You are on page 1of 150

UNIVERSIDAD DE CONCEPCIN

EXPRESIN Y ACUMULACIN DE DESHIDRINAS EN Deschampsia antarctica Desv.

Tesis doctoral presentada a la Escuela de Graduados de la Universidad de Concepcin como parte de los requisitos para optar al grado de Doctor en Ciencias Biolgicas

POR

NLIDA CRISTINA OLAVE CONHA

TUTOR Dr. Luis Corcuera P. Dr. Simn Ruz L.

2004

Esta

tesis ha sido realizada en el Departamento de Botnica de la Universidad de

Concepcin y en el Instituto de Biologa Vegetal y Biotecnologa de la Universidad de Talca.

Integrantes de la Comisin Evaluadora: Dr. Len Bravo R. Depto. Botnica Facultas de Ciencias Naturales y Oceanogrficas Universidad de Concepcin

Dr. Juan Olate A. Depto. Biologa Molecular Facultad de Ciencias Biolgicas Universidad de concepcin

Dr. Luis Corcuera P. Director de Tesis Depto. Botnica Facultas de Ciencias Naturales y Oceanogrficas Universidad de Concepcin

Dr. Simn Ruz L. Director de Tesis Instituto de Biologa vegetal y Biotecnologa Universidad de Talca

Dr. Juan Carlos Vera C. Director Programa de Doctorado en Ciencias Biolgicas rea Biologa Celular Molecular
2

AGRADECIMIENTOS

A Dios y todos aquellos que hicieron posible llevar a buen trmino esta tesis doctoral. CONICYT: Beca Doctorado 1996-1999. Proyecto FONDECYT Doctorado N 2000144.

INDICE Indice Lista de figuras Lista de tablas Abreviaturas Resumen Abstract 1. Introduccin 1.1. Deshidrinas 1.1.1. Motivos conservados en DHNs 1.1.2. Propiedades Bioqumicas de las DHNs 1.1.3. Modificaciones Post-transduccionales en DHNs 1.1.4. Regulacin de la expresin de genes para DHNs 1.2. Deshidrinas y estrs abitico 1.2.1. Temperaturas bajas 1.2.2. Desecacin (estrs hdrico) 1.2.3. Salinidad 1.3. Localizacin de las deshidrinas 1.3.1. Distribucin tisular 1.3.2. Localizacin subcelular 1.4. Funcin de las DHNs 1.5 Deschampsia antarctica 1.6. Hiptesis 1.7. Objetivo General 1.8. Objetivos Especficos 2. Diseo Experimental 3. Materiales y Mtodo 3.1. Aclimatacin al fro 3.2. Eficiencia fotosinttica 3.3. Estrs salino, osmtico y tratamiento con ABA 3.4. Estrs hdrico 3.5. Contenido relativo de agua 3.6. Medios de cultivo, tampones y antibiticos 3.7. Bacterias, plasmidios y bacterifagos 3.7.1. Cepas utilizadas 3.7.2. Plsmidios utilizados 3.8. Transformacin de E. coli con plsmidios 3.8.1. Preparacin de clulas competentes 3.8.2. Transformacin 3.9. Mini-preparaciones de ADN plasmdico 3.10. BacterifagoGEM-12, infeccin de E.coli y obtencin de ADN del fago 3.10.1. Preparacin de clulas para infeccin 3.10.2. Infeccin de bacterias 4 7 9 10 11 14 17 17 18 23 25 26 27 27 31 32 33 33 34 35 38 39 39 40 41 43 43 43 44 45 45 46 47 47 48 48 48 49 50 51 51 52

3.10.3. Obtencin de fagos desde placas de lisis y determinacin del ttulo 53 3.10.4. Midi-preparaciones de ADN de fago 54 3.11. Encapsidamiento in vitro 56 3.12. Extraccin y purificacin de ADN genmico 56 3.12.1. Extraccin de ADN desde D. antarctica 57 3.13. Recuperacin de fragmentos de ADN separados en geles de agarosa 58 3.14. Recuperacin de ADN separado en geles de agarosa de bajo punto de fusin 59 3.15. Extraccin, fraccionamiento y purificacin de ARN desde D. antarctica 60 3.15.1. Purificacin de ARN total con la solucin de Chomczynski con fenol cido 60 3.16. Extraccin, purificacin y separacin electrofortica de protenas D. antarctica en geles de poliacrilamida-SDS 61 3.16.1. Extraccin de protenas 61 3.16.2. Confeccin de geles 62 3.17. Electroforesis de cidos nucleicos en geles de agarosa 62 3.17.1 Condiciones desnaturantes 62 3.18. Transferencia de protenas a membranas y deteccin inmunolgica 63 3.19. Transferencia de ADN y ARN a membranas 65 3.19.1. Digestin enzimtica del ADN genmico de D. antarctica 66 3.19.2. Transferencias de ARNs 67 3.20. Sondas 68 3.20.1. Sonda heterloga 68 3.20.2. Obtencin sonda homloga 68 3.20.3. Anlisis de secuencias 69 3.21. Marcacin de sondas e hibridaciones 70 3.21.1. Marcaje por cebadores al azar (Random Primers) 70 3.21.2. Marcaje por la tcnica de PCR 71 3.22. Hibridaciones ADN-ADN y ARN-ADN 72 3.23. Construccin y anlisis de genoteca de ADN genmico de D. antarctica 73 3.23.1. Anlisis de la digestin parcial de ADN genmico con la enzima Mbo I 73 3.23.2. Digestin parcial preparativa y purificacin de fragmentos de 12 a 20 kpb 74 3.23.3. Modificacin de los extremos de los fragmentos genmicos 75 3.23.4. Ligacin del ADN genmico digerido al vector GEM-12 75 3.23.5. Titulacin de la genoteca 76 3.23.6. Anlisis de la genoteca 77 3.24. RT-PCR (Reverse Transcription-Polymerase Chain Reaction) 78 4. Resultados 79 4.1. Estudio de la presencia de genes para DHNs en D. antarctica 79 4.2. Construccin de genoteca de ADN genmico de D. antarctica 87 4.3. Clonaje de los fragmentos genmicos 91 4.4. Anlisis de la genoteca 92 4.5. Anlisis de la expresin de genes para DHNs en D. antarctica por las

tcnicas de Northern y Western blots 94 4.5.1. Anlisis de los Northern blotst 94 4.5.2. Anlisis de la expresin de genes para DHNs en condiciones de temperatura baja 98 4.5.3. Anlisis de la expresin de genes para DHNs en condiciones de estrs salino y osmtico 98 4.5.4. Anlisis de la expresin de genes para DHNs por tratamiento exgeno con ABA 83 4.6. Anlisis de la expresin de genes para DHNs en condiciones de estrs por temperatura baja, salinidad y ABA por RT-PCR 102 4.7. Anlisis de la acumulacin de DHNs en D. antarctica sometida a distintas a distintos estrs por Western blots 104 4.7.1. Anlisis de la expresin de DHNs en D. antarctica por tratamiento con temperatura baja 104 4.7.2. Anlisis de la expresin de DHNs en D. antarctica por tratamiento con deshidratacin 102 4.7.3. Anlisis de la expresin de DHNs en D. antarctica por tratamiento salino (NaCl) 108 4.7.4. Anlisis de la expresin de DHNs en D. antarctica por tratamiento osmtico (PEG) 115 4.7.5. Anlisis de la expresin de DHNs en D. antarctica por tratamiento con ABA exgeno 120 5. Discusin 122 5.1. Deteccin de genes para DHNs en D. antarctica 123 5.2. Expresin de genes para DHNs en D. antarctica 124 5.3. Acumulacin de DHNs en D. Antarctica durante distintos estreses 128 6. Conclusiones 134 6.1. Conclusin general 135 7. Bibliografa 135

Lista de Figuras Figura 1. Caractersticas generales de las deshidrinas. a) Representacin de una deshidrina utilizando la nomenclatura YSK Figura 2. Diagrama en rueda Schiffer-Edmundson de una -hlice amfiptica Clase-A Figura 3. Diseo experimental Figura 4. Regin aminoacdica codificada por la sonda Dhn5 de H. vulagare Figura 5. Productos de PCR obtenidos con MB1 y MB2 Figura 6. Secuencia nucleotdica y aminoacdica deducida del fragmento genmico aislado desde D. antarctica Figura 7. Alineamiento entre la secuencia nucleotdica de la sonda con secuencias nucleotdicas de genes para deshidrinas inducidos por fro Figura 8. Anlisis Southern blot de ADN genmico de D. antarctica utilizando las sondas homloga y heterloga Figura 9. Digestin analtica parcial del ADN de D. antarctica con MboI Figura 10. Fraccionamiento por tamao del ADN de D. antarctica parcialmente digerido con MboI Figura 11. Ligacin ADN D. antarctica a GEN-12 Figura 12. Calidad de ARN total purificado
86

21 22 42 68 80 81 86 88 89 90 93 96 97 100 101 103 105 106 111 109 110 114

Figura 13. Plantas de D. antarctica a distintas temperaturas Figura 14. Autoradiografa de membrana con ARN de D. antarcica aclimatada a temperatura baja Figura 15. Deteccin de transcritos para deshidrinas por Northern blot bajo estrs osmtico y salino Figura 16. Deteccin de transcritos para deshidrinas por Northern blots en D. antarctica tratadas con ABA exgeno Figura 17. Deteccin de ARNm por RT-PCR en D. antarctica bajo tratamiento salino, ABA y fro Figura 18. Acumulacin de deshidrinas en hojas de D. antarctica durante tratamiento a temperatura baja Figura 19. Acumulacin de deshidrinas en hojas de D. antarctica en respuesta a deshidratacin Figura 20. Acumulacin de deshidrinas en plantas tratadas con NaCl 0,25 y 0,5 M Figura 21. Acumulacin de deshidrinas en plantas tratadas con disolucin de NaCl 0,75 M Figura 22. Acumulacin de deshidrinas en D. antarctica tratadas con una disolucin de NaCl 1M Figura 23. Plantas de D. antarctica rebrotadas despus de los tratamientos con NaCl Figura 24. Acumulacin de deshidrinas en plantas de D. antarctica tratadas

con potencial osmtico de 0,3 MPa y 0,6 MPa 116 Figura 25. Acumulacin de deshidrinas en plantas de D. antarctica tratadas con potenciales osmticos de 0,9 MPa y 1,2 MPa 118 Figura 26. Plantas de D. antarctica rebrotadas despus de los tratamientos con PEG 119 Figura 27. Cintica de acumulacin de deshidrinas en D. antarctica tratadas con ABA exgeno 121 Figura 28. Representacin esquemtica de los mecanismos de tolerancia de la D. antarctica a las condiciones ambientales de la Antrtida 135

Lista de Tablas Tabla I. Cepas bacterianas utilizadas Tabla II. Deshidrinas que presentan identidad con el fragmento obtenido por PCR desde D. antarctica Tabla III. Porcentaje de identidad entre la secuencia aminoacdica deducida de 123 aminocidos con algunas DHNs disponibles en la base de datos internacionales Tabla IV. Contenido relativo de agua (CRA) en plantas de D. antarctica durante el tratamiento de deshidratacin Tabla V. Parmetros de Fv/Fm en D. antarctica tratada con soluciones de NaCl con concentraciones diferentes 113 107 83 82 47

Abreviaturas
ABA: ADNc: BCIP: cido abscsico ADN complementario Bromo-cloro indolil-fosfato

BSA: CRA: DHN: DEAE: DEPC: LEA: IgG: IPTG: MPa: NBT: PAGE: PCR: PEG: Pfu:

Sero albmina de bovino Contenido relativo de agua Deshidrinas Dietilaminoetilo Pirocarbonato de dietilo Late Embryogenesis Abundant Inmunoglobulina Isopropiltio--galactosidasa Mega Pascal Azul de nitro-tetrazolio Electroforesis en gel de poliacrilamida Reaccin en cadena de la polimerasa Polietilenglicol Unidades formadoras de placa

RT-PCR: Transcripcin inversa-Reaccin en cadena de la polimerasa SDS: TTBS: X-Gal: Dodesil sulfato de sodio Amortiguador Tris salino con 0,1%Tween-20 5-bromo-4-cloro-3-indolil--D-galactosidasa

10

Resumen Las plantas han desarrollado diferentes mecanismos adaptativos para enfrentar condiciones ambientales adversas de temperatura, salinidad y sequa. Las plantas responden a tales condiciones iniciando numerosos cambios fisiolgicos. Muchos de estos mecanismos adaptativos son en respuesta a la percepcin del estrs, los que llevan a la induccin de genes especficos. La expresin de estos genes conduce a la sntesis de protenas de estrs especficas, las que confieren tolerancia a las plantas. Un grupo importante de genes que responden a estrs abitico, son los genes lea, los cuales fueron identificados por vez primera en las fases de maduracin y desecacin de las semillas de algodn. Varios genes lea han sido caracterizados y basado en el anlisis de sus secuencias aminoacdicas deducidas, se han identificado distintos grupos. Uno de estos grupos, son las protenas LEA-D11 o deshidrinas, las que forman parte de una familia de protenas vegetales que se acumulan en respuesta a estmulos que producen deshidratacin, como son la sequa, temperaturas bajas, salinidad alta y respuesta a ABA. Una caracterstica distintiva de las deshidrinas, es la presencia de una secuencia rica en lisina altamente conservada y designada con el nombre de segmento K (EKKGIMDKIKEKLPG) debido a la presencia de mltiples lisinas, el que generalmente est repetido ms de una vez. Aunque no se conoce en forma clara la funcin de las deshidrinas, se ha postulado que ellas protegeran a las plantas de la deshidratacin. Lo anterior se basa en que ellas se encuentran en la mayora de las especies vegetales, muestran un carcter hidroflico, sus propiedades son similares a la de los solutos compatibles y porque se ha observado una correlacin entre su acumulacin y la tolerancia al fro y sequa. Por otro lado, hay evidencias recientes de su participacin como estabilizadores de las membranas celulares durante la deshidratacin.
11

Desachampsia antarctica Desv. (Poaceae) es una de las dos plantas vasculares


que ha colonizado la Antrtida Martima. La vegetacin nativa de la Antarctica debe tener varios mecanismos que les permitan mantener su metabolismo a temperaturas bajas durante el verano Antrtico (estacin de crecimiento) y sobrevivir durante el invierno. D. antarctica no tiene un contenido inusual de lpidos totales polares o un alto grado de cidos grasos insaturados al compararla con otras Poacea. Sin embargo, se han detectado en esta planta altos contenidos de sacarosa y fructanos hacia el trmino del verano. En consideracin a que D. antarctica est

generalmente expuesta al fro, salinidad y viento en su ambiente en natural, se postula que D. antarctica debera tener genes que codifican

para deshidrinas y que su acumulacin estara diferencialmente regulada por temperaturas bajas, salinidad, estrs osmtico y ABA. D. antarctica fue sometida a y La distintos se tratamientos la de que inducen de la acumulacin y de ARN

deshidrinas, mensajeros.

analiz

acumulacin una sonda

deshidrinas para

utilizacin

homloga

deshidrinas, primero

permiti la deteccin de dos ARN mensajeros de 1,0 y 1,6 kb. El

slo se acumul en respuesta a ABA y el segundo se observ en los tratamientos de salinidad y estrs osmtico. La acumulacin del

transcrito de 1,6 kb fue mucho ms rpida en los tratamientos con PEG que en los tratamientos con NaCl. Cuando las plantas fueron tratadas a 4 C, no se detect transcritos para deshidrinas. La utilizacin de un

anticuerpo anti-deshidrina dirigido contra el segmento-K, permiti la deteccin de 10 protenas con tamaos de 58, 57, 53, 48, 38, 32, 30, 28 y 25 kDa. La cintica de acumulacin de las deshidrinas en todos los

tratamientos indicara la existencia de una regulacin diferencial. Los resultados obtenidos en esta tesis indican que: a) D. antarctica tiene

12

genes

que

codifican

para

deshidrinas,

los

cuales

estaran

diferencialmente regulados por estrs osmtico, salinidad y ABA exgeno, b) las temperaturas bajas, salinidad, sequa, y ABA exgeno llevaron acumulacin de la

deshidrinas de diferentes tamaos y c) la acumulacin de

las deshidrinas en D. antarctica estara mediada por vas dependientes e independientes de ABA.

13

Abstract Plants have developedment different adaptive mechanisms to withstand abiotic stress conditions such as high or low temperature, salinity and drought. Plants react to such environmental stresses by initiating a number of physiological and developmental changes. Some of these adaptive mechanisms are a consequence of stress perception and are likely to be mediated through stress induced expression of specific genes. This stress induced gene expression leads to the synthesis of specific stress responsive proteins, which may impart tolerance. An important group of stress responsive genes is late embryogenesis abundant (lea) genes, which were first identified in maturation and desiccation phases of seed development in cotton. Several lea genes have been characterized and, based on deduced amino acid sequence, different LEA groups proteins have been identified. Dehydrins or LEA-D11 are a family of plant proteins that are induced by stimuli that have a dehydration component such as drought, low temperature, salinity, and ABA. In addition, indicative of dehydrin is the presence of a highly conserved lysine-rich 15-amino acid sequence (consensus sequence EKKGIMDKIKEKLPG), referred to as the K segment, which is often repeated several times. Although there is not clear understanding of the entire sequence of events, dehydrins are thought to play a major role in protecting plants from dehydration stress. This is based on their presence in many plant species, their hydrophilic character, possible compatible solute-like properties, and correlation of their accumulation with cold and drought tolerances. Indeed, there is emerging evidence for the participation of dehydrins in the stabilization of cell membranes against dehydration-induced injury.
14

Deschampsia antarctica Desv. (Poacea) is one of the two vascular plants that have colonized the Maritime Antarctic. The native Antarctic vegetation must have various mechanisms that allow the maintenance of metabolism at low temperature during the Antarctic summer (growing season) and survival during winter. D. antarctica does not have unusual contents of total polar lipids or high degree of unsaturation of fatty acids compared with other Poaceae. High amounts of sucrose and fructans are found in this plant mainly towards the end of summer under field conditions. Since D. antarctica is usually exposed to cold, salt, and desiccant winds in the field, we hypothesize that D. antarctica would have genes that encode dehydrin-like proteins and that their accumulation is differentially affect by low-temperature, ABA, salt or osmotic stress. In this work D. antarctica was subjected to different treatments known to induced dehydrins in whole plants, and dehydrins proteins and RNA levels were monitored. Using a genomic fragment from dehydrin gene as a probe, two mRNA of 1.0 and 16 kb were detected. The former accumulated only under exogenous ABA and the latter under osmotic and salt treatment. The 1.6 kb transcript was induced faster in plats under PEG than under NaCl treatment. When the plants were treated at 4 C, the probe did not detectec dehydrin transcripts. Ten dehydrins-like proteins with size of 58, 57, 55, 53, 48, 38, 32, 30, 28 and 25 kDa were detected with a polyclonal antibody raised against the K-segment. The kinetic of dehydrin-like proteins accumulation in response to low temperature, salt, osmotic and ABA treatment was differentially regulated.Therefore, the results obtained in this thesis demonstrated that: a) D. antarctica has a dehydrin-like gene family which is differentially
15

regulated by osmotic stress, salt, and exogenous ABA, b) low temperature, drought, salinity stresses and exogenous ABA resultn accumulation of the different dehydrin-like protein, and c) the accumulation of dehydrin-like proteins in D. antarctica would be mediated by ABA-dependent and ABA-independent pathways.

16

1. Introduccin Las plantas durante su ciclo de vida tienen que enfrentar diversas condiciones ambientales. La deshidratacin celular y el estrs osmtico son elementos comunes de respuesta a muchas condiciones ambientales adversas (Richard et al. 2000, Zhu 2002). Los principales factores que producen deshidratacin celular son la temperatura baja, sequa, salinidad y viento (Wanner y Junttila 1999). Las plantas responden a estas injurias a nivel molecular, celular y fisiolgico. Estas respuestas incluyen disminucin del crecimiento y de la expansin celular (Richardson et al. 2001), disminucin en la asimilacin de CO 2 (McCree et al 1984), incremento de los solutos compatibles (Black et al. 1999), variaciones en los niveles de cido abscsico (ABA) (Wang et al. 2002), expresin de genes (Zhu 2002), sntesis y acumulacin de protenas nuevas (Xiong y Zhu 2001). Los genes inducidos por deshidratacin, salinidad o fro codifican enzimas que son necesarias para la biosntesis de osmoprotectantes, protenas LEA (Late Embryogenesis Abundant), protenas anticongelantes, chaperonas, enzimas detoxificantes, quinasas, enzimas que participan en el metabolismo de fosfoinositoles, y muchas otras protenas con funciones conocidas y desconocidas (Svensson et al. 2002).

1.1. Deshidrinas Las deshidrinas (DHNs) o LEA-D11 son protenas que se acumulan durante los

estados tardos de la embriognesis, desecacin de semillas, en respuesta a temperaturas

17

bajas, sequa, salinidad y ABA. A estas protenas se les han atribuido importantes funciones durante la deshidratacin celular contribuyendo a la supervivencia de las plantas afectadas (Close 1996, 1997; Campbell y Close 1997). El trmino deshidrina fue introducido en 1989 y significa dehydration-inducedproteins (Close et al. 1989). Posteriormente, este trmino se ha utilizado para todas aquellas protenas que presentan secuencias homlogas especficas. Los primeros genes Dhns clonados y caracterizados fueron Rab21 (responde a ABA) de arroz y D-11 de algodn (Baker et al. 1988; Mundy y Chua 1988). Dure et al. (1989), posteriormente clasific a las protenas LEA en tres grupos, dejando las DHNs en el Grupo 2 o LEA-D11. Al comparar las secuencias aminoacdicas de las DHNs con las secuencias de

protenas disponibles en los bancos de datos internacionales, stas no presentan similitud con otras enzimas o protenas con funciones conocidas, sus tamaos varan en un rango amplio (82-648 aminocidos), constituyen entre el 1 y 5 % de las protenas solubles y no son exclusivas de los organismos fotosintetisadores (Close 1996, 1997, Campbell et al. 1997, Browne et al. 2002).

1.1.1. Motivos conservados en DHNs Las DHNs se caracterizan principalmente por la presencia de un dominio rico en lisina altamente conservado, denominado segmento-K y dos dominios menos comunes conocidos como segmento-Y y segmento-S (Fig. 1a) (Close 1996; 1997). En el N-terminal de las DHNs, el segmento-Y (DEYGNP) se encuentra entre una a tres copias. Las posiciones 1,4, 5 y 6 son las ms conservadas (Fig. 1b) y los residuos aminoacdicos que preceden y siguen al segmento-Y son menos conservados, con predominancia de V/T y V/I, respectivamente.
18

El segmento-S tiene la secuencia consenso LHRSGS 4-10(E/D)3 (Fig. 1c), el cual en la mayor parte de los casos precede al segmento-K. El segmento-S es muy conservado en todas sus posiciones, con excepcin de la 5 (Fig. 1c); adems, tiene la particularidad de que puede ser fosforilado (Svensson et al. 2002). El segmento-K (EKKGIME/DKIKEKLPG) se encuentra repetido entre una y once veces, es el nico motivo presente en todas las DHNs conocidas. Se han descrito un total de 247 segmentos-K, sus secuencias son altamente conservadas y los aminocidos que se alternan mantienen la hidrofobicidad o la carga (Fig. 1d). Se ha propuesto que 10 12 residuos de los que conforman el segmento-K forman una -hlice anfiptica Clase A (Dure et al. 1993; Close 1996). Las hlices anfipticas Clase A se caracterizan por tener lados demarcados por aminocidos polares y no-polares con los residuos cargados negativos en oposicin a la cara hidrofbica y residuos con carga positiva en la interfase polar/no-polar (Fig. 2) (Tytler et al.1988). Los aminocidos que separan los segmentos Y, S y K se les denominan segmentos- . Estos segmentos son menos conservados y presentan considerable variacin entre las diferentes DHNs, presentndose en ocasiones como repeticiones en tandem. Los segmentos- generalmente son ricos en glicina (hasta un 30%), treonina y aminocidos cargados. Basados en la nomenclatura YSK (por segmento-Y, S y K, respectivamente) (Close 1996), se han reconocido cinco tipos estructurales diferentes entre las distintas secuencias de DHNs en las plantas superiores. Estas comprenden los siguientes tipos: YnSKn ,SKn, Kn, YnKn, y KnS.

19

(a)

Y S K K
(b) D71 E2 G1 E52 Q15 A4 V2 T1 K2 Q1 Y59 H5 F4 R3 G73 R1 N70 Q2 D1 E1 P69 V3 A1 H1

(c) L54 H39 H2 R12 I1 Q5 A1 R57 S51 T5 R1 G37 S9 D5 N4 H2 S56 K1 S55 G1 I1 SSSSS31 E42 SSSSSS16 D13 SSS3 A1 SSSSSSS3 L1 SSSSSSSS2 SSSS1 SS1 D37 E17 S2 T1 D36 E19

20

(d)

E140 K35 R31 H15 D7 G4 Q7 N4 L1 A1 V1 P1

K216 N11 E6 G6 R3 D2 Q2 M1

K197 E18 G10 D5 R5 A3 V3 T2 Q1 S1 M1 P1

G215 S22 K2 E2 I2 D1 P1 N1 R1 V1

I80 L58 V52 M24 F22 A5 T2 D1 C1 R1 K1

M99 K44 L41 V37 I10 T8 F2 G2 S2 A1 D1

E116 D106 G13 Q3 A2 T3 K1 Y1 L1 G1

K205 N26 Q7 R4 S3 M1 G1

I213 V22 L9 M1 E1 F1

K227 M11 Q3 T3 N2 E1 G1

E168 D62 Q10 G2 K1 A1 N1 M1 K1

K235 Q8 M1 T1 S1 R1

L196 I39 V4 M3 F3 A1 T1

P223 H12 S8 G3 V1

G235 V3 H3 S2 L2 A1 R1

Figura 1.

Caractersticas generales de las DHN. a) Representacin de una deshidrina

utilizando la nomenclatura YSK. El ejemplo corresponde a una deshidrina YSK2. Y: segmento-Y (T/VDEYGNP), K: segmento-K (EKKGIMDKIKEKLPG), S: segmento-S (SSSSSSS). : segmento- (rico en glicina y aminocidos polares). b), c) y d) segmentos Y, S y K desde 92 DHN tomadas desde el banco de datos Swiss Protein. Los aminocidos se representan utilizando el cdigo de una letra, los nmeros en subndice indican la frecuencia de los residuos en cada posicin (Svensson et al. 2002)

21

Figura 2. Diagrama en rueda Schiffer-Edmundson de una -hlice anfiptica Clase A. La hlice anfiptica se caracteriza por tener residuos con cargas positivas distribuidas en la interfase polar/no-polar y los residuos negativos se encuentran al centro de la cara polar (Tytler et al. 1988)

22

En Arabidopsis, se han encontrado seis DHNs, cada una con 250 aminocidos, las que contienen una secuencia similar al segmento-K, ELMEKISEKIH. Este segmento-K presenta una homologa alta entre las posiciones 5-13 al compararla con otros segmentosK. En estas protenas el segmento-K se encuentra prximo al N-terminal seguido por residuos de serina, similar a lo encontrado en las DHNs del tipo KnS. En musgos se han encontrado protenas similares a las DHNs. Estas protenas tienen un segmento-K ubicado en el C-terminal, mientras que el resto de la protena est formado de una serie de elementos repetidos designados X. La DHN rehidrina de Tortula ruralis est compuesta de 15 elementos repetidos, siendo cada uno de ellos un motivo de 15 aminocidos, denominados GPN (Svensson et al. 2002). Una parte de la secuencia GPN muestra un alto grado de homologa con el segmento-K, y se ha predicho que ste formara una -hlice anfiptica (Velten y Oliver 2001), por lo que estas protenas han sido descritas como del tipo Kn. En la protena PpDHNA de Physcotrella patens se encontraron once secuencias repetidas, cada una de 35 aminocidos y con el motivo GPN, y en el Nterminal se encontr un segmento similar al Y (DNYGN R/P), un segmento-Y (DEYGNP) y un segmento-Y con una sustitucin (DN/SEYGNP) (Svensson 2002). DHN con estructuras similares a las descritas en musgos no se han encontrado en otros vegetales.

1.1.2. Propiedades Bioqumicas de las DHNs Una caracterstica sorprendente de las DHNs es que ellas son termoestables. El anlisis de la composicin aminoacdica indica que tienen un alto porcentaje de glicina (20-30%),

23

de residuos polares y cargados, los que le proporcionan un carcter altamente hidroflico, lo cual estara contribuyendo a la mantencin de su solubilidad en condiciones de

temperaturas altas. Las DHNs generalmente no presentan en su secuencia residuos de cistena o triptfano, lo cual evitara la tendencia hacia el plegamiento y por lo tanto no se formaran centros hidrofbicos (Svensson et al. 2002). La purificacin de DHNs desde Arabidopsis por IMAC (Immobilized Metal Affinity Chromatography) revel una fuerte afinidad de las DHNs por las columnas de cobre. Como las DHNs no poseen motivos de unin a metal, probablemente esta unin se deba a la formacin de complejos de coordinacin entre los mltiples residuos de histidina que quedan accesibles en la superficie de las protenas y el metal (Svensson et al. 2000). El anlisis estructural de varias DHNs indica que ellas no poseen elementos de estructura secundaria definidos. Estudios realizados con dicrosmo circular indican que las DHNs DHN1 de maz y COR19 de Citrus unshiu no poseen una estructura definida en solucin acuosa (Ceccardi et al. 1994; Hara et al. 2001). El anlisis de otras DHNs utilizando

resonancia magntica nuclear de hidrgeno (1H-NMR) confirma la falta de una estructura definida en solucin acuosa (Lisse et al. 1996). Sin embargo, in vivo, las DHNs podran adoptar ms de una estructura ordenada al interactuar con otras molculas o estructuras celulares como membranas o nucleoprotenas. El carcter intrnseco de estructura desplegada de las DHNs podra ser una consecuencia termodinmica sobre la forma en que se pliegan estas protenas in vivo, tal vez, influenciadas por factores como la concentracin de solutos, fosforilacin del segmento-S, o modulacin de los patrones de unin a las membranas cuando hay alteracin en el contenido de fosfolpidos (Wright y Dynson 1999). Estudios realizados con DHN1 y CuCor19 en presencia de SDS, indican que el segmento24

K tiende a adoptar una estructura de -hlice al interaccionar con la superficie de las micelas de SDS (Svensson et al. 2002, Koag et al. 2003). Se ha propuesto que DHN1 estabilizara las membranas por una reduccin de la tensin en la curvatura negativa de la capa mono lipdica, lo que posiblemente evita la transicin a la fase hexagonal II o por una alteracin en la densidad de carga interfacial de la membrana, lo que evitara la fusin de vesculas con cargas negativas (Koag et al. 2003)

1.1.3. Modificaciones Post-transduccionales en DHNs Vilardell et al. (1990) fue el primero en informar que la protena RAB17 (YSK 2) era fosforilable. Posteriormente, Plana et al. (1991) demostraron con experimentos in vitro e in vivo la fosforilacin de RAB17, determinando que son tres los aminocidos (EDD) implicados en el reconocimiento por la enzima casena quinasa 2 (CK2). Estos resultados fueron posteriormente confirmados con ensayos de mutacin sitio dirigida a los tres residuos implicados en la fosforilacin, lo que result en la ausencia de protena

fosforilada (Jensen et al. 1998). El estado de fosforilacin de RAB17 sera importante para su traslocacin al ncleo (Jensen et al. 1998). Otro ejemplo es VCaB45 de Apium graveolens, una protena con gran afinidad por Ca2+, donde la unin del Ca2+ a VcaB45 dependera del estado de fosforilacin en el que se encuentre la protena (Heyen et al. 2002). Otro tipo de modificacin post-transduccional informada es la glicosilacin (Svensson et al. 2002). Levi et al. (1999) inform de dos DHN de 60 y 65 kDa que seran O-glicosiladas en residuos de serina o treonina (Levi et al. 1999).

25

1.1.4. Regulacin de la expresin de genes para DHNs La regulacin de la expresin de genes que codifican para DHNs en respuesta a distintos estreses ambientales est determinada por una compleja red de eventos que se pueden dividir en: a) percepcin del estmulo; b) procesamiento del estmulo, incluyendo amplificacin e integracin de las seales y c) reaccin a travs de la expresin de novo de genes. Muchos de los cambios observados en las cantidades de ARNm son reflejo de una activacin a nivel transcripcional (Ingram y Bartels 1996). En los ltimos aos se han descrito distintos elementos en cis en las regiones promotoras de genes para DHNs que responden a fro, deshidratacin, salinidad y ABA, as como los elementos en trans que se les unen (Svensson et al. 2002, Thomashow MF 2001). Nordin et al. (1993) sugiri la presencia de un elemento que respondera a temperatura baja (LTRE, Low Temperature Responseive Element). Deleciones efectuadas en los promotores de genes para DHNs confirmaron la existencia de una secuencia de 9 pb (TACCGACAT), que era responsable de la resistencia a temperatura baja, salinidad y sequa, pero que no responda a ABA (Yamaguchi-Shinozaki y Shinozaki 1994). Este elemento de respuesta a temperatura baja y sequa se conoce como LTRE/DRE o C-repeat (CRT) y est presente en varias regiones promotoras de genes para DHNs, as como en promotores de otros genes que responden a sequa y fro (Baker et al. 1994). Una familia de protenas descritas en Arabidopsis,

llamadas CBF1, CBF2 y CBF3 (CRT binding factor) o DREB 1B, DREB 1C y DREB 1A (DRE binding protein) son las responsables de activar la expresin de genes que en sus regiones promotoras lleven elementos DRE/CRT/LTRE (Shinozaki y Yamaguchi26

Shinozaki 2000). Otra familia de protenas relacionada, que reconoce estos elementos, son los factores de transcripcin DREB 2A y DREB 2B los que son especficos para sequa (Liu et al. 1998). Muchos de los genes que codifican para DHNs responden a temperatura baja, sequa y, adems, son inducidos por ABA. Es as, que se han descrito, elementos que responden a ABA o cajas ABRE (ABRE, ABA Responsive Element), los que presentan el motivo C/TACGTGGC (Guiltinan et al. 1990, Leung y Giraudat 1998). Los factores de transcripcin que se unen especficamente a ABRE contienen un motivo bsico denominado cierre de leucina (bZIP) (Xiong y Zhu 2001). Recientemente se aislaron dos genes que codifican para bZIP que se unen especficamente a elementos ABRE (Uno et al. 2000). Estos genes, codifican para AREB1 y AREB2 (ABA-Responsive Element Binding Proteins) los que son sensibles a sequa, salinidad y ABA. Otra familia de factores de transcripcin caracterizada en Arabidopsis corresponde a los ABFs (ABRE Binding

Factor); stos responden diferencialmente a distintas presiones ambientales (Choi et al. 2000).

1.2. DHNs y estrs abitico 1.2.1. Temperaturas bajas La supervivencia de las plantas durante el invierno depende de la habilidad que tengan para aclimatarse a temperatura bajas no congelantes, lo cual les permite posteriormente soportar temperaturas entre 5 C a 30 C (Thomashow 1998). La aclimatacin es un proceso que implica varios cambios fisiolgicos. Estos cambios incluyen un aumento en las concentraciones de azcares, protenas solubles, prolina y una variedad de protenas, entre

27

ellas las DHNs, as como alteraciones en la composicin de los lpidos de membrana (Hughes y Dunn 1990). Las DHNs han sido extensamente estudiadas en cebada, donde se ha caracterizado una familia de 12 de genes (Dhn) (Choi et al. 1999, Choi y Close 2000, Zhu et al. 2000). La mayor parte de los genes Dhn en cebada son regulados positivamente (upregulated) por deshidratacin y ABA. Estas DHNs son alcalinas y del tipo YSK 2, mientras que las DHNs inducidas por fro son neutras o cidas. Dhn5 y Dhn8 de cebada son inducidas en respuesta a temperatura baja y deshidratacin. Fowler et al. (2001) encontraron que la acumulacin de DHN5 y DHN8 es mayor en plantas mantenidas en fotoperodo de da corto que de da largo, indicando la influencia de mltiples vas de control. La deshidrina P-80 aislada del cultivar Aramir (Bravo et al. 1999), slo se acumula en respuesta al fro despus de 48 horas de tratamiento, sus niveles no son afectados por deshidratacin, temperaturas altas o ABA. P-80 se encontr asociada al tejido vascular y epidermis, principales puntos de nucleacin de hielo, lo que estara indicando que tendra una funcin protectora en estas estructuras (Bravo et al. 1999, 2003). Las restantes DHNs de cebada ( Dhns 1, 2, 3, 4, 7 y 9) responden a estrs hdrico y a tratamiento de congelamiento-descongelamiento (Zhu et al. 2000). En cambio, la DHN Dhn12 slo se ha encontrado en embriones de cebada (Choi y Close 2000). En trigo se ha descrito una familia de genes para DHNs similar a la encontrada en cebada e incluye miembros que son coordinadamente regulados por temperatura baja. Esta familia codifica un grupo de protenas muy abundantes con masas aparentes que van desde 12 a 200 kDa (Sarhan et al. 1997). La acumulacin de las DHNs WCS120 (K 6) y WCOR410 (SK3) estara correlacionada con la capacidad de tolerancia al congelamiento
28

(Danyluk et al. 1994, 1998). WCS120 se ha encontrado asociada a la zona de transicin vascular del tejido meristemtico de la corona, sugiriendo que esta protena protegera estos tejidos durante el congelamiento (Houde et al. 1995, Sarhan et al. 1997). Mientras que WCOR410 se ha encontrado en la periferia de la membrana plasmtica, lo que ha llevado a pensar que tendra una funcin crioprotectora al evitar la desestabilizacin de las

membranas plasmticas en condiciones de congelamiento y deshidratacin (Danyluk et al. 1998). El mecanismo exacto de cmo WCR410 acta se desconoce, aunque se han

sugerido tres posibles modelos que lo explicaran: a) reposicin del agua y por lo tanto se produce solvatacin de las membranas, b) prevencin de interacciones entre la bicapalipdica, por lo tanto se reduce la fusin de las membranas y la transicin de fase lamelar a hexagonal II o c) la formacin de puentes salino, evitando el efecto daino del aumento de la concentracin inica (Danyluk et al. 1998). Las DHNs ERD14 (SK2), LTI30 (K6), TLI29 (SK3), COR47 (SK3) y RAB18 (Y2SK2) de Arabidopsis se han estudiado en plantas tratadas y no tratadas con temperatura baja (Nylander et al.2001). De stas, slo LTI30 se acumul en respuesta a temperatura baja, observndose que hay una correspondencia entre la acumulacin del transcrito y los niveles de protena. Aunque LTI30 no se detect en las plantas control, el transcrito estuvo presente en los controles, sugiriendo que la expresin de TLI30 est regulada transcripcional y posttranscripcionalmente (Nylander et al. 2001). LTI29 y COR47 se detectaron en las plantas control y tratadas con fro. En cambio, ERD14 se expres constitutivamente, pero sus niveles aumentaron en plantas tratadas con fro y RAB18 no se acumul en plantas tratada con fro (Nylander et al. 2001).

29

Las DHNs tambin han sido estudiadas en rboles frutales y perennes (Svensson et al. 2002). En rboles de origen templado las DHNs fluctan estacionalmente, comenzando con niveles altos en invierno para disminuir durante el perodo de crecimiento activo (Wisniewski et al. 1996, Sauter et al. 1999). En abedul ( Betula pubescens) se identificaron dos DHNs de 34 y 36 kDa cuya acumulacin fue afectada por el fotoperodo y

deshidratacin, sugiriendo que las DHNs tendran participacin en la tolerancia al congelamiento en especies arbreas (Welling et al. 1997). En abedul se identificaron dos DHNs adicionales, las que se acumulan en el ncleo, cuerpos proteicos de reserva y amiloplastos durante el periodo de aclimatacin al fro (Rinne et al. 1999). Los autores proponen que las DHNs podran crear un pool de agua en las clulas deshidratadas para mantener la actividad de enzimas que son necesarias para la degradacin de almidn y protenas de reserva, las que son gradualmente consumidas durante el invierno. En arndano se inform de tres DHNs con pesos moleculares aparentes de 65, 60 y 14 kDa que se acumularon durante la aclimatacin al fro (Arora et al. 1997, Levi et al. 1999). Las cantidades de estas protenas aumentaron considerablemente durante la aclimatacin al fro y disminuyeron durante la desaclimatacin o reanudacin del crecimiento. Las evidencias experimentales indican que las DHNs estn involucradas en la adquisicin de tolerancia al congelamiento en distintas especies vegetales. Muchas de las DHNs se acumulan lentamente durante el periodo de aclimatacin, cuando las plantas son expuestas a temperaturas bajas, no-congelantes y disminuyen con la desaclimatacin o reanudacin del crecimiento. Estas protenas posiblemente ejercen su funcin manteniendo la integridad de macromolculas y membranas celulares, as como la actividad de enzimas que son esenciales para el funcionamiento del metabolismo.
30

1.2.2. Desecacin (estrs hdrico) Uno de principales factores que limitan el crecimiento de las partes areas y del sistema radicular de las plantas, es la disponibilidad de agua. Las respuestas de las plantas a la deshidratacin incluyen el cierre de los estomas y la sntesis de osmolitos (betaina y prolina) (Riccardi et al. 1998). Estos cambios son en parte controlados por ABA, cuya concentracin aumenta considerablemente en las plantas sujetas a dficit de agua e induce la expresin de genes que codifican para DHNs o que responden a ABA (protenas RAB) (Riccardi et al. 1998, Wang et al. 2002). ltimamente, se ha demostrado que el ABA no es el nico factor que media la regulacin de genes por sequa, ya que estmulos externos, como la luz, podran modular la expresin de genes inducidos por sequa (Cellier et al. 2000). DHNs que se acumulan en respuesta a deshidratacin o dficit de agua se han descrito en distintas especies vegetales. En Arabidopsis, se ha informado que RAB18 se acumula en gran cantidad en condiciones de dficit de agua y en presencia de ABA (M ntyl et al. 1995, Nylander et al. 2001). Cellier et al. (2000) demostr que en plantas de Helianhus annuss bajo ests hdrico, el ciclo dial noche modula la expresin de los genes de DHNs HaDhn1 y HaDhn2 que responden a sequa, aunque con distintos patrones de acumulacin. Tambin demostr que responden diferencialmente a las variaciones de ABA, sugiriendo que estos genes tendran funciones distintas en las plantas.

31

En Populus tremula una leosa, se inform de una DHN constitutiva de 43 kDa la que est presente en la raz y que se acumul en respuesta a deshidratacin en los brotes. En esta misma especie dos DHN con masa molecular aparente de 31 y 33 kDa se expresaron diferencialmente en respuesta a deshidratacin y ABA, respectivamente (Pelah et al 1997). En arndano, se encontr que las DHNs que responden a deshidratacin se acumulan previo a que ocurran cambios significativos en los contenidos relativos de agua y que stas se encuentran extensamente distribuidas en los tallos ms que en las hojas y races (Panta et al. 2001).

1.2.3. Salinidad Concentraciones altas de sal interfieren con la homeostasis del potencial hdrico y la distribucin inica en los tejidos vegetales. La salinidad produce deshidratacin celular por osmosis, toxicidad por acumulacin de ines (inhibicin de actividad enzimtica y muerte celular) y desbalance nutricional. (Zhu 2001). Los genes para DHNs que responden a salinidad, probablemente son inducidos por la deshidratacin celular causada por el estrs osmtico, explicando por qu se han encontrado DHNs que responden a salinidad (Godoy et al. 1994, Danyluk et al. 1994). Moons et al. (1995) encontraron que las cantidades de DHN en raz de arroz tolerante a salinidad, son significativamente ms alta que en cultivares intolerantes. Jayaprakash et al. (1998) informaron de una correlacin positiva entre los niveles de DHNs y la tolerancia a salinidad en Oryza sativa y Eleusine coracan. En cultivares tolerantes a salinidad se encontr que estas DHNs se acumulan en gran cantidad en respuesta a una deshidratacin parcial y ABA, en comparacin a los cultivares intolerantes, sugiriendo una asociacin entre tolerancia al estrs y la expresin cuantitativa
32

de estas protenas. En Arabidopsis, se han descrito varias DHNs que se acumulan durante el estrs salino. ERD14 se acumula en grandes cantidades principalmente en tallos y hojas. En plantas tratadas con sal, LTI30 se acumula en cantidades pequeas principalmente en races, hojas y flores, pero no en tallos. TLI29 tambin se acumula muy poco y se le encontr en races, tallos, hojas y flores, mientras que COR47 se detect slo en races y tallos. En cambio, RAB18 se detect slo en las flores de las plantas tratadas con sal (Nylander et al. 2001).

1.3. Localizacin de las DHNs 1.3.1. Distribucin tisular Las DHNs se encuentran ampliamente distribuidas en los tejidos vegetales. Los estudios de localizacin se han realizado utilizando mtodos immuno-histoqumicos. En plantas de cebada aclimatadas a temperatura baja, la deshidrina P-80 se acumula en los haces vasculares, en xilema y floema (Bravo et al. 1999). Schneider et al. (1993) analizaron la distribucin de DSP16 en C. plantagieum bajo estrs de sequa. sta se localiza preferente en el floema y en clulas embrionarias. Protenas de la familia WCS120 (K 6) de trigo, se encontraron asociadas a los haces vasculares y bordeando las clulas parenquimticas de plantas aclimatadas al fro (Houde et al.1995). WCOR40 otra deshidrina de trigo, se acumula principalmente en el rea de transicin vascular (Danyluk et al. 1998). PCA60, una deshidrina de duraznero, durante el invierno se distribuye generalmente en las clulas de los rebrotes, incluyendo tejido epidrmico, cortical, floema y xilema (Wisniewski et al. 1999). Tambin, se ha informado de DHNs en tejidos no fotosintticos, como ECP40 (Y3SK2) de zanahoria, que se ha encontrado en el endosperma
33

y en embriones zigticos (Kiyosue et al. 1993), RAB17 se ha encontrado en todas las clulas de embriones maduros y en la aleurona (Goday et al. 1994). TAS14, una DHN de tomate que se acumula es respuesta a estrs salino, se localiz en los primordios de races adventicias en desarrollo, en el tejido vascular de los brotes y en clulas corticales del tallo y hojas (Goday et al. 1994). En Arabidopsis no estresadas, las DHNs TLI29 y ERD14 se detectaron en las puntas de las races y tejido vascular, mientras que RAB18 se localiz en las clulas de la guarda en los estomas. En cambio, en las plantas estresadas, estas DHNs se localizaron en la mayora de las clulas, aunque las clulas cercanas a los tejidos vasculares mostraron una tincin ms intensa. En contraste, LTI30 no se detect en plantas control; slo se visualiz en los tejidos vasculares y anteras de plantas tratadas con fro (Nylander et al. 2001). La presencia de DHNs constitutivas en Arabidopsis y su localizacin restringida a ciertos tejidos, sugieren que stas cumpliran funciones protectoras bsicas en ciertos tipos celulares (pe. tejido vascular) y en condiciones de estrs estas funciones son extendidas a la mayora de las clulas. En su conjunto, las DHNs se han observado en los tejidos vasculares y clulas cercanas, tejidos muy vulnerables a la nucleacin del hielo y al dao ocasionado por las temperaturas bajas. Finalmente, la variacin en la distribucin espacial de las DHNs sugiere una especializacin funcional de las distintas protenas o sub-familias de protenas.

1.3.2. Localizacin subcelular Evidencias de la presencia de DHNs en el citoplasma y ncleo se encontraron en estudios realizados en embriones de maz (Egerton-Warburton et al. 1997), primordios
34

radiculares de tomate (Godoy et al. 1994), corona de trigo (Houde et al. 1995) y en brotes de duraznero (Wisniewski et al. 1999). La mayora de las DHNs presentan un segmento-S y secuencias de localizacin nuclear (SLN) similares a las descritas para RAB17, una DHN que se encuentra en el ncleo de plantas estresadas. Sin embargo, DHNs con caractersticas similares se han encontrado slo en el citoplasma, incluyendo DHNs fosforiladas, como DSP16 de C. plantagineum (Svensson et al. 2002) y RAB21 de arroz (Mundy y Chua 1998). Estos resultados sugieren que la fosforilacin es importante para la traslacin al ncleo, pero habra otros factores que estaran controlando la localizacin subcelular de las DHNs. Algunos estudios han proporcionado pruebas que sealan la asociacin de DHNs con estructuras endomembranosas y organelares. PCA60 se encontr asociada a cloroplasto, adems de estar en el citoplasma y el ncleo (Wisniewski et al. 1999). Estudios de fraccionamiento celular en trigo y arroz de invierno mostraron la presencia de dos DHNs asociadas con mitocondrias (Borovskii et al. 2000). Fraccionamientos celulares de espinaca mostraron que la DHN CAP85 se encontraba principalmente en el citoplasma y asociada a retculo endoplasmtico (Neven et al. 1993). Otras DHNs adems de encontrarse en el citoplasma y ncleo, se han localizado en cuerpos proteicos de reserva y en amiloplastos de almidn (Rinne et al. 1999), as como en la periferia de cuerpos proteicos y lipdicos (Egerton-Warburton et al. 1997).

1.4. Funcin de las DHNs

35

El estudio de la contribucin de las DHNs a la tolerancia del estrs abitico se ha abordado utilizando distintas estrategias como: anlisis de la variacin gentica de los genes Dhn, utilizacin de plantas transgnicas y aproximaciones in vitro. Ismail et al. (1999) encontr evidencias de variaciones allicas en el gen Dhn1 que codifica para una DHN de aproximadamente 35 kDa en Vigna unguiculata lo que explicara uno de los aspectos de la tolerancia al fro durante el crecimiento. Otra aproximacin experimental ha sido el uso de transgnicos (plantas, levaduras), las cuales sobre-expresan genes que codifican para DHNs y se estudia el efecto que tienen sobre la tolerancia al estrs. Kaye et al. (1998) trabaj con plantas de tabaco que sobre-expresan CAP85 de espinaca y evaluaron la tolerancia al congelamiento midiendo la liberacin de electrolitos en hojas bajo condiciones congelantes. Los autores concluyeron que CAP85 no contribuy a la tolerancia al congelamiento. Resultados similares se observaron en

Arabidopsis y tabaco que sobre-expresan RAB18 o LTI29 (Lng 1992, Welin 1994). En plantas de tabaco transformadas con DSP16 de C. plantagineum se evalu la tolerancia a la deshidratacin midiendo la liberacin de electrolitos, los resultados indicaron que DSP16 no tuvo ningn efecto (Iturriaga et al. 1992). Sin embargo, en plantas de Arabidopsis que sobre-expresan Dhn1 de cebada, se observ un aumento en la tasa de geminacin en condiciones de estrs salino y osmtico, aunque no hubo un efecto significativo sobre la germinacin en tratamientos con temperaturas bajas y congelantes (Calestani et al. 1998). Trabajos realizados en levaduras que expresan LE4 (TAS14) de tomate, indicaron un aumento de la tolerancia a temperaturas bajas, concentraciones altas de KCl, pero no a NaCl o sorbitol (Zhang et al. 2000).

36

Las evidencias indican que las plantas transformadas con genes que codifican para DHN, no mejoran su capacidad de tolerancia al congelamiento o a la sequa, con la sola excepcin de LE4 en levadura. En contraste, la sobre-expresin en Arabidopsis de los factores de transcripcin CBF1/DREB1B o CBF3/DREB1A, que llevan a la expresin constitutiva de DHN (COR47) y de otros genes que en sus promotores llevan la secuencia DRE/CRT/LTRE, result en un mejoramiento significativo de la tolerancia al congelamiento, salinidad y sequa en plantas no aclimatadas (Jaglo-Ottosen et al. 1998, Kasuga et al. 1999). Los anlisis bioqumicos in vitro mostraron que las DHNs COR45 de espinaca, DHN1 de maz, WSC120 de trigo, PCA60 de duraznero y CuCor19 de Citrus unshiu y P-80 de cebada, tienen actividad crioprotectora y algunas como PCA60 presentan, adems, actividad anticongelante (Kazuoka y Oeda 1994, Houde et al. 1995, Wisniewski et al. 1999, Hara et al. 2001, Bravo et al. 2003). Por lo tanto, el funcionamiento de las DHNs durante el estrs por temperatura baja, sequa o salinidad involucrara procesos complejos que incluyen la accin concertada de un grupo de DHNs o la interaccin con otras molculas que tambin tienen una funcin protectora, como los solutos compatibles o otras protenas LEA.

1.5. Deschampsia antarctica Deschampsia antarctica Desv. (Poaceae) es una de las dos plantas vasculares que ha colonizado la Antrtida Martima (Edward y Lewis-Smith 1988). Es una planta perenne que se distribuye en Argentina en los Andes por el norte y en las zonas de Mendoza y Santa Cruz. En Chile se la encuentra en Tierra del Fuego e islas cercanas. Adems, se encuentra
37

en las Islas Falkland, islas antrticas, subantrticas y costa oeste de la pennsula Antrtica (Alberdi et al. 2002). El ambiente antrtico es uno de los ms inhspitos para el desarrollo de la vida vegetal. D. antarctica debe soportar variaciones de temperatura generalmente entre 0 C y 6 C en verano (Enero) y en invierno, el rango las temperaturas fluctan entre 10 C y 20 C. Otros factores ambientales importantes lo constituyen las horas luz / da y la intensidad de irradiacin (Alberdi et al. 2002). La combinacin de temperaturas bajas y alta irradiacin podran daar el sistema fotosinttico, causando una reduccin en la tasa fotosinttica conocido como fotoihibicin (Alberdi et al. 2002) En estas condiciones D. antarctica se reproduce por medio de la geminacin de semillas o propagacin vegetativa. Esta planta forma densos cojines de hasta 50 cm de dimetro y 10 cm de altura. En las poblaciones antrticas de Deschampsia, el inicio de la floracin es durante el mes de Enero (Reyes 1998). Por lo tanto, D. antarctica, durante el verano (estacin de crecimiento), debe soportar drsticas condiciones fisiolgicas, causadas por las temperaturas bajas, ciclos de congelamiento/deshielos, desecacin y alta irradiacin. Esto implica que D. antarctica tiene mecanismos que le permitan el mantenimiento del metabolismo en las condiciones descritas durante el perodo de crecimiento y sobrevivir durante el invierno (Bravo et al. 2001). D. antarctica no tiene un contenido inusual de lpidos polares total o un alto grado de cidos grasos insaturados, al compararla con otras Poaceae (Ziga et al. 1994). Sin embargo, se han encontrado altas concentraciones de sacarosa y fructanos en D. antarctica, principalmente hacia la finalizacin del verano (Ziga et al. 1996). Esto es consistente con las tasas fotosintticas relativamente altas durante das fros (Xiong et al. 1999). A 0C, esta

38

planta mantiene alrededor del 30% de la tasa fotosinttica encontrada a temperatura ptima (Edwards y Lewis-Smith 1988).

1.6. Hiptesis Teniendo en consideracin que: a) Las DHNs se expresan en gramneas aclimatadas al fro y su acumulacin se ha relacionado con su capacidad de tolerar el estrs por temperaturas bajas, sequa y salinidad. b) La expresin de genes que codifican para DHNs est regulada por uno ms factores, como temperaturas bajas, sequa, salinidad o ABA. c) Las DHNs se han encontrado asociadas a membranas y en tejido vascular de plantas aclimatadas al fro y, d) D. antarctica est generalmente expuesta a temperaturas bajas, salinidad y vientos desecantes. Se postula que Deschampsia antarctica tendra genes que codifican para DHNs cuya expresin y acumulacin estara regulada diferencialmente por temperaturas bajas, salinidad, deshidratacin o estrs osmtico.

1.7. Objetivo General


39

Caracterizar en Deschampsia antarctica

la expresin de genes para DHNs y su

acumulacin en distintas condiciones fisiolgicas.

1.8. Objetivos Especficos 1) Detectar en Deschampsia antarctica la presencia de genes que codifican para DHNs. 2) Estudiar en Deschampsia antarctica la expresin de DHNs a nivel de ARNm y la cintica de acumulacin de las DHNs bajo distintas condiciones fisiolgicas.

40

2. Diseo Experimental

Mtodos

(objetivo 1)

D. antarctica 15C, fotoperodo 16/8, 150 mol m-2s-1

ADN Genoteca ( GEM-12) Sonda Homloga (PCR) Anlisis secuencia FASTA) de la (BLAST;

GEN-Bank (AY266052)

41

Mtodos

(objetivo 2)

D.antarctica 15C, fotoperiodo 16/8, 150 molm-2s -1

D. antarctica 4C, 21 d
F:16/8 y F:21/3

Estrs salino, 24 h (NaCl): O;0.5M F: 21/3

Estrs osmtico, 24 h (PEG): 0; -1,2 MPa F:21/3

ABA 100 M, 24h F:21/3

Northern blot

Western blot

Northern blot

Northern blot

Northern blot

Mtodos

(objetivo 2)

D. antarctica, 15C, fotoperiodo 21/3, 150 molm-2s-1


Estrs osmtico (4d) PEG: 0; -0,3;-0,6; -0,9 Y -1,2 MPa ABA 100 M (24h)

42

Figura 3. Diseo experimental aplicado para ejecutar los objetivos 1 y 2 de esta tesis. 3. Materiales y Mtodos En los experimentos se utiliz Deschampsia antarctica Desv., Poaceae, una de las dos plantas vasculares que crecen naturalmente en la Antrtida. Las plantas fueron colectadas en la Isla Robert (6222`S; 5943`W) de la Antrtida Martima y reproducidas vegetativamente en envases con turba / tierra estril (1:3), en cmaras climticas a 15C 1 C, con un fotoperodo de 16/8 horas da / noche con densidad de flujo fotnico (DFF) de 150 molm-2s-1. Las plantas se regaron una vez por semana con agua y cada 15 das con solucin nutritiva de Phostrogen (0,12g/l).

3.1. Aclimatacin al fro Las plantas fueron transferidas a una cmara de cultivo, donde se mantuvieron a 4 C 2 C por un perodo de 21 das. Se realizaron aclimataciones a dos fotoperodos, de 16/8 y 21/3 horas luz / oscuridad, respectivamente. La DFF fue de 150 molm-2s-1. Muestras de plantas fueron tomadas a intervalos de tiempos regulares para realizar los ensayos de Northern y Western blot.

3.2. Eficiencia fotosinttica La eficiencia fotosinttica se determin midiendo la fluorescencia de las molculas de clorofila del fotosistema II. Una porcin de las hojas de D. antarctica se mantuvo en
43

oscuridad por 30 min, utilizando una pinza oscura. Posteriormente se ilumin con el dispositivo de iluminacin del Analizador de Eficiencia de Plantas (Plant Eficiency Analyser, PEA; Hansatech). La intensidad utilizada fue de 2250 mol m-2s-1. Se tomaron registros en triplicado cada 40 segundos. Los parmetros de fluorescencia que se obtienen para la clorofila son los siguientes: Fo: Fluorescencia inicial de hojas oscurecidas y excitadas con un pulso de luz. Se produce por reduccin de la QA. Fm: Fluorescencia mxima, al tiempo mximo en que se reducen todas las quininas del PSII. Fv: Fluorescencia variable = Fm-F0 Fv/Fm: Coeficiente de fluorescencia variable a mxima, eficiencia fotoqumica mxima cuntica o eficiencia fotoqumica del PSII.

3.3. Estrs salino, osmtico y tratamiento con ABA Se tomaron plantas desde las cmaras a 15 C y fotoperodo 21/3 luz / oscuridad. stas se trasplantaron a macetas con vermiculita y despus de una semana se realizaron los ensayos. Para el estrs salino, las plantas se regaron con soluciones de cloruro de sodio (NaCl) a concentraciones de 250, 500, 750 y 1000 mM. Para el estrs osmtico, las plantas se regaron con soluciones de polietilenglicol (PEG) 15000-2000 a concentraciones de 13,5 % p/p (-0,3 MPa), 19 % p/p (-0,6 MPa), 23% p/p (-0,9 MPa) y 25 % p/p (-1,2 MPa). Los tratamientos con ABA exgeno se realizaron regando las plantas con una solucin de ABA
44

100 M. El ABA se diluy desde una solucin madre 100 m M preparada en etanol absoluto. Las plantas fueron puestas a 15 C y fotoperodo 21/3 luz/oscuridad durante 4 das. Las muestras fueron tomadas a intervalos de tiempos regulares para los ensayos de Western y Northen blot.

3.4. Estrs hdrico Las plantas fueron lavadas para eliminar restos de tierra y se dejaron secar sobre maceteros con vermiculita saturados en agua en una cmara a 15 C con un fotoperodo de 21/3 luz/oscuridad. Las plantas no se regaron por un periodo de 4 das y se tomaron muestras a distintos intervalos de tiempo para los anlisis de Western blot y determinacin de contenido relativo de agua.

3.5. Contenido relativo de agua Se analiz el CRA de las plantas enteras. Para ello se efectuaron mediciones a tiempos regulares hasta 4 das de deshidratacin. Despus de obtener el PF del tejido, las plantas fueron saturadas en agua durante 24 horas, se pesan (PT), y se secaron a 80 C hasta peso constante. El grado relativo de hidratacin de los tejidos fue calculado comparando la hidratacin real del tejido con su mximo potencial de hidratacin:

Contenido relativo de agua = CRA =

PF PS PT - PS
45

Donde PF es peso fresco, PS es peso seco y PT es peso turgente (con mximo potencial de hidratacin). 3.6. Medios de cultivo: LB (Luria Bertani): Bactotriptona (10g/L), Extracto de Levadura (5g/L), Cloruro de Sodio (5g/L), pH 7.5 con NaOH 1N LM: LB suplementado con MgSO4 o MgCl2 (utilizado para el trabajo con bacterifagos)

Medios slidos: Placas de Agar: 12 g agar/L de LB o LM Agar de cobertura o top agar: 7 g agar/L de Lb o LM

Tampones y disoluciones: TM: 10 mM Tris-HCl, pH 7,5; 10 mM MgSO4 (utilizado para diluir cultivos de fagos) X-Gal: 20 mg/ml en dimetilformamida (sustrato de la -Galactosidasa) Conservacin a oscuras a 4 C. IPTG: 20 mg/ml en H2O (inductor del gen Lac Z, inactiva el represor de Lac Z). Conservacin a 4 C.

Antibiticos: Ampicilina: 100 mg/ml en H2O (concentracin de trabajo: 50 g/ml) Conservacin a 20 C. Tetraciclina: 25 mg/ml en etanol al 50 % (concentracin de trabajo: 12,5 g/ml) Conservacin a 20 C, protegida de la luz

Los antibiticos se esterilizaron por filtracin. Se agregaron al medio una vez autoclavado y a una temperatura no superior a 50 C.

46

3.7. Bacterias, plasmidios y bacterifagos 3.7.1. Cepas utilizadas Todas las cepas utilizadas en esta tesis proceden de la cepa K12 de Escherichia coli. En la Tabla I describe sus caractersticas.

Tabla I. Cepas bacterianas utilizadas Cepa KW251 Genotipo Aplicaciones Husped permisivo

F-,supE44,supF58,galK2, galT22,metB21,hsdR2,mcrB1,mc Para Gem-12 rA-, argA81:Tn10,recD1014

LE-392

F-hsdR514(rk-mk-)sup E44supF58 lacY1 o (lacIZY)6galK2 galT22metB1 trpR55-

Husped permisivo para sondeo en placa y crecimiento lquido de Gem-11

DH5

F80dlacZM15 (lacZYAargF)U169 endA 1 recA1 Husped para pUC y hsdR17(rk- mk+) deoR thi-1 phoA otros vectores con sup E44 - gyr A96 rel A1. complementacin, pBR322 .

47

3.7.2. Plsmidios utilizados PtZ19R (plsmido fagmido) Replicones Tamao Fenotipo seleccionable Marcadores genticos pGEM-T ( Robles et al. 1994) Replicn Tamao Fenotipo seleccionable Marcadores genticos fago f1 3000 pb Ampicilina Lac Z (Short et al.1988) pMB1 2870 pb Ampicilina Lac Z

pBluescript II +SK (plsmido fagmido) Replicn Tamao Fenotipo seleccionable Marcadores genticos

f1 fago M13 y colE1 2961 pb Ampicilina LacZ

Estos plsmidos en condiciones adecuadas de IPTG y X-Gal permiten la seleccin por color de los recombinantes positivos (colonias blancas).

3.8. Transformacin de E. coli con plsmidios 3.8.1. Preparacin de clulas competentes 1.- Se hace crecer un precultivo de 3 ml toda la noche en LB a 37 C con agitacin suave. 2.- Se inoculan 25 ml de LB con 250 l del precultivo. Se incuba con agitacin enrgica hasta una DO550 = 0,4 0,5
48

3.- Se detiene el crecimiento por enfriamiento a 0 C durante 5 min. 4.- Se centrifuga a 4000 x g, 5 min a 4 C. 5.- Se resuspende el sedimento en 12,5 ml de 50 mM CaCl2 10mM Tris- HCl, pH 8,0 (esterilizado por filtracin), y se deja reposar por 15 mim a 0 C. 6.- Se centrifuga a 4000 x g, 5 min a 4 C. Se resuspende el sedimento en 12.5 ml de la solucin de CaCl Tris-HCl en fro. Las clulas se conservan a 4 C durante varios das. Tambin pueden guardarse congeladas a 70 C en presencia de glicerol al 15.

3.8.2. Transformacin La tcnica empleada es una adaptacin del mtodo original descrito por Mandel y Higa (1970). 1.- Se mezclan 0,2 ml de suspensin de clulas competentes y un mximo de 50 ng de ADN recombinante proveniente, por ejemplo desde una mezcla de ligacin, diluidos hasta un volumen de 100 l con 10 mM Tris-HCl, pH 8- 0,1 mM EDTA. 2.- Se deja reposar 30 min en hielo y se provoca a continuacin un shock trmico a 42 C durante 2 min. 3.- Se diluye con 0,5 ml de LB y se incuba 1 hora a 37 C con agitacin vigorosa. 4.- Se siembran 100, 200 y 300 l del cultivo en placas de Petri con LB-agar conteniendo el antibitico con el que interesa seleccionar. Las placas se incuban invertidas a 37 C un mximo de 14 horas (Mandel M y Higa A.1970)
49

3.9. Mini-preparaciones de ADN plasmdico 1.- La colonia de clulas que contienen el plsmido se deja en un precultivo de 3 ml de LB con el antibitico de seleccin, toda la noche a 37 C con agitacin vigorosa. 2.- El precultivo es centrifugado a 12000 x g por 1 min en una microcentrfuga. 3.- Se elimina el sobrenadante y se resuspende el sedimento con un vortex en 200 l de TE (10 mM Tris-HCl, pH 8 0,1 mM EDTA).Luego se llenan los tubos Eppendorf con TE y se repite la centrifugacin anterior. 4.- El sedimento se resuspende en 400 l de TS (50 mM Tris-HCl, pH 8 25 % sacarosa) con un vortex. Se agregan 600 l de una mezcla conteniendo 500 l de BL (50 mM Tris-HCl, pH 8 62,5 mM EDTA 0,1 % Tritn X-100). 50 l de lisozima (10 mg/ml) y 50 l de 0,5 M EDTA pH 8. 5.- Se mezcla todo cuidadosamente y se deja en reposo 10 min a 0 C. 6.- Se incuba 15 min a 70 C. 7.- Se enfra en hielo 5 min y luego se centrifuga 15 min a 12000 x g. 8.- Se recoge el sobrenadante cuidadosamente por decantacin. Se agregan 700-759 l de solucin de BP (: 20 mM Tris-HCl, pH 8 1M NaCl 20 % PEG 8000). Se mezcla bien y se deja reposar 30 min a temperatura ambiente. 9.- Se centrifuga a 12000 x g durante 10 min. Se desecha el sobrenadante y se vuelve a centrifugar 1 min para eliminar completamente el PEG.

50

10.- Se disuelve el sedimento en 100 l de TE. Se agregan 1,5 l de ARNsa (10 mg/ml) y se incuba 30 min a 37 C. 11.- Se agrega 1 volumen de fenol/cloroformo (1:1). Se mezcla con vortex 1 min y se centrifuga 5 min a 12000 x g. 12.- Se recoge la fraccin superior acuosa y se repite el paso 11. 13.- Se recoge nuevamente la fase superior acuosa y se agregan 70 l de acetato de Amonio 7 M y 525 l de Etanol absoluto. Se deja 10 min en hielo y se centrifuga 15 min a 12000 x g. 14.- Se elimina el sobrenadante y se lava el precipitado con 500 l de etanol al 80 %. Se centrifuga 5 min a 12000 x g. 15.- Se elimina el sobrenadante. Se seca el sedimento a 37 C y se resuspende en 50 l de TE.

3.10. Bacterifago GEM-12, infeccin de E. coli y obtencin ADN del fago. Se utiliz el bacterifago de sustitucin GEM-12 que es un vector de sustitucin, comercializado por PROMEGA. GEM-12 tiene un tamao de 43 kb, el sitio de clonamiento est parcialmente rellenado en XhoI y los brazos son compatibles con BcI I, BgI II, Mbo I y Sau3A I. El GEM-12 acepta insertos de entre 15 y 23 kb y las cepas huspedes son E. coli LE-392 y E.coli KW 251.

51

3.10.1. Preparacin de clulas para la infeccin Para la obtencin de bacterias utilizadas en la infeccin se sigui la metodologa descrita por Davies et al. 1980. 1.- Se prepara un precultivo de la cepa bacteriana en 3 ml de LM (suplementado con antibitico si se requiere) y se incuba a 37 C, durante 12 16 horas, con agitacin enrgica. 2.- Se inoculan 50 ml de LM (suplementado con 0,2 % de maltosa) con 200 l de precultivo. Se incuba a 37 C con agitacin hasta alcanzar una OD600 = 1,0. 3.- Se centrifuga a 4000 x g, 10 min a temperatura ambiente. 4.- Se elimina el sobrenadante y se resuspenden las clulas en 1/10 del volumen inicial con MgSO4 10 mM. Esta suspensin celular puede mantenerse a 4 C hasta una semana.

3.10.2. Infeccin de bacterias 1.- Se mezclan 100 l de suspensin de clulas para sembrar y 100 l de solucin de fago diluido adecuadamente en TM (se realizan diluciones seriadas). Se incuba 20 min a 37 C. 2.- Se agrega top-agar a 43 C (3ml para una placa de Petri de 90mm de dimetro), suplido con antibitico si se requiere. 3.- Se vierte sobre placas de LM-agar bien secas y se deja gelificar. Se incuban las placas invertidas a 37 C entre 12 y 16 h. El nmero de placas de lisis permite calcular las pfu (unidades formadoras de placa) en la mezcla de partida, teniendo en cuenta el factor de dilucin. De esta manera se

52

determina el ttulo, es decir la cantidad de fagos que se tienen por g de ADN o por ml de solucin.

3.10.3 Obtencin de fagos desde placas de lisis y determinacin del ttulo. Para la obtencin de fagos desde placas de lisis se utiliz la tcnica descrita por Davies et al. 1980. 1.- Se extrae una placa de lisis bien aislada del resto, perforando el agar con una pipeta Pasteur estril y se deposita en un tubo Eppendorf que contiene 400 l de TM. 2.-Se agrega al tubo una gota de cloroformo y se agita suavemente. Se deja difundir los fagos a temperatura ambiente o a 4 C. Se considera que a las 2 horas se han eluido el 90 % de los fagos contenidos en la placa de lisis. La suspensin puede guardarse indefinidamente a 4 C. 3.- Con la solucin anterior se preparan diferentes diluciones seriadas y se siembran en cpsulas de LMagar. Se espera que al menos alguna placa de Petri contenga placas de lisis confluentes (104 pfu/cpsula). 4.- A las placas de Petri con placas de lisis confluentes, se les agrega 5 ml de TM y se deja difundir un mnimo de 30 min a temperatura ambiente, bajo agitacin suave. 5.- Se recupera el tampn y se agrega a la placa de Petri 1 ml adicional que es recogido a los 10 min. 6.- Se agregan unas gotas de cloroformo a la suspensin de fagos en TM, se agita con un vortex y se centrifuga a 4000 x g 10 min. 7.- Se recupera el sobrenadante y se agregan nuevas gotas de cloroformo. Las suspensiones pueden conservarse indefinidamente a 4 C.
53

8.- Se titulan estos sobrenadantes. Pueden resultar ttulos de 1010 pfu/ml.

3.10.4. Midi-preparaciones de ADN de fago. Para la preparacin de ADN de fago se utiliz el protocolo descrito por Leder et al. 1977 y Patterson y Dean 1987). 1.- Se prepara un precultivo de 3 ml de LB con la cepa bacteriana a utilizar (KW251 o LE392) y se incuba a 37 C, durante toda la noche, con agitacin vigorosa. 2.- Se toma una alcuota de solucin titulada de fagos correspondiente a 2 x 10 6 pfu en un volumen final de 500 l en TM y se aaden 2,5 ml de precultivo saturado. Se incuba 1 hora a 37 C con agitacin suave. 3.- Los 3 ml finales de mezcla se inoculan a 50 ml de LM (con antibitico si es necesario) conteniendo CaCl2 5 mM. Se incuba a 37 C con agitacin vigorosa, hasta que se inicie la lisis (clarificando del cultivo y aparicin de restos celulares agregados). La lisis suele producirse entre las 6 y las 8 horas. 4.- Se aaden 500 l de cloroformo y se prodigue incubando a 37 C durante 15 min para que la lisis se complete. 5.- Se enfra el lisado en hielo, se decanta el cloroformo y se traspasa el sobrenadante acuoso a tubos Corex de30 ml. Se centrifuga a 8000 x g (rotor JA 20) por 5 min a 4 C. 6.- Al sobrenadante se le aade ARNsa A a una concentracin de 5 g/ml y ADNsa I a una concentracin de 1g/ml. Se incuba a 37 C por 30 min. Se repite la adicin de ADNsa a la misma concentracin y se contina la incubacin otro 5 min.

54

7.- Las reacciones enzimticas se detienen por adicin de EDTA a una concentracin final de 10 mM. 8.- A la solucin resultante se le aade un volumen de 20 % de PEG 8000 1 M NaCl 1 mM EDTA 20 mM TrisHCl, pH 8,0. Se mezcla por inversin y se dejan precipitar los fagos a 4 C toda la noche. 9.- Se centrifuga a 8000 x g durante 20 min a 4 C. Se elimina el sobrenadante y se secan las paredes interiores de los tubos. 10.- El sedimento es resuspendido en 1 ml de TM. Se transvasa a tubos Eppendorf, se da un pulso de microcentrfuga 1 2 min y el sobrenadante se transfiere a tubos limpios. 11.- Se aade un volumen de cloroformo y se agita con vortex durante 20 30 seg. Se centrifuga 2 min a 12000 x g y se recoge el sobrenadante obviando la emulsin de la interfase. 12.- Se adiciona un volumen de fenol/cloroformo (1:1), se agita suavemente por inversin de los tubos y se centrifuga a 12000 x g por 5 min. Se recoge el sobrenadante evitando las protenas desnaturalizadas de la interfase. Se repite la operacin dos o tres veces ms hasta que la emulsin de protenas en la interfase desaparezca. 13.- Se precipita la fase acuosa con 2,5 volmenes de etanol absoluto, invirtindose los tubos sucesivamente hasta la aparicin de un ovillo de ADN, el cual se recoge con una micropipeta y se traspasa a otro tubo Eppendorf con etanol. 14.- Se recoge el ADN del fago por centrifugacin a 12000 x g por 15 min. Se lava 2 veces con etanol al 80 % y el ADN sedimentado se seca y se disuelve en 100 l de TE.

55

3.11. Encapsidamiento in vitro Los extractos de empaquetamiento comercializados por Stratagene se denominan

Gigapack III Gold Packaging Extract, stos son defectuosos en los sistemas de restriccin HsdR, McrA, McrBC, McrF y Mrr. El protocolo de encapsidamiento in vitro utilizado es el descrito por los proveedores. 1.- Se ponen sobre hielo seco los extractos de encapsidamiento a ocupar. 2.- Se descongelan rpidamente y se agregar al extracto de encapsulamiento

inmediatamente el ADN (1 - 4 l que contengan 0,1 1,0 g de ADN ligado). 3.- Se mezcla suavemente con micropipeta evitando la formacin de burbujas y se da un pulso de 3 5 seg en una microcentrfuga, todo el contenido debe estar en el fondo del tubo. 4.- Se incuba a temperatura ambiente (22 C) durante 2 horas. 5.- Se diluye hasta 500 l con TM y se aaden 20 l de cloroformo. Se mezcla suavemente y se da un pulso breve en la microcentrfuga. El sobrenadante conteniendo el ADN encapsidado puede guardarse a 4 C hasta un mes. Se determina el ttulo infectando la cepa adecuada.

3.12. Extraccin y purificacin de ADN genmico Se realizaron purificaciones de ADN con 1g de tejido tomado desde plantas de Deschampsia antarctica mantenidas a 15 C con un fotoperodo 21/3 luz/oscuridad. El
56

ADN de alta calidad obtenido se emple para anlisis Southern, PCR y construccin de una genoteca genmica. 3.12.1. Extraccin de ADN desde D. antarctica. Para la extraccin de ADN desde D. antarctica se utiliz la tcnica descrita por Dellaporta, Wood y Hichs 1983. 1.- Se congela el tejido (1g) en nitrgeno lquido y se muele en un mortero hasta obtener un polvo fino. 2.- Se transfiere el polvo a un tubo Corex de 15 ml. Se aade 7,5 ml de solucin A (100 mM Tris pH8, 50 mM EDTA pH8, 500 mM NaCl, 10 mM, - mercapto etanol) y se mezcla. 3.- Se aaden 0,5 ml de SDS al 20 %, se agita suave y se incuba a 65 C durante 10 min. 4.- Se aade 2,5 ml de acetato de potasio 5 M, se mezcla y se incuba a 0 C por 20 min. 5.- Se centrifuga a 10000 x g durante 20 min. El sobrenadante se transfiere a tubos Corex de 30 ml por filtracin a travs de una malla de nylon de 20 m de dimetro de poro. Se aaden 5 ml de isopropanol al filtrado, se mezcla e incuba a 20 C por 30 min. 6.- Se centrifuga a 10000 x g durante 15 min. Se elimina el sobrenadante por decantacin y el pellet se deja secar sobre papel filtro durante 10 min. 7.-Se resuspende el pellet en 0,7 ml de agua. Se transfiere la solucin a un tubo Eppendorf y se centrifuga durante 10 min para eliminar residuos insolubles. 8.- Se transfiere el sobrenadante a un nuevo tubo y se aade 75 l de acetato de sodio 3 M y 0,5 ml de isopropanol. Se mezcla bien y se sedimenta el ADN y lava con etanol al 70 %, se seca y resuspende en 0,1 ml de agua.
57

9.- Se aade un volumen de fenol y se agita por inversin durante 1 min. Se aade un volumen de cloroformo-alcohol isoamlico, agitar nuevamente por inversin y se centrifuga por 5 min a 10000 x g 10.- Se transfiere el sobrenadante a un tubo limpio y se le agrega 0,2 M NaCl y 2 volmenes de etanol fro. Se mezcla y deja precipitar en hielo durante 10 min. Se centrifuga por 15 min a 10000 x g, el sobrenadante se elimina y el ADN se lava con etanol al 70 %, se deja secar y se resuspende en agua.

3.13. Recuperacin de fragmentos de ADN separados en geles de agarosa La recuperacin de fragmentos de ADN de distinto tamao se realiz por retencin del ADN en papel de DEAE-celulosa y mediante agarosa de punto de fusin bajo (Dretzen, et al. 1981)

1.- Una vez separados electroforeticamente los fragmentos de ADN en el gel de agarosa y visualizados con luz UV, se realizan incisiones en el gel por delante de los fragmentos de ADN que interesa recuperar. 2.- En la incisin se coloca un pedazo de papel de DEAEcelulosa (Whatman DE-81) del mismo grosor del gel y del mismo ancho que la banda a purificar, asegurndose que el gel y el papel estn en contacto. 3.- Se coloca el gel en la cubeta de electroforesis y se conecta la corriente elctrica durante 5 min aplicando un voltaje de 100 V. 4.- Se comprueba por fluorescencia con luz UV que el ADN se ha transferido al papel.

58

5.- Se retira el pedazo de papel y se coloca en un tubo Eppendorf conteniendo 200 l de 10 mM Tris-HCl, pH 8; 1 mM EDTA, 1,5 M NaCl. Se incuba 15 min a 37 C. 6.- Se recuperan los 200 l de la solucin anterior y se vuelve a extraer con 200 l adicionales, continundose la incubacin otros 15 min. 7.- Se recupera el ltimo lavado y se junta con el anterior. Se aade un volumen de fenol/cloroformo. Se agita en vortex y se centrifuga 5 min a 12000 x g. 8.- Se recoge la fase acuosa y se mezcla con 2,5 volmenes de etanol absoluto. Se deja precipitar el ADN a 20 C por 20 min. 9.- Se centrifuga a 12000 x g, 15 min. Se desecha el sobrenadante y se lava con etanol al 70% dos veces. 10.- Se seca el sedimento y se resuspende en un volumen adecuado de agua.

3.14. Recuperacin de ADN separado en geles de agarosa de bajo punto de fusin Para la purificacin de los fragmentos de ADN se utiliz Wizard PCR preps ADN Purification System (PROMEGA)

1.- Una vez realizada la electroforesis se visualizan los fragmentos de ADN resueltos por fluorescencia con transluminador de UV y se seccionan los trozos de agarosa que contienen las bandas de inters. 2.- Se colocan los trozos de agarosa en tubos Eppendorf, aproximadamente 300 l de gel. A los tubos de les agrega 1 ml de Wizard PCR Preps ADN Purification Resin, y se agita suavemente hasta que el gel se disuelva completamente.

59

3.- La solucin que contiene el ADN y la agarosa fluida se pasa a travs de una mini columna. 4.- La mini columna se lava con 3 ml de isopropanol al 80 %. Despus se centrifuga 20 seg para eliminar el exceso de isopropanol de la columna. 5.- Se coloca la columna en un Eppendorf limpio. Se agregan 60 l de agua estril a 60 C y se mantiene por 1 min. Se centrifuga 20 seg para eluir el ADN desde la columna.

3.15.

Extraccin, fraccionamiento y purificacin de ARN desde D. antarctica.

Se utilizaron distintos mtodos de extraccin para RNA, dando mejores resultados el mtodo descrito por Chomczynski con fenol cido (Chomczynski 1987, 1993). Para evitar la contaminacin con ribonucleasa todo el material de vidrio se calent a 200 C al menos 4 horas y las disoluciones se prepararon en agua previamente tratadas con pirocarbonato de dietilo (DEPC) al 0,1 % (inhibidor de ribonucleasas).

3.15.1. Purificacin de ARN total con la solucin de Chomczynski con fenol cido El ARN obtenido desde tejido foliar de D. antarctica se utiliz para anlisis Northern y RT-PCR. 1.- Se toman 0,15 g de hojas de D. antarctica desde plantas sometidas a los distintos tratamientos. stas se muelen en nitrgeno lquido hasta obtener un polvo. 2.- Se agrega 1 ml de solucin de Chomczynski con fenol y se mezcla hasta formar una pasta homognea.

60

3.- Se incuba 5 min a temperatura ambiente. 4.- Se aade 0,2 ml de cloroformo por cada ml de solucin de Chomczynski con fenol usado en la homogeneizacin. 5.- Se agita vigorosamente por 15 seg y se incuba 2-3 min a temperatura ambiente. 6.- Se centrifugan a 12000 x g por 15 min a 2-8 C. la fase acuosa se transfiere a un tubo limpio. 7.- Se adiciona 0,5 ml de alcohol isoproplico por cada ml de solucin de Chomczynski con fenol empleada. Se mezcla e incuba a temperatura ambiente por 10 min. 8.- Se centrifuga a 12000 x g por 15 min a 2-8 C. se elimina el sobrenadante y el ARN se lava con alcohol etlico al 75 %, usando al menos 1 ml por cada ml de solucin de Chomczynski con fenol. 9.- Se elimina el sobrenadante y el precipitado se seca a temperatura ambiente, por 5-10 min. 10.- Se disuelve el ARN e n 100 l de agua sin nucleasas y se guarda a 80 C.

3.16. Extraccin, purificacin y separacin electroforticas de protenas de D. antarctica en geles de poliacrilamida - SDS 3.16.1. Extraccin de protenas. 1.- Se toman 0,15 g de hojas de D. antarctica desde plantas sometidas a los distintos tratamientos. stas se muelen en nitrgeno lquido hasta obtener un polvo. 2.- Se agrega 500 l de buffer de extraccin (60 mM Tris-HCl, pH 8; 100 mM NaCl) y se calienta a 100 C por 5 mim, se enfria sobre hielo y centrfuga a 1200 x g por 10 min.

61

3.- Se transfiere el sobrenadante a un tubo limpio y se determinana el contenido de protena por el mtodo Bradford (Bradford 1976).

3.16.2. Confeccin del gel Gel concentrador: Acrilamida /bisacrilamida 5,6 %; Tris-HCl 0,12 M pH 6,8; TEMED 0,005 %; SDS 0,1 %; Persulfato de Amonio 0,05 %. Gel separador: Acrilamida 10 %; Tris-HCl 0,1%; Persulfato de Aminio 0,1 %. El tampn de electroforesis est compuesto por Tris-.HCl 0,05 M, pH 6,8, Glicina 0,38 M y SDS 1 %. Las muestras (10 g protena total) se mezclan en una proporcin 4:1 con el buffer de carga (Tris-HCl 0,12 M; pH 6,8; SDS 0,1 %; -mercaptoetanol 25 mM y azul de bromofenol 0,01 %), calentadas a 100 C y cargadas en el gel. La electroforesis se realiz a 100 V. La tincin de los geles se efectu con azul de Coomassie al 0,1 %, en una mezcla de 25 % metanol / 7% cido actico. La misma solucin acuosa sin colorante utiliz en el desteido (Panyim y Challkley 1969). 0,37 M pH 8,8; TEMED 0,05 %; SDS

3.17. Electroforesis de cidos nucleicos en geles de agarosa 3.17.1. Condiciones desnaturantes Los geles de agarosa/formaldehido (Lehrach et al. 1977), se emplearon para separar ARN totales que han servido posteriormente para transferencias a membranas y anlisis de hibridaciones, por el mtodo Northern. 1.- Se funde la agarosa a la concentracin deseada en agua.

62

2.-Se deja enfriar hasta 50 C aadindose MOPS 10X ( 0,2 M MOPS, pH 7,0; 50 mM acetato de sodio;10 mM EDTA) hasta una concentracin de (1X) y formaldehdo al 37 % hasta una concentracin final de 6,5 % (v/v). El pH del formaldehdo debe ser superior a 4,0. 3.- Se vierte la agarosa fundida sobre el soporte, se coloca el peine y se deja gelificar. 4.- El gel se coloca en la cubeta de electroforesis conteniendo el tampn de electroforesis (1 X). 5.- Las muestras de ARN se preparan en el siguiente tampn: 2,0 l de tampn MOPS, conteniendo el ARN, 8,33 l de formamida desionizada, 3,6 l de formaldehdo al 37%, 0,5 l bromuro de Etidio y 2 l de tampn de electroforesis. 6.- Se incuban las muestras 5 min a 65 C. Se enfran rpidamente en hielo y se aaden 2 l de tampn de muestra (50 % glicerol; 0,2 % azul de bromofenol; 0,2 % xilencianol). 7.- Se cargan las muestras en el gel y se aplica un voltaje de 13 voltios/cm durante 5 horas.

3.18. Transferencia de protenas a membrana y deteccin inmunolgica Como tampn de transferencia para geles SDS se utiliz la siguiente mezcla: 25 m M Tris-HCl, pH 8,3; 192 mM Glicina y 20 % metanol (La migracin de las protenas en la membrana es de ctodo a nodo). 1.- Se equilibra el gel que ha de ser transferido con el tampn de transferencia durante 10 min. 2.Se coloca sobre una hoja de papel Whatman 3MM humedecida con tampn de transferencia, asegurndose que no queden burbujas de aire.
63

3.- Se cubre el gel con una membrana hmeda de nitrocelulosa del mismo tamao del gel, evitando la formacin de burbujas de aire. 4.- Se coloca sobre la membrana otra hoja de papel Whatman tambin empapada en tampn. 5.- A continuacin de ambas hojas de papel Whatman, se colocan tres hojas de papel filtro humedecido y finalmente una esponja Scotch-brite a cada lado. Luego, se coloca en el soporte plstico de la cubeta de transferencia, orientando la membrana de nitrocelulosa hacia el electrodo de migracin. 6.- Se llena la cubeta con tampn de transferencia y se conectan los electrodos. Los geles se transfieren durante 1 hora a 500 mA a 4 C. 7.- Se desmonta el aparato y se procede a la deteccin inmunolgica. Los filtros pueden ser equilibrados con TTBS y guardados en bolsas plsticas selladas. La eficiencia de la transferencia puede comprobarse le eficiencia de la transferencia tiendo el gel o parte de la membrana de nitrocelulosa con Amido-Black 0,1% amido-black; 45 % metanol; 10 % cido actico). Se tie el filtro 5 min en esta solucin y se destie en 45 % metanol 10 % cido actico. 8.- La deteccin de protenas especficas fijadas a membranas de nitrocelulosa se realiz utilizando un anticuerpo policlonal antideshidrina generado contra un pptido sinttico de 19 residuos CTGEKKGIMDKIKEKLPGQH acoplado a BSA (Close T.J. 1993). 9.- Las membranas de nitrocelulosa se equilibran con TTBS 1X (20 mM Tris-HCl; 500 mM NaCl; 0.1 % (v/v) Tween-20) durante 5 min. 10.- Se bloquean los sitios inespecficos de la membrana con 10 % de leche descremada en TTBS durante 30 min 1 hora a temperatura ambiente, agitando suavemente.
64

11.- Se elimina el exceso de solucin bloqueadora enjuagando con TTBS. 12.- Se prepara la solucin de anticuerpo antideshidrina diluido 1:10000 en TTBS con 5 % leche descremada. Se incuba con esta solucin durante toda la noche a 4 C, agitando suavemente en el mnimo volumen posible. 13.- Se lava sucesivamente 3 veces con TTBS durante 15 min, con agitacin suave. 14.- Se prepara el segundo anticuerpo anti-IgG de conejo conjugado a fosfatasa alcalina en TTBS con 5 % leche descremada. Se incuba por 1 hora a temperatura ambiente. 15.- Se lava como en el paso 5. 16.- Las membranas se incuban con la solucin de revelado (100 m M Tris-Base, pH 9,5; 100 mM NaCl; 5 mM MgCl2) y los sustratos de la fosfatasa alcalina en oscuridad (Azul de nitro-tetrazolio (NBT); Bromo-cloro indolil-fosfato (BCIP)

3.19. Transferencia de ADN y ARN a membranas 3.19.1. Digestin enzimtica del ADN genmico de D. antarctica 1.- Se toman seis tubos Eppendorf, cada uno con 10 g de ADN genmico de D. antarctica. 2.- Se agrega a cada tubo 20 l del buffer de reaccin 10X, 164 l de agua y 2l de enzima de restriccin, BamH I, Hind III, EcoR I, Xba I, Xho I o Nde I, respectivamente. 3.- Se incuba a 37 C se vuelve adicionar la enzima de restriccin cada 3 horas (digestin total del ADN) hasta alcanzar un volumen de 200 l.

65

4.- La reaccin se detiene con 8 l 500 mM EDTA. El ADN se precipita con 200 m M NaCl y 2,5 volumen de etanol absoluto enfriado a 20 C, se centrifuga, lava y seca el pellet. 5.- El pellet de ADN se resuspende en agua y se realiza la electroforesis en un gel de agarosa al 0,7 % (p/v) a 20 V toda la noche.

3.19.2. Transferencia Southern de ADN 1.- Una vez realizada la electroforesis se somete el ADN a un proceso de depurinacin sumergiendo el gel en una solucin de 0,25 N HCl y se agita durante 15 min. Si los fragmentos de ADN a transferir son de un tamao inferior a 3 kb, este tratamiento es innecesario. 2.- Se desnaturaliza el ADN en una solucin que contiene 1,5 M NaCl 0,5 M NaOH durante 30 min, con agitacin suave. 3.- Se equilibra el gel en una solucin 1,5 M NaCl 0,5 M Tris-HCl pH 8,0, durante 15 min con agitacin suave. 4.- Se llena un recipiente con unos 250 500 ml de SSCE 20X (0,3 M citrato de sodio, pH 7,5; 3,0 M NaCl; 20 mM EDTA). Se coloca un vidrio a manera de puente y se cubre con 3 tiras de papel Whatman 3MM cuyos extremos deben estar en contacto con el tampn de la cubeta. Se vierte tampn sobre el papel y se eliminan todas las burbujas de aire. 5.- Se coloca el gel sobre el papel y encima de l una membrana de nylon humedecida en agua o tampn SSCE del mismo tamao del gel. Se eliminan las burbujas de aire.

66

6.- Se cubre la membrana de nylon con 3 hojas de papel Whatman 3MM humedecidas en SSCE (20X), de igual tamao que la membrana. Nuevamente se verifica que no queden burbujas de aire. Se coloca encima de las hojas de papel Whatman un paquete de lminas de papel filtro sin humedecer (3 a 6 cm de alto), del mismo tamao del gel. 7.- Se coloca encima un vidrio y un peso de entre 0,5 y 1 kg. 8.- Se deja difundir toda la noche a temperatura ambiente. 9.- Se recupera la membrana y se marcan los pozos para orientarla. Se lava con SSCE (20 X) durante 5 min. 10.- El ADN transferido se fija a membrana irradindolo durante 5 min con luz UV y despus se coloca a 80 C por 2 horas.

3.19.3. Transferencia de ARNs. Para realizar la transferencia de los ARN se siguo el protocolo descrito por Thomas 1980. 1.- Una vez realizada la electroforesis de ARN en el gel de agarosa formaldehdo, se lava 2 veces el gel durante 20 min en SSPE 20X (0,2 M Sodio Fosfato Monobsico Hidratado, pH 7,4; 3 M NaCl; 0,02 M EDTA), agitando suavemente. 2.- Se prepara la cubeta con tampn SSPE (20X) y el puente de papel Whatman 3MM como en el procedimiento de las transferencias Southern. 3.- Se coloca el gel sobre papel Whatman y encima de l un filtro de nylon del mismo tamao, humedecido con agua y equilibrado con SSPE. Se eliminan las burbujas de aire. 4.- Se procede a la transferencia tal como se indica para el mtodo Southern. Se deja transferir toda la noche a temperatura ambiente.
67

5.- Se recupera la membrana y se marcan los pozos para orientarla. Se irradia la membrana durante 5 min con luz UV y se seca a 80 C por 2 horas.

3.20. Sondas 3.20.1. Sonda heterloga Inicialmente la deteccin de genes para DHNs se realiz utilizando la sonda heterloga Dhn5 (donada por el Dr. T. Close, Riverside California, EEUU). sta corresponde a un fragmento genmico de 1300 pb del gen dhn5 de cebada clonado en el plasmidio pTZ19-R, y que codifica una regin de la protena. (Fig. 4)

KLPGGHGDHQKTSDTYGHQEDTAMTGMGRHSTPATGGSYGQHVHTGQTDMGT HGTGEKKGVMENIKDKLPGGHDDHQKTAGTYGQQGHVGTGTHGTPATGGAYG QHEHTGATGTGTYGTGEKKGIMENIKEKLPGGHGDHHKTGDTYGHQEDTKMT GMGRHSAPATGGSYGQHAHTGETGTGTHGTGEKKGVMENIKEKLSGGHDDHQ KTAGTYGQQGHVGTGTHGTPATGGAYGQHERTGATGTETYSTGEKKGVMENI KEKLPGGHGDHQQTGGIYGQQAHVGTGTHDTPATGGTYGQHGHTGVTGTGTH GTGEKKGVMENIKEKLPGGHSDHQHTTETYGQHRHTGVAGTETHGTTATGGT YGQQAQTGTTGAGTHGTDGTGEKKSLMDKIKDKLPGQH


Figura 4. Regin aminoacdica codificada por la sonda Dhn5 de Hordeum vulgare L. En negrita se indican los segmentos-K, caracterstico de las DHNs.

3.20.2. Obtencin de sonda homloga La obtencin de dicha sonda se realiz por PCR desde ADN genmico utilizando un par partidores degenerados, MB1: 5`GGI ARY TTY TCY TTI ATY TT 3` y MB2: 5`GAY GAR TAY GGI AAY CC 3`, estos partidores corresponden al segmento DEYGNP y
68

KIKEKLP, respectivamente. Estos partidores se disearon a partir de una alineacin mltiple de secuencias de ADNc para DHNs. 1.- Se toman aproximadamente 200 ng de ADN genmico y se agrega una mezcla que contiene: 5 l 2mM dNTP, 5l 10X Buffer PCR, 3 l 25 mM MgCl, 2 l 10 pmol/l Cebador directo, 2 l 10 pmol/l Cebador indirecto, 0,25 l llev a un volumen final de 50l con agua. 2.- El programa de PCR utilizado fue: 1 ciclo de desnaturalizacin inicial (95 C 5,00 min), 35 ciclos de desnaturalizacin (93 C 1,00 min), alineamiento (48 C - 0,30 seg), Extensin (72 C 2 min) y un ciclo de extensin final (72 C - 7,00 min). Se ensayaron otras dos temperaturas de alineamiento: 53 C y 57 C. 3.- Terminada la amplificacin se verifican 2 l del producto de amplificacin en un gel de agarosa. 4.- Se purifica la banda de inters de acuerdo al protocolo descrito en el Apartado 2.14. y se clona en el vector pGEM-T (PROMEGA) para su posterior secuenciacin y anlisis. 5U/l Taq Polimerasa, se

3.20.3. Anlisis de secuencias Los anlisis de la secuencia nucleotdica y aminoacdica deducida se realizaron comparando con secuencias de los bancos de datos EMBL y SWAAL utilizando el programa FASTA3 (http://www.ebi.ac.uk/fasta33/).

69

3.21. Marcacin de sondas e hibridaciones Los fragmentos de ADN 1,3 kpb (sonda heterloga) y 454 pb (sonda homloga) aislados y purificados fueron marcados radiactivamente con dCTP- 32P por la tcnica de PCR y se adicionaron a mezclas independientes de pre-hibridacin.

3.21.1. Marcaje por cebadores al azar (random primers) Se utiliz reactivos comerciales de GIBCO BRL (Random Primers ADN Labeling System). 1.- Se desnaturaliza el ADN (25-50 ng) a 100 C durante 5 min, enfrindolo a continuacin rpidamente en hielo. 2.- Se prepara la siguiente mezcla de reaccin en hielo: 20 l ADN desnaturalizado, 2 l dATP 500 M, 2 l dGTP 500 M, 2 l dTTP 500 M, 20 l, Solucin Random primer 2,5X, 3 l (-32P) dCTP 3000Ci/mmol), 1l Fragmento Klenow. 3.- Se mezcla suavemente y se incuba por 10 15 min a 37 C. 4.- Se detiene la reaccin inactivando la enzima con 5 l de buffer de parada. 5.- El ADN marcado se precipita con 25 l de Acetato de amonio 7 M y 150 l de etanol, dejndolo 10 min en hielo. 6.- Se centrifuga 15 min en microcentrfuga. 7.- Se lava el precipitado dos veces con etanol al 80 % (se comprueba que la radiactividad haya decado en el segundo lavado. Si no fuese as se procede a un tercer lavado con etanol al 80 %)

70

8.- El precipitado se seca y resuspende en 50 l de agua estril y se determina su actividad especfica. Se conserva a 20 C

3.21.2. Marcaje radiactivo por la tcnica de PCR 1.- El programa de PCR utilizado fue: 1 ciclo de desnaturalizacin inicial (95 C 5,00 min), 35 ciclos de desnaturalizacin (93 C 1,00 min), alineamiento (53 C - 0,30 seg), Extensin (72 C 2 min) y un ciclo de extensin final (72 C - 7,00 min). Las condiciones de PCR fueron templado 100 ng, 5 l 10X Buffer PCR; 3 l 25 mM MgCl; 5 l 2 mM dNTPs, 5 l 3000 Ci 32P-dCTP, 2 l 10 pmol/l Cebador directo, 2 l 10 pmol/l Cebador indirecto, 0,25 l 5U/l Taq Polimerasa, se llev a un volumen final de 50l con agua. 2.- Terminada la amplificacin se verifican 2 l del producto amplificado en un gel de agarosa (todo est radiactivo) 3.- Se precipita la sonda marcada con 30 l de ADN carrier, 40 l de acetato de amonio 7,5 M y 300 l de etanol. 4.- Se deja por 1 hora en hielo y se centrifuga a 12000 x g por 20 min a 4 C. El sobrenadante se pasa a un tubo limpio rotulado NI (No incorporado) 5.- Se hacen dos lavados con etanol al 80 %. Se deja secar y se resuspende en 100 l de agua. 6.- Se calcula la radiactividad incorporada a la sonda utilizando la siguiente formula de la siguiente forma:

71

% de incorporacin = (cpm sonda/cpm sonda + cpm NI) x 100 3.22. Hibridaciones ADN-ADN y ARN-ADN Las hibridaciones se efectuaron con una sonda heterloga Dhn5 y homloga Dadhn454 las que fueron marcados con 32P utilizando las tcnicas de random primer y PCR y se utilizaron dos tipos de soporte en las hibridaciones, membranas de nylon y nitrocelulosa. Las hibridaciones se han realizado en botellas de vidrio. Se procur utilizar el mnimo volumen de solucin de hibridacin compatible con el tamao de la membrana, para aumentar la concentracin efectiva de la sonda.

1.- Las membranas se incuban con 25 ml de la solucin de pre-hibridacin (50 % formamida desionizada, 5X SSCE, 5X Denhardt (Denhardt 50X: 1 % Ficoll; 1 % Polivinilpirrolidona; 1 % BSA), 1 % SDS, 0,05 mg/ml ADN sonicado no homlogo) entre 2 a 6 horas a 42 C con agitacin suave. 2.- La solucin de pre-hibridacin es reemplazada por la de hibridacin a 42 C, la cual es de composicin idntica a la solucin de pre-hibridacin pero lleva la sonda previamente desnaturalizada (calentar a 100 C por 10 min y enfriar rpidamente en hielo) y se incuba a 42 C entre 6 y 15 horas, agitando suavemente. 3.- Las membranas se lavan con SSCE 2 X 0,1 % SDS (2 veces a temperatura ambiente, 15 min), SSCE 1 X 0,1 % SDS (1 vez a 65 C, 15 min), SSCE 0,2 X 0,1 % SDS (2 veces a 65 C, 15 min) y finalmente con SSCE 0,2 X (1 vez a temperatura ambiente, 2 min). Se elimina el exceso de lquido de la membrana con papel filtro. 4.- Las membranas hmedas en bolsas de nylon selladas se ponen en contacto con pelcula autorradiogrfica durante 24 horas a -80C.
72

Los Northern blot con la sonda radiactiva se realizaron de la misma forma, pero se utiliz la solucin SSPE 20X (0,2 M Sodio Fosfato Monobsico hidratado, pH 7,4; M NaCl; 0,02 M EDTA). 3

3.23. Construccin y anlisis de la genoteca de ADN genmico de D. antarctica Para la construccin de la genoteca genmica es importante destacar los siguientes aspectos: a.- Seleccin del vector. Es decir, un derivado comercial de Lambda al que se le haya eliminado el fragmento central y cuyos extremos (brazos) estn purificados. b.- Digestin del ADN genmico de forma aleatoria. Los fragmentos deben variar entre 12 y 20 kpb, y sern generados por restriccin enzimtica parcial. c.- Separacin del ADN fragmentado por electroforesis en gel de agarosa de bajo punto de fusin. d.- Adaptacin de los extremos de los fragmentos genmicos, para su especfica ligacin al vector y formacin de recombinantes concatemricos. Estos se producen al unirse entre s los extremos de los brazos del vector llamados cohesivos, que poseen 12 nucletidos de cadena sencilla complementarios entre s. d.- Encapsulacin in vitro del ADN recombinante.

3.23.1. Anlisis de la digestin parcial de ADN genmico con la enzima Mbo I.

73

1.- Se mezclan en un tubo Eppendorf de 1,5 ml las siguientes soluciones: 10 g ADN genmico, 15 l Tampn Mbo I (10X), se completa a un volumen de 150 l con H2O estril. 2.- Se mezcla bien y se transfieren 30 l a un primer tubo Eppendorf y 15 l a los 7 tubos restantes. 3.- Al tubo 1 se agregan 4 unidades de la enzima Mbo I, se mezcla bien y se transfieren 15 l al tubo 2. Este procedimiento se repite hasta el tubo 6. El tubo 7 se deja como control sin enzima. Las concentraciones finales de enzima en el tubo 1 es de 2 U/ g de ADN; tubo 2 es de 1 U/ g de ADN y as sucesivamente, conteniendo el tubo 6 una concentracin de 0,00625 U/g de ADN. 4.- Todos los tubos se incuban a 37 C, por una 1 hora. 5.- Se detiene la reaccin con 0,5 M EDTA pH 8, a una concentracin final de 20 mM. 6.- Se comprueban las restricciones enzimticas por electroforesis en gel de agarosa al 0,4 % en TBE a 1 V/cm.

3.23.2. Digestin parcial preparativa y purificacin de fragmentos de 12 a 20 kpb Una vez establecida la concentracin de enzima apropiada para generar fragmentos de ADN genmicos del tamao deseado, se procede a una restriccin de carcter preparativo. Para ello se preparan alcuotas de ADN (25 g) y se digieren con enzima a la concentracin adecuada durante el intervalo de tiempo seleccionado.

74

Se toma una muestra conteniendo 1 g de ADN genmico digerido para anlisis electrofortico y el resto es purificado por extraccin fenol/cloroformo/alcohol isoamlico (25:24:1) y precipitado con etanol. Finalmente el ADN es disuelto en 500 600 l de TE. El aislamiento de fragmentos de ADN de 12 a 20 kpb se realiz por electroforesis en gel de agarosa de bajo punto de fusin. 3.23.3. Modificacin de los extremos de los fragmentos genmicos La modificacin de los extremos de los fragmentos genmicos resultantes de la digestin con Mbo I consiste en su llenado parcial con desoxinucletidos (dGTP y dATP), con el objeto que pierdan su complementariedad y slo puedan ligarse con el vector de clonaje. Para ello se sigui el siguiente protocolo: 1.- Se mezcla en un tubo Eppendorf 5 l tampn de rellenado parcial 10X [0,5 M Tris.HCl, pH 7,2; 0,1 M MgSO2;1,0 mM DDT; 10,0 mM dATP; 10,0 mM dGTP; BSA acetilada (500 g/ml)], 18 l (10 g) fragmentos de ADN genmico 12-20 Kb, 2 l Fragmento Klenow del ADN polimerasa (5 U/l), se lleva a un volumen final de 50 l con agua estril y se incuba a 37 C durante 30 min. 2.- La reaccin se detiene con EDTA 20 mM de concentracin final y se hace una extraccin fenol/cloroformo y precipitacin con etanol. 3.- El ADN es disuelto en 30 l de H2O.

3.23.4. Ligacin del ADN genmico digerido al vector GEM-12 La ligacin se realiz una relacin molar de 1:1, fue la que dio mejores resultados entre las ensayadas.
75

1.- En un tubo Eppendorf de 0,5 ml, se prepara la siguiente mezcla de reaccin: 1 l GEM-12 digerido con Xho I (0,25 ng/l); 4 l ADN genmico 12-20 kb (35 ng/l); 1,0 l Tampn T4 ADN ligasa (con 10 m M ATP) (10X); 1,0 l T4 ADN ligasa (1U/l) y 3,0 l de H2O estril (volumen final de 10 l). 2.- Se mezcla bien sin provocar burbujas de aire y se incuba 12 horas a 4 C. Se puede suplementar la reaccin con 0,5 l de T4 ADN ligasa y proseguir incubando otras 6-7 horas. 3.- Se verifica el resultado de la ligacin mediante electroforesis en gel de agarosa al 0,7 % en TBE de una alcuota de 1 l. Con el resto de la mezcla de ligacin se procede al encapsidamiento in vitro.

3.23.5. Titulacin de la genoteca 1.- Se prepara una serie de diluciones de 103, 5 x 103, 104 y se mezclan con clulas preparadas para la siembra de la cepa KW251 o LE392. El proceso de infeccin y crecimiento de los fagos se realiza igual que en el Apartado 2.3.1.2. 2.- El nmero de placas de lisis en cada dilucin permite calcular el nmero de fagos infectivos que existen por g de ADN, o sea, el ttulo de la genoteca. A continuacin se da un ejemplo de clculo: si hay 20 placas de lisis por placa desde una dilucin 1:10.000 y el volumen de plaqueado ha sido 0,1 ml cul es el ttulo en unidades formadoras de placa (pfu/ml)?

Formula: nmero de placas x factor de dilucin

= pfu/ml
76

Volumen del extracto plaqueado 20 placas x 10.000/0,1 ml Recombinantes /g ADN = 2 x 10 6 pfu/ml 1g/ml = 2 x 10 6 recombinantes/ g ADN = 2 x 10 6 pfu/ ml pfu/ ml Conc. ADN de vector empaquetado

3.23.6. Anlisis de la genoteca La sonda radiactiva utilizada fue un fragmento de ADN que corresponde a una porcin interna de un gen que codifica para DHN. 1.- Se infectan clulas de siembra KW251 con 10 4 pfu/placa de Petri. Se incuban invertidas a 37 C hasta que las placas de lisis alcancen un tamao aproximado de 1,5 mm de dimetro (12-18 horas). Es importante utilizar placas de agar bien secas para prevenir la difusin de los fagos. 2.- Se enfran las placas durante 5 min a 4 C, para dar consistencia al agar de cobertura. 3.- Se toman dos rplicas por placa de Petri colocando las membranas en contacto con la superficie de la placa por la parte central y dejando que el resto se deposite suavemente. 4.- Se deja la membrana en contacto con el agar durante 1 min para la primera rplica y 2 min para la segunda. Es importante que estn bien orientadas con el fin de identificar posteriormente su posicin original.

77

5.- Las membranas se retiran de las placas de agar con pinzas, evitando adherir restos de agar. Se dejan secar 15 min a temperatura ambiente. 6.- Se desnaturaliza el ADN contenido en las rplicas, sometiendo las membranas durante 2 min a 100 C, y posteriormente fijacin del ADN por incubacin a 80 C, 2 horas. 7.- La prehibridacin, hibridacin y exposicin a pelcula autorradiogrfica, as como las disoluciones empleadas en cada una de estas etapas, se desarrollan igual que en el caso de membranas de nylon provenientes de una transferencia Southern.

3.24. RT- PCR (Reverse Transcription-Polymerase Chain Reaction) Se utiliz THERMOSCRIPT RT-PCR System de GIBCO BRL y las etapas realizadas fueron las siguientes: 1.-Se pone en un tubo de 0,2 0,5 ml lo siguiente: 1 l de oligo (dT) 50M, ,5l de ARN (4,0g), 2 l de dNTPs (10 mM) y se completa a un volumen de 12 l con agua tratada con DEPC. 2.- Se incuba a 65 C por 5 min y se incuba a 4C (sobre hielo). 3.- Se mezcla bien el Buffer de sntesis de ADNc 5X (250 mM Tris acetato, pH 8,4; 375 mM Acetato de potasio; 40 mM Acetato de magnesio) antes de usar y se prepara la siguiente mezcla de reaccin por muestra: 4 l Buffer sntesis ADNc (5X), 1 l DTT 0,1M, 1 l ARNsaOUT (40 U/l), 1 l Transcriptasa inversa (15 U/l) y 1 l H2Otratada con DEPC. 4.- Se pone las muestras en termociclador precalentado a: 43 C 30 min, 99 C 5 min, 5 C 5 min.

78

5.- Se agrega 1 l de ARNsa H y se incuba a 37 C por 20 min. 6.- El ADNc se utiliza para PCR o se guarda a -20 C.

PCR: El protocolo usado es el descrito en el apartado 2.20.2 4. Resultados 4.1. Estudio de la presencia de genes para DHNs en D. antarctica La presencia de genes para DHNs en D. antarctica fue analizada por Southern blot utilizando como sonda un fragmento codificante del gen dhn5 de cebada (Fig. 4). La sonda heterloga hibrid dbilmente con el ADN de D. antarctica (Fig. 8B). Debido a lo anterior y con la finalidad de aumentar al mximo la especificidad en el reconocimiento de genes para DHNs en D. antarctica, se obtuvo una sonda homloga. Los resultados de estas reacciones de PCR fueron visualizadas en gel de agarosa, observndose fragmentos de ADN de diferente tamao a las temperaturas de 48 C y 53 C (Fig. 5). A 57 C no se observaron productos de amplificacin (datos no mostrados). El producto de PCR de aproximadamente 500 pb (Fig. 5) fue clonado en el vector pGEM-T (PROMEGA), secuenciado y comparado con las secuencias depositadas en los bancos de datos (EMBL, GeneBank). Este anlisis mostr que dicha secuencia presentaba semejanza con ARN mensajeros y ADN para DHNs descritas en distintas especies vegetales. Un anlisis ms detallado de la secuencia revel la presencia de un intron entre los nucletidos 134 y 213, por lo que las secuencias comprendidas entre los nucletidos 1 - 133 y 213 - 454

corresponden a la secuencia codificante (Fig. 6). El anlisis de la secuencia codificante sin el intron indic que los porcentajes de identidad con secuencias de DHNs contenidas en el

79

banco de datos EMBL-EBI variaron entre un 87 y 64 % (Tabla II), y corresponden a secuencias de genes que son inducidos por ABA, deshidratacin, estrs hdrico y salino, pero no por fro, con la excepcin de un gen para DHN (AC: U73213.1) que sera inducido por fro, ABA y deshidratacin (Tabla II). Al realizar un alineamiento entre la secuencia nucleotdica de la sonda y genes para DHNs inducidos por fro, se observ un porcentaje bajo de identidad y un gran nmero de inserciones (Fig. 7). El anlisis de la secuencia aminoacdica deducida de 123 aminocidos indic que los porcentajes de identidad variaron entre un 77 y 47 % con secuencias de DHNs que se acumulan en respuesta a deshidratacin, salinidad y ABA (Tabla III). En la secuencia deducida (123 aminocidos) se observaron elementos distintivos que son caractersticos en las DHNs (Fig. 1 y 6), un nmero alto de aminocidos cargados (17 aminocidos con carga positiva y 12 aminocidos con carga negativa) y que correspondera a una DHN bsica con un pI= 9,6. Todas estas caractersticas se han asociado a DHNs que se acumulan en respuesta a estrs hdrico, salino y ABA.

kpb 1

2 3

4 5 Figura 5. Productos de PCR obtenidos con MB1 y MB2. Gel de agarosa al 1 % p/v teido con Bromuro de Etidio. Carril 1 y 2:

2,0

estndar

de peso molecular

Hind III. y ADN

100pb

respectivamente. Carril 3: control negativo PCR. Carril 4-5: 0,6 productos de PCR a 48 C y 53C, respectivamente.

80

GTCCGTTGGC GGGCATGGCG GCATGGGAGG AGCACACGCT GCTCCCGGCA CCGGTGGGCA GTTCCAGCCC AGCAGGGAGC AGCACAAGAC CGGCGGCATA CTGCATCGCT CCGGCAGCTC CAGCTCCAGC TCCGTAAGTG TCTCTGTCCG CTCGGATATA TATGGTTATG ATCGTGCGCT GCGGATACGT TTAGTTTGCG TGCGTTTTTA CAGTCTTCCG ACGAGGACGA CGGCATGGGC GGGAGGAGGA AGAAAGGCAT GAAAGATAAG ATCAAGGAGA AGATTCCTGG TGGCCACAAA GACAACCAGC AGCACATGGC CACGGGGACG GGCGGCACGG GGGCGGGAAT TGATACCTAC GGGCAGCAAG GGCACGAAGG AATGACCGGC ACCGGCACCG GCACAGGCAC AGGCGAGAAG AAAGGACTCA TGGACAAGAT AAGGAGAAGC TCCC

40 80 120 160 200 240 280 320 360 400 440

SVGGHGGMGGAHAAPGTGGQFQPSREQHKTGGILHRSGSSSSSSSSDEDD GMGGRRKKGMKDKIKEKIPGGHKDNQQHMATGTGGTGAGIDTYGQQGHEG

MTGTGTGTGTGEKKGLMDKIRRS

Figura 6. Secuencia nucleotdica y aminoacdica deducida del fragmento genmico aislado desde D. antarctica. (A) Secuencia del fragmento de ADN de 454 pb obtenido por PCR desde ADN genmico de D. antarctica. La secuencia subrayada corresponde al intron
81

(nucletidos 134 213). (B) Secuencia aminoacdica deducida del fragmento de ADN que se indica en (A). En negrita se seala el segmento-S, la lnea punteada indica el segmentoK, la lnea simple indica el segmento-, indica la posicin del intron.

Tabla II. Deshidrinas que presentan identidad con el fragmento de PCR obtenido desde D. antarctica

DHNs AC* Gen X78431.1 (tddeh27) X59133.1 (tarab) X78429.1 (tddeh16) X15290.1 (zmdhn3) AF031248.1 (ledhn) AY177889.1 (sbrab) U63831.1 (sbdhn) AF453444.1 (tadhn) X62476.1 (tarab15b) X15287.1 (hvdhn18) X15289.1 (hvdhn9) X15286.1 (hvdhn17) X72748.1 (hvdehyd) X15288.1 (hvdhn8) U11696.1 (sbdhn) AF181459.1 (hvdhn) X15994.1 (zmrab15g) X57327.1 (osrab25) X52423.1 (osrab16b) Y00842.1 (osrab21) X52424.1 (osrab16d )

Especie vegetal T.durum T.aestivum T.durum Z. mays L. elongatum S. bicolor S. bicolor T. aestivum T. aestivum H. vulgare H. vulgare H. vulgare H. vulgare H. vulgare cv Morex S. bicolor H. vulgare Z. mays O. sativa O. sativa O. sativa O. sativa

Induccin Deshidratacin ABA Deshidratacin ABA Estrs salino ABA Deshidratacin Estrs hdrico ABA ABA y estrs Hdrico ABA y ests hdrico ABA y estrs hdrico ABA ABA y estrs hdrico ABA y estrs hdrico Deshidratacin ABA ABA ABA Estrs hdrico ABA y estrs

% Identidad (n en negrita) [88,7] 79 ( 237) [89,4] 87 (233) [76,5]70 (370) [78,3]72 (315) [75,0]70 (364) [76,0 ]70 (336) [78,0]73 (293) [76,0]72 (300) [74,5]69 (340) [78,0]73 (246) [74,8]70 (288) [75,0]70 (288) [79,6]74 (233) [75,0]70 (272) [80,0]76 (214) [80,0]74 (237) [74,0]71 (189) [70,6]65 (259) [75,8]76 (131) [83,5]80 (123) [68,4]67 (192)
82

X52422.1

(osrab16b)

O. sativa B. crassifolia H. vulgare H. vulgare T. aestivum L. elongatum L. elongatum

AY243045.1 (bcdhn) AF043092.1 (hvdhn) AF043090.1 (hvdhn) U73213.1 (tadhn) AF031250.1 (ledhn) AF031249.1 ( ledhn)
AC: Accession number

hdrico ABA y estrs hdrico Deshidratacin Deshidratacin Deshidratacin Fro, ABA y deshidratacin Estrs salino Estrs salino

[70,0]68 (173) [76,8]70 (197) [74,3]70 (182) [75,0]73 (149) [69,5]65 (222) [69,0]64 (222) [70,0]64 (205)

[] : % de ungapped () : n de nucletidos idnticos

Tabla III. Porcentajes de identidad entre la secuencia aminoacdica deducida de 123 aminocidos con algunas DHNs disponibles en la base de datos internacionales. Protena (AC)* Deshidrina DHN9 (Q9ZTR3) Deshidrina RAB 16C (P22912) Deshidrina RAB 15 (Q00742) Deshidrina DHN1 (P12951) Deshidrina -/LEA grupo 2 (064940) Deshidrina 7 (Q9ZTR4) Deshidrina RAB21 (P12253) Deshidrina DHN4 (P12949) Deshidrina WZY1-1 (Q8W192) Deshidrina DHN3 (P12948) Deshidrina RAB 16D (P22913) Identidad % 77.293 68.939 69.828 67.717 66.412 60.645 64.662 61.157 64.286 66.429 53.968

DHN9, DHN7, WZY1-1, se acumulan en respuesta a deshidratacin. RAB16C, RAB15, DHN1,RAB21 DHN3, RAB16D, se acumulan en respuesta a estrs hdrico y ABA . Deshidrina/LEA se acumula en respuesta a estrs salino. * Accession number 83

Base de datos utilizada Swall con el programa FASTA3.

DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5

tataaatagtgccgcgtgctgcacatacttcacacaaccaacgcaagtaaacagcttaac -----------------------------------------------------------agcagcgcttgtagatattcccgagtgagaggctcagcgcaagatggagcaccaggcaca -----------------------------------------------------------cgtcgccggcgagaagaagggcatcatggagaagatcaaggagaaactccccggcggcca -gtc-c--------------g--t--tg-----g-----------------cgg-----*** * * * ** * *** cggtgaccacaagcaggccgctgacacccacggccagcaggggcacgccggcacggggac ---------------g------------ca----------tgg--cg------------* ** ** ** gcatggtgccccggccactggtggcgcctatgagcagcagggtcgcaccggagtcaccgg gcat-------------------g------------g---------------g--a---**** * * * * cacggggttgaatggcgctgatgccggcgagaagaagggcctcatggagaagatcaagga ---gg------------------------------a-g--c------------------a ** * * * * caagctccctggtggccacggtgaccagcagaccacggctatgggcagcagggacacacc cacgct---------------------gc------------t---c------------cc ** *** ** * * ** ggcaccgcggcgcatggcaccccggccggcggcggcacctatgaccaggagggacacacc ggcacc---------g-------g--tg-----ggcagtt----cca------------****** * * * **** * *** gggatgtctggcatgggggcgcacgacacccacaccacgggcggcgcctatgggcagcat -----g-c-----------c------------cagca---g-gg-----a---gca---* * * ** ** * ** * *** gcacacaccggagggaccggcacggggacgcacggcaccggcgagaagaagggcgtcatg gcaca------a-------------g----------accggc-----------------***** * * ****** gagaacatcaaggacaagcttcctggtggccacggtgatcatcagaagacgagtgacacg g-g-----ca-------------t-----------------------------------* * ** * tacgggcaccaggaagacaccgaaatgactggcatggggaggcatagcacccctgccacc ---------------------------act--------g-----------------ca-*** * ** ggcggttcctatgggcagcatgtcacacggacagaccgacatgggaacacacggcaccgg ------t--------c-g---------c------tccggca------------gc-ccag * * * * *** ** ** ** * cgagaagaagggtgtaatggagaacatcaaggataagctccccggtggtcatgatgacca c-------------t--------cc----------agctcc------------------* * * ****** ccagaagactgctggcacctacgggcagcagggacacgtcggcacgggcacacatggcac ---g---------------t---------------------------------------* * ccccgccactggcggcgcctacggacaacatgaacacaccggagcgaccggcactggaac --------ct-------tc-------------------------cga-cg----agg--** * *** ** ** gtacggcactggcgagaagaagggcatcatggagaacatcaaggagaagctccctggtgg --ac------g---------a------c---g-g--cat-----------------g--** * * * * * *** * ccacggtggccaccagaagaccggcgacacctacgggcaccaggaagacaccaaaatgac ----gg---------------------------cggg-aggaggaag-----aaa----** **** * ****** *** tggcatggggaggcatagcgccccggccaccggcggctcctatgggcagcatgcacacac

84

Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda

-ggcat-----------------------------------------------------***** cggagagaccggcacggggacacacggcaccggcgagaagaagggtgtaatggagaacat ------------------------------------------------gaaagataagat * ** ** ** caaggaaaagctccctggtggccatgatgaccaccagaagactgctggcacctacgggca caaggagaagattcctggtgg------------cc---a---------ca---aag---a ****** *** * ******** ** * ** * * * gcagggacacgtcggcacggggacacatggcacccccgccactggcggcgcctacgggca ---------------c------a---a-----------------------cc----agca * * * ** *** gcatgaacacaccggagcgaccggcactgaaacgtacagcaccggcgagaagaagggcgt gc---------------------------------------------------------** catggaaaacatcaaggagaagctccccggtggccacggagaccaccagcagacaggtgg -----a------ca----------------t-------g---------gc---------* ** * * ** catctacgggcagcaagcacacgtcggcacgggacgcatgacacgccggccaccggcggc c----acgggg-----------------acggg-cg---g-cacg--------ggg---* ***** ***** ** * **** ** acctacgggcagcacggacacaccggagtgccggcactgggacgcacggcaccggcgaaa ------g-------------c-----------------gg-------------------* * ** gaagggtgtcatggagaacatcaaggagaagctccccggtggccacagtgaccaccagca ga-----------------at--------------------------------------** ** taccactgagacctacgggcagcatcggcacactggagtggccggcacggagacgcatgg ------tgatacctacgggca------gca-a------------g-------------gg *** *********** *** * * ** caccacggccactggcggcacctacgggcagcaggcacagaccggcacgactggcgctgg cacga-----a--gg---------------------aatgaccggc---------accgg *** * * ** * ******* * ** cacacacggcaccgacggcacgggcgagaagaagagcctcatggacaagatcaaggacaa cac---cggcaca---ggcacaggcgagaagaaaggactcatggacaagat-aaggagaa *** ****** ***** *********** * ************** ***** ** gctgcctggacagcacta gct-cc-------c---*** ** *

DHN5 Sonda DHN5 Sonda DHN5 Sonda

DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda DHN5 Sonda

DHN8 Sonda DHN8 Sonda DHN8 Sonda DHN8 Sonda DHN8 Sonda DHN8 Sonda DHN8 Sonda DHN8

tatataaggacgagtcatagcttgggcaccttcatcattcagaaagccacaagccaagaa -------------------------------------gtc------c----------g-** * * ccaatagtctttgctgatccgctgttttctctagctcccacgagtctttagctgcaccga -----------t--tg--gcg------------g-------g---c---a--t------* ** ** * * * * * ccgatctcgatcatggaggatgagaggagcacccagtcataccagggagctgaggcgatc --g---gc------g--gcatgggaggagcacacgct----------------------* * * * *** ********* * * aggtggaggtgacggacaggggcctactcggcaacctcctcggcaagaagaaggaggagg -------gct------------cc----cggca------cc------------------* * ** ***** * aggacaagaagaaggaggaagagctggtcaccggcatggagaaggtctccgtggaagagc --------------g-----g---tg------ggc----a----g--ttc----cag--* * ** *** * * * * ** ccgaggttaaggaggatggcgagaagaaggagactctcttctccaagctgcaccgatcca ccca-g--cag--gga-g--cagcaca---agac---cggcggcatactgcatcgctccg ** * * ** *** * ** * * **** * * ** ***** ** *** gct--ccagctccagctc-gtctagtgacgaggaggaggaggaggaggtcatcgatgaga gcagcccagctccagctccgtc---ttccgacgaggacgacg----g--cat------g** ************* *** * *** ***** ** * * *** * acggtgaggtgatcaagaggaagaagaagaagggtctcaaggagaagctcaaggagaagc

85

Sonda DHN8 Sonda DHN8 Sonda DHN8 Sonda DHN8 Sonda DHN8 Sonda

--gg---cggg---aggaggaagaa-a-----ggcatgaaagataagatcaaggagaaga ** * * * ********* * ** * ** ** *** *********** tgcccgg---ccacaaggacaacgaggctgagcacgtgacgggcctacccgcaccgatgg ttcctggtggccacaaagacaaccag---cagcac---------------------atg* ** ** ****** ****** ** ***** *** cccccgcgtctgttcagactcaccatgacaccgacgtcgtcgtcgagaagatcgacggcg -----gc--c-----------------ac--------------------------ggg-** * ** ** acgcgaagacagaggccacaccggcagtgcccgaggagg-agaa-gaaaggcttcttgga -------gacgg--------gcggca----cgggggcggga-attgata-cctac--gg*** * ***** * * ** ** * * ** * ** * ** aaagatcaaggagaagctgcccggcggccacaagaagccggaggacgctgccgcggtgcc gcag--caagg----------------------gca--cgaagga--------------** ***** * * ** **** cgtcacgcacgctgctccagcgccagtgcacg-cgcctgcgccggccgccgaggaggtga ------------------------a-tgaccggcaccggcaccgg----c-a-cag---* ** ** * ** ** **** * * ** gcagcccggacgcgaaggagaagaagggcctactgggcaagatcatggacaagctgcccg ---gcacaggc------gagaagaaagg---ac---------tcat-g-------g---** * * * ******** ** ** **** * * gttaccacaagacaggggaggaggacaaggccgccgccccttcaggcgagcacaagccca ------acaagataag---g--aga------------------ag-------c--tccc****** * * * ** ** * *** gagcttga --------

DHN8 Sonda DHN8 Sonda DHN8 Sonda

Figura 7. Alineamiento entre la secuencia nucleotdica de la sonda con secuencias nucleotdicas de genes para DHNs inducidos por fro ( dhn5 y dhn8 de H vulgare) * indica las identidades y -las inserciones. Se utiliz el programa T-Coffee (Notredame et al. 2000).

El revelado de la pelcula autoradiogrfica mostr que la sonda heterloga a pesar de largos tiempos de exposicin era incapaz de dar seales de reconocimiento que fueran distinguibles en el ruido de fondo de la membrana. En cambio, la sonda homloga detect bandas claras en un periodo corto de exposicin, sugiriendo la existencia de distintos genes para DHNs (Fig. 8A). Tales resultados, hicieron interesante considerar la posibilidad de

86

encontrar los genes para DHNs desde una genoteca genmica utilizando para ello la sonda homologa.

4.2. Construccin de genoteca de ADN genmico de D. antarctica Los fragmentos genmicos fueron obtenidos para su clonaje mediante restriccin con la enzima Mbo I que reconoce una secuencia compuesta por 4 pb, lo cual hace que ella tenga una frecuencia estadstica de restriccin cada 256 pb. Antes de iniciar los ensayos de restriccin con Mbo I se procedi a comprobar la integridad del ADN genmico para asegurar que el tamao medio fuera apropiado, es decir, no fuera daado por cizallamiento durante su preparacin. Una vez confirmada que en las preparaciones predominaban los tamaos iguales o superiores a 100 kpb, se realiz la cintica de restriccin del ADN genmico con el objeto de obtener poblaciones mayoritarias de fragmentos entre 12 20 kpb. Las condiciones de restriccin parcial se determinaron mediante digestiones analticas con diferentes concentraciones de enzima y su posterior anlisis electrofortico en geles de agarosa al 0,4 %. De acuerdo con estos resultados se consider que la relacin 0,031 unidades/g de ADN era la que proporcionaba una mayor cantidad de fragmentos entre tamaos deseados (Fig. 9). Una vez establecidas las condiciones de restriccin parcial se procedi a una digestin preparativa de 50 g de ADN genmico de D. antarctica. Los fragmentos de ADN del tamao deseado fueron purificados desde un gel de agarosa de bajo

87

punto de fusin al 0,4 %. Mediante este procedimiento se obtuvieron 6,3 g de ADN genmico de tamao comprendido entre 12 y 20 kpb (Fig. 10).

A
kpb 1
23,1 9,4 6,5 4,3 2,3 2,0 0,5

B
2 3 4 5 6 kpb
23,1 9,4 6,5 4,3 2,3 2,0 0,5

Figura 8. Anlisis Southern blot de ADN genmico de D. antarctica, utilizando las sondas homloga y heterloga. Autorradiografa de las hibridaciones con A) sonda homloga y B) sonda heterloga. Los carriles 1 al 6 corresponden a los productos de las digestiones con las enzimas de restriccin: Bam H I, Himd III, EcoRI, Xba I, Xho I y Nde I, respectivamente.

88

kpb 1

23,1 9,4 6,5

Figura 9. Digestin analtica parcial del ADN de D. antarctica con MboI. La concentracin de enzima que proporciona una poblacin de entre 12 y 20 Kb es de 0.031 U de MboI/g de ADN. Los carriles indican las concentraciones de MboI usadas en la digestin parcial. 1) estndar Hind III; 2) 1U MboI/g ADN; 3) 0,5 U MboI/g ADN; 4) 0,25 U MboI/g ADN; 5) 0,125 U MboI/g ADN; 6) 0,0625 U MboI/g ADN; 7) 0,031 U MboI/g ADN; 8) 0,0156 U MboI/g ADN.
89

Kpb

23,1 9,4 6,5 4,3

Figura 10. Fraccionamiento por tamao del ADN de Deschampsia antarctica parcialmente digerido con MboI. El ADN entre 12 y 20 Kb se recuper desde geles de bajo punto de fusin al 0,4 %. Los fragmentos de gel se fundieron y se pasaron por columnas NACS. El carril 1) Estndar Hind III; 2) y 3) ADN parcialmente digerido con MboI con un tamao entre 12 y 20 Kb.

90

4.3. Clonaje de los fragmentos genmicos Los extremos sobresalientes Mbo I de los fragmentos genmicos de 12 20 kpb requieren ser parcialmente llenados para que sean compatibles con los extremos Xho I modificados del vector. Una vez realizada la reaccin de llenado parcial de los extremos Mbo I de los fragmentos genmicos, se procedi a realizar pruebas analticas de ligacin con el vector a diferentes relaciones molares. Con la relacin 1:1 se obtuvo los mejores resultados (Fig. 11). La mezcla de ligacin (10 l) se utiliz ntegramente en la reaccin de encapsidacin in vitro. Se procedi a infectar clulas E. coli KW-551 obtenidos de la encapsidacin y E. coli LE-392, con fagos molar (vector: inserto) de

in vitro. En ambos casos el ttulo de la genoteca fue

determinado considerando el nmero de placas de lisis y la dilucin realizada. Se observ mayor eficiencia en la cepa E. coli-KW251, con la que se alcanz un ttulo de 7,4 x 10 6 recombinantes/g de ADN. A la genoteca genmica se le adicion dimetilsulfxido (DMSO) a una concentracin final de 7 % v/v y se guard a 80 C. Para comprobar la representatividad de los clones, se realiz un control de 10 de ellos elegidos al azar. Se obtuvo ADN de cada uno de los clones mediante midipreparaciones y se someti a restriccin con EcoR I. Los fragmentos resultantes de la restriccin enzimtica fueron resueltos mediante electroforesis en geles de agarosa al 0,7 %. Los resultados mostraron que el patrn de restriccin de cada uno de los clones era diferente (no se muestra). De esta forma se comprob que la genoteca genmica era representativa para D. antarctica.

91

4.4. Anlisis de la Genoteca Se procedi a sembrar clulas de la cepa KW-251 de E. coli infectadas con fagos de la genoteca genmica a una densidad de 104 pfu por cpsula de Petri de 90 mm de dimetro. El sondeo se realiz sobre filtros de nitrocelulosa por duplicado y con la sonda homloga marcada radiactivamente con dCTP-32P. Se sondearon aproximadamente 100.000 fagos, detectndose 25 seales dbiles positivas que deban ser confirmadas. Se aislaron las placas de lisis de la zona donde aparecan las seales positivas, se eluyeron los fagos en medio TM y se volvieron a infectar y sembrar clulas KW251. Posteriormente los fagos fueron aislados y su ADN purificado para ser analizados por PCR con los partidores degenerados. Los productos de esta reaccin de PCR fueron separados en elecetroforesis en gel de agarosa al 1 %, transferidos a membrana de nylon e hibridados con la sonda homloga para Dhn. Seal positiva fue observada con los fagos: 5, 15, 19, 20 y 21. El anlisis de los clones aislados no se concluy, principalmente por razones de tiempo, quedando pendientes la secuenciacin y el anlisis de stas. La gran probabilidad de que sean genes para DHNs, ofrece la posibidad de responder a la pregunta qu factores estran regulando la expresin de los genes que codifican para DHNs en D. antarctica?

92

kpb 1

2 3

5 6

23,1

9,4 6,5

Figura 11. Ligacin ADN D. antarctica a GEN-12. Gel de agarosa al 0,6 % p/v con bromuro de Etidio. Se muestran los productos de ligacin del ADN semirellenado de D. antarctica con los brazo del vector GEN-12.Carril 1: estndar Hind III. Carril 2, 4 y 5: productos de la ligacin en las proporciones 1:2, 2:1 y 1:1, respectivamente. Carril 3 y 6: Control de ligacin.

93

4.5. Anlisis de la expresin de genes para DHNs en D. antarctica por las tcinas de Northern y Western blot La expresin de genes para DHNs fue estudiada por la tcina de Northern blot

tilizando una sonda homloga para DHNs El marcaje de la sonda se hizo por el mtodo Radom primer con la finalidad de obtener fragmentos marcados que correspondieran a regin codificante para deshidrina, ya que el fragmento completo contiene 79 pb que corresponden a un intron. Una segunda forma de analizar la expresin de genes para DHNs fue estudiando la acumulacin de sus productos, es decir, las protenas (DHNs). La acumulacin de DHNs se determin por Western blot usando un

anticuerpo policlonal anti-DHNs.

4.5.1. Anlisis de los Northern blot Uno de los requisitos para hacer Northern blot es contar con un ARN en excelentes condiciones (Fig. 12). Los ARN total fueron extrados desde plantas sometidas a distintos tratamientos: a) plantas aclimatadas a 4 C durante periodos cortos (24horas) y periodos largos (21 das) a dos fotoperodos, 16/8 y 21/3 luz/oscuridad respectivamente. La eficiencia fotoqumica del PSII de las plantas aclimatadas a 4 C con respecto a las control a 15 C no se vio alterada por los cambios de temperatura (Muoz 1998), permaneciendo las plantas en buenas condiciones durante los experimentos (Fig. 13), b) estrs salino (NaCl 500 mM, fotoperodo 21/3 luz/oscuridad), c) estrs osmtico (24 % p/p PEG, fotoperodo 21/3 luz/oscuridad y d) cido abscsico 100 M, fotoperodo 21/3 luz/oscuridad).

94

28S 18S 5.8S

Figura 12. Calidad de ARN total purificado. Gel de agarosa al 1,2 % p/v con formaldehdo que muestra ARN total aislado (mtodo de Chomczynski) desde D. antarctica. Se cargaron aproximadamente 15 g de ARN por carril. A la izquierda se indican los ARN ribosomales.

95

Figura 13. Plantas de D. antarctica a distintas temperaturas. Las plantas permanecieron 21 das a 15 C (A) y 4 C (B)

96

1h

2h

4 h 10h 1d

2d 4d

6d

8d

10d 14d 18d 21d

Figura 14. Autoradiografa de membrana con ARN de D. antarcica aclimatada a temperatura baja. El ARN se extrajo a distintos intervalos de tiempo desde plantas mantenidas a 4 C durante 21 das. Cada carril se carg con 15 g de ARN total. La sonda homloga se marc radiactivamente por la tcnica de PCR. A) plantas bajo un fotoperodo de 16/8 horas de luz/oscuridad. B) plantas bajo un fotoperodo de 21/3 horas de luz/oscuridad. C) control de carga, ARN ribosomal 18S.
97

4.5.2. Anlisis de la expresin de genes para DHNs en condiciones de temperatura baja Se evalu la acumulacin de mensajeros para DHN en plantas mantenidas a 4 C en periodos cortos (24 horas) y largo (21 das), a dos fotoperodos, 16/8 y 21/3 luz/oscuridad. Los anlisis Northern blot se realizaron con la sonda marcada con dCTP-32P utilizando el mtodo de Random primer. En los tratamientos a 4 C no se detectaron seales para transcritos de DHNs en ninguno de los fotoperodo ensayados (Fig. 14).

4.5.3. Anlisis de la expresin de genes para DHNs en condiciones de estrs salino y osmtico La acumulacin de transcritos para DHNs en plantas de D. antacrtica bajo tratamiento con NaCl y PEG se determin durante un perodo de 24 horas. La hibridacin de las membranas se hizo con la misma sonda que se empleo para la deteccin de transcritos en plantas mantenidas a 4 C. En plantas bajo estrs salino a la hora se observ un transcrito de 1,6 kb, ste aument hasta llegar a un mximo a las 10 horas y disminuy su expresin considerablemente a las 24 horas de tratamiento (Fig. 15). En las plantas bajo estrs osmtico se observ a la hora de transcurrido el tratamiento un transcrito de 1,6 kb, la acumulacin de ste fue muy superior a la observada en las plantas tratadas con NaCl
98

durante el mismo periodo, diminuyendo considerablemente su acumulacin a las 5 horas, detectndose hasta el trmino del tratamiento (Fig. 15). En ambos tratamiento la seal detectada correspondera al constitutiva. 4.5.4. Anlisis de la expresin de genes para DHNs por tratamiento exgeno con ABA. La respuesta de genes para DHNs a la aplicacin de cido abscisico (ABA) exgeno, se evalu aplicando una concentracin de la hormona de 100 M durante un periodo de 24 horas a 15 C y con un fotoperodo 21/3 horas de luz/oscuridad. Al exponer las plantas a la hormona se observ un transcrito de 1,0 kb una hora despus de comenzado el experimento, seal que se intensifica a las 10 horas y que se debilita notoriamente a las 24 horas (Fig. 16). Este transcrito responde especficamente a ABA, sugiriendo que en D. antarctica, existen diferentes genes de la familia de las DHNs dependiente e independiente de ABA. cuya expresin sera mismo transcrito para deshidrina y su expresin no es

99

PEG 1,6 Kb NaCl 1,6 Kb

18S ARNr

10

24 (h)

Figura 15. Deteccin de transcritos para DHNs por Northern blot bajo estrs osmtio y salino. El ARN se obtuvo desde plantas tratadas con NaCl (500 m M) y PEG (-1.2 MPa). Cada tratamiento se aplic por un perodo de 24 horas. Las plantas se mantuvieron a 15 C y con un fotoperodo 21/3 horas luz/oscuridad. C (control): plantas no tratadas. En la parte inferior control de carga, ARNr 18S.

100

ABA 100 M 1,0 Kb

ARNr 18S

10

24 (h)

Figura 16. Deteccin de transcritos para DHNs por Northern blot en D. antarctica tratadas con ABA exgeno. El ARN se obtuvo desde plantas tratadas con una concentraciones de ABA (100 M). El tratamiento fue por un perodo de 24 horas, a 15 C y con un fotoperodo 21/3 horas luz/oscuridad. C (control): plantas no tratadas. En la parte inferior control de carga, ARNr 18S.

101

4.6. Anlisis de la expresin de genes para DHNs en condiciones de estrs para temperatura baja, salinad y ABA por RT-PCR. Debido a que el fragmento obtenido por PCR desde ADN de D. antarctica contiene un intron y su presencia limitaba su utilizacin a los anlisis Southern, se hicieron RT-PCR con partidores degenerados para DHNs con la finalidad de amplificar ADNc para DHNs desde plantas mantenidas a 15 y 4 C, con el propsito de emplearlos como sonda en los anlisis Northern. Los RT-PCR realizados no arrojaron resultados positivos (Fig. 17 A). Tambin se buscaron transcritos para DHNs en plantas tratadas con 100 M ABA y tratadas con 500 mM NaCl. En los ensayos realizados en plantas con tratamiento salino y ABA exgeno se observ claramente un producto de amplificacin de aproximadamente 400 pb, ste resultado confirmaba lo observado en los Northern blot de plantas en tratamiento salino y con ABA (Fig. 17 B).

102

A
kpb 1
23,1 9,4 6,5 4,3 2,3 2,0

B
2 3 4 5 kpb
23,1 9,4 6,5 4,3 2,3 2,0

1 2 3 4

0,5 0,5

Figura 17. Deteccin de ARNm por RT-PCR en D. antarctica bajo tratamiento salino, ABA y fro. El ARN total se obtuvo desde plantas tratadas a 4 C, con NaCl (500 m M) y ABA (100 M). La sntesis de ADNc se realiz utilizando los primer MB1 y MB2. A) RTPCR con ARN total aislado de plantas sin tratamiento, mantenidas a 15 (3); 4 C por 1 da (4) y 7 das (5). Marcador de peso molecular Hind III (1); control negativo (2). B) RTPCR desde plantas tratadas con NaCl (3) y ABA (4) a las 10 horas de tratamiento, respectivamente. Los productos de amplificacin fueron separados en un gel de agarosa al 0,7% y visualizados por tincin con bromuro de Etidio.

103

4.7. Anlisis de la expresin de deshidrinas en D. antarctica sometidas a distintos estrs por Western blot. 4.7.1. Anlisis de la expresin de DHNs en D. antarctica por tratamiento con temperatura baja. La cintica de acumulacin para DHNs en plantas sometidas a temperatura baja (4 C) fue la nica que se realiz por un perodo de 21 das. Los dems anlisis se realizaron por un perodo de 4 das. En las plantas tratadas con temperatura baja se observ la

acumulacin de seis DHNs con una movilidad relativa (Mr) de 58, 53, 48, 30, 28 y 25 kDa. Las protenas con Mr 58, 53 y 48 kDa se detectaron dbilmente a las 5 horas de

comenzado el tratamiento. Despus de las 5 h stas se hacen ms notorias hasta el da 21 del tratamiento. Durante la cintica de acumulacin de las DHNs, se observaron dos mximos, a los 2 y 18 das de tratamiento. Adems, en el da 14 se observaron tres DHNs de tamao menor (30, 28 y 25 kDa), hacindose ms evidente al da 18 para disminuir en el da 21 (Fig. 18).

4.7.2. Anlisis de la expresin de DHNs en D. antarctica por tratamiento de deshidratacin. El efecto de la deshidratacin sobre la acumulacin de DHNs en D. antarctica se determin dejando las plantas expuesta al aire por un perodo de 4 das. Junto con determinar la cintica de acumulacin de las DHNs a tiempos definidos, se midi en cada punto el contenido relativo de agua (CRA). Los resultados muestran la presencia de cuatro DHNs, 58, 53, 48 y 30 kDa respectivamente. Las cuatro protenas se observaron

104

dbilmente a las 10 horas de comenzado el tratamiento, un aumento importante se detect a los 2 das para decaer al cuarto da (Fig. 19). Los CRA durante el tratamiento variaron desde un 76 % (tiempo cero) a un 24 % (4 das de deshidratacin). El anlisis estadstico indic que se produjeron diferencias significativas (p = < 0.001) en los CRA entre las controles (tiempo cero) y a 1, 2 y 4 das de tratamiento (Tabla IV), indicando una coincidencia entre la disminucin en el CRA en acumulacin de DHNs. las hojas de D. antarctica y la

kDa St
175 85 62 48 32 25
58kDa 53 48 30 28 25

1h

2h

10h

1d

2d

4d

10 d

14 d

18 d

21d

Figura 18. Acumulacin de DHNs en hojas de D. antarctica durante tratamiento a temperatura baja. Las protenas (10 g) se corrieron en un gel denaturante de
105

poliacrilamida, las protenas se transfieren a una membrana de nitrocelulosa. La deteccin se hizo con un anticuerpo anti-DHN. A) PAGE-SDS teido con azul de Coomasie, B) Western blot. C (control): planta no tratada; h: horas; d: das. A la izquierda se indican los tamaos de las protenas en kDa. kDa St
175 85 62 48 32 25
58kDa 53 48 30

1h

2h

5h 10h

1d

2d

4d

Figura 19. Acumulacin de DHNs en hojas de D. antarctica en respuesta a deshidratacin. La parte superior PAGE-SDS con 10 g de protenas teidas con azul de Coomasie. Parte inferior Western-blot a la izquierda estndar peso molecular. C: control (plantas no tratada); h: horas; d: das.

106

Tabla IV. Contenido relativo de agua (CRA) en plantas de D. antarctica durante el tratamiento de deshidratacin.

TIEMPO (H) 0 (Control) 1 2 5 10 24 48 96

CRA 0,76 0,74 0,70 0,65 0,52 0,44 0,37 0,24 0,02 0,02 0,07 0,02 0,04* 0,11* 0,09* 0,05*

El CRA se determin por triplicado (n=3). Se aplico una ANOVA de una va. Test de TUKEY con un p 0,05. *: Hay diferencias significativas con respecto al control.

107

4.7.3. Anlisis de la expresin de DHNs en D. antarctica por tratamiento salino. El efecto del NaCl sobre la cintica de acumulacin de DHNs se determin utilizando cuatro concentraciones distintas, 0,25 M, 0,5 M, 0,75 M y 1 M, respectivamente. El anticuerpo anti-DHN detect ocho protenas, cuya acumulacin temporal dependi de la concentracin de NaCl utilizada. Cuando las plantas se sometieron a 0,25 M se observ una DHNs con Mr de 58 kDa (Fig. 20). La protena de 58 kDa se detect dbilmente a 1 da de comenzado el ensayo, aumentando su acumulacin progresivamente hacia al trmino del tratamiento (Fig. 20). En las plantas tratadas con una solucin 0,5 M NaCl, el anticuerpo anti-DHN detect seis protenas con Mr de 58, 55, 53, 48, 30 y 28 kDa, respectivamente (Fig. 20). La protena de 58 kDa se detect dbilmente a las 2 horas de comenzado el tratamiento, su acumulacin fue en aumento progresivo hasta el da 2, para disminuir levemente al trmino del tratamiento (4 da). Las protenas con Mr de 55, 53 y 48 kDa se detectaron dbilmente a las 10 horas de comenzado el tratamiento, observndose un aumento en la acumulacin a los 2 das y despus una leve disminucin. Con respecto a las protenas de menor Mr, stas slo se detectaron al cuarto da del tratamiento (Fig. 20). Las plantas tratadas con una solucin de NaCl 0,75 M se observaron seis protenas con Mr de 58, 55, 53, 48, 30 y 28 kDa, respectivamente (Fig. 21). La protena con Mr de 58 kDa se detect en forma temprana, a la hora de comenzado el tratamiento. Esta se mantuvo en niveles relativamente constantes hasta las 10 horas, para aumentar su acumulacin notoriamente a las 24 horas, alcanzando un mximo al cuarto da. Las protenas de 55, 53,

108

48, 30 y 28 kDa respectivamente, aparecieron dbilmente a las veinticuatro horas de exposicin al tratamiento salino, para ir en aumento hasta el da 4 (Fig. 21).

kDa St
175 85 62 48 32 25
58 kDa 55 53 48 30 28

1h

2h 5h 10h 1d 2d

4d

Figura 21. Acumulacin de DHNs en plantas tratadas con solucin de NaCl 0,75 M. La parte superior PAGE-SDS con 10 g teido con azul de Coomasie, e a la izquierda los tamaos del estndar de peso molecular. En la parte inferior Western-blot con anticuerpo anti-DHN, a la derecha los Mr de las protenas detectadas. C: control (plantas no tratadas); h: horas; d: das, St: estndar de masa molecular.

109

kDa
175 85 62 48 32 25

St
58 kDa 55 53 48 32 30 28 25

1h

2h

5h

10h 1d

2d 4d

Figura 22. Acumulacin de DHNs en D. antarctica tratadas con una solucin de NaCl 1M. La parte superior PAGE-SDS con 10 g de protenas teidas con azul de Coomasie. A la izquierda estndar de peso molecular. En la parte inferior Western-blot con anticuerpo anti-DHN. A la izquierda marcador de peso molecular. A la derecha Mr de las protenas detectadas. C: control (plantas no tratadas); h: horas; d: das; St: estndar de masa molecular.
110

175 85 62

kDa St

175 85 58 kDa 62 48 32 25

kDa St

48 32 25

58 kDa 55 53 48 30 28

C 1h 2h

5h 10h 1d 2d 4d

C 1h 2h 5h 10h 1d 2d 4d

Figura 20. Acumulacin de DHNs en plantas tratadas con NaCl 0,25 y 0,5 M. Plantas de D. antarctica se trataron con disoluciones de NaCl 0,25 M (A) y 0,5 M (B) por un perodo de 4 das. La parte superior PAGE-SDS con 10 g de protenas teido con azul de Coomasie, a la izquierda se indican los tamaos del estndar de peso molecular. Parte inferior Western-blot con anti-DHN, a la derecha se indican los tamaos relativos de las protenas detectadas. C: control (plantas no tratadas); h: horas; d: das.

111

Durante el tratamiento de plantas de D. antarctica con una solucin de NaCl 1 M, se detectaron ocho protenas con Mr de 58, 55, 53, 48, 32, 30, 28 y 25 kDa (Fig. 22) respectivamente. La protena con Mr 58 kDa fue detectada a la hora de comenzado el tratamiento, aumentando hasta el trmino del ensayo. Las protenas con Mr de 55, 53, 48, 32, 30, 28 y 25 kDa respectivamente, se detectaron dbilmente a las dos horas de comenzado el tratamiento, su acumulacin fue en aumento hasta el trmino del tratamiento (Fig. 22). Para conocer el estado fisiolgico de las plantas al trmino de los tratamientos se evalu el parmetro Fv/Fm, el que da cuenta de la eficiencia fotosinttica del PS II. En D. antarctica el Fv/Fm se mantuvo entre 0,81 y 0,76 (Tabla V). Los valores Fv/Fm en las plantas mantenidas durante cuatro das con disoluciones de NaCl a distintas concentraciones, no variaron significativamente. Con la finalidad de contar con una aproximacin del efecto txico del NaCl sobre D. antarctica, las plantas despus de terminado los ensayos se les elimin del medio el NaCl, se podaron dejndolas a un centmetro aproximadamente desde el suelo y se observ el rebrote durante un perodo de tres semanas. Todas las plantas se recuperaron, slo se observ un menor nmero de plantas rebrotadas en aquellas que estuvieron en contacto con disoluciones de NaCl sobre o igual a 0,5 M (Fig. 23).

112

Tabla V.

Parmetros de Fv/Fm en D. antarctica tratado con disoluciones de NaCl con concentraciones diferentes.

TIEMPO (D) 4 4 4 4 4

NaCl (M) CONTROL 0,25 0,50 0,75 1,00

Fv/Fm 0,81 0,007 0,82 0,007 0,76 0,010 0,77 0,037 0,77 0,007

Los valores de Fv/Fm se determinaron con un n=2. significativas con un P = 0,207. Control: Plantas no tratadas Fv: Fluorescencia variable Fm: Fluorescencia mxima M: Molaridad D: Das

Entre los valores de Fv/Fm no hay diferencias

113

0,25 M

0,5 M

0,75 M

1M

Figura 23. Plantas de D. antarctica rebrotadas despus de los tratamientos con NaCl. Las plantas de D. antarctica despus de cuatro das en medios con NaCl a distintas concentraciones, se les elimin la sal, se cortaron y dejaron rebrotar durante 3 semanas. Se pusieron en cmara a 15 C y fotoperodo 21/3 luz/oscuridad. C: control (planta no tratada); 0,25; 0,5; 0,75 y 1 M, son las concentraciones de NaCl.

114

4.7.4.

Anlisis de la expresin de DHNs en D. antarctica por tratamiento con PEG (Estrs osmtico)

Las plantas de D. antarctica se sometieron a cuatro tratamientos distintos con PEG. Estos consistieron en aplicar distintos potenciales osmticos, -0,3; -0,6; -0,9 y 1,2 MPa por un perodo de 4 das. El anticuerpo anti-DHN detect 7 protenas con Mr de 58, 55, 53, 48, 32, 30 y 28 kDa, cuyas cinticas de acumulacin dependieron del tratamiento aplicado. En las plantas de D. antarctica sometidas a un potencial osmtico de 0,3 MPa, el anticuerpo anti-DHN detect tres protenas con Mr de 58, 53 y 48 kDa (Fig. 21). La protena con Mr de 58 kDa se visualiz a la hora de comenzado el tratamiento, aumentando su acumulacin considerablemente a las 2 horas, para disminuir a las 5 horas, despus de lo cual se mantuvo relativamente constante (Fig. 24). Las protenas de 53 y 48 kDa, se detectaron dbilmente a la hora de comenzado el tratamiento, su acumulacin fue mayor a las 2 horas, para despus decaer bruscamente (Fig. 24). En las plantas tratadas con un potencial osmtico de 0,6 MPa, se observaron protenas con las mismas Mr, pero con una cintica totalmente distinta (Fig. 24). La protena con Mr 58 kDa se detect a la hora de comenzado el tratamiento, su acumulacin fue en aumento hasta las cinco horas, tiempo en el cual se observ la mayor acumulacin de las protenas con Mr 53 y 48 kDa, stas al igual que en tratamiento anterior, disminuyen en cantidad hacia el trmino del tratamiento, pero su acumulacin es mayor con respecto a las plantas mantenidas con un potencial osmtico de 0,3 MPa, adems, se observ muy conspicuamente una protena con Mr 55 kDa (Fig. 24).

115

kDa St
175 85 62 48 32 25

kDa St

175 85 62 48 32 25

58 kDa 53 48

58 kDa 53 48

C 1h

2h

5h 10h 1d 2d 4d

1h 2h 5h 10h 1d 2d 4d

Figura 24. Acumulacin de DHNs en plantas de D. antarctica tratadas con potencial osmtico de 0,3 MPa y 0,6 MPa. Las plantas de D. antarctica se mantuvieron a 0,3 MPa (A) y 0,6 MPa (B), por un perodo de cuatro das. En la parte superior se muestran los PAGE-SDS con 10 g de protenas teidos con azul de Coomasie, a la izquierda se indican los tamaos del estndar de peso molecular En la parte inferior Western-blot con anticuerpo anti-DHN, a la derecha se indican los Mr de las protenas detectadas. C: control (plantas no tratadas); h: horas; d: das; St: estndar de masa molecular.

116

En las plantas de D. antarctica sometidas a potenciales osmticos de 0,9 y 1,2 MPa se detectaron siete protenas, tres de stas no se observaron en los tratamientos con potenciales osmticos de 0,3 y 0,6 MPa. Estas protenas tienen Mr de 32, 30 y 28 kDa., respectivamente (Fig. 25). Todas las protenas se observaron a la hora de comenzado los tratamientos, siendo ms abundantes las protenas de mayor tamao. En las plantas mantenidas con un potencial osmtico de 0,9 MPa, la acumulacin de todas las protenas fue relativamente constante hasta alcanzar un mximo a las 10 horas, para disminuir lentamente hasta el da cuarto (Fig. 25). En las plantas tratadas con un potencial osmtico de 1,2 MPa la acumulacin de todas las protenas fue constante hasta las 10 horas, alcanzando su mximo a las 24 horas de iniciado el tratamiento (Fig. 25). Para descartar un posible efecto txico del PEG sobre las plantas de D. antarctica, despus de cada tratamiento a las plantas se les elimin el PEG, se cortaron dejndolas a un centmetro aproximadamente desde la superficie de los maceteros y se dejaron rebrotar por un perodo de tres semanas. Todas las plantas rebrotaron (Fig. 26). En las plantas bajo un potencial osmtico de 0,3 MPa no se present variacin en el rebrote con respecto al control. Las plantas ms afectadas en su rebrote fueron las sometidas a 0,9 y 1,2 MPa, respectivamente (Fig. 26), observndose un efecto directo del potencial osmtico sobre el crecimiento y recuperacin de las plantas.

117

kDa St
175 85 62 48 32 25

kDa St
175 85 62 48 32 25

58 kDa 55 53 48 32 30 28

58kDa 55 53 48 32 30 28

C 1h

2h 5h 10h 1d 2d 4d

C 1h 2h 5h 10h 1d 2d 4d

Figura 25. Acumulacin de DHNs en plantas de D. antarctica tratadas con potenciales osmticos de 0,9 MPa y 1,2 MPa. Las plantas de D. antarctica se mantuvieron a 0,9 MPa (A) y 1,2 MPa (B), por un perodo de cuatro das. En la parte superior se muestran los PAGE-SDS con 10 g de protenas teidos con azul de Coomasie, a la izquierda se indican los tamaos del estndar de peso molecular En la parte inferior Western-blot con anticuerpo anti-DHN, a la derecha se indican los Mr de las protenas detectadas. C: control (plantas no tratadas); h: horas; d: das; St: estndar de masa molecular.

118

CR

-0.6 MPa

-0.9 MPa

-1.2 MPa

Figura 26. Plantas de D. antarctica rebrotadas despus de los tratamientos con PEG. Las plantas de D. antarctica despus de cuatro das de tratamientos con distintos potenciales osmticos (diferentes concentraciones de PEG), se elimin el PEG, se podaron y dejaron rebrotar por 3 semanas. CR: control rebrote (plantas no tratadas); MPa: Mega Pascal.

119

4.7.5. Anlisis de la expresin de DHNs en D. antarctica por tratamiento exgeno con ABA Las plantas de D. antarctica se trataron con una solucin de ABA a una concentracin de 100 M por un perodo de veinticuatro horas. Se detectaron nueve protenas, algunas de las cuales fueron comn a la mayor parte de los tratamientos realizados en la Deschampsia (58, 55, 53, 48, 30 y 28 kDa) y otras slo se acumularon en respuesta al ABA (57, 42 y 38 kDa) (Fig. 27). Las protenas de mayor tamao, excepto por la de 57 kDa fueron de acumulacin temprana (a la hora de iniciado el ensayo), las protenas de 42, 38, 30 y 28 kDa se detectaron dbilmente a las 2 horas del ensayo para alcanzar un mximo las 10 horas, despus de lo cual, su acumulacin disminuy levemente (Fig. 27).

120

kDa St
175 85 62 48 32 25
58 kDa 55 53 48

42 38 30 28

1h

2h

5h

10h

24h

Figura 27. Cintica de acumulacin de DHNs en D. antarctica tratadas con ABA exgeno. Las plantas se mantuvieron por un perodo de 24 horas en ABA 100 M. Parte superior PAGE-DSD al 10 %; las protenas estn teidas con azul de Coomasie. En la parte inferior inmunoblot con anti-DHN. A la izquierda estndar de peso molecular. A la derecha tamaos relativos de las DHNs detectadas. C: control (plantas no tratadas). h: horas. St: estndar.

121

5. Discusin El fragmento genmico de 1,3 kb del gen dhn5 de cebada se utiliz como sonda heterloga en los primeros anlisis Southern, pero debido a que los resultados mostraron bandas poco claras, se hizo necesario disponer de una sonda homloga. Utilizando partidores degenerados, cuyas secuencias corresponden a regiones consenso dentro de ADNc y ARNm de DHNs, se obtuvo por PCR desde ADN genmico de D. antarctica un fragmento de 454 pb. El anlisis de la secuencia nucleotdica indic la existencia de un intron entre los nucletidos 134 y 214. An as, este fragmento present distintos porcentajes de identidad con genes para DHNs, los que aumentaron considerablemente al eliminar el intron. Pero, sin duda la presencia de un intron en la secuencia limitaba la utilizacin de esta sonda slo a los anlisis Southern. Para obtener una sonda homloga que fuese adecuada para los anlisis Northern, se realiz con los partidores degenerados para DHN RT-PCR con ARN total de D. antarctica mantenidas a 15 y 4 C, en ninguno de los ensayos se observaron ADNc para DHNs. Considerando los resultados de los RTPCR y teniendo presente que el fragmento del gen obtenido por PCR present porcentajes de entre 90 y 63 % (sin intron) de similitud con genes para DHNs, que slo 79 pb corresponden a intron, que los segmentos codificantes estn por sobre los 130 pb y, considerando que la utilizacin de la tcnica Random primer para marcar radiactivamente los 454 pb proporcionara fragmentos de distintas longitud marcados y entre ellos fragmentos de secuecias codificantes los cuales hibridaran con secuencias de ARNm para DHNs de D. antarctica, se decidi utilizar el fragmento genmico de 454 pb como sonda en los anlisis Northern.

122

La secuencia aminoacdica deducida a partir del fragmento de 375 pb (454 pb menos 79 pb del intron) codificara para una protena de 123 aminocidos. La secuencia aminoacdica mostr la presencia de elementos caractersticos de las DHNs (Ingram y Bartels 1996), como un segmento-K, dos segmentos y un segmento-S. El segmento-K, el cual se ha descrito que formara una -hlice Clase A (Dure 1993, Svensson et al. 2002), cuya funcin sera estabilizar las membranas biolgicas introduciendo alteraciones en el radio de curvatura intrnseca de la monocapa lipdica, lo que impedira la ruptura de las clulas, contribuyendo a su estabilidad durante condiciones de deshidratacin (Tytler et al. 1993, Koag et al. 2003). Sin embargo, si el segmento-K tiene una funcin importante durante el estrs por temperatura baja, sequa o salinidad es algo que debe ser an establecido. La tendencia general de las DHNs es la ausencia de cisteina y triptofano, adems de una abundancia en aminocidos cargados y polares (Close 1989). En la secuencia aminoacdica deducida no se detectaron C ni W, pero s un nmero importante de aminocidos cargados (29), y de glicina, principalmente distribuidas entre aminocidos polares (segmento-) (Fig. 6). Los segmentos- se ha propuesto que formaran puentes de hidrgeno con los grupos polares de macromolculas y posiblemente estableceran interacciones con los solutos compatibles, evitando la precipitacin o coagulacin de macromolculas importantes para la sobrevivencia de las plantas (Cambell et al. 1997).

5.1. Deteccin de genes para DHNs en D. antarctica. Con la finalidad de obtener resultados confiables (debido a la presencia de un intron) en los anlisis Southern con la sonda de 454 pb, sta se marc en toda su extensin

123

utilizando la tcnica de PCR. No se utiliz marcaje al azar ( Random Prime), ya que exista la probabilidad de generar fragmentos pequeos que corresponderan a secuencias intrnicas, las que daran seales de hibridacin falsas para DHNs. La digestin del ADN de D. antarctica con distintas enzimas de restriccin (6) mostr la hibridacin de la sonda con fragmentos de distintos tamaos, lo que sugiere la presencia de diferentes genes que codificaran para DHNs y que ellos seran parte de una familia de genes para DHNs. Esto es consistente con antecedentes obtenidos en otras plantas, donde se ha establecido que las protenas LEA-D11 son codificadas por una familia de genes, al igual que otras familias de protenas relacionadas con las DHNs (Hughes y Galau 1989, Jarvis et al. 1996, Choi et al. 1999, Mtwisha et al. 1998, Richard et al. 2000).

5.2. Expresin de genes para DHNs en D. antarctica. La sonda homloga utilizada y marcada por Radom Primer detect ms de un transcrito, posiblemente debido a la presencia de dominios conservados para DHNs en su secuencia codificante. La presencia de varios transcritos al utilizar una sonda especfica para deshidrina, han sido reportado por Richard et al. (2000), ellos obtuvieron resultados similares al estudiar la expresin de Dhn1 en Picea glauca, donde la sonda PGDhn1 detect ms de un transcrito, lo que se debera a la presencia generalizada de los segmentos-K en las secuencias de DHNs. Se ha descrito que la expresin de genes que codifican para DHNs o LEA-D11 es inducida por temperatura baja, sequa (deshidratacin), salinidad o estrs osmtico (Richard et al. 2000, Borovskii et al. 2002) y que muchos de ellos responden a ABA (Mundy y Chua 1988, Wang et al. 2002). Para estudiar el efecto del potencial hdrico sobre la expresin de
124

Dhns se eligi PEG 15000-2000. El PEG a diferencia de otros osmolitos (manitol o sorbitol) no entra al apoplasto; el agua es retirada desde las clulas y la pared celular (Verslues et al. 1998), imitando muy de cerca las condiciones de un suelo deshidratado. Para el estrs salino las plantas se trataron con NaCl, el que tambin disminuye el potencial hdrico (estrs osmtico), pero a diferencia del PEG, el NaCl entra a las clulas produciendo un efecto txico como consecuencia del aumento en las concentraciones de sodio intracelular (Zhu 2000). Por lo tanto, ambos compuestos tienen un efecto osmtico sobre la Deschampsia. Considerando lo anterior, la deteccin de un transcrito de 1,6 kb en ambos tratamientos indicara que un mismo gen estara regulado por ambos estreses. Ejemplos de stos incluyen genes que participan en la biosntesis de osmolitos, genes que codifican para protenas LEA-D11, chaperonas, etc. (Zhu 2002). Los niveles del transcrito de 1,6 kb fueron ms altos en estrs por PEG que en salino, a pesar de que el potencial hdrico ejercido por NaCl fue menor que el del PEG, por lo que se esperaba una mayor acumulacin del transcrito para DHNs en plantas tratadas con NaCl. La disminucin en los niveles del transcrito de 1,6 kb en el tratamiento con NaCl 0,5 M podra deberse a un efecto txico del Na+ sobre el metabolismo celular (Adams et al. 1998, Zhu 2002). El transcrito de 1 kb slo se detect en plantas tratadas con ABA. Genes de Dhns que slo responden a ABA han sido reportados en cebada (Aba3), en arroz (Rab21) y tomate (Le4), entre otros (Close 1997). El ABA cumple amplias funciones durante el crecimiento y el desarrollo de las plantas Su principal funcin es la de regular el balance hdrico y la tolerancia al estrs abitico. Antecedentes de la funcin del ABA en las plantas se han obtenido desde estudios realizados con mutantes que no producen la hormona (aba1, aba2 y aba3 de Arabidopsis) (Zhu 2002). Se ha propuesto que el ABA actuara de dos formas, a
125

nivel del balance hdrico y tolerancia a la deshidratacin. El primero es principalmente a travs de la regulacin de las clulas de guarda y el segundo por la induccin de genes que codifican para protenas que proporcionan tolerancia a la deshidratacin. Tambin, se ha reportado que el ABA participara en la respuesta de tolerancia al congelamiento, a travs de la induccin de genes cuyos productos son necesarios para la sobrevivencia de las plantas (Perras y Sarhan 1989, Zhu 2002). Debido a que los niveles de ABA aumentan en condiciones de deshidratacin (Bravo 1996, Abe et al. 1997), y la aplicacin de ABA exgeno tiene un efecto similar al producido por estrs hdrico se ha sugiriendo que ABA estaran mediando algunas respuestas a estrs osmtico. Entonces, por qu el transcrito de 1,6 kb no se detect en plantas tratadas con ABA y el transcrito de 1 kb no se observ en estrs salino ni osmtico?, la respuesta estara en que algunos genes que responden a estrs osmtico no responden a las variaciones de concentracin de ABA (Shinozaki et al. 1997). Lo observado en D. antarctica tratada con ABA (Fig. 16) sugerira que sta tendra vas de sealizacin para el estrs hdrico/osmtico independiente y dependiente de ABA. La falta de deteccin del transcrito de 1 kb en estrs salino y PEG, podra deberse a que las concentraciones de ABA durante el transcurso del tratamiento (24 horas), no fueron lo suficiente para inducir la expresin del transcrito, por lo que sera interesante estudiar las variaciones de ABA en condiciones de potenciales osmticos altos. En las plantas tratadas con temperatura baja no se detectaron transcritos para Dhns (Fig. 14), pero s se detectaron protenas con el anticuerpo anti-DHNs en las mismas condiciones (Fig. 18). Esto se debera a que el anticuerpo permite detectar una poblacin importante de protenas inmunolgicamente relacionadas con las DHNs, a diferencia de la sonda que slo permiti detectar algunos transcritos. Esto se explicara porque el anticuerpo
126

est

hecho

contra

un

pptido

sinttico

que

corresponde

al

segmento-K

(EKKGIMKIKEKLPG), el que est presente en todas las DHN (Close 1996). La nodeteccin de transcritos en D. antarctica tratado con temperatura baja podra estar relacionada con las caractersticas del fragmento utilizado como sonda o con la abundancia de ARNm para Dhns inducidas por fro. La falta de deteccin de mensajeros para DHNs en D. antarctica mantenida a 4 C apoyara los resultados de los RT-PCR realizados con los partidores degenerados para DHNs, stos no amplificaron ningn ADNc a partir de ARN total de D. antarctica aclimatadas a 4 C (Fig. 17), pero como la sonda detect transcritos en plantas tratadas con estrs osmtico, salino y ABA, se realizaron RT-PCR con los mismos partidores degenerados sobre ARN total provenientes de plantas bajo estrs salino y ABA, en ambos casos amplificaron ADNc que codificaran para DHN, confirmando de esta forma los resultados de los anlisis Northern en tales condiciones. Otras circunstancias que estaran apoyando la falta de deteccin de transcritos en D. antarctica mantenidas a

4 C, sera la secuencia de la sonda, los anlisis de secuencia nucleotdica indicaron que el fragmento de 454 pb sin considerar los 79 pb del intron, presenta porcentajes importantes de identidad (87 a 64 %) con secuencias de genes para DHNs que son inducidos por deshidratacin, ABA, estrs hdrico y salino, encontrndose slo un caso de un gen para deshidrina que es inducido por ABA, deshidratacin y fro (Tabla II). Por otro lado, al realizar un alineamiento de la secuencia nucleotdica de la sonda con las secuencias de algunas DHNs inducidas especficamente por fro (dhn5 y dhn8), se observ un nmero importante de gaps y pequeas regiones con coincidencias, lo que implicara un porcentaje bajo de similitud (Fig. 7). Adems, si analizamos las propiedades qumicas de la secuencia aminoacdica deducida a partir de los 375 pb (454 pb 79 pb intron), sta correspondera a
127

una protena bsica (pI= 9,6), del tipo que se acumulan en respuestas a estrs hdrico, salino, deshidratacin y ABA (Ingram y Bartels 1996). En cambio, las protenas

acumuladas durante estrs por temperatura baja se ha descrito que presentan caractersticas neutras o cidas (Svensson et al. 2002). Con relacin a la abundancia de mensajeros, se ha informado que para una cantidad dada de protenas, la expresin del transcrito correspondiente podra variar hasta en 30 veces (Pradet-Balade et al. 2001). Las discrepancias entre los niveles de ARNm y su protena pueden deberse a que el control de la expresin de los genes no slo involucra la transcripcin y la estabilidad del mensajero, sino tambin un control a nivel de procesamiento del mensajero, exportacin del ncleo, traduccin y degradacin del mismo (Pradet-Balade et al. 2001). Sin embargo, esta posibilidad es menos probable, considerando que los RT-PCR con ARN total de plantas mantenidas a 4 C, no arrojaron resultados positivos. Por lo tanto, la sonda utilizada correspondera a un gen que no se expresa en el D. antarctica bajo condiciones de temperatura baja, sino que su regulacin estara modulada por estrs osmtico, salino y ABA.

5.3. Acumulacin de DHNs en D. antarctica durante distintos estreses. La presencia de DHNs y las cinticas de acumulacin en los tratamientos a temperatura baja, sequa (deshidratacin), NaCl, PEG y ABA se hicieron utilizando un anticuerpo antiDHNs. En todos los tratamientos se detect ms de una de una protena, confirmando la presencia de una familia de DHNs en D. antarctica. Esto concuerda con lo encontrado en otras especies vegetales, como en cebada y trigo. En la primera se han descrito doce DHNs diferentes (Choi et al. 1999, Choi y Close 2000) y en la segunda se describi una familia
128

de DHNs similar a la encontrada en cebada, con protenas cuyos tamaos varan entre 12 y 200 kDa (Sarhan et al. 1997), a diferencia de la D. antarctica donde los Mr observados variaron entre 25 y 58 kDa. Los Western blot, indicaron que indistintamente del tratamiento aplicado, se acumularon las mismas protenas. Slo en las plantas tratadas con NaCl 1 M se detect una DHNs especfica con Mr de 27 kDa., y en las plantas tratadas con ABA se detectaron dos DHNs especficas para la hormona, con Mr de 42 y 38 kDa respectivamente, sugiriendo que D. antarctica tiene DHNs cuya acumulacin sera estrs especificas. La cintica de acumulacin para DHNs en los tratamientos con temperatura baja y deshidratacin mostraron protenas comunes (58, 53, 48 y 30 kDa) y dos protenas que slo se acumularon en respuesta a fro (28 y 25 kDa). La acumulacin temporal de las protenas en ambos tratamientos sugiere que las DHNs posiblemente tendran funciones diferentes, lo que estara relacionado con una respuesta adaptativa del D. antarctica al estrs. En las plantas sometidas a estrs con NaCl y PEG se observaron siete DHNs en comn (58, 55, 53, 48, 32, 30 y 28 kDa) y una que slo se acumul en respuesta a NaCl (25 kDa). La acumulacin temporal de las DHNs fue diferente en ambos tratamientos, indicando que las plantas se adaptaran de forma diferente al estrs por NaCl y PEG, seguramente porque el PEG slo involucra un componente osmtico, en tanto el NaCl incluye una respuesta osmtica e inica. Esto se observ al trabajar con disoluciones de concentraciones crecientes, a medida que aument la concentracin de NaCl y PEG, la deteccin de las DHNs ocurra a tiempos ms cortos, aunque en las plantas tratadas con NaCl la deteccin fue ms tarda con respecto al PEG. Informacin disponible de experimentos similares es escasa, Godoy et al. 1994, estimaron el efecto de concentraciones equimolares de NaCl y
129

manitol sobre la acumulacin de TAS14, una DHN que se acumula en respuesta a estrs salino. Los autores encontraron que la acumulacin de TAS14 fue similar en ambos tratamientos. Esto no coincide con lo observado en D. antarctica, posiblemente porque el manitol, a diferencia del PEG, entra a la clula y el efecto que tiene no es slo osmtico (Verslues et al. 1998) o porque las concentraciones de NaCl utilizadas con D. antarctica son mayores a las empleadas por Godoy et al. (1994). Considerando que concentraciones de NaCl sobre los 0,3 M producen fragmentacin nuclear y dao en el ADN de plantas sensibles, lo que implicara una disminucin en la induccin de genes y en la sntesis de protenas (Jayaprakash et al. 1998, Posas et al. 2000, Richardson et al. 2001), probablemente la D. antarctica durante las primera horas del estrs salino, estabilizara la maquinaria transcripcional, solucionara la disminucin del potencial hdrico acumulando osmolitos, y las DHNs seran importante durante perodos prolongados de exposicin al NaCl. La D. antarctica, durante el perodo de exposicin a distintas concentraciones de NaCl, no evidenci cambios importantes en su aspecto. Se ha descrito que uno de los sistemas ms afectados por el NaCl es el PSII, por lo que en cada tratamiento se estim Fv/Fm como una medida del estado fisiolgico de las plantas, no observndose variaciones

significativas entre tratamientos (Tabla V). An as, se determin cualitativamente el efecto del NaCl sobre la recuperacin de las plantas, para ello se les elimin el NaCl, se cortaron y se pusieron en cmaras de cultivo, observndose un efecto en aquellas plantas expuestas a concentraciones igual o superior a 0,75 M NaCl (Fig. 23). Estos resultados son interesantes si consideramos evidencias provenientes desde experimentos realizados con cebada y papa (especies sensibles a estrs salino), donde la exposicin a NaCl 0,5 M
130

produjo la fragmentacin de ncleo, deformacin y muerte celular durante las cuatro y doce horas de exposicin al NaCl (Katsuhara y Kawasaki 1996, Richardson et al. 2001). Por lo tanto, teniendo en consideracin lo anterior y lo observado en D. antarctica, se propone que la D. antarctica es una planta tolerante al estrs salino, siendo de gran inters realizar estudios futuros sobre los posibles mecanismos involucrados en la eliminacin o incorporacin del NaCl. En los tratamientos con PEG la acumulacin de DHNs se relacionara con la disminucin del potencial hdrico. Close y Lammers (1993) reportaron la acumulacin de una DHN de 40 kDa en cultivos de cianobacterias suplementados con distintos solutos (sacarosa, sorbitol y PEG), los que incrementaban significativamente el potencial osmtico del medio. Esta deshidrina de 40 kDa no se acumulaba en los cultivos control, sugiriendo los autores que el aumento en el potencial osmtico de los medios de cultivo eran suficiente para inducir la sntesis de la protena de 40 kDa. Con respecto a la utilizacin del PEG en ensayos de estrs osmtico, algunos estudios sealan que podra tener un efecto txico en las plantas, principalmente sobre el

crecimiento (Verslues et al. 1998). Otros estudios han sealado que el dao slo se producira si el PEG entra en los tejidos (Verslues et al. 1998). En el caso particular de los ensayos realizados con Deschampsia, el efecto del PEG sobre la recuperacin de las plantas despus de los tratamientos donde se aplicaron potenciales osmticos de 0,9 MPa y 1,2 MPa, se debera a un efecto hdrico sobre las clulas, descantando la posibilidad de que el PEG haya ingresado a las clulas debido al tamao del polmero que se utiliz (Carpita et al. 1979). Esto indicara que el PEG no tendra un efecto txico sobre la D. antarctica, aunque tal aseveracin debe ser comprobada con estudios cuantitativos.
131

Al estudiar el efecto que tendra ABA sobre la acumulacin de las DHNs, se observ que muchas de ellas se correspondan con las encontradas en los otros tratamientos, y slo dos DHNs fueron especficas para ABA, lo que indicara la existencia de vas de sealizacin independientes y dependientes de la hormona en D. antarctica. Resultados similares han sido descritos por otros autores. Borovskii et al (2002) encontraron en mitocondrias de trigo de invierno una DHN de 63 kDa presente en plantas sometidas a sequa, congelamiento y ABA. Una DHN de 52 kDa slo se detect en los tratamientos con ABA exgeno. Nylander et al. (2001) estudiaron la acumulacin de DHNs en Arabidopsis thaliana sometida a distintos estreses, encontrando que las DHNs LTI29 y COR47 se acumulaban en estrs salino, sequa y ABA exgeno. En cambio RAB18 slo respondi a ABA exgeno. Estos antecedentes demuestran que la mayora de los genes para DHNs que responden a temperatura baja y sequa son inducidos por ABA exgeno, que algunos de estos genes para DHNs no responden a ABA o slo son inducidos por ABA (Nylander et al. 2001). Distintos estudios han demostrado que la respuesta de genes a ABA estara mediada por la presencia de determinados elementos en cis en los promotoras de estos genes (Abe et al. 1997, Svensson et al. 2002). A estos elementos se les han denominado ABRE (ABA Responsive Elements) y se caracterizan por llevar la secuencia C/TACGTGGC (Xiong y Zhu 2001). Los Western blot mostraron patrones complejos de acumulacin de DHNs en D. antarctica, sugiriendo que estas protenas tendran ms de una funcin especfica durante el estrs por temperaturas bajas, dficit de agua o salinidad. Considerando las propiedades fsico-qumicas de las DHNs y su produccin masiva durante estrs hdrico, se podra sugerir que las DHNs ayudaran a la mantencin de la integridad de las macromolculas y
132

membranas celulares, as como a la actividad de enzimas que son esenciales para el funcionamiento del metabolismo, contribuyendo a la mantencin del balance hdrico entre la D. antarctica y su ambiente.

133

6. Conclusiones 1. D. antarctica tiene genes que codifican para una familia de protenas conocidas como DHNs. 2. El anlisis de la secuencia del fragmento obtenido por PCR desde ADN genmico de la D. antarctica con partidores degenerados, indica que corresponde a parte de un gen que codifica para deshidrina, cuya expresin estara regulada por estrs osmtico, salino y ABA, pero no por temperaturas bajas en D. antarctica. 3. La expresin de algunos genes para DHNs en D. antarctica estara regulada por distintos factores ambientales a travs de vas dependiente e independiente de ABA. 4. Las distintas cinticas de acumulacin de las DHNs en D. antarctica dependen de la severidad de las condiciones estresantes aplicadas. 5. La cintica de acumulacin de DHNs en D. antarctica durante el estrs por sequa se correlacion con la disminucin del CRA en las plantas. 6. Las diferencias observadas en los patrones de acumulacin de DHN en D. antarctica tratadas con PEG (estrs osmtico), respecto de las tratadas con NaCl (estrs osmtico y salino) se deberan a que ste ltimo adems de tener un componente osmtico, lleva asociado un efecto inico.

134

6.1. Conclusin General

SEQUI A

BAJ AS TEMPERATURAS

DESHI DRATACI N

SALI NI DAD

SACAROSA FRUCTANOS PROLINA

DESHI DRI NAS

TOLERANCI A, SOBREVI VENCI A

Figura 28. Representacin esquemtica de los mecanismos de tolerancia de la D. antarctica a las condiciones ambientales de la Antrtida. Los solutos compatibles, prolina y DESHIDRINAS contribuiran a la sobrevivenvia de la planta en su ambiente natural.

Se concluye que: Deschampsia antarctica Desv. tiene genes que codifican para una familia de DHNs, que se expresan diferencialmente ante diversos tipos de estrs, siendo su regulacin compleja y dependiente de mltiple factores.

135

7. Bibliografa Abe H, Yamaguchi-Shinozaki K, Urao T, Iwasaki T, Hosokawa D, Shinozaki K (1997) Role of Arabidopsis MYC and MYB homologs in drought-and abscisic acidregulated gene expression. Plant Cell 9: 1859-1868 Adams P, Nelson DE, Yamada S, Chmara W, Jensen RG, Bohnert HJ, Griffiths H (1998) Growth and development of Mesembryanthemum crystallinum (Aizoaceae). New Phytol 138: 171-190 Alberdi M, Bravo LA, Guitirrez A, Gidekel M, Corcuera LJ (2002) Ecophysiology of Antarctic vascular plants. Physiol Plant 115: 479-486 Arora R, Rowland LJ, Panta GR (1997) Chill-responsive dehydrins in blueberry: are they associates with cold hardiness or dormancy transitions? Physiol Plant 101: 8-16 Baker J, Steele C, Dure LI (1988) Sequence and characterization of 6 Lea proteins and their genes from cotton. Plant Mol Biol 11: 277- 291 Baker SS, Wilhelm KS, Thomashow MF (1994) The 5region of Arabidopsis thaliana cor15a has cis-acting element that confer cold-, drought-, and ABA-regulated gene expression. Plant Mol Biol 24: 701-713 Black M, Corbineau F, Gee H, Cme D (1999) Water content, raffinose, and dehydrins in the induction of desiccation tolerance in immature wheat embryos. Plant Physiol 120: 463-471 Borovskii GB, Stupnikova IV, Antipina AI, Vladimirova SV, Voinikov VK (2002) Accumulation of dehydrin-like proteins in the mitochondria of cereals in response to cold, freezing, drought and ABA treatment. BMC Plant Biology 2: 5-11

136

Borovskii GB, Stupnikova IV, Antipina AA, Downs CA, Voinikov VK (2000) Accumulation of dehydrin-like proteins in the mitochondria of cold treated plants. J Plant Physiol 156: 797-800 Bradford M (1976) A rapid method for the quantitation of microgram quantities of protein utilizing the principle of protein-dye binding. Anal Biobhem 72: 248-254 Bravo LA (1996) Tolerancia al congelamiento en cebada. Tesis Doctorado. Universidad de Chile. Bravo LA, Close TJ, Corcuera LJ, Guy CL (1999) Characterization of an 80-kDa dehydrinlike protein in barley responsive to cold acclimation. Physiol Plant 106: 177-183 Bravo LA, Ulloa N, Ziga GE, Casanova A, Corcuera LJ, Alberdi M (2001) Cold resistance in Antarctic angiosperms. Physiol Plant 111: 55-65 Bravo LA, Gallardo J, Navarrete A, Olave N, Martnez J, Alberdi M, Close TJ, Corcuera LJ (2003) Cryoprotective activity of a cold induced dehydrin purified from barley. Physiol Plant 118:262-269 Browne J, Tunnacliffe A, Burnell A (2002) Anhydrobiosis: Plant desiccation gene found in a nematode. Nat 416: 38 Calestani C, Bray AE, Close TJ, Marmiroli M (1998) Constitutive expression of a dehydrin in Arabidopsis thaliana enhances tolerance to salt stress. 9th International Conference on Arabidopsis Research. Univ Wisconsin. Madison USA Campbell SA, Close TJ (1997) Dehydrins: genes, proteins, and associations with phenotypic traits. New Physiol 137: 61-74 Carpita N, Sabularse D, Montezinos D, Delmer D (1979) Determinations of the pore size of cell walls of living plant cells. Sci 205: 1144-1147

137

Ceccardi TL, Meyer NC, Close TJ (1994) Purification of a maize dehydrin. Prot Expr Purif 5: 266-269 Cellier F, Conjro G, Casse F (2000) Dehydrin transcript fluctuations during day/night cycle in drought-stressed sunflower. J Exp Bot 51: 299-304 Choi DW, Close TJ (2000) A newly identified barley gene, Dhn12, encoding an YSK2 dehydrins, is located on chromosome 6H and has embryo-specific expression. Theor Appl Genet 100: 1274-1278 Choi DW, Zhu B, Close TJ (1999) The barley ( Hordeum vulgare L.) dehydrin multigene family: sequences, allele types, chromosome assignments and expression

characteristic of 11 Dhn genes of cv. Dicktoo. Theor Appl Genet 98: 1234-1247 Chomczynski P, Sacchi N (1987) Single step method of RNA isolation by acid guanidinum thiocyanate-phenol-chloroform extraction. Ann Biochem 162: 156-159 Close TJ, Kortt AA, Chandler PM (1989) A cDNA-based comparison of dehydrationinduced proteins (dehydrins) in barley and corn. Plant Mol Biol 13: 95-108 Close TJ, Lammers PJ (1993) An osmotic stress protein of cyanobacteria is immunologically related to plant dehydrins. Plant Physiol 101: 773-779 Close TJ (1996) Dehydrins: emergence of a biochemical role of a family of plant dehydration proteins. Physiol Plant 97: 795-803 Close TJ (1997) Dehydrins: a commonality in the response of plants to dehydration and low temperature. Physiol Plant 100: 291-296 Danyluk J, Perron A, Houde M, Limin A, Fowler B, Benhamou N, Sarhan F (1994) Accumulation of an acidic dehydrin in the vicinity of the plasma membrane during cold acclimation of wheat. Plant Cell 10: 623-638
138

Danyluk J, Perron A, Houde M, Limin A, Fowler B, Benhamou N, Sarhan F (1998) Accumulation of an acidic dehydrin in the vicinity of the plasma membrane during cold acclimation of wheat. Plant Cell 10: 623-638 Davis R, Botstein D, Roth JR (1980) A manual for genetic engineering: advanced bacterial genetics. Cold Spring Harbor NY. pp 70-113 Dellaporta SL, Wood J, Hicks JB (1983) A plant DNA minipreparation: version II. Plant Mol Biol Rep 4: 19-21 Dretzen G, Bellard M, Sassone-Corsi P, Chambon P (1981) A reliable method for the recovery of DNA fragments from agarose and acrylamide gels. Anal Biochem 112: 295-298. Dure L III, Crouch M, Harada J, Ho T-HD, Mundy J, Quatrano R, Thomas T, Sung ZR (1989) Common amino acid sequence domains among the LEA proteins of higher plants. Plant Mol Biol 12: 475-486 Dure L III (1993) The LEA proteins of higher plants. - In Control of Plant Gene Expression (D.P.S. Verna, ed), pp.325-335. CRC Press, Boca Raton, FL. ISBN 0-8493-8866-X. Edwards JA, Lewis-Smith RI (1988) Photosynthesis and respiration of Colobanthus quitensis and Deschampsia antarctica from the Maritime Antarctic. Br Antarct Surv Bull 81: 43-63 Egerton-Warburton LM, Balsamo RA, Close TJ (1997) Temporal accumulation and ultrastructural localization of dehydrins in Zea mays. Physiol Plant 101: 545-555 Fowler DB, Breton G, Limin AE, Mahfoozi S, Sarhan F (2001) Photoperiod and temperature interactions regulate low-temperature induced gene expression in barley. Plant Physiol 127: 1676-1681
139

Goday A, Jensen AB, Culianezmacia FA, Alba MM, Figueras M, Serratosa J, Torrent M, Pages M (1994) The maize abscisic acid-responsive protein Rab17 is located in the nucleus and interacts with nuclear-localization signals. Plant Cell 6: 351-360 Godoy JA, Lunar R, Torres-Schumann S, Moreno J, Rodrigo RM, Pintor-Toro JA (1994) Expression, tissue distribution and subcellular localization of dehydrin TAS 14 in salt-stressed tomato plants. Plant Mol Biol 26: 1921-1934 Guiltinan MJ, Marcotte WR, Quuatrano RS (1900) A plant leucine zipper protein that recognizes and abscisic acid response element. Sci 250: 267-271 Hara M, Terashima S, Kuboi T (2001) Characterization and cryoprotective activity of cold responsive dehydrin from Citrus unshiu. J Plant Physiol 158: 1333-1339 Heyen BJ, Alsheikh MK, Smith EA, Torvik CF, Seals DF, Randall SK (2002) The calciumbinding activity of a vacuole-associated, dehydrin-like protein is regulated by phosphorylation. Plant Physiol 130: 675-687 Houde M, Daniel C, Lachapelle M, Allard F, Lalibert S, Sarhan F (1995) Immunolocalization of freezing-tolerance-associated proteins in the cytoplasm and nucleoplasm of wheat crown tissue. Plant J 8:583-593 Hughes DW, Galau GA (1989) Temporally modular gene expression during cotyledon development. Genes Dev 3: 358:369 Hughes MA, Dunn MA (1990) The effect of temperature on plant growth and development. Biotechnol Genet Eng Rev 8: 161-188 Ingram J, Bartels D (1996) The molecular basis of dehydration tolerance in plants. Annu Rev Plant Physiol Plant Mol Biol 47: 377-403

140

Ismail AM, Hall AE, Close TJ (1999) Allelic variation of a dehydration gene cosegregates with chilling tolerance during seedling emergence. Proc Natl Acad Sci USA 96: 13566-13570 Iturriaga G, Schneider K, Salamini F, Bartels D (1992) Expression of desiccation related proteins from the resurrection plant Craterostigma plantagineum in transgenic tobacco. Plant Mol Biol 20: 555-558 Jaglo-Ottosen KR, Gilmour S, Zarka DG, Schabeberger O, Thomashow MF (1998) Arabidopsis CBF1 overexpression induces COR genes and enhances freezing tolerance. Science 280: 104-106 Jarvis SB, Taylor MA, MacLeod MR, Davies HV (1996) Cloning and characterization of the cDNA clones of three genes that are differentially expressed during dormancybreakage in the seeds of Douglas Fir ( Pseudotsuga menziesii). J Plant Physiol 147: 559-566 Jayaprakash TL, Ramamohan G, Krishnaprasad BT, Ganeshkumar, Prasad TG, Mathew MK, Udayakumar M (1998) Genotypic variability in differential expression of lea2 and lea3 genes and proteins in response to salinity stress in fingermillet ( Eleusine coracana Gaertn) and rice (Oryza sativa L) seedlings. Annals of Botany 82: 513-522 Jensen AB, Goday A, Figueras M, Jessop AC, Pages M (1998) Phosphorilation mediates the nuclear targeting of maize Rab17 protein. Plant J 13:691-697 Kasuga M, Liu Q, Miura S, Yamaguchi-Shinozaky K, Shinozaki K (1999) Improving plant drought, salt, and freezing tolerance by gene transfer of a single stress-inducible transcription factor. Nat Biotechnol 19: 287-291

141

Katsuhara K, Kawasaki T (1996). Salt stress induced nuclear and DNA degradation in meristematic cells of barley roots. Plant Cell Physiol 37: 169-173 Kaye C, Neven L, Hafig A, Li QB, Haskell D, Guy C (1998) Characterization of a gene spinach CAP160 and expression of two spinach cold-acclimation proteins in tobacco. Plant Physiol 116: 1367-1377 Kazuoka T, Oeda K (1994) Purification and characterization of Cor85-ologomeric complex from cold-acclimated spinach. Plant Cell Physiol 35: 601-611 Kiyosue T, Yamaguchi-Shinizaki K, Shinozaki K, Kamada H, harada H (1993) cDNA cloning of Ecp40, an embryonic-cell protein carrot, and its expression during somatic and zygotic embryogenesis. Plant Mol Biol 21: 1053- 1068 Koag MC, Fenton RD, Wilkens S, Close TJ (2003) The binding of maize DHN1 to lipid vesicules. Gain of structure and lipid specificity. Plant Physiol 131: 1-8 Lng V, Palta ET (1992) The expression of a rab-related gene, rab18, is induced by abscisic acid during the cold acclimation process of Arabidopsis thaliana(I) Heynh. Plant Mol Biol 20: 951-962 Leder P, Tiemeier D, Enquist L (1977) EK2 Derivatives of bacteriophage Lambda useful in the cloning of DNA from higher organisms: The 8gt WES System. Sci 196: 175-177 Lehrach H, Diamond D, Wozzney JM, Boedtker H (1977) RNA molecular weight determinations by gel electrophoresis under denaturing conditions, a critical reexamination. Biochem 16: 4743-4751 Leung J, Giraudat J (1998) Abscisic acid signal transduction. Annu Rev Plant Physiol Plant Mol Biol 49: 199-222

142

Levi A, Panta GR, Parmentier CM, Muthalif MM, Arora R, Shanker S, Rowland LJ (1999) Complementary DNA cloning, sequencing and expression of unusual dehydrin from blueberry floral buds. Physiol Plant 107: 98-109 Lisse T, Bartels D, Kalbitzer HR, Jaenicke R (1996) The recombinant dehydrin-like desiccation stress protein from the resurrection plant Craterostigma plantagineum displays no defined three-dimensional structure in its native state. Biol Chem 377: 555-561 Liu Q, Kasuga M, Sakuma Y, Abe H, Miura S, Yamaguchi-Shinozaki K, Shinozaki K (1998). Two transcriptions factors, DREB1 and DREB2, with an EREBP/AP2 DNA binding domain separate two cellular signal transduction pathways in drought- and low-temperature-responsive genes expression, respectively in Arabidopsis. Plant Cell 10: 1391-1406 McCree KJ, Kallsen CE, Richarson SG (1984) Carbon balance of Sorghum plants during osmotic adjustment to water stress. Plant Physiol 76: 898-902 Moons A, Bauw G, Dekeyser R, Von Montagu M, Van Der Straeten D (1995) Novel, ABA responsive proteins in vegetative rice tissue. Current Top Plant Physiol 10: 288-289 Mtwisha L, Brandt W, McCready L, Lindsey G (1998) HSP12 is a LEA-like protein in Saccharomyces cerevisiae. Plant Mol Biol 37: 513-521 Mundy J, Chua N-H (1988) Abscisic acid and water-stress induce the expression of a novel rice gene. EMBO J 7: 2279-2286 Neven LG, Haskell DW, Hofig A, Li QB, Guy CL (1993) Characterization of a spinach gene responsive to low-temperature and water-stress. Plant Mol Biol 21: 291-305

143

Nordin K, Vahala T, Palva ET (1993) Differential expression of two related lowtemperature-induced genes in Arabidopsis thaliana (L) Heynh. Plant Mol Biol 21: 641-653 Notredame C, Higgins D, Heringa J (2000) A novel method for multiple sequence alignments. J Mol Biol 302: 205-217 Nylander M, Svensson J, Palva ET, Welin BV (2001) Stress-induced accumulation and tissue-specific localization of dehydrins in Arabidopsis thaliana. Plant Mol Biol 45: 263-279 Panta GR, Rieger MW, Rowland LJ (2001) Effect of cold and drought stress on blueberry dehydrins accumulation. J Hort Sci Biotechnol 76: 549-556 Patterson TA, Dean M (1987) Preparation of high titer lambda phage lysates. Nucleic Acids Res 15: 6298 Pelah D, Wang W, Altman A, Shoseyov O, Bartels D (1997) Differential accumulation of water stress-related proteins, sucrose synthase, and soluble sugar in Populus species that differ in their water stress response. Physiol Plant 99: 153-159 Perras M, Sarhan F (1989) Synthesis of freezing tolerance protein in leaves, crown and root during cold acclimation of wheat. Plant Physiol 89:577-585 Plana M, Itarte E, Eritja R, Goday A, Pages M, Martinez MC (1991) Phosphorilation of maize Rab-17 protein by casein kinase-2. J Biol Chem 266: 22510-22514 Posas F, Chambers JR, Heyman JA, Hoeffler, de Nadal E, Arino J (2000) The transcriptional response of yeast to salt stress. J Biol Chem 275: 17249-17255

144

Pradet-Balade B, Boulm F, Beug H, Mllner EW, Garcia-Sanz JA (2001) Translation control: bridging the gap between genomics and proteomics? Trends Biochem Sci 4: 225-229 Reyes MA (1998) Respuestas fisiolgicas y matablicas de Deschampsia antarctica Desv. al estrs termico. Tesis de Magistir. Universidad de Chile Riccardi F, Gazeau P, de Vienne D, Zivy M (1998) Protein changes in response to progressive water deficit in maize. Plant Physiol 117: 1253-1263 Richard S, Morency MJ, Drevet C, Jouanin L, Sguin A (2000) Isolation and characterization of a dehydrin gene from white spruce induced upon wounding, drought and cold stresses. Plant Mol Biol 45: 1-10 Richardson KVA, Wetten AC, Caligari PDS (2001) Cell and nuclear degradation in root meristems following exposure of potatoes (Solanum tuberosum L) to salinity. Potato Research 44: 389-399 Rinne PLH, Kaikuranta PLM, van der Plas LHW, van der Schoot C (1999) Dehydrins in cold-acclimated apices of birch (Betula pubescens Ehrh) production, localization and potential role in rescuing enzyme functions during dehydration. Plant 209: 377-388 Robles J, Doers (1994) Promega Notes 45: 19. Sarhan F, Ouellet F, Vazquez-Tello A (1997). The wheat wcs120 gene family. A useful model to understand the molecular genetics of freezing tolerance in cereals. Physiol Plant 101: 439-445 Sauter JJ, Westphal S, Wisniewski M (1999) Immunological identification of dehydrinrelated proteins in the wood of five species of Populus and in Salix caprea LJ. Plant Physiol 154: 781-788
145

Schneider K, Wells B, Schmelzer, Salamini F, Barlels D (1993) Desiccation leads the rapid accumulation of both cytosolic and chloroplastic proteins in the resurrection plant Craterostigma plantagineum Hochst. Plant 189: 120-131 Shinozaki K, Yamaguchi-Shinozaki K (1997) Gene expression and signal transduction in water-stress response. Plant Physiol 115: 327-334 Shinozaki K, Yamaguchi-Shinozaki K (2000) Molecular response to dehydration and low temperature: differences and cross-talk between two stress signaling pathways. Curr Opin Plant Biol 3: 217-233 Svensson J, Palva ET, Welin B (2000) Purification of recombinant Arabidopsis thaliana dehydrins by metal ion affinity chromatography. Protein Expr Purif 20: 169-178 Svensson J, Ismail AM, Palva ET, Close TJ (2002) Dehydrins. Sensing Signaling and Cell Adaptation. Edited by KB Storey and JM Storey. Elservier Science BV. 155-171 Thomas PS (1980) Hybridization of denatured RNA and small DNA fragments transferred to nitrocellulose. Proc Natl Acad Sci USA 77: 5201-5205 Thomashow MF (1994) Arabidopsis thaliana as a model for studying mechanisms of plant cold tolerance. In Arabidopsis, Meyerowitz E, Somerville C (eds.), Cold Spring Harbor Laboratory Press, NY, pp. 807-834 Thomashow MF (1998) Role of cold-responsive genes in plant freezing tolerance. Plant Physiol 118: 1-7 Thomashow MF (2001) So whats new in the field of plant cold acclimation? Lots! Plant Physiol 125: 89-93 Tytler, EM, Segrest JP, Epand RM, Nie SQ, Epand RF,Mishra VK, Venkatachalapathi YV, Anantharamaiah GM (1993) Reciprocal effects of apolipoprotein and lytic peptide
146

analogs on membranes. Cross-sectional molecular shapes of amphipathic alpha helixes control membrane stability. J Biol Chem 268: 22112-22118 Uno Y, Furihata T, Abe H, Yoshida R, Shinozaki K, Yamaguchi-Shinozaki K (2000) Arabidopsis basic leucine zipper transcription factors involved in an abscisic aciddependent signal transduction pathway under drought and high-salinity conditions. Proc Natl Acad Sci USA 97: 11632-11637 Velten J, Oliver MJ (2001) Tr88, a rehydrin with a dehydrin twist. Plant Mol Biol 48: 713722 Verslues PE, Ober ES, Sharp E (1998) Root growth and oxygen relations at low water potentials. Impact of oxygen availability in polyethylene glycol solutions. Plant Physiol 116: 1403-1412 Vilardell J, Goday A, Freire MA, Torrent M, Martinez MC, Torn JM, Pags M (1990) gene sequence, developmental expression and protein phosphorylation of RAB-17 in maize. Plant Mol Biol 14: 423-432 Wang XJ, Loh CS, Yeoh HH, Sun WQ (2002) Drying rate and dehydrin synthesis associated with abscisic acid-induced dehydration tolerance in Spathoglottis plicata orchidaceae protocorms. J Exp Botany 53: 551-558 Wanner LA, Junttila O (1999) Cold induced freezing tolerance in Arabidopsis. Plant Physiol 120: 391-359 Welling A, Kaikuranta P, Rinne P (1997) Photoperiodic induction of dormancy and freezing tolerance in Betula pubescens. Involvement of ABA and dehydrins. Physiol Plant 100: 119-125

147

Wisniewski M, Close TL, Artlip, Arora R (1996) Seasonal patterns of dehydrins and 70kDa heat-shock proteins in bark tissues of eight species of woody plants. Physiol Plant 96: 496-505 Wisniewski M, Webb R, Balsamo R, Close TJ, Yu X-M, Griffith M (1999) Purification, immunolocalization, cryoprotective, and antifreeze activity of PCA60: A dehydrin from peach (Prunus persica). Physiol Plant 105: 600-608 Wright PE, Dynson HJ (1999) Intrinsically unstructured proteins: Re-assessing the protein structure-function paradigm. J Mol Biol 293: 321-331 Xiong FS, Ruhland CT, Day TA (1999) Photosynthetic temperature response of the Antarctic vascular plants Colobanthus quitensis and Deschampsia antarctica. Physiol Plant 106: 276-286 Xiong L, Zhu JK (2001) Abiotic stress signal transduction in plants: Molecular and genetic perspectives. Physiol Plant 112: 152-166 Yamaguchi-Shinozaki K, Shinozaki K (1994) A novel- cis acting element in an Arabidopsis gene is involved in responsiveness to drought, low-temperature, or high-salt stress. Plant Cell 6: 251-564 Zhang L, Ohta A, Takagi M, Imai R (2000) Expression of plant group 2 and group 3 lea genes in Saccharomyces cerevisae reveled functional divergence among LEA proteins. J Biochem 127: 611-616 Zhu B, Choi DW, Fenton R, Close TJ (2000) Expression of the barley dehydrin multigene family and the development of freezing tolerance. Mol Gen Genet 264: 145-153 Zhu JK (2000) Genetic analysis of plant salt tolerance using Arabidopsis thaliana. Plant Physiol 124: 941-948
148

Zhu JK (2001) Plant salt tolerance. Trends Plant Sci 6: 66-71 Zhu JK (2002) Salt and drought stress signal transduction in plants. Annu Rev Plant Biol 53: 247-273 Ziga GE, Alberdi M, Fernndez J, Montiel P, Corcuera LJ (1994) Lipid content in leaves of Deschampsia antarctica from the Maritime Antarctic. Phytochem 37: 669-672 Ziga GE, Alberdi M, Corcuera LJ (1996) Non-structural carbohydrates in Deschampsia antarctica Desv. from South Shetland Island, Maritime Antarctic. Environ Exp Bot 36: 393-398

149