity etad vivaksitam / tasmäd asamkirnam etat / ity evam ambhahprabhrtayo nava visayebhyah sangad<o>sanivrttihetavo3 vyäkhyätäh / te jnänavirahitänäm yoginäm tustisabdaväcyatäm labhante / jfiäninäm tu vairägyaparvasamjnit<ä>4 sväsu sväsu tattvabhümisu siddhä 5 eveti / / 5 0 / / äha: präg apadistam 6 (SK47) astadhä siddhir iti tad idänim abhidhiyatäm iti / ucyate: ÜHAH SABDO 'DHYAYANAM DUHKHAVIGHÄTÄS TRAYAH7 SUHRTPRÄPTIH / DÄNAM CA SIDDHAYO 'STAU / (SK51abc) tatroho näma yadä pratyaksänumänägamavyatirekenäbhipretam artham vicäranäbalenaiva pratipadyate sädyä siddhis tärakam ity apadisyate / tärayati samsärärnaväd iti tärakam / yadä tu svayam pratipattau pratihanyamäno gurüpadesät pratipadyate sä dvitiyä siddhih sutäram 8 ity apadisyate / katham / sukham anenädyatve 'pi bhavasamkatät tarantiti 9 / yadä tv anyopadesäd apy asamarthah pratipattum adhyayanena sädhayati sä trtlyä siddhis tärayantam ity 10 apadisyate / tad etat täranakriyäyä adyatve 'py avyävrttatvän 11 mahävisayatvät 12 tärayantam ity apadistam / ta ete trayah sädhanopä<yä>yair13 ä brahmanah pränino ?bhipretam artham präpnuvanti / äha ca "säksätkrtadharmäna rsayo babhüvuh / te 'parebhyo 14 ? säksätkrtadharmebhya 15 upadesena 16 manträn sampräduh / upadesäya gläyanto 'pare bilmagrahanäyemam 17 grantham samämnäX

5

10

15

20

P. writes and deletes three lines following tad of tadarthinäm, which read as follows: (tad) asya samjnäyäm rasyam (sic) eva ramyakam // dänam yadä tu daurbhägyam dänenänätitya pürvesäm trayänäm antyam eva sädhayati säst ami siddhih sadäpramuditam ity abhidhiyate / subhago hi sadäpramudito bhavati tasmäd daurbhägyanivrttih sadäpramuditam / ity evam etäh siddhayo 'stau vyäkhätäh / etäsäm samsrayenäbhipretam artham yatah samsädhayantity atah pürväcäryagatam märgam äruruksur tatpravanah syäd 2fo'(cf.p.252.18nc.). 2 D. pratyanekänäm, s.m. pratyanekäsänäm 3 A11 the Mss read sangadvesanivrttihetavo. 4 All the Mss read ° samjnitäm. We follow Raghavan. 5 B. siddha 6 D. apadistam, s.m. aparisistam 7 B. °vighätatrayam D. °vighätä$ trayah, s.m. ° vighätatrayam D. sutaräm, s.m. sutäram 9 D. tarantiti, s.m. tärayatiti 10 D. api 1J D. avyävrtatvän D. °visayatvät, s.m. °visaye AH the Mss read sädhanopäyair. 14 D. parebhyo 15 B. ksätkrta0 D. säksätkrta0 16 D. encircles na of upadesena. D. bilmagrahanä yemam, s.m. vikalpaprahänäya imam

252

YUKTIDIPIKA

5

10

15

20

25

sisur vedam ca 1 vedangani ca"(Nir.l.2O) iti / bilmam bhasanam samyakpratibhäsäya visistah samketa uktah / esäm tu sädhanopäyänäm pratyanikapratisedhäya 2 duhkhavighätatrayam / duhkhäni triny ädhyätmikädlni / tatra 3 cädhyätmikänäm vätädinäm siddhipratyanlkänäm äyurvedakriyänusthänena 4 vighätam krtvä pürvesäm trayänäm anyatamena sädhayati sä caturthi siddhih pramodam ity abhidhiyate / katham / nivrttarogä hi präninah pramodayanta 5 iti krtvä / yadä tv ädhibhautikänäm mänusädinimittänäm siddhipratyanlkänäm sämädinä yatidharmänugunena 6 vopäyena pürvesäm trayänäm anyatamena sädhayati sä pancami siddhih pramuditam 7 ity abhidhiyate / katham / anudvigno hi pramudita iti krtvä / yadä tu sltädiny ädhidaivikäni dvandväni siddhipratyanikäni svadharmänurodhena pratihatya pürvesäm trayänäm anyatamena sädhayati sä sasthi siddhir modamänamity abhidhiyate / katham / dvandvänupahatä 8 hi pränino modanta iti krtvä / suhrtpräptih / yadä tu kusalasamsprstam sanmitram äsritya sandehanivrttim labhate sä ramyakam iti saptaml siddhir apadisyate / ramyo hi loke sanmitrasamparkah / tasya samjnäyäm(cf.Pän.4.3.147) ramyam eva ramyakam / dänam / yadä tu daurbhägyam dänenätitya pürvesäm trayänäm anyatamena sädhayati sästaml siddhih sadäpramuditam ity abhidhiyate 9 / subhago hi sadäpramudito bhavati / tasmäd daurbhägyanivrttih sadäpramuditam / ity evam etäh siddhayo 'stau vyäkhyätäh / etäsäm samsrayenäbhipretam artham yatah samsädhayantity 10 atah pürväcäryagatam 11 märgam äruruksus tatpravanahsyäd iti / äha: kah punar atra hetur 12 yena purusärthatvävisese sati gunänäm sarvasiddhinimittatvam na bhavatiti 13 / ucyate: yasmät— SIDDHEH PÜRVO ?NKUSAS TRIVIDHAH //(SK51d) sädhyapratipattisämarthyasämänyam anglkrtyäha siddher iti / pürvo viparyayäsaktitustilaksano 14 'hkusa ivänkuso nivartanasämänyät / nityapravrttasyäpi pradhänät siddhisrotaso viparyayäsaktitustipratibandhät sarvapränisv
J B. omits ca. D. adds ca in the right margin. 2 D. pratyaneka0 3 P. taträ 4 B. äyurvedavihitakriyä0 D. äyurvedakriyä0, s.m. 5 B. pramodanta D. encircles ya of pramodayanta. 6 B. °änugune 7 D. pramuditam, s.m. pramodam 8 B. dvänupahatä 9 B. apadisyate D. abhidhiyate, s.m. apadisyate 10 D. samsädayantiti, s.m. samsädhayantiti 11 P. pürväcäryagatam 12 P. punar ahetur 13 P. sarvasiddhinimittam tv anubhavati B. sarvatra 14 0

30

äyurvedavihitakriyä0

siddhinimittatvam na bhavati

D. viparyayah sakti

NAVAMAM AHNIKAM SK51

253

apravrttir bhavati / viparyayät 1 tävat sthävaresu / te hi mukhy<a>srotaso2 viparyayätmänah / asaktes tiryaksu / te hi tiryaksrotaso 'saktyätmänah 3 / tuster 4 devesu / te hy ürdhvasrotasas tustyätmänah / mänusäs tv arväksrotasah samsiddhyätmänah / tasmät ta eva tärakädisu pravartante sattvarajastamasäm cähgängibhävaniyamäd viparyayäsaktitustibhih pratihanyanta iti 5 na sarvesäm sarvadä siddhir bhavati / ata etad uktam siddheh pürvo 'nkusas trividha iti / yathä ca siddheh viparyayäsaktitustayah pratipaksä evam siddhir api viparyayädinäm / sä hy utpannä sarvän etän nivartayati / katham / avipantajnänam viparyayam, atitänägatavartamänesu sannikrstesu viprakrstesv 6 indriyagrähyesv7 atmdriyesu cäpratighätäd asaktim, purusasya prakrtivikäravyatiriktasya darsänät sarväsu bhümisu tustim / evam etäni srotämsi pränädayah karmayonayas ca vyäkhyätäh / etesäm marge 'vasthäpanät paräm siddhim kaivalyalaksanäm acirena 8 präpnoti / äha ca— yoninäm sapramänänäm samyanmärge niyojanät / srotasäm ca visuddhatvän niräsangamatis caret / / iti iti 9 yuktidlpikäyäm navamam ähnikam /

5

10

15

P. deletes the first two lines of its fol.H3b preceding viparyayat, which read as follows: mahadahamkäratanmätrendriyabhütatvenävasthäya paramarsihiranyagarbhädinäm sariram utpädayanti / satsiddhiksayakälottaram tu gunavimardavaicitryäd rajastamovrtyanuyätisamsäracakram pravrttam // na vinä bhävair Ungarn // devamanusyatiryagbhävena vyavatisthata iti väkyasesah //(cf.p.255.11ff.). 2 A11 the Mss read mukhyäh srotaso. 3 D. 'sakyätmänah, s.m. 'sakyätmänah 4 K., P. and B.: tustir D. tustir, s.m. tusteh 5 B. ity ato 6 D. writes and deletes vya before viprakrstesv. D. indriyagrähyesv, s.m. indriyagrähyesv 8 D. adds acirena in the right margin. 9 B. omits iti.

l

D a s a m a m - E k a d a s a m A h n i k a m

evam yat purvam apadistam "samyogakrtah sargah"(cf.SK21d) iti tad vyakhyatam / atredänim äcäryänäm vipratipattih / <...> dharmädmäm sariram antarenänutpatteh sarirasya ca dharmädyabhäve nimittäntaräsambhaväd ubhayam idam anädi / tasmäd ekarüpa eväyam yathaivädyatve 1 tathaivätikräntäsv anägatäsu kälakotisu sarga iti / äcärya äha: naitad evam / kirn tarhi / präk pradhänapravrtter dharmädharmayor asambhavo buddhidharmatvät 2 tasyäs ca pradhänavikä<ra>tvät 3 / tatas tadvyatiriktam sabdädyupa<bhoga>laksanam4 gunapurusäntaropalabdhilaksanam cärtham uddisya sattvädayo mahadahamkäratanmätrendriyabhütatvenävasthäya 5 paramarsihiranyagarbhädinäm sariram utpädayanti / satsiddhiksayakälottaram tu gunavimardavaicitryäd rajastamovrttyanupäti samsäracakram pravrttam 6 <iti> / NA VINÄ BHÄVAIR LINGAM7/ (SK52a) devamanusyatiryagbhävena vyavatisthata iti väkyasesah / NA VINÄ LINGENA BHÄVASAMSIDDHIH / (SK52b) samsiddhir atra nispattir abhipretä / LINGÄKHYO BHÄVÄKHYAS TASMÄD DVIVIDHAH PRAVARTATE SARGAH8// (SK52cd) so ' y a m lingäkhyo bhäväkhyas ca satsiddhiksayakäläd ürdhvam bhavati / gunasamanantaram tv adhikäralaksanah / tasmäd dvidhä sargo 'dhikäralaksano <lihgäkhyo> bhäväkhyas ca / yesäm tu dharmädharmasarirayoh paryäyena hetuhetumadbhävas tesäm "käranam asty avyaktam"(SK16a) ity atra prativihitam /
1

5

10

15

20

D. yathaiväditye B. buddhirüpatvät D. buddhidharmatvät, s.m. buddhirüpatvät 3 AH the Mss read °vikäritvät We follow Chakravarti. 4 K., P. and B.: sabdädyupalabdhigunalaksanam D. sabdädyupalabdhilaksanam, s.m. sabdädyupalabdhigunalaksanam 5 B. mahadamkära0 B. samsärapravrttam 7 To the right of Ungarn D. adds lingena vinä kirn. 8 B. omits SK52cd.

256

YUKTIDIPIKA

ye 'pi ca samkhya evam 1 ahur "dharmadharmadhikaravasat pradhanasya pravrttih" iti tesäm anyataraparikalpanänarthakyam iti / katham / yadi tävad adhikära eväyam pradhänapravrttaye 'lam kirn2 dharmädharmäbhyäm / atha <täv>3 antarenädhikärasya pradhänapravrttäv asämarthyam evam api kirn adhikärena / tayor eva pravrttisämarthyät / tasmäd adhikärabhävanimitto dvidhä sargah / tatra yathedam sariram avibhaktam dharmärthakämamoksalaksanäsu kriyäsu vibhaktam bhaved ity atah pänyädivikalpo 'sya 4 bhavaty evam sattvasargo 'py avibhakto dharmärthakämamoksalaksanäsu kriyäsu <s>amartho5 bhaved iti / / 5 2 / /

10

ASTAVIKALPO DAIVAS TAIRYAGYONAS CA PANCADHA BHAVATI / MÄNUSYAS CAIKAVIDHAH / (SK53abc) astau vikalpä asya so 'yam astavikalpah / astaprakäro 'stabheda ity arthah / tadyathä brahmaprajäpatlndrapitrgandharvanägaraksahpisäcäh / tairyagyonas6 ca pancadhä bhavati / pasumrgapaksisarisrpasthävaräh / mänusyas caikavidho jätyantaränupapatteh / äha: kirn etävän eva bhütasargavikalpa ähosvid anyo 'stiti / ucyate: vikalpäntaram asty 7 etesäm eva sthänänäm antarganabhedät / ayam tu 8 — SAMÄSATO BHAUTIKAH SARGAH / / (SK53d) kirn / upadista iti väkyasesah / tatra devänäm sädhyamarudrudrädibhedät 9 , tirascäm grämyäranyädibhedät 10 , mänusänäm ca brähmanaksatriyavitsüdrabhedät / udbh<idbhedäs>11 ca vistarenäpadisyamän<a> änantyam 12 äpädayet / tasmät samäsato bhütasargo 'padisyate / äha: vikalpäntaravacanam srotobhedät / daivamänusatairyagyonä 13 iti trividho bhütänäm 14 vikalpo 'padisyate / srotämsi tu catväry uktäni / tasmäd vikalpäntaram vaktavyam iti / ucyate: na gunadharmasarigrahasämarthyät / sattvabahulä ürdhvasrotasah, rajobahulä arväksrotasah 15 , tamobahuläs tiryaksrotaso mukhyasro tasas ca / tasmäd anayor abhedenopadesah / P.: kirn ca D. encircules ca of kirn ca. All the Mss read tävad. We follow Chakravarti. 4 B. pänyädivikalpasya 5 A11 the Mss read kriyäsv asamartho. We follow Pandeya. 6 B. tairyagyonis 7 D. asty, s.m. apy asty 8 D. adds tu in the right margin. 9 P. sädhyarudrudrädibhedät 10 D. grämäranyabhedät 11 K., and D.: udbhedabhedäc P. udbhedabhedäs We follow Pandeya. 12 All the Mss read ° disyamänam änantyam. We follow Chakravarti. 13 B. daivamänusya0 D. daivamänusatairyagyonä, s.m. daivamänusataiyagyonäni 14 Before bhütänäm D. writes and deletes rüpänä. 15 Before arväksrotasah D. writes and deletes ca (not clear).
1 B. eva 2 K. and 3

15

20

25

DASAMAM-EKÄDASAM ÄHNIKAM SK52,53,54

257

äha: asurädyupasamkhyänam abhedopadeso 1 vä / asurayaksakinnarapretänäm upasamkhyänam kartavyam itaresv <an>antarbhäväd2 abhedena vopadesah 3 käryah, na tu daivamänusatirasc<äm>4 iti / ucyate: na uktesv eva ta<t>sangrahät 5 / asuränäm tävad aindra eva sthäne 'ntarbhävah pürvadevatvät / pürvadevä hy asuräh / kirn ca paryäyena indratvät / baliprabhrtinäm 6 paryäyenendratvam srüyate / tathä yaksänäm raksassv ekarüpatvät 7 / kinnaravidyädharänäm 8 gandharvesu samänasilatvät / pretänäm pitrsv adhipatisämänyät / tasmät trivikalpa eva bhütasargah / sa cäyam— ÜRDHVAM SATTVAVISÄLAH /(SK54a) ürdhvam ity anenästau devasthänäny äha / taträyam sargah sattvavisälah / atra 9 ca visälagrahanäd vipsälopo drastavyah / ürdhvam <ü>rdhvam10 sattvavisälah / pisäcebhyo raksasäm raksobhyo 11 nägänäm nägebhyo gandharvänäm gandharvebhyah pitrnäm pitrbhyas tridasänäm tebhyah prajäpatinäm tebhyo 'pi brahmanah / evam visälagrahanam samarthitam bhavati / TAMOVISÄLAS TU MÜLATAH SARGAH /(SK54b) mülatas tu sargas12 tamovisälah / pasubhyo hi mrgänäm prakrstataram tamah / mrgebhyah paksinäm, paksibhyah sarlsrpänäm, sansrpebhyah sthävaränäm / MADHYE13 RAJOVISÄLAH / (SK54c) devebhyas tiryagbhyas cävakrstäsu bhümisu yathä yathä sattvatamasor 14 nirhräsas 15 tathä tathä rajaso 16 vrddhih / manusyäs 17 tübhayor madhyam iti tatra paramah prakarso rajasa 18 arväksrotasah siddhirüpatväd atyantam kriyäpravrttatvät / yathä ca mänusesu rajahprakarsa evam brahmanah sthäne sattvasya sthävaresu tamasah / sa khalv ayam— BRAHMÄDISTAMBAPARYANTAH / / (SK54d)
1

5

10

15

20

25

D. adds atra ca visälagrahanäd vxpsälopo drastavyah ürdhvam ürdhvam sattvavisälah in the right margin. This phrase is not found in K., P. and B. 10 D. urdhvam 11 B. raksebhyo Before sargas D. writes and deletes visäla. 13 D. adds punar ayam sargo after madhye. 14 D. sattvatamaso 15 P. nihräsah 6 D. rajaso, s.m. rajasas tu 17 B. manusyäs 18 D. rasasah, s.m. rajasah

2 All the Mss read antarbhäväd. We follow Chakravarti. 3 D. abhedenopadesah 4 K., P. and D.: daivamänusatiras ca B. daivamdnusyatiras 5 A11 the Mss read tadasamgrahät. We follow Chakravarti. 6 K., P. and B.: dhanviprabhrtinäm D. dhanviprabhrtinäm, 7 B. aikarüpatvät 8 D. kimnnara0, s.m. kinnara0 9

D. adds abhedopadeso vasurayaksakinnarapretanam upasamkhyänam in the right margin. This phrase is not found in K., P. and B. ca s.m. baliprabhrtinäm

258

YUKTIDIPIKA

caturdasabhedas trivikalpah sattvadyatisayanirhrasavisayabhavena yah sargo vyäkhyätah//54// ATRA JARÄMARANAKRTAM DUHKHAM PRÄPNOTI CETANAH PURUSAH / (SK55ab) 5 jaräkrtam maranakrtam jarämaranakrtam / tatra jaräkrtam tävad yathä valltarangitagätratvam, dandam 1 antarena cahkramanädisv apravrttih, sarvendriyänäm visayopabhogesv2 asämarthyam, prabalakäsasväsatä, säsrävileksanatä, dasanänäm asthiratvam, varnavikrtih, saithilyam, abhivyähärasangah 3 , mandä smrtir ity evamädi / maranakrtam api prthivyädinäm sarirabhävenävasthitau sahabhävam tityaksatäm 4 svabhävabhedäd dhrtisahgrah<a>paktivyühävakäsadänäder5 upakärasya pracyutih / indriyädhisthänavikäräc chabdasparsarüparasagandhänäm 6 satäm agrahanam asatäm ca grahanam abhütäkäram sambhavaviparltam vä sarvärthänäm grahanam tadyathä paurnamäsyäm daksinatah khandasyendumandalasya, pisäcädinäm pändurasya ca nabhasa ityädi / tathä vätädivaisamyät samupajanitänekaprakäravyädhih 7 prabhrasyamänasakalendriyavrttih 8 srastängas tämrapitäsrävileksano bhramadähasväsädipariga<täntar>marmasandhir 9 jalärtham diso 'valokayan sabrahmalokesv api lokesu trätäram avindan rägädyanekakälätyaktenätmagrahenätmakäryakaranopahriyamänabuddhir mandamandesv api smrtipralambhesu dayitajanasyätmanas 10 cänusmaran dasavidhät kutumbäd yah prabhrasyate 11 <...(?)> / so ' y a m avasyambhävi 12 sarvasattvänäm prakrstodvegakän cävyutpannas cäparihäryas cäniyatakälas ca mahätmabhih paramarsyädibhir 13 andhatämisrasabdenäpadisto maranakrt<am> 14 duhkham / tac cedam duhkham pradhänamahadahamkäratanmätrendriyabhütavisesalaksanasya tattvaparvanas caitanyäsambhavät purusa eva caitanyasaktiyogäd upalabhate / tad api samiksyoktam äcäryena— atra jarämaranakrtam duhkham 15 präpnoti cetanah purusah / (SK55ab) iti /
J 2 D. visvopabhogesv, 3 D. abhihärasarigo, 4 D. titiksatäm 5

10

15

20

25

D. valttarangitagätram tvadandam, s.m. valitarangitamätratve dandam s.m. visayopabhogesv s.m. abhivyähärasarigo

K., B. and D.: dhrtisangrahäpaktivyühä0 P. dhrtisangrahäpanthivyühä0 We follow Chakravarti. 6 B. chabdasparsarasarüpagandhänäm 7 D. samupajanitänekaprakära0, s.m. samupajanitäpratikära0 8 D. prabhrsyamänasakale0 9 K. and P.: ° ädiparigamäntamarmasandhir B. ° ädiparigamäntamaranasandhih 0 D. brah madähasväsädiparigamäntamarana0, s.m. bhramadähasväsädiparigamättamarana We f low Chakravarti. 10 D. dayitajanasya ätmanas, s.m. dayitäjanasya ätmanas 11 B. and D.: prabhrsyate 12 B. avasyabhävT 13 D. paramarsädibhir 14 All the Mss read maranakrto. We follow Chakravarti. 15 D. jaramaranaduhkham

DASAMAM-EKADASAM AHNIKAM SK54,55

259

äha: janmakrtasyopasamkhyänam / yathaiva hi jarä maranam cätmanah prakrstodvegakärakam 1 evam janmäpi / tathä hy ayam mätur udare jaräyuparivestitasariro 'medhyaparipluto 2 vranamäträyäm garbhadhänyäm yathäsukham asambhavät 3 paripiditagätro 4 mätur asanädibhih pidyamäno garbhaväse duhkham anubhüya pascät samvrtenästhidvayavivarena nissrto mütrarudhirakalilaih parisiktagätro bähyena väyunä karais ca samsparsäd asibhir iva tudyamänah svasamvedyam duhkham ätmani vartamänam äkhyätum asamarthah svasukhaduhkhasämänyät 5 paratra parikalpitasukhaduhkhabuddhibhir 6 drdhagätrair uc<c>itaklesais7 ca yätyamäno janmaduhkham 8 anubhavati / tasmät tad api vaktavyam iti / ucyate: na avyäpitvät 9 / mänusatirascäm eva janmakrtam duhkham bhavati na devänäm / katham / tadidvilasitavat ksanamätrena sariraprädurbhävät / jarämaranakrtam tu tesv api na nivartate / tasmät prädhänyäd etad evopadistam netarad iti / äha: itaragrahanäprasangah tulyatvät 1 0 / na 11 hi devasthänesu jarä maranam vä srüyate / tasmäd avyäpitvät 12 tayor apy agrahanaprasahgah / ucyate: na <sruti>smrtivacanät / jiryate 'nayeti jarä(cf.Pän.3.3.104) ksaya ity uktam bhavati / sa ca devabhümäv api bhavati / kasmät / evam hy äha— rajovisaktir angesu vaivarnyam mlänapuspatä / patisyatäm devalokät präninäm upajäyate / / sakrädinäm vyädhisravanäc chariraksayah / evam hy äha "tvästriyam säma bhavatmdra<m vä ksyämayinam> na 1 3 sarvabhütäni prasväpayitum näsaknuvams 14 tarn etena sämnä tvästriyam sväpayat 15 "(Tän.Br.l2.5.18,19) iti / tathä prajäpater väyur aksayit 16 / daksäbhisäpäc ca somasya ksayah / tathä 1 7 "prajäpatir vai somäya räjne duhitrr ad an naksaträni sa rohinyäm evävasat / täny anupeyamänäni 18 punar agacchams tasmät stry anupeyamänä 19 punar
X D. prakrstotkä(1), s.m. prakrstodvegakäkam 2 P. 'medhyaparisnuto 3 D. not clear, s.m. yathäsukhasambhavät 4 K. and P.: paripiditagätro D. paripititagätro, s.m. paripiditagätro 5 D. sukhaduhkhasämarthyäC?), s.m. sukhaduhkhasämänyät D. omits sva of 6 D. parikalpitasukhaduhkhibhi, s.m. parikalpitasukhaduhkhabuddhir 7 A11 the Mss read ucitaklesais. 8 D. janmaduhkam, s.m. janmadrdhaduhkam(?) 9 D. avyäpyatvät, s.m. avyäpitatvät 10 D. adds tulyatvät na hi ... tayor apy agrahanaprasangah in the right margin. n D . adds katham before na. 12

5

10

15

20

25

svasukha0.

D. avyäpyatvät, s.m. avyäpitatvät K. and P. bhavati indraksyämayi na B. bhavati indraksyämayinana(?), s.m. °ksyämayina na D. bhavati indraksyämamayi na, s.m. bhagavattndraksyamäyinam 14 B. °nuva$ 15 D. tvästriyan sväpayad, s.m. tvästriyam sväpayed 16 B. aksasviyata D. aksayit, s.m. aksyasvayit 17 B. omits tathä ... yaksm<ä>d amuncad ityädi(259.25-260.8). K. anupeyamänäni P. anapeksamänäni D. anupiyamänäni, s.m. anupeyamänäni 19 P. not clear (it seems that P. corrects into stry anupeyamänä). D. anupeyamänäni(?), s.m. anupeyamänä

260

YUKTIDIPIKA

5

10

15

20

gacchati 1 tany anvagacchat tani punar ayacata / tany asmai na punar adadat / so 'bravit sarvesv eva samävad 2 vasätha te punar däsyämiti sa rohinyäm evävasat ta<m>3 tasminn anrte yaksmo 'grhnät / candramä vai somo räjä yad raj an am yaksmo 'grhnät / tad räjayaksmasya janma / sa trnam 4 iväsusyat sa prajäpatä anäthata / so 'bravit 5 sarvesv eva samävad vasätha tväto moksyämiti / tasmäc candramäh sarvesu naksatresu samävad vasati / tarn vaisvadevena carunämävasyäm rätrim ayäyajat / tenainam 6 yaksm<ä>d7 amuncat" (Käth.S.11.3) ityädi / tasmäd devabhümäv api jaräkrtam duhkham asti / tathä maranakrtam bhümyantaragamanät tatrotpannänäm yayätir udäharanam / tathä gopathabrähmanam "devänäm ha vä pancadasasatäny äsams täni brahmakilbisäd aksiyanta 8 / tatas trayastrimsad evästa / tad etad rcäpy uktam 9 / 'sodaryänäm paficadasänäm satänäm trayastrimsad udasisyanta deväh / sesäh präsiyanta 10 ' " iti / svetäranye cäntakasya rudrena krtam duhkham asti(cf.Räm.3.29.27cd) iti / <äha: ädisabdalopa> udäharanamäträd vä / athavodäharanamätram eva duhkhänäm / ädisabdalopo vä vaktavyah 11 / jarämaranädikrtam jarämaranakrtam / <jarämaranam> evodäharanatvenäbhipretam na punar duhkhäntaram / kasmät / taträpi hy 12 ädisabdalop<a> udäharanamätratvät 1 3 sak<yam>14 parikalpayitum idam iti / ucyate: na sarvaduhkhäspadatvät / sarvesäm hi duhkhänäm äspadam 15 jarämaranakrtam sädhäranam / katham / tadbandhumitränäm apy udvegahetutvät / na tu janmakrtam sambandhinäm praharsanimittatvät 16 / yatas ca brahmädau stambänte 17 jagati jarämaranakrtam duhkham na kascid ativartate 18 — LINGASYÄVINIVRTTES TASMÄD DUHKHAM SAMÄSENA //(SK55cd) sukhalesasya tena 19 vyäptatväd yävad idam Ungarn na nivartate tävad avasyam duhkhena bhavitavyam paryäyena samskärasya 20 sämarthyäl lokäntaropapatteh / tathä cäha—
2 D. samäsavad, s.m. samävad 3 All the Mss read tat. 4 D. satrnam 5 D. 5a prajäpatänäthatamo 'bravit 6 P. yajante nainam 7 All the Mss read yaksmod 8 D. aksiyanta, s.m. aksayanta 9 D. evästa tad etad rcäpi uktam, s.m. avasisyanta 10 D. prämxyanta 11 B. drastavyah D. vaktavyah, s.m. drastavyah 12 Before hy D. writes and deletes a. 13 0

25

punar gacchati D. writes and deletes punar agaccham.

ete trayastrimsad deväs tad apy uktam

K., P. and D.: ädisabdalopayudäharana B. ädisabdalope udäharana0 We follow Chakravarti. 14 All the Mss read saktyä. 15 After äspadam D. adds jarämaranakrtam ca tathä sädhäranatvät. 16 D. praharsahetutvät, s.m. praharsanimittatvät 17 K., P. and D.: stambaparyante 18 D. ativartate, s.m. anuvartate 19 K. and P.: te 20 D. samskärasya, s.m. samskärä

DASAMAM-EKÄDASAM ÄHNIKAM SK55,56

261

sukham ca duhkham <cänu>sayam1 ca värenäyam sevate tatra tatra / / (cf.e.g.DNC.I.p.267.1) katham punar duhkhena vyäptam sukham iti ced ä brahmano 'suddhiksayätisayopapattes tasyäs ca2 duhkhamülatvät / prajäpater aksirogasravanät, indrasya kämopatäpät 3 gautamaparibhäväd rambhäyäs cäbhisäpät päsänabhävopapatteh, nägänäm sarpasatträyäsät, vaisravanasya ya<ksä>bhisäpäd 4 dhastibhävopapatt<e>h 5 , jaratkäroh pitrnäm ca garte Valambanät, pisäcänäm mantrausadhimangalaprayogair 6 udväsanät, mänusatirascäm pratyaksata eva präyena duhkhäspadatvät / tasmän nästi samsäre kascit pradeso yatra saha lirigenätmänam 7 duhkham näväpnuyäd ity ata evam prayatitavyam yena liiigasyaivätyantocchedah / tato hi sarvaduhkhänäm atyantopasamah 8 / samäsagrahanam tu sukhamohayor avakäsadänärtham / anyathä samsäre tayor abhäva eväbhyupagatah syät / / 5 5 / / evam yathävat sargam upäkhyäyopasamharann äha— ITY ESA PRAKRTIKRTAH9 PRAVARTATE10 TATTVABHÜTABHÄVÄKHYAH / PRATIPURUSAVIMOKSÄRTHAM SVÄRTHA IVA PARÄRTHA ÄRAMBHAH / / (SK56) ifcikaranena sargasamäptim dyotayati / esa ity uktam api pratyämnäyärtham punar apeksate / prakrtyä krtah prakrtikrtah / anena väkyaparisamäptyartham vitävitäbhyäm siddham pradhänästitvam anvädipratisedham cäpeksate / prakrtikrta eva nänvädikrtah / pravartata iti kriyäprabandham 11 äha / <na> pravrtto na pravartsyati / kirn tarhi / pravartata evänant<aräyam>12 sarirädibhävena parasparänugrahena ca / neyam kriyä kadäcid api bhütabhavisyadrüpä bhavati / kirn tarhi / vartamänarüpä / yathä "vahanti nadyas tisthanti parvatäh" (cf.MBhäsya.II.123.6fF.) iti / tattvabhütabhäväkhya ity uktänäm nigamärtham pratyämnäyam karoti / tattväkhyo mahadädir bhäväkhyo dharmädir bhütäkhyo <brah>mädih 13 / purusam purusam prati vimoksah pratipurusavimoksah / tadartham pratipurusavimoksärtham / sarvapurusädhikäranibaddhäyäh sarvasakter niräkänksikaranärtham ity arthah / svärtha iva
1 A\\ the Mss read ca hi samsayam. 2 Before tasyäs ca D. writes and deletes 3 B. indrakämo0 4 All the Mss read yaskäbhi0. 5 K., B. and D.: dhastibhävopapattih 6

5

10

15

20

25

tathä cäha.

P. vastibhävo0 We follow Raghavan. D. ° ausadhimangaprayogair, s.m. ° ausadhimangalaprayogair D. sahalingena ätmänam, s.m. mahälingena ätmänam 8 D. atyantopasamah, s.m. atyantopayogah 9 D. prakrtigatah(?), s.m. prakrtikrtah 10 B. pravartete 11 D. kriyäpradhänam, s.m. kriyäprabandham 12 All the Mss read evänantänäm. K., P. and D.: vyomädih B. dharmädih

262

YUKTIDIPIKA

5

10

15

20

25

30

parärtha ärambhah1/ karyak<a>ranabhavena 2 / tatra karyasya tavac chabdadeh svärtha ivendriyänäm visayabhävah / indriyänäm apräptavisayänäm laulyam adhisthänavikäränumeyam svärtham iva karanänäm ca samkalpäbhimänädhyavasäyänäm visayadväribhävopagamanam manahprabhrtinäm ca svapravrttivisayatvam mano'hamkärayos ca buddhau svapravrttyupasamhäro 3 buddhes ca säntaghoramüdhatvam vyavasäyakartrtvam ca sattvarajastamasäm ca prakäsapravrttiniyamalaksanair dharmaih parasparopakäritvam 4 / na caisa svärthah sarvasyäsyäcaitanyät / kirn tarhi / parärtha eväyam ärambhah sanghätatväd iti / äha: yad uktam(SK56) pratipurusavimoksärtham ayam ärambha iti tad ayuktam äcäryavipratipatteh / pratipurusam anyat pradhänam sarixädyartham karoti / tesäm ca mähätmyasarirapradhänam yadä pravartate tadetaräny api / tannivrttau ca tesäm api nivrttir iti paurikah sämkhyäcäryo manyate / tat katham apratisidhyaikä prakrtir abhyupagamyata iti / ucyate: na prämänäbhävät / na tävat pratyaksata eva tac chakyam niscetum pradhänänäm atindriyatvät / lihgam casandigdham nasti / äptäs ca no näbhidadhuh 5 / ato manyämahe naitad evam iti / kirn ca ekenärthaparisamäpteh / aparimitatväd etad ekam pradhänam alam sarvapurusasarirotpädanäya / tasmäd anyaparikalpanänarthakyam / parimitam iti cet / atha matam parimitam pradhänam iti / na ucchedaprasangät / evam api tasyocchedah präptah ksiravat tathä ca samsärocchedaprasangah / kirn ca anavasthäprasangät / ekasyesvarasya yogino vecchäyogäd anekasariratvam tatparimi<tatväd> ayuktam 6 / pratisariram väpradhänaparikalpane pradhänänavasthä bhavati / parimitasarirakäranatväbhyupagamäd 7 anyaparikalpanänarthakyam / tatas ca pradhänaikatvam eva / tasmäd ayuktam pratipurusam pradhänämti 8 / yat tüktam(262.12) mähätmyasarirapradhänapravrttäv 9 itaresäm pravrttis tannivrttau nivrttir ity atra brümah: na atisayäbhävät / yathä ksetrajnänäm niratisayatväd itaretaräpravartakatvam evam esäm api, sätisayatve vä pradhänänupapattiprasango vaisamyät / tasmäd yuktam pratipurusavimoksärtham ekä prakrtih pravartata iti / / 5 6 / / äha: tadanupapattir äcaitanyät / ihäcetanänäm ghatädinäm uddisya <artham(?)> pravrttir adrstä / sä ced iyam acetanä 10 prakrtir asyä apy uddisya purusärtham pravrttir nopapadyate / bhavati cec caitanyam tarhi präptam asyäh / tatra yad uktam(SK56c) pratipurusavimoksärtham prakrteh pravrttir
1 D. parärthärambhah, s.m. parärtha ärambhah 2 K., P. and B.: käryakäranabhävena D. käryakärana bhävena, 3 B. svavrttyupasamhäro D. encircles pra of svapravrtty0. 4 B. parasparopikäritvam 5 D. ca no näbhidadhur, s.m. codanenäbhidadhur 6 K., P. and D.: tatparimitäd ayuktam B. tatparimitätmayuktam 7 D. parimita0, s.m. aparimita0 8 D. pradhänäny eti, s.m. pradhänämti 9 B. and D.: mahätmya0 10

35

s.m. käryakäranabhävena

D. acenä, s.m. acetanä

DASAMAM-EKADAgAM AHNIKAM SK56,57 ity etad ayuktam iti / ucyate: na drstantopapatteh /

263

VATSAVIVRDDHINIMITTAM KSIRASYA YATHÄ PRAVRTTIR AJNASYA / PURUSAVIMOKSANIMITTAM TATHÄ PRAVRTTIH PRADHÄNASYA //(SK57) yathä kslram acetanam vatsavivrddhim uddisya pravartata evam pradhänam api purusavimoksam uddisya pravartate na cäsya caitanyam syät / sädhyatväd ayuktam iti cet / syän matam / sädhyam etat kim ksirasyoddisya vatsavivrddhim pravrttir atha neti / tasmäd udäharanam sädhyatväd ayuktam iti 1 / etac cäyuktain / kasmät / tadabhäve 'bhävät tadbhäve ca bhävät / yatra nästi vatsavivrddhis tatra na ksirasya pravrttir upalabdhä / yaträsti tatropalabdhä 2 / yad yasmin sati bhavati tasya tadarthä pravrttir drstä tadyathä ghate kumbhakärasya / sa cäyam Idrso 'smäkam uddeso 'bhipreto yad uta tädarthyam / tasmän nästy udäharanasädhyatvam iti / asadbhäväbhidhänät satkäryavirodha iti cen na vyaktiparyäyatvät / vyaktiparyäyo hi <s>ad3 iti sästralokaprämänyät / sästram tävat "sattämätro mahän" (cf.YBh. onYS.2.19) / vyaktimätra ity arthah / loke 'pi nästy asmin küpe salilam ity ucyate / na kvacid api küpe salilam nästi, abhivyaktam tu tad bhavati / tasmän na satkäryavirodhah / adrstapreranatväd asiddhir iti cet / atha matam / dharmädharmapreritam ksiram pravartate na vatsavivrddhyartham iti / tad apy ayuktam / kasmät / dosasämyät / dharmädharmäv acetanau vivrddhikäle ksiram pravartayatas tadavasäne ca nivartayatah 4 / tasmäd ittham 5 api parikalpyamäne samäno dosah / Tsvarapreranäd iti cet / syän matam / Isvaras tatra ksiram pravartayate vatsärtham, na svayam iti / tad ayuktam / kasmät / pratisedhät / präk pratisiddham(157.20ff.) Isvarakarma / tasmäd idam apy ayuktam / evam ced avasthito drstäntah / värsaganänäm tu yathä strlpumsarlränäm acetanänäm 6 uddisyetaretaram pravrttis tathä pradhänasyety ayam drstäntah / äha: katham avagamyate tädarthyäd utpannena vyaktena purusasya sambandho na punah sännidhyamäträd <krsi>bhiksuvad7 iti / ucyate: na anapavargaprasangät 8 / sännidhyamäträt purusopabhogam abhyupagacchato <'na>pavargaprasangah9 syän nityasännidhyät / tasmäd ayuktam etat / apravartayitäram prati käryak<a>ranänäm 10 pravrttir ayukteti cet / syän matam / apravartayitä krsyädinäm bhiksuh / ato na tesäm api tarn prati pravrttih / evam apravartayitä käryakaranänäm purusah / tasmät tesäm api tarn prati pravrttir ayukteti / etad 1 1 api <...> ata evänaikäntikam /
1 D. sädhyatväd iti, s.m. sädhyatväd ayuktam iti 2 B. tatra copalabdhä 3 K., P. and D.: tad B. omits tad. 4 D. pravartayatas, s.m. nivartayatas 5 P. not clear. 6 B. acetanäm 7 A11 the Mss read bhiksuvad. 8 K., P. and D.: anavarga0 9 A11 the Mss read °gacchato näpavargaprasangah. 10 All the Mss read käryakaranänäm. We follow Chakravarti. ll

5

10

15

20

25

30

35

B. ed

264

YUKTIDIPIKA

vatso hi ksirasyapravartayitatha ca tarn prati tasya pravrttih / tasmad yuktam etat purusavimoksärthä 1 prakrteh pravrttir na 2 caitanyaprasariga iti / / 5 7 / / äha 3 : na apravrttiprasangät / yadi pradhänasya purusakaivalyärthä pravrttis tena tadabhäve kaivalyam siddham evety apravrttiprasangah / atha kevale puruse pradhänam 4 pravartate na tarhy asya tadarthä pravrttir iti / ucyate: AUTSUKYANIVRTTYARTHAM YATHÄ KRIYÄSU PRAVARTATE LOKAH / PURUSASYA VIMOKSÄRTHAM PRAVARTATE TADVAD AVYAKTAM //(SK58) 10 präg evaitad apadistam(SK21) yathä drsyadarsanasaktiyuktatväd 5 anyataräbhäve ca tayor änarthakyät 6 pradhänapurusayor itaretarasambandham praty autsukyam / drstä coparamärthäpi lokasyautsukyanivrttyarthä pravrttih / tathä pradhänasyäpy uparamärthä pravrttih / atha drsyadarsanasaktyor autsukyanivrttyartham pravartata iti / ekatra krtärthatväd itaresv apravrttiprasanga iti cet / syäd etat / pradhänam ekasya purusasyätmänam prakäsyoparamed evam 7 drsyadarsanasaktyor autsukyanivrttir bhavisyaty apravrttis ceti / etad 8 api nopapannam 9 / kasmät / drstäntäntarasämarthyät / tadyathä kim / ucyate: RANGASYA DARSAYITVÄ NIVARTATE NARTAKI YATHÄ NRTYÄT10/ 20 PURUSASYA TATHÄTMÄNAM PRAKÄSYA VINIVARTATE PRAKRTIH / / (SK59) tatra 1 1 nänävarnasvabhävavijnänänäm preksärthinäm purusänäm sahghäto rahga ity ucyate / nartakyäs ca tadärädhanä 12 nrttakriyänekapurusärthä 13 / yadi vätra kascid brüyän nrttäcäryena 14 kusllavair vä drstaiveyam 15 kasmän na nivartata 16 iti tac cäpy asau krtsnasya rangasyautsukyänuparamän na nivartate / katham / akrtärthatvät / evam sarvapurusänäm käryakaranasambandhenautsukyavatäm 17 niräkänksikaranärtham pravrttä prakrtih katham 1 8 ekasya
X P. vimoksärtham 2 D. prakrtir na, s.m. prakrteh pravrttir na 3 D. writes and deletes äha after iti, and then starts a new line with äha. 4 B. pradhänam pradhänam 5 B. omits -sakti-. 6 D. änarthakyät 7 D. prakäso parame devam 8 D. ceti, s.m. cety etad 9 B. apy anupapannam 10 P. nyatyät n B . tatra tatra 0 12 D. tadäräthanä , s.m. tadärädhanä 13 P. nrtukriyä0 14 D. nrttäcärena 15 K. and D.: drstyaiveyam 16 K., P. and D. omit nivartata0 ... rangasyautsukyänuparamän. 17 K., P. and D.: käryakärana 18

5

15

25

B. omits katham .... atra ca ... / ... käryakara-(264.25-265.4).

DASAMAM-EKÄDASAM ÄHNIKAM SK57,58,59,64,67

265

purusasyautsukyanivrttau krtärthä syät / tasmän naikasya purusasyätmänam prakäsya prakrter nivrttir yuktä iti / atra ca 1 / käryakaranakriyäsäksi purusah / tasmäd ye bhautikäh sirahpänyädayo ye cähamkärikäh sravanädayo vacanädayah samkalpäbhimänädhyavasäyäs ca te laksanaviparyayän näh am <...(?)> nästau prakrtayah <...(?)> / tad etad evam tattvänäm abhyäsaikägramanaso yateh punah punar abhyäsäd ekasyäpy asmitärüpasya parikalpitavisaya<sya> bhedapratisedhamukhena 2 — NÄSMI NA ME NÄHAM ITY APARISESAM / (SK64b) ä prakrteh pratipaksagrahanäd— AVIPARYAYÄT / (SK64c') pancasrotaso 'syävidyäparvano 3 nivrtteh säntam dhruvam sakalabhävä<bhävä>nubandhapratipaksabhütam 4 dharmädyäpyäyitasyabuddhitattvasyäsandigdham aviparitam— VISUDDHAM KEVALAM UTPADYATE JNÄNAM / / (SK64c'd) äha: visuddham kevalam <iti> anyataränabhidhänam 5 arthäbhedät / yad eva visuddham tad eva kevalam ity arthäbhedäd anyatarac chakyam 6 avaktum iti / ucyate: gunäntararüpanivrttihetutvät / rajastamodharmänäm tävad prahänäc chuddham / samsayaviparyayavyatiriktam 7 ca kevalam ksetrajnaparijnäne 'pürvabhava 8 iti / / 6 4 / / äha: tatsamakälam eva sarirasya pätah präpnoti / sati dha 9 ... vasthäne näjnänahetukam 10 sariram iti / ucyate: ajfiänahetukam sariram 11 / atha cäyam nänätvadarsi—
DHARMÄDINÄM AKÄRANAPRÄPTAU /

5

10

15

20

TISTHATI SAMSKÄRAVASÄC CAKRABHRAMAVAD DHRTASARIRAH / / (SK67bcd)
1 After atra ca K. and P. mark a lacuna for the 2 All the Mss read parikalpitavisayabheda0 . 3 B. pancaparvane 'syävidyäsrotaso 4 K., P. and D.: sakalabhävänubandha0 B. 5 B. °bhidänam 6 D. anyatarasa, s.m. anyatarac chakyam 7 D. samsarya0, s.m. samsaya0 8 B. (')pürvabhäva D. pürvabhäva 9 B. does not indicate a lacuna after dha. 10 D. vasthänena ajfiänahetukam 11

25

rest of the folio. sakalabhävävabandha0

B. cäsya sariram

266

YUKTIDIPIKA

5

10

yada 1 sanrantaroparjita dharmadayo na tavat karanam, buddhilaksanam upasampräptä 2 <k>rtärthatväd 3 buddhis ca pradhänam tadä tisthaty ayam nänätvadarsi tasya samskärasya sämarthyät / ko drstäntah / cakrabhramavad dhrtasanrah / tadyathä kumbhakäraprayatnavisistena dandena ghatädinispattiyogyä kriyä cakrasya4 bhramah, tena tulyam cakrabhramavat / yathä cakrabhramanam ghatärtham nispanne ghate pürvasamskäränurodhän na nivartate na ca tadä nivrttam iti krtvä samskäraksaye 'py avatisthate, evam samyagdarsanärtham sariram samyagjnänädhigame Jpi na nivartate pürvasainskäravasät / na ca tadä nivrttam iti krtvä sarnskäraksaye 'py avasthäpyata i yadä tu samskäraksayas tannimittasya sarirasya bhedah / atah— PRÄPTE SARIRABHEDE / (SK68a) dharmädharmau krtärthau kärane 5 buddhilaksane 6 layam gacchatah / yas cäsya bhütävayavah sarirärambhakah sa sarvabhütesu, bhütäni tanmätresu, indriyäni tanmäträni cähamkäre, ahamkäro buddhau, buddhir avyakte / seyam tattvänupürvi 7 tadartham prädhänäd utpannä, parisamäpte 'syärthe 8 punah pradhäne pralayam gacchati / pradhänam apy arthavasäd eväsya sariräni tesu tesu jätyantaraparivartesu karoti / sa cärthas caritärthah / atah— CARITÄRTHATVÄT PRADHÄNAVINIVRTTAU9 /(SK68b)

15

20

atindriyam asamvedyam laghu sarvatra sannihitam prasastam anirmitam visuddham aksayam niratisayam— AIKÄNT<IKAM>10 ÄTYANTIKAM ABHAYAM KAIVALYAM ÄPNOTI / / (SK68cd)

25

etac cävasthänam bauddhair <nirupadhisesanirvänam ity ayam> n apavargo vyäkhyätah / etat param brahma dhruvam amalam abhayam / atra sarvesäm gunadharmänäm pratipralayah / etat präpya sarväyäsaih sarvabandhanair anädikälapravrttarägadvesa<ir> viyukto 12 mukto bhavati / etadartham brähmanä dayitaputradäradhanasambandham 13 apahäya gurususrüsäparäh sariram P. and D. indicate a lacuna after ya instead of yada. K., P. and D. read buddhi m upasampräptä, indicating a lacuna after buddhi. 3 All the Mss read akrtärthatväd. 4 D. °nispattiyogyah kriydcakrasya 5 D. tärane 6 B. käranabuddhilaksane 7 P. tattvänapürvi 8 P. omits 'syärthe. 9 B. pradhänanivrttau. D. pradhänavari(l), s.m. pradhänavinivrttau 10 All the Mss read aikäntam. We follow Chakravarti. 11 K., P. and D.: nirupädhiviSesanirvänalaksanam B. nirupädhivisesanirvänam ity ayam 12 All the Mss read °pravrttarägadvesaviyukto. 13 B. °putradärädhana0
1 K., 2

DASAMAM-EKÄDASAM ÄHNIKAM SK67,68,69

267

aranyesu 1 yätayanti katham nämaikäntikam ätyantikamca kaivalyam syäd iti / yatraivotthänam sästrasya tatraivopasamhära äcäryena krtah / / 6 8 / / äha: kimartham punar idam sästram kena vä pürvam prakäsitam iti / ucyate: yad uktam kimartham iti— PURUSÄRTHÄRTHAM2/ (SK69a') katham nämäjnänavasät tatsamskäropanip<a>titänäm 3 präninäm apavargah syäd ity evamartham— IDAM SÄSTRAM / (SK69a') vyäkhyätam / yad tüktam keneti / ucyate: GUHYAM PARAMARSINÄ SAMÄKHYÄTAM /(SK69b) guhyam iti gühaniyam rahasyam akrtätmanäm yamaniyamesy anavasthitänäm ädaräd 4 apy anadhyeyam / paramarsir bhagavän sämsiddhikair dharmajnänavairägyaisvaryair ävistapindo visvägrajah kapilamunih / tena kapilamuninä samäkhyätam samyag äkhyätam 5 ciräbhyastasya vidyäsrotaso 6 nirvacanasämarthyät / syäd etat katham 7 idam guhyam iti / ucyate: katham vedam guhyam na syät / bhavägrotpannair api sanakasanätanasanandanasanatkumäraprabhrtibhir anityänäm— STHITYUTPATTIPRALAYÄS CINTYANTE YATRA BHÜTÄNÄM / / (SK69cd) tatra sthitis tävad rüpapravrtt<i>phalanirdesenotpatair 8 api "prakrter mahän" (SK22a') ityädih / pralayo 'pi "avibhägäd vaisvarüpyasya9 " (SK15d) iti vacanät / autsukyänuparamät prakrtipurusayoh sthitih / utpattir drsyadarsanasaktyoh 10 säpeksatvät / tathä coktam— purusasya darsanärthah kaivalyärthas tathä pradhänasya / pangvandhavad ubhayor api samyogas tatkrtah sargah / / (SK21) iti / pralayah—
l P. aranesu 2 B. purusärtham 3 All the Mss read ° opanipätitänäm. We follow Pandeya. 4 B. äräd 5 D. adds samyag äkhyätam in the right margin. 6 D. ciräbhyastavidyäsrotaso 7 After katham D. writes and deletes etad guhyam. 8 All the Mss read rüpapravrttih phalanir0. We follow Chakravarti. 9 B. B vaisvarüpasya i ü 10

5

10

15

20

25

D. sthityutpattidrsyadarsana

268

YUKTIDIPIKA prapte sanrabhede caritarthatvat pradhanavinivrttau /(SK68ab)

5

10

iti / athavä sthitih ksanabhangapratisedhät käläntaresv asyänäsäd 1 , utpattir viparinämän näbhütaprädurbhäväd akasmäd asambhavät, pralayo 'pi nimittäntarän na tatsväbhävyäd eva / bhütänäm api vyaktänäm nispattimatäm iti yävat / evam ca mahadädayo 'pi parigrhitä iti / äha: purusädayas tarhi parityaktäh / katham vä bhütasabda 2 iti / ucyate: vitathapratisedhärthatvät / yävat kimcid avitatham bhütam tasya 3 sarvasyeha sthityädaya ucyanta iti / <äha:> utpattivinäs<au> pratisedhävisesät 4 / evam api purusädinäm 5 utpattipralayäv api präpnutah / kirn käranam / avisesäd iti / ucyate: sambhavato visesanam bhavati / tatra sthitir eva purusädinäm / itaresäm tu sthityutpattipralayä iti vijnäsyämah / / 6 9 / / äha: kasmai punar idam sästram paramarsinä 6 prakäsitam iti / ucyate:

15

ETAT PAVITRAM AGRYAM MUNIR ÄSURAYE7 'NUKAMPAYÄ PRADADAU8 / (SK70ab) tatra pavitram pävanät(cf.Nir.5.6) / agryam sarvaduhkhaksapanasamarthatvät / paviträntaräni punar ek<de>sam9 ksälayanty aghamarsanagangädlni / tasmäd idam evägryam munir äsuraye 'nukampayä pradadau / äha: sampradänasyäkasmikatvarn dharmädinimittänupapatteh / na tävät paramarser dharmärtham sästrapradänam u<pa>padyate10 phalenänabhisvahgät 11 / närthakämärtham sisyänäm anäyäsaprasangät 12 / na moksärtharn sämsiddhikenaiva jnänena tatpräpteh / na tadviparitärtham 13 asambhavät / parisesäd akasmäd äcäryah sästranidhänam 14 pradadäv iti / ucyate: na akasmät kirn tarhi anukampayä pradadau / ädhyätmikädhidaivikädhibhautikair 15 duhkhaih pldyamänam äsurim upalabhya, svätmani ca jnänasämarthyät sati käryakaranasamprayoge 16 duhkhänäm apravrttim pari1 D. asya nasäd 2 D. bhütasabda 3 B. bhütasya instead of bhütam tasya 0 4 All the Mss read utpattivinäsapratisedhä . 5 D. purusädtnäv{l) 6 D. maharsinä, s.m. paramarsinä 7 D. munir äsunir äsuraye 8 B. pradadäv iti 9 All the Mss read ekädasam. We follow Pandeya. 10 All the Mss read utpadyate. We follow Raghavan. n B . tatphalenä0 12

20

25

K., P. andD.: ana ... sa° B. anäsväsa°(l) The lacuna of P. is filled with yäsa by adifferent hand. 13 K., P. and D.: tadmäd viparitärtham 14 B. sästram äsuraye 15 B. ° ädhibhautikädhidaivikair 16 K., P. and D.: käryakärana0

DASAMAM-EKADASAM AHNIKAM SK69JQ,71

269

jnäya sisyagunäms ca, katham näma yathä mama sukhaduhkhesu jnänopanipätät sämyam evam äsurer api syät, taddvärenänyesäm api purusänäm <ity > evam anukampayä bhagavän 1 paramarsih sastram äkhyätavän / yathä ca paramarsir äsuraye tathä— ÄSURIR API / (SK70c') dasamäya kumäräya bhagavatPANCASIKHÄYA TENA CA BAHUDHÄ KRTAM TANTRAM / / (SK70c'd) bahubhyo janakavasisthädibhyah samäkhyätam / asya tu sästrasya bhagavato 'gre pravrttatvän 2 na sästräntarava<d>3 vamsah sakyo varsasatasahasrair apy äkhyätum / samksepena tu dväva 4 ... härita<bäddhali>kairätapaurik<a>rsabhesvarapancädhikaranap<a>tanjalivärsaganyakaundinyamükädika-5 SISYAPARAMPARAYÄGATAM / (SK71a) [bhagavän Isvarakrsnas ca] sähäyakam sästram / pürväcäryasütraprabandh<o>6 guruläghavam anädriyamä<nah> purätanäkhyänavyäkhyänaväky<änu>vyäkhyänagarbham atipramädam dadätiti 7 granthabhüyastvam upajäyate / tac cedänlntanaih pränibhir alpatväd äyuso granthata eva na süpapädam kirn punah sravanaprayogäbhyäm / äha ca "caturbhih prakärair vidyopayuktä 8 bhavaty ägamakälena svädhyäyakälena <pravacanakälena> prayogakälena ca / tatra cäsyägamakälenaiväyuh paryupayuktam syät>?(cf.MBhäsya.I.6.1f.) <iti> / tatas ca sästränarthakyam ity asya mandadhiyäm apy äsu grahanadhäranaprayogasampat 9 syäd iti sastitanträd upäkhyänagäthävyavahitäni väkyäny ekata upamrdya 10 sisyänukampärtham yävat— ISVARAKRSNENA CAITAD ÄRYÄBHIH / (SK71b) saptatyä— SAMKSIPTAM ÄRYAMATINÄ / (SK71c) sarvasattvahitapravrttena— SAMYAG VIJNÄYA SIDDHÄNTAM / / (SK71d)
l B. bhavän 2 K., B. and D.: 'grapravrttatvän 3 All the Mss read sästräntarava ... 4 recte devala(?) 5

5

10

15

20

25

. We follow Chakravarti.

K., P. and B. read häritavädvalikairätapaurikaursa0 and °pätanjali°. D. °paryaka°, s.m. °paurikausa° We follow Chakravarti. 6 K., P. and D.: °sütraprabandhe B. °sästrasambandhe K., P. and D.: anädriyamänapaurastyän vyäkhyänavyä nagarbham atipramädam dadätiti B. anädriyamänapaurastyän vyäkhyänavyäkyänavyäkhyänagarbham atipramä dadhatiti 8 K., P. and D.: vidyä süpayuktä 9 B. grahadhäranam prayogasampat 10 B. and D.: upapädya

270

YUKTIDIPIKA

katham casya samyaksiddhantavijiianasyapy 1 anekagranthasatasahasrakhyeyam sämkhyapadärthasatattvam 2 akhandam äryanäm saptatyä samksipta<m>3 äha ca— 5 SAPTATYÄM KILA YE 'RTHÄS TE 'RTHÄH4 KRTSNASYA SASTITANTRASYA / ÄKHYÄYIKÄVIRAHITÄH5 PARAVÄDAVIVARJITÄS CÄPI6 //(SK72) yatas ca näräyanamanujanakavasisthadvaipäyanaprabhrtibhir 7 äcäryaih pradhänapurusädayah padärthäh parigrhitäs copadistäs ca prasastäs cätah svabhävatah prasiddham aisvaryasya phalata rjv äryamärgam 8 alam kartum iti bhagavadisvarakrsnena padärthasvarüpanirüpananipunasäramatinä paramarsyädiyathoktägamena pramänatrayam puraskrtya tarkadrsä vicärah krtah / na cäsya mülakanakapindasyeva svalpam api dosajätam astiti / äha ca— ajnänadhväntasäntyartham rsicandramasas 9 cyutä / malinais tlrthajaladais chädyate jnänacandrikä / / 15 iti sadbhir asambhräntaih kudrstitimiräpahä / prakäsikeyam sarvasya 10 dhäryatäm yuktidlpikä / / sphutäbhidheyä madhuräpi 11 bhäratl manisino nopakhalam viräjate / krsänugarbhäpy abhito himägame kadusnatäm yäti diväkaradyutih / / nayanti santas ca yatah svasaktito gunam paresäm tanum apy udäratäm / 20 iti prayätv esa mama sramah satäm vicäranänugrahamätrapätratäm 12 // iti yuktidipikäyäm sämkhyasaptatipaddhatau caturtham prakaranam ekädasam cähnikam / samäptä ceyam yuktidlpiketi sivam 13 /

10

1 B. casysamyaksiddhanta0 2 B. °padärthasattvam 3 All the Mss read samksiptavän. 4 D. tirthäh 5 D. äkhyäyikä virahitäh 6 B. ceti 7 D. näräyanananujanakabasistha0(?), s.m. näräyanamanujanakavasistha0 8 P. not clear. 9 B. rsticandramasas 10 K. and P.: sargasya B. sarvasya, s.m. sargasya D. not clear. 11 B. madhuräd api 12 B. °mätrapätram 13

B. subham P. cähnikam // sampürnam krtir iyam sriväcaspatimisränäm sivam om tat sat // om hari instead of sivam

A p p e n d i c e s

A p p e n d i x I.

Bibliography

[1] Editions of the Yuktidipika 1. Yuktidipika, edited by Pulinbehari Chakravarti, Calcutta Sanskrit Series No.23, 1938, Calcutta. 2. Yuktidipika, An Ancient Commentary on the Sämkhya-Kärikä of Isvarakrsna, edited by Ram Chandra Pandeya, 1967, Delhi-Varanasi-Patna. 3. Isvarakrsnaviracitä Sämkhyakarikä, Räma-Sankara-Tripäthiviracitayä Tattvaprabhäkhyä Vyäkhyayä Ajnätakartrkayä Yuktidipikäkhyayä Vivrtyä ca Vibhüsitä, edited by Räma Sänkara Tripäthi, 1970, Varanasi. 4. Yuktidipika, With the Hindi Commentary 'Kalä' by Acäryasri Kedäranätha Tripäthi, edited by Acäryasri Kedäranätha Tripäthi, GangänäthajhäGranthamälä vol.15, 1996, Varanasi.

[2] Monographs and Articles on the Yuktidipika 1. Koki Aruga, Some Problems of anumäna in Sämkhya, JIBS vol.39-2 (1991), pp.1044-1042. 2. , On Väcaspatimisra's Explanation of the Cause of samyoga, JIBS vol.41-2 (1993), pp.1131-1127.

3. Johannes Bronkhorst, God in Sämkhya, WZKS vol.27 (1983), pp.149-164. 4 known to ? ^4 Possible Quotation from the Niruktavärttika Durga in the YuktidTpikä, Proceedings of the Fifth World Sanskrit Conference, New Delhi (1985), pp.90-100. , Värttika, WZKS vol.34 (1990), pp.123-146. , The Qualities of Sänkhya, WZKS vol.38 (1994), pp.309-322.

5. 6.

272 7.

APPENDIX I , Once Again Vaisesika sutra 3.1.13, Asiatische Studien, vol.XLVIII-2 (1994), pp.665-681.

8. Pulinbehari Chakravarti, Origin and Development of the Sämkhya System of Thought, Calcutta 1951; Second Edition Delhi 1975. 9. George Chemparathy, The Testimony of the Yuktidtpikä concerning the Isvara Doctrine of the Päsupatas and Vaisesikas, WZKSO vol.9 (1965), pp.119-146. 10. Edeltraud Harzer Clear, Isvarakrsna's Two-Level-Perception: Propositional and Non-Propositional, JlPh vol.18 No.4 (1990), pp.305-340. 11. R.C.Dwivedi, Concept of the Sästra, Indologica Taurinensia, vol.XIII (1985-86) pp.43-60. 12. Eli Franco, Whatever happened to the Yuktidtpikä?, WZKS vol.35 (1991) pp.123-137. 13. Erich Frauwallner, Die Erkenntnislehre des klassischen Sämkhya Systems, WZKSO vol.2 (1958), pp.84-139 = Kleine Schriften, hrsg. v. G.Oberhammer und E.Steinkellner, Wiesbaden 1982, pp.223-278. 14
? Landmarks in the History of Indian Logic, WZKSO vol.5 (1967), pp.125-148 = Kleine Schriften, hrsg. v. G.Oberhammer und E.Steinkellner, Wiesbaden 1982, pp.847-870.

15. Kazuyuki Funatsu, Sänkhya Gakuha ni okeru Jissenron (I —Yuktidtpikä to Kinshichijüron o Chüshin ni) (On the Practical Theory of Sänkhya Philosophy with a Focus upon the Yuktidtpikä and the Suvarnasaptati), JIBS vol.27-2 (1979), pp.668-669. 16. Megumu Honda, Pancädhikarana (1975), pp.518-514. 17. 18. a Sämkhya teacher, JIBS vol.24-1

, karmayoni, JIBS vol.26-1 (1977), pp.511-506. , Yuktidtpikä Zakkö (Notes on the Yuktidtpikä), JIBS vol.27-1 (1978), pp.64-69.

19. Shiv Kumar and D.N.Bhargava, Yuktidipikä, Delhi, vol.1, 1990; vol.2, 1992. 20. Shiv Kumar, Sämkhya-Yoga Epistemology, Delhi, 1984. 21. G.J.Larson, The pratyaya-sarga or "intellectual creation" in Classical Samkhya as interpreted by the Yuktidtpikä, Religion and Society in Ancient India, Sudhakar Chat topadhy ay a Commemoration Volume, Calcutta (1984), pp.60-71.

BIBLIOGRAPHY

273

22. Esho Mikogami Samkhyakarika Daishichige o megutte ( On the Samkhyakärikä v.7), JIBS vol.28-2 (1980), pp.903-896. 23. , Yuktidipikä ni okeru Apoha Setu Hihan-äptavacana to pratibhä wo megutte ( A Criticism of Apoha in the Yuktidipikä: äptavacana and pratibhä), Indian Thoughts and Buddhist Culture, Essays in Honour of Professor Junkichi Imanishi on His Sixtieth Birthday, (1996) Tokyo, pp.790-777.

24. Hisayoshi Miyamoto, Sämkhya Tetugaku ni okeru Jikan Gainen (The Concept of Time in the Sämkhya Philosophy)', Töyö Kenkyü, vol.91 (1989), pp.27-49. 25. Meizo Motegi, Yuktidipikä no Kenkyü (I) (Studies of the Yuktidipikä I), JIBS vol.26-2 (1978), pp.166-167. 26. Shujun Motegi, Yuktidipikä no Kenkyü (II) (Studies of the Yuktidipikä II), JIBS vol.27-1 (1978), pp.453-448. 27. , Sämkhya-ha ni okeru Sözö-shin no Kannen no Hensen (Change and Development of the Concept of the Creation God in Sämkhya), Shükyö Kenkyü (Journal of Religious Studies) vol.240 (1979), pp.67-86. , Yuktidipikä no Kenkyü (III) (Studies of the Yuktidipikä III), JIBS vol.28-2 (1980), pp.907-904. , Sämkhya-gakuha to Bukkyö no Ronsö (An Argument between Sämkhya and a Buddhist school), Nihon Bukkyö Bunka Kenkyü vol.4 (1983), pp.37-44. , Sämkhya-gakuha ni okeru Ninshiki Shutai no Mondai (Some problems on the knower of Sämkhya), Journal of Department of Education (Shinshu University) vol.51 (1984), pp.117-128. , Inchü-uka to Inchü-muka (I) (Satkäryaväda and Asatkäryaväda I), Sötö Shü Kenkyuin Kenkyüsei Kenkyü Kiyö (Journal of Soto Shu Research Fellows) vol.18 (1986), pp.281-266. — Inchü-uka to Inchü-muka (II) (Satkäryaväda and Asatkärya, väda II), Sötö Shü Kenkyuin Kenkyüsei Kenkyü Kiyö (Journal of Soto Shu Research Fellows) vol.19 (1987), pp.292-278. , The Vaisesikasütra 9-1 referred to in the Yuktidipikä, JIBS vol.36-2 (1988), pp.1-8.' , Inchü-uka to Inchü-muka (III) (Satkäryaväda and Asatkäryaväda III), Sötö Shü Kenkyuin Kenkyüsei Kenkyü Kiyö (Journal of Soto Shu Research Fellows) vol.20 (1988), pp.232-221.

28. 29.

30.

31.

32.

33. 34.

274 35.

APPENDIX I , Samkhya-gakuha no Suiri-setu (On the Theory of Anumana of Sämkhya), Indo Shisöshi Kenkyü (Studies in the History of Indian Thought) (Felicitation Volume of Prof.Dr.M.Hattori) vol.6 (1989), pp.4152. , Some Vaisesika thoughts referred to in the Yuktidipikä, Asiatische Studien vol.XLVIII-2 (1994), pp.807-817. , avibhägäd vaisvarüpyasya (SK15) o megutte (On avibhägäd vaisvarüpyasya of SK15), JIBS vol.43-1 (1994), pp.453-447. , Yuktidipikä Shahon no Kentö (An Examination of the Manuscripts of the Yuktidipikä), Indo Shisöshi Kenkyü (Studies in the History of Indian Thought) vol.7 (1995), pp.19-35. (On jfiäna\

36. 37. 38.

39. Shinkan Murakami, Chigyö Heigösetsu (samuccaya-väda) karmasamuccaya-väda), JIBS vol.28-1 (1979), pp.16-21. 40.

, Yuktidipikä Yakuchü (I) (Yuktidipikä—Translated into Japanese with Critical Notes I), Tohoku Daigaku Bungakubu Kenkyu Nenpo (Annual Reports of the Faculty of Arts and Letters Tohoku University) vol.33 (1983), pp.37-69. , Benares-Manuscripts (1987), pp.1020-1016. of the Yuktidipikä, JIBS vol.35-2

41. 42.

, Yuktidipikä Yakuchü (II) (Yuktidipikä—Translated into Japanese with Critical Notes II), Tohoku Daigaku Bungakubu Kenkyu Nenpo (Annual Reports of the Faculty of Arts and Letters Tohoku University) vol.38 (1989), pp.31-79. ^ Kankan no sämänya-jnäna (Yuktidipikä p. 102) (On the sämänya-jnäna of the Sense Organs, Yuktidipikä p. 102), JIBS vol.39-2 (1991),pp.788-794.

43

44. Yasutaka Muroya, Satkäryaväda Ronshö ni okeru abhivyakti to parinäma (Parinäma and Abhivyakti in the Sämkhya Argument for Satkäryaväda), Indo Shisöshi Kenkyü (Studies in the History of Indian Thought) vol.8 (1996), pp.42-63. 45. Naomichi Nakada, Vyäkhyänga and Parapratipädanänga in Yuktidipikä, JIBS vol.13-2 (1965), pp.805-799. 46. 47. 48. , Three Kinds of Inference in the Commentaries on Sämkhya kärikä (part II), JIBS vol.15-1 (1966), pp.437-427. , Word and Inference in the Yuktidipikä part 1, JIBS vol.18-2 (1970), pp.41-45. , Word and Inference in the Yuktidipikä part 2, JIBS vol.19-2 (1971), pp.25-31.

BIBLIOGRAPHY 49. 50

275

, Word and Inference in the Yuktidtpika part 3, JIBS vol.21-1 (1972), pp.19-22. ^ Suiron wo Kösei suru Kakuyöso no Kentö (Constituent Elements of the Inference as Examined in the Yuktidtpika), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.12, part two (1975), pp.149-170. , Yuktidtpika ni okeru Sanshu no Suiron (Three Kinds of Inference as found in the Yuktidtpika—Japanese translation from its Sanskrit text), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.13 part three (1976), pp.171-182.
? Saishi no Kitei toshiteno Dharma to Shakai Kihan toshiteno Dharma— "Ronri no Tomoshibi" ni okeru (Dharma as Ritual Norm and as Social Norm, referred to in the Yuktidtpika), "Bukkyö ni okeru Ho no Kenkyü11 ("Papers on Dharmas in Budddhism") (Felicitation Volume of Dr.A.Hirakawa), Tokyo (1975), pp.567-587. ? Kotoba to Ronri (Word and Logic), Yamanashiken Kötö Gakkö Kyöiku Kenkyükai Kenkyü Kiyö vol.12 (1976), pp.18 pages (no pagination).

51.

52.

53

54

^ Yuktidtpika to Nyäyakandalt no Shosetu wo Hikaku shite (Opposing opinions on the relationship between word and inference— Comparison of the disputes as found in the Yuktidtpika and the Nyäyakandalt—), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.20 part four (1983), pp.75-79. , Word and Inference in the Yuktidtpika (Revised and together with two appendixies), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.28 part four (1991), pp.123-153. , Kotoba to Suiron—Yuktidtpika ni okeru (Wayaku to Kötei) (Word and Inference in the Yuktidtpika—Japanese Translation and Collation of the Text), Indian Thoughts and Buddhism (A Felicitaion Volume for Dr. H. Nakamura on His Sixtieth Birthday), Tokyo (1973), pp.37-56.

55.

56.

57. Honshu Nakai, Sämkhya ha ni okeru Pramäna Ron (The theory of Pramäna in the Sämkhya-System), JIBS, vol.28-2 (1980), pp.678-679. 58. Maria Nowotny, Die Sämkhya-Philosophie auf Grund der Yuktidlpikä und der Fragmente der Werke alter Sämkhya-Lehrer, Wien (1941) [unpublished dissertion]. 59. Gerhard Oberhammer, On the'Sästra' Quotations of the Yuktidtpika, The Adyar Library Bulletin, vol.25 parts 1-4 (1961), pp.131-172. 60. pp.71-91. , The Authorship of the Sastitantram, WZKSO vol.4 (1960),

274 35.

APPENDIX I , Samkhya-gakuha no Suiri-setu (On the Theory of Anumana of Sämkhya), Indo Shisöshi Kenkyü (Studies in the History of Indian Thought) (Felicitation Volume of Prof.Dr.M.Hattori) vol.6 (1989), pp.4152.
? Some Vaisesika thoughts referred to in the YuktidTpikä, Asiatische Studien vol.XLVlil-2 (1994), pp.807-817. ? avibhägäd vaisvarüpyasya (SK15) o megutte (On avibhägäd vaisvarüpyasya of SK15), JIBS vol.43-1 (1994), pp.453-447.

36 37 3g

^ YuktidTpikä Shahon no Kentö (An Examination of the Manuscripts of the YuktidTpikä), Indo Shisöshi Kenkyü (Studies in the History of Indian Thought) vol.7 (1995), pp.19-35. (On jnäna-

39. Shinkan Murakami, Chigyö Heigösetsu (samuccaya-väda) karmasamuccaya-väda), JIBS vol.28-1 (1979), pp.16-21. 40.

, Yuktidipikä Yakuchü (I) (Yuktidipikä—Translated into Japanese with Critical Notes I), Tohoku Daigaku Bungakubu Kenkyu Nenpo (Annual Reports of the Faculty of Arts and Letters Tohoku University) vol.33 (1983), pp.37-69. , Benares-Manuscripts (1987),pp.l020-1016. of the YuktidTpikä, JIBS vol.35-2

41. 42.

, YuktidTpikä Yakuchü (II) (YuktidTpikä—Translated into Japanese with Critical Notes II), Tohoku Daigaku Bungakubu Kenkyu Nenpo (Annual Reports of the Faculty of Arts and Letters Tohoku University) vol.38 (1989), pp.31-79. , Kankan no sämänya-jnäna (YuktidTpikä p. 102) (On the sämänya-jnäna of the Sense Organs, YuktidTpikä p. 102), JIBS vol.39-2 (1991), pp.788-794.

43.

44. Yasutaka Muroya, Satkäryaväda Ronshö ni okeru abhivyakti to parinäma (Parinäma and Abhivyakti in the Sämkhya Argument for Satkäryaväda), Indo Shisöshi Kenkyü (Studies in the History of Indian Thought) vol.8 (1996), pp.42-63. 45. Naomichi Nakada, Vyäkhyänga and Parapratipädanänga in YuktidTpikä, JIBS vol.13-2 (1965), pp.805-799. 46 47. 48.
} Three Kinds of Inference in the Commentaries on Sämkhya kärikä (part II), JIBS vol.15-1 (1966), pp.437-427.

, Word and Inference in the YuktidTpikä part 1, JIBS vol.18-2 (1970), pp.41-45. , Word and Inference in the YuktidTpikä part 2, JIBS vol. 19-2 (1971), pp.25-31.

BIBLIOGRAPHY 49. 50.

275

, Word and Inference in the Yuktidipika part 3, JIBS vol.21-1 (1972), pp.19-22. , Suiron wo Kösei suru Kakuyöso no Kentö (Constituent Elements of the Inference as Examined in the Yuktidipika), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.12, part two (1975), pp.149-170. ^ Yuktidipika ni okeru Sanshu no Suiron (Three Kinds of Inference as found in the Yuktidipika—Japanese translation from its Sanskrit text), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.13 part three (1976), pp.171-182. • , Saishi no Kitei toshiteno Dharma to Shakai Kihan ioshiteno Dharma— "Ronri no Tomoshibi" ni okeru (Dharma as Ritual Norm and as Social Norm, referred to in the Yuktidipika), "Bukkyö ni okeru Ho no Kenkyü11 ("Papers on Dharmas in Budddhism") (Felicitation Volume of Dr.A^Hirakawa), Tbkyo (1975), pp.567-587. • , Kotoba to Ronri (Word and Logic), Yamanashiken Kötö Gakkö Kyöiku Kenkyükai Kenkyü Kiyö vol.12 (1976), pp.18 pages (no pagination). ^ Yuktidipika to Nydyakandali no Shosetu wo Hikaku shite (Opposing opinions on the relationship between word and inference— Comparison of the disputes as found in the Yuktidipika and the Nyäyakandali—), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.20 part four (1983), pp.75-79. ^ Word and Inference in the Yuktidipika (Revised and together with two appendixies), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.28 part four (1991), pp.123-153. , Kotoba to Suiron—Yuktidipika ni okeru (Wayaku to Kötei) (Word and Inference in the Yuktidipika—Japanese Translation and Collation of the Text), Indian Thoughts and Buddhism (A Felicitaion Volume for Dr. H. Nakamura on His Sixtieth Birthday), Tokyo (1973), pp.37-56.

51

52.

53.

54

55

56.

57. Honshu Nakai, Sämkhya ha ni okeru Pramäna Ron (The theory of Pramäna in the Sämkhya-System), JIBS, vol.28-2 (1980), pp.678-679. 58. Maria Nowotny, Die Sämkhya-Philosophie auf Grund der Yuktidipika und der Fragmente der Werke alter Sämkhya-Lehrer, Wien (1941) [unpublished dissertion]. 59. Gerhard Oberhammer, On the'Sästra' Quotations of the Yuktidipika, The Adyar Library Bulletin, vol.25 parts 1-4 (1961), pp.131-172. 60. — pp.71-91. , The Authorship of the Sastitantram, WZKSO vol.4 (1960),

276 51 62. 616.

APPENDIX I
} ßjn Beitrag zu den Vada-Traditionen Indiens, WZKSO vol.7 (1963), pp.63-103.

, Notes on the Tantrayukti-s, ALB vol.31-32 (1967-68), pp.600-

63. V.Raghavan, The Yuktidipikä on the Sämkhya-kärikä, Corrections and Emendations in the Text, Annals of Oriental Research (University of Madras) , vol.12 (1954-55) pp.1-14; vol.14 (1957-58), pp.1-8; vol.15-1 (1958-59), pp.1-12; vol.15-2 (1958-59), pp.1-10. 64. Sadhu Ram, References to Sämkhya thories in Vätsyäyana's Nyäyabhäsya, ALB vol.22 parts 1-4 (1958), pp.8-24. 65. Ernst Steinkellner, DharmakTrti on the Inference of Effect (kärya), Papers in Honour of Prof. Dr. Ji Xianlin on the Occasion of His 80th Birthday, Beijing (1991), pp.711-736. 66. Albrecht Wezler, Some Observations on the Yuktidipikä, ZDMG Supplement II (1975), pp.434-455. 67 gg
? Qn Two Medical Verses in the Yuktidipikä, Journal of the European Äyurvedic Society (Reinbek) vol.1 (1990), pp.127-148.

^ On a Prose Passage in the Yuktidipikä of Some Significance for the History of Indian Medicine, Journal of the European Ayurvedic Society vol.3 (1993), pp.282-304.

[3] Sanskrit Texts referred to in the present edition 1. Atharvasira Upanisad, Publiee et traduite par B. Tubini, LES UPANISHAD vol.XI, Texte et traduction sous la direction de Louis RENOU, Paris, (1952). 2. Abhidharmakosabhäsya of Vasubandhu, edited by P.Pradhan, Tibetan Sanskrit Works Series vol.VIII, Patna (1967). 3. Abhidharmakosavyäkhyä, edited by Unrai Ogiwara, Tokyo, (1971). 4. Dvädasäram Nayacakram, edited with critical notes by Muni Jambuvijayaji, Bhavnagar, (1966f.). 5. Mahäbhärata, for the first time critically edited by V.S.Sukthankar, Poona, (1954f.). 6. Mugdhabodhavyäkarana of Vopadeva with the commentary of Ramatarkavagisha, edited by S.N.Siromaniand A.N.Nyayaratna, Bibliotheca Indica, No.1325, Calcutta, (1912). 7. Nyäyabhüsanam, edited by Svämi Yogindränanda, Saddarsanaprakäsana Granthamälä prathamam puspam, Varanasi, (1968).

BIBLIOGRAPHY

277

8. Nyayamanjan, edited by S.N.Sukla, Kashi Sanskrit Series No.l06(part 1, part 2), Varanasi, (1971). 9. Nyäyadarsanam with Vätsyäyana's Bhäsya Uddyotakara's Värttika Väcaspati Misra's Tätparyatikä and Visvanätha's Vrtti, edited by Taranatha Nyaya Tarkatirtha and Amarendramohan Tarkatirtha, Calcutta Sanskrit Series 18, Calcutta, (1936). 10. Die Nyäyasütra's, Text, Übersetzung, Erläuterung und Glossar, edited by Walter Ruben, (Abhandlungen für die Kunde des Morgenlandes Band 18-Nr.2), Leipzig, (1928). 11. Tibetan Tripitaka (Peking Edition), edited by D.T.Suzuki, Tokyo-Kyoto, (1955-1961). 12. Tibetan Tripitaka (sDe-dge Edition), preserved at the Faculty of Letters, University of Tokyo, Tokyo, (1981). 13. Vijnäptimätratäsiddhi, Deux traites de Vasubandhu, Vimsatikä (la Vingtaine) accompagnee d'une explication en prose et Trimsikä (la Trentaine) avec le commentaire de Sthiramati, premiere partie, edited by S.Levi, Paris, (1925). 14. The Vyäkaranamahäbhäsya of Patanjali, edited by F.Kielhorn, Poona, 3rd edition by K.V.Abhyankar, (1962f.). 15. Bhartrharis Väkyapadiya, edited by Wilhelm Rau, Abhandlungen für die Kunde des Morgenlandes Band XLII4, Wiesbaden, (1977). 16. Sarvadarsanasahgraha, edited by M.V.S.Abhyankar, Government Oriental Series Class A No.l, Bhandarkar Oriental Research Institute, Poona, (1978). 17. Särnkhya-Sangraha, edited by Sri Vindhyesvari Prasäda Dvivedi, Chowkhamba Sanskrit Series Nos.246, 286, Varanasi, (1969).

278 Appendix II

APPENDIX II

T h e Text of t h e Sämkhyakärikä as attested in YuktidTpika within the c o m m e n t a r y to the sponding verse

the

corre-

duhkhatrayäbhighätäj jijnäsä tadapaghätake hetau / drste säparthä cen naikäntätyantato'bhävät //!// pp.10.8; 11.8; 24.15; 25.5

drstavad änusravikah sa hy avisuddhiksayätisayayuktah / tadviparitah sreyän vyaktävyaktajnavijfiänät / / 2 / / pp.30.18; 31.9; 47.9; 48.15

mülaprakrtir avikrtir mahadädyäh prakrtivikrtayah sapta / sodasakas tu vikäro na prakrtir na vikrtih purusah / / 3 / / pp.58.8; 62.18; 63.24; 66.4

drstam anumänam äptavacanam ca sarvapramänasiddhatvät / trividham pramänam istam prameyasiddhih pramänäd dhi / / 4 / / pp.67.4; 68.29; 69.20; 70.11

prativisayädhyavasäyo drstam trividham anumänam äkhyätam / äptasrutir äptavacanam tu / / 5 / / pp.76.25; 82.29; 87.3

sämänyatas tu drstäd atindriyänäm prasiddhir anumänät / tasmäd api cäsiddham paroksam äptägamät sädhyam / / 6 / / pp.88.3; 99.6

atidürät sämipyäd indriyaghätän mano'navasthänät / sauksmyäd vyavadhänäd abhibhavät samänäbhihäräc ca / / 7 / / p.98.2-3

The Text of the Samkhyakarika as attested in the Yuktidipika sauksmyät tadanupalabdhir näbhävät käryatas tadupalabdhih / mahadädi tac ca käryam prakrtivirüpam sarüpam ca / / 8 / /

279

pp.106.6,10; 107.14 asadakaranäd upädänagrahanät sarvasambhaväbhävät / saktasya sakyakaranät käranabhäväc ca sat käryam / / 9 / / pp.117.6; 119.6,19; 122.19; 124.6 hetumad anityam avyäpi sakriyam anekam äsritam Ungarn / sävayavam paratantram vyaktam vipantam avyaktam / / 1 0 / / p.127.3-4

sattvam laghu prakasakam ist am upastambhakam calam ca rajah / guru varanakam eva tamah pradlpavac cärthato vrttih / / 1 3 / / pp.134.26-27; 137.5 avivekyädih siddhas traigunyät tadviparyayäbhävät / käranagunätmakatvät käryasyävyaktam api siddham / / 1 4 / / pp.139.20,23; 140.7 bhedänäm parimänät samanvayät saktitah pravrttes ca / käranakäryavibhägäd avibhägäd vaisvarüpyasya / / 1 5 / / pp.141.17; 143.27; 144.31; 147.24; 150.18 käranam asty avyaktam pravartate trigunatah samudayäc ca / parinäma<ta>s salilavat pratipratigunäsrayavisesät / / 1 6 / / pp.162.14,23; 163.4; 165.1 sanghätaparärthatvät trigunädiviparyayäd adhisthänät / puruso ?sti bhoktrbhävät kaivalyärtham pravrttes ca / / 1 7 / / pp.168.4; 169.17,22; 170.4; 173.20

280

APPENDIX II

janmamaranakarananam pratiniyamad ayugapatpravrttes ca / purusabahutvam siddham trigunädiviparyayäc caiva / / 1 8 / / pp.174.28; 175.17-18; 176.4 tasmäc ca viparyasät siddham säksitvam asya purusasya / kaivalyam mädhyasthyam drastrtvam akartrbhävas ca / / 1 9 / / p.176.15-16 tasmät tatsamyogäd acetanam cetanävad iva Ungarn / gunakartrtve ca tathä karteva bhavaty udäsinah / / 2 0 / / purusasya darsanärthah kaivalyärthas tathä pradhänasya / pangvandhavad ubhayor api samyogas tatkrtah sargah / / 2 1 / / pp.183.30; 184.15,27; 185.20 prakrter mahän tato 'hamkäras tasmäd ganas ca sodasakah / tasmäd api sodasakät pancabhyah panca bhütäni 1/22// pp.187.23; 188.1,5,8 adhyavasäyo buddhir dharmo jnänam viräga aisvaryam / sättvikam etad rüpam tämasam asmäd viparyastam / / 2 3 / / pp.188.17; 191.28-29; 193.7 abhimäno 'hamkäras tasmäd dvividhah pravartate sargah / aindriya ekädasakas t<ä>nmätrah paiicakas caiva / / 2 4 / / p.194.2,18,28 sättvika ekädasakah pravartate vaikrtäd ahamkärät / bhütädes tänmätrah sa tämasas taijasäd ubhayam //2b// pp.195.32; 196.4,20 p. 180.35-36

buddhlndriyäni karnatvakcaksürasananäsikäkhyäni / väkpänipädapäyüpasthäh karmendriyäny ähuh / / 2 6 / / p.197.9,25

The Text of the Samkhyakarika as attested in the Yuktidipika samkalpakam atra manas tac cendriyam ubhayathä samäkhyätam / antas trikälavisayam tasmäd ubhayapracäram tat / / 2 7 / /

281

pp.199.12; 200.2,8

rüpädisu paiicänäm älocanamätram isyate vrttih / vacanädänaviharanotsargänandäs ca pancänäm / / 2 8 / / pp.201.11; 204.3

svälaksanyam vrttis trayasya saisä bhavaty asämänyä / sämänyakaranavrttih pränädyä väyavah pafica / / 2 9 / / pp.205.9,23; 206.5

yugapac catustayasya tu vrttih kramasas ca tasya nirdistä / drste tathäpy adrste trayasya tatpürvikä vrttih / / 3 0 / / pp.211.24; 212.5,12,27

sväm sväm pratipadyante parasparäkutahetukim vrttim / purusärtha eva hetur na kenacit käryate karanam / / 3 1 / / p.213.26-27

karanam trayodasavidham tad äharanadhäranaprakäsakaram / käryam ca tasya dasadhähäryam dhäryam prakäsyam ca / / 3 2 / / pp.215.21; 216.14,17

antahkaranam trividham dasadhä bähyam trayasya visayäkhyam / sämpratakälam bähyam trikälam äbhyantaram karanam / / 3 3 / / pp.216.22; 217.1,18,25,28

buddhindriyäni tesäm panca visesävisesavisayäni / väg bhavati sabdavisayä sesäny api paficavisayäni / / 3 4 / / p.218.1,8,13

säntahkaranä buddhih sarvam visayam avagähate yasmät / tasmät trividham karanam dväri dväräni sesäni / / 3 5 / / p.221.7-8

282

APPENDIX II ete pradipakalpah parasparavilaksana gunavisesah / krtsnam purusasyärtham prakäsya buddhau prayacchanti / / 3 6 / / p.222.17-18 sarvam praty upabhogam yasmät purusasya sädhayati buddhih / saiva ca visinasti <yat>ah pradhänapurusäntaram süksmam / / 3 7 / / p.223.9,23 tanmäträny avisesäs tebhyo bhütäni panca paiicabhyah / ete smrtä visesäh säntä ghoräs ca müdhäs ca / / 3 8 / / pp.224.18; 225.5,7; 227.19 süksmä mätäpitrjäh saha prabhütais tridhä visesäh syuh / süksmas tesäm niyatä mätäpitrjä nivartante / / 3 9 / / p.228.2,23

pürvotpannam asaktam niyatam mahadädi süksmaparyantam / samsarati nirupabhogam bhävair adhiväsitam Ungarn / / 4 0 / / p.230.13-14 citram yathäsrayam rte sthänvädibhyo vinä yathä cchäyä / tadvad vinä visesair na tisthati niräsrayam lingam / / 4 1 / / purusärthahetukarn idam nimittanaimittikaprasarigena / prakrter vibhutvayogän natavad vyavatisthate lingam / / 4 2 / / p.232.21-22 p.231.9-10

sämsiddhikäs ca bhäväh präkrtikä vaikrtäs ca dharmädyäh / drstäh karanäsrayinah käryäsrayinas ca kalalädyäh / / 4 3 / / p.234.18-19,21

dharmena gamanam ürdhvam gamanam adhastäd bhavaty adharmena / jnänena cäpavargo viparyayäd isyate bandhah / / 4 4 / / pp.235.7,9,19; 236.4

The Text of the Samkhyakarika as attested in the Yuktidipika vairägyät prakrtilayah samsäro bhavati räjasäd rägät / aisvaryäd avighäto viparyayät tadviparyäsah / / 4 5 / /

283

pp.236.9,25; 237.11,22 esa pratyayasargo viparyayäsaktitustisiddhyäkhyah / gunavaisamyavimardät tasya ca bhedäs tu paiicäsat / / 4 6 / / pp.239.4; 240.3 paiica viparyayabhedä bhavanty asaktis ca karanavaikalyät / astävimsatibhedä tustir navadhästadhä siddhih / / 4 7 / / pp.240.10; 241.18-19,22 bhedas tamaso 'stavidho mohasya ca dasavidho mahämohah / tämisro 'städasadhä tathä bhavaty andhatämisrah / / 4 8 / / pp.241.28; 242.1,4,8,11 ekädasendriyavadhäh saha buddhivadhair asaktir uddistä / saptadasavadhä buddhir viparyayät tustisiddhinäm / / 4 9 / / pp.242.26; 243.11 ädhyätmik<yas>(?) catasrah prakrtyupädänakälabhägyäkhyäh / bähyä visayoparamät paiica ca nava tustayo 'bhihitäh / / 5 0 / / pp.244.1; 248.1 ühah sabdo 'dhyayanam duhkhavighätäs trayah suhrtpräptih / dänam ca siddhayo Jstau siddheh pürvo 'nkusas trividhah / / 5 1 / / pp.251.10-11; 252.28 na vinä bhävair Ungarn na vinä lingena bhävasamsiddhih / lihgäkhyo bhäväkhyas tasmäd dvividhah pravartate sargah / / 5 2 / / p.255.14,16,18 astavikalpo daivas tairyagyonas ca paficadhä bhavati / mänusyas caikavidhah samäsato bhautikah sargah / / 5 3 / / p.256.10-11,19

284

APPENDIX II urdhvam sattvavisalas tamovisalas tu mulatah sargah / madhye rajovisälo brahmädistambaparyantah / / 5 4 / / p.257.10,16,19,25

atra jarämaranakrtam duhkham präpnoti cetanah purusah / lihgasyävinivrttes tasmäd duhkham samäsena / / 5 5 / / pp.258.3; 260.25

ity esa prakrtikrtah pravartate tattvabhütabhäväkhyah / pratipurusavimoksärtham svärtha iva parärtha ärambhah / / 5 6 / / p.261.15-16

vatsavivrddhinimittam ksirasya yathä pravrttir ajnasya / purusavimoksanimittarn tathä pravrttih pradhänasya / / 5 7 / / p.263.3-4

autsukyanivrttyartham yathä kriyäsu pravartate lokah / purusasya vimoksartham pravartate tadvad avyaktam / / 5 8 / / p.264.7-8

rahgasya darsayitvä nivartate nartaki yathä nrtyät / purusasya tathätmänam prakäsya vinivartate prakrtih / / 5 9 / / p.264.19-20

nasmi na me naham ity aparisesam / aviparyayäd visuddham kevalam utpadyate jnänam / / 6 4 / / pp.265.8,10,14

dharmadinam akaranapraptau / tisthati samskäravasäc cakrabhramavad dhrtasanrah / / 6 7 / / p.265.24-25

präpte sarirabhede caritärthatvät pradhänavinivrttau / aikänt<ikam> ätyantikam abhayam kaivalyam äpnoti / / 6 8 / / p.266.12,19,22

The Text of the Samkhyakarika as attested in the Yuktidipika purusärthärtham idam sästram guhyam paramarsinä samäkhyätam / sthityutpattipralayäs cintyante yatra bhütänäm / / 6 9 / /

285

p.267.5,8,11,20

etat pavitram agryam munir äsuraye 'nukampayä pradadau / äsurir api pancasikhäya tena ca bahudhä krtam tantram / / 7 0 / / pp.268.15; 269.5,7

sisyaparamparayägatam Isvarakrsnena caitad äryäbhih / samksiptam äryamatinä samyag vijnäya siddhäntam / / 7 1 / / p.269.12,23,25,27

saptatyäm kila ye 'rthäs te 'rthäh krtsnasya sastitantrasya / äkhyäyikävirahitäh paravädavivarjitäs cäpi / / 7 2 / / p.270.5-6

286 Appendix The III

APPENDIX III

Text of t h e Sämkhyakärikä as found in II

con-

texts other t h a n those of A p p e n d i x

duhkhatrayäbhighätäj jijnäsä tadapaghätake hetau / (SKlab) drstavad änusravikah sa hy avisuddhiksayätisayayuktah / (SK2ab) tadviparitah sreyän (SK2c) vyaktävyaktajfia-(SK2d') vyaktävyaktajiiavijnänän mokso 'väpyate //(cf.SK2d) mülaprakrtih (SK3aJ) mülaprakrtir avikrtih (SK3a) mahadädyäh prakrtivikrtayah sapta / (SK3b) sodasakas tu vikäro na prakrtir na vikrtih purusah / / (SK3cd) drstam anumänam äptavacanam ca (SK4ab}) sarvapramänasiddhatvät trividham pramänam istam (SK4bJc) prativisayädhyavasäyo drstam (SK5abJ) trividham anumänam äkhyätam (SK5b') sämänyatas tu drstäd atindriyänäm prasiddhir anumänät / (SK6ab) sauksmyät tadanupalabdhih (SK8a) sauksmyät tadanupapattih (ef.SK8a) näbhävät (SK8b') käryatas tadupalabdhih / (SK8b') mahadädi tac ca käryam prakrtivirüpam sarüpam ca / / (SK8cd)

p.4.19 p.19.8 p.35.5-6 p.58,fn.(4) pp.90.6, 107.20 p.57,fn.(2) p.63.2 p.60.11 p.63.4 pp.4.5-6, 32.5-6 p.76.12-13 pp.4.6, 70.16 p.6.2-3 p.86.2

p.107.6-7, 9-10 p.3.26-27 p. 107.9 p. 107.6

pp.6.26, 125.23 prakrtivirüpam (SK8d') sarüpam ca / / (SK8dJ) asadakaranät (SK9aJ) p.8.3 p.8.4 p. 152.2

The Text of the SK in contexts other than those of Appendix II hetumad anityam vyaktam (SKlOa'd') trigunam aviveki visayah (SKlla) aviveki visayah sämänyam acetanam prasavadharmi / (SKlla'b)

287

p.189.21 p.l26,fn.(3) p.139.21

trigunam aviveki visayah sämänyam acetanam prasavadharmi / (SKIlab) pp.169.18, 176.6 sämänyam acetanam prasavadharmi / (SKllb) p. 17.1

sämänyam acetanam prasavadharmi vyaktam tathä pradhänam (SKllbc) p.8.5-6 tathä pradhänam (SKllc') tadviparltah (SKIId') tathä ca pumän / / (SKlld') prityapritivisädätmakäh (SK12a) bhedänäm parimänät (SK15a) parimänam anvayah (cf.SK15a'b') samanvayäc chaktitah pravrttes ca (SKI5b) avibhägäd vaisvarüpyasya //(SK15d) käranam asty avyaktam (SK16a) sanghätaparärthatvät (SK17a) sanghätaparärthatvam (cf.SK17a) janmamaranakaranänäm (SK18a) tasmäc ca viparyäsät (SK19a) pp.140.4, 169.19 p.8.4 p.8.5 p.148.5-6 pp.3.22, 4.21, 5.28 p.89.6 p.97,fn.(l) p.267.23 pp.3.22, 4.20, 5.28, 255.23 p.78.10-11 p.89.6-7 p.6.16 pp.6.19, 66.9-10, 155.12, 157.10

tasmäc ca viparyäsät siddham säksitvam asya purusasya / kaivalyam mädhyasthyam drastrtvam akartrbhävas ca //(SK19) tasmät tatsamyogäd acetanam cetanävad iva Ungarn / (SK20ab) purusasya darsanärthah (SK21a) p.180.30-31 p.78.7 p.6.17

purusasya darsanärthah kaivalyärthas tathä pradhänasya / pangvandhavad ubhayor api samyogah (SK21abcd?) pp.48.10-11 purusasya darsanärthah kaivalyärthas tathä pradhänasya / pangvandhavad ubhayor api samyogas tatkrtah sargah / / (SK21) p.267.26-27

288

APPENDIX III p.255.3 pp.267.22, 57,fn.(2) p.63.11

samyogakrtah sargah / / (cf.SK21d) prakrter mahän (SK22a') prakrter mahäms tato 'hamkärah (SK22ab')

prakrter mahäms tato 'hamkäras tasmäd ganas ca sodasakah / (SK22ab) p.7.14 adhyavasäyo buddhih (SK23a) tasmäd dvividhah pravartate sargah / (SK24b) ekädasakah pravartate vaikrtäd ahamkärät / (SK25a'b) buddhindriyäni karnatvakcaksürasananäsikäkhyäni /(SK26ab) pp.77.4, 57,fn.(2) p. 194.23 p.197.5 p.216.32

tac cendriyam ubhayathä samäkhyätam antas trikälavisayam (SK27bc) p.216.35-36 p.213. 1 .5 rüpädisu paficänäm älocanamätram isyate vrttih / (SK28ab) sabdädisu sroträdinäm älocanamätram vrttih (cf.SK28ab) svälaksanyam vrttis trayasya (SK29ab ) saisä bhavaty asämänyä / (SK29b') drste tathäpy adrste trayasya tatpürvikä vrttih / / (SK30cd) <31ab) sväm sväm pratipadyante parasparäkütahetuklm vrttim / (SK31ab) karanam trayodasavidham (SK32a) käryam ca tasya dasadhä (SK32c) trayasya visayäkhyam / (SK33b?) buddhindriyäni tesäm (SK34a) buddhindriyäni tesäm paiica visesävisesavisayäni / (SK34ab) panca visesä<visesäh>(SK34b') sesäny api pancavisayäni (SK34d) säntahkaranä buddhih sarvam visayam avagähate yasmät / tasmät trividham karanam dväri dväräni sesäni / / (SK35) tasmät trividham karanam dväri (SK35cd') p.214.30 p.175.2 pp.217.32, 224 .13 pp.217.7, 221.25 (2) P .57,fn. p.77.3 p.224.13 (2) P .57,fn. (2) P .57,fn. p.4.23-24
?

p.217.30 p.189.35 p.213.16 p.204.24

The Text of the SK in contexts other than those of Appendix II ete pradipakalpah (SK36a) ete pradipakalpah parasparavilaksanä gunavisesäh / krtsnam purusasyärtham prakäsya buddhau prayacchanti / / (SK36) p.209.6-7 sarvam praty upabhogam yasmät purusasya sädhayati buddhih / (SK37ab) ' pp.79.28, 209.8 tanmäträny avisesäh (SK38a) tebhyo bhütäni panca paficabhyah, ete smrtä visesäh (SK38bc) säntä ghoräs ca müdhäs ca //(SK38d) süksmäs tesäm niyatäh (SK39c) purusärthahetukam (SK42a') natavad vyavatisthate lirigam / / (SK42d) sämsiddhikäs ca bhäväh (SK43a) p.7.4 p.7.2-3 pp.7.3-4 p.230.11 p.57,fn.(l) p.4.21-22 p.57,fn.(2) p.79.26-27

sämsiddhikäs ca bhäväh präkrtikä vaikrtäs ca dharmädyäh / (SK43ab) p.68.1 dharmena gamanam ürdhvam (SK44a) esa pratyayasargo viparyayäsaktitustisiddhyäkhyah / (SK46ab) panca viparyayabhedä bhavanty (SK47ab') panca viparyayabhedä bhavanti asaktis ca karanavaikalyät / astävirnsatibhedä tustir navadhästadhä siddhih / / (SK47) bhedas tamaso 'stavidhah (SK48a) ühah sabdo 'dhyayanam (SK51a) astavikalpo daivas tairyagyonas ca pancadhä bhavati / mänusyas caikavidhah (SK53abc) p.57,fn.(l) p.7.9 p.7.10 p.6.21-22 p.7.11 p. 192.10 p.18.2-3

atra jarämaranakrtam duhkham präpnoti cetanah purusah / (SK55ab) p.258.27 atra jarämaranakrtam duhkham präpnoti cetanah purusah / lingasyävinivrttes tasmäd duhkham samäsena //(SK55) ksirasya yathä tathä pravrttih pradhänasya / / (SK57b'd) p. 19.1-2 p.4.22-23

evam tattväbhyäsän näsmi na me näham ity aparisesam / aviparyayäd visuddham kevalam utpadyate jfiänam / / (SK64) pp.7.29-30, 192.13-14

290

APPENDIX III p. 184.9 p.49.7 p.6.18 p.6.17-18 p.268.1

drsta mayety upeksaka eko drstaham ity uparataika / (SK66ab) drstä mayety upeksata eko drstaham ity uparamaty anyä / (SK66ab) samyagjnänädhigamät (SK67a) präpte sarirabhede (SK68a) präpte sarirabhede caritärthatvät pradhänavinivrttau /(SK68ab)

Index of Words of the Samkhyakarika Appendix IV

291

Index of W o r d s of the Samkhyakarika as in the Yuktidipika and Mss.* -anavasthanat the Marginal

attested Notes of

Kashmir and Delhi -akaranät 9a: ( Ü 7.0), 152.2

7b:(98.2)

akartrbhävah 19d:{176.16), 180.31 akaranapraptau 67b:(265.24)

anityam 10n:(127.3), 189.21 anukampaya 70b:(268.15) -anupalabdhih 8a:(106.6), 1077,10,

a g r y a m 70a:(268.15) ankusah 5ld:(252.28) 17.1, 139.21,

a n u m ä n a m 4a:^.5, 32.5, (70.11)', 5b:6.3, (82.29) anumänät 6b:86.2, (88.3) anekam 10b:(127.3) antah 27c:(200.8), 216.35 antahkaranam ZZa,:(216.22) -antahkarana 3ba:57,fn.(2), -antaram %7d\(223.23) a n d h a t ä m i s r a h 4%d\(242.11) a n y ä (66b):^P.7 -andha- 21c:48.11, (184-27), 267.27 - a p a g h ä t a k e lb:4.19, (11.8) aparisesam 64b: 7.29, 192.13, (265'.8) apavargah 44c:(235.19) apärthä lc:(24.15) (221.7)

a c e t a n a m (llb):8.5, 169.18, 176.6; 20b: 75.7, (180.35) ajnasya 57b:(263.3) atidürät 7a>:(98.2)

-atisaya- 2b:19.8, (31.9) atindryanam 6b:86.2, (88.3) - a t y a n t a t o - Id:(25.5) atra 27&:( 199.12); 55a:J9.J, (258.3), 258.27 adrste 30c:204.24, (212.12) adharmena 44b:(235.9) adhastät 44b:(235.9) - a d h i g a m a t (67&):6.18 adhiväsitam 40d:(230.14) adhisthänät 17b:(169.22)

adhyayanam 5W.192.10, (251.10) adhyavasäyah 2U:57Jn.(2), 77.4, (188.17) -adhyavasäyah (76.25) .£, 70.16,

api 6c:(99.6); Ud:(140.7) 140.30) 21c:48.11, (184-27), 267.27; 22c:(188.8); 30c.204.24, (212.12); Ud:57Jn.(2), (218.13); 70c:(269.5); 72d:(270.6)

*The Karika number within brackets means that the word concerned is supplemented only from the Appendix III. Page and line numbers are shown by italics. Page and line numbers in brackets mean that the word concerned is given in Appendix II.

292 -aprlti- (I2a):148.6 abhayam 6Sd:(266.22) abhävät 8b:(106.6)

APPENDIX IV aviparyayät 64c:7.30, 192.14, (265.10) avibhägät 15d:( 150.18), 267.23 aviveki ( l l a ) : 126Jn.(3), 139.21, 169.18, 176.6 avivekyädih U&:(139.20) avisuddhiksayätisayayuktah 2b:i9.S, (31.9) -avisesa- 34b: 77.3, (218.1), 224.13 avisesäh 38a: 7.4, (224.18) -avyakta- 2d:(48.15), 58Jn.(4), 90.6, 107.20 avyaktam lOd:(127.4); Ud:(140.7), 140.30; 1^.3.22,4.20, 5.28, (162.14), 255.23; avyäpi l0a,:(127.3) -asakti- 46b:7.9, (239.4)

-abhävät ld:(25.5); 9b:(119.19); Ub:(139.23) -abhighätät la:^iP, (10,8) abhibhavät 7cd:{98.3) abhimänah 24a:(194.2) -abhihärät 7d:(98.3) abhihitäh 50d:(248.1) -abhyäsät (64a):7.29, 192.13 ayugapatpravrtteh l&b:(175.17) -artha- 42a,:57,fn.(l), (232.21); 69a,:(267.5) -arthah 21^.(183.30);
2

Zlc:(213.27);

arthatas 13d:(137.5) -arthatvät 17^.78.11,(168.4)] 68b:(266.19), 268.1 artham Z6c:209.7, (222.18) -artham 17 d;(173.20)\ 56c:(261.16)] 5Sc:(264.8); 69*1(267.5) arthäh 72a:(270.5); 72b:(270.5) avagahate Zhb:57Jn.(2), avikrtih 3a:(5<S.S), 63.2 avighätah 45c:(237.ü) avinivrtteh 55c:i9.2, (260.25) (221.7)

asaktih A7b:6.21, (241.18) 49bl(242.26) astadhä A7d:6.22, (241.22) astavikalpah 53a: 18.2, (256.10) astavidhah 48a: 7.11, (241.28) astädasadhä 48c:(^2.S) astävimsatibhedä 47c:6.22, (241.19) astau blc:(251.11)

asaktam 40a:(230.13) asadakaranät 9a: (117.6), 152.2 asämänyä 29b:(205.23), 213.16 asiddham §c:(99.6)

Index of Words of the Samkhyakarika asti Wa,:3.22, 120, 5.28, {162.14), 255.23; 17c:(170.4) asmäd 2ZA:{193.7) -ädih asmi 64b:7.29, 192.13, (265.8) asya I9b:( 176.15), 180.30 aham G4b:7.29, 192.13, (265.8); (66b):49.7, 184-9 ahamkarah 22ab:7.14, 63.11, (188.1)-' 24a: 194.2 ahamkärät 25b:(195.32), 197.5 -äküta- 31b:(213.26), 214-30 -äkhyah 46b:7.P, (239.4); 52c:(255.18); 56b:(261.15) -äkhyäh 50b:(244.1) -äkhyam ZZb:217.7, (217.18), 221.25 äkhyätam 5b:^.5, (82.29) äkhyäni 26b:(197.9), 216.32 äkhyäyikävirahitäh 72c:(270.6) ägatam -ägamät 71^(269.12) 6d:(99.6) Uv.(139.20) -ädibhyah Alb:(231.9) -ädlnäm 67b:(265.24) -ädyäh Sb:60.11, (62.18); 29d:(206.5); 4Zb:68.1, (234-18); 4Zd:(234-21) ädhyätmikyah 5Qa,:(244.1) -änandäh 2 8 d : ( ^ . 5 ) anusravikah 2&A9.8, (30.18) -ädi- I7b:(169.17); 18d:(176.4)l 40b:(230.13)] Md:(257.25)

293

äptavacanam 4ab:^.5, 32.5, (70.11); bd:(87.3) äptasrutih bd:(87.3) äptägamät 6d:(99.6) apnoti 68d:(266.22) äbhyantaram ZZd:(217.28) ärambhah f>§d:(261.16) äryamatinä 7lc:(269.25)

äryäbhih 71b:(269.23) alocanamitram 28b:(201.11), 213.15, 217.30 -asrayaUd:(165.1)

ätmakatvät Uc:(140.7, 140.30) -ätmakäh (I2a):148.6

äsrayam 41a:(^i.P) -asrayinah 43c:(234.19); äsritam 10b:(127.3) asuraye 70b:(268.15) äsurih 70c:(269.5) 43d:(234.21)

ätmänam 59c:(264.20) ätyantikam 68c:(266.22) -ädäna- 2Sc:(204.3) -ädi 8c:6.26, (107.14), 125.23

äharaiiadhäranaprakäsakaram 32b: (215.21)

294 ähäryam $2d:(216.17) ähuh 2Qd:(197.25) iti 64b:7.29, 192.13, {265.8)] (66a):^P.7, 1819; (66b):49.7, 1819 idam 42^(232.21); 69^.(267.8) indriyaghätät 7b:(98.2)

APPENDIX IV uparamati -uparamät -upalabdhih 8a,:(106.6), 107.7,10 upastambhakam 13b:(lS4.26)

-upasthäh 26d:(197.25) -upädäna- b0b:(244.1) upädänagrahanät 9ab:(119.6)

indriyam 27b:(200.2), 216.35 indriyavadhäh 49^.(242.26) upeksakah (66a):i^.P upeksatah (66a):^9.7 ubhayathä 27b:(200.2), 216.35 ubhayapracäram 21d:(200.8)

-indriyänam 6b:86.2, (88.3) -indriyäni 26a,:(197.9), 216.32; 26d:(197.25); 34a:57,/h.#), 77.3, (218.1) iva 20b:78.7, (180.35); 20d:(180.36); 56d:(261.16) istam 4c:(68.29), 76.13; Ub:(134.26) isyate 28b:(20i.ll),

ubhayam 2§d:(196.20) ubhayoh 21c.48.ll, (184.27), 267.27 ürdhvam 44a:57,fn.(l), S4a,:(257.10) ühah bU:192.10, rte Tsvarakrsnena 7lb:(269.23) 4U:(231.9) (235.7);

(251.10)

-rsinä 6 9 b : ( ^ 7 . ü ) ekah (66b):^P.7, 184.9 ekavidhah §2>c:18.3, (256.11) ekä (66b):if^.P ekädasa- 49^.(242.26)

-utpatti- 69c:(267.20) -utpannam utpadyate 64d:7.3ö, (265.14) -utsargaudäslnah 20d:(180.36) uddistä 49b:(242.26) upabhogam %lv.79.28, 209.8, (223.9) uparata (66b): 184.9

ekädasakah 24c:(194.28); 25^.(195.32), 197.5 ekäntätyantato'bhävät etat 23c:(191.29); 70^.(268.15); 71b:(269.23) ld:(25.5)

Index of Words of the Sämkhyakarika e t e S6&.79.26, 209.6, (222.17); 38c:7.3, (225.7) eva I3c:(134.27); 18d:(176.4); 24d:(194.28); Zlc-(213S7)' 37c:(223.23) karmendriyini 26d:(197.25)

295

kalalädyäh 43d: (23121) -kalpSh 36^.79.27, 209.6, (222.17) ,_ ,_ . , , _ _. 1C ,,.„„., karanakaryavibhagat lhc:(147.2A) käranagunätmakatvät 14

evam (64&):7.29, 192.13 esah 46a:7.9, (239-4); 56a:(261.15) esä 29b:(205.23), 213.16 aikäntikam 6Sc:(266.22) aindriyah 24c:(194.28) aiSvaryam 23b:(191.28) aiSvaryät 45c:(237.11) käranabhävät 9d:(124-6) käranam 16&.3.22, 4-20, 5.28, (162.14), 255.23 -kärya- 15c:(147.24) käryatas Sb:(106.10) käryate 3\d:(213.27)

käryam Sc:6.26, (107.14), 125.23; 9d:(124-6); autsukyanivrttyartham bS&:(264-7) 32c:(216.14), 217.32, 224.13 -karam Z2b:(215.21) ' karyasya Ud:(U0.7), 140.30

-käla- 21c:(200.8), 216.36; 35c:4.23, 57,fn.(2), -karana- 29c:(206.5) -karanam ^.(216.22) -karanä M*:57Jh.(2), (221.7)
kila

(221.8) -kälam 33c:(217.25); 83d:(«7.«)

karanavaikalyät 47b:6.21, (241.18) -karanät 9z:(117.6), 152.2

-*#* 2ld:(185.20), 255.3, 267.27; bo3i:(261.15) krtam 70d:(269.7)

-karananam 18^:6.16, (174.28) -krtam 55a:/Ai, (258.3), 258.27 karanäsrayinah 43c:(234.19) I _ # _ krtsnam 36c:509.7, (222.18) karnatvakcaksurasananasikäkhyani 26ab:(197.9), 216.32 kartä 20d:(180.36) -kartrtve 20c:(180.36) krtsnasya 12b:(270.5) kenacit 31d:(213.27) kevalam 64d:7.50, 192.14, (265.14)

296

APPENDIX IV

ca Ab:4.6,32.6, (70.11); 6c:(99.6); 7d:(98.3); kaivalyärthah 21b:48.10, (184.15), 8c:6.26, (107.14), 125.23; 267.26 Sd:6.26, (107.14), 125.23; 9d:(124.6); kaivalyärtham l7d:(173.20) ( ) 13b:{l34.26); k r a m a s a s 30b:(212.5) 1M:(137.5); lbb:97,fh.(l), (144-31); kriyäsu 58b:(264.7) 16b:(162.23); -ksaya- 2b: 19.8, (31.9) Ud:(173.20); lSb:(175.17); kslrasya b7b:4.22, (263.3) 18d:(176.4); 19a,:6.19, 66.9, 155.12, 157.10, g a n a h 22b:7.14, (188.5) (176.15), 180.30; I9d:(176.16), 180.31; g a m a n a m 44&:57,fn.(l), (235.7); 20c:(180.36); 44b:(235.9) 22b:7.14, (188.5); 24d:(194-28); -guna- 14c:{140.7), 140.30; 27b:(200.2), 216.35; Üb:(162.23); 2M:(204.8)', 30b:{212.5); 17b:(169.17) Z2c:(216.14), 217.32, 224.13; Z2d:(216.17); gunakartrtve 20c:(180.36) 37c:(223.23); - g u n a m (11B): 126,fn.(3), 169.18, 3Sd:7.42, (227.192); 176.6 4U:57,fh.(2), 68.1, (234-18); \lb\68.1, (234.18); gunavisesäh ?>§b\209.6, (222.17) A3d:(234.21); 4Ac:(235.19); gunavaisamyavimardät 46c:(240.3) 46d:(240.3)', 47b:6.21, (24L18); -gunätmakatvät 14c: (140.7) 48b:(242.1); 50d:(248.1); -gunäsraya- 16d: (165.1) -gunyät guru 14b\(139.20) bSb:18.2, (256.10); b3c:18.3, (256.11); 70d:(269.7); 7lb:(269.23); 72d:(270.6) cakrabhramavat 67d: (265.25) -caksü- 26b:(197.9), catasrah 50a:(244.1) 216.32

kaivalyam 19c:(176.16), 180.31; 68d:(266.22)

lZz\(134.27) 69b:(267.11) 9b:(119.6)

guhyam -grahanät -ghätät

7b:(98.2)

g h o r ä h 38d: 7.3, (227.19)

Index of Words of the Samkhyakarika catustayasya 30a:(211.24) caritarthatvat 68b:(266.19), 268.1 calam I3b:(134.26) t a t p ü r v i k ä 30d:204.24, (212.27) tatsamyogät 20a:7£.7, (180.35) t a t h ä (llc):8.6, 140.4, 169.19] 20c:(180.36)] 2lb.48.10, (184.15), 267.26] ZQc.204.24, (212.12)] 48d:(242.11)] hld:4.22, (263.4)] 59c:(264-20) tadanupapattih 8a,:3.27 c e t a n ä v a t 20b:78.7, (180.35) chäyä 41b:(231.9)

297

c i t r a m 41a,:(231.9) c i n t y a n t e 69d:(267.20) cet lc:(24.15)

c e t a n a h 55b: 19.1, (258.3), 258.27

t a d a n u p a l a b d h i h 8&:(106.6), 107.7, 107.10

janmamaranakarananam \8&:6.16, tadupalabdhih 8b:(106.10) (174.28) " t a d a p a g h ä t a k e lb:4.19, (11.8) jarämaranakrtam 5 5a: 19.1, (258.3), t a d v a t 4lc:(231.10)] 258.27' 58d:(264.8) -jäh 39a:(Ä8S.Ä); t a d v i p a r l t a h 2c:35.5, (47.9)] hd:(228.23) (lld):<^ " jijiiäsä lb:4.19, (10.8) tadviparyayäbhävät Ub:(139.23) -jna- 2d:(48.15), 58Jn.(4), 90.6, tadviparyäsah 4bd:(237.22) 107.20 -jnäna- (67a):6.18 j n ä n a m 2Sb:(19L28)\ 64d:7.30, 192.14, (265.14) j n a n e n a 44c:(235.19) t a t 8c:6.26, (107.14), 125.23] 27b:(200.2), 216.35] 27d:(200.8)] S2b:(215.21) t a t a h 22a,: 7.14, 63.11, (188.1) t a t k r t a h 21d:(185.20), 267.27 t a n t r a m 70d:(269.7) - t a n t r a m 10c:(127.4) tanmäträiii 38a: 7.4, (224.18) tamah Uc:(134.27)

t a m a s a h 48a: 7.11, (241.28) tamovisälah 54b:(257.16) -tas 8b:(106.10)] \U:(137.5)] lbb:97,fn.(l), (144-31)] Ub:(162.23)] bZd:(256.19)] b4b:(257.16)

tattvabhütabhäväkhyah b6b:(261.15) t a t t v ä b h y ä s ä t (64a):7.29, 192.13

298

APPENDIX IV tesäm 34a,:57,fn.(2), 77.3, (218.1); *39c:(228.23), 230.11 taijasät 2hd:(196.20) tairyagyonah 53b: 18.2, (256.10) -traya- la,:4.19, (10.8) trayah blb:(251.10)

tasmät 6c:(99.6); 19a,:6.19, 66.9, 155.12, 157.10, {176.15), 180.30; ,z 20^:78.7,(180.35); 22b:7.14, (188.5); 22c:(188.8); 24b:(194.18), 194.23; 27d:(200.8); Z5c:4.23, 57Jn.(2), (221.8); 52d:(255.18); 55d:19.2, (260.25) tasya 30b:(212.5); 32c:(216.14), 217.32, 224-13; 4ßd:(240.3) tänmätrah 24d:(194.28); 2bc:(196.4) tämasah 25d:(196.4) tämasam 23d:(iP5.7) tämisrah ASc:(242.8) -tamisrah A8d:(242.11) tisthati 4ld:(231.10); "67c:(265.25) tu 3c:63.4, (63.24); bd:(87.3); fa:86.2, (88.3); 46d:(240.3); 54b:(257.16) tustayah b0d:(248.1)

trayasya 29b:189.35, (205.9); Z0d:204.24, (212.27); ZSb:217.7, (217.18), 221.25 trayodasavidham 32a: 175.2, (215.21) trikälam Zid:(217.28)

trikälavisayam 27c:(200.8), 216.36 trigunatah 16b:(162.23) trigunam (lla): 126,fn.(3), 169.18, 176.6 trigunädiviparyayät I8d:(176.4) tridhä S9b:(228.2) trividhah trividham Ac:(68.29), 76.13; bb:6.2, (82.29); Zbc:4.23, 57Jn.(2), (221.8) 17b:(169.17);

traigunyat 14b: (139.20) -tvak- 26b:(iP7.P), 216.32 -tusti- 46b:7.9, (239.4) tustih Md:6.22, (241.22) tustisiddhinäm 49d:(^ te 72b:(270.5) tena 70d:(^9.7) t e b h y a h 38b:7.2, (225.5) dasavidhah ASb:(242.4) darsanärthah 2la,:6.17, 48.10, (183.30), 267.26 darsayitvä 59a:(2^.1P) dasadha Z2z.(216.14), 217.32, 224.13;

Index of Words of the Samkhyakarika dänam 5lc:(251.11) n a l&:(25.5); 3d:63.42, (66.42); Sb:(106.6); 31d:(213.27); 4ld:(231.10); 52^.(255.14); 52b:(255.16); 64b:7.29, 192.13, (265.P) natavat 42d:4.21, (232.22) nartald nava navadhä 47d:6.22, (241.22) -näsikä- 26b:(197.9), 216.32 nimittanaimittikaprasangena 42b: (232.21) -nimittam 51^.(263.3); 57c:(263.4) niyatam 40b:(230.13) niyatäh Z9c:(228.23), 230.11 -niyamät niräsrayam lSb:(174.28) 4ld:(231.10) 59b:(264.19)

299

duhkhatrayäbhighätät Ia:^.i0, (10.8) duhkham 55b:19.1, (258.3), 258.27; 55(1:19.2, (260.25) duhkhavighätäh -dürät 1^.(98.2) drstam 4*4.5, 32.5, (70.11); "5b:4.6, 70.16, (76.25) drstavat 2a: 19.8, (30.18) drstäh 43c:(234.19) drstä (66a):^P.7, 184.9 "(66b):49.7, 184.9 drstat 6an86.2, (88.3) drste lc:(24.15); "S0c:204.24, (212.12) daivah 53a: 18.2, (256.10) drastrtvam 19d:( 176.16), 180.31 dvarani 35d:51fJn.(2), (221.8) dväri 35d:^.^5, 57Jn.(2), dvividhah 24b:(194.l8), 52d:(255.18) dharmah 23b:(191.28) dharmädlnäm 67b:(265.24) dharmädyäh 43b:68.1, (234.18) (221.8) 194.23; 5lb:(251.10)

nirupabhogam 40c:(230.14) nirdista 30b:(212.5) nivartate 59b:(264.19) nivartante

-dharmi (Ub):8.6, 17.1, 139.21, 169.18, 176.6 dharmena AA*,:57,fn.(l), (235.7) -dhärana32b:(215.21)

-nirvrtti- 5 8 a : ( ^ . 7 ) nrtyät 5 9 b : ( ^ . l P ) -naimittika- 42b:(232.21) pangvandhavat 2lc:48.11, 267.27 (184.27),

dharyam Z2A:(216.17) dhrtasarlrah 67d:(265.25)

300 panca 22d:(188.8)] 29d:(206.5)] 34b:77.5, (218.1), 224.13] 38b:7.2, (225.5)] 47&.6.21, 7.10, (240.10)] 50d:(£#.J) pancakah 24d:(194.28) pancadhä 53b: 18.2, (256.10) pailcabhyah 22d:( 188.8)\ 38b: 7.3, (225.5) paiicavisayäni 34d: 57,fn. (2), (218.13) pancasikhäya 70c:(269.7) paiieäiiäm 2^.(201.11), 2Sd:(204.3) paiicäsat 46d:(240.3) paratantram 10c:(127.3) paramarsinä 69b:(267.11) -paramparayä 71a,:(269.12)

APPENDIX IV pavitram 70^.(268.15) -päni- 26c:(197.25) -päda- 26c:(197.25) -päyu- 26c:(197.25) -pitr- 39a:(228.2)] i§d:(228.23) punah * 37d:(Ä85.&?) pumän (lid):8.5 -purusa- Z7d\(223.23)] b6c:(261.16) purusah 3d:63.4, (66.4)] 17c:(170.4)] 55b:i9.i, (258.3), 258.27 purusabahutvam 18c: (175.18) purusavimoksani mit tarn 57c:(263.4) purusasya 19b:(176.15), 180.30] 2U.6.17, 48.10, (183.30), 267.26] 36c:209.7, (222.18)] S7b:79.28, 209.8, (223.9)] bSc:(264.8)] 59c:{264.20)

213.15]

paravädavivarjitäh 72d:(270.6) parasparavilaksanäh 36b: 209.6, (222.17)

parasparakutahetukim Ub:(213.26))purusärthah 31c'(213 27) V ; 214.30 purusarthahetukam 42a: 57,fn. (1), parärthah böd:(261.16) (232.21) -parärthatvät 17^:78.11, (168.4) parinämatah I6c:(163.4) pur usart hart harn 69a: (267.5) pürvah 5ld:(252.28)

parimänät I5a,:3.22, 4.21, 5.28, (14L17) paroksam 6d:(99.6) -paryantah b4d:(257.25) -partyantam 40b:(230.13)

-pürvikä 30d:204.24, (212.27) pürvotpannam 40a,:(230.13) prakäsakam -prakäsa-

*The reading punah of the Mss is emended to yatah in this edition.

Index of Words of the Samkhyakarika prakäsya S6d:209.7, (222.18); b9d:(264.2O) prakasyam 2>2d.(216.17) prakrtih Zd:63.4, (66.4); 59d:(264.20) -prakrtih 3a,:(58.8), 63.2 prakrtikrtah 56&:{261.15) prakrtilayah 45^.(236.9) prakrtivikrtayah 3bi60.ll, (62.18) pradhänapurusantaram

301 37d:(223.23)

pradhänam (Uc):8.6, HO.4, 169.19 pradhanavinivrttau 268.1 6Sb:(266.19),

pradhänasya 21b:48.10, (184.15), 267.26] *>7d:4.23, (263.4) prabhütaih 39b:{228.2) . p P a m 5 ? a . 4b:(69.20), 76.13 pramänam 4c:t68.29), 76.13 pramanat 4d:(67.4)

prakrtivirüpam 8d:6.26, (107.14), 125.23 prakrteh 22a:7.14, 57Jn.(2), 63.11, (187.23), 267.22; 42c:(232.22)
P r

prameyasiddhih 4d:(67.4) prayacchanti 36d:209.7, (222.18) -pralayäh G9c:(267.20) pravartate I6b:( 162.23); 24^.(19118), 19123; 25b:(195.32), 197.5; b2d:(255.18); 56b:(261.15); 58c:{264.7) 58d:(264.8)
v ; v ;

f ^

-pracaram 27d:(200.8) prati 37a:7P.2S, 209.8, (223.9) -prati- 16d:(165.1) pratmiyamat 18b:(174.28)

pratipadyante 31a:(^i5.^), £14.

pravrttih h7b:(263.3);
pPaVTtteh

.(l),

(144-31);

Ud:(173.20)

prativisayadhyavasayah oai^.o, 7ö.i^, (76.25)
m

-prasangena 42b:(232.21) prasavadharmi (Ub):8.6, 17.1, 139.21, 169.18, 176.6 prasiddhih 6b:86.2, (88.3) präkrtikäh 4Sb:68.1, (234.18) pränädyäh 29d:(206.5) -präptih

pratyayasargah 46a:7.9, (239.4) pradadau 70b:(268.15) pradipakalpäh 36a,:79.26, 209.6, (222.17) ' pradlpavat 13d:(i57.5)

302 präpte 68a,:(266.12), 268.1 -präptau 67b:{265.24)

APPENDIX IV bhäväh 43a,:57,fn.(2), 68.1, {23118) -bhävät

präpnoti 55b:10.1, (258.3), 258.27 17 - . . . ._ , -, / 1 O v 1IQ -bhäväkhyah S2c:(255.18) pntyapritivisadatmakah (12a.):148.5 u AU u ^ ^ /iioÄ /\ bhävaih 40d:(ÄJO.i^); bandhah 44d:(«J&^) 52a:(«5ff.l]) -bahutvam lSc:{175.18) -^ uu Kß v ; -bhuta- 56 bahudhä 7Od:(«0P.7) k , % . . , bhutadeh bähyam 33b:(^i7.i); 33c-(217 25) bhütänäm bähyäh 50c:(^Äi) bhütäni 22d:(WÄ«) 38b: 7.Ä, (j8«5.5) buddhih 23&:57,fh.(2), 77.1 {188*17); bhedah 48a:7.ü, (241.28) Kz:57,fn.(2), (221.7); Z7b:79.28, 209.8, (223.9); -*>heda l) bhedah buddhivadhaih A9b:(242.26) buddlndriyäni 26^.(197.9), 216.32; M*:57,Jh.(£), 77.3, (218.1) buddhau 36d:«W.7, (222.18)
b r

-bhedäh 47z:6.21, 7.10, (240.10)
bhedänäm

lte:3.22, 4.21, 5.28, 268.1

(UU7} ^ ^ ^.(266.12),

t ^ S 7

t

^

P a r y m t <

*

bhoktrbhävät 17c:(i7M) bhautikah -bhramavat SU:(256.19) 67d:(265.25)

bhavati 20d:(Wft55); 2Vh:(205.23), 213.16; Z4c:(218.8); teb:(235.9); Ahb:(236.25); 1); , (256.10) bhavanti \7b\6.21, 7.10, (240.10) ; ' 'v ^ -bhagyakhySh ; bhävasamsiddhih -bhävab2b:(255J6)
}

-mat 10^.(127.3), 189.21 -matina 7lc:(269.25)

madhye . _ , , n n fflX manah 27^.(199.12) mano'navasthanat 7b:(98.2)

mayä (66a):^P.7, 184.9 -marana- 18a:6.16, (174.28); 55a:19.1, (258.3), 258.27

Wb:(261.15)

-bhavah 19d:(17&ltf), 180.31

Index of Words of the Samkhyakarika mahadadi 8c:6.26, {107.14), 125.23 40b:(230.13) mahadädyäh 3b:60.11, (62.18) mahän 22a: 7.11 57Jn.(2), 63.11, (187.23), 267.22 mahämohah 48b:(242.4) mätäpitrjäh 39a:(22&2); ?><äd:(228.23) -matram 28b:(201.11), 213.15, 217.30 mädhyasthyam 19c:(176.16), 180.31 mänusyah 53c: 18.3, (256.11) mimih 70b:(268.15) müdhäh 38d:7.^, (227.19) mülatah 54b:(257.16) mülaprakrtih 3a,:(58.8), 63.2 m e 64b:7.29, 192.13, (265.8) -mohah 48b:(242.4) mohasya 48b:(242.1) yatah 37c:(223.23) yatra 69d:(267.20) yathä 4U:(231.9); 41b:(231.9); hlb.4.22, (263.3); 58b:(264.7); b9b:(264-19) yasmät 35b:57,fn.(2), (221.7); Zlb:79.28, 209.8, (223.9) -yuktah 2b:19.8, (31.9) yugapat 30a,:(211.24) ye 12^.(270.5) -yogät 42c:(232.22) rangasya 5 9 a : ( ^ . 19) rajah 13b:(134.26) rajovi^alah 54c:(257.19) -rasana- 26b:(197.9), 216.32 rägät 45b:(236.25) räjasät 45b:(236.25) rüpam 23c:(191.29) rüpädisu 28^.(201.11), 213.15 -laksanyam 29a: 189.35, (205.9) laghu U*,:(134.26) -layah 45z:(236.9) Ungarn 10b:(127.3); 20b:78.7, (180.35); 40d:(230.14); 41d:(231.10); 42d:4.22, (232.22); 57Jn.(2), ^2^.(255.14) lhigasya bbc:19.2, (260.25) liiigäkhyah 52c:(255.18) lingena 52b:(255.16) lokah 58b:(264.7) -vacanam 4ab:4.6, 32.6, (70.11); 5d:(87.3)

303

vacanadänaviharanotsargänandäh -vat 2a,: 19.8, (30.18); Ud:(137.5); 20b:78.7, (180.35); 2ic.48.ll, (184.27), 267.27; 41c:231.10); 42d:4.21, (232.22); f>8d:(264.8); 67d:(265.25)

304

APPENDIX IV

vatsavivrddhinimittain 57a: (263.3) vinivartate b9d:(264.20) -vadhäh 49^.(242.26) -vadhä 49c:(243.11) -vadhaih 49b:{242.26) varanakam I3c:(134.27) -vasät $7c:(265.25) väk Uc:(218.8) viparyayabhedäh 47&:6.21, 7.10, (240.10) viparyayät 44d:(236.4); 45d:(237.22); 49d:(243.11) -viparyaya- 14b:(139.23) viparyayäsaktitustisiddhyäkhyah 46b:7.9, (239.4)" -vikalpah 53a: 18.2, (256.10) vikärah Zc\63.l (63.24) (62.18) viparyastam 2M\(193.7) -vinivrttau 6$b:(266.19), 268.1 -viparitah 2c:35.5, (47.8); (Ud):8.4 viparltam 10d:(i^7.^)

-väda- 72d:(270.6) väkpänipädapäyüpasthäh 26cd: (197.25) väyavah 29d:(206.5)

-vikrtayah Sbi60.ll,

vikrtih id:63.4, (66.4) -vighätäh 5lb:{251.10)

-viparyäsah 4§d:(237.22) viparyäsät I9<i:6.19, 66.10, 155.12, 157.10, (176.16), 180.30 -vibhägät \hc:{147.24)

-vijfiänät 2d:(48.15), 90.6, 107.20 vijfiäya 7ld:(269.27)

vibhutvayogät 42c:(232.22) -vimardät 4ßc:(240.3) -vimoksa- b6c:(261.16); b7c:(263.4) vimoksärtham b8c:(264-8) -virahitäh 72c:(270.6) virägah 23b:(191.28) -virüpam 8d:6.26, (107.14), 125.23 -vilaksanäh 36b:209.6, (222.17) -vivarjitäh 72d:(270.6) -vivrddhi- 57*1(263.3) -visälah b4z:(257.10); 54b:(257.16); 54c:(257.19)

-vidhah 24b:(194.18), 194.23) 48an7.ll, (241.28); 48b:(242.4)', 5ld:(252.28); 52d:{255.18); h?>c:18.3, (256.11) -vidham 4c:(68.29), 76.13; 5b:6.3, (82.29); 32a: 175.2, (215.21); c:4-23, 57Jn.(2), (221.8) vinä 41b:(231.9); 41c:(231.10); 52a:{255.14); b2b:(255.16)

Index of Words of the Samkhyakarika visinasti ilc:(223.23) vaikrtäd 25b:(195.32), 197.5 vairägyät 45a:(236.9) vaisvarüpyasya 15d:( 150.18), 267.23 -vaisamya- 46 v y a k t a m l0d:(127.4), 189.21] (llc):8.6 vyaktävyaktajnavijiiäiiät 90.6, 107.20

305

visuddham 64c: 7.30, 192.11 (265.14) -visesäh Wb:209.6, {222.17) visesäh 38c:7.3, (225.7)] Üb:(22ll3) S9b:(228.2) -visesät 16d:( 165.1) visesävisesavisayäni 34b: 77.5, (218.1)' visesair Alc:(231.10)

2d:(48.15)

vyavatisthate 42d:4.21, (232.22) vyavadhänät lc:(98.3)

-visaya- 5a:^.£, 70.16, (76.25) visayah (11*): 126Jn. (3), 139.21, '169.18, 176.6 -visayam 27c:(200.8), 216.36 visayam Sbb:57,fn.(2), -visayä Uc:(218.8) 7, (217.18), (221.7)

saktasya 9c:(122.19) s a k t i t a h 15b:97,jh.(l), (144-31)

sakyakaranät 9c:(122.19) s a b d a h 51a.: 192.10, (251.10) sabdavisayä ZAc:(218.8) -sarlrah 67d:(265.25) s a r l r a b h e d e 6S*:{266.12), 268.1 säntäh 38d: 7.5, (227.19) s ä s t r a m 69a,:(267.8) sisyaparamparayä ll&:(269.12)

visayäkhyam " 221.25

-visayäni 34b:77.3, (218.1)] 'Ud:57,fn.(2), (218.13) visayoparamät 50c:(248.1) -visäda- (12a): 148.6 -viharana- 2 8 c : ( ^ . 5 ) - v r t t i 29c:(206.5) vrttih 13d:(i575); " 28b:(201.11), 213.15, 217.30] 29^:189.35, (205.9)] 30d:204.24, (212.27) v r t t i m nb:(213.26), 214.30

sesäni Md:57Jn.(2), (218.13)] *3bd:57Jn.(2), (221.8) - s r u t i h bd:(87.3) sreyän 2c:35.6, (47.9) sastitantrasya 12b:(270.5) sodasakah Zc:63.4, (63.24)] % 22b:7.14, (188.5) sodasakät 22c:(188.8) samksiptam 7lc:(269.25)

-vaikalyät 47b:6.21, (241.18) v a i k r t ä h 43b:68.1, (234.18)

306

APPENDIX IV sargah 21d:(185.20), 255.3, 267.27; 24b:(194.18), 194.23; 52d:(255.18); bSd:(256.19); b4b:{257.16) -sargah 46a:7.9, (239.4) sarvapramänasiddhatvät 76.12 4b:(69.20),

sanghat aparärt hat vat 17a: 78.10, (168.4) samyogah 21d.48.ll, '267.27 (184.27),

-samyogät 20a,:78.7, (180.35) samsarati A0c:(230.14) samsärah 45b:(236.25) -samsiddhih 52b:(255.16) samskäravasät &7c:(265.25) sa 2b: 19.8, (31.9); 2bd:(196.4) sakriyam 10b:(127.3) samkalpakam 27&:(199.12) sat 9d:(124.6) sattvam 1^.(134.26)

sarvam 35b:57,Jh.(2), (221.7); Wv.79.28, 209.8, (223.9) sarvasambhaväbhävät salilavat 16c:(165.1) saha 39b:(228.2); 49b:(242.26) sämsiddhikäh 4U:57Jn.(2), \234.18) sa lc:(24.15); 29b:(205.23), 213.16; 37c:(223.23) säksitvam 19b:(176.15), 180.30 sättvikah 2h*:(195.32) sättvikam 2ic:(191.29) 68.1, 9b:(119.19)

sattvavisälah 54*1(257.10) sapta 2b:60.11, (62.18) saptatyäm 72a,:(270.5) saptadasavadhä A9c:(243.11) samanvayät l$b:97,fn.(l), {143.27)

samäkhyätam 27h:(200.2), 216.35; 69b:(267.11) samänabhihärät 7d:(98.3) samäsatah hZd:(256.19) samäsena 55d:19.2, (260.25) samudayat l$b\(162.23)

sädhayati Z7b:79.28, 209.8, (223.9) sädhyam 6d:(P9.^) säntahkaranä Z$a,:57,fn.(2), (221.7) sämänyakaranavrttih 29c: (206.5) sämänyam (llb):8.5, 169.18, 176.6 17.1, 139.21,

-sambhava- W.(119.19) samyak 71d:{269.27) samyagjnänäbhigamät (67a): 6./^ sarüpam Sd:6.26, (107.14), 125.23

sämänyatah 6a,:86.2, (88.3) sämlpyät 7a:(98.2) sämpratakälam ZZc:(217.25) sävayavam 10c: (127.4)

Index of Words of the Samkhyakarika siddhah 14^.(139.20) -siddhatvät 4b:(69.20), 76A3 siddham 14d:(^0.7), 140.30; lSc:(175.18); I9b:(176.15), 180.30 siddhayah §lc:(251.11) smrtäh 38c: 7.5, (225.7) syuh 39b:(228.2) sväm 31a2'-.(213.26), 214-30 svärthah b6d:(261.16) sauksmyat 7c:(98.3); 8a:J,«0, (106.6), 107.6,9 -stamba- 54d:(257.25) sthänvädibhyah 4lb:(231.9)

307

sthityutpattipralayäh 69c:(267.20) siddhantam 71d:(269.27) -siddhi- 46b:7.9, (239.4) siddhih 476:6.22, (241.22) -siddhih Ad:(67.4) -siddhlnam 49d:(243.11) siddheh bld:(252.28)

svälaksanyam 29a: 189.35, (205.9) hi 2b:19.8, (31.9); 4d:(67.4) hetuh Uc:(213.27)

suhrtpräptih 51b:(251.10) süksma- 40b:(230.13)

-hetukam 42a:5?'Jn.(l), (232.21) süksmaparyantam 40b:(230.13) süksmam 37d:(223.23) süksmäh 39a:(228.2); i9c:(228.23), 230.11 -hetuklm 31b:(2i3.2£), 214.30 hetumad 10^.(127.3), 189.21 hetau lb:4.19, (11.8)

308 Appendix V

APPENDIX V

I n d e x of t h e verses q u o t e d or at a n y rate found the Yuktidlpika

in

angabhävam vrajat sattvam duhkham sampadyate yadi / <trai>rüpyasyopasamhärät pürvadosänivartanam / / p. 138.6-7

angabhävänapeksam <tu> grahanam nasty rser api / p. 138.14

agädham etat pätälam esa panko duruttarah / klesavyädhibhayäkirnam etac chvabhram bhayävaham / / p.29.3-4

ajnänadhväntasäntyartham rsicandramasas cyutä / malinais tirthajaladais chädyate jiiänacandrikä / / p.270.13-14

ato 'pi yena purusah samayed vadavänalam / nendriyäny upabhogena visayebhyo nivartayet / / pp.249.28-250.1

anasüyä brahmacaryam yajanam yajanam tapah / dänam pratigrahah saucam sraddhäyä laksanam smrtam / / p.210.4-5

apäma somam amrtä abhüma / p.30.13-14

ayam sa ksetriyo vyädhir ayam ätyantiko jvarah / idam äspadam Itlnäm esa yonih sapäpmanäm / / p.29.1-2 arke cen madhu vindeta kimartham parvatam vrajet / istasyärthasya sampräptau ko vidvän yatnam äcaret / / p.51.11-12

arthäkära iväbhäti yathä buddhis tathä pumän / äbhäsamäno buddhyäto boddhä manivad ucyate / / p.171.15-16

Index of the verses quoted or at any rate found in the Yuktidipika alpagrantham analpärtham sarvais tantragunair yutam / päramarsasya tantrasya bimbam ädarsagam yathä / / p.3.2-3

309

alpäksaram asandigdam säravad visvatomukham / astobham anavadyam ca sütram sütravido viduh / / p.3.28-29

asattvän nästi sambandhah kärakaih sattvasangibhih / asambandhasya cotpattim icchato na vyavasthitih / / p. 118.6-7

äkäro gauravam rauksyam varanam sthairyam eva ca / sthitir bhedah ksamä krsnacchäyä sarvopabhogyatä / / p.225.24-25

ätmaiva hy ätmano nästi viparitena kalpyate / naiveha sattvam ätmästi dharmäs tv ete sahetukäh / / p. 167.13-14

äyäsäs ca vighätäs ca vipralambhabhayäni ca / yac cänyad asivam loke tat kämebhyah pravartate / / p.28.10-11

ärambhäya prasrtä yasmin käle bhavanti kartärah / käryasyä nis<n>ätäs tarn madhyamam kälam icchanti / / p.118.11-12

itas tyam sadbhir ädiptam trnolkäcapalam sukham / sudrdhair na nipätavyam duhkhair dehäntarodbhavaih / / p.248.19-20

iti te pärthivä dharmäs tadvisistäs tathäpare / jalägnipavanäkäsavyäpakäs tän nibodhata / / p.225.27-28

iti sadbhir asambhräntaih kudrstitimiräpahä / prakäsikeyam sarvasya dhäryatäm yuktidipikä / / p.270.15-16

ürdhva<gam> pävakam dagdhr päcakam laghu bhäsvaram / pradhvarpsy ojasvitä jyotih pürväbhyäm <sa>vilaksanam / / p.226.4-5

310

APPENDIX V rsaye paramayarkamancisamatejase / samsäragahanadhväntasüryäya gurave namah / / p. 1.5-6

evam vinäpi sargena yasmäd baddhah pumän gunaih / tasmäd viphalatäm yätu manorathimanorathah / / p. 185.17-18

karanänäm asämarthyam astävimsatidhä matam / iti sastih padärthänäm astäbhih saha siddhibhih / / p.2.18-19

karmanä mrtyum rsayo nisedhuh prajävanto dravinam icchamänäh / athäpara rsayo mamsinah param karmabhyo 'mrtatvam änasuh / / p.37.5-6

kurvann eveha karmäni jijivisec chatam samäh / p.35.15

kaivalyapräptihetutväd yä vedavihitä stutih / prasastä yäjnavalkyädyair visistais tattvaniscayät / / p.54.11-12

granthenälpena samksipya tad ärsam anusäsanam / nibaddham amalaprajiiaih sisyänäm hitakämyayä / / p p . 1.11-2.1

cetanädhisthitä buddhis cetaneva vibhävyate / kartrsv avasthitas cätmä bhoktä karteva laksyate / / p. 181.11-12

caitrasya däsabhäryeyam lünacakraratho mayä / saraih sätitapatro 'y a i P vrksäd iti satäm matam / / p.l2,fn.(6)

jagäma tarn vanoddesam vyäsah saha maharsibhir / p.221.13

janmatulyam hi buddhinäm äptänäptagiräm srutau / janmädikopayogam ca nänumäne trilaksanah / / p.l04,fn.(l)

Index of the verses quoted or at any rate found in the Yuktidipika jahad dharmäntaram pürvam upädatte yadä par am / tattväd apracyuto dharmi parinämah sa ucyate / /

311

pp.111.21-22, 163.12-13 jaräyujam gavädinäm andajam caiva paksinäm / trnädes codbhijjam ksudrajantünäm svedajam smrtam / / jnänavijiieyayor yadvad rüp<ä>bhede 'pi bhinnatä / grähyagrähakabhävena tathaivätmaprakäsayoh / / p. 172.6-7 taträhäravihärotthän rogän dravyam apohati / yas tu karmakrto vyädhir maranät sa nivartate / / p.26.8-9 tattvamjijnäsamänäya vipräyäsuraye munih / yad uväca mahat tantram duhkhatrayanivrttaye / / p. 1.7-8 tattvasamam vaivartam taträbhisyandikam dvitiyam syät / vaikrtam atas trtiyam sätk<au>sikam etad äkhyätam / / p.233.14-15 tathaiva sarvasabdänäm prthagarthäbhidhäyinäm / väkyebhyah pravibhaktänäm arthavattä na labhyata / / p. 13.13-14 tad eva bhävanäpeksajiiänam käläntare punah / tatraiva sendriyam jätam pratyabhijfiänam ucyate / / p.212.22-23 tad evaitac chirognvam tau bähü parighopamau / tad eva cäsya vikräntam näyam anyo dhananjayät / / p. 154.5-6 tapahsraddhe ye hy upavasanty aranye säntä vidvämso bhaiksacaryäm carantah / süryadvärena te <virajäh> prayänti yaträmrtah sa puruso <hy> avyayätmä / / p.41.11-14 tarn eva viditvämrtatvam eti nänyah panthäyanäya vidyate / p.51.1 p.228.18-19

312

APPENDIX V tarunyo vrsalibharyah praviram putrakamyati / rddhasya räjamätangä iti na syuh prayuktayah / / p.l2,fn.(6)

tasmät sanghätamätratvät sattvädinäm ghatädivat / ä brahmanah parijnäya dehänäm anavasthitim / / p.248.17-18

tasmäd anicchann anyesäm präninäm dehapidanam / santosenaiva varteta tyaktasarvaparicchadah / / p.250.18-19

tasmäd rägänugair uktäm kuhetuprtanäm imäm / apohya matimän yuktyä hy äsramäd äsramam vrajet / / p.54.15-16

tasmäd vinäsisv äsaktäm putradäragrhädisu / mameti buddhim yatnena buddhimän vinivartayet / / p.249.16-17

tasmäd visayasamparkam asamartham nivartane / indriyänäm parijnäya niräsangamatis caret / / p.250.2-3

tasmäd vai vidvän purusam idam brahmeti manyate / sarvä hy asmin devatäh sarlre 'dhisamähitäh / / pp.46.17-47.1

tasya vyäkhyäm karisyämi yathänyäyopapattaye / kärunyäd apy ayuktäm täm pratinandantu sürayah / / p.3.4-5

tiryakpätah pavitratvam äksepo nodanam balam / rauksyam acchäyatä saityam väyor dharmäh prthagvidhäh / / p.226.6-7

tesäm icchävighätärtham äcäryaih süksmabuddhibhih / racitäh svesu tantresu visamäs tarkagahvaräh / / p.2.4-5

drsyadarsanabhävena prakrteh purusasya ca / apeksä sästratattvajfiair bandha ity abhidhiyate / / p.185.15-16

Index of the verses quoted or at any rate found in the Yuktidipika dvädasaiva <bh>avängäni skandhäyatanadhätavah / vicintya sarväny etäni pudgalo nopalabhyate / / p. 167.15-16

313

dvitvaikatvaprthaktvam nityam cetanam acetanam süksmam / satkäryam asatkäryam vividisitavyarn vividisäyäh / / p.210.10-11

na karmanä na prajayä dhanena tyägenaikenämrtatvam änasuh / parena näkam nihitam guhäyäm vibhräjate yad yatayo visanti / / p.37.1-2

na jätu kam ah kam an am upabhogena sämyati / havisä krsnavartmeva bhüya eväbhivardhate / / p.27.9-10

na tat parasya sandadhyät pratikülam yad ätmanah / esa samksepato dharmah kämäd anyah pravartate / / pp.34.17-18, 248.12-13

na tad asti jagaty asmin bhütam sthävarajangamam / pratyaksato 'numänäd vä vinäso yasya neksyate / / p.249.14-15

na tasyädhigamah sakyah kartum varsasatair api / bhüyastväd iti samcintya munibhih süksmabuddhibhih / / p.1.9-10 naseso< ? gne> 'nyajätam <asti> / p.83.5

nayanti santas ca yatah svasaktito gunam paresäm tanum apy udäratäm / iti prayätv esa mama sramah satäm vicäranänugrahamätrapätratäm / / p.270.19-20

nastotpannam ananyatväd anityam nityam eva vä / nastotpannävinastänäm nityam no nästi caikadä / / p.189.11-12

314

APPENDIX V nadhyavasayam kurute puruso naiva sthitim prayogam va / na svätmano na parato <na> vyapadesän na cobhayatah / / p. 180.27-28

näbhijätim na vijnänam na ca sauryam apeksate / laksmih samskärayogäc ca kvacid evävatisthate / / p.28.5-6

nirätmakatväd asatäm sarvesäm avisistatä / visesanam ced bhinnam te sattvam abhyupagamyatäm / / p.125.6-7

pancavimsatitattvesu janmanä jnänam äptavän / ya ädisrstau(?) namas tasmai kapiläya mahätmane / / p.l,fn.(l)

pancänäm yoninäm dharmädinimittatäm ca samsthäpya / paripakvam ity adhastän na punas tadbhävito gacchet / / p.211.11-12

param rahasyam vedänäm avasänesu pathyate / pandädyartham tad istam ced distyä saphalatä sruteh / / p.54.5-6

prthannivistatattvänäm prthagarthäbhipätinäm / indriyänäm yathä käryam rte dehän na labhyate / / p.13.11-12

pracyuto mahato yas tu na präpto jnänalaksanam / vyäpäro jnänayonitvät sä yonih kukkutändavat / / p.209.22-23

pratipaksäh punas tasya purusesänuvädinah / vainäsikäh präkrtikä vikärapurusas tathä / / p.2.2-3

pratiyogipadäd anyad yat <anyat> kärakäd api / vrttisabdakadambasya sambandhas tena nesyate / / p.l2,fn.(6)

pratyaksam anumänam ca sabda<s> copamayä saha / arthäpattir abhävas ca hetavah sädhyasädhakäh / / p.70.20-21

Index of the verses quoted or at any rate found in the Yuktidipika pradhänästitvam ekatvam arthavattvam athänyatä / pärärthyam ca tathänaikyam viyogo yoga eva ca / / p.2.12-13

315

pramänatvena täm lokah sarvah samanugacchati / vyavahäräh pravartante tirascäm api tadvasät / / p.75.12-13

präninäm upaghätena yo 'rthah samupajäyate / so 'napeksaih prahätavyo lokäntaravighätakrt / / p.248.15-16

punar jvare samutpanne kriyä pürvajvaräriugä / p.26.16

bädhiryam ändhyam aghratvam mükatä jadatä ca yä / unmädakaustyakaunyäni klaibyodävartaparigutäh / / p.243.4-5

bähyäm pränavivrttim samyanmärge budhah pratisthäpya / vinivrttavikharakaluso dhruvam amrtam sthänam abhyeti / / p.211.9-10

bhinnä laksanabhedäs cen mithah sattvädayo gunäh / tarhi laksanayuktatvät sad gunäh präpnuvanti te / / p. 137.22-23

bhüyah pro_ttapaksäs(?) cyutabahulasiläh ksobhayanty adrayas ced utplutyoccaih sakälau pad_äsu(?) dandahrte 'gnih / dedhlyante 'thaväntar miladalaghujalasaptakü (?) svasthänäj jätucin me pracalati na mano viradhiram tathäpi / /

matabhedesu pathyatväbhimänändhä janä vrthä / yato ghattakutlbhävah par am tvam visvatomukha / / p.l5,fn.(l)

mustir yathä vikirnah sücyagre sarsapädinäm / tisthati na süksmabhävät tadvad dvandväni sarvajiie / / pp.181.34-182.1

316

APPENDIX V yato vaco nivartante 'prapya manasa saha / änandam brahmano vidvän na bibheti kutascana / / p.50.18-19

yatnopättäh suguptäs ca visayä visayaisinäm / pasyatäm eva nasyanti budbu<d>äh salile yathä / / p.249.12-13

yathä bähyädyavasthäsu vyäkärä cittasantatih / vidyate bljamäträ vas tathä dhir iti grhyatäm / / p.190.26-27

yathä yathä manovrttih puruso 'pi tathä tathä / buddhirüpam aväpnoti cetanatvät paräsrayam / / p. 171.17-18

yathä yathä hi visayo vrddhim gacchati dehinäm / apaghätas tadahgänäm tathaiväsya vivardhate / / p.250.16-17

yathäkramam laksanatah kärtsnyenehäbhidhäsyate / tasmäd atah sästram idam alam nänätvasiddhaye / / pp.2.21-3.1

yathäbhyäsam hi väkyebhyo vinäpy arthena jäyate / svapratyayänukärena pratipattir anekadhä / / p.75.5-6

yadä prabandhäd visayi visayän upasevate / tadäsya <tesv> abhipräyah sutaräm sampravartate / / p.249.26-27

yadä hetuh svarüpena sädhyasiddhau prayujyate / sa vito 'rthäntar<a>ksepäd itarah parisesatah / / p.89.2-3

yady asattvam ghatädinäm utpattau hetur isyate / sasasrnge 'pi tulyatväd utpattis te prasajyate / / p.122.15-16

yasya yenäbhisambandho dürasthasyäpi tasya tat / arthatas tv asamänänäm änantarye 'py asambhavah / / p.23.5-6

Index of the verses quoted or at any rate found in the Yuktidipika yarn eva prathamäm rätrim garbhe bhavati purusah / samprasthitas tarn bhavati sa gacchan na nivartate / / p.246.12-13

317

yena dravyena mohändhä rantum icchanti dehinah / tad evaisäm vinäsitväd bhavaty aratikäranam / / p.249.10-11

yo 'smäd visayasambhogäd vihagah panjaräd iva / gato vanesu ramate sa sukhäni samasnute / / p.29.7-8

yoninäm sapramänänäm samyanmärge niyojanät / srotasäm ca visuddhatvän nirasangamatis caret / / p.253.14-15

rajovisaktir angesu vaivarnyam mlänapuspatä / patisyatäm devalokät präninäm upajäyate / / p.259.20-21

laksanavisayasatattvam traigunyasamanvayam ca pancänäm / yoninäm yo vidyäd yativrsabham tarn tv aham manye / / p.210.19-20

laghüni sücitärthäni svalpäksarapadäni ca / sarvatah särabhütäni süträny ähur manlsinah / / p.4.2-3

varsätapäbhyäm kirn vyomnas carmany asti tayoh phalam / carmopamas cet so 'nityah khatulyas ced asatsamah / / p. 182.4-5 väci karmani samkalpe pratijnäm yo <Jnu>raksati / tannisthas tatpratijnas ca dhrter etad dhi laksanam / / p.210.1-2

vidvän karmäni kurvitety etad uktam kila srutau / sa ca pandädir eva syäd yo 'tyantam karmanas cyutah / / p.54.7-8

vinä sargena bandho hi purusasya na yujyate / sargas tasyaiva moksärtham aho sämkhyasya süktatä / / p. 185.12-13

318

APPENDIX V vividhayasasokanam etad ayatanam mahat / dainyasramavisädänäm etat ksetram apävrtam / / p.29.5-6 visapltasuptamattavad avividisä dhyäninäm sadä yonih / käryakaranaksayakari präkrtik<a>gatih* samäkhyätä / / p.210.13-14 visayendriyasamyogät pratyaksajnänam ucyate / tad evätindriyam jätam punar bhävanayä smrtih / / p.212.20-21 vitävitavisänasya paksatävanasevinah / pravädäh sämkhyakarinah sallakisandabhanguräh / / pp.1.3-4, 2.6-7 vrksägräc cyutapädo yadvad anicchan narah pataty eva / tadvad gunapurusajno 'nicchann api kevali bhavati / / p.50.10-11

vrttir antah samastänäm karanänäm pradipavat / aprakäsä kriyärüpä jivanam käyadhärikä / / p.208.23-24 vedavedähgatarkesu vedasamjfiä nirucyate / p.31.5

vaikrtam api ca dvividham svavaikrtam tatra tärakam bhavati / syät saptavidham paravaikrtam <su>tärädi nirdistam / / p.233.17-18 <vya>bhicäräd visesäs tu pratitäh pratipädakäh / / p.86.20

sisyair duravagähäs te tattvärthabhräntabuddhibhih / tasmäd Isvarakrsnena samksiptärtham idam krtam / / p.2.8-9

sünyam ädhyätmikam pasya sünyam pasya bahirgatam / na drsyate so 'pi kascid yo bhävayati sünyatäm / / p. 167.18-19 *A11 the Mss read prakrtika gatih

Index of the verses quoted or at any rate found in the Yuktidipika sesavrttir akartrtvam cülikärthäh smrtä dasa / viparyayah pancavidhas tathoktä nava tust ayah / / p.2.15-16

319

satsatäni niyujyante pasünäm madhyame 'hani / asvamedhasya vacanäd ünäni pasubhis tribhih / / p . 31.16-17

sa eva vartyatäm präjnaih kirn nyäyyo 'tha matibhramah / indriyärthänurägo vä dveso vä moksavartmani / / p.54.9-10

satyam jnänam anantam brahma / yo veda nihitam guhäyäm parame vyoman / so 'snute sarvän kämän / saha brahmanä vipascitä / / p.50.15-17 (metrically irregular)

satyaväcah prasäntasya sarvabhütäny anicchatah / bhavändhakäräntajnänam acirena pravartate / / p.250.20-21

saptatyäkhyam prakaranam sakalam sästram eva vä / yasmät sarvapadärthänäm iha vyäkhyä karisyate / / p.2.10-11

samvid ahamkäragat<ä>käryam k<a>ranam <ca> pürayati yasmät / tasmät pur ity uktä pratyavabhäsästamam bhoktuh / / p.209.2-3

samvedyatväd gurutväc ca ninditatväc ca sädhubhih / sarvaträsannidhänäc ca na drsto hetur isyate / / p.27.14-15

samhatänäm tu yat käryam sämänyam te gavädayah/ itaretaradharmebhyo visesän nätra samsayah / / p.226.12-13

sarvatogatir avyüho Viskambhas ceti te trayah / äkäsadharmä vijfieyäh pürvadharmavirodhinah// p.226.9-10

320

APPENDIX V sarvesam vyadhirupanam nidanam trividham smrtam / ähäras ca vihäras ca karma pürvakrtam tathä / / p.26.6-7

sä yävad aniruddhä tu hanti väyum rajo'dhikä / dharmädyanävrttivasät tävaj jivati mänavah / / p.208.25-26

sukham ca duhkham <cänu>sayam ca värenäyam sevate tatra tatra / / p.261.1

sukhärthi yas tu seveta vidyäm karma tapämsi vä / präyascittaparo nityam sukhäyäm sa tu vartate / / p.210.7-8

sütrapramänävayavopapattir anyünatä samsayanirnayoktih / uddesanirdesam anukramas ca samjnopadesäv iti tantrasampat / / p.3.10-11

seyam visayarägändhair viparitärthavädibhih / vidyä kanyeva pandäya dlyamänä na sobhate / / p.54.13-14

sopadravah sarvarüpo balamämsendriyäpahah / säristas caiva yo vyädhis tarn bhisak parivarjayet / / p.26.11-12

snehah sauksmyam prabhä sauklyam märdavam gauravam ca yat / saityam raksä pavitratvam santänas caudakä gunäh / / p.226.1-2

sphutäbhidheyä madhuräpi bhäratl manisino nopakhalam viräjate / krsänugarbhäpy abhito himägame kadusnatäm yäti diväkaradyutih / / p.270.17-18

Pada Index of verses found in the Yuktidipika Appendix Päda VI of the verses quoted or at any

321

Index

rate

found in the

YuktidTpika p.138.6 p. 138.14 p. 2 9.3 p.250.21 p.270.13 p.228.18 p.249.28 p.37.6 p.210.4 p.50.11 p. 189.11 p.3.10 p.250.17 p.30.13-14 p.185.16 p.54.16 p.208.24 p.50.18 p.l5,fn.(l) p.29.1 p.29.1 p.51.11 p.23.6 p. 13.14 p.2.12 p.171.15 p.70.21 p.3.1 p.3.2 p.3.28 p.54.5 p.210.13 p.226.9 p.31.17 p.2.19 p.2.18 p. 118.6 p. 118.7 p.250.2 p.3.29

angabhavam vrajat sattvam (a) ahgabhävänapeksam <tu> agädham et at pätälam (a) acirena pravartate / / (d) ajnänadhväntasäntyartham (a) andajam caiva paksinäm / (b) ato 'pi yena purusah (a) athäpara rsayo manisinah (c) anasüyä brahmacaryam (a) anicchann api kevali bhavati / / (d) anityam nityam eva vä / (b) anyünatä samsayanirnayoktih / (b) apaghätas tadangänäm (c) apäma somam amrtä abhüma / apeksä sästratattvajiiair (c) apohya matimän yuktyä (c) aprakäsä kriyärüpä (c) apräpya manasä saha / (b) -(a)bhimänändha janä vrthä / (b) ayam ätyantiko jvarah / (b) ayam sa ksetriyo vyädhir (a) arke cen madhu vindeta (a) arthatas tv asamänänäm (c) arthavattä na labhyata / / (d) arthavattvam athänyatä / (b) arthäkära iväbhati (a) arthäpattir abhävas ca (c) alam nänätvasiddhaye / / (d) alpagrantham analpärtham (a) alpäksaram asandigdam (a) avasänesu pathyate / (b) avividisä dhyäninäm sadä yonih / (b) aviskambhas ceti te trayah / (b) asvamedhasya vacanäd (c) astäbhih saha siddhibhih / / (d) astäviinsatidhä matam / (b) asattvän nästi sambandhah (a) asambandhasya cot pat t im (c) asamartham nivartane / (b) astobham anavadyam ca (c)

322 aho samkhyasya suktata / / (d)

Appendix VI p. 185.13 p.248.18 p.225.24 p.226.10 p.226.6 p.2.4 p.167.13 p.23.6 p.50.19 p.lO4,fn.(l) p.171.16 p.28.10 p.118.11 p.26.7 p.118.7 p.89.3 p.226.13 p.248.19 p.225.27 P .12,fn.(6) p.270.20 p.2.19 p.270.15 p.29.2 p.46.17 p.250.3 p.13.12 p.54.10 p.51.12 p.2.11 p.122.16 p.122.15 p.l,fn.(l) p.3.11 p.243.5 p.27.9 pp.111.21, 163.12 p.31.17 p.226.4 p.13.12

a brahmanah parijnaya (c) äkäro gauravam rauksyam (a) äkäsadharmä vijneyäh (c) äksepo nodanam balam / (b) äcäryaih süksmabuddhibhih / (b) ätmaiva hy ätmano nästi (a) änantarye 'py asambhavah / / (d) änandam brahmano vidvän (c) äptänäptagiräm srutau / (b) äbhäsamäno buddhyäto (c) äyäsäs ca vighätäs ca (a) ärambhäya prasrtä yasmin (a) ähäras ca vihäras ca (c) icchato na vyavasthitih / / itarah parisesatah / / (d) itaretaradharmebhyo (c) itas tyam sadbhir ädiptam (a) iti te pärthivä dharmäs (a) iti na syuh prayuktayah / / (d) iti prayätv esa mama sramah satäm (c) iti sastih padärthänäm (c) iti sadbhir asambhräntaih (a) idam äspadam Itlnäm (c) idam brahmeti manyate / (b) indriyänäm parijnäya (c) indriyänäm yathä käryam (c) indriyärthänurägo vä (c) istasyärthasya sampräptau (c) iha vyäkhyä karisyate / / (d) utpattis te prasajyate / / (d) utpattau hetur isyate / (b) utplutyoccaih sakälau pad«_äsu(?) dandahrte 'gnih / (b) uddesanirdesam anukramas ca (c) unmädakaustyakaunyäni (c) upabhogena sämyati / (b) upädatte yadä param / (b) ünäni pasubhis tribhir / / (d) ürdhva<gam> pävakam (a) rte dehan na labhyate / / (d)

Pada Index of verses found in the Yuktidipika rddhasya räjamätangä (c) rsaye paramäyärka-(a) rsicandramasas cyutä / (b) etac chvabhram bhayävaham / / (d) etat ksetram apavrtam / / (d) et ad äy at an am mahat / (b) etad uktam kila srutau / (b) evam vinäpi sargen a (a) esa panko duruttarah / (b) esa yonih sapäpmanäm / / (d) esa samksepato dharmah (c) kadusnatam yäti diväkaradyutih / / (d) kapiläya mahätmane / / (d) karanänäm asämarthyam (a) karanänäm pradipavat / (b) kartum varsasatair api / (b) kartrsv avasthitas cätmä (c) karma pürvakrtam tathä / / (d) karmanä mrtyum rsayo nisedhuh (a) kämäd anyah pravartate / / (d) kärakaih sattvasangibhih / (b) kärunyäd apy ayuktäm täm (c) kärtsnyenehäbhidhäsyate / (b) käryam k<a>ranam <ca> pürayati yasmät / (b) käryakaranaksayakari (c) käryasyä nis<n>ätäs tarn (c) käle bhavanti kartärah / (b) kimartham parvatam vrajet / (b) kirn nyäyyo ? tha matibhramah / (b) kudrstitimiräpahä / (b) kurvann eveha karmäni (a) kuhetuprtanäm imäm / (b) -krtam <su>tärädi nirdistam (d) / / krsänugarbhäpy abhito himägame (c) kaivalyapräptihetutväd (a) ko vidvän yatnam äcaret / / (d) kriyä pürvajvaränugä / klesavyädhibhayäkirnam (c) klaibyodävartapangutäh / / (d) kvacid evävatisthate / / (d) khatulyas ced asatsamah / / (d) gato vanesu ram ate (c) p.l2,fn.(6) p. 1.5 p.270.13 p.29.4 p.29.6 p. 29.5 p.54.7 p. 185.17 p.29.3 p.29.2 pp.34.18, 248.13 p.270.18 p.l,fn.(l) p.2.18 p.208.23 p. 1.9 p. 181.12 p.26.7 p.37.5 pp.34.18, 248.13 p. 118.6 p.3.5 p.2.21 p.209.2 p.210.14 p. 118.12 p. 118.11 p.51.11 p.54.9 p.270.15 p.35.15 p.54.15 p.233.18 p.270.18 p.54.11 p.51.12 p.26.16 p.29.4 p.243.5 p.28.6 p.182.5 p. 29.8

323

324

Appendix VI p.246.12 p.270.19 p.1.11 p.138.14 p.172.7 p.182.4 p.182.5 p.2.15 p.171.18 p.181.11 p.181.11 P .12,fn.(6) p.270.14 p.225.25 p.221.13 p.228.19 P .104,fn.(l) p.l,fn.(l) p.lO4,fn.(l) p.228.18 p.225.28 pp.111.21, 163.12 p.35.15 p.208.24 p.212.22 p.172.6 p.28.11 p.1.7 p.233.14 pp.111.22, 163.13 p.2.8 p.233.14 p.26.8 p.212.23 p.190.27 p.13.13 p.172.7 p.250.17 p.2.16 p.1.11 p.154.6 p.212.22

garbhe bhavati purusah / (b) gunam paresäm tanum apy udäratäm / (b) granthenälpena samksipya (a) grahanam nasty rser api / grähyagrähakabhävena (c) carmany asti tayoh phalam / (b) carmopamas cet so 'nityah (c) cülikärthäh smrtä dasa / (b) cetanatvät paräsrayam / / (d) cetanädhisthitä buddhis (a) cetaneva vibhävyate / (b) caitrasya däsabhäryeyam (a) chädyate jnänacandrikä / / (d) -cchäyä sarvopabhogyatä / / (d) jagäma tarn vanoddesam -jantünäm svedajam smrtam / / (d) janmatulyam hi buddhinäm (a) janmanä jiiänam äptavän (b)/ janmädikopayogam ca (c) jaräyujam gavädlnäm (a) j alägnipavanäkäsa- (c) jahad dharmäntaram pürvam (a) jijlvisec chat am samäh / (b) jlvanam käyadhärikä / / (d) -jnänam käläntare punah / (b) jnänavijiieyayor yadvad (a) tat kämebhyah pravartate / / (d) tattvam jijnasamänäya (a) tattvasamam vaivartam (a) tattväd apracyuto dharmi (c) tattvärthabhräntabuddhibhih / (b) taträbhisyandikam dvitiyam syät / (b) taträhäravihärotthän (a) tatraiva sendriyam jätam (c) tathä dhir iti grhyatäm / / (d) tathaiva sarvasabdänäm (a) tathaivätmaprakäsayoh / / (d) tathaiväsya vivardhate / / (d) tathoktä nava tustayah / / (d) tad ärsam anusasanam / (b) tad eva cäsya vikräntam (c) tad eva bhävanäpeksa-(a)

Pada Index of verses found in the Yuktidipika tad evatmdriyam jatam (c) tad evaitac chirogrivam (a) tad evaisäm vinäsitväd (c) tadasya <tesv> abhipräyah (c) tadvad gunapurusajiio (c) tadvad dvandväni sarvajne / / (d) tadvisistäs tathäpare / (b) tannisthas tatpratijnas ca (c) tapahsraddhe ye hy upavasanty aranye (a) tarn eva viditvämrtatvam eti tarn bhisak parivarjayet / / (d) tarunyo vrsalibhäryah (a) tarhi laksanayuktatvät (c) tasmät pur ity uktä (c) tasmät sahghätamätratvät (a) tasmäd atah sästram idam (c) tasmäd anicchann anyesäm (a) tasmäd Isvarakrsnena (c) tasmäd rägänugair uktäm (a) tasmäd vinäsisv äsaktäm (a) tasmäd viphalatäm yätu (c) tasmäd visayasamparkam (a) tasmäd vai vidvän purusam (a) tasya vyäkhyäm karisyämi (a) tävaj jivati mänavah / / (d) tirascäm api tadvasät / / (d) tiryakpätah pavitratvam (a) tisthati na süksmabhävät (c) trnädes codbhijjam ksudra- (c) trnolkäcapalam sukham / (b) tesäm icchävighätärtham (a) tau bähü parighopamau / (b) tyaktasarvaparicchadah / / (d) tyägenaikenämrtatvam änasuh / (b) traigunyasamanvayam ca paiicänäm / (b) <trai>rüpyasyopasamhärät (c) dänam pratigrahah saucam (c) distyä saphalatä sruteh / / (d) dlyamänä na sobhate / / (d) duhkham sampadyate yadi / (b) duhkhatrayanivrttaye / / (d) duhkhair dehäntarodbhavaih / / (d) dürasthasyäpi tasya tat / (b) drsyadarsanabhävena (a) dedhiyante 'thavantar miladalaghujalasaptaku_^?) (c) p.212.21 p.154.5 p.249.11 p.249.27 p.50.11 p.182.1 p.225.27 p.210.2 p.41.11 p.51.1 p.26.12 P .12,fn.(6) p.137.23 p.209.3 p.248.17 p.3.1 p.250.18 p.2.9 p.54.15 p.249.16 p.185.18 p.250.2 p.46.17 p.3.4 p.208.26 p.75.13 p.226.6 p.182.1 p.228.19 p.248.19 p.2.4 p.154.5 p.250.19 p.37.1 p.210.19 p.138.7 p.210.5 p.54.6 p.54.14 p.138.6 p.1.8 p.248.20 p.23.5 p.185.15 p.l,fn.(l)

325

326

Appendix VI p.248.18 p.29.6 p. 167.15 p. 210.10 p.54.10 p.211.11 p.208.26 p. 167.14 p.270.16 p.210.2 p.211.10 p.37.1 p.28.5 p.27.9 pp.34.17, 248.12 p.249.14 p.1.9 p. 167.19 p.27.14 p.211.12 p.50.19 p.209.22 p. 180.28 p.83.5 p. 180.28 p.270.19 p. 189.11 p. 189.12 p.180.27 p.51.1 p.28.5 p. 154.6 p.210.10 p.189.12 p.26.6 p.27.14 p.2.1 p. 125.6 pp.250.3, 253.15 p.l04,fn.(l) p.250.1 p. 167.14 p.1.3, 2.6

dehanam anavasthitim / / (d) dainyasramavisädänäm (c) dvädasaiva <bh>avängäni (a) dvitvaikatvaprthaktvam (a) dveso vä moksavartmani / / (d) dharmädinimittatäm ca samsthäpya / (b) dharmädyanävrttivasät (c) dharmäs tv ete sahetukäh / / (d) dhäryatäm yuktidipikä / / (d) dhrter etad dhi laksanam / / (d) dhruvam amrtam sthänam abhyeti / / (d) na karmanä na prajayä dhanena (a) na ca sauryam apeksate / (b) na jätu kämah kämänäm (a) na tat parasya sandadhyät (a) na tad asti jagaty asmin (a) na tasyädhigamah sakyah (a) na drsyate so 'pi kascid (c) na drsto hetur isyate / / (d) na punas tadbhävito gacchet / / (d) na bibheti kutascana / / (d) na präpto jnänalaksanam / (b) <na> vyapadesän na cobhayatah / / (d) na seso <'gne> ? nyajätam <asti> na svätmano na parato (c) nayanti santas ca yatah svasaktito (a) nastotpannam ananyatväd (a) nastotpannävinastänäm (c) nädhyavasäyam kurute (a) nänyah panthä ayanäya vidyate / näbhijätim na vijnänam (a) näyam anyo dhananjayät / / (d) nityam cetanam acetanam süksmam / (b) nityam no nästi caikadä / / (d) nidänam trividham smrtam / (b) ninditatväc ca sädhubhih / (b) nibaddham amalaprajfiaih (c) nirätmakatväd asatäm (a) niräsahgamatis caret / / (d) nänumäne trilaksanah / / (d) nendriyäny upabhogena (c) naiveha sattvam ätmasti (c) paksatävanasevinah / (b)

Pada Index of verses found in the Yuktidipika pancavimsatitattvesu (a) pancänäm yoninäm (a) pandädyartham tad istam ced (c) patisyatäm devalokät (c) param karmabhyo 'mrtatvam änasuh / / (d) param tvam visvatomukha / / (d) param rahasyam vedänäm (a) parinämah sa ucyate / / (d) paripakvam ity adhastän (c) parena näkam nihitam guhäyäm (c) pasünäm madhyame 'hani / (b) pasyatäm eva nasyanti (c) päcakam laghu bhäsvaram / (b) paramarsasya tantrasya (c) pärärthyam ca tathänaikyam (c) putradäragrhädisu / (b) pudgalo nopalabhyate / / (d) punar jvare samutpanne punar bhävanayä smrtih / / (d) purusasya na yujyate / (b) purusesänuvädinah / (b) puruso ?pi tathä tathä / (b) puruso naiva sthitim prayogam vä / (b) pürvadosänivartanam / / (d) pürvadharmavirodhinah / / (d) pürväbhyäm <sa>vilaksanam / / (d) prthagarthäbhidhäyinäm / (b) prthagarthäbhipätinäm / (b) prthannivistatattvänäm (a) prakäsikeyam sarvasya (c) prakrteh purusasya ca / (b) pracyuto mahato yas tu (a) prajävanto dravinam icchamänäh / (b) pratikülam yad ätmanah / (b) pratijnäm yo <?nu>raksati / (b) pratinandantu sürayah / / (d) pratipaksäh punas tasya (a) pratipattir anekadhä / / (d) pratiyogipadäd anyad (a) pratitäh pratipädakäh / / pratyaksajnänam ucyate / (b) pratyaksato 'numänäd vä (c) pratyaksam anumänam ca (a) pratyabhijfiänam ucyate / / (d) pratyavabhäsästamam bhoktuh / / (d) pradhänästitvam ekatvam (a)

327

p.l,fn.(l) p.211.11 p.54.6 p.259.21 p.37.6 p.l5,fn.(l) p.54.5 pp.111.22, 163.13 p.211.12 p.37.2 p.31.16 p.249.13 p.226.4 p.3.3 p.2.13 p.249.16 p. 167.16 p.26.16 p.212.21 p. 185.12 p.2.2 p. 171.17 p. 180.27 p. 138.7 p.226.10 p.226.5 p.13.13 p.13.11 p. 13.11 p.270.16 p. 185.15 p.209.22 p.37.5 pp.34.17, 248.12 p.210.1 p.3.5 p.2.2 p.75.6 p.l2,fn.(6) p.86.20 p.212.20 p.249.15 p.70.20 p.212.23 p.209.3 p.2.12

328

Appendix VI p.226.5 p.75.12 P-l-4, 2.7 p.l2,fn.(6) p.54.12 p.210.14 p.248.15 p.259.21 p.250.18 p.210.8 p.185.16 p.26.11 p.243.4 p.211.9 p.3.3 p.249.17 p. 171.18 p.249.13 p. 171.16 p.249.11 p.250.21 p. 137.22 p.249.14 p.27.10 p.l,fn.(l) p.1.10 p.181.12 p.l5,fn.(l) p.118.12 p.270.17 p.185.18 p.249.17 p.26.9 p.1.5 p.270.14 p.226.1 p.137.22 p.1.10 p. 181.34 p.243.4 p.l,fn.(l)

pradhvamsy ojasvita jyotih (c) pramänatvena täm lokah (a) pravädäh sämkhyakarinah (c) praviram putrakämyati / (b) prasastä yäjiiavalkyädyair (c) präkrtik<a>gatih samäkhyätä / / (d) präninäm upaghätena (a) präninäm upajäyate / / (d) präninäm dehapidanam / (b) präyascittaparo nityam (c) bandha ity abhidhiyate / / (d) balamämsendriyäpahah / (b) bädhiryam ändhyam aghratvam (a) bähyäm pränavivrttim (a) bimbam ädarsagam yathä / / (d) buddhimän vinivartayet / / (d) buddhirüpam aväpnoti (c) budbu<d>äh salile yathä / / (d) boddhä manivad ucyate / / (d) bhavaty aratikäranam / / (d) bhavändhakäräntajnänam (c) bhinnä laksanabhedäs cen (a) bhütam sthävarajangamam / (b) bhüya eväbhivardhate / / (d) bhüyah pro—ttapaksäs(?) cyutabahusiläh ksobhayanty adrayas ced (a) bhüyastväd iti samcintya (c) bhoktä karteva laksyate / / (d) matabhedesu pathyatvä-(?) (a) madhy am am kälam icchanti / / ( d ) manisino nopakhalam viräjate / (b) manorathimanorathah / / (d) mameti buddhim yatnena (e) maranät sa nivartate / / (d) -marlcisamatejase / (b) malinais tirthajaladais (c) märdavam gauravam ca yat / (b) mithah sattvädayo gunäh / (b) munibhih süksmabuddhibhih / / (d) mustir yathä vikirnah (a) mükatä jadatä ca yä / (b) ya ädisrstau(?) namas tasmai (c)

Pada Index of verses found in the Yuktidipika yac cänyad asivam loke (c) yajanam yajanam tapah / (b) yat <anyat> kärakäd api / (b) yativrsabham tarn tv aham manye / / (d) yato ghattakutibhävah (c) yato väco nivartante (a) yatnopättäh suguptäs ca (a) yaträmrtah sa puruso <hy> a v y a y ä t m ä / / ( d ) yathä bähyädyavasthäsu (a) yathä buddhis tathä pumän / (b) yathä yathä manovrttih (a) yathä yathä hi visayo (a) yathäkramam laksanatah (a) yathänyäyopapattaye / (b) yathäbhyäsam hi väkyebhyo (a) yad uväca mahat tantram (c) yadä prabandhäd visayi (a) yadä hetuh svarüpena (a) yady asattvam ghatädinäm (a) yadvad anicchan narah pataty eva / (b) yas tu karmakrto vyädhir (c) yasmät sarvapadärthänäm (c) yasmäd baddhah pumän gunaih / (b) yasya yenäbhisambandho (a) yä vedavihitä stutih / (b) yarn eva prathamäm rätrim (a) yena dravyena mohändhä (a) yo 'tyantam karmanas cyutah / / (d) yo 'rthah samupajäyate / (b) yo 'smäd visayasambhogäd (a) yo bhävayati sünyatäm / / (d) yo veda nihitam guhäyäm parame vyoman / (b) yonlnäm yo vidyäd (c) yoninäm sapramänänäm (a) racitäh svesu tantresu (c) rajovisaktir angesu (a) rantum icchanti dehinah / (b) rüp<ä>bhede ?pi bhinnatä / (b) rogän dravyam apohati / (b) rauksyam acchäyatä saityam (c) laksanavisayasatattvam (a) laksmih samskärayogäc ca (c) laghüni sücitärthäni (a) lünacakraratho mayä / (b) p.28.11 p.210.4 p.l2,fn.(6) p.210.20 p.l5,fn.(l) p.50.18 p.249.12 p.41.14 p. 190.26 p. 171.15 p.171.17 p.250.16 p.2.21 p.3.4 p.75.5 p. 1.8 p.249.26 p.89.2 p. 122.15 p.50.10 p.26.9 p.2.11 p.185.17 p.23.5 p.54.11 p.246.12 p.249.10 p.54.8 p.248.15 p.29.7 p. 167.19 p.50.16 p.210.20 p.253.14 p.2.5 p.259.20 p.249.10 p.172.6 p.26.8 p.226.7 p.210.19 p.28.6 p.4.2 p.l2,fn.(6)

329

330 lokantaravighatakrt / / (d)

Appendix VI p.248.16 p.225.24 p. 182.4 p.13.14 p.210.1 p.226.7 p.261.1 p.2.3 p.270.20 p. 167.16 p.190.27 p.54.14 p.210.7 p.54.7 p. 185.12 p.75.5 p.249.15 p.211.10 p.54.13 p.167.13 p.2.16 p.28.10 p.1.7 p.37.2 p.2.13 p.210.11 p.29.5 p.54.12 p. 125.7 p.226.13 p.210.13 p.2.5 p.249.12 p.249.26 p. 212.20 p.250.1 p.29.7 p. 1.3, 2.6 p.50.10 p.l2,fn.(6) p.208.23 p.l2,fn.(6) p.250.16 p.31.5 p.31.5

varanam sthairyam eva ca / (b) varsätapäbhyäm kirn vyomnas (a) väkyebhyah pravibhaktänäm (c) väci karmani samkalpe (a) väyor dharmäh prthagvidhäh / / (d) värenäyam sevate tatra tatra / / vikärapurusäs tathä / / (d) vicäranänugrahamätrapätratäm / / (d) vicintya sarväny etäni (c) vidyate bijamäträ vas (c) vidyä kanyeva pandäya (c) vidyäm karma tapämsi vä / (b) vidvän karmäni kurvltety (a) vinä sargen a bandho hi (a) vinäpy arthena jäyate / (b) vinäso yasya neksyate / / (d) vinivrttavikharakaluso (c) viparitärthavädibhih / (b) viparitena kalpyate / (b) viparyayah paficavidhas (c) vipralambhabhayäni ca / (b) vipräyäsuraye munih / (b) vibhräjate yad yatayo visanti / / (d) viyogo yoga eva ca / / (d) vividisitavyam vividisäyäh / / (d) vividhäyäsasokänäm (a) visistais tattvaniscayät / / visesanam ced bhinnam te (c) visesän nätra samsayah / / (d) visapitasuptamattavad (a) visamäs tarkagahvaräh / / (d) visayä visayaisinäm / (b) visayän upasevate / (b) visayendriyasamyogät (a) visayebhyo nivartayet / / (d) vihagah panjaräd iva / (b) vitävitavisänasya (a) vrksägräc cyutapädo (a) vrksäd iti satäm matam / / (d) vrttir antah samastänäm (a) vrttisabdakadambasya (c) vrddhim gacchati dehinäm / (b) vedavedängatarkesu vedasamjiiä nirucyate /

Pada Index of verses found in the Yuktidipika vaikrtam atas trtiyam (c) vaikrtam api ca dvividham (a) vainäsikäh präkrtikä (c) vaivarnyam mlänapuspatä / (b) <vya>bhicäräd visesas tu vyavahäräh pravartante vyäkärä cittasantatih / (b) -vyäpakas tan nibodhata / / (d) vyäpäro jnänayonitvät (c) vyasah saha maharsibhir / sabda<s> copamayä saha / (b) samayed vadavänalam / (b) sarlre 'dhisamähitäh / / (d) saraih sätitapatro ' y a m (c) sasasrnge 'pi tulyatväd (c) säntä vidvämso bhaiksacaryäm carantah / (b) sisyänäm hitakämyayä / / (d) sisyair duravagähäs te (a) sünyam ädhyätmikam pasya (a) sünyam pasya bahirgatam / (b) sesavrttir akartrtvam (a) saityam raksä pavitratvam (c) sraddhäyä laksanam smrtam / / (d) satsatäni niyujyante (a) sad gunäh präpnuvanti te / / (d) sätk<au>sikam etad äkhyätam / / (d) sa eva vartyatäm präjfiaih (a) sa gacchan na nivartate / / (d) sa ca pandädir eva syäd (c) sa vito ?rthäntar<a>ksepäd (c) sa sukhäni samasnute / / (d) samksiptärtham idam krtam / / (d) sakalam sästram eva vä / (b) samjiiopadesäv iti tantrasampat / / (d) satkäryam asatkäryam (c) sattvam abhyupagamyatäm / / (d) sattvädinäm ghatädivat / (b) satyam jnänam anantam brahma / (a) satyaväcah prasäntasya (a) santänas caudakä gunäh / / (d) santosenaiva varteta (c) saptatyäkhyam prakaranam (a) samprasthitas tarn bhavati (c) p.233.15 p.233.17 p.2.3 p.259.20 p.86.20 p.75.13 p.190.26 p.225.28 p.209.23 p.221.13 p.70.20 p.249.28 p.47.1 p.l2,fn.(6) p. 122.16 p.41.12 p.2.1 p.2.8 p. 167.18 p. 167.18 p.2.15 p.226.2 p.210.5 p.31.16 p. 137.23 p.233.15 p.54.9 p.246.13 p.54.8 p.89.3 p.29.8 p.2.9 p.2.10 p.3.11 p.210.11 p. 125.7 p.248.17 p.50.15 p.250.20 p.226.2 p.250.19 p.2.10 p.246.13

331

332

Appendix VI p.l2,fn.(6) p.253.14 p.211.9 p. 185.13 p.75.12 p.4.3 p.226.9 p.27.15 p.250.20 p.47.1 p. 125.6 p.26.6 p.3.2 P-l-4, 2.7 p.209.2 p.27.14 p.1.6 p.226.12 p.50.17 p.208.25 p.209.23 p.89.2 p.226.12 p.3.28 p.26.12 p.261.1 p.210.8 p.210.7 p.249.27 p.248.20 p. 181.34 p.3.10 p.3.29 p.4.3 p.41.13 p.1.6 p.54.13 p.248.16 p.50.17 p.26.11 p. 167.15 p.225.25 p.226.1 p.270.17 p.233.18 p.253.15

sambandhas tena nesyate / / (d) samyanmärge niyojanät / (b) samyanmärge budhah pratisthäpya / (b) sargas tasyaiva moksärtham (c) sarvah samanugacchati / (b) sarvatah särabhütäni (c) sarvatogatir avyüho (a) sarvaträsannidhänäc ca (c) sarvabhütäny anicchatah / (b) sarvä hy asmin devatäh (c) sarvesäm avisistatä / (b) sarvesäm vyädhirüpänäm (a) sarvais tantragunair yutam / (b) sallakisandabhahguräh / / (d) samvid ahamkäragat<ä> (a) samvedyatväd gurutväc ca (a) samsäragahanadhvänta- (c) samhatänäm tu yat käryam (a) saha brahmanä vipascitä / / (d) sä yävad aniruddhä tu (a) sä yonih kukkutändavat / / (d) sädhyasiddhau prayujyate / (b) sämänyam te gavädayah/ (b) säravad visvatomukham / (b) säristas caiva yo vyädhis (c) sukham ca duhkham <cänu>sayam ca sukhäyäm sa tu vartate / / (d) sukhärthlyas tu sevate (a) sutaräm sampravartate / / (d) sudrdhair na nipätavyam (c) sücyagre sarsapädinäm / (b) sütrapramänävayavopapattir (a) sütram sütravido viduh / / (d) süträny ähur manisinah / / (d) süryadvärena te <virajäh> prayänti (c) -süryäya gurave namah / / (d) seyam visayarägändhair (a) so 'napeksaih prahätavyo (c) so 'snute sarvän kam an / (c) sopadravah sarvarüpo (a) skandhäyatanadhätavah / (b) sthitir bhedah ksamä krsna- (c) snehah sauksmyam prabhä sauklyam (a) sphutäbhidheyä madhuräpi bhärati (a) syät saptavidham paravai- (c) srotasäm ca visuddhatvän (c)

Pada Index of verses found in the Yuktidipika svapratyayänukärena (c) svalpäksarapadäni ca / (b) svavaikrtam tatra tärakam bhavati / (b) svasthänäj jätucin me pracalati na mano vlradhiram tathäpi / / (d) hanti väyum rajo'dhika / (b) havisä krsnavartmeva (c) hetavah sädhyasädhakäh / / (d) hy äsramäd äsramam vrajet / / (d) p.75.6 p.4.2 p.233.17 p.l,fn.(l) p.208.25 p.27.10 p.70.21 p.54.16

333

334 Appendix VII

Appendix.VII

Index of the prose passages quoted or referred in the YuktidTpika and Kashmir and Delhi Mss. in t h e Marginal in alphabetical p.60.1 Notes order

to of

akärasya vivrtopadesah (cf.MBhäsya.I.1.2,1.15.2)

agunavato dravyasya gunärambh<ät> karmagunä agunäh (VS.7.1.12) p.116.17 agnihotram juhuyät svargakämah / ajädi gunavacanäd eva (Pän.5.3.58) pp.38.13-14 (vidhih), 232,26 (tadyathä) p.64.22

atha ye ime gräme istäpürte dattam ity upäsate / te dhümam abhisambhavanti / dhümo bhütväbhram bhavati / megho bhütvä pravarsati / ta iha vrihiyava osadhivanaspatayas tilamäsä iti jäyante / <ato> vai yo <hy> annam atti yo retah siiicati tad bhüya eva bhavati (cf.Chänd.U.5.10.3,5,6) pp.43.12-44.1 atha sabdänusäsanam, kesäm sabdänäm (cf.MBhäsya.I.1.1-2) p.24.6

anadväham udahärini bhagini vahasi yä tvam sirasä kumbham aväcinam abhidhävantam adräksih (cf.MBhäsya.I.152.26fF.) p.23.14-15 anantarasya vidhir vä bhavati pratisedho vä (cf.MBhäsya.I.101.12) anantasaktih (cf.Mait.U.7.2) p.159.10 p.20.13-14

animitto 5py evam avasthitasya jnänasya vrttih pratyayah prädus tiras ca <bhavati> vrttyarthe na bhavaty animitto Jpity anägatavyavahitavisayajnänam tu lingägamäbhyäm (tathä ca vrsaganavirenäpy uktam bhavati) p.212.17-19 ambha iti gunalingasannicayam evädhikurute (sästram äha) p.244.13-14

amrtam vä mrtam atijivo mä te häsisur asavah sariram (AV(S).8.2.26) p.45.6-7 arthakriyä ca na syät (cf.Vims.3,4) alug uttarapade (cf.Pän.6.3.1) p.219.6

p.23.13

<a>sad iti bhütapratyaksäbhäväd bhütasmrter virodhapratya<ksatväc> ca (cf.VS.9.6) p.151.22-23 asti karmästi vipäkah kärakas tu nopalabhyate ya <imäms ca skandhän niksipaty> anyäms ca pratisandadhäty anyatra dharmasamketät (cf.AKBh. p.468.20-22;TSP.p.l73.6-7) p.167.21-23 ahimsä satyam asteyam akalkatä brahmacaryam iti panca yamäh (cf.YS.2.30)

Index of the prose passages in alphabetical order

335

pp.191.37-192.1 äjavanjavlbhävo (cf.MV.25.9) p.232.19 p.204.8

an abhividhyarthe (cf.Pän.2.1.13)

ätmendriyamano'rthasannikarsäd yan nispadyate tad anyat (VS.3.1.13) p.76.18-19 ädaiksu (cf.Pan. 1.1.1) p. 102.10

<änyabhävyam> tu kälasabdavyaväyät (Vär.ll on Sivasütra 1, MBhäsya.I.18.5) p.205.10-11 ävahanti (cf.Tai.Br.3.2.5.6) p.52.12 ähamkärikänäm tu tesäm vyäpakatväd visayäkäraparinämätmikä vrttir vrttimato 'nanyä sati sambhavaty eveti suvacam präpyakäritvam / api ca mahadanugrahanam ähamkärikatve tesäm kalpate na bhautikatve / bhautikatve hi yatparimänam <graha>nam tatparimänam grähyam grhniyäd <iti> (see NM.part2,p.49.5-10) p.203.28-32 ähamkärikänlndriyäny artham sädhayitum arhanti nänyathä (evam hi sämkhyavrddhä ähuh) p.203.25-26 äharanam karmendriyäni kurvanti, dhäranam mano ^hamkäras ca, prakäsanam buddhindriyäni buddhis ca (apara äha) p.216.10-12 icchädvesaprayatnasukhaduhkhadharmädharmajnänasamskäränäm tvam (cf.NS.1.1.10) p.16.10-11 icchädvesaprayatnadharmädharmajnänasannskäränäm (cf.NS. 1.1.10) iti ha uväca yäjnavalkya (Brh.U.2.4.13 et passim) p.71.4 ätmagunap. 179.13

indriyärthasannikarsotpannam jnänam avyapadesyam avyabhicäri vyavasäyätmakam pratyaksam (NS.1.1.4) p.76.17-18 istäpürte samupäsya te dhümam abhisambhavanti (yac ca sästram) (cf.Chänd.U.5.10.3) p.52.1-2 upabhogasya sabdädyupalabdhir ädih, gunapurusopalabdhir antah cähuh) p.223.20-21 upalambhau yatnah kriyatäm (cf.MBhäsya.I.9.19fF.) p.41.1 p.59.7 (tathä

upasarjanam pürvam (Pän.2.2.30) nipatati (MBhäsya.II.355.9)

ekam eva darsanam khyätir eva darsanam (sästram) (cf.YBh.on YS.1.4) pp.79.25-26, 222.5

336

Appendix. VII p.82.21-22

ekasesanirdesat (cf.MBhasya.I.88.25 et passim)

etam eva viditvä munir bhavati, etam eva pravräjino lokam icchantah pravrajanti / et ad vah sarve pürve vidvämsah prajäm näkämayanta prajayä kirn karisyämo yesäm näyam ätmä näyam loka iti te ha sma putraisanäyäs ca vittaisanäyäs ca lokaisanäyäs cätha bhiksäcaryam caranti (cf.Brh.U.4.4.25) p.38.2-6 etasmäd dhi mahata ätmana ime traya ätmänah srjyante vaikärikataijasabhütädayo 'hamkäralaksanäh / aham ity evaisäm sämänyalaksanam bhavati / gunapravrttau ca punar visesalaksanam (tathä ca sastram äha) p.194.12-14 kadäcid guno gunivisesako bhavati kadäcit tu guninä guno visisyata (cf.MBhäsya.II.356.8-9) karanasädhano lyut(cf.Pän.3.3.117) p.67.6-7 p.ll.15-16

kartari yau trjakau täbhyäm saha sasthi na samasyate (Käsikä2.2.16, Pän.2.2.15) karmavat karmanä tulyakriyah (Pän.3.1.87) kalpanäpodham (cf.PS.1.3) p.76.21 p.157.6 p.59.25 p.ll.10-11

käranäbhävät käryäbhävah (VS.1.2.1)

krttivasäh pinäkahasto vitatadhanvä nilasikhandi (cf.Tai.S.1.8.6.2) p.159.19-20 kriyägunavyapadesasambhavah (cf.VS.9.1) p . l l 1.5 p.235.1

ksiram pitvä garbhim gauram putram janayati (cf.Brh.U.6.4.14) gunäs ca gunäntaram (VS.1.1.9) p.126.5

grhasthah sadrslm bhäryäm vindetänanyapürvikäm / (GDhS. 1.4.1)

p.34.4-5

gaur anübandhyo 'ajo 'gnisomiya iti na bähiko 'nubadhyate (cf.MBhäsya.I.71.18ff. et passim) p.80.14-15 grämagamanam bhavatah sobhanam ity aträntarena vidhim stutir eva devadattam grämagamanäya prarocayati (tathä ca säbaräh pathanti) p.40.8-9 ghränarasanacaksustvakcchrotränindriyäni bhütebhyah (naiyäyikäs tv evam ähuh) (cf.NS.1.1.12) p.203.15-16 nyäpprätipadikät (cf.Pän.4.1.1) p.23.11-12

caturbhih prakärair vidyopayuktäbhavaty ägamakälena svädhyäyakälena <pravacanakälena) prayogakälena ca / tatra cäsyägamakälenaiväyuh paryupayuktam syät (äha ca) (cf.MBhäsya.l.6.1ff.) p.269.17-19

Index of the prose passages in alphabetical order cittam mano vijfiänam (Vims.p.3.3, AKBh.p.62.1-2) jagadvaicitryopalambhät (cf.AK.p.192.5) p.154.24 p.170.14

337

jarämaryam etat sattram yad agnihotradärsapaurnamäsau jarayä ha etasmät satträd vimucyate mrtyunä ca (cf.SPBr.12.4.1.1) p.35.12-13 jätiväcakatvät (Vär.7 on Pän.4.1.14, MBhäsya.II.206.23; Vär.l on Pan. 1.2.10, MBhäsya.I.107.21) p.11.14 tatprayojako hetus ca (Pän.1.4.55) tad asya parimänam (Pän.5.1.57) p.11.13 p.63.25

tad etat trailokyam vyakter apaiti na sattvät / apetam apy asti vinäsapratisedhät / samsargäc cäsya sauksmyam sauksmyäc cänupalabdhih / tasmäd vyaktyapagamo vinäsah / sa tu dvividhah / ä sargapralayät tattvänäm kimcitkälävasthänäd itaresäm (tathä ca värsaganäh) (cf.YBh.onYS.3.13, NBh.1.2.6) pp.128.23-129.3 tad etasmin vaikärike sraksyamäna esa bhütädis taijasenopastabdha etarn vaikärikam abhidhävati / tathaiva tasmin bhütädau sraksyamäna esa <vaikärikas> taijasenopastabdha etam bhütädim abhibhavati (sästram caivam äha) pp.196.32-197.3 taj jnäpayati (cf.MBhäsya.I.33.17,1.35.9 et passim) p. 106.18 tad dha smaitad ärunir auddälakir jyesthäya puträya proväca / idam <väva> jyesthäya puträya pitä brahma prabrüyät pranäyyäya cänte väsine nänyasmai yasmai kasmaicana / ya imäm adbhih parigrhitäm vasunä vasumatlm pürnäm dadyäd etad eva tato bhüyah (äha) (cf.Chänd.U.3.11.4-6) pp.53.23-54.3 tad ya ittham viduh / ye ceme <'ranye> sraddhä tapa ity upäsate / te 'rcisam abhisambhavanti / arciso 'hah / ahna äpüryamänapaksam / äpüryamänapaksäd yän sad udann eti mäsäms tän / mäsebhyah samvatsaram / samvatsaräd ädityam / ädityäc candramasam / candramaso vidyutam / tat puruso 'mänavah / sa etän brahma gamayati (Chänd.U.5.10.1-2) pp.37.7-38.2 tadyathä dadhitrapusam <pratyakso> jvarah (tadyathä ) (cf.MBhäsya.1.156.8) p.213.33 tarati mrtyum (cf.Mund.U.3.2.9) p.45.9 p.43.7-8

tarati mrtyum tarati päpmänam (cf.Mund.U.3.2.9) tarati sokam ätmavit (Chänd.U.7.1.3) p.51.3

te dhümam abhisambhavanti (cf.Chänd.U.5.10.3)

p.45.2

trividhä bhäväh sämsiddhikäh präkrtikä vaikrtikäs ca (äcärya äha)

338

Appendix.VII (cf.SK43ab) p.233.27

tvästriyam säma bhavati <indram vä ksyämayinam> na sarvabhütäni prasväpayitum näsaknuvams tarn etena sämnä tvästriyam sväpayat (evam hy äha) (Tän.Br.12.5.18,19) p.259.22-24 dadhi brähmanebhyo diyatäm takram kaundinyäya passim) pp.33.17-18, 81.20 dadhnä juhoti payasä juhoti (tadyathä) p.53.5-6 p.48.3 (cf.MBhäsya.1.115.2-3 et

duhkhahetuh käryakaranasaktih (tathä ca tanträntaresv apy uktam) devadattasya gurukulam (yathä) (cf.MBhäsya.I.361.13ff.) p.59.15

devänäm ha vä paiicadasasatäny äsams täni brahmakilbisäd aksiyanta / tatas trayastrimsad evästa / tad etad rcäpy uktam / ^sodaryänäm pancadasänäm satänäm trayastrimsad udasisyanta deväh / sesäh präslyanta' (tathä gopathabrähmanam) p.260.10-13 dravyam anekadravyam adravyam vä (sästram) (cf.Vyo.p.231.5-6; VSC. on VS.2.1.11) p.114.6 dravyäni dravyäntaram ärabhante (VS.1.1.8) pp.121.14, 126.5 p.52.21

dve vidye veditavye parä caiväparä ca yä (cf.Mund.U.1.1.4)

dharmä vedanä samjiiä cetanä sparso <manaskära> evamädayah (cf.AK.II.24) p.170.18-19 dharmotpattivinäse dharmyutpattivinäsaprasangah (cf.AKBh.p.159.24) p.163.27-29 na prthakpratipattihetü vltävitau (uktam tanträntariyaih) p. 107.2-3

nah kye (Pän.1.4.15) p.64.20-21 navadhätharvano <v>edah sahasravartmä sämaveda ekasatam adhvaryusäkhäs caturvimsatidhä b<ä>hvrcyam (cf.MBhäsya.I.9.21fF.) p.41,fn.(l) näträsüyä kartavyä (cf.MBhäsya.II.356.1ff) p.60.2 p.45.11

nityaprahasito nityajalpitah (cf.MBhäsya.I.7.4) niravayavo 'nantasaktih (cf.Mait.U.7.2)

p. 159.9-10 p.64.7

panca pancanakhä bhaksyäh (cf.MBhäsya.I.5.15) parimänam asya (cf.Pän.5.1.57) p.195.3

pasubandhena sarväml lokän jayati (cf.SPBr.11.7.1.1, SBh.1.2.4)

p.30.2

Index of the prose passages in alphabetical order päcako lävakah (cf.gßh. on MS.1.1.5) p.7.19-20

339

putraisanäyäs ca vittaisanäyäs ca vyutthäyätha bhaiksacaryam caranti (cf. Brh.U.3.5.1, 4.4.22) p.53.19-20 puri sete (cf.e.g. Gop.Br.1.1.39) p.7.25

pürvam upädänät paksah pürvasabdenocyate / so <'stu eva> yasya tat pürvavat paksavyäpakam Ungarn ucyate / sesa iti sapaksa uktät paksäc chisyamänatväd atah sesavad iti / sapaksavad iti uktam bhavati / sämänyatodrstam iti vipaksa ity adhyähäryam / sämänyena <adrstam> vipaksasabdäbhidheye sarvaträdrstam ity arthah (see NBhüs. p.l91.2i-26) p.83,fn.(l) pürvavad iti kevalänvayi anumänam, sesavad iti kevalavyatireki, sämänyatodrstam ity anvayavyatirekiti / katham / pürvasabdenänvaya upadisyate prägadhyavasiyamänatvät / na hi yävan nägnibhäve dhümabhävo 'dhyavasiyate tävad agnyabhäve dhümabhävo drsto 'py <adhyavasätum> sakyate / vidhyadhyavasäyapürvakatvät / nisedhädhyavasäyasya pürvam eva vidyate 'nvaya evästi yasyänumänasya tat pürvavat / seso vyatirekah / sa eva yasyästi tac chesavat / bädhakopakrtasya kevalavyatirekasya gamakatvam na vyatirekamätrasyeti pradarsanärtham sesavad ity uktam na vyatirekavad iti / anvayavyatirekayoh sädhanängayos sämänyena yad anumänam drstam tat sämänyatodrstam / et ad uktam bhavati: yathänvayenaitad anumänam <upakrtam> tathä vyatirekenäpy <anvayavyatirekivad> itarayor api gamakatvam astiti nyäyabhüsane / säkyäh khalu kevalänvayinah kevalavyatirekinas ca gamakatvam nästity ähuh / (see NBhüs. p.190.16-26) p.83,fn.(l) prthivyädlnäm <dhrtisangrahapaktivyühävakäsadänair> gavädibhävah (cf.NS. 3.1.26(c)) prthivyädini manahparyantäni navaiva dravyäni (cf.VS. 1.1.4) prthivyaptejo väyur äkäsam iti bhütäni (cf.NS. 1.1.13) prakäsavrttir dharmah (tanträntare ?py uktam) p.148.10-11

p. 160.8-9

p.203.18

p.195.26

prajäpatir vai somäya räjne duhitrr adän naksaträni sa rohinyäm evävasat / täny anupeyamänäni punar agacchams tasmät stry anupeyamänä punar gacchati täny anvägacchat täni punar ayäcata / täny asmai na punar adadät / so 'bravit sarvesv eva samävad vasätha te punar däsyämiti sa rohinyäm evävasat <tam> tasminn anrte yaksmo 'grhnät / candramä vai somo räjä yad räjänam yaksmo 'grhnät / tad räjayaksmasya janma / sa trnam iväsusyat sa prajäpatä anäthata / so 'bravit sarvesv eva samävad vasätha tväto moksyämiti / tasmäc candramäh sarvesu naksatresu samävad vasati / tarn vaisvadevena carunämävasyäm rätrim ayäyajat / tenainam yaks<mäd> amuncat (Käth.S.11.3) pp.259.26-260.7

340

Appendix.VII p.44,fn.(2)

prajapatyam <tu>param ajam alabheta (cf.Tai.S.2.1.1.5)

pratigra<hane> punah kriyamäne pratir äbhimukhye vartate (see NM.part 1. p.100.17) pratyaksapürvakatväd vä samjnäkarmanah (VS.2.1.19) pratyaksänumänopamänasabdäh pramänäni (NS.1.1.3) p.81.10-11

p.160.16-17 p.70.18-19 p.70.26

prasiddhasädharmyät sädhyasädhanam upamänam (NS.1.1.6)

pränäpänasamänodänavyänäh pafica väyavah, sastham manah, saptamlpüh, astami väk / (sästram caivam aha) p.209.11-12 bahusu bahuvacanam (cf.Pän.1.4.21) p.23.12 p.51.3-4

brahmavid brahmaiva bhavati (brähmane 'py uktam) brähmanam älabheta (Tai.Br.3.4.1) p.31.15

mangalädini hi sästräni prathante virapurusäni ca bhavanti / adhyetäras ca mangalenäbhihitasamskäräh sästrärthän äsu pratipadyante (cf.MBhäsya.I.40.7-9) p.12.4-6 mahadädivisesäntah sargo buddhipürvakatvät / utpannakäryakaranas tu mähätmyasarira ekäkinam ätmänam aveksyäbhidadhyau 'hantäham puträn sraksye ye me karma karisyanti / ye mäm param cäparam ca jiiäsyanti' / tasyäbhidhyäyatah pafica mukhyasrotaso deväh prädurbabhüvuh / tesütpannesu na tustim lebhe / tato 'nye tiryaksrotaso 'stävimsatih prajajfie / tesv apy asya matir naiva tasthe / athäpare navordhvasrotaso deväh prädurbabhüvuh / tesv apy utpannesu naiva krtärtham ätmänam mene / tato 'nye 'stäv arväksrotasah utpeduh (evam hi sästram) p.239.11-18 <mä täri(?)> srutau bhaktih sahasaiva mahätmanäm (tathä ca sati yad uktam) p.40.12-13 middhopaghätät tadvisesa(h) (Vims.18) p.219.26

mukuti kundall vyüdhoraskas tämräyatäksa(h) (cf.MBhäsya.I.259.20fF.) p.72.14-15 mürtimatäm asamänadesatvam (sästram) p. 114.4

ya ätmäpahatapäpmä vijighatso vipipäso vijaro vimrtyur visokah <satya>samkalpah so 'nvestavyah sa jijnäsitavyah / sa sarväms ca kam an aväpnoti sarväms ca lokän yas tarn ätmänam anuvidya vijänätlti prajäpater vacanam srüyate (cf.Chänd.U.8.7.1) p.52.17-20 yamaräjyam agnistomenäbhijayati (tadyathä) p.232.26

Index of the prose passages in alphabetical order

341

yasya gunasya hi bhäväd dravye sabdanivesas tadabhidhäne tvatalau (cf.Vär.5 on Pän.5.1.119, MBhasya.II.366.10) p.23.9-10 yasya yasyendriyasya visayam mano dhyäyaty abhisampattyarthena tasya tasyautsukyam pravrttis ca bhavati (tanträntare 'py uktam) p.214.28-29 yasya hi pratiksanam anyathätvam nästi tasya bähyapratyayo bhedah / pascäd visesagrahane nästi tadyathä bhümer apacyamänäyäh päkajänäm / na ca bhümeh pratiksanam anyathätvam nästi aksanikatvaprasangät (ksanabhangädhikäre bhavadbhir apy uktam) p. 169.10-13 yo yaträbhiyuktah karmani cädustah sa taträptas tasyopadesah äptavacanam (cf.SV(I).onSK4)' p.5.13-14 yo 'lam sann agnihoträyägnihotram na juhoti tarn esä devatäparuddhäparunaddhy asmäc ca lokäd amusmäc cobhäbhyäm (Ai.Br.5.30=25.5.12) p.36.9-10 yogapramäne ca tadabhäve 'darsanam syät (cf.Pän.1.2.55) rät sasya (Pän.8.2.24) p.64.21 p.24.5

rüpätisayä vrttyatisayäs ca virudhyante / sämänyäni tv atisayaih saha vartante / (värsaganyah pathati) (cf.YBh.on YS.2.15, 3.13) p.137.15-16 vasantäya kapinjalän älabhate (e.g.Väj.Sam.24.20) p.216.29 p.261.24-25 p.38.14

vahanti nadyah tisthanti parvatäh (cf.MBhäsya.II.123.6ff.)

väyavyam svetam [ajam] älabheta bhütikäma (cf.Tai.S.2.1.1.1)

väyur vai ksepisthä devatä väyum eva svena bhägadheyenopadhävati sa evainam bhütim gamayati (cf.Tai.S.2.1.1.1) pp.38.16-39.1 vidvän yajeta vidvän yäjayet (iti vacanät) p.51.17-18

vidvän yajeta vidvän yäjayet srotriyasya ca karmany adhikärah (idam ucyate) p.53.7-8 vidvämsah prajäm na kämayante kirn prajayä karisyämah (Brh.U.4.4.22) p.53.18-19 visamo ' y a m upanyäsah (cf.MBhäsya.I.16.13,1.18.18 et passim) p.106.12

vrddhir ädaic (Pän. 1.1.1) p.lO2,fn.(3) vrstir vrstir iti sriya evopanipätam adhikurute / sä hi vrstivat sarvam äpyäyati (sästram apy äha) p.247.2-3 vyäkhyänato visesapratipattir na hi sandehäd alaksanam (MBhäsya.I.6.26 et passim) p.80.4-5

342 vyapi (Svet.U.3.11 et passim)

Appendix.VII p.159.9

sabdapramänakä vayam / yac chabda äha tad asmäkam pramänam (cf.MBhäsya.I.ll.lff.,i.366.12ff.) p.43.6 sabde 'ham sparse 'ham rüpe 'ham rase 'ham gandhe 'ham iti (cf.TSV. p.76.1; Math, on SK24) p.195.6 savatir gatikarmä kämbojesv eva bhäsyate / ramhatih präcyesu tathä dätir lavanärtho <präcyesu> dätram udicyesu (tadyathä) (cf.MBhäsya.I.9.25ff.) p.102.4-5 simsapädisabdänäm nirvikalpam anumäne 'ntarbhävas trilaksanatvät (yad uktam tanträntariyaih) p.87.14-15 sroträdivrttih (värsaganyäh) p.76.21

sroträdivrttih pratyaksam (cf.e.g.PS.:Peking.Ce.3bl, Derge.Ce.3a3; NV. and NVTT. on NS.1.1.4) ' p.5.11 svetäranye cäntakasya rudrena krtam duhkham asti (cf.Räm.3.29.27cd) p.260.13-14 sasthyä vyäsraye (cf.Pän.5.4.48) p.25.9 p.44.8 p.63.26 p. 160.16

sa ätmano vapäm udakhidat (Tai.S.2.1.1.4)

samkhyäyah samjiiäsanghasüträdhyayanesu (Pän.5.1.58) samjnäkarma <tv> asmadvisistänäm Ungarn (VS.2.1.18) samjnäyäm (cf.Pän.4.3.147) p.252.18

sattämätro mahän (sästram tävat) (cf.YBh. on YS.2.19)

p.263.15 p.211.2

sattvärämah sattvamithunas ca sadä syäd (yasmäc chastram äha)

satsamprayoge purusasyedriyänäm buddhijanma tat pratyaksam (MS. 1.1.4) p.76.19-20 sad anityam dravyavat kärya<m> käranam sämänyavisesavad iti dravyagunakarmanäm avisesam (cf.VS.1.1.7) p.126.3-4 sandehamätram etad bhavati / sarvasandehesu cedam upatisthate (MBhäsya.I. 42.11fF., I.119.23fF. et passim) sambandhäd ekasmät sesasiddhir anumänam (cf.e.g.NV. on NS.1.1.5) sarüpänäm ekasesah (cf.Pän.1.2.64) p.82.23-24 p.7.6-7 p.80.3-4 p.5.12

sarvo dvandvo vibhäsayaikavad bhavati (cf.MBhäsya.I.476.1) savisesanänäm vrttir na (MBhäsya.I.361.5 cf.ibid.II.18.7)

p.59.3, 22

Index of the prose passages in alphabetical order

343

säksätkrtadharmäna rsayo babhüvuh / te 'parebhyo 'säksätkrtadharmebhya upadesena manträn samprädur upadesäya gläyanto 'pare bilmagrahanäyemam grantham samämnäsisuh vedam ca vedängäni ca (äha ca) (Nir.1.20) pp.251.22-252.1 sämänyajiiänam indriyänäm visesajnänam buddheh (uktam anyair äcäryaih) p.201.22 sämänyavihitam ca visesavihitena (cf.MBhäsya.I.383.25f. et passim) sämänyavihitasya visesavihitena (cf.MBhäsya.I.383.24ff. et passim) p.81.19 p.81.16

siddham nimittam naimittakasyänugraham kurute näpürvam utpädayati (äha) ' (cf.YBh. onYS.4.12) siddhasuskapakvabandhaih (cf.Pän.2.1.41) sälädinämjalabhüml (cf.YBh.onYS.3.14) supo dhätuprätipadikayoh (cf.Pan.2.4.71) p.70.2 p.150.19 p.23.12-13 p.233.23-24

süksmebhyah süksmatamo mahadbhyo mahattamo (cf.Kath.U.2.20) p.159.10-11 sodaryänäm pancadasänäm satänäm trayastrimsad udasisyanta deväh / sesäh präsiyante (rcäpy uktam) p.260.12-13 stenam mano 'nrtavädini väk (cf.SBh.1.2.2) p.44.8-9

stautinyor eva sanyabhyäsäd (Pän.8.3.61) p.64.22-23 hantäham puträn sraksye ye me karma karisyanti / ye mäm param cäparam ca jiiasyanti / p.239.13-14 hantäham puträn <sra>ksye ye me karma karisyanti ye mäm param <cäparam> ca jiiasyanti / sa yädrk sargam abhidhyäyati tädrk pradhänäd utpadyate tadyathä mahesvarasya rudrakotisrstau / p.234.26-29

344 Appendix VIII

APPENDIX VIII

Index of the prose passages quoted or referred in the YuktidTpikä a n d in the Kashmir and Delhi Mss. AK.II.24 p.170.18-19 p.154.24 p.170.14 p.111.16 p.163.27-29 p.167.21-23 p.51,fn.(2) p.40,fn.(l) Marginal Notes

to of

according to the Tai.S.2.1.1.5 TSP.(p.l73.6-7) TSV.(p.76.1) Nir.1.20 Nir.3.2 Nir.5.6 p.44,fn.(2)

sources

AK.(p.l92.5)

p.167.21-23 p.195.6

AKBh.(p.62.1-2) AKBh.(p.l59.19) AKBh.(p.l59.24)

pp.251.22-252.1 p.83.5 p.268.17 p.83,fn.(l) p.83,fn.(l)

AKBh.(p.468.20-22) Amarakosa 3.3.4 Arnarakosa 3.3.78 AV(S).8.2.26

NBhüs.(p.l90.16-26) NBhüs.(p.l91.21-26) NBh.1.2.6

p.45.6-7 p.36.9-10

pp.128.23-129.3 p.81.10-11 p.203.28-32

Ai.Br.5.30=25.5.12 Kath.U.2.20 Käth.S.11.3 Käsikä 2.2.16 Gop.Br.1.1.39 GDhS.1.4.1

NM.(partl.p.l00.17) NM.(part2.p.49.5-10) NS.1.1.3 NS.1.1.4 NS.1.1.6 NS.1.1.10 NS.1.1.12 NS.1.L13 NS.3.1.26(c) p.70.18-19 p.76.17-18 p.70.26

p.159.10-11 pp.259.26-260.7 p.ll.10-11 p.7.25 p.34.4-5 pp.53.23-54.3 pp.37.7-38.2 pp.45.2, 52.1-2 pp.43.12-44.1

Chand.U.3.11.4-6 Chand.U.5.10.1-2 Chand.U.5.10.3

pp.16.10-11, 179.13 p.203.15-16 p.203.18 p.148.10-11 p.5.11 p.5.12 p.5.11

Chand.U.5.10.3,5,6 Chand.U.7.1.3 Chand.U.8.7.1

p.51.3 p.52.17-20 p.259.22-24

NV. on NS.1.1.4 NV. on NS.1.1.5

Tan.Br.12.5.18,19 Tai.Br.3.2.5.6 Tai.Br.3.4.1 Tai.S.1.8.6.2 Tai.S.2.1.1.1 Tai.S.2.1.1.4

NVTT. on NS.1.1.4 Pan.1.1.1 Pan.1.1.8 Pän.1.2.55 Pän.1.2.29-31 Pän.1.2.64

p.52.12 p.31.15 p.159.19-20 pp.38.14, 38.16-39.1 p.44.8,44,fn.(2)

p.102.10, 102,fn.(3) p.224.26 p.24.5 p.224.26 pp.82.23-24,87.7

Index of prose passages according to Tfche sources Pan.1.4.15 Pän.1.4.21 Pän.1.4.55 Pän.2.1.13 Pan.2.1.41 Pan.2.2.15 Pän.2.2.28 Pan.2.2.30 Pan.2.2.34 Pän.2.4.71 Pan.3.1.87 Pan.3.3.104 Pan.3.3.117 Pan.4.1.1 Pan.4.3.53 Pan.4.3.120 Pan.4.3.147 Pän.5.1.57 Pän.5.1.58 Pän.5.1.115 Pän.5.1.119 Pän.5.2.127 Pän.5.3.58 Pan.5.4.48 Pän.5.4.154 Pän.6.3.1 Pan.8.2.24 Pan.8.3.61 PS.1.3 p.64.20-21 p.23.12 p.11.13 p.204.8 p.70.2 p . l l . 10-11 p.221.9 p.59.7 p.49.2 p.23.12-13 p.59.25 p.259.17 pp.67.6-7, 204.5, 216.4 p.23.11-12 p.30.19 p.180.2 p.252.18 pp.63.25, 195.3 p.63.26 p.30.20 pp.l4,fn.(l), 69.21 p.87.5-6 p.64.22 p.25.9 p.213.31 p.23.13 p.64.21 p.64.22-23 Brh.U.2.4.13 Brh.U.3.5.1 Brh.U.4.4.22 Brh.U.4.4.25 Brh.U.6.4.14 Math, on SK24 Mund.U. 1.1.4 Mund.U.3.2.9 Mait.U.7.2 p.71.4 p.53.19-20

345

p.53.18-19,53.19-20 p.38.2-6 p.235.1 p.195.6 p.52.21 pp.43.7-8,45.9 p.159.9-10, 159.11 p.24.6 p.60.1 p.64.7 p.269.17-19 p.80.4-5 p.45.11 p.41.1 p.41,fn.(l) p.102.4-5 p.43.6 p.4.15 p.60.1 p.106.12 p.205.10-11 p.106.12 p.106.18 p.106.18 p.7.16 p.12.4-6 p.80.3-4 p.80.14-15 p.82.21-22

MBhäsya.1.1.1-2 MBhasya.I.1.2 MBhasya.I.5.15 MBhäsya.I.6.1f. MBhäsya.I.6.26 MBhasya.I.7.4 MBhäsya.I.9.19ff. MBhasya.I.9.21ff. MBhäsya.I.9.25ff. MBhäsya.I.ll.lff. MBhäsya.1.12.27 MBhasya.I.15.2 MBhäsya.I.16.13 MBhäsya.I.18.5 MBhasya.I.18.18 MBhäsya.I.33.17 MBhäsya.I.35.9 MBhäsya.I.38.20 MBhasya.I.40.7-9 MBhäsya.I.42.11ff. MBhäsya.I.71.18fF. MBhäsya.I.88.25

p.76.21

PS.(Peking.Ce.3bl,Derge.Ce.3a3) pp.5.11, 76.21

346 MBhäsya.I.101.12 MBhäsya.1.107.21 MBhäsya.I.119.23ff. MBhäsya.L 115.2-3 oi on

APPENDIX VIII p.20.13-14 p.11.14 p.80.3-4 pp.33.17-18, Räm.3.29.27cd Väj.Sam.24.20 p.260.13-14 p.216.29 p.11.14 p.23.9-10 p.11.14

Vär.l on Pän.1.2.10, Vär.5 on Pän.5.1.119 Vär.7 on Pän.4.1.14,

MBhisya.L152.26fF. p.23.14-15 MBhisya.I.156.8 pp.213.33 MBhasya.L259.20fF. MBhasya.I.361.5 MBhäsya.I.361.13fF. MBhäsya.I.362.27 MBhasya.L366.12fF. MBhäsya.I.383.24fF MBhäsya.I.383.25F. MBhäsya.I.476.1 MBhäsya.II.18.7 MBhasya.II.123.6ff. MBhasya.II.206.23 MBhäsya.II.355.9 MBhäsya.II.356.1fF. MBhäsya.H.356.8-9 MBhäsya.II.366.10 MV.25.9 MS.1.1.4
P .232.19

^ ,„ . o Vims.3 Vims.4

)
Mne

p.72.14-15 p.59.3,59.22

p.219.6 p.219.6 p.219.26 p.114.6

p.59.15 Vims.18 p.59.18 Vyo. (p.231.5-6) p.43.6 VS.1.1.1 p.81.16 p.81.19 p.7.6-7 p.59.3,59.22 p.261.24-25 p.11.14 p.59.7 p.60.2 p.11.15-16 p.23.9-10 VS.1.1.4 VS.1.1.7 VS.1.1.8 VS.1.1.9 VS.1.2.1 VS.2.1.18 VS.2.1.19 VS.2.2.6 VS.3.1.13
VS 7 L2

p.160.24 p.160.8-9 p.126.3-4 pp.121.14, 126.5, 156.13-14 p.126.5 p.157.6 p.160.16 p.160.16-17 p.161.29-30 p.76.18-19
Pl16 p

- ' ' -

'17

p.76.19-20
P p.79.25-26,222.5

VS 9 1 VS

-11L5

YBh.onYS.1.4 YBh.onYS.2.15 YBh.cn YS.2.19 YBh.on YS.3.13 129.3, 137.15-16 YBh.on YS.3.14 YBh.on YS.4.12 YS.2.30

pl5L22 23 ™ " p.137.15-16 VSC.on VS.2.1.11 pp.114.6, 160.6-7 pp.62.15,263.15 SPBr.11.7.1.1 P-30.2 pp.111.16, 128.23- ^ . 1 2 . 4 . 1 . 1 p.35.12-13

ÖBh. on MS.1.1.5 p.150.19 p.233.23-24 SBh.1.2.2 SBh.1.2.4 p.44.8-9 p.30.2

p.7.19-20

pp.191.37-192.1

SV.ätmaväda 62

p.230.6-7

Index of prose passages according to the sources Svet.U.3.11 p.159.9 SV(I). on SK4 p.5.13-14

347

ALT- UND NEU-INDISCHE STUDIEN Herausgegeben vom Institut für Kultur und Geschichte Indiens und Tibets an der Universität Hamburg 15. Kiyoaki Okuda, Hrsg.: Eine DigambaraDogmatik. Das fünfte Kapitel von Vattakeras Müläcära. Übersetzung u. Kommentar. 1975. IV, 164 S., kt. ISBN 3-515-02139 - 6 16. Tapan Kumar Das Gupta: Der Vajra - eine vedische Waffe, (vergriffen) 2174 - 4 17. Klaus Rüping: Studien zur Frühgeschichte der Vedänta-Philosophie. Teil 1: Philologische Untersuchungen zu den BrahmasütraKommentaren des Safikara und des Bhäskara. 1977. VI,75S.,kt. 2409-3 18. Claus Oetke: Die aus dem Chinesischen übersetzten tibetischen Versionen des Suvarnaprabhäsasütra. Philologische und linguistische Beiträge zur klassifizierenden Charakterisierung übersetzter Texte. 1977. VI, 462 S., kt. 2600 - 2 19. Horst Brinkhaus: Die altindischen Mischkastensysteme. 1978. VI, 232 S., kt.2759 - 9 20. Axel Michaels: Beweisverfahren in der vedischen Sakralgeometrie. Ein Beitrag zur Entstehungsgeschichte von Wissenschaft, (vergriffen) 2978 - 8 21. Catharina Kiehnle: Vedisch uks und uks/ vaks. Wortgeschichtliche und exegetische Untersuchungen. 1979. V, 241 S., kt. 3149 - 9 22. Egon Brucker: Die spätvedische Kulturepoche nach den Quellen der £rauta-, Grhyaund Dharmasütras. Der Siedlungsraum. '1980. IV, 160S.,4Ktn.,kt. 2999-0 23. Klaus Bruhn/ Albrecht Wezler, Hrsg.: Studien zum Jainismus und Buddhismus. Gedenkschrift für Ludwig Aisdorf, (vergriffen) 2874 - 9 24. Axel Michaels: A Comprehensive 6ulvasütra Word Index. 1983. VII, 60 S., kt. 4157 - 5 25. S. A. Srinivasan: Studies in the Rama Story. On the irretrievable loss of Välmiki's original and the operation of the received text as seen in some versions of the Välin-Sugnva episode. 1984. Volume I. XII, 259 S.; Volume II. Notes, Index of References, Addenda. VI, 195 S., kt. zus. 3664 - 4 26. Leonard W. J. van der Kuijp: Contributions to the Development of Tibetan Buddhist Epistemology. From the eleventh to the thirteenth century. 1983. IX, 330 S., kt. 3584 - 2 27. Andreas Bock: Der Sägara-GangävataranaMy thus in der episch-puranischen Literatur. 1984. IX, 356S.,kt. 4222-9 28. Johannes Bronkhorst: The Two Traditions of Meditation in Ancient India, (vergriffen) 4238 - 5 29. Takashi Iwata: Sahopalambhaniyama. 1991. 2 Bde. XXVIII, 286 und V,246 S., kt. 4398 - 5 30. Caren Dreyer: Das Käthaka-Grhya-Sütra. Mit Vivarana des Ädityadafsana, Btiasya des Devapäla und GrhyapänciJ^ä de&sBrähmanabala. Kritische Edition mit Anmerkungen. Teil I. 1. Kandikä und Sandhyopäsanamantrabhäsya des Devapäla. 1986. XXXV., 185 S., kt. 4532 - 5 31. Martin Mittwede: Textkritische Bemerkungen zur Maiträyanl Samhitä. Sammlung und Auswertung der in der Sekundärliteratur bereits geäußerten Vorschläge. 1986. V,207 S., kt. 4620 - 8 32. Horst Brinkhaus: ThePradyumna-Prabhävafi Legend in Nepal. A study of the Hindu myth of the draining of the Nepal Valley. 1987. VIII, 398 S., kt. 4631 - 3 33. Claus Oetke: "Ich" und das Ich. Analytische Untersuchungen zur buddhistisch-brahmanischen Ätmankontroverse. 1988. VIII, 577 S., kt. 4675 - 5 34. Rahul Peter Das: Das Wissen von der Lebensspanne der Bäume. Surapälas Vrksäyurveda kritisch ediert, übersetzt und kommentiert. Mit einem Nachtrag von G. Jan Meulenbeld zu seinem Verzeichnis "Sanskrit Names of Plants and their Botanical Equivalents". 1988. IX, 598 S., kt. 4663 -1 35. Eli Franco: Perception, Knowledge and Disbelief. A Study of Jayaräsi's Scepticism. 1987. VII, 584 S.,kt. 4879-0 36. Horst Brinkhaus: Jagatprakäsamallas Müladevasasidevavyäkhyänanätaka. Das älteste bekannte vollständig überlieferte Newari-Drama. Textausgabe, Übersetzung und Erläuterungen. 1987. VII, 207 S., kt.4976 - 2 37. Martin Mittwede: Textkritische Bemerkungen zur Käthakä-Samhitä. 1989. V, 160 S., kt. ' 5072 - 8 38. Thomas Oberlies: Studie zum Cändravyäkarana. Eine kritische Bearbeitung von Candra IV.4.52-148 und V.2.1989. XI, 295 S., kt. 5022-1 39. Almuth Degener: Khotanische Suffixe. 1989. LII, 349 S., kt. 5478-2 40,1+2. Hidenori S. Sakuma: Die äsrayaparivrtti-Theorie in der Yogäcärabhümi. 199O.Teil I: VIII, 170 S. with Engl. Summary; Teil II: XVII, 243 S., kt. 5629-7 41. Christoph Cüppers: The IXth Chapter of the Samädhiräjasütra. A Text-critical Contribution to the Study of Mahäyäna Sütras. 1990. XXIX, 171 S., kt. 5649-1 42. Marek Mejor: Vasubandhu's Abhidharmakosa and the Commentaries Preserved in the Tanjur. 1991. XX, 115 S., kt. 5535-5 43. Yoshihito G. Muroji: Vasubandhus Interpretation des Pratityasamutpäda. Eine kritische Bearbeitung der Pratityasamutpädavyäkhä (Samskära- und Vijnänavibhanga). 1993. VIII, 259 D.,kt. 6119-3 44. Albrecht Wezler / Shujun Motegi, Ed.: Yuktidlpikä. The Most Significant Commentary on the Sämkhyakärikä. Vol. I. 1998. XXXVII, 347 S., kt. 6132-0

45. Nalini Balbir (Tl. 1)/Thomas Oberlies (Tl. 48. Catharina Kiehnle: Jiiändev Studies I, II 2): Ävasyaka-Studien. Tl. 1: Introduction v ,and III. generate et Traductions; Tl. 2: Glossar ausge(48,1* I and II: Songs on Yoga. Texts and wählter Wörter zu E. Leumanns „Die ÄvasyaTeachings of the Mahärästrian Näths. ka-Erzählungen". 1993. Zus. 685 S.,kt. 48,2. Ill: The Conservative Vaisnava. 6149-5 Anonymous Songs of the Jnändev Gäthä. 46,1+2. Karin Preisendanz: Studien zu Nyä1997. Zus. XII, 352 u. VII, 123 S., kt. 6922-4 yasütra III.l mit dem Nyäyatattväloka Vä- 49. Birte Plutat: Catalogue of the Papers of caspati Misras II. 1994. 2 Teile m. zus. LI I, Ernst Leumann in the Institute for the Culture VII, 858 S., kt. 6460-5 and History of India and Tibet, University of 47. Alexander von Rospatt: The Buddhist DocHamburg. 1998. 136 S., kt. 7096-6 trine of Momentariness. A Survey of the Origins and Early Phase of this Doctrine up to Vasubandhu. 1995. IX, 285 S., kt. 6528-8

FRANZ STEINER VERLAG STUTTGART ISSN 0170 - 3242

Sign up to vote on this title
UsefulNot useful