You are on page 1of 118

12 UPANISHADS

$
12 Upanishads


Traduction franaise
Gaura Krishna




YOGI RAMSURATKUMAR BHAVAN
1
12 UPANISHADS

































Juillet 2011
2
12 UPANISHADS







Presque toutes ces 12 Upanishads sont apparues,
dans leur traduction franaise et au fil des annes, dans la
revue mensuelle du YOGI RAMSURATKUMAR
BHAVAN Rama Nama Il nous a sembl utile de les
runir sous forme de livre.

LIsha Upanishad est la plus connue et a fait lobjet
de nombreuses traductions. Il nen est pas de mme pour
les autres et nous esprons que la publication de ce livre
sera donc de quelque profit.

Nous prsentons enpremier lieu le texte original en
devanagari, suivi de sa translittration en caractres
romains, puis de la traduction franaise.

Deux de ces Upanishads ont t traduites partir des
versions anglaises quen ont donnes deux traducteurs
indiens diffrents.




3
12 UPANISHADS
4
12 UPANISHADS




Introduction aux Upanishads

De 'upa' : proche de, prs de, 'ni' : bas, et 'shad' tre
assis. C'est le fait d'tre assis aux pieds du Guru pour
recevoir l'enseignement.
Les upanishads forment ce que l'on appelle
le Vedanta, de Veda-anta, la fin des Vedas, non
seulement parce qu'elles constituent en la partie finale,
mais surtout parce qu'elles en sont l'enseignement ultime,
atteignant la plus haute mtaphysique, au-del de
laquelle est le royaume du Silence.
Les plus anciennes font en effet partie des Veda, et
font donc partie de la shruti que lon peut appeler
rvlation. Aussi forment-elles la base, l'essence de la
philosophie hindoue. Elles ont trait l'intgralit de la
connaissance et y sont exposs l'origine de l'univers, la
nature du Brahman, du jivatman, la relation entre mental
et matire, etc Il n'en demeure pas moins que le thme
principal des upanishad est la connaissance ultime :
l'identit du Brahman et du jivatman (" Tat tvam asi : Tu
es Cela " (Chandgogya Up), la recherche de l'unit au
sein de la diversit, ("ce par la connaissance de quoi tout
dans l'Univers est connu" (Mundaka Up.). C'est dans les
5
12 UPANISHADS
Upanishads qu'apparat aussi pour la premire fois
l'exposition de la loi du karma, telle qu'enseigne par
Yajnavalkya (Brihadaranyaka Up.)
Ce qui caractrise donc aussi les Upanishads c'est
bien entendu leur universalit et leur absence de tout
dogmatisme. Elles constituent la plus haute philosophie
jamais conue par l'esprit humain.
Traditionnellement, il y a 108 upanishads (majeures).
Elles ont t classes par la suite :
1) 12 upanishads majeures,
- Aitareya et la Kauhsitaki appartiennent au Rg Veda
- Chandogya et Kena au Samaveda
- Taittiriya, Katha, Shvetashvatara, Brhadaranyaka, Isha
au Yajur Veda
- Prashna, Mundaka et Mandukya l'Atharvaveda.

2) 23 samanayayuvedanta upanishads
3) 20 Yoga upanishads
4) 17 samnuasa upanishads
5) 14 vaishnava upanishads
6) 14 shaiva Upanishads
7) 8 shakta upanishads
6
12 UPANISHADS

S'il y a plus de 200 textes qui ont reu le titre
d'upanishads, il vaut mieux s'en tenir la tradition et
notamment l'enseignement des upanishads 'vdiques'.
Les Upanishads sont, nous l'avons vu, l'uvre de
plusieurs auteurs et on ne peut donc faire d'elles, mise
part les 'grandes upanishads' appartenant la sruti et qui
sont en prose, un systme de philosophie proprement dit,
certaines upanishads se rattachant des sectes
particulires. (cultes de Shiva, de Vishnu, de Ganesha, de
Surya, etc)
Voici la liste traditionnelle des upanishads, donne
dans la Muktika Upanishad :

1 Ishavasya (majeure)
2 Kena (majeure)
3 Katha (ou Kathaka) (majeure)
4 Prashna (majeure)
5 Mundaka (majeure)
6 Mandukya (majeure)
7 Taittiriya (majeure)
8 Aitareya (majeure)
9 Chhandogya (majeure)
10 Brihadaranyaka (majeure)
11 Brahma (Samnyasa)
12 Kaivalya (Shaiva)
13 Jabala (Shaiva)
7
12 UPANISHADS
14 Shvetashvatara (majeure)
15 Hamsa (Yoga)
16 Arunika (Samnyasa)
17 Garbha (Samanaya)
18 Narayana (Vaishnava)
19 Paramahamsa (Samnyasa)
20 Amritabindu (Yoga)
21 Amritanada (Yoga)
22 Atharvashiras (Shaiva)
23 Atharvashikha (Shaiva)
24 Maitrayani (Samanaya)
25 Kaushitaki (majeure)
26 Brihajjabala (Shaiva)
27 Narisimhatapaniya (Vaishnava)
28 Kalagnirudra (Shjaiva)
29 Maitreyi (Samnyasa)
30 Subala (Samanaya)
31 Kshurika (Yoga)
32 Mantrika (Samanaya)
33 Sarvasara (Samanaya)
34 Niralamba (Samanaya)
35 Shukarahasya (Samanaya)
36 Vajrasuchika (Samanaya)
37 Tejobindu (Yoga)
38 Nadabindu (Yoga)
39 Dhyanabindu (Yoga)
40 Brahmavidya (Yoga)
41 Yogatattva (Yoga)
42 Atmabodha (Samayana)
43 Naradaparivrajaka (Samnyasa)
44 Trishikhibrahmana (Yoga)
45 Sita (Shakta)
8
12 UPANISHADS
46 Yogachudamani (Yoga)
47 Nirvana (Samnyasa)
48 Mandalabrahmana (Yoga)
49 Dakshinamurti (Shaiva)
50 Sharabha (Shaiva)
51 Skanda (Samanaya)
52 Tripadvibhutimahanarayana (Vaishnava)
53 Advayataraka (Yoga)
54 Ramarahasya (Vaishnava)
55 Ramatapaniya (Vaishnava)
56 Vasudeva (Vaishnava)
57 Mudgala (Samanaya)
58 Shandilya (Yoga)
59 Paingala (Samanaya)
60 Bhikshuka (Samnyasa)
61 Maha (Samanaya)
62 Shariraka (Samanaya)
63 Yogashikha (Yoga)
64 Turiyativadhuta (Samnyasa)
65 Samnyasa (Samnyasa)
66 hamsaparivrajala (Samnyasa)
67 Akshamala (Shaiva)
68 Avyakta (Vaishnava)
69 Ekakshara (Samayana)
70 Annapurna (Samanaya)
71 Surya (Samanaya)
72 Akshi (Samanaya)
73 Adhyatma (Samanaya)
74 Kundika (Samnyasa)
75 Savitri (Samanaya)
76 Atma (Samanaya)
77 Pashupatabrahma (Yoga)
9
12 UPANISHADS
78 Parabrahma (Samnyasa)
79 Avadhuta (Samnyasa)
80 Tripuratapini (Shakta)
81 Devi (Shakta)
82 Tripura (Shakta)
83 Katharudra (Samnyasa)
84 Bhavana (Shakta)
85 Rudrahridaya (Shaiva)
86 Yogakundali (Yoga)
87 Bhasmajabala (Shaiva)
88 Rudrakshajabala (Shaiva)
89 Ganapati (Shaiva)
90 Darshana (Yoga)
91 Tarasara (Vaishnava)
92 Mahakavya (Yoga)
93 Panchabrahma (Shaiva)
94 Pranagnihotra (Samanaya)
95 Gopalatapini (Vaishnava)
96 Krishna (Vaishnava)
97 Yajnavalkya (Samnyasa)
98 Varaha (Yoga)
99 Shatyayana (Samnyasa)
100 Hayagriva (Vaishnava)
101 Dattatreya (Vaishnava)
102 Garuda (Vaishnava)
103 Kalisamtarana (Vaishnava)
104 Jabali (Samnyasa)
105 Saubhagyalakshmi (Shakta)
106 Sarasvatirahasya (Shakta)
107 Bahvricha (Shakta)
108 Muktika (Samanaya)
10
12 UPANISHADS

A ct, on trouve des upanishads dont les textes sont
pourtant importants :
(109) Yogasara
(110) Vedantasara
(111) Sivajnanamrita
(112) Advaitamrita
(113) Svarupabodha
(114) Brahmarahasya
(115) Brahmanubhava
(116) Vucharabindu
(117) Jyotirbindu
(118) Anandabindu




11
12 UPANISHADS
12
12 UPANISHADS


Isha Upanishad
(ou Ishavasya Upanishad)

Cette trs importante upanishad est la seule upanishad
qui fasse partie intgrante d'un Samhita, d'o son second nom
de Samhitopanishad. Elle forme le dernier chapitre du Sukla
Yajur Veda Samhita (Yajur Veda blanc). Elle est en vers,
appele comme toutes les upanishads en vers une
mantropanishad. Son nom drive du premier mot du premier
mantra qui la compose. Dans toutes les listes ou numrations
d'upanishads, elle figure en premire place. L'Isha Upanishad
est une des Upanishads qui a t commente par Adi
Shankaracharya. Il expose que l'upanishad prsente deux
voies pour les aspirants spirituels : la premire pour les
jnanins (voie de la connaissance) et l'autre pour ceux qui n'ont
pas atteint le dveloppement intrieur requis pour renoncer
aux dsirs et adopter cette voie. Un tel jnanin n'a pas
accomplir de rites. L'upanishad le concerne dans ses huit
premiers vers. La seconde partie concerne ceux qui sont
encore attachs au monde. Ceux-ci doivent accomplir les rites
et leurs devoirs tout en acqurant la connaissance.

L'Isha Upanishad a donn lieu des interprtations
diffrentes qui peuvent ne pas retenir cette division donne par
Shankara. En franais la traduction de Sri Aurobindo se
distingue. Nous avons autant que faire se peut suivi le texte au
13
12 UPANISHADS
mot mot pour viter tout glissement, avec en vue aussi bien
l'interprtation de Shri Shankaracharya que celle de Shri
Aurobindo.
14
12 UPANISHADS


:rrr r-i=- = ai+ ==r ==a (
a= +a= -r =irr =r =r: +-i-== ((((
Au ish vsyamidam sarva yatkica jagaty jagat |
ten tyakten bhujth m gdha kasyasviddhanam ||1||

Aum. Tout ce qui est changeant dans le monde,
tout cela est envelopp par le Seigneur. Par la
renonciation cela, aide-toi. Ne convoite pas la richesse
d'autrui.


+= +=rir i==iir-ca ==r: (
( i =r-rar i-a = += i=-a = ((-((
kurvanneveha karmi jijviecchatam sam |
evatvayi nnyatheto'sti na karma lipyate nare ||2||

Certes, en faisant les oeuvres, on doit dsirer vivre
cent ans ici
1
. Pour un homme tel que toi, il n'y a pas
d'autre moyen que celui-ci, par lequel l'action ne s'attache
pas ( l'homme)
2
.


=r =r= a =r+r -r= a==rar: (
ar -a ri-r=-ci-a + r===r ==r: ((((
asury nma lok andhena tamasvt |

1
Cela pour l'homme qui n'est pas jnanin, car pour celui-ci il n'y a ni
vie ni mort.
2
C'est dire la voie du renoncement ce qui est changeant dans le
monde.

15
12 UPANISHADS
t ste pretybhigacchanti ye ke ctmahano jan ||3||

Ces mondes asuriques (dmoniaques) sont
envelopps d'aveugles tnbres. Ceux qui tuent le Soi y
vont aprs leur dpart
3
.


==-+ ===r =ir ==--r r-== +=ra (
a-rrar -r=ia ia=-ri-=+r =rarirr -rria ((((
anejadeka manaso javyo nainaddev pnuvan prvamarat |
taddhvato'nynatyeti tihattasminnapo mtriv dadhti ||4||

Cela demeure sans mouvement, un(ique) et plus
rapide que la pense, les dieux (les sens) ne peuvent
l'atteindre dans sa progression en avant. Demeurant
stable, il distance tous les autres qui courent. Cela tant
l, Matarisva (l'air, l'nergie cosmique) supporte toutes
les activits.
4



a-=ia a=ia a-- aai-a+ (
a--a- =- a- =-r- =r=a: ((-((
tadejati tanaijati taddre tadvantike |
tadantarasya sarvasya tad sarvasysya bhmata ||5||


3
Ceux qui tuent le Soi sont ceux qui ne s'en proccupent pas, qui ne
sont nullement intresss par la vie spirituelle et la ralisation du
Soi.
4
Nous avons gard la traduction exacte du terme 'Tat', qui veut dire
'Cela' au lieu de le traduire comme le font beaucoup par Brahman.
Le terme 'Cela' est exactement ce que veut signifier lupanishad.
'Tat' en sanscrit est neutre : ni masculin, ni fminin, indfini, le
mental ne peut le connatre.
16
12 UPANISHADS
Cela se meut, Cela ne se meut pas; Cela est loin,
Cela est prs; Cela est au-dedans de tout; Cela est aussi
l'extrieur de tout.


-a =rir -rar-r=-r=+ri= (
=-rar r=r= aar = i==-=a ((((
yastu sarvi bhtnytmanyevnupayati |
sarvabhteu ctmna tato na vijugupsate ||6||

Celui qui voit tous les tres dans l'Atman mme et
l'Atman dans tous les tres, ne ressent aucune haine du
fait de cela (cette ralisation).


i-== =rir -rar-r=r-r- i=r=a: (
a +r =r=: +: rrr+ (+==+ra: ((((
yasmin sarvni bhtnytmaivbhd vijnata |
tatra ko moha ka oka ekatvamanupayata ||7||

Lorsque pour celui qui sait, tous les tres sont
devenus l'Atman mme, alors quelle illusion, quelle peine
peut-il y avoir, pour lui qui voit l'unit ?


= +=r-c+=+r=r=-=ri rra=+r+ia= (
+i==iri +i-r: ---rrraar rr= -rr-crrrai-: ==r-: ((((
sa paryagcchkramakyamavraamasnviram uddhamapviddham |
kavirman paribh svayambhrythtathyato'rthn
vyadadhcchvatbhya sambhya ||8||

17
12 UPANISHADS
Il est omnipntrant, pur, sans corps, sans nerfs,
sans blessure, sans tche, non touch par la faute,
omniscient, gouverneur du mental, transcendant et
existant par lui-mme; Il a assign les devoirs pour les
Prajapatis (annes ternelles). (5)


-r a=: irri-a ir=+r=a (
aar -r : a a=r = irr ar: ((((
andha tama pravianti ye'vidymupsate |
tato bhya iva te tamo ye u vidyy rat ||9||

Ceux qui rendent culte avidya (ignorance ou rites)
entrent dans des tnbres aveuglantes. En de plus grandes
tnbres que celles-ci entrent ceux qui sont engags en
vidya (connaissance, philosophie, mditation sur les
dieux).


--r= ir --r=ir (
:ia rr= rirrr =-a-ii=r ((((
anyadevhur vidyay anyadhuravidyay |
iti uruma dhr ye nastadvicacakire ||10||

Ils disent que par vidya un rsultat diffrent (est
obtenu) et que par avidya un rsultat diffrent (est
obtenu); ainsi avons-nous entendu des sages qui nous
l'ont expliqu.


ir rir -a--r-r == (
ir = air ir =a=r=a ((((
18
12 UPANISHADS
vidy cvidy ca yastadvedobhayam saha |
avidyay mtyu trtv vidyay'mtamanute ||11||

Celui qui connat la fois vidya et avidya, ayant
conquis la mort par avidya, atteint l'immortalit par
vidya.


-r a=: irri-a =--ria=+r=a
aar -r : a a=r = =--rr ar: ((-((
andhatama pravianti ye'sambhtimupsate
tato bhya iva te tamo ya u sambhtym rat ||12||

Ceux qui se vouent au non-devenir (prakrti non
manifeste) entrent dans des tnbres aveuglantes. En de
plus grandes tnbres entrent ceux qui se vouent au
devenir (hiranyagarbha).


--r=: =--rr---r==--rra (
:ia rr= rirrr =-a-ii=r ((((
anyadevhu sambhavdanyadhurasambhavt |
iti uruma dhr ye nastadvicacakire ||13||

Ils disent qu'un rsultat diffrent est obtenu par le
culte du devenir et qu'un rsultat diffrent est obtenu par
le culte du non-devenir. Ainsi l'avons-nous entendu des
sages qui nous l'ont expliqu.


=--ria i=rrr -a--r-r == (
i=rrr= = air =--rr =a=r=a ((((
19
12 UPANISHADS
sambhti ca vina ca yastadvedobhayam saha |
vinena mtyu sambhty'mtamanute ||14||

Celui qui connat la fois le non-devenir (prakriti)
et la destruction (le devenir) atteint l'immortalit par le
non-devenir en conqurant la mort par la destruction.


i=== +rr =-ri+i== ==r=
aa +r+rr =r=r c: ((-((
hiramayena ptrea satyasypihina mukham
tat tva pannapvu satyadharmya dye ||15||

L'entre de la Vrit est cache par un plateau dor.
O toi, Soleil, te-le pour que je la voie, moi qui suis par
nature vridique.


+r+r = = r=r+ = r=i= === (
a =r a a =+ +-rra= aa a +rri= r =r=r + =r: =r ==i-=
pannekare yama srya prjpatya vyha ramn samha |
tejo yat te rpa kalytama tat te paymi yo'svasau pura so'hamasmi ||16||

O nourrisseur, voyageur solitaire, contrleur,
acqureur, fils de Prajapati, retire tes rayons, ramasse ta
lumire. Je vois cette forme qui est tienne qui est la plus
bnie. Je suis ce purusha (cette personne) qui est l.


ri====a=r- -r-=r-a rri= (
+ar -= ja -= +ar -= ja == ((((
vyranilamamtamatheda bhasmntam arram |
20
12 UPANISHADS
Aum krato smara ktam smara krato smara ktam smara ||17||

Que mon nergie vitale atteigne maintenant l'Air
ternel; que ce corps soit rduit en cendres. Aum. Mental,
rappelle-toi de ce qui a t fait, rappelle-toi de ce qui a
t fait.


= = =+rr r -=r= irri= - =ri= iar= (
r-=-==rr==r -ri=r a ===i+ ir= ((((
agne naya supath rye asmn vivni deva vayunni vidvn |
yuyodhyasmajjuhurameno bhyih te namaukti vidhema ||18||

O Agni (Feu), connaissant toutes nos actions,
conduis-nous par le bon chemin la jouissance des fruits
de nos actions; te de nous toutes les fautes malhonntes.
Nous t'offrons beaucoup de salutations.



+r=-: +ri=- +rra +r=--a (
+r- +r=r-r +r=rirra ((
Aum pramada pramida prt pramudacyate |
prasya pramdya pramevvaiyate ||

Aum. Cela (Brahman inconditionn) est infini, ceci
(Brahman conditionn) est infini. De l'infini
(inconditionn) est apparu l'infini (conditionn). En
prenant l'infini de l'infini (conditionn), il demeure
comme le seul infini (inconditionn). (L'Infini
inconditionn) demeure le mme, mme si l'infini
(conditionn) est apparu partir de lui.
21
12 UPANISHADS



Amrtabindupanishad
(et Brahmabindupanishad)


Upanishad : goutte (de nectar) d'immortalit


L'Amritabindupanishad est l'une des 5 "Bindu
Upanishads", avec la Nadabindupanishad, la
Brahmabindupanishad, la Dhyanabindupanishad et la
Tejabindupanishad. Le texte de la Brahmabindupanishad est
pratiquement identique et nous en donnons les quelques
diffrences. L'Amritabindupanishad est rattache l'Atharva
Veda. Elle a aussi cinq strophes en commun avec la
Maitrayana Upanishad.

Il semble que la mention de 'Vasudeva' la fin soit
relativement tardive, alors que l'Upanishad est elle-mme
considre comme trs ancienne.
C'est bien entendu chacun de mditer sur cette Upanishad,
rsum de toute sagesse. Rappelons que le "bindu" est le point
de la lettre AUM, symbolisant le quatrime tat.
22
12 UPANISHADS




==r i= iair r+ rra rrra= (
rra +r==+-+ rra +r=ii=a= ((((
mano hi dvividha prokta uddha cuddhameva ca |
auddha kmasakalpa uddham kmavivarjitam ||1||

Le mental est dit tre principalement de deux sortes :
pur et impur. Le mental impur est celui qui est possd
de dsirs, et le pur est celui qui est dpourvu de dsirs.


== ( ==rrr +rr =-r=r=rr: (
=-rr irr=+ =+
5
i=ir -=a= ((-((
mana eva manuy kra bandhamokayo |
bandhya viaysakta mukta nirviaya smtam ||2||

En vrit le mental est la cause de la servitude et de
la libration des hommes. Le mental qui est attach aux
objets des sens conduit l'esclavage, et celui qui est
dtach des objets des sens conduit la libration. Telle
est la smrti.


ar i=ir-r- ===r =i+aia (
ar
6
i=ir i= ==: +r ===rrr ((((

5
Ici la Brahmabindupanishad porte =+S (muktyau) au lieu de =+a
(muktam) (mme sens).
6
Ici la Brahmabindupanishad porte a-=r (tasma) au lieu de ar
(ato) : mme sens : 'c'est pourquoi')
23
12 UPANISHADS
yato nirviayasysya manaso muktirisyate |
ato nirviaya nitya mana krya mumuku ||3||

Puisque la libration est pour le mental dpourvu
de dsir envers les objets des sens, le mental doit toujours
tre rendu libre d'un tel dsir par celui qui cherche la
libration.


i=-airr=c =i==a ==r i- (
-r r==r
7
-rr a-r a+= +-= ((((
nirastaviaysangha saniruddha mano hdi |
yad'ytytmano bhva tad tatparama padam ||4||

Lorsque le mental, son attachement pour les objets
des sens tant annihil, est pleinement contrl dans le
coeur et qu'il ralise ainsi sa propre essence, alors c'est
l'Etat Suprme.


ar- i=ra rai- =a =r= (
(a-nr= r= rrrr -rr i-a:
8
((-((
tvadeva niroddhavya yvaddhvdi gata kayam |
etajjnam ca dhyna ca eo nyyaca vistara ||5||


7
Ici la Brahmabindupanishad porte r-==r (ytyunmano) au lieu
de r==r (ytytmano)
8
Ici la Brahmabindupanishad porte =r=r ar -r =-ri-a: (mokam
ca ato'nyo granthastarah) au lieu de r= rrrr -rr i-a:
(dhynam ca eo nyyaca vistarah): le sens est le mme mais le
mot Mditation est remplac par celui de Libration.
24
12 UPANISHADS
On doit le contrler jusqu' ce qu'il s'unisse dans le
coeur. Ceci est la Connaissance et c'est Dhyana
(mditation) aussi. Tout le reste n'est qu'argumentation et
verbiage.


= i- = ri- = i- i-= aa
9
(
+=r+raii==+ = =+a a-r ((((
naiva cintya na ccintya na cintya cintyameva tat |
pakaptavinirmukta brahma sapadyate tad ||6||

Cela n'est ni concevable ni inconcevable, il est la
fois concevable et inconcevable. Dans cet tat ce
Brahman libre de toute partialit est atteint.


-r =rr==- -rr+= (
-rr=-rr= -rrr r -rr :a ((((
svarea sadhayedyogamasvara bhvayetparam |
asvarenubhvena bhvo v'bhva iyate ||7||

On doit pratiquer le Yoga sur Om d'abord au
moyen de ses lettres, puis mditer sur Om sans ses
lettres. Finalement l'ide du non-tre est atteinte comme
tre (on atteint l'tre, pas le non-tre).


a- i=+= = i=i+-+ i= === (

9
Ici la Brahmabindupanishad porte ri-=i- i-=
(ccintyamacintyam cintyameva ca) au lieu de ri- = i- i-=
aa (ccintyam na cintyam cintyameva tat) : mme sens.
25
12 UPANISHADS
a-=r=i=ia nrr = =+a r= ((((
tadeva nikala brahma nirvikalpa nirajanam |
tadbrahmhamiti jntv brahma sapadyate dhruvam ||8||

Cela seul est Brahman, sans parties, sans doute,
sans teinte. En ralisant "Je suis ce Brahman", on devient
le Brahman immuable.


i=i+-+==-a =a:r-ai=a= (
===rr-
10
-nrr =-a =r:
11
((((
nirvikalpamananta ca hetudntavarjitam |
aprameyamanrdi ca yajjtv mucyate budha ||9||

Sans doute (ou sans distinction), infini, au-del de
la raison et de l'analogie, au-del de toutes preuves et
sans cause, Le connaissant, le sage devient libre.


= i=rrr = r+i-r= =ar
12
= =rr+: (

10
Ici la Brahmabindupanishad porte +===r
(aprameyamandyam) au lieu de ===rr- (aprameyamanrdim),
ce dernier semblant tre une faute figurant dans notre texte.
11
Ici la Brahmabindupanishad porte nrr += irr= (jntv ca
paramam ivam) ('ainsi est connu l'apaisement suprme'), au lieu de
-nrr =-a =r: (yajjntv mucyate budhah).
12
Ici la Brahmabindupanishad porte -r = rrr===~~~~ (vandyo na ca
sanam) au lieu de =ar = =rr+: (baddho na ca sdhakah). Dans
la seconde partie : = ===rr = =i+ (na mumuk na muktiva) au lieu
de = ===r= =+a (na mumukurna cau mukta) : le sens gnral est le
mme.

26
12 UPANISHADS
= ===r= =+a :rr +=rrar ((((
na nirodho na cotpattirna baddho na ca sdhaka |
na mumukurna vai mukta itye paramrthat ||10||

La plus haute vrit est : il n'y a ni contrle du
mental, ni jeu du mental, je suis pas attach ni ne suis un
adorateur ni ne suis un chercheur de libration ni un tre
qui a atteint la libration.


(+ (r =r =-ar =r=--==ri-ar (
-rr=aia- +==-= = ia ((((
eka ev'tm mantavyo jgratsvapnasuuptiu |
sthnatrayavyattasya punarjanma na vidyate ||11||

En vrit l'atman doit tre connu comme tant le
mme dans ses tats de veille, de rve et de sommeil
profond. Pour celui qui a transcend les trois tats il n'y a
plus de renaissance.


(+ ( i= -rar=r -ra -ra i-ra: (
(+rr ==rr -ra ==--a ((-((

eka eva hi bhttm bhte bhte vyavasthita |
ekadh bahudh cauva dyate jalacandravat ||12||

Etant l'Un, l'me universelle est prsente en tous
les tres. Quoiqu'unique il est vu comme plusieurs,
comme la lune dans l'eau
13
.


13
La lune peut se reflter par exemple dans trois flaques d'eau
diffrentes et apparatre ainsi tre trois alors qu'elle est une.
27
12 UPANISHADS

r:=a=r+rrr
14
=i=r=
15
r: rr (
r:r =ia
16
=r +rrr arr =ir =-rr+=:
17
((((
ghatasavtamka nyamne ghate yath |
ghato nyeta n'ka tath jvo nabhopama ||13||

Tout comme c'est la jarre qui, lorsqu'elle est
enleve, change de place et non l'akasha contenu dans la
jarre, de mme c'est le jiva qui ressemble l'akasha.


r:iairr+r i-r=r= +=: +=: (
a--r= = =r=ria = =r=ria i=rr: ((((
ghatavadvividhkra bhidyamna puna puna |
tadbhagna na ca jnti sa jnti ca nityaa ||14||

Quand les formes diverses comme la jarre se
brisent encore et encore, il ne sait pas qu'elles sont
casses, mais Il sait parfaitement.


rr-=rrar = a==r ria
18
++ (
i-r a=i= +=+ (r=+ria ((-((

14
Brahmabindupanishad : =-ra=r+rrr (sambhrtamkam) au lieu de
=a=r+rrr (samvrtamkam) (aucune diffrence).
15
Brahmabindupanishad : =i=r= (liyamne) et =ia (liyeta )au lieu
de =i=r= (niyamne) et =ia (niyeta).
16
v. note ci-dessus.
17
Brahmabindupanishad : r:r+=: (ghatopamah) au lieu de =-rr+=:
(nabhopamah) (ther, akasha)
18
Brahmabindupanishad : r-rri-rria (yvattvattirti) au lieu de
= a==r ria (nauva tamas yti) (mme sens gnral)
28
12 UPANISHADS
abdamyvto naiva tamas yti pukare |
bhinne tamasi caikatvameka evnupayati ||15||

Etant couvert par Maya, qui est un simple son, au
travers de l'obscurit Il ne connat pas l'Akasha. Lorsque
l'Ignorance se dchire, tant alors Lui-mme Il voit
l'unit.


rr-r=r + = ai-=-=rir -=r= (
aiaar==r r-i-c-cri-a=r==: ((((
abdkara para brahma tasminke yadakaram |
tadvidvnakaram dhyyedyadcchchecchchntimtmana ||16||

La Parole imprissable est le Suprme Brahman..
Quand elle s'est vanouie, l'imprissable demeure. Que le
sage mdite sur l'imprissable, s'il souhaite la paix de son
me.


a i i-a a rr-= + a (
rr-=ir i=rra: + =rir=-cia ((((
dve vidye veditavye tu abdabrahma para ca yat |
abdabrahmai nita para brahmdhigacchati ||17||

Deux sciences doivent tre connues : la Parole-
Brahman (le Verbe-Brahman) et le Suprme Brahman.
Celui qui s'est plong profondment dans le Verbe-
Brahman atteint le Brahman Suprme.


29
12 UPANISHADS
=-r=-- =rri nr=inr=a+:
19
(
+=r=i= rr-ri =-=-r=rrra: ((((
grathamabhyasya medhv jnavijnnatatpara |
pallamiva dhnyarth tyajedgranthamaeata ||18||

Que celui qui souhaite obtenir la connaissance,
aprs avoir tudi les traits de connaissance intrieure et
de connaissance extrieure, les abandonne entirement,
comme l'homme qui cherche obtenir le grain
abandonne la paille.


=r==+rr=r =ri-r-+rar (
=ri+ra nr= i=ic=-a =r rr ((((
gavmanekavarna krasypyekavarat |
kravatpayate jna liginastu gav yath ||19||

Des vaches qui ont des couleurs diverses le lait est
de la mme couleur. On doit regarder Jnana (la
Connaissance) comme le lait, et les diffrents traits
comme les vaches.

rai= +i= i==: -ra -ra =ia () inr==(
=aa =-ria ===r =-rr=-ra= ((-((
ghtamiva payasi nigtham bhte bhte (ca) vasati vijnam |
satata manthayitavya manas manthnabhtena ||20||

Comme le beurre cach dans le lait, l'intelligence
demeure en chaque tre. Elle doit tre constamment
baratte par la tige servant baratter qu'est le mental.

19
Brahmabindupanishad : nr=inr=-a: (jnnavijnnatattvatah) au
lieu de nr=inr=a+: (jnnavijnnatatparah)
30
12 UPANISHADS


nr== ==r-r =aai?+=
20
(
i=+= i=r=
21
rrr-a a-=r=i=ia -=a= ((-((
jnanetra samdya uddharedvanhivatparam |
nikala nicalam nta tadbrahmhamiti smtam ||21||

Prenant la corde de la connaissance, on doit en faire
sortir, comme le feu, le suprme Brahman. Je suis ce
Brahman invisible, immuable, et calme, ainsi pense-t-on.


=-rarirr= () --rar ()
22
=i+
23
(
=r==r=+= a---= r=--a---= =- :ia ((--((
sarvabhtdhivsa (ca) yadbhteu ca vasatyapi |
sarvnugrhakatvena tadasmyaha vsudevastadamyaha vasudeva iti ||22||

Celui en qui tous les tres rsident et Qui rside en
tous les tres par la vertu de Son tre rpandant la grce,
Ce Vasudeva, je le suis, ce Vasudeva, je le suis.



20
Brahmabindupanishad : ai==a: (caredvahnimatah) au lieu de
=aai + (uddharedvanhivat)
21
Brahmabindupanishad : i=== (nirmalam) au lieu de i=r=
(nicalam)
22
Le premier p (ca) ne figure pas dans l'Amrtabindupanishad et le second y
figure mais ne figure pas dans la Brahmabindupanishad.
23
Brahmabindupanishad : olR;fk (vasatyadhi) au lieu de olR;fi (vasatyapi)

31
12 UPANISHADS



Sarvopanishad
(ou Sarvasaropanishad)


Il est dit de la Sarvopanishad qu'elle est la
quintessence des Upanishads. Elle dfinit d'abord 23
sujets en ordre conscutif, jusqu'au Parabrahman.

Pour cette traduction, nous nous sommes servis de
2 textes sanscrits, ayant entre eux quelques diffrences
vritablement mineures. Les diffrences trs minimes
n'ont pas t signales; celles un tout petit peu plus
importantes, dans les mots, mais qui n'altrent pas le
sens, l'ont t en notes ('V2 pour 'version 2''). La
diffrence majeure rside en un sloka qui diffre quelque
peu, ainsi qu'en d'autres slokas figurant dans certains
textes la fin de l'upanishad et qui semblent avoir t
rajouts plus tardivement, mais que nous faisons paratre
ici, afin d'tre complets. Nous avons, comme pour
l'Amrtabindu Upanishad, donn la translittration du
sanscrit en lettres romaines (avec des signes diacritiques
cette fois au complet) selon les rgles standardises en
juin 1988 par la Librairie Nationale de Calcutta mais
dj utilise auparavant.
32
12 UPANISHADS

La seule traduction franaise de cette upanishad
semble tre celle de B. Tubini, parue chez Adrien
Maisonneuve en 1952 et trs certainement disparue de la
circulation.
33
12 UPANISHADS
+r =-r: +r =rS=r: +r ir +r iia =r=--= =r-a
ai +r==: +rr=r ==r=r inr== r=--=: (
24
)
+r +ar =i: (
25
) =rn: =r=ri +:-rr -ar=i +r +=r=r
+=r=r =r =rr ia +r=r=rr(
26
) =r==r -=r-i=r=-
=ri-r=-a =r i-r=r= r==r =-r-aii-r=r=r-a-i-r=r=
+ria r =r ir =r i-r=r=r r i-ri=aa =r ir (
==ri-a-rr+r: ++=ri-r===ia: rr-r-ii-rr--r=r-
--r+=-ra a-r ==r =r=r aar==ri=arai-r: (
27
) +r:
rr-r-rr i+ r==r=r rr-r-i--r+=-ra a-r ==: --==
( a-rr+rr+=riarrrinr=r-rrr-r (
28
) a-r ==: =r-a=
(( ((

Om katha bandha katha moka k'vidy k vidyeti
jgratsvapna suupta turya ca kathamannamaya prnamayo manomayo
vijnamaya nandamaya (
24
) katha kart jva (
25
) ketraja sk
kastho'ntarym katha pratyagtm paramtm'tm my ceti
kathamtmevaro'(
26
)-ntmano dehdntmatvenbhimanyate so'bhimna
tmano bandhastannivttirmoka-stadabhimna krayati y s'vidy
so'bhimno yay'bhinirvartate s vidy |
manadicaturdaakaraai pukalairditydyanughtai abddnviayn-
sthlnyadopalabhate tad'tmano jgaraa tadvsanrahitacaturbhi (
27
)
karaai abddyabhve'pi vsanmayabddnyadopalabhate tad'tmana
svapnam caturdaakarayoparamdvieavijnbhvdyad (
28
) tad'tma-na
suuptam ||1||


24
La V2 prcise ici '=rrr' (koa - enveloppes).
25
La V2 ajoute ici 'pacavarga' (quintuple)
26
La V2 ajoute ici 'r=:' ('jva', me individuelle) kathamtmevara'
27
V2 : 'tadvsansahitaicaturdaa'
28
La V2 ajoute ici 'r-r-rr=+ra' (abddnnopalabhate)

34
12 UPANISHADS
Om. Qu'est-ce que le lien
29
? Qu'est-ce que la
libration ? Qu'est-ce que l'Ignorance ? Qu'est-ce que la
Connaissance ? Que sont les tats de veille, de rve, de
sommeil profond et Turiya
30
?

Que sont annamaya, pranomaya, manomaya,
vijnanamaya et Anandamayakoshas
31
? Qu'est-ce que
l'agent, qu'est-ce que le jiva, le connaisseur du champ, le
Tmoin, le Kutastha
32
, l'Antaryamin
33
? Qu'est-ce que
l'atman interne, qu'est-ce que le Paramatman, l'Atman,
Maya ?

Le seigneur de l'atman voit le corps et autres choses
de mme nature comme des choses autres que l'atman :
cet gosme est l'esclavage de l'atman. Sa cessation est la
libration. Ce qui cause cet gosme est l'Ignorance. Ce
par quoi cet gosme est compltement repouss est la
Connaissance.

Lorsque l'atman, au moyen de ses quatorze organes
des sens
34
commenant avec le manas (mental) et
favorablement influenc par le soleil (Aditya) et le

29
L'esclavage.
30
"Le quatrime" : le quatrime tat, au-del des trois autres.
31
Les enveloppes de nourriture, vitale, mentale, intellectuelle et de
batitude (v. 'HAMSA').
32
"Qui se tient au sommet".
33
Qui gouverne l'intrieur, guide intrieur.
34
Le manas, la buddhi, la chitta, l'ahamkara, les cinq organes de
connaissance (jnanendriyas) et les cinq organes d'action
(karmendriyas) (v. 'HAMSA')

35
12 UPANISHADS
reste
35
qui apparaissent l'extrieur, peroit les objets
grossiers tels que le son etc...
36
, alors c'est l'tat de veille
de l'Atman. Lorsque, mme en l'absence de son etc... (
35
),
il n'est pas dnu de pense envers eux (
35
), il
exprimente le son et le reste sous forme de dsir par le
moyen des quatre organes
37
, c'est l'tat de rve de
l'Atman. Lorsque les quatorze organes cessent leur
activit et qu'il y a absence de connaissance
diffrencie
38
, c'est l'tat de sommeil profond de l'Atman.


-rr-rrr--rr=ri=r - -rrr-rri=a =-a + (
39
)
-r a-r a-ri a-i=-a +rrrr rrr(
40
) +rrrr=r
===r =: +rrr :-a ( rrri-a-rrr-r-r =
+rrr -r a-a a-r rr=: +rrr :-a (a+rrra=+ar
==ri-a-rr +rr=r rr-ri-irr-=+-+ri-r=r--r +ria
a-r ==r=: +rrr :-a ( (a+rrr=+-a-=airr-
rrirrrnr (
41
) -r -rr=a a-r inr==: +rrr :-a (

35
La Lune, Visnu, Shiva, etc., qui prsident sur les 'quatorze'
organes des sens.
36
Les objets qui peuvent tre perus par les organes des sens, donc
qui peuvent tre entendus, touchs, vus, gots et sentis, etc.
37
Les quatre organes 'internes' formant l'antahkarana, savoir
buddhi, manas, chitta, ahamkrti.
38
Faisant voir les objets comme diffrents les uns des autres, faisant
voir plusieurs objets.
39
V2 : 'a-=' (caitanya) au lieu de caikya.
40
Ce mot n'est pas dans V2.
41
La V2 porte '(a-=rr=== aa=rkKs' (etatkoatrayasakta
tadgavieaje) au lieu de etatkoatrayasayuktastadgavie-
vieaje.
36
12 UPANISHADS
(a+rrra: (
42
) -+rrnr= :+ir+rri= =-a:=rr (
43
)
-r aa a-r =--=+rrr :-a ( ==r-:=r=ia=rr
-r-a: (
44
) +ar -r a-:ir =ia: ==r=iai=:ir
=ia-:=r=ia: rr--+rr =+==-rr: ==r-:=r=a: (
++r++=r==ri -rr r-arri=irr==r-arri=r=i=
+rrr -r -ra a-r+i=ar-=i :-a ( ==ri-r
rri-r (
45
) =-ri-r-cri-r (
46
) +ri-ra + =r :arr
+ =rrr r=i -rar=nr=r- a = i=ria ( r==i=rr
i== ai=r= r=r+rir-ai-=c rri -=i-ri-a
a +rrra a- = =rn :-a (( -((

avasthtrayabhvdbhvaski svaya bhvbhvarahita nairantarya
caikya (
39
) yad tad tatturya caitanya-mityucyate'nna-kry a
kon samho'nnamaya koa ityucyate | prdicaturdaavyubhed
annamaye koe yad vartante tad pramaya koa ityucyate
etatkoadvayasayukto manadicaturdaa karaairtm
abddiviaynsakalpdi-dhrmanyad karoti tad manomaya koa
ityucyate | etatkoatrayasayuktastadgavie-vieaje (
41
) yad'vabhsate
tad vijnamaya koa ityucyate | etatkoacatuaya (
42
) svakraajne
vaakaikymiva guptavaavko (
43
) yad vartate tad'nandamayakoa
ityucyate | sukhadukhabuddhyrayo vednta (
44
) kart yad tadeaviaye
buddhi sukhabuddhiraniaviaye buddhirdukhabuddhi abdaspara-rpa-
rasagandh sukhadukhahetava | puyappakarmnusr bhtv
prptaarrasadhirygamaprpta-arrasayogamiva kurvo yad dyate
tadopahitatvjjva ityucyate | manadica prdica (
45
) sattvdicecchdica

42
La V2 ajoute ici== (sasakta) - sasakti = contact troit.
43
Ici la V2 porte simplement 'vko'.
44
Ici la V2. porte '==r-:=r==r >=r -a:' (sukhadukhabuhy reyo'nta)
au lieu de 'sukhadukhabuddhyrayo vednta'.
45
Ici, la V2, au lieu de '=rrr-' (pradica) porte '=rrr--r-'
(prdicecchdica).
46
En revanche, elle ne porte pas ici le 'iccha' (dsir).
37
12 UPANISHADS
(
46
) puydicaite pacavarg ityete pacavarg dharmo
bhttmajndte na vinayati | tmasanidhau nityatvena pratyamna
tmopdhirya-stalliga arra hdgranthirityucyate tatra yatprakate
caitanya sa ketraja ityucyate ||2||

Lorsque l'essence de la conscience qui se manifeste
sous forme des trois tats est un tmoin des tats, elle-
mme dpourvue d'tat, positif ou ngatif, et demeure
dans l'tat de non-sparation et d'unit, alors on l'appelle
Turiya.

L'ensemble des six enveloppes formes par la
nourriture
47
est appel Annamayakosha (enveloppe
forme de nourriture). Lorsque les quatorze sortes de
Vayu
48
, qui commencent avec le Prana, sont dans
l'enveloppe forme de nourriture, on l'appelle alors
Pranamayakosha (enveloppe forme de prana, enveloppe
vitale).

Lorsque l'Atman, uni ces deux enveloppes,
accomplit, au moyen des quatre organes qui commencent
avec le manas
34
, les fonctions de dsir et autres qui ont
comme objets le son et les autres, on l'appelle
Manomayakosha (enveloppe mentale)

Lorsque l'Atman, uni ces trois enveloppes et en
connaissant les diffrences et les non-diffrences, brille,

47
A savoir : nerfs, os, molle, peau, chair et sang.
48
'Vent, air'. Les 14 sont les pranas et les vayu secondaires : prana,
apana, vyana, udana, samana, naga, kurma, krkara, devadatta
dhananjaya, vairambhana, sthanamukhya, pradyota et prakrta.

38
12 UPANISHADS
il est alors appel Vijnanamayakosha (enveloppe de
connaissance, enveloppe intellectuelle).

Lorsque ces quatre enveloppes demeurent dans leur
propre cause qui est Connaissance, de la mme manire
que le banyan demeure dans la graine de banyan, on
l'appelle alors Anandamayakosha (enveloppe forme de
batitude).

Lorsqu'il demeure dans le corps comme sige de
l'ide de plaisir et de peine, il est alors appel Karta
(l'agent). L'ide de plaisir est celle qui appartient 'celui
qui dsire les objets' et l'ide de peine aux objets
indsirables.Le son, le toucher, la vue, le got et l'odorat
sont les causes du plaisir et de la peine.

Lorsque l'Atman, suivant les actions bonnes et
mauvaises, s'est li au corps actuel et est vu effectuer une
union avec le corps non encore reu, il est alors appel
Jiva (me individuelle), du fait qu'il est limit par des
upadhis (adjonctions limitantes)
49
.

Les cinq groupes sont ceux qui commencent avec
le mental
34
, ceux qui commencent avec le prana
50
, ceux
qui commencent avec Sattva
51
, ceux qui commencent

49
Lorsque l'Atman, selon les bonnes et mauvaises actions, est li
avec le corps actuel et qu'il tablit une connexion avec le corps
futur....
50
V. 'HAMSA' : udana, prana, vyana, samana, apana.
51
d : sattva, rajas, tamas, les trois guna.

39
12 UPANISHADS
avec la volont
52
, et ceux qui commencent avec le mrite
et le dmrite
53
. L'ego possdant les attributs de ces cinq
groupes ne prit pas sans la connaissance de l'Atman
toujours atteint.

Ce qui, du fait de sa proximit avec l'Atman,
apparat imprissable et est attribu l'Atman, est appel
Lingasharira (corps subtil), le noeud du coeur. La
Conscience qui s'y manifeste est appele le Connaisseur
du champ
54
.



nranr=nr=r=ri-rriar-rrnrar -==ri-rriar-rr=i=:
--ria: = =r=ri-a ( =ri-i++ii=+r+-a
=rir=iaiirr:ar+=-=r=: =rir=ia-rr -r a-r
+:-r :-a ( +:-rr+i=a-r-r=r -=+=r-r=a-rr
=ir=r=i= ==r=-a= -r +rrra (
55
) r=r
a-r -ar=i-a ( (
56
) =r+ririi==+a: =rianr=-

52
Le groupe Iccha, savoir, volont, dsir, rsolution, doute, envie,
incrdulit, satisfaction, dsir de satisfaction, honte, peur et
imagination.
53
Le groupe Punya : mrite, dmrite, savoir et samskaras.
54
Le champ est le corps : les fruits de l'action y sont produits et
rcolts comme dans un champ.
55
La V2 porte ici '=r=a' (kyate) au lieu de 'prakate'.
56
La V2 porte ici un loka different : '=a nr===-a=r=-- =r+ririi==+
+:+=+:r+rir-i=a=rr=ianr=i-=r--rrr=r -r -rr== a-r -+-rr:'
(satya jnamanantamnanda sarvopdhivinirmukta
kaakamukudyupaghanavadvijnacinmtra-svabhvtm
yad bhsate tad tvapadrtha) (traduction dans le texte).

40
12 UPANISHADS
r=ir-=r-=+ r=r -a-r -r -rr=a a-r +-rr:
=r=-a ( = nr===-a=r=-- = ==i=rirr (
57
)
=r=-rr+r=-ai=i=-rr i=r= i=ri=rirr
a=i=-a (
58
) ( nr=i=+i-ri=rrri=a a-
nr=i=i-rria (
59
) (( ((

jtjnajeynmvirbhvatirobhvajt svayamevamvirbhvati-robhvahna
svayajyoti sa sktyucyate | brahmdipiplik-paryanta sarvapri-
buddhivaviiatayopalabhyamna sarva-pribuddhistho yad tad kastha
ityucyate | kasthdyupahitabhedn svarpalbhahetur-bhtv mai-
gaastramiva sarvaketrevanusytatvena yad prakata (
55
) tm
tad'ntarymtyucyate | (
56
) sarvopdhivinirmukta suvaravadvijnagha-
nacinmtrasvarpa tm svatantro yad'vabhsate tad svapadrtha
nacinmtrasvarupa tm svatantro yada'vabhsate tad tvapadrta
pratyagtmetyucyate | satya jnamanantamnanda brahma satyamavini
(
57
) nmadeaklavastunimitteu vinayatsu yanna vinayatyavini
tatsatyamityucyate (
58
) | jnamityutpattivinarahita caitanya
jnamityabhidhyate (
59
) ||3||

Celui qui est le connaisseur de la manifestation et
de la disparition du connaisseur, de la connaissance et de
l'objet qui peut tre connu, mais qui est lui-mme
dpourvu d'une telle manifestation et d'une telle
disparition, est appel le Tmoin.

Quand, tant peru d'une manire indiffrencie
dans la conscience de tous les tres, commencer par

57
La V2 porte, ici, en plus : 'i=rirr' (avini) : imprissable.
58
La V2 porte '===a a-==rr' (vinayati tadavini) au lieu de
'vinayatyavini tatsatyamityucyate'.
59
Dans la V2, ce loka devient : 'nr= =r=r-=-r==rr==a ==-a= a-=
nr==-=-=a' - jna nmotpattivinarahita nairantarya
caitanya jnamityucyate.
41
12 UPANISHADS
Brahma jusqu' la fourmi, il demeure dans la conscience
de tous les tres, il est alors appel le Kutastha (celui qui
rside dans l'irrel).

Quand, se tenant comme moyen de raliser la
nature relle du Kutastha et autres, qui sont des
diffrenciations du fait qu'ils possdent des adjonctions
limitantes, l'Atman se rvle comme tiss en tous les
corps comme le fil dans un collier de perles, il est alors
appel l'Antaryamin (le Seigneur intrieur).

Quand l'Atman brille, libre de toutes les
adjonctions limitantes, comme une entiret homogne
de conscience dans son essence de pure Conscience, alors
on l'appelle "Toi", et l'Atman intrieur (pratyagatman).

(A la place du shloka prcdent, la V2 donne celui-
ci :)

Vrit, Connaissance, Batitude, Infini, libre
d'adjonctions limitantes, de la mme manire qu'un lingot
d'or est libre des adjonctions limitantes que sont
bracelets, diadmes et autres choses, lorsque l'Atman
brille ainsi dans son essence, faite entirement de
Connaissance et d'esprit, il est alors appel 'Toi'.

La Vrit, la Connaissance, l'Infini, la Batitude,
c'est Brahman. La Vrit est imprissable; ce qui, lorsque
nom, espace, temps, substance, et cause sont dtruit, ne
meurt pas, c'est l'Imprissable; et c'est appel la Vrit.

Et la Connaissance, cette essence de Conscience
qui n'a ni commencement ni fin, on l'appelle
42
12 UPANISHADS
Connaissance. (3) (V2 : "Ce qui n'a ni naissance, ni
dclin, ni diffrenciation est appel Connaissance.")


=-a =r= =ia+rr =i- =ri+rr =ri= a-a+rr
a-air+ari--=i:+ r + r++ a-==-ai=-a
r=--r =r= ==ra--=+r +ii=ar=---==-r iirr:==r.
=+rr =-- :-a (aa-aa: - ==rr (
60
)
-ai=i=-ri-rri = a+-rr: +=r=r + =-a (
61
) (
+-rr-r+rir+r-r+-rrr-r+rir+ria==rr r+rrr==a:(
62
)
===: +=: =-rr=rr i=+-rr: --riar=-a a+-rr-
rr =-a (
63
) ( (
64
) =ri--a=i =rrr=rr=rrrrr =
=ai =r=ai = =-=ai -= (
65
) i+rria+r=ar

60
La V2 a ici (avant vastu...) : '-r=r' (deakla) : 'espace temps'.
61
La V2., au lieu de 'paramtm para brahmetyucyate', a
'===r-=-=-=a' -paramtmetyucyate) : donc simplement : 'est appel
Paramatma', sans ajouter 'Parabrahman'.
62
La V2 ne porte pas 'sarvagata'
63
Et c'est ici qu'elle parle de Parabrahman, avec ici une diffrence
sensible entre les 2 upanishads. La V2, au lieu de 'sattmtro....
atmetyucyate' porte simplement '=-rr=r==+rr= == =a=-==' -
sattmtrasvabhva para brahmetyucyate' - dont l'essence est
ralit, est appel Parabrahman.
64
Dans ce shloka encore quelques diffrences, la premire : ici au
dbut du shloka, la V2 ajoute :'=r=r =r=' - my nma : "Le nom
'Maya'"
65
La V2 ajoute le suffixe 'r=r' (dhik) 'svayama'.

43
12 UPANISHADS
i==-=rr =ai ( i==-=rr =ai (
66
) ==rrrr-r =r
=r-a (( ((

ananta nma mdvikreu mdiva suvaravikreu suvaramiva tantukryeu
tanturivvyaktdisiprapaceu prve vypaka caitanya-manantamityucyata
nando nma sukhacaitanyasvarpo' pari-mitnandasamudro'viia-
sukharpac'nanda ityucyata etadvastucatuaya yasya lakaa (
60
)
vastunimittevavyabhicri sa tatpadrtha paramtm para brahmetyucyate
(
61
) | tvapadrthdaupdhikttatpadrthdaupdhi-kdvilakaa kavatsarvagata
(
62
) skma kevala sattmtro'sipadrtha svayajyotirtmetyucyate'tat-
padrthac''tmetyucyate (
63
) | (
64
) andirantarvatn prampramasdhra
na sat nsat na sadasat svayama (
65
)vikr-dvikrahetau nirpyame'sat |
anirpyame sat (
66
) lakaany s myetyucyate ||4||.

Ce qui est nomm Infini est ce qui est, comme
l'argile dans les transformations de l'argile, comme l'or
dans les transformations de l'or, comme le fil dans les
fabrications de fil, permanent; la Conscience
omnipntrante qui est en tous les phnomnes de
cration commencer par le Non-Manifest, est appele
Infini. Ananda (batitude) est le nom de l'essence de la
Conscience, ocan de batitude sans mesure, tat de
bonheur indiffrenci. Cela, dont la nature quadruple est
une indication, et qui est permanent en espace, temps,
substance et cause, est appel l'tre de Cela, Paramatman,
Parabrahman.

Distingu de l'tre de "Tu" (tvam) qui est dou
d'attributs aussi bien que de l'tre de "Cela" (Tat) dou

66
Ici la V2 n'ajoute pas 'anirpyame sat ', elle porte simplement,
aprs 'nirpyame' sat' le suffixe de comparatif 'a=' - tara'.
Diffrence minime encore.

44
12 UPANISHADS
d'attributs, ce qui pntre tout comme le ciel, subtil,
entiret par lui-mme, pure Existence, tre de "Es"
(Asi)
67
. Lumineux par lui-mme, on en parle comme de
l'Atman; l'tre du "pas Cela" est aussi appel Atman.

Ce qui est sans commencement, fcond, ouvert la
fois la preuve et la preuve du contraire, ni rel ni
irrel, ni rel-irrel, non existant lorsque, du fait de
l'immuabilit de sa propre essence, la cause du
changement est constate, existant lorsqu'elle n'est pas
constate, qui est indfinissable, est appele Maya.


:rr+i=ri- =r+i=r=r ==r-a= ((
ityatharvopaniadi sarvopaniatsra samptam

Ici se termine la Sarvopanishad, qui fait partie de
l'Atharvaveda.



67
Cela se rapporte l'une des Mahavakyas : "Tat tvam asi" : (Toi
aussi) "Tu es Cela".

45
12 UPANISHADS
(Alors que le premier texte s'arrte ici comme dans
beaucoup de textes, on trouve quelquefois cette partie,
qui semble tre d'un autre auteur :)

nr= a-cr-=ai +r= i+ +r=rrr r-ai
=-=ia=ri++r=ri=-i=ri=-i==ir + = rr+a (
=r= -rr-= -r =i--rir -rr a ( = =ia= ==:
rrrr=+r-ar (( ((

ajna tucchpyasat klatrayo'pi pmara vstav ca
sattvabuddhirlaukiknmidamitthamityanirvacany vaktu na akyate | nha
bhavmyaha devo nendriyi deaiva tu | na buddhirna mana
avannhakrastathaiva ca ||1||

L'esprit empirique des profanes, infrieur, ne
subsistant pas dans les trois temps, habitant ceux qui sont
vulgaires, ne valant pas d'tre mentionn, est incapable
de parler de cette ignorance. Je ne suis pas ce moi, je suis
Dieu et ni les sens ni la buddhi ni le manas, ni l'ahamkara
ne sont ternels.


rrr ===r: rr-rr ==r-i=r i= =-r (
=r== =-r i=ir-=rr = = =rr: (( - ((

aprno hyaman ubhro buhvdn hi sarvad |
skyaha sarvad nityacinmtro'ha na saaya ||2||

Sans prana, sans manas, sans buddhi et autres, je
suis toujours pur. Je suis toujours tmoin, je suis, sans nul
doute, pure Existence ternelle.

46
12 UPANISHADS
=r= +a = -rr+r ja: =ri=r=++: (
==rira-a -=rr =-r : (( ((

Nha karta naiva bhokt prakte skirpaka |
matsnnidhytpravartante dehdy aja iva ||3||

Je ne suis ni l'agent ni sujet qui jouit mais tmoin
de la Nature (naturante, prakrti); ma proximit fait
mouvoir le corps et les autres.


-rrri=: =-r=--: rrar nr==r ==: (
r=r= =-rar=r i-r ==ri = =rr: (( ((

sthurnitya sadnanda uddho jnamayo'mala |
tmha sarvabhtn vibhu sak na samaya ||4||

Immuable, ternel, batitude ternelle, je suis pur,
fait de Connaissance, sans tche. Je suis l'Atman de tous
les tres, omniprsent, tmoin, il n'y a pas de doute.


r= =-r-a =r= r=rari-=+= (
=+ =r= =r= = += =r= =i--r=--=+= (( - ((

brahmaivha sarvavedntavedya nha vyomavtdirpam |
rpa nha na karma brahmaivha saccidnandarpam ||5||

Je suis le Brahman qui doit tre connu par tous les
vedanta(s). Je ne dois pas tre connu sous les formes
d'ther (espace), de vent (air) etc. Je n'ai pas de forme ni
de nom ni d'action. Je suis Brahman, fait d'Existence-
Conscience-Batitude.
47
12 UPANISHADS

=r= -=r =-== +ar = =r= rr: =ri++r= +ar = (
=r= a: rrr+=r=r +ar = =r= +ar =-r=r=rr +ar =
:+i=ra ((

nha deho janmamty kuto me nha pra kutpipte kuto me |
nha ceta okamohau kuto me nha kart bandhamokau kuto ma
ityupaniat ||

Je ne suis pas le corps, comment naissance et mort
m'affecteraient-elles ? Je ne suis pas le prana, comment
faim et soif m'affecteraient-elles ? Je ne suis pas
intelligence, comment la peine et l'attachement
m'affecteraient-ils ? Je ne suis pas agent, comment
servitude et libration m'affecteraient-elles ?

48
12 UPANISHADS



Tejabindu Upanishad
Upanishad du Point de Feu


La Tejabindu Upanishad est la dernire des cinq "bindu" upanishads
faisant partie de l'Atharva Veda.


a=i=--: + r= irraia i- i-ra= (
rr rrr-r rrr+a -r= === + a ((((
Aum tejabindu para dhyna vivtta hdi sthitam |
ava bhava kta sthla skma para ca yat ||1||

1.- Om. Au sujet du Point de Feu
68
. Sa mditation
suprme est au-del dumonde, situe dans le coeur,
(atteignable) par l'Anava, le shakta et le Sambhvava
69
; (la

68
Le Point de Feu est bien entendu l'Atman, la Lumire des
lumires.
69
Ce sont les trois modes d'initiation mentionnes dans les critures :
1) Anava o le Guru communique un mantra son disciple que ce
dernier doit rpter et l'instruit par ailleurs; 2) Shakta : confre par
les siddhas (mes parfaites) qui peuvent instiller la plus haute
conscience spirituelle dans le disciple sans que celui-ci ait
entreprendre une sadhana particulire; 3) Shambhava, o les plus
grands instructeurs de l'humanit lvent le disciple au plus haut
stade de ralisation.
49
12 UPANISHADS
mditation) est grossire, subtile aussi bien que
transcendantale.


-:=r -rr -= -r= (
-==r --a r= ==i=r ==iirrr= ((-((
dusdhya ca durrdhya duprekya ca durrayam |
durlaka dustara dhyna munn ca munim ||2||

2.- Mme pour le sage et le penseur, cette mditation est
difficile accomplir, difficile atteindre, difficile
connatre et difficile supporter.


i=ar=rr i=a+rrr i=a===r i=ai--:
i=a-ar i==+rr i=rrri+i==: ((((
jithro jitakrodho jitasaago jitendriya |
nirdvandvo nirahakro nirraparigraha ||3||

3.- (Pour l'atteindre, il faut tre) frugal en ce qui concerne
la nourriture, matre de la colre, de l'attachement et de
ses passions; libre des paires d'opposs, dpourvu du sens
de l'ego et libre du sens de la possession.


=-=-+a ===r=rr=r==: (
==rri= iir i--i-a irr=r == =-a ((((
agamyagamyakarta ca grmnrthamnasa |
mukhni tri vindanti tridhm hasa ucyate ||4||

4.-On doit tre quelqu'un qui rend accessible ce qui est
inaccessible, quelqu'undont le seul but est de ne servir
50
12 UPANISHADS
que le Guru et sa cause. (Les sages) en atteignent les trois
portes. (Aussi) l'me Suprme est-elle dite possder trois
accs
70
.


+ ==i=- -rr==+a = i=r= (
r==+ +=r=== irr-a+ +-= ((-((
para guhyamida sthnamavyakta brahma nirrayam |
vyomarpa kalskma viostatpara padam ||5||

5.- Ceci est suprme, cach dans le mystre, lieu de repos
et imperceptible; c'est Brahman, sans support, de la
nature de l'espace illimit, atomique (indivisible et
minuscule) et subtil. C'est la Demeure Suprme de
Vishnu
71
.


Z-=+ i=r -rr= irra =+ri=a= (
i=r= i=i+-+ i+rrr i=r= ((((
tryambaka trigua sthna tridhtu rpavarjitam |
nicala nirvikalpa ca nirdhra nirrayam ||6||

6.- Tryambaka
72
, contenant les trois Gunas, support (de tout); les
trois mondes sont ses composants lmentaires et essentiels;

70
Les trois portes, si l'on s'en rfre au vers lui-mme et au
prcdent, sont le renoncement, l'absence d'ego et le dvotion envers
le Guru. Les trois accs : tat de veille, de rve et de sommeil
profond.
71
Driv de la racine 'vish", il signifie "ce qui imprgne tout, ce qui
rside en tout".
72
Tryambaka : trois yeux.

51
12 UPANISHADS
dpourvu de forme, immuable, inconditionn, qui ne peut tre
contenu, et sans substratum.


=+riri=a -rr= r===r aia=r= (
--rr-rr=r=r= =rra++-r-=a= ((((
updhirahita sthna vamano'ttagocaram |
svabhvabhvangrhya saghtaikapadojjhatam ||7||

7.- C'est l'tat libre de toute condition limitante, au-del
du domaine de la parole et du mental, perceptible par la
pense sur son propre tat (d'tre), et abandonn par les
mots dnotant la pluralit aussi bien que l'unit.


r=-- =--=raia -===== (
i-ri-rii==+a rrrra r=-a= ((((
nanda nandantta duprekyamajamavyayam |
cittavttivinirmukta vata dhruvamacyutam ||8||

8.- Le Bonheur lui-mme, au-del de la causalit du
bonheur, difficile tre vu, sans naissance, immuable,
libre de toutes fonctions mentales, ternel, constant et
imprissable.


a-=rr a-r= ai=r a+rr= (
i-ri-r=r=r= a-r= += i-ra= ((((
tadbrahmaa tadadhytma tanni tatparyaam |
acittacittamtmna tadvyoma parama sthitam ||9||

9.- C'est Cela qui est Brahman. Il est Cela qui est
adhyatma (spirituel), Il est Cela qui est la limite extrme.
52
12 UPANISHADS
Il est Cela qui est le Refuge Suprme; Il est connaissance,
indpendant de ce qui est mental, Il est l'Atman, Il est de
la nature de l'espace infini, tabli (en tout).


rr- rr--rr rr-raia=i-ra= (
= r= = r rar = r ( ((((
anye nyabhva ca nyttamavasthitam |
na dhyna na ca v dhyt na dhyeyo dhyeya eva ca ||10||

10.- Bien qu'Il soit ce qui n'est pas vide, quoique conu
comme vide, Il transcende le vide et Il est fix
fermement. L il n'y a ni penseur, ni pense ni pensable.
On doit pourtant mditer sur Cela.


= a+= rr- = + +=r+= (
i-==a = = = =i-: ((
==i=r a-+a a = -r = + +-: ((((
sarva tatparama nya na para paramtparam |
acintyamaprabuddha ca na ca satya na savidu
munn tattvayukta tu na deva na para vidu ||11||

11.- Cela est Tout, Suprme, de la nature de l'espace, il
n'y a rien qui lui soit suprieur; plus haut que le plus
haut, inconcevable et libre des expriences de l'tat de
veille. Ce n'est pas que les sages qui se dvouent eux-
mmes la Vrit ne connaissent pas Cela comme
Ralit. Ce n'est pas non plus que les dieux ne
connaissent pas Le Plus Haut.


53
12 UPANISHADS
=r-r =r= -r -+ +r= +rr i+i-=r= (
rriarr =ri++r= =+-+ i+-++= (
= =+=-+ = =i+a =-r== ((-((
lobha moha bhaya darpa kma krodha ca kilbibaam |
toa kutpipsa ca sakalpa ca vikalpakam |
na brahmakuladarpa ca na mukti granthasacayam ||12||

12.- Il n'est pas (connu de ceux pourvus d') avarice,
d'illusion, de peur, d'gosme, de dsir, de colre et de
pch (ou de maladie) ou qui connaissent froid et chaud,
faim et soif ou rsolution mentale et indcision, ou qui
sont fiers de leur naissance dans une famille brahmane,
ou d'avoir lu une masse de livres sur Mukti (la
libration).


= -r ==r-:=r arr =r=r+=r=r (
(a- -rrii== +a a-= r= = a+ a-= r= = a+i=ia ((((
na bhaya sukhadukha ca tath mnpamnayo |
etadbhvavinirmukta tadgrhya brahma tatpara tadgrhya brahma tatparamiti ||13||

13.- Il n'est pas (connu de ceux qui connaissent) la peur,
ou le plaisir et la peine, ou l'honneur et la disgrce. A
celui qui est libre de ces ides, Brahman se manifeste,
celui dont le plus haut refuge est Brahman, oui, ce
Suprme Brahman se manifeste celui dont le refuge le
plus haut est Brahman.


:r- a=i=--+i=r==r-ar ((
ityatharvavede tejabindpaniatsampt ||

Ici se termine la Tejabindupanishad, contenue dans l'Atharvaveda.
54
12 UPANISHADS





Brahmopanishad


La Brahmopanishad appartient l'Atharva Veda. Cette Upanishad
traite de la nature de l'Atman qui connat quatre tats de conscience.



=r=+r = ==rrr=r === -r=-a i+-+=r-=+-ca (
i- =+ =iai=ar -ri-a +r ==i-a +-r =i==r =-r
r =r =i==r =-r + (r: (
Om aunako ha vai mahlo'garasa bhavavanta pippaldamapcccat |
divye brahmapure sapratit bhavanti katha sujanti
kasyaia mahim babhva yo hyea mahim babhva ka ea |

1.- Om ! Shaunaka, matre de maison de renom, demanda
un jour Bhagavan Pippalada de la famille d'Angira :
Dans ce corps, la cit divine de Brahman, installs
(dedans), comment crent-ils (les devas) ? De qui ceci
constitue-t-il la gloire ? Qui est celui qui devient toute
cette gloire ?


a-= = =rr =ir i=r= ( rr =r r=r ( r==r
=i==r =-r -r=r=r: = -r=r i=r==i=r= i- =+
55
12 UPANISHADS
i= i=+= rr-r==r -= i-rria = i=-cia =r+r==
=r=r+i-ia ( rr =r=ri++= a-a=r =r= ii=r+ia
a=r++ria arr rrr -r ria ==:=rj (
rr-ar-ar: =r =r-=: ( =+ r=r+rrrrr =r
r==ri ria -=r== =r-ar =a rr ---rr :=r
i+ ar-==r=r =i=:r+a: rr-rrrr-r= i=-a ( rr +=rr
i=+r= r=--=+ria arr ---r: --= r=--=i-rria (
- ( + -ria: -ria+r=r -riar=--a ( -r-a=
--=r =cia ==+ra ( rr ==r+r === =r=r=
=ia + =r ( + =r+ =ia = =r=-i-rria (
rr ++r=r:+ ==ia ( a= -a= : =-=a --ri=:
( =r=ia rr-rrrr-r i==+a=- -- = ==rr -ar=i
=r=: ++:+: ++: +=r: rrr i==r +r+ = r=r -ar
-ia ( ( - = + = r= =rn=ia ((((

tasmai sa hovca brahmavidy varim | prao yea tm | tmano mahim
babhva devnmyu sa devn nidhanamanidhana divye brahmapure
viraja nikala ubhramakara yadbrahma vibhti sa niyacchati
madhukararjana mkakavaditi | yath mkkaikena tantun jla vikipati
tenpakarati tathaivaia pro yad yti sasamkya | pradevatst
sarv n?a | suvape yenkavadyath kha yenamitya yti
svamlayameva suupto brte yathaivaia devadatto yaa?pi tatmno
nayatyevamiprtai ubhubhairna lipyate | yath kumro nikma
nandamupayti tathaivaia devadatta svapna nandamabhiyti | deva eva
para jyoti jyotikmo jyotirnandayate | bhyastenaiva svapnye gacchati
jalaukvat | yath halauk'gramagra nayatytmna nayati para sadhaya |
yatpara npara tyajati sa jgradabhidhyate | yathaivaia kaplaka
sanayati | tameva stana iva lambata devadeva yoni | yatra jgrati
ubhubha nirktamasya devasya sa saprasro'ntarym khaga
karkaaka pukara pura pro his parpara brahma tm devat
vedayati | ya evasa para brahma dhma ketrajamupaiti ||1||
56
12 UPANISHADS
1.- Il (Pippadala) lui (Shaunaka) transmit la suprme
sagesse du Brahman : Cela est prana
73
, l'Atman
74
. Il
constitue la gloire de l'atman
75
, la vie des devas. Il
reprsente la fois la vie et la mort des devas
76
. Ce
Brahman qui brille dans la divine Brahmapura
77
en tant
que pur Un, dpourvu d'effets de la manifestation
78
,
brillant par Lui-mme, Omnipntrant, contrle (le jiva)
de la mme manire qu'une araigne contrle la reine des
abeilles
79
. De la mme manire que les araignes, au
moyen d'un fil, projettent et retirent la toile, de mme
aussi le prana se retire en retirant sa cration. Le prana
appartient aux nadis
80
comme leur devata
81
. Dans le
sushupti (sommeil profond) on va jusqu' sa propre

73
Dans la Prashnopanishad, Pippadala donne la philosophie
complte relative au prana.
74
Il y a ici identification complte entre l'atman ('me') et le prana
('souffle').
75
Le prana est la gloire (mahima) de l'atman en ce qu'il en est la
manifestation extrieure.
76
Les devas sont ici les sens qui sont des manifestations extrieures
du prana; naissance et mort des sens signifient extriorisation du
prana et rsorption en le prana.
77
Brahmapura signifie 'la ville du Brahman, ainsi est nomm le
corps humain.
78
Il y a 16 kalas ou effets de la manifestation. Dans la
Prashnopanishad, Pippadala esplique comment travers eux
Brahman semble se reproduire en tant qu'homme et comment,
lorsque ces 16 effets s'unissent comme des rivires dans l'ocan, seul
demeure l'Akala (sans kala) ou le Nishkala (d).
79
Exactement au roi des abeilles : Madhukararaja.
80
Voir 'HAMSA' pour toute explication. Le prana circule dans les
nadis, c'est la relation entre le prana et les sens.
81
Le prana est le devata (dit intrieure) des nadis. L'unique prana
devient plusieurs.

57
12 UPANISHADS
demeure, comme un faucon avec le ciel
82
. On dit : de la
mme manire que ce Devadatta
83
ne s'enfuit pas mme
lorsqu'il est frapp avec un bton, mme alors il ne
s'attache pas aux consquences bonnes ou mauvaises des
activits prescrites pour l'homme; de la mme manire
qu'un enfant se rjouit sans motif ni fruit dsir, mme
ainsi ce Devadatta jouit du bonheur dans cet tat.
84
. Il sait
qu'il est la Lumire Suprme. Dsirant la Lumire il jouit
de la Lumire. De mme il retourne par le mme chemin
l'tat de rve, comme une sangsue : de la mme
manire qu'une sangsue se porte sur les autres points en
face, en se fixant d'abord sur le prochain point. Et cet tat
qu'il n'abandonne pas pour un tat suivant est appel l'tat
de veille. Tout comme une dit porte les huit coupes
sacrificielles en mme temps
85
. C'est de Lui que la source
des Vedas et des Devas pend comme des seins.
Particulirement dans cet tat de veille, bien et mal
s'obtiennent pour l'tre brillant
86
, comme c'est ordonn.

82
Image du faucon retournant son nid qui se trouve sur le ciel.
83
Devadatta : Mr Toutlemonde, Monsieur X. Traduction littrale :
Dieu donn.
84
Dans l'tat de sommeil profond, on rejoint sa demeure, sa nature.
L il n'y a plus de dualit, de bien ou de mal, il n'y a plus de sujet ni
d'objet, et donc plus de dsir. Cela rappelle la signification de la
phrase de Jsus" : "Soyez comme ces petits enfants qui viennent
Moi."
85
L'Upanishad dit ici qu'il n'y a pas un tat (sommeil profond, rve
ou veille) qui surpasse l'autre mais qu'il y a une 'concentration' dans
notre conscience lorsqu'elle entre dans l'un de ces tats, suivie par
un retrait inconscient du contact avec le dernier tat o elle se
trouvait.
86
C'est dans l'tat de veille en particulier que l'tre brillant (le Soi
de l'homme) exprimente bien et mal.

58
12 UPANISHADS
Cet atman est totalement tendu par lui-mme, il est le
contrleur interne des choses et des tres, il est
l'Oiseau
87
, le Crabe
88
, le Lotus
89
, il est le Purusha, le
Prana, la propension tuer, la cause et l'effet, le Brahman
et l'Atman, il est le Devata qui fait connatre toutes
choses. Quiconque sait tout cela atteint le Brahman
transcendant, le support sous-jacent, le principe subjectif.



rr- +=r- ri -rr=ri= -ri-a =ri-r - += =ria
( a a+r- = i-rria ( =r=ia --= =r-a aii=ia
( =r=ia =r --= ir: =r-ar =--ai +=r=r =
ri-r irrrr = +=r: = rr: = =i: =r i=:
=rr =r=-rrr = + = i-ria (
-===-+=r=+rir+r- -riai=a = a =r+r = =r+r
-r = -r -r = -r nr = nr =rar = =rar i+ar = iar
-=rr = -=rr r-r=r = r-r=: +r-+=r = r-+=: =rr
= =r: +rrr = +r-ar+=r = ar+= :+= + =
i-rria ( r+rrr a=ir=r+rrr a=ir=r+rrr aa
r+rrr i-=i- =ia iia i-=i- ==ra ra ( =
i-rr: =r nr= ( = a -r =r: i+a :rra ia=:
=ii-ia ((-((

87
"Celui qui va dans le ciel". Il n'a pas d'autre support que lui-
mme.
88
'Le Soi en l'homme est dit tre le crabe parce que, pouss par le
dsir, il se meut dans tous les angles avec l'aide de ses organes des
sens.'
89
'Pushkara'. Il fleurit dans le temps, l'espace et la 'cause' mais tire
sa substance de quelque chose au-del de ces trois (du Turiya).

59
12 UPANISHADS

athsya purasya catvri sthnni bhavanti nbhihdaya kaa mrdhati |
tatra catupda brahma vibhti | jgarita svapna suupta turyamiti |
jgarite brahm svapne viu suuptau rdrasturya paramkara sa
dityaca viucevaraca sa pura sa pra sa jva so'gni sevaraca
jgratte madhye yatpara brahma vibhti | svayamamanaskama-
rotramapipda jyotirtavarjita na tatra lok na lok ved na ved dev na
dev yajna yaj mt na mt pit na pit snu na snu clo na
cla paulkaso na paulkasa ramao na ramana paavo na paavastpaso
na tpasa ityekameva para brahma vibhti | hdyke tadvijnamka
tatsuiramka tadvedya hdyka yasminnida sacarati
yasminnida sarvamota prota | sa vibho praj jyeran / na tatra dev
aya pitara ate pratibuddha sarvaviditi ||2||

2.- Maintenant ce Purusha a quatre siges : l'ombilic, le
coeur, la gorge et la tte
90
. En eux brille le Brahman
quatre aspects : l'tat de veille, de rve, de sommeil
profond, et le quatrime tat. Dans l'tat de veille, Il est
Brahma, dans l'tat de rve Il est Vishnu, dans l'tat de
sommeil profond Il est Rudra
91
; et dans le quatrime tat
(turiya) Il est le Suprme Un Indestructible; et Il est
encore Aditya (soleil), Vishnu, Ishvara, Il est Purusha,
Prana, le Jiva, Il est le Feu, l'Ishvara et le Resplendissant;
ce Brahman qui est transcendant brille en eux tous ! En
Soi-mme, Il est dpourvu de mental, d'oreilles, de mains
et de pieds, de lumire. Il n'y a pas non plus de mondes
existants ou non-existants, ni de Vedas ou d'absence de
Vedas, ni de Devas qui existent ou n'existent pas, ni de

90
Il est noter que l'on parle dj ici des centres allant de l'ombilic
la tte, de manipuracakra ajnacakra.
91
V. encore 'HAMSA'. Il est Brahma dans l'tat de veille parce que
l, comme il dsire, il cre. Dans l'tat de veille, les objets (de dsir
donc) sont prservs. Rudra est le nom de Shiva en tant que
destructeur (de la manifestation). Dans l'tat de sommeil profond, il
n'y a pas manifestation (des objets).
60
12 UPANISHADS
sacrifices qui existent ou non, ni de mre ni de pre ni de
belle fille existants ou n'existant pas, ni de fils de
Chandala ou de Pulkasa qui existent ou n'existent pas, ni
de mendiant existant ou non, ni toutes les cratures ou les
asctes existants ou non; seul l'Unique Brahman Suprme
y brille. Dans le fond du coeur se trouve cet Akasha de la
Conscience, avec de nombreuses ouvertures, le but de la
connaissance, l'intrieur de l'espace du coeur dans
lequel tout ceci (l'univers) se dveloppe et se meut, dans
lequel tout ceci est voil et tiss. (Celui qui sait ceci)
connat pleinement toute la cration. L les Devas, les
Rishis, les Pitris n'ont aucun contrle car, tant
pleinement veill, on devient le connaisseur de toute
vrit.


i--rr -ar: =r i- rrr: iai=ar: (
i- rrr =riar i= -==a ((
i- a- ia=ia nr +ia += +i =r+a === + -ara (
r=== ia= rr-r nr+ia ===-a a =: ((

hdisth devat sarv pr prati |
hdi praca jyotica trivtsytra ca yanmahat ||
hdi caitanye tiati yajopavta para pavitra prajpateryatsahaja purastt |
yuyamagrahya pratimu ca ubhra yajopavta balamastu teja ||

3.- Dans le coeur vivent les Devas, dans le coeur les
Pranas sont installs, dans le coeur existent le suprme
Prana et la Lumire comme aussi la Cause immanente
avec le cordon aux triples sections et le principe Mahat.
92


92
v. 'HAMSA' o tout est expos. Le principe Mahat est, en d'autres
termes, la Paraprakrti ou Parashakti, nergie indiffrrencie. La
61
12 UPANISHADS
Cela existe dans le coeur, c'est dire dans la Conscience.
"Mets le cordon sacrificiel qui est extrmement sacr, qui
se manifeste de toute ternit avec Prajapati, qui incarne
la longvit, le renom et la puret, et puisse-t-il tre pour
toi force et puissance !"


=irr=r += jr =i=:= =- =r: (
=-=r = a=i=ia rra ((
saikha vapana bahistra tyajed budha |
madakara para brahma tatstramiti dhrayet ||

Celui qui est clair doit rejeter le cordon extrieur en
l'enlevant avec la touffe de cheveux sacre sur la tte; le
Suprme Brahman en tant qu'Omnipntrant (ou ternel)
est le cordon, et il (celui qui est clair) doit mettre ceci
(le Brahman).


==r=i=r=: = =r= + +-= (
a= ii-a = = ir +-+r=: ((
scantstramityhu stra nma para padam |
tatstra vidita yena sa vipro pedapraga ||

Le Sutra (cordon) est appel ainsi parce qu'il perce et
commence
93
. Ce sutra constitue l'Etat Suprme
94
. Celui

cause avec les triples constituants, le fil aux triples sections, est
particulirement expose dans 'HAMSA' avec la triple manifestation,
selon les trois gunas.
93
La racine de 'sutra' est 'such-" qui signifie la fois "percer
travers" et "commencer". Le cordon' perce' en quelque sorte le
grain, il 'enfile', et par l 'commence' le processus de 'devenir', de
manifestation, de cration.
62
12 UPANISHADS
qui connat ce Sutra est le Vipra (sage), il est parvenu au-
del des Vedas.


a= =i=- ra ==ir=rr : (
a= rrr=i r=i-r--irrr= ((
tena sarvamida stramaaga iva |
tatstra dhrayedyog yogavittattvadarivn ||

Par Cela tout ceci (l'univers) est transfix, comme une
collection de pierres prcieuses est enfile sur un fil. Le
Yogi qui est le connaisseur de tous les Yoga et le voyant
de la vrit devrait mettre ce cordon.


=i=:= =iaar-r==-r==ri-ra: (
=-rr= = rr: = a=: ((
bahistra tyajedvidvnyogamuttamamsthita|
brahmabhvamaya stra dhrayedya sa cetana ||

Etabli dans l'tat du Yoga le plus lev, le sage devrait
enlever le cordon extrieur. Celui qui est rellement
conscient de soi doit mettre le cordon constitu de la
conscience de Brahman.


rrrr-r- =- =ri-c:r =rrri-ra (
==-a=a rr nr=nr+iia=r= ((
dhrattasya strasya nocchio nsucirbhavet |
stramantargata ye jnayajopavtinm ||

94
Le sutra lui-mme, en tant que tel (sur lequel sont ventuellement
enfils les grains).
63
12 UPANISHADS
A cause du port de ce sutra, ils ne peuvent ni devenir
contamins ni sales, ceux qui ont ce cordon en eux, ceux
qui ont ce cordon sacrificiel de la connaissance.


a =i-r =r+ a nr+iia=: (
nr=irri=r=r nr=i=r=r nr=nr+iia=: ((
te vai stravido loke te ca yajopavtina |
jnaikhino jnayni jnayajopavtina ||

Eux, parmi les hommes, connaissent le Sutra, ils portent
le cordon sacrificiel, ceux qui sont dvous Jnana (la
Connaissance), qui ont cette Jnana pour touffe de
cheveux sacre, cette Jnana pour cordon sacr.


nr== + arr +i nr==-r== (
=i irr=rr =r-r - nr==i irr=rr ((
= irr=ri-a iari=a +rrrrir: ((
jnameva para te pavitra jnamuttamam |
agneriva ikh nny yasya jnamay ikh ||
sa ikhtyucyate vidvnitare keadhria ||

Pour eux Jnana est le purificateur le plus grand, Jnana est
ce qu'il y a de mieux en tant que tel. Ceux qui ont cette
Jnana pour touffe de cheveux sont aussi non-diffrents
d'elle que l'est le feu de sa flamme. Le sage est dit tre un
Shikhi (porteur de la touffe de cheveux), tandis que les
autres sont de simples cultivateurs de cheveux.
95



95
"Flamme est aussi appel 'Shikh'. Comme le feu est un avec sa
Shikh, de mme le jnani est un avec sa shikh (ou jnana).
64
12 UPANISHADS
+=irjar a i-+ =rrr-: (
a: =rri=- = i+rc aia -=a= ((
karmyadhikt ye tu vaidike brhmadaya |
tai sadhryamida stra kriyga taddhi vai smtam ||

Mais ceux des classes comme les brahmanes ...qui ont le
droit d'accomplir des travaux vdiques doivent mettre ce
cordon sacr, car surement ce cordon est dcrt faire
partie de tels travaux.


irr=rr nr==i - =+ia a-== (
=r =+= a- :ia = i-r i-: ((
ikh jnamay yasya upavta ca tanmayam |
brmanya sakala tasya iti brahmavido vidu ||

Celui qui a Jnana comme touffe de cheveux ainsi que
pour cordon sacr a tout ce qui caractrise l'tat de
Brahmane, aussi connais ceux qui connaissent le
Brahman !


:- nr+ia a +i +rr= (
= iar-nr+iai -r= n: = nia ((
ida yajopavta pavitra yatparyaam |
sa vidvnyajopavt sytsa yaja sa ca yajavit ||

Ce cordon sacr est, aussi, la purification (mme) et ce
qui est la fin de tout; et celui qui porte ce cordon sacr est
le sage, il est Yajna lui-mme aussi bien que celui qui
connat le Yajna.

65
12 UPANISHADS
(+r -: =-rar =:: =r+i =-rar-ar=r (
+=r=r: = -rarirr=: =r=ri ar +=r i==rr ((
eko deva sarvabhteu gua sarvavyp sarvabhtntartm |
karmdhyaka sarva bhtdhivsa sk cet kevalo nirguaca ||

L'unique Dieu en tous les tres demeure cach,
omnipntrant et Soi de tous les tres, contrlant et
surveillant toutes les actions, vivant en toutes les
cratures et Tmoin, l'Intelligence Suprme, l'Un sans
second, sans attributs.


(+r ==iri i=i+rrr ===r=+ =-a ==rr : +ria (
a=r=r= =+ri-a rir-arr rrri-a: rrrrai =arr= ((
eko man nikray bahnmeka santa bahudh ya karoti |
tamtmna ye'nupayanti dhrste nti vat netarem ||

L'unique tre Intelligent parmi les nombreux inactifs, Lui
qui fait les nombreux partir de ce qui est un; les
hommes sages qui dcouvrent cet Atman, la paix
ternelle est leur, non aux autres.


r=r==ir jr r r-rrir= (
r=i==r=r-r=rd +ri=:a ((
tmnamarai ktv praava cottarraim |
dhynanirmathanbhysddeva payennigavat ||

66
12 UPANISHADS
Ayant fait de soi-mme l'Arani
96
et du Pranava
97
l'arani
suprieur, et les frottant ensemble par la pratique de la
mditation, vois Le dans sa ralit cache.


r=ri-rrr a-a-==a ==i+ (
=r=--= arr =ir =-cr=-ca +=: ((
arbhirth tantnsjate saharatyapi |
jgratsvapne tath jvo gacchtygacchate puna ||

Comme l'araigne tisse sa toile (en dehors d'elle) et la
retire, de mme le jiva sort de et rentre dans les tats de
veille et de rve respectivement.


+m+rrrai+rrr =ir r-rr==r= (
- aia=r=iriar-r a= ==a ((
padmakoapratka suira cpyadhomukham |
hdaya tadvijnydvivasy''yatana mahat ||

Le corps ressemble au calice d'un lotus, plein de cavits
et la face tourne vers le bas. Sache que cela est la grande
demeure de l'univers entier.


=-r =r=a ir+= --= ii=i-rra (
=r-a --r ai =i= =i-ra= ((
netrastha lgrata vidytkaa svapna vinirdiet |
suupta hdayastha turya mrdhni sasthitam ||

96
L'arani est un morceau de bois de l'arbre Shami, utilis pour
allumer le feu sacr par friction.
97
Le son AUM.
67
12 UPANISHADS
Sache que l'tat de veille a pour centre les yeux; l'tat de
rve doit tre assign la gorge; l'tat de sommeil
profond se trouve dans le coeur; et le quatrime tat se
trouve la couronne de la tte
98
.


-r=r nr=r= =r-r +=r=i= (
a= =r r== a-=r=ri-r--== ((
yadtm prajaytmna sadhatte paramtmani |
tena sadhy dynameva tasmtsadhybhivandanam ||

Du fait qu'un individu tient son atman dans le
Paramatman au moyen de Prajna (comprhension
spirituelle), nous avons ce qui est appel sandhya et
dhyana, de mme que l'adoration associe au Sandhya
99
.


i=r-+r r==r r++r+=rri=ar (
=ir=i =-rar=r =r =r =+-i-=r= ((
nirodak dhynasadhy vkkyakleavarjit |
sadhin sarvabhtn s sadhy hyekadainm ||

Le Sandhya par mditation est dpourvu de toute offrande de
liquide ainsi que de tout effort du corps et de la parole; c'est le
principe unificateur pour toutes les cratures, et ceci est
rellement le Sandhya pour les Ekadandis
100
.



98
Respectivement ajnacakra, vishuddhacakra et saharapadma.
99
Le Sandhya est une forme de culte l'aube, midi et au
crpuscule. Dhyana est la mditation.
100
Sannyasins ( un bton).

68
12 UPANISHADS
ar rr i=a-a r- ===r ==(
r=--=a-=i- nrr =a =r: ((
yato vco nirvatante aprpya manas saha |
nandametajjvasya ya jtv mucayate budha ||

De quoi, sans L'atteindre, la parole retombe avec le
mental, cela est la Batitude (absolue) de cet tre incarn,
le connaissant le sage est libr.


=ri+==r=r= =ri =i+iri+a= (
r=ira+r== a-=r+i=r+= ((
=r=+=+r a-=r+i=r+i=ia ((
sarvaypinamtmna kre sarpirivrpitam |
tmavidytapomla tadbrahmopaniatparam ||
sarvtmaikatvarpea tadbrahmopaniatparamiti ||

(Et la Batitude est vraiment) l'Atman qui pntre
l'univers entier, comme le beurre dans le lait.
Ceci est la Brahmopanishad, ou la sagesse suprme du
Brahman, sous la forme d'une unit de l'Atman de tous,
fonde sur la discipline spirituelle (tapas), c'est Vidya ou
science de l'Atman.


:r- =r+i=r==r-ar ((
ityatharvavede brahmopaniatsampt ||

Ici se termine la Brahmopanishad qui appartient
l'Atharvaveda.
69
12 UPANISHADS



Kaivalyopanishad

Cette Upanishad appartient l'Atharvaveda.



rrr=r=r -r=-a +=i===+==rr
rii= -r== =ir i=r
=-r =i--: ==r=r i==:r= (
r ira =+r+ +r= +r+ +=r ria iar=((((
athvalyano bhagavanta paramehinamupasametyovca
adhhi bhagavan brahmavidy varih
sad sabhdi sevyamn nigm |
yay'cirt sarvappa vyapohya partpara purua yti vidvn ||1||

1.- Alors Ashvalayana s'approcha du Seigneur
Paramesthi (Brahma) et dit : Enseigne-moi, Seigneur, la
connaissance de Brahman, la plus haute, toujours cultive
par le bon, cache, et par laquelle un homme sage loigne
instantanment toutes les fautes et atteint le Purusha plus
haut que le haut
101
.



101
Prakrti (la Nature naturante) est appele 'haut'. Donc ici Purusha
est plus lev que Prakrti.
70
12 UPANISHADS
a= = =rr i+ar==r r-ri+ar=r=r-i= (
= +=rr = =r r== r==+ =}a=r=rr: ((-((
tasmai sa hovca pitmahaca radcbhaktidynayogdavaihi |
na karma na prajay dhanena tygenaike amtatvamnau ||2||

2.- Et lui, le Grand Pre (Brahma) dit : "Connais la au
moyen de la foi, de la dvotion et de la mditation. Non
par les actions, ni par la progniture, ni par la richesse,
mais par la renonciation, certains atteignent l'immortalit.


+r =r+ i=i=a ==rr i-rr=a -ar irri-a (
-r-ainr==i=irarrr: =-r=r=r-a: rr=-r: ((
a ==r+r +r-a+r= +r=}ar+i=-i-a = ((((
parea nka nihita guhy vibhrjate yadyatayo vianti |
vedntavijanasunicitrth sanysayogdyataya udcasattv ||
te brahmalokeu parntakle parmttparimucyanti sarve |||3||

3.- Plus haut que les cieux, sigeant dans la caverne
(buddhi), cela brille qu'atteint celui qui s'est contrl -
celui qui s'est contrl, qui tant d'un mental pur s'est
bien rendu compte de la ralit, par la connaissance du
Vedanta et par le sannyasa ou renonciation. Dans la
sphre de Brahma, au temps de la dissolution cosmique,
ils deviennent tous librs de l'immortalit apparente la
plus haute de l'univers manifest
102
.


102
Ceux qui ne sont pas parvenus raliser Brahman dans cette vie
du fait de quelque obstacle, demeurent dans le Brahmaloka et se
fondent en Brahman au moment du Pralaya. Il est noter que les
deux dernires lignes se retrouvent dans la Mundaka Upanishad (6,
6).
71
12 UPANISHADS
ii+a-rr ==rr==-r: rri: ===iirr:rri: ((((
r=-r: =+=i--rir i== -r+ar -== r- (
+-i+ i= irr ii-a = irr- irrr+= ((-((
viviktadee ca sukhsanastha uci samagrvairarra ||4||
atyramastha sakalendriyi nirdhya bhakty svagur praamya |
htpuarka viraja viudca vicintya madhye viada viokam ||5||

4-5.- En un endroit retir, assis en sukhasana
103
, pur, le
cou, la tte et le corps droits, vivant dans le dernier
ashrama
104
, ayant contrl tous les sens, saluant son
propre guru avec vnration, mditant au-dedans du lotus
du coeur, sans tche, pur, clair et sans peine.


i-=+a==-a=+ irr rrr-a==a =ri==(
arr i-=r-ai=i==+ i-r i-r=--==+=--ra=((((
acintyamavyaktamanantarpa va prantamamta brahmayonim |
path'dimadhyntavihnameka vibhu cidnandamarpamadbhutam ||6||

6.- Inconcevable, non-manifest, de formes infinies, le
bon, le pacifique, l'immortel, l'origine des mondes, sans
commencement, sans milieu, sans fin, le seul,
omniprsent, Conscience et Batitude, le sans forme et le
merveilleux.


==r==r +=r -r ia=r= =i=+= rrr-a=(
rr =i==-cia -rari= ==-a=ri=r a==: +-ara((((
umsahya paramevara prabhu trilocana nikakaha prantam |
dhytv munirgacchati bhtoni samastaski tamasa parastt ||7||

103
Posture facile.
104
Quatrime et dernier stade de la vie : le sannyasa.
72
12 UPANISHADS
7.- Mditant sur Parameshvara
105
, alli Uma
106
,
puissant, trois yeux, au cou bleu, tranquille, l'homme
saint atteint Celui qui est la source de tout, le tmoin de
tout et qui est au-del des Tnbres (de l'ignorance).


= =r = irr: =--: =r =r: +=: -r: (
= ( ir: = rr: = +r=r i=: = --=r: ((((
sa brahm sa iva sendra so'kara parama svart |
sa eva viu sa pra sa klo'gni sa candrama ||8||

8.- Il est Brahma, Il est Shiva, Il est Indra, Il est
l'Immuable, le Suprme, le Lumineux par lui-mme, Lui
seul est Vishnu, Il est le Prana, Il est le Temps (Kala) et
le Feu (Agni), Il est la Lune (Chandrama).


= ( = --ra - -r ==ra== (
nrr a ==ia =r-: +-rr i=+a ((((
sa eva sarva yadbhta yacca bhavya santanam |
jtv ta mtyumatyeti nnya panth vimuktaye ||9||

9.- Lui seul est tout ce qui a t et tout ce qui sera,
l'Eternel (sanatana); Le connaissant, on transcende la
mort; il n'y a pas d'autre voie pour la Libert.


=-ra-r=r=r= =-rari= r=i= (
=-+r== += ria =r-= =a=r ((((

105
Le Seigneur Suprme.
106
Autre nom de Parvat.
73
12 UPANISHADS
sarvabhtasthamtmna sarvabhtni ctmani |
sampayan brahma parama yti nnyena hetun ||10||

10.- En voyant l'Atman dans tous les tres, et tous les
tres dans l'Atman, on obtient le Brahman le plus haut,
non par d'autres moyens.


r=r==ir jr r r-rrir=(
nr=i==r=r-r=ra +rrr -=ia +i-a: ((((
tmnamarai ktv prava cottarraim |
jnanirmathanbhyst pa dahati paita ||11||

11.- Faisant de l'atman l'arani
107
du dessous et du
pranava
108
l'arani du dessus, par la friction rpte de la
connaissance, un homme sage brle le lien (de
l'esclavage)
109
.


= ( =rr+i=ri=ar=r rri=r-rr +ia == (
-+r=ri-ii-rr=: = ( =r=+iai-a=ia ((-((
sa eva myparimohittm arramsthya karoti sarvam |
striyannapndivicitrabhogai sa eva jgratparitptimeti ||12||

12.- L'atman ainsi illusionn par Maya ou ignorance, c'est
lui qui s'identifie avec le corps et fait toutes sortes de
choses. Dans l'tat de veille il est celui qui atteint la

107
L'arani est une des deux pices de bois utilises jadis pour
allumer le feu sacr par friction.
108
OM.
109
Image dj rencontre dans la Brahmopanishad.
74
12 UPANISHADS
satisfaction au moyen des divers objets de plaisir, tels
que les femmes, la nourriture, la boisson, etc...


--= = =i: ==r-:=r-rr+ar -=rr +i-a=r=r+ (
=ri-a+r= =+= i=i= a=r i-r-ra: ==r=+=ia ((((
svapne sa jva sukhadukhabhokt svamyay kalpijvaloke |
suuptikle sakale vilne tamo'bhibhta sukharpameti ||13||

13.- Dans l'tat de rve ce Jiva ressent plaisir et peine
dans la sphre de l'existence cre par sa propre Maya ou
ignnorance. Pendant l'tat de sommeil profond, lorsque
tout est dissous
110
, il est matris par Tamas (ou non-
manifestation) et vient exister sous sa forme de
bonheur
111
.


+=r =-=r-a+=r=ra = ( =i: -i+ia =: (
+ +i-ia =i-aa-a =ra =+= ii= ((
rrr=r=--==r-=rr r-=-= ria + ((((
punaca janmntarakarmayogt sa eva jva svapiti prabuddha |
puratraye krati ya'ca jvastatastu jta sakala vicitram ||
dheamnandamakhaabodha ysmaillaya yti puratraya ||14||

14.- Encore, par sa relation avec les actions faites dans de
prcdentes naissances, cet Atman mme retourne l'tat
de rve ou l'tat de veille. L'tre qui joue dans les trois

110
Dans l'tat causal, comme la poupe de sel lorsqu'elle est plonge
dans la mer.
111
Cela signifie que tamas empche le jiva d'tre conscient qu'il se
trouve dans l'tat de Batitude.
75
12 UPANISHADS
cits
112
a fait apparatre partir de lui toute diversit. Il
est le substratum, la batitude, la Conscience indivisible
dans laquelle les trois cits se dissolvent.


(a-=r-=ra rrr ==: =i--rir (
=r r-riar+: +iri ir- riri ((-((
etasmjjyate pro mana sarvendriyi ca |
kha vyurjyotirpa pthiv vivasya dhri ||15||

15.- De Ceci apparaissent le Prana, le mental, tous les
sens, l'ther, l'air, le feu, l'eau et la terre qui supporte
tout.
113



+ = =r=r ir-ra= ==a (
===r===a i= a-= = aa ((((
yatpara brahma sarvtm vivasyyatana mahat |
skmtskmatara nitya tattvameva tvameva tat ||16||

16.- Cela qui est le Suprme Brahman, l'me de tout, le grand
support de l'univers, plus subtil que le subtil, et ternel, cela
est toi-mme, et tu es Cela.


=r=--a=r-ri-+ +rrra (
a-=r=i=ia rr ==-r: =-a ((((
jgratsvapnasuuptyvipraca yatprakate |
tadbrahmhamiti jatv sarvabandhai pramucyate ||17||

112
Les trois villes : le monde physique, le monde subtil, le monde
causal.
113
Shloka identique dans la Mundaka Upanishad, II, 3.
76
12 UPANISHADS
17.- Cela qui manifeste le phnomne, tel que les tats de
veille, de rve et de sommeil profond, Je suis ce
Brahman, en ralisant ainsi on est libr de tous les liens.


ir rr== --rr -rr+ar -rr=r --ra (
a-r i==rr: =r=ri i-=rr = =-rirr: ((((
triu dhmasu yadbhogya bhogaca yadbhavet |
temyo vilakaa sk cinmtro'ha sadiva ||18||

18.- Ce qui constitue le jouissable, le jouisseur et la
jouissance, dans les trois demeures, diffrent d'eux Je
suis, le Tmoin, la Pure Conscience, l'Eternel Bien.


= =+= =ra i = iai=a= (
=i = = ria a-=ra=--== ((((
mayyeva sakala jta mayi sarva pratihitam |
mayi sarva laya yti tadbrahmdvayamasmyaham ||19||

19.- En moi seul tout est n, en moi toute chose demeure,
et en moi tout est dissout. Je suis ce Brahman, le sans
second.

rrrir=== aa===r== ir== i= (
+ra=r = +=rr ==irrr i==r = irr=+=i-= ((-((
aoraynahameva tadvanmahnaha vivamaha vicitram |
purtano'ha puro'hamo hiramayo'ha ivarpamasmi ||20||

20.- Je suis plus minuscule que le minuscule, Je suis
aussi le plus grand de tout, Je suis l'univers manifest. Je
77
12 UPANISHADS
suis l'Ancien, le Purusha et le Dirigeant, Je suis
l'Effulgent, et le Tout-bon.


+rir+r-r ==i-rri+a: +rr-=r: = rrrr-+r: (
= i=r=ri= ii+a=+r = ri-a -rr == i=-r == ((-((
apipdo'hamacintyaakti paymyacaku sa omyakara |
aha vijnmi viviktarpo na csti vett mama citsad'ham ||21||

21.- Sans pieds ni jambes Je suis, d'une puissance
inconcevable; Je suis sans yeux et Je suis sans oreilles. Je
connais tout et je suis diffrent de tout. Nul ne peut Me
connatre. Je suis toujours l'Intelligence.


-=+== r -r-aja-i- r== (
= ++r+ == =ri-a =rrrr = =-= -=i--=ii-a ((--((
vedairanekairahameva vedyo vedntakdvedavideva cham |
na puyappe mama nsti no na janma dehendriyabuddhirasti ||22||

22.- Moi seul suis enseign dans les diffrents Vedas, Je
suis le Rvlateur du Vedanta et Je suis aussi le
Connaissant des Vedas. Il n'y a pour Moi ni mrite ni
dmrite, Je ne souffre aucune destruction, je n'ai pas de
naissance et je n'ai aucune identit avec le corps et les
sens.
114



= -ri=r+r = =i=i-a = ri==r = i-a = r-= (

114
La premire moiti du shloka apparat aussi dans la Bhagavad
Gita (XV, 15).
78
12 UPANISHADS
( ii-r +=r==+ ==rrr i=+==iaai= ((-((
==-a=ri=r =-=ia=i= ria rr +=r==+= ((-((
na bhmirpo na ca vahgnirasti na cnilo me'sti na cmbara ca |
eva viditv paramtmarpa guhaya nikalamadvityam ||23||
samastaski sadasadvihna prayti gudda paramtmarpam ||24||

23-24.- Pour moi il n'y a ni terre, ni eau, ni feu, ni air, ni
ther. Ralisant ainsi le Paramatman qui demeure dans la
cavit du coeur, qui est sans parties et sans second,
Tmoin de tout, au-del la fois de l'existence et de la
non-existence, on atteint le pur Paramatman Lui-mme.


:ia r=: =r-:
iti prathama khaa

Ici se termine la Premire Partie

79
12 UPANISHADS

Nous pensons, en ce qui nous concerne, qu'ici en fait se
termine l'Upanishad. La seconde partie semble tre un rajout,
premirement parce qu'elle n'apporte strictement rien de
nouveau, ensuite parce que le caractre n'a rien voir avec la
haute mtaphysique de la premire partie, troisimement
parce qu'elle est teinte de brahmanisme, et enfin parce qu'elle
qualifie l'Upanishad mme de 'Shatarudriya' et semble donc
en tre distincte, alors que le Shatarudriya est un ensemble de
100 shlokas en louange Rudra qui forme une partie du
Yajurveda. Nous nous devons cependant de la donner. Pour
information, voil les deux shlokas qui forment la soi-disant
seconde partie


: rra=-i=ria =r i=+ar -ria =r+r=r+ar -ria
==r+ar-ria jrjr+ar -ria a-=r-i= +a=riar
-ria ( r=i =-r =jar =+a ((
ya atarudryamadhte so'gninapto bhavati surpntpto bhavati
brahmahatytptobhavati ktyktytpto bhavati tasmdavimuktamrito
bhavati atyram sarvad sakdv japet ||1||

1.- Celui qui tudie le Shatarudriya est purifi comme par
les Feux, il est purifi du pch de la boisson, purifi du
pch du meurtre d'un brahmane, des actions faites
consciemment ou inconsciemment. Grce ceci il a son
refuge en Avimukta
115
, le Soi Suprme. Celui qui
appartient l'ordre le plus lev de la vie doit rpter ceci
toujours ou une fois (par jour).




115
Epithte de Shiva.
80
12 UPANISHADS
== nr==r-=ria ==rrr=rrr==(
a-=r- ii-= +- ===r=a +- ==r=a :ia ((-((
anena jnampnoti sasrravananam |
tasmdeva viditvaina kaivalya phalamanute kaivalya phalamanuta iti ||2||

2.- Grce ceci, on atteint la Connaissance qui dtruit
l'ocan du samsara. C'est pourquoi l'on atteint ainsi le
fruit du Kaivalya, vraiment on atteint le fruit du kaivalya
(Libration).


:r- +-r+i=r==r-ar (
ityatharvavede kaivalyopaniatsampt |

Ici se termine la Kaivalyopanishad
faisant partie de l'Atharvaveda.






81
12 UPANISHADS


Atmopanishad


Cette upanishad, trs courte, transmet un enseignement
d'Angirasa, l'un des 7 rishis, un prajapati ou crateur de
l'humanit, un des 10 fils ns du mental de Brahma. Considr
comme le prtre des dieux, il enseigna Brahmavaidya (la
connaissance de Brahman) et il est l'auteur de nombre
d'hymnes du Rigveda. Cette upanishad relve de
l'Atharvaveda.


rricri-ir: +=r-arr =r=r=r -ar=r +=r=r ia (
+= ==rr =r =r== -== =+=rr==r=-=r-=ri-r=:+:=++r=-r=
=r:=r= +rr irrrr=i=+r=riir rrir -ri-a =ra i=a
:r =r=r=r =r= ((-((

Aum athaivgarstrividha purstadyath bhytmntartm paramtm ceti |
tvakcarmanakhsaromagulyaaguhaphavaanakhagulphodaran-
bhimehrakayurhapolabhrla laabhprvairodhamanikki rotri
bhavanti jyate mriyata ityoa bahytm nma ||1||

1.- Om. Puis Angiras (dit) : Le purusha est triple, savoir :
l'Atman extrieur, l'Atman intrieur et le Paramatman.
Les deux couches de la peau (piderme et derme), les
ongles, la chair, les poils, les doigts et les orteils, la
colonne vertbrale, les ongles (de pied), les chevilles, le
ventre, l'ombilic, les hanches, les cuisses, les joues, et les
sourcils, le front et les bras, les flancs, la tte, les petites
82
12 UPANISHADS
veines et les nerfs, les yeux, et les oreilles, etc... : celui
qui a ces choses, et qui est n et meurt, est appel
l'Atman extrieur.


rr-ar=r =r=
+ir-a=rrr+rrr-rar==r-:=r+r==r=i+-+=ri-i-r:
-=iai=c =-r-rr=-r-r=--ir-=a-=ri=a=i=a-=i:a=i-a-
==iari-=i=i--rari-i-r: rar rrar =iar =-ar
=rar +ar inr=r=r +=r: +rr -rr =i=r=r r=rrr-rriia
rrrrr+rr+=irrrr +rrr -ar=r =r= ((-((

athntarsm nma
pthavyaptejovyvke cchdveasukhadukhakmamhavikalpandibhi
smtiliga udttnudttahrasvadrghaplutaskhalitaharjitasphuitamudita-
ntyagtavditrapralayavijmbhitdibhi rot ghrt rasayit mant
boddh kart vijntm pura pura nyyo mmas dharmastrti
ravaaghrkaraakarmavieaa karotyeontartm nma ||2||

2.- Maintenant, en ce qui concerne l'Atman intrieur : en
vrit, Il est le Purusha qui, par sa perception de l'air, de
l'eau, du feu, de l'air et de l'ther, du dsir et de
l'aversion, du plaisir et de la peine, de la luxure, de
l'illusion, du doute, etc.; qui, par sa perception de l'aig et
du grave
116
, du court, du long et prolong
117
, du cri, de
l'interrompu abruptement, et du mlang
118
, et qui par sa
sensibilit la danse, la musique, au vocal et
l'instrumental, la perte de conscience, au baillement,

116
Accents.
117
Voyelles.
118
Syllabes.
83
12 UPANISHADS
etc., est le soi qui entend, sent, gote, pense, comprend,
agit et discrimine, dont le signe est la mmoire, (qui
tudie) les Puranas, le Nyaya, les Mimansas et les
Dharmashastras, et qui distingue le fait d'entendre, de
sentir et d'attirer de la gnralit des actions : Il est appel
l'Atman intrieur.


r +=r=r =r= rr=r=+r==i: (
= rrrr=r=r==rirr=r==r=rr=i-a+ :+ir+r
rr=r+a-=r =r=r=rra==-i+-+=ri-i-r= =-a =r+=-a (
= =ra i=a = rra = -=ia = +-+a = i-ra = i-a
i==r: =r=ri-ra: (
rrar i=r=r +=: ===r i=+=r i= ==r i=i-r=r=:
rr--+rr==+=-ri=ar
i=i+-+r i=r+r==r: =r+i =r i-r r
+=rrrar-+ari= i=i+:
=-+rr =ri-a =-+rr =r-r +=r=r +=rr =r= ((((

atha paramtm nma yathkaramupsanya |
sa ca praymapratyhrasamdhiyognumndhytmacintaka vaakaik
ymkataulo blgraatasahastravikalpandibhirna labhyate nopalabhyate |
na jyate mriyate na uyate na dahyati na kampate na bhidyate nacchidyate
nirgua skbhta |
uddho niravayavtm kevala skmo nikalo nirajano nirabhimna
abdaspararasarpagandhavarjito
nirvikalpo nirkaka sarvavyp socintyovaryaca
puntyauddhnyaptni nikriya
saskro nsti sakro nstyea paramtm puro nma ||3||


84
12 UPANISHADS
3.- Maintenant au sujet du Paramatman : En vrit Il doit
tre ralis selon les prceptes des Vedas. Et Il (se rvle)
celui qui, par le yoga du pranayama
119
, de pratyahara
120

et de samadhi
121
, ou par la discrimination, mdite sur
l'adhyatma
122
. Il est comme la graine du banyan, ou
comme la graine du shyamaka
123
, conu comme tant
aussi subtil que le cent millime de la pointe d'un cheveu,
etc. Il ne peut tre apprhend ni peru. Il est non n, Il
ne meurt pas, Il n'est ni dessch, ni brl, ni branl, ni
perc, ni rompu; Il est au-del de toutes les qualits
(gunas) le Tmoin, ternellement pur, de l'essence de
l'indivisible, unique subtil, sans composants, sans
souillure, sans gosme, dpourvu de son, de toucher, de
got, de vue et d'odeur, dpourvu de doute, sans
expectation; Il est prsent en tout, impensable,
indescriptible, Il purifie le sale et le souill; Il est sans
action; Il n'a pas de samkaras (impressions dans le
mental) : Il est le Purusha qui est appel le Paramatman.

119
Le contrle du souffle, de la respiration. Une des tapes du yoga
(matrise de pranomayakosa). Ce sujet sera abord dans HAMSA.
120
Le retrait des sens, stade suivant du yoga (matrise de manomayakosa)
(d).
121
Stade suivant du Yoga, quelquefois traduit par 'transe' ou 'extase' : tat
d'union.
122
La vrit essentielle, essence de toute chose. Comme dans 'Adhyatma
ramayana' : le Ramayana dans son essence.
123
Quoique trs petit, ses pousses donnent de longues tiges.
85
12 UPANISHADS



Paramahamsopanishad

(Traduite ici partir de la version anglaise de Swami Madhavananda)



-r- +ri-r: rrr= -r -r- +r=r=ri-r=r: (
i-rc-a:r=-a=i-rrr= -i=a -r: (
-i-a = :--r ar: -i-a =: +rr ir-r : (
-i-a =-ar=r i:=i=: -i-a =r ==-+-rra (
rrri-a: rrri-a: rrri-a: (
=i:

Aum bhadra karebhi uyma dev bhadra payemkabhiryajatr |
sthirairagaistuuvsastanubhirvyaema devahita yadyu |
svasti na indro vddhaav svasti na p vivaved |
svasti nastrkyo'rianemi svasti no bhaspatirdadhtu |
Aum nti nti nti |
Hari aum

Aum ! Devas, puissions-nous entendre de nos oreilles
ce qui est auspicieux; puissions-nous voir de nos yeux ce
qui est auspicieux. vous dignes d'adoration ! Puissions-
nous jouir de la dure de la vie attribue par les Devas, en
les louant avec nos corps et nos membres fermes ! Puisse
86
12 UPANISHADS
le glorieux Indra nous bnir ! Puisse le soleil omniscient
nous bnir ! Puisse Garuda, foudre pour le mal, nous
bnir ! Puisse Brihaspati nous accorder le bien-tre !
Aum ! Paix ! Paix ! Paix ! Hari Om !


r ri==r +===r=r +r =r=-arr +r i-riaiia =r-r
-r=-a=+=rr ( a -r=r=r= ( r +====r=r =r+
-=-rar = a =r=-r +r -ria = ( i=+a-r: = (
-+=r :ia i-rr =--a ==r+=rr i--r a=-r
=ria=a a-=r-= ai-=r-ria ( =r
-+i=+==-r-ii rr=rrnr+ia -rr =+=rir
=--r =r- i=r +r+i= --=r-cr-=
-rrir+-rr=rrr =r+-r++rrrr +i==-r- =
==r i-a +r == :ia - ==: ((((

atha yogin paramahasn ko'ya mrgaste ko sthitiriti nrado
bhagavantamupagatyovca | ta bhagavnha | yo'ya paramahasamrgo
loke durlabhataro na tu bhulyo yadyeko bhavati sa eva nityaputastha sa eva
vedapurua iti viduo manyante mahpuruo yaccitta tatsarvad
mayyevvatiate tasmdaha ca tasminnevvasthyate | asau svaputramitra-
kalatrabandhvdikhyajopavte svdhyya ca sarvakarmi
sanyasyya brahma ca hitv kaupna daamcchdana ca
svaarropabhogrthya ca lokasyopakrrthya ca parigrahettacca na
mukhyo'sti ko'ya mukhya iti cedaya mukhya ||1||
87
12 UPANISHADS
1.- "Quelle est la voie des Paramahamsa Yogis
124
, et
quels sont leurs devoirs ?", fut la question que Narada
demanda au Seigneur Brahma en allant le voir. Le
Seigneur lui rpondit : La voie des Paramahamsas sur
laquelle tu questionnes est accessible aux gens avec la
difficult la plus grande; ils n'ont pas beaucoup de
protagonistes, et ce serait assez s'il y en avait un de la
sorte. En vrit, un tel tre demeure dans le Brahman
toujours pur; il est vraiment le Brahman indiqu dans les
Vedas : c'est ce que maintiennent les connaisseurs de la
Vrit; il est le grand, car son mental demeure toujours
en Moi; et Moi aussi, pour cette raison, Je demeure en
lui. Ayant renonc ses enfants, ses amis, sa femme
et ses relations etc.; et ayant abandonn la shikha, le
cordon sacr, l'tude des Vedas et toutes les oeuvres
aussi bien que cet univers
125
, il doit utiliser la kaupina, le
bton et juste assez de vtements, etc. pour la stricte
maintenance de son corps et pour le bien de tous
126
. Et
cela n'est pas la dernire chose. Si on demande quelle est
la dernire chose, elle est ce qui suit :



124
Les Paramahamsa yogis sont ceux qui ont contrl toutes les
facults 'sortantes' du mental et qui ont atteint la concentration par
la pratique des huit moyens du Yoga (yama, niyama, asana,
pranayama, pratyahara, dharana, dhyana et samadhi (v. Hamsa)).
Ils ont atteint l'tat de supraconscience dans lequel toute illusion du
monde s'est vanouie dans la ralisation directe de la Vrit. Ils
appartiennent l'ordre le plus lev des sannyasis.
125
La shikha est la touffe de cheveux maintenue au sommet de la
tte. Le paramahamsa a renonc tout, tous les signes, toutes les
tudes, oeuvres, et a renonc totalement au monde.
126
Qui le reconnatront la kaupina, au bton,etc... et en
l'approchant pourront s'lever.
88
12 UPANISHADS
= -- = irr=rr = nr+ia = r-cr-= ia +===: ( =
rria = rr = ==r = -:=r = =r=r=rr= r-i==
i=--r===---r-+-crar==r-:=r+r=+rr=r-r=r==rr=r=+rr
-ir i=r -+: +r+i= -ra a-aa++-a
=rri+iai=rnr=r=r r =a -a= i=i=-r-ai.
=rr-a-=ri-ria-a rr-a===ar=--inr=r= (ri-= (
a- == +=rr= a- irr=rr a-r+ia (
+=r=r=r=r+nr== ar-r- ( i-r=: =r =r ((-((

na daa na ikh na yajopavta na ccchdana carati paramahasa |
na ta na coa na sukha na dukha na mnvamne ca
aurmicarja nindgarvamatsaradambhadarpecchdveasukhadukhakma-
krodhalobhamohaharsyhakrdca hitv svavapu kuapamiva
dyate yatastadvapurapadhvasta saayavipartami-thyjnn yo
hetustena nityanivttastannitya-bodhastatsvayamevvasthitista ntamacala-
madvaynandavijnaghana evsmi | tadeva mama paramadhma tadeva ikh
ca tadevopavta ca | paramtmtmanorakatvajnena tayorbheda eva
vidhagna s sadhy ||2||

2.- Le Paramahamsa ne porte ni le bton, ni la shikha, ni
le cordon sacr ni de couverture. Il ne ressent ni le froid,
ni la chaleur, ni le bonheur ni la misre, ni l'honneur ni le
mpris, etc. Il convient qu'il soit au-del de l'atteinte des
six vagues de cet ocan du monde
127
. Ayant abandonn
toute pense de calomnie, de vanit, de jalousie,
d'ostentation, d'arrogance, d'attachement aux ou
d'antipathie envers les objets, de joie et de peine, de dsir
(charnel), de colre, de cupidit, d'illusion de soi,
d'exaltation, d'envie, d'gosme et autres, il regarde son
corps comme un cadavre car il a compltement dtruit

127
Faim, soif, peine, illusion, dcadence et mort.
89
12 UPANISHADS
l'ide de corps. Eternellement libre de la cause du doute,
des fausses ides et de la connaissance fausse, ralisant le
Brahman Eternel, il vit lui-mme en Cela, avec la
conscience : "Je suis Lui, je suis Cela qui est toujours
calme, immuable, non divis, de l'essence de la
Connaissance-Batitude, Cela seul est ma nature relle."
Cela (cette connaissance) seul est sa shikha. Cela seul est
son cordon sacr. Par la connaissance de l'unit du
Jivatman et du Paramatman, la distinction entre eux est
elle aussi totalement disparue. Ceci est sa sandhya
128
.


=r-+r=r-+i- aa +=i-ria: (
nr=--r rar = (+--i = =-a ((
+r=--r rar = =rrri nr=i=a: (
= ria =+r-rri-==rr=n+r= ((
:-=-a nrr = +===: ((((

sarvnkmnparityajya advaute paramasthiti |
jnadao dhto yena ekada sa ucyate ||
kadao dhto yena sarv jnavarjita |
sa yti naraknghornmahrauravasajakn ||
idamantara jtv sa paramahasa ||3||

3.- Celui qui, renonant tous les dsirs, a sa demeure
suprme dans l'Un sans second,et tient le bton de la
connaissance, est le vritable Ekadandi
129
. Celui qui

128
Sandhya : rite accompli la sandhya, c'est dire au moment
intermdiaire du jour et de la nuit et de la nuit et du jour, savoir
l'aube et au crpuscule.
129
Ekadandi : un seul bton. Ce seul bton est celui de la
connaissance.
90
12 UPANISHADS
porte un simple bton de bois, qui prend got toutes
sortes d'objets des sens et qui est dpourvu de Jnana
(connaissance) va vers de terribles enfers connus comme
Maharauravas. Connaissant la distinction entre ces deux,
il devient un Paramahamsa.


rrrr-=r = ==-+rr = -rr+rr = i=--r = -aiar-i-c+r
-r-i-r=r=r ri= = i=== = =- = r= =r+r== =
== =r== = +r=r+r== = = = = ri=+ai-ria
i-r=r: =rrr-i=r =r +i== =r+ =r=r+ r =rr+: +
:ia -=rr+r - -=r-i-r=ri= == -: = ==r
-ra ( -=r-i-r=ri= == -+: = +r-+=r -ra (
-=r-i-r=ri= == =r= = r=ir -ra (
a-=r-i-r=ri= == = -: = -+: = =r= ( =r
+r=r ==r=ar ra-a ( -:=r =ria=: ==r = -+=r r=r
r= = rr-rrrr-rr=i-r-==r = ai: = =r - (
=rri=i--rrr =ia=+=a r=-r-ria
+rr=--+=rr-a-=r==-=iia jajr -ria jajr -ria
((((

mbaro na namaskro na svadhkro na nind na stutarydcchiko
bhavedbhikurn''vhana na visarjana na mantra na dhyna
nopsana ca na lakya nlakya na pthagnpthagaha na na sva
na sarva cniketasthitireva bhiku sauvardn nauva parigrahenna
loka nvaloka c''bdhaka ka iti cedbdhako'styeva
yesmdbhikurhiraya rasena da ca sa brahmah bhavet |
yasmdbhikurhiraya rasena spa ca sa paulkaso bhavet |
yasmdbhikurhiraya rasena grhya ca sa tmah bhavet |
91
12 UPANISHADS
tasmdbhikurhiraya rasena na da ca na spa ca na grahya ca |
sarvem km manogat vyvartante | dukhe nodvigna sukhe na sph
tygo rgo sarvatra ubhubhayoranabhisneho na dvei na moda ca |
sarvemindriy gatiruparamate ya tmanyevvasthyate
yatprnandaikabodhastadbrahmhamasmti ktaktyo bhaveti ktaktyo
bhavati ||4||

4.- Les points cardinaux sont son vtement, il ne se
prosterne devant personne, il n'offre pas d'oblation aux
Pitris (manes), il ne blme personne, il ne loue personne;
le sannyasi est toujours d'une volont indpendante. Pour
lui il n'y a ni invocation ni crmonie d'adieu; pas de
mantra, pas de mditation; pas d'adoration; pour lui le
monde phnomnal n'existe pas ni Cela qui est
inconnaissable; il ne voit pas la dualit ni ne peroit
l'unit. Il ne voit ni "je" ni "tu" ni tout ceci.
130
Le
sannyasi n'a pas de demeure. Il ne doit rien accepter qui
soit fait d'or ou autre; il ne doit pas avoir de corporation
de disciples ni accepter de richesse. Si on lui demande
quel mal il y a les accepter : oui, il y a du mal en le
faisant. Parce que si le sannyasi regarde l'or avec dsir, il
se fait assassin de Brahman; parce que si le sannyasi
touche l'or avec dsir, il devient dgrad en Chandala;
parce que s'il prend l'or avec dsir, il se fait tueur de
l'Atman. Aussi le sannyasi ne doit ni regarder ni toucher
ni prendre de l'or avec dsir. Tous les dsirs du mental
cessent d'exister, il n'est pas agit par la peine et il n'a
aucun dsir de bonheur; la renonciation l'attachement
aux plaisirs des sens arrive, et il est toujours dtach dans

130
Il a atteint le Brahman et est devenu un avec le Brahman sans
second. Il n'y a donc rien en dehors de Lui. - "Ceci" : le monde
phnomnal.
92
12 UPANISHADS
le bien ou le mal; il ne hait point ni n'est exalt. La
tendance extriorisante de tous les organes des sens
s'affaisse en celui qui demeure dans le seul Atman.
Ralisant : "Je suis ce Brahman qui est l'Un Infini,
Connaissance-Batitude", il atteint la fin de ses dsirs, en
vrit il atteint la fin de ses dsirs.


-r- +ri-r: rrr= -r: (
-i-a =r (
rrri-a: rrri-a: rrri-a: (
=i: ((

:ia i+===r+i=r==rr-ar ((

Aum bhadra karebhi uyma dev 0 |
svasti no 0 |
Aum nti nti nti |
Hari aum ||

iti rparamahasopaniatsampt ||


Aum ! Devas, puissions-nous entendre de nos oreilles etc ...
Aum Paix ! Paix ! Paix !
Hari Om !

Ici se termine la Paramahamsopanishad.

93
12 UPANISHADS



Vajrasucikopanishad

(Traduite ici partir de la version anglaise de S. Radhakrishnan)


Cette Upanishad, qui appartient au Sama Veda, nous semble
importante de nos jours, spcifiquement en ce qu'elle montre
bien que la croyance en la caste par la naissance est
absolument contraire au sanatana dharma (ou hindouisme),
mais que la varna, ou couleur, de nos jours la classe, est une
division naturelle de la socit et que le brahmane se fait lui-
mme, qu'il est possible de changer de classe de par son
volution ou en retrouvant le niveau d'volution atteint dans la
vie antrieure. On pourrait dire pour rsumer que ni la
naissance ni une crmonie ne font l'initi.



==i= =ri= nr==rnr=-r-==
-rr nr==i=r=r= -rrr nr==rrr

vajrascim pravakymi jnamajnabhedanam
daa jnahnnm bhaa jnacaku

1.- Je vais dcrire la doctrine Vajrasuchi qui brle
l'ignorance, condamne ceux qui sont dpourvus de
94
12 UPANISHADS
connaissance et exhalte ceux qui sont pourvus de l'oeil de
la connaissance.


=rr=rirrr-r :ia rr r: arr rr=r= =rr (
rr= :ia -=r==+ -= iai-r++a= ( a r=i-a (
+r r =rrr =r= i+=i: i+-=: i+=ria: i+nr== i++=
i+rri=+ :ia ((

brhmaanakatriyavaiyadr iti catvro var te varnm brhmaa
eva pradhna iti vedavacannurpa smtibhirapyuktam | tatra codyamasti | ko
v brhmao nma kijva kideha kijti kijnam kikarma
kidhrmika iti ||

2.- Le Brahmane, le Kshatriya, le Vaishya et le Shudra
sont les quatre varnas. Que le Brahmane est le chef de
ces classes est en accord avec les textes vdiques et est
affirm par les Smritis. A ce propos il y a un point digne
d'investigation. Qui est, en vrit, le Brahmane ? Est-ce
l'me individuelle (jiva) ? Est-ce le corps ? Est-ce la
classe base sur la naissance ? Est-ce la connaissance ?
Est-ce les actions ? Est-ce celui qui accomplit les rites ?


a r=r =ir =rr :ia -r aia=r=ar=+-=r=r
ai-+=+a (
(+-ri+ +=r-=+-==--rr=rrir =i-+=+c
a-=r= air =rr :ia ((

tatra prathamo jvo brhmaa iti cettanna attngatnekadehn
jvasyaikarpatvat |
95
12 UPANISHADS
ekasypi karmavadanekadehasambhavt sarvarr jvasyaikarpat-
vcca tasmnna jvo brhmaa iti ||

3.- De ceux-ci, si l'on prend le Jiva pour le Brahmane, il
n'en est pas ainsi, car la forme de l'individu est une seule
et mme chose dans le grand nombre de corps passs et
venir. Mme si le jiva est un, il y a de la place pour
plusieurs corps du fait du travail du karma, et dans tous
ces corps la forme du jiva est unique. Aussi le jiva n'est-il
pas le brahmane.


ai= -=r =rr :ia -r (
r-=ri- +-ar=r= ==rrrr= + -rria+=-=-i=+a
=r=rr=rr=ri-=r--rr=ra =rr-rar: =rir
+a: r+iar: rr-: jrr :ia i==r-rrra i+ri--==
+r-i=r= =r=ri--rr=--rc a-= -=r =rr :ia ((

tarhi deho brhmaa iti cet tan na |
caaldi paryantnm manuympacabhautikatvenadehasyaikarpatvat
jarmaraadharm-dharmdismyadarant brhmaas vetavara katriyo
raktavara vaiyah ptavara dra kavara iti niyambhvt pitrdidahane
putrdnm brahmahatydidoasambhavcca tasmn na deho brhmaa iti ||

4.- Si on dit alors que le corps est le brahmane, il n'en est
pas ainsi, du fait de l'unit de la nature du corps qui est
compos des cinq lments, dans toutes les classes
(varnas) des tres humains jusqu'aux chandalas, etc.; du
fait de la perception des caractres communs du vieil ge
et de la mort, de la vertu et du vice, du fait de l'absence
de toute rgularit dans le fait que le brahmane soit de
teint clair, le kshatriya de teint rouge, le vaishya de teint
96
12 UPANISHADS
fauve, le shudra de teint sombre et du fait de la
disposition des fils et des autres devenir souills du
meurtre d'un brahmane et d'autres (fautes) en brlant le
corps de leurs pres et d'autres parents. Aussi le corps
n'est-il pas le brahmane.


ai= =ria=rr :ia -r a =r-a=-a=+=ria=--rr
==rr ==-=-ia r =r =r: +rirr+: +rrra =r-=+r
=-=+a r-=i+r -=i+ra r=: +a+-rr= rrrr+=ra
=ra=: i== =rr= =-: +=rr =ra :ia ara
(arr =rr i=r-= nr=ia+ri-ar rr ==-=-ia a-=r
=ria=rr :ia

tarhi jti brhmaa iti cet tan na tatra jtyantarajantuvanekajtisambhav
maharayo bahavassanti yago mgy kauika kut jmbuko jambukt
vlmko valmkt vysa kaivartakanyym aapht gautama vasiha
rvaym agastya kalae jta iti rutatvt ete jty vinpyagre
janapratipdit ayo bahavassanti tasmn na jtirbrhmaa iti.

5.- Alors si l'on dit que la naissance (fait) le brahmane, il
n'en est pas ainsi, car il y a beaucoup d'espces parmi les
cratures autres que l'homme; beaucoup de sages sont
d'origines diverses. Nous savons par les livres sacrs que
Rishyashringa est n d'un cerf, Kaushika de l'herbe
kusha, Jambuka d'un chacal, Valmiki d'une fourmilire,
Vyasa d'une femme pcheur, Gautama du dos d'un livre,
Vasishtha d'Urvashi, Agastya d'une jarre en terre. Parmi
eux, malgr leur naissance, il y a beaucoup de sages qui
ont aussi pris le rang le plus lev, ayant donn preuve de
leur sagesse. Ainsi la naissance ne fait pas le brahmane.

97
12 UPANISHADS
ai= nr== =rr :ia -r rrir-r i=
+=rr-rr=r i-rnr ==-=-ia a-=r nr== =rr :ia

tarhi jnam brhmaa iti cettanna katriydayo'hi
paramrthadarano'bhij bahavassanti tasmn brhmaa iti

6.- Alors (si l'on dit) que la connaissance (fait) le
brahmane, il n'en est rien parce que parmi les kshatriyas
et autres y en a beaucoup qui ont vu la Ralit la Plus-
Haute et atteint la sagesse. Ainsi la connaissance ne (fait
pas) le brahmane.


ai= += =rr :ia -r =rrr= rir=r=
rr= iar=ri=+==rr--rr=ra
+=ri-riar: =-ar ==r: i+r: +-aiia
a-=r+= =rr :ia

tarhi karma brhmaa iti cettanna sarvem prinm
prrabdhasacitgmikarmasdharmyadarant
karmbhi prerit santo jan kriy kurvantti
tasmn na karma brmaa iti

7.- Alors (si l'on dit) que les oeuvres (font) le brahmane,
il n'en est rien, car nous voyons que les oeuvres
commences dans la prsente incarnation ou accumules
pendant les vies prcdentes ou commencer dans une
future incarnation sont communes toutes les cratures
vivantes et que les hommes de bien accomplissent des
oeuvres pousss par leur karma pass. Aussi les oeuvres
ne font-elles pas le brahmane.

98
12 UPANISHADS
ai= rri=+r =rr :ia -r
=rir-r i=-rarr ==-=-ia
a-=r rri=+r =rr :ia

tarhi dharmiko brhmaa iti cettanna
ktriydayo hirayadtaro bahavassanti
tasmnna dhrmiko brhmaa iti.

8.- Alors (si l'on dit) que celui qui accomplit des devoirs
religieux est un brahmane, il n'en est rien, car il y a eu
beaucoup de kshatriyas et d'autres qui ont donn de l'or.
Aussi celui qui accomplit des rites religieux n'est-il pas le
brahmane.
ai= += r =nrr =r=
: +i-r=r==iaai= =ria=ri+r=i==
r-i=r--rri-=-rri=a=
=nr=r=--r=-a-=+= -=
i=i +-+=rr r+-+rrr=rr r-rar-ai= = a =r==
-a=i=rr+rrr-=-a==r-r=----rr===
=-r+=+r=rar-rr==r==
+a=r==+a =r=rra+r=rij jarrar +r=r=ri--rri=a:
rr=ri-=r =-+r
-rr=r=arrrrr=r=ri-i=a: ---rr=+rri-i-r=-+:ar aa
(=+a==rrr : = ( =rr :ia
ia-=ia+rria=r=r=r=i-rr:
-rr= rr+==r - =i--r=--=r=r==iaai= = -rr a
r===iaia= == -rri-+i=r- ((

tarhi ko v brhmao nma
99
12 UPANISHADS
ya kacidtmnamadvityam jtiguakriyhnam
armiabhavetydisarvadoarahitam
satyajnnandnantasvarpam svayam
nirvikalpam aeakalpdhram aeabhtantaryamitvena vartamnam
antarbahickavadanusytam akhanandasvabhvamaprameyam
anubhavaikavedyamaparokataybhsamnam
karatalmalakavat skt aparokktya ktrthay kmargdidoarahita
amdigua sampanno
bhvamtsaryatmohdirahita dambhhakradibhirasapacet vartate
evam uktalakao ya sa eva brhmaa iti
rutismtipuretihsnm abhiprya
anyathbrmaatvasiddhir nstyeva saccidnandamtmnam advityam brahma bhvayet
tmanamadvitiyam brahma bhvayedityupaniad ||

9.- Alors, qui en vrit est le brahmane ? Celui qui, aprs
avoir peru, comme le fruit amalaka dans la paume de sa
main, le Soi sans second, dpourvu de distinction de
naissance, d'attribut et d'action, dpourvu de toutes fautes
comme les six infirmits
131
et les six tats
132
, de la forme
de la vrit, de la sagesse, de la batutide et de l'ternit;
qui est par lui-mme, dpourvu de dterminations, base
de dterminations sans fin, qui fonctionne comme esprit
rsidant l'intrieur de tous les tres, qui se rpand
l'intrieur et l'extrieur de tous comme l'ther, de la
nature de la batitude, indivisible, incommensurable,
uniquement ralisable par l'exprience et qui se manifeste
directement et, par l'accomplissement de sa n ature,
devient dbarrass des fautes du dsir, de l'attachement,
etc., et dou des qualits de tranquillit, etc... dbarrass
des tats d'tre, de rancune, d'avidit, d'expectation, de

131
Les 6 infirmits sont : vieillesse, mort, chagrin, illusion, faim et
soif.
132
Les 6 tats sont : naissance, tre, croissance, changement, dclin
et prissement.
100
12 UPANISHADS
confusion, etc., le mental inaffect par l'ostentation,
l'gosme et autres, il vit. Celui seul qui possde toutes
ces qualits est le brahmane. Telle est la vue des textes et
de la tradition vdiques, du savoir et de l'histoire de jadis.
L'accomplissement de l'tat de brahmane est sinon
impossible. Mdite sur le Brahman, le Soi qui est
Existence-Conscience-Batitude, sans second; mdite sur
Brahman qui est sans second. Telle est l'upanishad.
101
12 UPANISHADS
Quelques autres textes sur la 'classe'
(pour prouver encore et encore que le systme de la caste
par la naissance est tout fait contraire au Sanatana Dharma
et n'a rien voir avec le vritable Hindouisme).


rr =r += ar= = -rrrr = a= (
+rr= r ia= -r== =rr: ((
u yaka kula tta na svdhyayo na rutam |
kraam v dvijatve ca vttamevana saaya ||

(MAHABHARATA, Aranya Parva, 312, 106)

Cher Yaksha, coute : ni l'tude ni l'rudition ne sont la cause
de la re-naissance. La conduite est la base, il n'y a aucun doute
l-dessus.


== -r== =r=r rri===rr-= a+r rrr (
cr-a =r=-- = =rr :ia -=ia: ((
satyam dnam kam lamanasyam tapo gh |
dyante yatra ngendra sa brhmaa iti smti ||

roi des serpents, celui en qui se manifestent la vracit, la
charit, la patience, la bonne conduite, la non-blessure,
l'austrit et la compassion est un brahmane selon la tradition
sacre.

a-==a =+ -r = =rr-==a: (
a -ra = ar=-i=ia i=i-rra((
yatraitallakyate sarpa vtta sa brhmanassmta |
yatraitanna bhavet sarva dram iti nirdiet ||
102
12 UPANISHADS

serpent, celui en qui cette conduite est manifeste est un brahmane,
celui en qui cela est absent, traite-le comme un shudra.

(Mahabharata, Aranya Parva, 180, 20, 27)


i=rirrr==r--r= i===-+r=-aia= (
=rir =rir+=rr a--r =rr i-:
niriam anrambham nirnamaskram astutim |
aka kakarma tam dev brhmaa vidu

(Mahabharata, XII - 269, 34)

Les dieux considrent comme brahmane celui qui n'a pas de
dsirs, qui n'entreprend aucun travail, qui ne salue ni ne loue
personne, dont le travail a t puis mais qui demeure lui-
mme inchang.


-ra =r =: =+=i-rr=rr: (
a- +ar=i+ =r i-+ar== ((((
cturvarya may sha guakarmavibhgaa |
tasya kartramapi m viddhyakartramavyayam ||13||

Les quatre varnas (ordres de la socit) furent crs par Moi en
les classifiant selon le mode prdominant de Prakrti
133
en
chacun et en proportion des devoirs correspondants;
quoiqu'auteur de cette cration, sache que Moi, le Seigneur
Immortel, suis un non-acteur.

(Bhagavadgita - 4 - 13)

133
Sattva, rajas ou tamas.
103
12 UPANISHADS


Bhikshuka Upanishad

i-r=rrr +:= iri-a====-r (
a-+- =a- ==r +ia =r= ((

bhik paala virntimagamatsad |
antraipada brahmatattvakarotu mmam ||

+r=-: +ri=-
+rra +r=--a (
+r- +r=r-r
+r=rirra ((
rrria: rrria: rrria: ((

aum pramada pramida
prt pramudacyate |
purasya pramdya
pramevvaiyate ||
aum nti nti nti

104
12 UPANISHADS
Aum. Cela est infini, et ceci est infini. Linfini procde de
linfini. Prenant linfinitude de linfini, il demeure comme le
seul infini.
Aum ! Paix ! Paix ! Paix !


r i-r=rrr =i=rrir=r
+:i+==-+==+===rria r: (
aum atha bhik mokrthin
kucakabahdakahasaparamahasvati catvra |

1. Les moines mendiants qui dsirent la libration sont de
quatre sortes : le Kutichaka, le Bahudaka, le Hamsa et le
Paramahamsa.


+:i+r =r= =ia=-rar=rn-+i=* -
-rai *r =r=rr-ai
i==r= =r=r= rr-a (
kucak nma gautamabharadvjayjavalkyavasia-
prabhtayo au grsvaranto
yogamrge mokameva prrthayante |

2. Ceux qui sont appels Kutichakas
134
, comme
Gautama, Bharadvaja, Yajnavalkya et Vasistha,
subsistent de huit bouches de nourriture et ne
recherchent que la liberation par la voie du Yoga.

134
Asctes vivant dans des huttes.
105
12 UPANISHADS
r ==-+r =r= i--+=-=irr=rr
nr+ia+rrr-rrirr
=ir== =r=r= =ir*r
=r=r--r=rrr jr
r==r= =r=r= rr-a (
Atha bahdak nma tridaakamaaluikh-
yajopactakyavastradhrio
brahmarighe madhumsa varjaitvau
grsnbhaikcaraa ktv
yogamrge mokameva prrthayante |
3. Ensuite, ceux qui sont appels Bahudakas
135
qui
portent le tridanda
136
, le pot eau et une touffe de
cheveux, le cordon sacr et un vtement de couleur ocre.
Evitant le vin et la viande, ils subsistent de huit bouches
de nourriture obtenue en aumnes des demeures des
sages brahmanes et ils ne recherchent que la libration
dans la voie du Yoga.

r ==r =r= =r= (+r == + r
=r =-ar a-+i = =: (
r==r=r=irr i= r-:rr+rrr
r==r= =r=r= rr-a (
Atha has nma grma ekartra nagare pacartra
ketre saptartratadupari na vasuya |
gomutragomayhario nitya cndryaaparya
yogamge mokmeva prrthyante |

135
Que lon trouve prs deaux sacres.
136
Trident, bton.
106
12 UPANISHADS
4. Puis ceux appels Hamsas qui trouvent abri pour une
nuit dans un village, cinq nuits dans une ville et sept nuits
ou plus dans un lieu sacr. Subsistant durine de vache et
dautres produits de la vache, et toujours adonns au
voeu de chandrayana, ils ne recherchent que la libration
dans la voie du Yoga.

r +===r =r= =a+r=rra+a=--ra
--rrrr+r=-=ria+-rar *r
=r=rr-ar
r==r= =r=r= rr-a ((
atha paramahasnma savartakruavetaketujaabharata-
datttreyaukavmadehrtakaprabhtayoau
grsvaranto
yogamrge mokameva prrthayante ||

5. Puis ceux appels Paramahamsa (comme)
Samvartaka, Aruni, Svetaketu, Jadabharata, Dattatreya,
Suka, Vamadeva et Harita, qui vivent de huit bouches
de ourriture et ne recherchent que la liberation dans la
voie du Yoga.


=r== rr-== r=rrr=ri==r r
=r-=r r i-=-=r r (
= arr r=rr=r =r-rr=r-rr
rrrrrr aai=ar ====*rr=+r =r:
=rr -r=rrr jr =r=ia +ri-a (
vkamle nyaghe manavsino v
smbar v digambar v|
107
12 UPANISHADS
na te dharmdharmau lbhlbhau
uddhuddhau dvaitavarjit samalasemakcan
sarvaou bhaikcaraa ktv sarvatrtmaiveti payanti |

Ils trouvent refuge lombre des arbres, dans des
maisons dsertes ou dans un cimetire. Ils peuvent porter
une robe ou tre nus. Ils nobservent ni Dharma ni
Adharma. Ils ne sont conscients ni du profit ni de la
perte. Ils rejettent le Visishtadvata
137
, the Shuddha
Dvata
138
et lAshuddha Dvata. Estimant de la meme
manire un caillou, une pierre et de lor, ils recoivent des
aumnes de (personnes) de toutes les varnas
139
et ils ne
voient partout que lAtman.


r =ra=+rr i=a-ar i=+i==r:
rr-+r=+rrr r=i=*r: rr=rrrrr
rr++r= -r=r=r-a: rr-r=r-==
ar+:-=i+=r==+=r=rrr=ri==rrrr=r=-i+i==
i=i+--+=+r:i==-ri-= a ==r=
=-+=+zrr: rr=r==r: +===rr=
=-r== -=r= +i-a a +===r =r=+i=ra ((
atha jtarpadhar nirdvandv niparigrah
ulkadhynaparya tmani prasadhrarthe
yathoktakle bhaikamcaranta nygradevagha-
takavalmkavkamlakullalgnitralnadpulina-

137
De Ramanuja.
138
De Madhavacharya.
139
Il faut bien viter ici de traduire le mot varna, qui veut dire
couleur, par le mot caste. Ils recoivent des aumnes des 4 classes,
brahmanes, kshatriyas, vaishyas et shudras.
108
12 UPANISHADS
girikandarakaharakoaranirjharasthaiale tatra brahmamrge
samyaksapann uddhamnas paramahascaraena
sanysena dehatyga kurvanti te paramahas nmetuypaniate ||

Nus, non affects par les dvandvas
140
, ne recevant aucun
prsent, pratiquant uniquement la pure mditation, tablis
dans le seul Atman, recevant des aumnes au moment
prescrit pour soutenir la vie, (sabritant) dans une maison
dserte, un temple, sur une botte dherbe, une
fourmilire, lombre dun arbre, dans une hutte de
potier, dans un lieu o le feu rituel est entretenu, sur les
rives sableuses dune rivire, dans un fourr de montagne
ou dans une caverne, dans un trou dans un arbre , prs
dune chute deau ou sur un morceau de sol propre, ils
sont bien sur la voie de la ralisation de Brahman; le
mental pur, ils abandonnent leur corps dans ltat de
renoncement comme un Paramahamsa. Ce sotn vraiment
les Paaramahamsas.

:ia i-r=r+r+i=r==r-ar ((
iti bhikkopaniatsampt ||

Ici se termine la Bhiksukopanishad.

140
Paires opposes : chaud-froid, blanc-noir, etc.
109
12 UPANISHADS




Yogasara upanishad
La YOGASAROPANISHAD ne fait pas partie des 108
upanishads principales. Trs courte, elle rsume et
contient l' essence du Raja Yoga.
Satguru paratmane namah
Salutations au SadGuru, au Paramatma

(Shanti mantra)

r =r i-rria +
rr -r i=rria a-= (
a = -=r==i+rr
===r rrr== + ((
rrri-a: rrri-a: rrri-a: ((
Aum yo vai brahma vidadhti prvam
yo vai vedca prahioti tasmai |
ta ha devamtmabuddhi praka
mumukurvai araamaha prapadye ||
Om nti nti nti ||

110
12 UPANISHADS
Aum. A Lui qui ordonne Brahma au commencement
et qui lui dlivre les Vedas, ce Dieu clair par
Sa propre intelligence, j'ai recours, avide de libration.
Om Paix Paix Paix.


rrar r= r=r-r=: (
athto yoga vykhysyma | (1)

Le Yoga est maintenant expliqu.


r=i-ri-ri=rr: (
yogacittavttinirodha | (2)

Le Yoga est la restriction des vagues mentales.


aa +=r==r ==r: (
tatca paramtman samavya | (3)

Il y a alors communion avec le Paramatman.


=ri-a+rr==--a (
gurorantikdhyogamabhyasyet | (4)

Apprends le Yoga avec un guru


=-rari- i-r-a: +r+irr=: (
sarasyvartdiva vttiranta karaaparima | (5)
111
12 UPANISHADS

Une vritti est un tourbillon dans le lac mental

iia=ia =ai ( =r ria=ar rri+: (
citirmrtimat | s cpratihat akti | (6)

La pense est une chose. La pense est une force dynamique.


=i-+ ==i-r -rr -r: (
udrikta manacitta yatprabhav vttaya | (7)

La citta est la substance mentale d'o apparaissent les vrittis.


=i+ ==r ==ri-- arij ir ia+a (
buddhiprayukta mano bhyondriya dvrktya viaya pratipadyate | (8)

La perception ne vient que lorsque le mental
est reli au centre et l'instrument extrieur.


ir==r -:=r+ir-=(
viayasukha dukhavatparityjyam | (9)

Le plaisir doit aussi tre abandonn, comme la peine.


jiai-=rr=-==i (
praktistriguvalamban | (10)

Prakriti opre travers trois gunas.
112
12 UPANISHADS


+iiar =r==r--a r ==--rr- ia+r= rrrr (
ya kacidviaya bhyambhyantara
c anusandabhtyasya cittaikgraya dhraa | (11)

Dharana (concentration) est le fait de fixer le mental sur un idal
ou sur un point ou sur un objet intrieur ou extrieur.


a=rrr-==-rr==-a r== (
tailadhrvadanusandhnanairantarya dhynam | (12)

Dhyana (mditation) est le fait de conserver le courant
d'une (seule) ide comme la coule de l'huile.


==ririair: =nrar =nraia (
samadhirdvividha saprajto'saprajceti | (13)

Le samadhi est de deux sortes, Samprajnata et Asamprajnata
141
.


i=-=r r=i +-=r=a (
nistraiguyo yog kaivalyamanute | (14)

Le Yogi se spare des trois Gunas et atteint Kaivalya (l'isolation).

141
Samprajnata ou Savikalpa - Asamprajnata ou Nirvikalpa (v.
'HAMSA'). Dans le savikalpa, il existe le connaisseur, la
connaissance et le connaissable et les samskaras (impressions
latentes) sont toujours l. Dans le Nirvikalpa, tout disparat, il n'y a
que le seul Brahman.
113
12 UPANISHADS



Bhava(na) Upanishad


Nous ne donnerons de cette upanishad 'shakta' que la
traduction, sans le texte sanscrit devanagari ni translittration en
caractres romains.


1.- Le saint Guru est la Shakti qui est la cause de tout.

2.- De cette shakti le corps, avec ses neuf orifices, est la
forme.

3.- C'est la roue sacre sous le vtement des neuf roues.

4.- La shakti du Sanglier est paternelle; Kurukulla, la
dit du sacrifice, est maternelle.

5.- Les (quatre) Limites humaines sont les ocans.

6.- Le corps avec les sept constituants (dhatu) comme la
peau et le poil est l'le des neuf joyaux.

7.- Les rsolutions sont les arbres souhaits; l'nergie
(mentale) est le jardin des arbres d'abondance.

114
12 UPANISHADS
8.- Les six saisons sont les gots, savoir le doux,
l'acide, l'amer, le piquant, l'astringent et le sal, qui
sont apprhends par la langue.

9.- La connaissance est la matire pour l'adortion; l'objet
de la connaissance est l'oblation; le connaisseur est le
sacrifiant. La mditation sur l'identit des trois, la
connaissance, son objet et le connaisseur est
l'adoration rendue la Roue sacre.

10.- Le Destin et les sentiments comme l'amour sont (les
ralisations comme) l'atomicit, etc. Le dsir, la
colre, l'avidit, l'illusion, la gait constituent les huit
pouvoirs de Brahma, etc.

11.- Les neufs demeures sont les pouvoirs des gestes
mystiques. La terre, l'eau, le feu, l'air, l'tehr, l'oreille,
la peau, l'oeil, la langue, le nez, la parole, les pieds, les
mains, les organes d'vacuation et de gnration ainsi
que la modification du mental sont les seize pouvoirs,
tels que la force d'attraction du dsir, etc.

12.- La parole, la poigne, le mouvement, l'vacuation, la
gnration et les attitudes de rejet, d'acceptation et
d'apathie sont les huit, tels que la fleur d'amour, etc...

13.- Alambusha, kuhu, vishvodara, varana, hastijihiva,
yasovati, prayasvini, gan dhari, pusa, sankhini,
sarasvati, ida, pinigala et sushumna, ces quatorze
nadi sont les quatorze pouvoirs, tels que le tout-
passionnant, etc.

115
12 UPANISHADS
14.- Les cinq enveloppes vitales et les cinq prana
(souffles) mineurs (1) sont les dix divinits des rayons
extrieurs, dnommes Sarvasiddhiprada, etc.

15.- Le feu digestif devient quintuple de par les
distinctions bases sur son association avec ce souffle
principal. (Ils sont) ce qui jecte, ce qui cuit, ce qui
sche, ce qui brle et ce qui inonde.

16.- Du fait de l'minence du souffle mineur, ces (feux)
dans le corps humain en viennent tre dnomms le
corrodeur, l'jecteur, l'agitateur, le billeur et le
trompeur.

17.- Les dix aspects du Feu sont les dix divinits des
rayons intrieurs, Sarvajana, etc.

18.- Les qualits de froid, de chaud, de plaisir, de peine,
de sattva, de rajas et de tamas sont les huit pouvoirs,
vasini, etc.

19.- Les cinq, le son rudimentaire, etc., sont les cinq
flches fleuries.

20.- Le mental est l'arc fait de canne sucre.
L'attachement est la corde.

21.- L'aversion est le crochet.

22.- Le Non-manifest, le Grand, et le principe de
l'Egosme (ahamkara) sont les divinits du triangle
intrieur : Kameshvari, Vajreshvari et Bhagamalini.
116
12 UPANISHADS

23.- La Conscience Absolue, vraiment, est Kameshvara.

24.- La Divinit Suprme, Lalita, est notre propre Soi
bienheureux.

25.- De tout ceci l'apprhension distinctive est la lueur
rouge.

26.- La perfection (vient de) la concentration exclusive
du mental.

27.- Dans l'accomplissement de la mditation consiste le service
respectueux.

28.- L'acte d'oblation est la fusion dans le Soi des
distinctions comme Je, toi, l'existence, la non-
existence, le sens du devoir et sa ngation et
l'obligation de culte.

29.- L'apaisement est la pense de l'identit des objets de
l'imagination.

30.- La vue de la transformation du temps dans les quinze
jours (du mois lunaire) indique les quinze ternelles
(divinits).

31.- En mditant ainsi pendant trois instants, ou deux, ou
mme pendant un seul instant, on devient libr-
vivant; on est appel Shivayogi.

117
12 UPANISHADS
118
32.- Les mditations sur la roue intrieure ont t
discutes (ici) selon la doctrine du Saktaisme.

33.- Celui qui sait ainsi est un tudiant de l'Atharvasiras.