You are on page 1of 244

i

n
d
o
o
r

/

o
u
t
d
o
o
r

2
0
1
2
T
a
r
i
f
a


P
r
i
c
e

L
i
s
t


T
a
r
i
f


P
r
o
f
e
s
s
i
o
n
n
e
l
F
i
l
i

r
e

d
e
re
cyclage

d

d
i

e
w
w
w
.recylum
.c
o
m
/DPS RIUHFH VROXFLRQHV HFLHQWHV GH LOXPLQDFLyQ DGDS-
tndose a las necesidades de los proyectos, mediante
productos y servicios innovadores y competitivos.
/DPSSURYLGHV\RXZLWKHIFLHQWOLJKWLQJVROXWLRQVE\DGDS-
ting its products and services to your project needs.
/DPSRIIUHGHVVROXWLRQVHIFDFHVGpFODLUDJHHQVDGDSWDQW
aux ncessits des projets, grce des produits et des ser-
vices innovateurs et comptitifs.
L I G H T I N G
2
QGLFH
N
NEW NUEVA FAMILIA NEW FAMILY NOUVELLE FAMILLE
AMPLIACIN DE GAMA RANGE EXTENSION EXTENSION DE GAMME
Konic 13 Alumic 16 Mini Konic 12 Kubic 9 - 11 Mini Kubic 10
Duet 34 Twin Susp. 36 Konic Sup. 42 Puzzle Air 40 Miniyes 38 Satina 37
Avant 44 Twin 54 Vissio 50 Sat 48 Multispace 56 Comet 57 Finelamp 58 Carril Trifsico 59
Urban 71 Mural 73 Finelamp 70
Dinamic 65 Bloc 60 Satina 62 Ambient 68 Flat 66
Multispace 61
DOWNLIGHTS EMPOTRABLES - RECESSED DOWNLIGHTS - DOWNLIGHTS ENCASTRS
LUMINARIAS DE INTERIOR INTERIOR LUMINAIRES LUMINAIRES D'INTRIEUR
DOWNLIGHTS SUPERFICIE - SURFACE DOWNLIGHTS - DOWNLIGHTS APPARENTS
PROYECTORES - SPOTLIGHTS - PROJECTEURS
APLIQUES Y LMPARAS DE PIE - WALL MOUNTED AND STANDING LUMINAIRES - APPLIQUES ET LAMPADAIRES
FAMILIA CON MODELOS LED FAMILY WITH LED MODELS FAMILLE AVEC DES MODLES LED
LED LED
Micro Proa 63
LED LED
LED
Satina 62 Dinamic 64
Fine Leds
Linear
33
LED
Fine Leds 32
LED
Tub 72
Ring Leds 31
LED
Qbyto 30
LED
NEW
Mini Puzzle 25 Puzzle 20
LED LED
N N
Orbit 18
LED
N
Ring 28 Gala 27
LED
N
LED
N
N N
N
NEW
Domo Square 8
LED
Domo 6
LED
NEW
Domo Trimless 6
NEW
Domo Asim.
Spot
7
LED LED
N
LED LED
LED
N N
N
3
QGLFH
Control
DALI
153 Control
1-10V
152 Equipos
Auxiliares
155
Stylamp 120
Clinic 128 Hermtica 140 Canal
Gases
138 Hospital 134 Clinic Gas 130
Hangar 142 Hangar 65 143 Hi-Lux 64 145
Scening 148
Modular
Hospital
139 Ambient 139 Mural 139
Modular Slim 122
Modular
Asimtrica
127 Modular
Tech
126 Modular 123 Modular
Indirecta
125 Modular L.C. 124
LUMINARIAS EMPOTRABLES - RECESSED LUMINAIRES - LUMINAIRES ENCASTRS
SISTEMAS SANITARIOS - HEALTHCARE LIGHTING - SYSTMES HOSPITALIER
INDUSTRIAL - INDUSTRIAL - INDUSTRIEL
SISTEMAS DE CONTROL Y ALIMENTACIN - CONTROL SYSTEMS AND POWER SUPPLY - SYSTMES ALIMENTATION ET CONTRLE
DMX
DMX - RDM
IR
154
Mini Duelamp 112 Basic 104 Oval 102
Dinamic 96 Triplex 94
Finelamp 100
Fil Box 90 Fil Med 81 Fil 74 Flat L.C. 98 Multispace 92
Duelamp 114
Soportes a
Pared
119 Suspens. 118
BCN Canal 108 Lamptub 106
ESTRUCTURAS - MODULAR SYSTEMS - STRUCTURES
Fil +
Fil + LED
76
80
Hi-Lux 144
NEW
Extraplana 110
NEW
Extraplana
Asimtrica
111
NEW
N
N
Fil + Trimless 79
NEW
N
N
LED
4
QGLFH
Stick
159 Far 158 Bloc 160
Step Air 176 Bauline Air 175
Flash 198
Proa 182 Mini Proa 180 Micro Proa 178
Mini Eco 210 Eco 211 Smap 204
Step
167
Bauline
166
Shot 190 188 Sistema Vial
Shot
196
Columna
Troncocnica
Cilndrica
212
Sistema Vial
Proa / MiniProa
184 Accesorios
Proa / Mini Proa
186
Pictografa 216 Ref./Pg 222 IP, IK y Carta
de colores
220 Lmparas 218
Point 164 B-Side Led 165 Nic 175 163 Nic 162 Bloc 161
BALIZAS - BOLLARD - BORNES
APLIQUES - WALL MOUNTED - APPLIQUES
EMPOTRABLES - RECESSED - ENCASTRS
LUMINARIAS - LUMINAIRES - LUMINAIRES
PROYECTORES - SPOTLIGHTS - PROJECTEURS
ILUMINACIN VIAL Y URBANA - ROAD AND URBAN LIGHTING - CLAIRAGE PUBLIC ET URBAN
INFORMACIN COMPLEMENTARIA - COMPLEMENTARY INFORMATION - INFORMATION COMPLEMENTAIRE
LUMINARIAS DE EXTERIOR - EXTERIOR LUMINAIRES - LUMINAIRES EXTRIEUR
B-side 157
Shot 290
Shot 380
192 Shot 530 194
B-side Led 156
LED LED
LED LED
Xtrema 172
LED
Urban 65 174
LED
Uplights 170
LED LED
LED LED LED
Shot Leds 191
LED
Calculo
precios
especiales
214
DALI
1-10V
PVP
NEW
Gap 168
Dune 206 Dune Leds 207
LED
NEW
Fama 208
LED
NEW
Niu 202
NEW
Gap 168
DOWNLIGHTS - RECESSED - DOWNLIGHTS
N N
Green 200
LED
N
N
N NEW
Mini Shot
Leds
190
NEW
Niu Leds 203
LED
LED
LED
LED
N
LED
5
LUMINARIAS DE EXTERIOR
EXTERIOR LUMINAIRES
LUMINAIRES EXTRIEUR
LUMINARIAS DE INTERIOR
INTERIOR LUMINAIRES
LUMINAIRES D'INTRIEUR
DOWNLIGHTS SUPERFICIE
PROYECTORES
APLIQUES Y LMPARAS DE PIE
ESTRUCTURAS
DOWNLIGHTS EMPOTRABLES
LUMINARIAS EMPOTRABLES
SISTEMAS SANITARIOS
INDUSTRIAL
SISTEMAS DE CONTROL Y ALIMENTACIN
BALIZAS
APLIQUES / DOWLIGHTS
EMPOTRABLES
LUMINARIAS
PROYECTORES
ILUMINACIN VIAL Y URBANA
INFORMACIN COMPLEMENTARIA
6
'RZQOLJKWV(PSRWUDEOHV
DOMO / TRIMLESS
Downlight DOMO de alto confort visual
DOMO downlight of high visual confort
Downlight DOMO haut confort visuel
LED
208 Mx.35mm
850 Al
IP
20

N LED W Cdigo Color (XURV Kg K lm LED
5
10
15
11
19
33
86.40.63.0
86.40.60.0
86.40.61.0
180,00
246,00
349 ,00
1,5
1,5
1,5
Warm
Warm
Warm
1000
2000
3000
5HJXODEOH'LPPDEOH*UDGDEOH
N LED W Cdigo Color (XURV Kg K lm LED
10
15
19
33
86.80.60.0
86.80.61.0
389,50
566,50
1,5
1,5
Warm
Warm
2000
3000
1-10V DALI
Downlight DOMO luz dinmica regulable de alto confort visual
DOMO dimmable dynamic light downlight of high visual confort
Downlight DOMO clairage dynamique gradable et haut confort visuel
N LED W Cdigo Color (XURV Kg K lm LED
20 44 86.80.62.0 617,00 1,5 Warm
Cool
4410 DALI
220 mm
150 160
Cristal opal
Opal glass
Verre opal
Cdigo Color (XURV
86.06.12.0
86.06.12.3
10,50
10,50
Cristal transparente
Transparent glass
Verre translucide
Cdigo Color (XURV
86.06.14.0
86.06.14.3
9,50
9,50
Downlight DOMO TRIMLESS de alto confort visual
DOMO TRIMLESS downlight of high visual confort
Downlight DOMO TRIMLESS haut confort visuel
LED
198 7-25 mm
850 Al
IP
20

N LED W Cdigo Color (XURV Kg K lm LED
5
10
15
11
19
33
86.40.66.0
86.40.64.0
86.40.65.0
212,00
280,00
379,00
1,5
1,5
1,5
Warm
Warm
Warm
1000
2000
3000
N LED W Cdigo Color (XURV Kg K lm LED
10
15
19
33
86.80.64.0
86.80.65.0
416,50
590,00
1,5
1,5
Warm
Warm
2000
3000
1-10V DALI
Downlight DOMO TRIMLESS luz dinmica regulable de alto confort visual
DOMO TRIMLESS dimmable dynamic light downlight of high visual confort
Downlight DOMO TRIMLESS clairage dynamique gradable et haut confort visuel
N LED W Cdigo Color (XURV Kg K lm LED
20 44 86.80.67.0 640,50 1,5 Warm
Cool
4410 DALI
196 mm
148 160
5HJXODEOH'LPPDEOH*UDGDEOH
Difusor interior para Domo y Domo trimless
Inner diffuser for Domo and Domo trimless
Diffuseur intrieur pour Domo et Domo trimless
Cdigo Color (XURV
86.06.15.0 34,00
N
PC
Accesorios
Accessories
Accessoires
IP
54
7
'RZQOLJKWV(PSRWUDEOHV
DOMO ASIMTRICO / SPOTLIGHT
NEW
Downlight DOMO ASIMTRICO de alto confort visual
DOMO ASYMMETRIC downlight of high visual confort
Downlight DOMO ASYMTRIQUE haut confort visuel
LED
208 Mx.35mm
850 Al
IP
20

N LED W Cdigo Color (XURV Kg K lm LED
10
15
19
33
86.40.72.0
86.40.73.0
303,00
410,00
1,5
1,5
Warm
Warm
2000
3000
Downlight DOMO ASIMTRICO regulable de alto confort visual
DOMO ASYMMETRIC dimmable downlight of high visual confort
Downlight DOMO ASYMTRIQUE haut confort visuel
N LED W Cdigo Color (XURV Kg K lm LED
10
15
19
33
86.80.72.0
86.80.73.0
468,00
649,00
1,5
1,5
Warm
Warm
2000
3000
1-10V DALI
220 mm
150 160
Downlight DOMO SPOTLIGHT
DOMO SPOTLIGHT
Downlight DOMO SPOTLIGHT
LED
Warm
355 30 150 Mx.35mm
850 Al
IP
20
W Cdigo Color (XURV Kg lm LED
32
32
43
43
86.40.74.0
86.40.75.0
86.40.76.0
86.40.77.0
289,50
289,50
377,50
377,50
0,7
0,7
0,7
0,7
MFL
FL
MFL
FL
2000
2000
3000
3000
103
120
160 mm
'RZQOLJKWV(PSRWUDEOHV
DOMO ASIMTRICO / SPOTLIGHT
NEW
DDow li li nli hht ght DO DO DO DOMMO MO ASI AS ASI MT T MTRIC RRICO d d O de alt lt lto co ff nfo tt rt ii vis ll ual
850 Al
IP
P. 8 P. 7 P. 6/7 P. 6
S
c
e
n
in
g
Sistemas de control 1-10V p.148
Systems of control 1-10V p.148
Systmes de contrle 1-10V p.148
8
'RZQOLJKWV(PSRWUDEOHV
DOMO SQUARE
Downlight DOMO SQUARE de alto confort visual
DOMO SQUARE downlight of high visual confort
Downlight DOMO SQUARE haut confort visuel
LED
220 x 220 Mx.35mm
850 Al
IP
20

N LED W Cdigo Color (XURV Kg K lm LED
5
10
15
11
19
33
86.40.70.0
86.40.68.0
86.40.69.0
180,00
246,00
349,00
1,5
1,5
1,5
Warm
Warm
Warm
1000
2000
3000
Downlight DOMO SQUARE regulable de alto confort visual
DOMO SQUARE dimmable downlight of high visual confort
Downlight DOMO SQUARE haut confort visuel
N LED W Cdigo Color (XURV Kg K lm LED
10
15
19
33
86.80.68.0
86.80.69.0
389,50
566,50
1,5
1,5
Warm
Warm
2000
3000
1-10V DALI
Downlight DOMO SQUARE luz dinmica regulable de alto confort visual
DOMO SQUARE dimmable dynamic light downlight of high visual confort
Downlight DOMO SQUARE clairage dynamique gradable et haut confort visuel
N LED W Cdigo Color (XURV Kg K lm LED
20 44 86.80.71.0 617,00 1,5 Warm
Cool
4410
DALI
NEW
108
120
S
c
e
n
in
g
Sistemas de control 1-10V p.148
Systems of control 1-10V p.148
Systmes de contrle 1-10V p.148
Cristal semiopal
Semi-opal glass
Verre semi-opal
Cdigo Color (XURV
90.06.13.0
90.06.13.3
11,50
11,50
Decorativo opal espejo
Decorative opal-mirror
Enjoliveur opale-miroir
Cdigo (XURV
90.06.18.3 32,00
Difusor transparente
Transparent diffuser
Diffuseur translucide
Cdigo Color (XURV
90.06.14.0
90.06.14.3
90.06.15.0
90.06.15.3
10,00
10,00
20,00
20,00
IK
07
PC
GLASS
Difusor opal
Opal diffuser
Diffuseur opal
Cdigo Color (XURV
90.06.12.0
90.06.12.3
90.06.17.0
90.06.17.3
11,00
11,00
22,50
22,50
IK
07
PC
GLASS
230 mm
230
P. 8 P. 7 P. 6/7 P. 6
Difusor interior para Domo Square
Inner diffuser for Domo Square
Diffuseur intrieur pour Domo Square
Cdigo Color (XURV
86.06.16.0 34,00
N
PC
Accesorios
Accessories
Accessoires
IP
54
9
'RZQOLJKWV(PSRWUDEOHV
HST-DE
RX7s
HIT-DE
RX7s
212 x 212 Mx.35mm
850
GLASS
CLASE
I
IP
54
KUBIC
&ULVWDOWUDQVSDUHQWH7UDQVSDUHQWJODVV 9HUUHWUDQVSDUHQW
W Cdigo Color (XURV Kg
70
150
90.01.00.0
90.01.01.0
94,00
94,00
1
1
&ULVWDORSDO2SDOJODVV 9HUUHRSDOH
W Cdigo Color (XURV Kg
70
150
90.01.05.0
90.01.06.0
106,00
106,00
1
1
Downlight cuadrado KUBIC simtrico para lmparas de descarga
KUBIC square symmetric downlight for discharge lamps
Downlight carr KUBIC symtrique pour lampes dcharge
5HHFWRUVLPpWULFR
6\PPHWULFUHHFWRU
5pHFWHXUV\PpWULTXH
Equipos pgina 155
Control Gear page 155
Platine page 155
HST-DE
RX7s
HIT-DE
RX7s
212 x 212 Mx.35mm
850
GLASS
CLASE
I
IP
54
&ULVWDOWUDQVSDUHQWH7UDQVSDUHQWJODVV 9HUUHWUDQVSDUHQW
W Cdigo Color (XURV Kg
70
150
90.01.10.0
90.01.11.0
97,00
97,00
1
1
Downlight cuadrado KUBIC asimtrico para lmparas de descarga
KUBIC square asymmetric downlight for discharge lamps
Downlight carr KUBIC asymtrique pour lampes dcharge
5HHFWRUDVLPpWULFR
$V\PPHWULFUHHFWRU
5pHFWHXUDV\PpWULTXH
Marco includo
Incorporated frame
Cadre incorpor
Marco includo
Incorporated frame
Cadre incorpor
P. 9/11 P. 12 P. 13/14 P. 10
128
232 mm
187
128
232 mm
187
10
'RZQOLJKWV(PSRWUDEOHV
MINI KUBIC
Accesorios
Accessories
Accessoires
IP
54
Cristal transparente
Transparent glass
Verre translucide
Cdigo Color (XURV
90.00.14.0
90.00.14.3
6,00
6,00
Cdigo Color (XURV
90.00.12.0
90.00.12.3
6,50
6,50
Cristal opal
Opal glass
Verre opal
IP
20
Cdigo Color (XURV
90.00.20.0
90.00.20.3
5,50
5,50
Marco embellecedor
Decorative frame
Cadre enjoliveur
(TXLSR(OHFWUyQLFRLQWHJUDGR
W Cdigo Color (XURV Kg h min Portalmp.
1x13
1x18
1x26
90.41.02.0
90.41.03.0
90.41.04.0
58,50
58,50
59,50
0,40
0,40
0,40
110
110
110
G24q-1/2
G24q-1/2
GX24q-3
175
175
175
(TXLSR(OHFWUyQLFRH[WHUQR
W Cdigo Color (XURV Kg h min Portalmp.
1x32
1x14
90.41.05.0
90.41.59.0
73,00
79,00
0,5
0,6
132
110
GX24q-3
GR14q-1
175
175
'LUHFWRDUHG
W Cdigo Color (XURV Kg h min Portalmp.
1x20 90.01.07.0 41,50 0,36 110 E 27 175
Cristal semiopal
Semi-opal glass
Verre semi-opal
Cdigo Color (XURV
90.00.13.0
90.00.13.3
7,00
7,00
Decorativo opal espejo
Decorative opal-mirror
Enjoliveur opal-miroir
Cdigo (XURV
90.00.11.0 24,00
Downlight cuadrado MINI KUBIC FRQUHHFWRUPHWDOL]DGR
0,1,.8%,&VTXDUHZLWKPHWDOL]HGUHHFWRUVTXDUHGRZQOLJKW
'RZQOLJKW0,1,.8%,&FDUUpDYHFUpHFWHXUPpWDOOLVp
158 x 158 Mx.25mm
850
PC
IP
20
TC-TSE
E 27
TC-DE
G24q-1/2
PL-R
GR14q-1
TC-TE
GX24q-3
TC-TE
GX24q-3
P. 9/11 P. 12 P. 13/14 P. 10
165
100
h
165
100
h
11
KUBIC
*
*
IP
20
CLASE
I
PC 01
PL-R
GR14q-1
Mx.35mm 220 x 220
850
TC-DE
TC-TE
TC-D
'RZQOLJKWFXDGUDGR.8%,&&/$6(,,GHSROLFDUERQDWRSDUDXRUHVFHQFLD
6TXDUHSRO\FDUERQDWHGRZQOLJKW.8%,&&/$66,,IRUXRUHVFHQWODPSV
'RZQOLJKWFDUUp.8%,&&/$6(,,HQSRO\FDUERQDWHSRXUODPSHVXRUHVFHQWHV
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Portalmp.
2x18
2x26/32/42
90.42.24.0
90.42.25.0
75,00
75,00
1,1
1,2
G24q-2
GX24q-3/4
64
64 *
IP
20
01
220 x 220
850
Mx.35mm
PC
TC-DE
TC-TE
TC-D
2x42 slo con accesorios IP 20
2x42 single with accessories IP 20
2x42 seulement avec des accessoires IP 20
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Portalmp.
2x14
2x17
2x18
2x26/32/42
90.42.51.0
90.42.52.0
90.42.64.0
90.42.65.0
95,00
95,00
93,50
93,50
1,1
1,2
1,1
1,2
GR14q-1
GR14q-1
G24q-2
GX24q-3/4
64
64
64
64
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Portalmp.
2x18
2x26
90.02.64.0
90.02.65.0
62,00
63,50
1,4
1,5
G24d-2
G24d-3
64
64
IP
20
Darklight 4 celdas
Darklight 4 cells
Darklight 4 cellules
Cdigo Color (XURV
90.06.10.0
90.06.10.3
36,00
36,00
Cdigo Color (XURV
90.06.20.0
90.06.20.3
8,00
8,00
Marco embellecedor
Decorative frame
Cadre enjoliveur
Accesorios
Accessories
Accessoires
IP
54
Cristal semiopal
Semi-opal glass
Verre semi-opal
Cdigo Color (XURV
90.06.13.0
90.06.13.3
11,50
11,50
Darklight 4 celdas con cristal transparente
Darklight 4 cells with transparent glass
Darklight 4 cellules avec verre translucide
Cdigo Color (XURV
90.06.25.0
90.06.25.3
47,00
47,00
'RZQOLJKWFXDGUDGR.8%,&GHSROLFDUERQDWRSDUDXRUHVFHQFLD
6TXDUHSRO\FDUERQDWHGRZQOLJKW.8%,&IRUXRUHVFHQWODPSV
'RZQOLJKWFDUUp.8%,&HQSRO\FDUERQDWHSRXUODPSHVXRUHVFHQWHV
Decorativo opal espejo
Decorative opal-mirror
Enjoliveur opale-miroir
Cdigo (XURV
90.06.18.3 32,00
Difusor transparente
Transparent diffuser
Diffuseur translucide
Cdigo Color (XURV
90.06.14.0
90.06.14.3
90.06.15.0
90.06.15.3
10,00
10,00
20,00
20,00
IK
07
PC
GLASS
Difusor opal
Opal diffuser
Diffuseur opal
Cdigo Color (XURV
90.06.12.0
90.06.12.3
90.06.17.0
90.06.17.3
11,00
11,00
22,50
22,50
IK
07
PC
GLASS
'RZQOLJKWV(PSRWUDEOHV
12
'RZQOLJKWV(PSRWUDEOHV
158 Mx.25mm
850
PC
IP
20
01
MINI KONIC
(TXLSR(OHFWUyQLFRLQWHJUDGR
W Cdigo Color (XURV Kg Portalmp.
1x13
1x18
1x26
92.41.02.0
92.41.03.0
92.41.04.0
52,50
53,00
53,50
0,27
0,27
0,27
G24q-1
G24q-2
GX24q-3
175
175
175
(TXLSR(OHFWUyQLFRH[WHUQR
W Cdigo Color (XURV Kg Portalmp.
1x14
1x32
92.41.59.0
92.41.05.0
73,00
75,50
0,38
0,38
GR14q-1
GX24q-3
64
64
'LUHFWRDUHG
W Cdigo Color (XURV Kg Portalmp.
1x20 92.01.01.0 38,00 0,24 E-27 175
'RZQOLJKW0,1,.21,&&/$6(,,FRQUHHFWRUPHWDOL]DGRPP
0,1,.21,&&/$66,,GRZQOLJKWZLWKPHWDOL]HGUHHFWRUPP
'RZQOLJKW0,1,.21,&&/$66(,,DYHFUpHFWHXUPpWDOOLVpPP
TC-TSE
E 27
TC-DE
G24q-1/2
TC-TE
GX24q-3
PL-R
GR14q-1
TC-TE
GX24q-3
Accesorios
Accessories
Accessoires
IP
54
Cdigo Color (XURV
92.00.20.0
92.00.20.3
5,00
5,00
Cristal opal
Opal glass
Verre opal
IP
20
Aro embellecedor
Decorative ring
Anneau enjoliveur
Cdigo Color (XURV
92.00.12.0
92.00.12.3
6,50
6,50
Cristal semiopal
Semi-opal glass
Verre semi-opal
Cdigo Color (XURV
92.00.13.0
92.00.13.3
7,00
7,00
Cristal transparente
Transparent glass
Verre translucide
Cdigo Color (XURV
92.00.14.0
92.00.14.3
6,00
6,00
P. 9/11 P. 12 P. 13/14
IP
54
IP
54
P. 10
13
'RZQOLJKWV(PSRWUDEOHV
TC-DE
TC-TE
TC-D
TC-DE
TC-TE
236
236
Mx.35mm
Mx.35mm
850
850
GLASS
GLASS
PC
PC
CLASE
I
IP
54
IP
54
01
01
KONIC
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Portalmp.
2x18
2x26
92.02.66.0
92.02.67.0
67,50
70,50
1,7
1,8
G24d-2
G24d-3
64
64
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Portalmp.
2x18
2x26
92.62.66.0
92.62.67.0
195,50
196,00
1,2
1,2
G24d-2
G24d-3
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Portalmp.
2x18
2x26/32
92.42.26.0
92.42.27.0
80,00
80,00
1,4
1,7
G24q-2
GX24q-3
64
64
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Portalmp.
2x18
2x26/32
92.42.66.0
92.42.67.0
93,00
93,00
1,4
1,7
G24q-2
GX24q-3
64
64
'RZQOLJKW.21,&FRQGLIXVRURSDOL]DGRPP
.21,&GRZQOLJKWZLWKRSDOGLIIXVHUPP
'RZQOLJKW.21,&DYHFGLIIXVHXURSDOPP
'RZQOLJKW.21,&&/$6(,,FRQGLIXVRURSDOL]DGRPP
.21,&&/$66,,GRZQOLJKWZLWKRSDOGLIIXVHUPP
'RZQOLJKW.21,&&/$6(,,DYHFGLIIXVHXURSDOPP
Con emergencia de 1 hora de autonoma
With 1 hour emergency equipment
Avec quipement de secours, 1 heure autonomie
P. 9/11 P. 12 P. 13/14 P. 10
14
'RZQOLJKWV(PSRWUDEOHV
KONIC
PL-R
GR14q-1
TC-DE
TC-TE
TC-DE
TC-TE
TC-D
236
236
Mx.35mm
Mx.35mm
850
850
PC
PC
CLASE
I
IP
20
IP
20
01
01
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Portalmp.
1x18
1x26
2x13
2x18
2x26
92.01.64.0
92.01.65.0
92.02.63.0
92.02.64.0
92.02.65.0
61,00
63,50
63,50
63,50
65,50
1,20
1,25
1,30
1,40
1,50
G24d-2
G24d-3
G24d-1
G24d-2
G24d-3
64
64
64
64
64
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Portalmp.
2x18
2x26
92.62.64.0
92.62.65.0
191,50
196,00
1,20
1,20
G24d-2+q-2
G24d-3+q-3
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Portalmp.
1x18
1x26/32/42
2x14
2x17
2x18
2x26/32/42*
92.41.64.0
92.41.65.0
92.42.51.0
92.42.52.0
92.42.64.0
92.42.65.0
85,50
85,50
89,00
89,00
84,50
84,50
0,91
0,91
0,91
0,91
0,91
0,91
G24q-2
GX24q-3/4
GR14q-1
GR14q-1
G24q-2
GX24q-3/4
64
64
64
64
64
64
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Portalmp.
2x18
2x26/32/42*
92.42.24.0
92.42.25.0
73,00
73,00
1,70
1,80
G24q-2
GX24q-3/4
64
64
'RZQOLJKW.21,&FRQUHHFWRUPHWDOL]DGRPP
.21,&GRZQOLJKWZLWKPHWDOOL]HGUHHFWRUPP
'RZQOLJKW.21,&DYHFUpHFWHXUPpWDOOLVpPP
'RZQOLJKW.21,&&/$6(,,FRQUHHFWRUPHWDOL]DGRPP
.21,&&/$66,,GRZQOLJKWZLWKPHWDOOL]HGUHHFWRUPP
'RZQOLJKW.21,&&/$6(,,DYHFUpHFWHXUPpWDOOLVpPP
Con emergencia de 1 hora de autonoma
With 1 hour emergency equipment
Avec quipement de secours, 1 heure autonomie
2x42 slo con accesorios IP20
2x42 single with accessories IP20
2x42 seulement avec des accessoires IP20
*
2x42 slo con accesorios IP20
2x42 single with accessories IP20
2x42 seulement avec des accessoires IP20
*
P. 9/11 P. 12 P. 13/14 P. 10
15
'RZQOLJKWV(PSRWUDEOHV
KONIC
Accesorios IP 20
Accessories IP 20
Accessoires IP 20
Accesorios IP 54
Accessories IP 54
Accessoires IP54
IP
54
Cilndro opal
Opal cylindrical diffuser
Cylindrique opal
Darklight 4 celdas + cristal
Darklight 4 cells + glass
Darklight 4 cellules + verre
Cdigo Color (XURV
92.07.12.0
92.07.12.5
92.07.12.7
40,00
54,00
54,00
Cdigo Color (XURV
92.06.25.0
92.06.25.3
32,00
32,00
Cdigo Color (XURV
92.06.50.5 31,00
Cdigo Color (XURV
92.06.12.0
92.06.12.3
92.06.17.0
92.06.17.3
11,00
11,00
25,00
25,00
Darklight 4 celdas
Darklight 4 cells
Darklight 4 cellules
Darklight 9 celdas
Darklight 9 cells
Darklight 9 cellules
Aro embellecedor
Decorative ring
Anneau enjoliveur
Darklight Turbo
Turbo Darklight
Darklight Turbo
Cristal semi-opal
Semi-opal glass
Verre semi-opal
IP
20
Aro exterior de cristal azul
Blue exterior glass ring
Anneau verre extrieur blau
Difusor opal
Opal diffuser
Diffuseur opal
Cdigo Color (XURV
92.06.10.0
92.06.10.3
23,50
23,50
Cdigo Color (XURV
92.06.22.0
92.06.22.3
27,00
27,00
Cdigo Color (XURV
92.06.20.0
92.06.20.3
8,00
8,00
Cdigo Color (XURV
92.06.23.0
92.06.23.3
32,00
32,00
Cdigo Color (XURV
92.06.13.0
92.06.13.3
11,50
11,50
Cristal exterior
Exterior glass
Verre extrieur
&ULVWDOVHULJUDDGR
Decorative glass
Verre serigraphi
Cdigo Color (XURV
92.06.38.0 14,50
Cdigo Color (XURV
92.06.16.0
92.06.16.3
13,00
13,00
Aro exterior de cristal blanco
White exterior glass ring
Anneau verre extrieur blanc
Difusor transparente
Transparent diffuser
Diffuseur translucide
Cdigo Color (XURV
92.06.50.0 31,00
Cdigo Color (XURV
92.06.14.0
92.06.14.3
92.06.15.0
92.06.15.3
10,50
10,50
24,00
24,00
IK
07
PC
GLASS
IK
07
PC
GLASS
16
'RZQOLJKWV(PSRWUDEOHV
ALUMIC
TC-D
TC-DE
236 Mx.60mm
960 Al
CLASE
I
IP
20
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Portalmp.
2x18
2x26/32
92.42.61.0
92.42.62.0
115,50
116,00
1,6
1,2
G24q-2
G24q-3
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Portalmp.
2x18
2x26
92.02.61.0
92.02.62.0
86,00
87,50
1,9
2,2
G24d-2
G24d-3
'RZQOLJKW$/80,&SDUDXRUHVFHQFLDFRPSDFWD
$/80,&GRZQOLJKWIRUFRPSDFWXRUHVFHQWODPS
'RZQOLJKW$/80,&SRXUODPSHVXRUHVFHQWHVFRPSDFWHV
Equipos pgina 155
Control Gear page 155
Platine page 155
17
'RZQOLJKWV(PSRWUDEOHV
ALUMIC
Equipos pgina 155
Control Gear page 155
Platine page 155
W Cdigo Color (XURV Kg Portalmp.
70
150
92.01.09.0
92.01.10.0
77,00
77,00
0,8
0,8
Rx7s
Rx7s-24
Downlight ALUMIC confort para lmpara HIT-DE / HST-DE
con cristal incorporado
ALUMIC downlight for HIT-DE / HST-DE lamp visual
comfort with glass included
Downlight ALUMIC confort visuel pour lampe HIT-DE / HST-DE
avec verre incorpor
Mx.60mm HST-DE HIT-DE 236
960
GLASS
Al
CLASE
I
IP
20
W Cdigo Color (XURV Kg
70 92.01.19.0 42,00 0,6
Downlight ALUMIC para lmpara HIT-DE / HST-DE 70W
ALUMIC downlight for 70W HIT-DE / HST-DE lamp
Downlight ALUMIC pour lampe HIT-DE / HST-DE 70W
Cristal UVA
UVA Glass
Verre UVA
Cdigo mm (XURV
92.06.35.0 168 28,00
Mx.60mm HST-DE
RX7s
HIT-DE
RX7s
150
960
GLASS
Al
CLASE
I
IP
20
W Cdigo Color (XURV Kg
150 92.01.18.0 41,50 0,6
Downlight ALUMIC para lmpara HIT-DE / HST-DE 150W
ALUMIC downlight for 150W HIT-DE / HST-DE lamp
Downlight ALUMIC pour lampe HIT-DE / HST-DE 150W
Cristal UVA
UVA Glass
Verre UVA
Cdigo mm (XURV
92.06.36.0 228 29,00
Mx.60mm HST-DE
RX7s-24
HIT-DE
RX7s-24
210
960
GLASS
Al
CLASE
I
IP
20
Gris
Grey
Gris
Blanco
White
Blanc
18
'RZQOLJKWV(PSRWUDEOHV
ORBIT
Mx.30mm HST-DE HIT-DE
60 220 x 125
960
GLASS
Al
CLASE
I
IP
40
W Cdigo Color (XURV Kg Portalmparas
1x70
1x70
1x150
1x150
92.01.17.0
92.01.17.3
92.01.20.0
92.01.20.3
33,00
33,00
33,00
33,00
0,8
0,8
0,8
0,8
Rx7s
Rx7s
Rx7s-24
Rx7s-24
ORBIT basculante rectangular para lmpara HIT-DE/HST-DE
Adjustable rectangular ORBIT downlight for HIT-DE/HST-DE lamp
Downlight ORBIT basculant pour lampe HIT-DE/HST-DE
Cristal UVA
UVA Glass
Verre UVA
Cdigo (XURV
92.06.32.0 20,50
LED
Warm
12V
35
35
35
35
35
35
35
35
160
160
Mx.30mm
Mx.30mm
960
960
Al
Al
IP
20
IP
20
W Cdigo Color (XURV Kg J
75
75
35/70
35/70
35/70
35/70
max.100
max.100
92.03.06.0
92.03.06.3
92.03.07.0
92.03.07.3
92.03.03.0
92.03.03.3
92.03.05.0
92.03.05.3
72,00
72,00
76,50
76,50
87,50
87,50
49,00
49,00
0,5
0,5
0,6
0,6
0,6
0,6
0,4
0,4
1
1
1
1
1
1
2
2
Downlight ORBIT sistema cardan
ORBIT gimble downlight
Downlight ORBIT systme cardan
CLASE
I
PAR30
E27
CLASE
I
HI-PAR30
E27
CLASE
I
CDM-R111
GX 8,5
QR-111
G 53
Fig.1
Fig.2
N LED W Cdigo Color (XURV Kg lm Output J
8
8
8
8
15
15
15
15
92.01.48.0
92.01.48.3
92.01.49.0
92.01.49.3
163,00
163,00
163,00
163,00
0,7
0,7
0,7
0,7
830
830
830
830
2
2
2
2

Wide
Flood

Medium
Flood
ref.: 92.47.71.0
(p.155)
ref.: 92.47.71.0
(p.155)
Downlight ORBIT sistema cardan con lmpara LED
ORBIT gimble downlight with LED lamp
Downlight ORBIT systme cardan avec lampe LED
12V
35
35
35
35
Mx.30mm 94
960 Al
IP
20
Downlight MINI ORBIT sistema cardan
MINI ORBIT gimble downlight
Downlight MINI ORBIT systme cardan
Fig.2
QR-CBC51
GU 5,3
LED
Warm

Flood
N
N LED W Cdigo Color (XURV Kg lm output
4
4
10
10
92.41.30.0
92.41.30.3
67,50
67,50
0,2
0,2
385
385
W Cdigo Color (XURV Kg
50
50
92.01.30.0
92.01.30.3
17,50
17,50
0,2
0,2
Gris metalizado brillante
Bright silver gray
Brillant gris mtallis
Blanco mate
Matt white
Blanc mat
19
'RZQOLJKWV(PSRWUDEOHV
355 40 150 Mx.35mm
960
GLASS
Al
IP
40
ORBIT
W Cdigo Color (XURV Kg
max.100
max.100
35/70
35/70
35/70
35/70
35/70
35/70
max.100
max.100
max.100
max.100
20/35
20/35
20/35
20/35
92.01.77.0
92.01.77.3
92.01.76.0
92.01.76.3
92.01.70.0
92.01.70.3
92.01.71.0
92.01.71.3
92.01.72.0
92.01.72.3
92.01.73.0
92.01.73.3
92.01.74.0
92.01.74.3
92.01.75.0
92.01.75.3
50,50
50,50
104,00
104,00
63,00
63,00
63,00
63,00
86,00
86,00
86,00
86,00
93,00
93,00
93,00
93,00
0,5
0,5
0,6
0,6
0,7
0,7
0,7
0,7
0,7
0,7
0,7
0,7
0,7
0,7
0,7
0,7
-
-
-
-
MFL
MFL
WFL
WFL
MFL
MFL
WFL
WFL
MFL
MFL
WFL
WFL
Downlight ORBIT basculante circular 160
ORBIT adjustable circular downlight 160
Downlight ORBIT basculant circulaire 160
QR-111
G 53
CLASE
I
CDM-R111
GX 8,5
CLASE
I
HIT-TC
G8,5
QT 12
GY6,35
CLASE
I
CDM-Tm
PGJ5
355 40 185 Mx.35mm
960
GLASS
Al
IP
40
W Cdigo Color (XURV Kg
35/70/150
35/70/150
35/70/150
35/70/150
100
100
92.01.40.0
92.01.40.3
92.01.41.0
92.01.41.3
92.01.43.0
92.01.43.3
82,50
82,50
82,50
82,50
112,00
112,00
1,2
1,2
1,2
1,2
1,2
1,2
MFL
MFL
WFL
WFL
VWFL
VWFL
Downlight ORBIT basculante circular 195
ORBIT adjustable circular downlight 195
Downlight ORBIT basculant circulaire 195
CLASE
I
HIT
G12
CLASE
I
HST
PG12-1
Equipos pgina 155
Control Gear page 155
Platine page 155
12V
LED
Warm
12V
LED
Warm
ref.: 92.47.71.0
(p.155)
ref.: 92.47.71.0
(p.155)
N LED
W Cdigo Color (XURV Kg lm Output
8
8
8
8
15
15
15
15
92.01.78.0
92.01.78.3
92.01.45.0
92.01.45.3
159,00
159,00
159,00
159,00
0,5
0,5
0,5
0,5
WFL
WFL
MFL
MFL
830
830
830
830
Downlight ORBIT basculante circular 160 con lmpara LED
ORBIT LED adjustable circular downlight 160 with LED lamp
Downlight ORBIT basculant circulaire 160 avec lampe LED
20
'RZQOLJKWV(PSRWUDEOHV
PUZZLE
Marco Cdigo Color (XURV A X B a x b x x y Mdulos Combinacin
1
2
3
4
5
6
7
8
9
49.06.19.3
49.06.19.0
49.06.20.3
49.06.20.0
49.06.21.3
49.06.21.0
49.06.22.3
49.06.22.0
49.06.24.3
49.06.24.0
49.06.25.3
49.06.25.0
49.06.26.3
49.06.26.0
49.06.27.3
49.06.27.0
49.06.28.3
49.06.28.0
20,00
20,00
23,00
23,00
27,00
27,00
31,50
31,50
35,00
35,00
41,50
41,50
49,00
49,00
54,00
54,00
39,50
39,50
186 x 186
186 x 186
344 x 190
344 x 190
494 x 190
494 x 190
654 x 190
654 x 190
959 x 190
959 x 190
1264 x 190
1264 x 190
1574 x 190
1574 x 190
1884 x 190
1884 x 190
344 x 344
344 x 344
142 x 142
142 x 142
300 x 146
300 x 146

450 x 146
450 x 146
610 x 146
610 x 146
915 x 146
915 x 146
1220 x 146
1220 x 146
1530 x 146
1530 x 146
1840 x 146
1840 x 146
300 x 300
300 x 300
174 x 174
174 x 174
332 x 178
332 x 178
482 x 178
482 x 178
642 x 178
642 x 178
947 x 178
947 x 178
1252 x 178
1252 x 178
1562 x 178
1562 x 178
1872 x 178
1872 x 178
332 x 332
332 x 332
A
A
B
B
C
C
D
D
E
E

1A

2A / B

3A / A+B / C

A+C / B+B / 2A+B / 4A / D

D+B / D+2A / C+C

E / 2D / 4B...

E+2A / E+B / 2D+B...

E+D / E+2B / E+C+A ...

2B
Marcos embellecedores de empotrar para mdulos PUZZLE
Decorative frames for PUZZLE recessed installations
&DGUHVGpFRUDWLIVSRXUOLQVWDOODWLRQHQFDVWUpHGX38==/(
Mx.35mm
Marcos embellecedores de empotrar
Decorative frames recessed installations
&DGUHVGpFRUDWLIVSRXUOLQVWDOODWLRQHQFDVWUpH
Marcos ocultos de empotrar
Hidden frames recessed installations
&DGUHVFDFKpVSRXUOLQVWDOODWLRQHQFDVWUpH
Gris
Grey
Gris
Blanco
White
Blanc
21
'RZQOLJKWV(PSRWUDEOHV
PUZZLE
Cdigo Color (XURV A X B a x b x x y Mdulos
1
2
3
4
5
6
7
8
9
49.06.09.2
49.06.09.0
49.06.10.2
49.06.10.0
49.06.11.2
49.06.11.0
49.06.12.2
49.06.12.0
49.06.13.2
49.06.13.0
49.06.14.2
49.06.14.0
49.06.15.2
49.06.15.0
49.06.16.2
49.06.16.0
49.06.17.2
49.06.17.0
20,50
20,50
23,00
23,00
25,50
25,50
32,50
32,50
35,00
35,00
41,50
41,50
49,00
49,00
54,00
54,00
39,50
39,50
166x166
166x166
320x166
320x166
470x166
470x166
630x166
630x166
935x166
935x166
1240x166
1240x166
1550x166
1550x166
1860x166
1860x166
320x320
320x320
146x146
146x146
300x146
300x146
450x146
450x146
610x146
610x146
915x146
915x146
1220x146
1220x146
1530x146
1530x146
1840x146
1840x146
300x300
300x300
170x170
170x170
325x170
325x170
475x170
475x170
635x170
635x170
940x170
940x170
1245x170
1245x170
1555x170
1555x170
1865x170
1865x170
325x325
325x325
A
A
B
B
C
C
D
D
E
E

1A


2A / B

3A / A+B / C

A+C / B+B / 2A+B / 4A / D

D+B / D+2A / C+C

E / 2D / 4B...

E+2A / E+B / 2D+B...

E+D / E+2B / E+C+A ...

2B
Marcos ocultos de empotrar para mdulos PUZZLE
Hidden frames for PUZZLE recessed installations
&DGUHVFDFKpVSRXUOLQVWDOODWLRQHQFDVWUpHGX38==/(
13-15 mm
Blanco
White
Blanc
Negro
Black
Noir
Elementos para marcos ocultos
personalizados
Hidden frame components for
customized sizes
lements pour montage libre de
cadres cachs
3HUOPDUFRRFXOWR
+LGGHQ)UDPHSUROH
3UROGHFDGUHFDFKp
Cdigo Color (XURV Lm
49.05.00.2
49.05.00.0
49.05.02.2
49.05.02.0
16,50
16,50
35,00
35,00
1
1
3
3
Cdigo Color (XURV
49.06.18.2
49.06.18.0
19,50
19,50
Extremo de marco oculto U
Hidden end frames U
Extrme de cadre cach U
1 unit./ref (Uniones incluidas)
1 unit./ref
Unin codo 90
90 elbow joint
Union coude 90
Cdigo Color (XURV
49.06.45.2
49.06.45.0
24,00
24,00
Cdigo Color (XURV
96.06.05.0 5,00
Fijacin intermedia para marcos ocultos
Intermediate joint hidden frames
Union intermdiaire pour cadres cachs
(Uniones incluidas)
2 unit./ref
270
70
80
22
'RZQOLJKWV(PSRWUDEOHV
PUZZLE
W Cdigo Color (XURV Kg
1x75
1x75
1x mx.100
1x mx.100
1x35/70
1x35/70
1x mx.100
1x mx.100
1x35/70
1x35/70
1x35/70
1x35/70
1x35/70/150
1x35/70/150
1x20
1x20
1x20
1x20
49.01.02.1
49.01.02.0
49.01.03.1
49.01.03.0
49.01.05.1
49.01.05.0
49.01.14.1
49.01.14.0
49.01.09.1
49.01.09.0
49.01.15.1
49.01.15.0
49.01.40.1
49.01.40.0
49.01.11.1
49.01.11.0
49.01.12.1
49.01.12.0
68,00
68,00
45,50
45,50
77,00
77,00
78,00
78,00
84,00
84,00
75,00
75,00
123,50
123,50
128,50
128,50
121,00
121,00
0,6
0,6
0,6
0,6
0,6
0,6
0,6
0,6
0,7
0,7
0,6
0,6
0,7
0,7
0,7
0,7
0,7
0,7
Mdulo A para 1 lmpara
Module A for 1 lamp
Module A pour 1 lampe
PAR30
E27
QR-111
G 53
HI-PAR30
E27
QT 12
GY6,35
HIT-TC
G8,5
CDM-R111
GX 8,5
HIT
G12
CDM-Tm
PGJ5
CDM-Tm
PGJ5
CLASE
I
CLASE
I
CLASE
I
CLASE
I
CLASE
I
CLASE
I
CLASE
I
GLASS
GLASS
GLASS
GLASS
GLASS

Flood

Flood

Very Wide
Flood

Flood

Spot
IP
20
960
25
25
25
25
Equipos pgina 155
Control Gear page 155
Platine page 155
Blanco
White
Blanc
Negro
Black
Noir
W Cdigo Color (XURV Kg lm output
8
8
8
8
15
15
15
15
49.41.29.1
49.41.29.0
49.41.43.1
49.41.43.0
168,00
168,00
168,00
168,00
0,7
0,7
0,7
0,7
830
830
830
830
LED
Warm
LED
Warm

Wide
Flood

Medium
Flood
12V
12V
ref.: 92.47.71.0
(p.155)
ref.: 92.47.71.0
(p.155)
N LED
Mdulo A con lmpara LED
Module A with LED lamp
Module A avec lampe LED
W Cdigo Color (XURV Kg lm LED
32
32
32
32
43
43
43
43
49.41.65.2
49.41.65.0
49.41.66.2
49.41.66.0
49.41.67.2
49.41.67.0
49.41.68.2
49.41.68.0
240,00
240,00
240,00
240,00

308,50
308,50
308,50
308,50
0,7
0,7
0,7
0,7
0,7
0,7
0,7
0,7
2000
2000
2000
2000
3000
3000
3000
3000
LED
Warm
LED
Warm

Medium
Flood

Flood
Mdulo A con LED
Module A with LED
Module A avec LED
LED
Warm
LED
Warm

Medium
Flood

Flood
N
139
23
'RZQOLJKWV(PSRWUDEOHV
PUZZLE
Mdulo A ciego
Blind module A
Couvercle pour module A
Mdulo B ciego
Blind module B
Couvercle pour module B
Cdigo Color Lmm (XURV Kg
49.05.10.2
49.05.10.0
160
160
6,50
6,50
0,1
0,1
Cdigo Color Lmm (XURV Kg
49.05.11.2
49.05.11.0
320
320
8,50
8,50
0,2
0,2
Equipos pgina 155
Control Gear page 155
Platine page 155
W Cdigo Color (XURV Kg
2x75
2x75
2x mx.100
2x mx.100
2x 35/70
2x 35/70
2x mx.100
2x mx.100
2x35/70
2x35/70
2x35/70
2x35/70
2x35/70/150
2x35/70/150
49.02.00.1
49.02.00.0
49.02.01.1
49.02.01.0
49.02.03.1
49.02.03.0
49.02.08.1
49.02.08.0
49.02.07.1
49.02.07.0
49.02.09.1
49.02.09.0
49.02.40.1
49.02.40.0
95,00
95,00
63,50
63,50
104,00
104,00
131,00
131,00
147,00
147,00
137,50
137,50
235,50
235,50
1,3
1,3
1,3
1,3
1,3
1,3
1,3
1,3
1,4
1,4
1,3
1,3
1,4
1,4
Mdulo B para 2 lmparas
Module B for 2 lamps
Module B pour 2 lampes
PAR30
E27
QR-111
G 53
HI-PAR30
E27
QT 12
GY6,35
HIT-TC
G8,5
CDM-R111
GX 8,5
HIT
G12
CLASE
I
CLASE
I
CLASE
I
CLASE
I
CLASE
I
GLASS
GLASS
GLASS

Wide
Flood

Flood

Very Wide
Flood
IP
20
960
25
25
25
25
Posibilidad de utilizar el marco n 9
para combinar 2 mdulos de 2 lmparas
Possibility to use frame n9
to combine 2 moduls of 2 lamps
3RVVLELOLWpGXWLOLVHUOHFDGUHQ
pour combiner 2 modules de 2 lampes.
IP
20
960
25
25
25
25
Mdulo C para 3 lmparas
Module C for 3 lamps
Module C pour 3 lampe
W Cdigo Color (XURV Kg
3 x 75
3 x 75
3 x mx.100
3 x mx. 100
3 x 35/70
3 x 35/70
100+35/70+100
100+35/70+100
49.03.00.1
49.03.00.0
49.03.01.1
49.03.01.0
49.03.02.1
49.03.02.0
49.03.11.1
49.03.11.0
133,50
133,50
95,00
95,00
173,50
173,50
124,50
124,50
1,8
1,8
1,8
1,8
1,8
1,8
1,8
1,8
PAR30
E27
QR-111
G 53
HI-PAR30
E27
QR-111
G 53
CLASE
I
CLASE
I
HI-PAR30
E27
CLASE
I
IP
20
960
25
25
25
25
W Cdigo Color (XURV Kg
4 x 75
4 x 75
4 x mx.100
4 x mx.100
49.04.00.1
49.04.00.0
49.04.01.1
49.04.01.0
176,50
176,50
132,00
132,00
2,5
2,5
2,5
2,5
Mdulo D para 4 lmparas
Module D for 4 lamps
Module D pour 4 lampes
PAR30
E27
QR-111
G 53
CLASE
I
Mdulo B con LED
Module B with LED
Module B avec LED
W Cdigo Color (XURV Kg lm LED
2x32
2x32
2x32
2x32
2x43
2x43
2x43
2x43
49.42.72.2
49.42.72.0
49.42.73.2
49.42.73.0
49.42.74.2
49.42.74.0
49.42.75.2
49.42.75.0
478,50
478,50
478,50
478,50

614,50
614,50
614,50
614,50
1,4
1,4
1,4
1,4
1,4
1,4
1,4
1,4
2x2000
2x2000
2x2000
2x2000
2x3000
2x3000
2x3000
2x3000
LED
Warm
LED
Warm

Medium
Flood

Flood
LED
Warm
LED
Warm

Medium
Flood

Flood
N
139
139
24
'RZQOLJKWV(PSRWUDEOHV
850
PC
DIFUSER
850
960
TC-L
2 G 11
T5/T16
G5
T5/T16
G5
CLASE
I
PC
DIFUSER
CLASE
I
IP
30
CLASE
I
IP
20
IP
30
0yGXOR'SDUDXRUHVFHQFLDFRPSDFWDFRQGLIXVRURSDO
0RGXOH'IRUFRPSDFWXRUHVFHQWODPSZLWKRSDOGLIXVHU
0RGXOH'SRXUODPSHXRUHVFHQWHFRPSDFWHDYHFGLIIXVHXURSDO
0yGXOR'\(SDUDGREOHXRUHVFHQFLD7FRQGLIXVRURSDO
0RGXOH'DQG(IRUWZLQ7XRUHVFHQWODPSVZLWKRSDOGLIXVHU
0RGXOH'HW(SRXUGRXEOHXRUHVFHQW7DYHFGLIIXVHXURSDO
0yGXOR'\(DVLPpWULFRSDUDXRUHVFHQFLD7
0RGXOH'DQG(IRU7XRUHVFHQWODPSVZLWKDV\PPHWULFUHHFWRU
0RGXOH'HW(DV\PpWULTXHSRXUXRUHVFHQW7
PUZZLE
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
1x55
1x55
49.41.13.2
49.41.13.0
142,00
142,00
2,5
2,5
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm modul.
2x14/24
2x14/24
2x28/54
2x28/54
49.42.12.2
49.42.12.0
49.42.13.2
49.42.13.0
242,00
242,00
293,50
293,50
2,5
2,5
3,1
3,1
600
600
1220
1220
D
D
E
E
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm modul.
1x14/24
1x14/24
1x28/54
1x28/54
49.41.11.2
49.41.11.0
49.41.12.2
49.41.12.0
160,00
160,00
195,50
195,50
2,5
2,5
3,1
3,1
600
600
1220
1220
D
D
E
E
600 mm
L
140
140
140
115
115
115
Blanco
White
Blanc
Negro
Black
Noir
25
'RZQOLJKWV(PSRWUDEOHV
MINI PUZZLE
Equipos pgina 155
Control Gear page 155
Platine page 155
MINI PUZZLE con marco para 1 lmpara orientable
Directional MINI PUZZLE with frame for single lamp
MINI PUZZLE avec cadre pour 1 lampe orientable TBT
W Cdigo Color (XURV Kg
1x50
1x50
49.01.50.2
49.01.50.0
20,50
20,50
0,5
0,5
N LED W Cdigo Color (XURV Kg lm output
4
4
10
10
49.41.50.2
49.41.50.0
67,00
67,00
0,5
0,5
385
385
QR-CBC51
GU 5,3
Mx.25mm 95 x 190
35
35
35
35
960
IP
20
MINI PUZZLE con marco para 2 lmparas orientables
Directional MINI PUZZLE with frame for 2 adjustable lamps
MINI PUZZLE avec cadre pour 2 lampes orientables
W Cdigo Color (XURV Kg
2x50
2x50
49.02.50.2
49.02.50.0
39,00
39,00
0,8
0,8
LED
Warm

Flood

Flood
LED
Warm
QR-CBC51
GU 5,3
Mx.25mm 95 x 285
35
35
35
35
960
IP
20
MINI PUZZLE con marco para 3 lmparas orientables
Directional MINI PUZZLE with frame for 3 adjustable lamps
MINI PUZZLE avec cadre pour 3 lampes orientables
W Cdigo Color (XURV Kg
3x50
3x50
49.03.50.2
49.03.50.0
58,00
58,00
1,3
1,3
N
Gris
Grey
Gris
Blanco
White
Blanc
Mx.25mm 95 x 95
35
35
35
35
960
IP
20
N LED W Cdigo Color (XURV Kg lm output
2x4
2x4
2x10
2x10
49.42.50.2
49.42.50.0
135,00
135,00
0,5
0,5
2x385
2x385
N
12V
12V
ref.: 92.47.71.0
(p.155)
ref.: 92.47.71.0
(p.155)
ref.: 92.47.71.0
(p.155)

Flood
LED
Warm
N LED W Cdigo Color (XURV Kg lm output
3x4
3x4
3x10
3x10
49.43.50.2
49.43.50.0
200,50
200,50
0,5
0,5
3x385
3x385
N
12V
QR-CBC51
GU 5,3
26
'RZQOLJKWV(PSRWUDEOHV
MINI PUZZLE
Equipos pgina 155
Control Gear page 155
Platine page 155
MINI PUZZLE orientable con cristal opal
Directional MINI PUZZLE with opal glass
MINI PUZZLE orientable avec verre opal
MINI PUZZLE orientable y asimtrico
Directional and asymmetric MINI PUZZLE
MINI PUZZLE orientable et asymtrique
MINI PUZZLE orientable con confort visual
Directional MINI PUZZLE for visual confort
MINI PUZZLE orientable avec confort visuel
LED
Warm
LED
Warm
LED
Warm

Medium
Flood

Medium
Flood

Flood
QR-CBC51
GU 5,3
12V 15 70 x 75
960
IP
20
N
N
N
960
45
QR-CBC51
GU 5,3
12V Mx.30mm 75 x 75
OPAL
GLASS
Al
IP
44
45
QR-CBC51
GU 5,3
12V Mx.30mm 100 x 75
960
IP
20
91mm
150
150
115mm
90
Gris
Grey
Gris
Blanco
White
Blanc
N LED W Cdigo Color (XURV Kg lm output
4
4
10
10
49.41.46.3
49.41.46.0
66,50
66,50
0,2
0,2
385
385
N LED W Cdigo Color (XURV Kg lm output
4
4
10
10
49.41.47.3
49.41.47.0
64,50
64,50
0,2
0,2
385
385
N LED W Cdigo Color (XURV Kg lm output
4
4
10
10
49.41.60.2
49.41.60.0
67,50
67,50
0,2
0,2
385
385
W Cdigo Color (XURV Kg
50
50
49.01.46.3
49.01.46.0
12,00
12,00
0,2
0,2
W Cdigo Color (XURV Kg
50
50
49.01.47.3
49.01.47.0
11,00
11,00
0,2
0,2
W Cdigo Color (XURV Kg
50
50
49.01.60.2
49.01.60.0
14,50
14,50
0,2
0,2
ref.: 92.47.71.0
(p.155)
ref.: 92.47.71.0
(p.155)
ref.: 92.47.71.0
(p.155)
27
'RZQOLJKWV(PSRWUDEOHV
GALA
Gris oscuro satinado
Satin dark gray
Gris fonc satin
Blanco mate
Matt white
Blanc mat
'RZQOLJKWEDMRYROWDMH*$/$GHFXHUSRMR
/RZYROWDJHGRZQOLJKW*$/$[HGERG\
'RZQOLJKW*$/$7%7FRUSV[H
QR-CBC51
GU 5,3
QR-CBC51
GU 5,3
12V 95
960
Al
IP
44
Downlight bajo voltaje GALA de cuerpo orientable
Low voltage downlight GALA adjustable body
Downlight GALA TBT corps orientable
12V 350 30 95
960 Al
IP
20
Equipos pgina 155
Control Gear page 155
Platine page 155
$FFHVRULRVQHFHVDULRVSDUDFRPSOHWDUHOGRZQOLJKW*$/$FXHUSRMR
1HHGHGDFFHVVRULHVWRWWRWKH[HG*$/$GRZQOLJKW
$FFHVVRLUHVQpFHVVDLUHVSRXUFRPSOpWHUOHGRZQOLJKW*$/$FRUSV[H
Cristal semiopal
Central deco glass
Verre avec srigraphie
Cdigo Color (XURV
92.06.40.0
92.06.40.3
8,00
8,00
Cdigo Color (XURV
92.06.43.0
92.06.43.3
10,50
10,50
&ULVWDOFRQGREOHUHHFWRU
'RXEOHLQWHULRUUHHFWRUJODVV
Verre double rflecteur
N
N LED W Cdigo Color (XURV Kg lm output
4
4
10
10
92.44.00.0
92.44.00.3
69,50
69,50
0,2
0,2
385
385
W Cdigo Color (XURV Kg
50
50
92.04.00.0
92.04.00.3
21,50
21,50
0,2
0,2
N
N LED W Cdigo Color (XURV Kg lm output
4
4
10
10
92.44.01.0
92.44.01.3
73,00
73,00
0,2
0,2
385
385
W Cdigo Color (XURV Kg
50
50
92.04.01.0
92.04.01.3
29,00
29,00
0,3
0,3
LED
Warm
LED
Warm

Flood

Flood
ref.: 92.47.71.0
(p.155)
ref.: 92.47.71.0
(p.155)
Gris
Grey
Gris
Blanco
White
Blanc
28
'RZQOLJKWV(PSRWUDEOHV
RING
Equipos pgina 155
Control Gear page 155
Platine page 155
5,1*'$5./,*+7MRUHGRQGR
5RXQG[HG'$5./,*+75,1*
5,1*'$5./,*+7URQG[H
RING THINNER FRAME cuadrado
Squared RING THINNER FRAME
THINNER RAME carr
RING THINNER FRAME redondo
Round RING THINNER FRAME
RING THINNER FRAME rond
RING DARKLIGHT orientable oval
Oval adjustable DARKLIGHT RING
RING DARKLIGHT orientable oval
12V
12V
12V
12V
960
960
70
80 x 80
80
70
Mx.30mm
Mx.30mm
Mx.30mm
Mx.30mm
45
960
Al
Al
960
IP
20
IP
20
IP
20
IP
20
87 mm
35
68
43
68
43
87 mm
35
45
Negro mate
Matt black
Noir mat
90
mm
88
mm
88
mm
90
mm
105
105
LED
Warm

Medium
Flood
QR-CBC51
GU 5,3
N
N LED W Cdigo Color (XURV Kg lm output
4
4
10
10
92.41.28.0
92.41.28.2
63,50
63,50
0,1
0,1
385
385
W Cdigo Color (XURV Kg
50
50
92.01.28.0
92.01.28.2
10,00
10,00
0,1
0,1
LED
Warm

Medium
Flood
QR-CBC51
GU 5,3
N
N LED W Cdigo Color (XURV Kg lm output
4
4
10
10
92.41.29.0
92.41.29.2
63,50
63,50
0,1
0,1
385
385
W Cdigo Color (XURV Kg
50
50
92.01.29.0
92.01.29.2
10,00
10,00
0,1
0,1
LED
Warm

Medium
Flood
QR-CBC51
GU 5,3
N
N LED W Cdigo Color (XURV Kg lm output
4
4
10
10
92.41.06.0
92.41.06.3
66,50
66,50
0,1
0,1
385
385
W Cdigo Color (XURV Kg
50
50
92.01.06.0
92.01.06.3
11,50
11,50
0,1
0,1
LED
Warm

Medium
Flood
QR-CBC51
GU 5,3
N
N LED W Cdigo Color (XURV Kg lm output
4
4
10
10
92.41.27.0
92.41.27.3
66,50
66,50
0,1
0,1
385
385
W Cdigo Color (XURV Kg
50
50
92.01.27.0
92.01.27.3
11,50
11,50
0,1
0,1
ref.: 92.47.71.0
(p.155)
ref.: 92.47.71.0
(p.155)
ref.: 92.47.71.0
(p.155)
ref.: 92.47.71.0
(p.155)
Gris
Grey
Gris
Blanco
White
Blanc
29
'RZQOLJKWV(PSRWUDEOHV
RING
W Cdigo Color (XURV Kg
50
50
92.00.06.0
92.00.06.3
5,00
5,00
0,1
0,1
W Cdigo Color (XURV Kg
50
50
92.00.07.0
92.00.07.3
11,50
11,50
0,2
0,2
W Cdigo Color (XURV Kg
50
50
92.03.02.0
92.03.02.3
12,50
12,50
0,3
0,3
'RZQOLJKW5,1*EDMRYROWDMHMR
5,1*ORZYROWDJH[HGGRZQOLJKW
'RZQOLJKW5,1*VSRWHQFDVWUp7%7[H
Downlight RING bajo voltaje abatible 30 con rotacin 355
RING low voltage downlight adjustable vertical 30 horizontal 355
Downlight RING spot encastr TBT orientable basculant 30
horizontal 355
Downlight RING bajo voltaje abatible 80 con rotacin 355
RING low voltage downlight adjustable vertical 80 horizontal 355
Downlight RING spot encastr TBT orientable basculant 80
horizontal 355
Equipos pgina 155
Control Gear page 155
Platine page 155
Mx.30mm
Mx.30mm
QR-CBC51
GU 5,3
QR-CBC51
GU 5,3
QR-CBC51
GU 5,3
70
355
355
Mx.30mm
30
80
90
105
960 Al
960
960
Al
Al
IP
20
IP
20
IP
20
N
'RZQOLJKW5,1*EDMRYROWDMHMR,3
5,1*ORZYROWDJH[HGGRZQOLJKW,3
'RZQOLJKW5,1*VSRWHQFDVWUp7%7[H,3
12V 70 4-22 mm
960 Al
IP
65
LED
Warm

Flood
N
QR-CBC51
GU 5,3
N LED W Cdigo Color (XURV Kg lm output
4
4
10
10
92.43.11.0
92.43.11.3
69,50
69,50
0,1
0,1
385
385
W Cdigo Color (XURV Kg
50
50
92.03.11.0
92.03.11.3
18,50
18,50
0,1
0,1
ref.: 92.47.71.0
S(p.155)
160
mm
90
30
'RZQOLJKWV(PSRWUDEOHV
QBYTO
LED
350 mA

Very Wide
Flood 37
OPAL
GLASS
960 Al
IP
40
N LED W Cdigo Color (XURV Kg K lm LED
4
4
4
4
4
4
4,8
4,8
4,8
4,8
4,8
4,8
86.04.84.3
86.04.85.3
86.04.84.0
86.04.85.0
86.04.84.4
86.04.85.4
66,00
66,00
66,00
66,00
66,00
66,00
0,12
0,12
0,12
0,12
0,12
0,12
Cool
Warm
Cool
Warm
Cool
Warm
428
322
428
322
428
322
Downlight QBYTO
QBYTO downlight
Downlight QBYTO
Accesorios
Accessories
Accessoires
Marco cuadrado 1 elemento
Square frame 1 element
Cadre 1 lment carr
Marco rectangular 2 elementos
Rectangular frame 2 elements
Cadre 2 lments rectangulaire
Cdigo Color (XURV
86.01.99.3
86.01.99.0
86.01.99.4
21,50
21,50
21,50
Cdigo Color (XURV
86.02.99.3
86.02.99.0
86.02.99.4
27,00
27,00
27,00
Marco cuadrado 2x2 elementos
Square frame 2x2 elements
Cadre 2x2 lments carr
Cdigo Color (XURV
86.04.99.3
86.04.99.0
86.04.99.4
37,50
37,50
37,50
Blanco mate
Matt white
Blanc mat
Cromado brillo
Bright chrome
Chrome brillant
Gris satinado
Satin grey
Gris satin
46 mm
50
30
46
90 160
mm
Equipos pgina 155
Control Gear page 155
Platine page 155
90 x 90
160 x 160
160 x 90
31
Downlights Empotrables
LED
350 mA

Medium
Flood

Flood
850
PC
DIFUSER
Al
IP
20
RING LEDS
N LED W Cdigo Color Euros Kg K lm LED
1
1
1
1
1,2
1,2
1,2
1,2
92.01.44.3
92.01.51.3
92.01.44.0
92.01.51.0
49,00
49,00
49,00
49,00
0,1
0,1
0,1
0,1
Neutral
Warm
Neutral
Warm
94
81
94
81
N LED W Cdigo Color Euros Kg K lm LED
3
3
3
3
3,4
3,4
3,4
3,4
92.03.44.3
92.03.51.3
92.03.44.0
92.03.51.0
59,00
59,00
59,00
59,00
0,1
0,1
0,1
0,1
Neutral
Warm
Neutral
Warm
342
262
342
262
Downlight RING LEDS 1 LED
RING LEDS downlight 1 LED
Downlight RING LEDS 1 LED
Downlight RING LEDS 3 LED
RING LEDS downlight 3 LED
Downlight RING LEDS 3 LED
Anodizado plata mate
Anodized Matt silver
Anodis argent mat
Blanco Mate
Matt White
Blanc mat
31
24
41,5
50
mm
44
Equipos pgina 155
Control Gear page 155
Platine page 155
Anodizado plata mate + Negro mate
Anodized matte silver + Matt black
Anodis argent mat + Noir mat
32
'RZQOLJKWV(PSRWUDEOHV
LED
350 mA 40 Mx.22mm
850
PMMA
DIFUSER
Al
IP
20
FINE LEDS
N LED W Cdigo Color (XURV Kg K lm LED
1
1
1
1
1,2
1,2
1,2
1,2
86.01.10.2
86.01.12.2
86.01.14.2
86.01.16.2
39,50
39,50
39,50
39,50
0,1
0,1
0,1
0,1
Neutral
Neutral
Neutral
Neutral
VWFL
SP
MFL
14x40
100
100
100
100
'RZQOLJKW),1(/('6MR/('
),1(/('6[HGGRZQOLJKW/('
'RZQOLJKW),1(/('6VSRWHQFDVWUp[H/('
ref.: 92.47.82.0
(p.155)
P.32 P.32 P.33 P.33
Equipos pgina 155
Control Gear page 155
Platine page 155
LED
355 30
850
PMMA
DIFUSER
Al
CLASE
I
IP
20
N LED W Cdigo Color (XURV Kg K lm LED
1
1
1
1
1,2
1,2
1,2
1,2
86.41.30.3
86.41.32.3
86.41.34.3
86.41.36.3
81,50
81,50
81,50
81,50
0,5
0,5
0,5
0,5
Neutral
Neutral
Neutral
Neutral
VWFL
SP
MFL
14x40
100
100
100
100
'RZQOLJKWGHVXSHUFLH),1(/('6RULHQWDEOH/('
FINE LEDS adjustable surface downlight 1 LED
'RZQOLJKWVXSHUFLH),1(/('6SURMHFWHXURULHQWDEOH/('
IP
20
Mx.22mm
LED
350 mA 355 45 30
850
PMMA
DIFUSER
Al
N LED W Cdigo Color (XURV Kg K lm LED
1
1
1
1
1,2
1,2
1,2
1,2
86.01.20.3
86.01.22.3
86.01.24.3
86.01.26.3
50,50
50,50
50,50
50,50
0,1
0,1
0,1
0,1
Neutral
Neutral
Neutral
Neutral
VWFL
SP
MFL
14x40
100
100
100
100
Downlight FINE LEDS orientable 1 LED
FINE LEDS adjustable downlight 1 LED
Downlight FINE LEDS orientable 1 LED
ref.: 92.47.82.0
(p.155)
LED 850
PC
DIFUSER
Al
IP
40
FINE LEDS LINEAR
Posibilidad leds de color y RGB (SMD)
Possibility led & RGB color choosing
Possibilit leds couleur et RGB
([WHQVLYD
N LED W Cdigo Color (XURV Kg K Lmm lm LED
36
72
108
6
12
18
86.01.00.2
86.01.02.2
86.01.04.2
51,00
75,00
102,00
0,15
0,30
0,45
Warm
Warm
Warm
VWFL
VWFL
VWFL
330
630
930
262
524
786
6HPL([WHQVLYDFRQUHHFWRUGHDOXPLQLR
N LED W Cdigo Color (XURV Kg K Lmm lm LED
36
72
108
6
12
18
86.02.00.2
86.02.02.2
86.02.04.2
52,50
77,50
105,50
0,17
0,34
0,50
Warm
Warm
Warm
WFL
WFL
WFL
330
630
930
262
524
786
Luminaria FINE LEDS LINEAR HI-Distribution con difusor de PC
FINE LEDS LINEAR Hi-Distribution luminaire with PC diffuser
Luminaire FINE LEDS LINEAR Hi-Distribution avec difuseur PC
1M h03vvh2-h
(2 x 0,5)
LED
24V
850
PC
DIFUSER
Al
IP
40
([WHQVLYD
N LED W Cdigo Color (XURV Kg K Lmm lm LED
5
10
15
6
12
18
86.03.00.2
86.03.02.2
86.03.04.2
118,00
200,00
289,00
0,15
0,30
0,45
Neutral
Neutral
Neutral
VWFL
VWFL
VWFL
330
630
930
500
1000
1500
6HPL([WHQVLYDFRQUHHFWRUGHDOXPLQLR
N LED W Cdigo Color (XURV Kg K Lmm lm LED
5
10
15
6
12
18
86.04.00.2
86.04.02.2
86.04.04.2
121,50
202,50
293,00
0,17
0,34
0,50
Neutral
Neutral
Neutral
WFL
WFL
WFL
330
630
930
500
1000
1500
Luminaria FINE LEDS LINEAR HI-Output con difusor de PC
FINE LEDS LINEAR Hi-Output luminaire with PC diffuser
Luminaire FINE LEDS LINEAR Hi-Output avec difuseur PC
1M h03vvh2-h
(2 x 0,5)
ref: 92.47.46.0
p.155
Accesorios
Accessories
Accessoires
Caja para empotrar
Recessing box
Botie pour encastrer
*UDSDVXMHFLyQVXSHUFLH
&HOLQJ[LQJFOLS
$JUDIH[DWLRQVDLOOLH
Cdigo Color (XURV L mmXxY mm
86.00.51.3
86.00.52.3
86.00.53.3
32,00
36,50
39,00
348
648
948
30x340
30x640
30x940
Cdigo (XURV
86.00.50.0 1,50
L=330mm -> 86.00.50.0 x2
L=630mm -> 86.00.50.0 x3
L=930mm -> 86.00.50.0 x4
Mx.24mm
Anodizado negro mate
Anodized Matt black
Anodis noir mat
Anodizado negro mate + Anodizado plata mate
Anodized Matt black + Anodized Matt silver
Anodis noir mat + Anodis argent mats
EXT. Semi EXT.
EXT. Semi EXT.
24V
ref: 92.47.46.0
p.155
33
'RZQOLJKWV(PSRWUDEOHV
P.32 P.32 P.33 P.33
34
'RZQOLJKWV6XSHUFLH
IP
20
CLASE
I
PC
PC
DIFUSER
TL5c
2GX13
850
1-10V
TL5 C
S
c
e
n
in
g
(TXLSR(OHFWUyQLFR5HJXODEOH
W TL5 DIR TL5 IND Color (XURV Kg
60
60
60+100
60+100
60+35
60+35
60+70
60+70
60+3x100
60+3x100
55.50.01.0
55.50.01.2
55.51.02.0
55.51.02.2
55.51.04.0
55.51.04.2
55.51.05.0
55.51.05.2
55.53.03.0
55.53.03.2
55.50.01.0
55.50.01.2
55.51.32.0
55.51.32.2
55.51.34.0
55.51.34.2
55.51.35.0
55.51.35.2
55.53.33.0
55.53.33.2
306,00
306,00
352,00
352,00
374,50
374,50
374,50
374,50
442,50
442,50
2
2
2,1
2,1
2,1
2,1
2,1
2,1
2,3
2,3
Luminaria DUET para suspender
Suspended DUET luminaire
Luminaire DUET suspendu
DUET
QR-111
G 53
0/30 30
QR-111
G 53
0/30 30
CDM-R111
GX 8,5
0/30 30
CDM-R111
GX 8,5
0/30 30
CLASE
I
PC
PC
DIFUSER
IP
20
850
TL5c
2GX13
Mx.35mm 210 x 190
1-10V
TL5 C
S
c
e
n
in
g
295
(TXLSR(OHFWUyQLFR5HJXODEOH
W TL5 DIR TL5 IND Color (XURV Kg
60
60
60+100
60+100
60+35
60+35
60+70
60+70
60+3x100
60+3x100
55.50.21.0
55.50.21.2
55.51.22.0
55.51.22.2
55.51.24.0
55.51.24.2
55.51.25.0
55.51.25.2
55.53.23.0
55.53.23.2
55.50.21.0
55.50.21.2
55.51.42.0
55.51.42.2
55.51.44.0
55.51.44.2
55.51.45.0
55.51.45.2
55.53.43.0
55.53.43.2
310,00
310,00
383,00
383,00
392,00
392,00
392,00
392,00
450,00
450,00
1,9
1,9
2
2
2
2
2
2
2,2
2,2
/XPLQDULD'8(7FRQRUyQHPSRWUDGR
Suspended DUET with recessed celing rose
/XPLQDLUH'8(7DYHFHXURQHQFDVWUH
QR-111
G 53
0/30 30
QR-111
G 53
0/30 30
CDM-R111
GX 8,5
0/30 30
CDM-R111
GX 8,5
0/30 30
*
*
*
*
* * * *
* * * *
60
75
Blanco satinado
Satin white
Blanc mate
Negro satinado
Satin black
Noir mate
(p.148)
(p.148)
Blanco satinado
Satin white
Blanc mate
Negro satinado
Satin black
Noir mate
35
'RZQOLJKWV6XSHUFLH
IP
20
CLASE
I
PC
PC
DIFUSER
TL5c
2GX13
850
1-10V
TL5 C
S
c
e
n
in
g
(TXLSR(OHFWUyQLFR5HJXODEOH
W Cdigo Color (XURV Kg
60
60
55.50.11.0
55.50.11.2
283,00
283,00
2,5
2,5
Luminaria DUET para adosar
DUET luminaire to surface
Luminaire DUET en saillie
DUET
(p.148)
36
'RZQOLJKWV6XSHUFLH
Gris texturizado
Texturised grey
Gris textur
PAR20
E27
PAR30
E27
Al
Al
CLASE
I
CLASE
I
IP
20
IP
20
'LUHFWRDUHG
Base Ceiling Patre
W Cdigo Color (XURV Kg
max.50 73.01.21.3 35,00 0,6
'LUHFWRDUHG
Base Ceiling Patre
W Cdigo Color (XURV Kg
75 73.01.22.3 35,50 0,6
Twin para suspender para PAR20
Suspended TWIN downlight for PAR20
TWIN suspendu pour PAR20
Twin para suspender para PAR30
Suspended TWIN downlight for PAR30
TWIN suspendu pour PAR30
TWIN
P.36 P.54
Blanco mate
Matt white
Blanc mat
Gris texturizado
Texturised grey
Gris textur
37
'RZQOLJKWV6XSHUFLH
850
850
850
PC
DIFUSER
PC
DIFUSER
PC
DIFUSER
Al
Al
Al
CLASE
I
CLASE
I
CLASE
I
IP
20
IP
20
IP
20
SATINA
Luminaria SATINA para adosar con difusor de policarbonato opal
SATINA for surface mounting with opal polycarbonate diffuser
Luminaire SATINA en saillie avec diffuser opalis en polycarbonate
Luminaria SATINA con suspensin y difusor de policarbonato opal
SATINA with suspension and opal polycarbonate diffuser
Luminaire SATINA avec diffuser opalis en polycarbonate pour suspension
Luminaria SATINA para suspensin rgida con difusor de policarbonato opal
SATINA with rigid suspension and opal polycarbonate diffuser
Luminaire SATINA avec diffuser opalis en polycarbonate pour suspension rigide
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
1x26/32/42
1x26/32/42
87.40.13.0
87.40.13.3
214,00
214,00
1,12
1,12
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
1x26/32/42
1x26/32/42
87.40.73.0
87.40.73.3
280,00
280,00
1,12
1,12
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
1x26/32/42
1x26/32/42
87.40.23.0
87.40.23.3
204,50
204,50
1,2
1,2
'LUHFWRDUHG
W Cdigo Color (XURV Kg
max.100
max.100
87.00.11.0
87.00.11.3
183,00
183,00
1
1
'LUHFWRDUHG
W Cdigo Color (XURV Kg
max.100
max.100
87.00.71.0
87.00.71.3
246,00
246,00
1
1
'LUHFWRDUHG
W Cdigo Color (XURV Kg
max.100
max.100
87.00.21.0
87.00.21.3
173,50
173,50
1,08
1,08
TC-DE
G24q-3/4
TC-DE
G24q-3/4
TC-DE
G24q-3/4
A-60/A-65
E27
A-60/A-65
E27
A-60/A-65
E27
TC-TE
G24q-3/4
TC-TE
G24q-3/4
TC-TE
G24q-3/4
TC-TSE
E 27
TC-TSE
E 27
TC-TSE
E 27
P.62 P.62 P.37 P.62 P.37
Suspensin rgida
Rigid suspensions
Suspensions rigide
Accesorios
Accessories
Accessoires
Filtro azul para lmparas TC-DE de 26W
%OXHOWHUIRU:7&'(ODPSV
Filtre bleu pour lampes TC-DE de 26W
Cdigo Color (XURV
87.06.20.5 21,50
Cdigo Color Cdigo Color hmm (XURV
96.22.02.3
96.22.05.3
96.22.10.3
96.21.02.0
96.21.05.0
96.21.10.0
250
500
1000
16,00
17,50
20,50
max.4m
Gris texturizado
Texturised grey
Gris textur
38
'RZQOLJKWV6XSHUFLH
960
Al
TC-TSE
E 27
Al
960
TC-TE
GX24q
960
A-60/A-65
E27
CLASE
I
CLASE
I
Al
IP
20
IP
20
CLASE
I
IP
20
Luminaria pendular MINIYES para lmparas E27
MINIYES luminaire for E27 lamps
Luminaire MINIYES pour lampes E27
Luminaria pendular MINIYES con equipo incorporado para lmparas de
XRUHVFHQFLDFRPSDFWD
0,1,<(6OXPLQDLUHZLWKLQFOXGHGFRQWUROJHDUIRUXRUHVFHQWODPSV
Luminaire MINIYES avec quipement incorpor pour lampes
fluorescentes compactes
Luminaria pendular MINIYES con equipo incorporado para lmparas de descarga
MINIYES luminaire with included control gear for discharge lamps
Luminaire MINIYES avec quipement incorpor pour lampes dcharge
'LUHFWRDUHG
W Cdigo Color (XURV Kg Portalmp.
max.100 84.07.20.3 30,00 0,4 E27
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Portalmp.
26/32/42
57
70
84.47.32.3
84.47.35.3
84.47.37.3
97,50
111,50
124,00
1,5
1,5
1,5
Gx24q-3/4
Gx24q-5
Gx24q-6
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
70
150
70
150
84.07.41.3
84.07.42.3
84.07.43.3
84.07.44.3
100,50
113,50
106,50
120,00
4,6
5,2
4,6
4,6
MINIYES
*
*
Necesita lmpara GE:F70QBX para
combinacin con cierres de cristal
For combinatiopn with closing of glass,
needs the lamp GE:F70QBX
Pour combinaison avec des fermetures
de verre, il faut la lampe GE:F70QBX
HIE/HSE
E27
HIT
G12

200

200

200
39
'RZQOLJKWV6XSHUFLH
MINIYES
Accesorios
Accessories
Accessoires
Suspensiones
Suspensions
Suspensions
5HHFWRUPHWDOL]DGRPDWH
0DWWPHWDOL]HGUHHFWRU
5pHFWHXUPpWDOOLVpPDW
&DEOHGHDFHUR[UHJXODEOH
para conexin electromecnica a carril
Height-adjustable steel cable suspen-
VLRQ[ZLWKHOHFWULFDOFRQQHF-
tion in track
6XVSHQVLRQUpJODEOH[SRXU
connexion lectromecanique pour rail
5HHFWRUGLIXVRUGLUHFWRLQGLUHFWR
5HHFWRUGLIIXVHUGLUHFWLQGLUHFW
5pHFWHXUGLIIXVHXUGLUHFWLQGLUHFW
Difusor glaseado
Translucid diffuser
Diffuseur translucide
Cierre de cristal transparente
Transparent glass protector
Fermeture verre transparent
Cierre de cristal semi-opal
Semi-opal glass protector
Fermeture verre semi-opal
Cierre de cristal opal
Opal glass protector
Fermeture verre opal
Cdigo hmm mm (XURV
84.05.00.0 200 320 47,00
Cable de acero (3x0,75) regulable
para conexin electromecnica
Steel cable (3x0,75) height-adjustable
for electromechanical connection
Suspension rglable (3x0,75) pour
connexion lectromecanique
Cdigo Color h(m) (XURV
96.21.54.3 max.4 34,00
Cdigo Color h(m) (XURV
96.31.51.3 max.4 64,50
Rgida electromecnica
Electromechanical rigid
Rigide lectromecanique
Cdigo Color h(mm) (XURV
96.21.02.3
96.21.05.3
96.21.10.3
250
500
1000
16,00
17,50
20,50
Cdigo hmm mm (XURV
84.05.02.0 200 320 50,50
Cdigo hmm mm (XURV
84.05.01.0 200 320 31,50
Cdigo mm (XURV
84.05.03.0 310 33,00
Cdigo mm (XURV
84.05.04.0 310 37,00
Cdigo mm (XURV
84.05.05.0 310 35,00
850
850
850
PC
PC
PC
Cable de acero regulable
Steel cable height-adjustable
Cble en acier rglable
Cdigo Color h(m) (XURV
96.01.54.3 max.4 13,00
1 unit/cod.
1 unit/cod.
Anodizado plata mate + Gris oscuro satinado
Anodized Matt silver + Satin dark gray
Anodis argent mat + Gris fonc satin
40
'RZQOLJKWV6XSHUFLH
35
35
35
35
35
35
35
35
T8/T26
G13
35
35
35
35
960
PAR30
E27
960
Al
Al
CLASE
I
650
CLASE
I
IP
20
Al
IP
20
CLASE
I
IP
20
'LUHFWRDUHG
W Cdigo Color (XURV Kg
2x75 49.02.34.3 127,00 2,0
'LUHFWRDUHG
W Cdigo Color (XURV Kg
4x75 49.04.34.3 217,00 3,8
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
4x75 (PAR30)
+
2x18 (T26)
49.04.32.3 359,50 7,0
Luminaria PUZZLE AIR SDUDOiPSDUDVUHHFWRUDV
PUZZLE AIR OXPLQDLUHIRUUHHFWRUODPSV
Luminaire PUZZLE AIR SRXUODPSHVUpHFWHXU
Luminaria PUZZLE AIR SDUDOiPSDUDVUHHFWRUDV
PUZZLE AIR OXPLQDLUHIRUUHHFWRUODPSV
Luminaire PUZZLE AIR SRXUODPSHVUpHFWHXU
/XPLQDULD38==/($,5SDUDOiPSDUDVUHHFWRUDV3$5FRPELQDGDVFRQ
XRUHVFHQFLD77
38==/($,5OXPLQDLUHIRUUHHFWRUODPSVFRPELQHGZLWK77XRUHVFHQWOLJKWLQJ
/XPLQDLUH38==/($,5SRXUODPSHVjUpHFWHXUHWODPSHV7XRUHVFHQWHV
PUZZLE AIR
PAR30
E27
PAR30
E27
QR-111
G 53
QR-111
G 53
CDM-R111
GX 8,5
CDM-R111
GX 8,5
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
2x max.100
2x35
2x70
49.42.32.3
49.42.33.3
49.42.36.3
135,50
439,00
465,50
2,0
2,0
2,0
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
4x max.100
4x35
4x70
49.44.33.3
49.44.35.3
49.44.36.3
235,50
781,50
813,00
3,6
3,6
3,6
41
'RZQOLJKWV6XSHUFLH
PUZZLE AIR
Accesorios para sistemas areos
Accessories for suspended systems
Accessoires pour luminaires suspendus
Suspensiones
Suspensions
Suspensions
Cable de acero regulable en "Y"
Steel cable height-adjustable in "Y"
Suspension en acier rglable en "Y"
Cable de acero regulable en "Y"
Steel cable height-adjustable in "Y"
Cble en acier rglable en "Y"
Kit de 2 tapas para pared y techo
Kit 2 end covers for wall and ceiling
-HX[GHHPERXWVSRXUVFDWLRQPXUDOHHWSODIRQG
Kit de 2 tapas + conexin carril trifsico
Kit 2 end covers + track adaptor
-HX[HPERXWVFRQQH[LRQUDLOpOHFWULp
Dos cables de acero trenzado
Two braided steel cables
Deux cbles acier tress
Kit de 2 tapas para unin paralela de 2 lum.
Kit 2 end covers for paralel union 2 lum.
Jeux de 2 embouts pour jonction parallele
de 2 luminaires
Suspensin vertical electromecnica
Vertical electromechanical connection suspension
Suspension verticale electromcanique
Cdigo Color h(m) (XURV
96.28.63.0
96.28.63.3
max.3
max.3
50,00
50,00
Cdigo Color h(m) (XURV
96.08.63.3 max.3 16,00
Cdigo Color (XURV
49.06.00.3 31,50
Cdigo Color (XURV
49.06.01.3 84,00
Cdigo Color h(m) (XURV
96.07.49.0
96.07.49.3
max.3
max.3
19,50
19,50
Cdigo Color (XURV
49.06.40.3 23,00
Cdigo Color h(m) (XURV
96.01.13.3 max.4 70,50
Es necessario desmontar las 2 tapas
de la luminaria y colocar estas nuevas
Es necessario desmontar las 2 tapas
de la luminaria y colocar estas nuevas
Es necessario desmontar las 2 tapas
de la luminaria y colocar estas nuevas
360
360
42
'RZQOLJKWV6XSHUFLH
Blanco mate
Matt white
Blanc mat
KONIC SUPERFICIE
Luminaria KONIC SUPERFICIE para adosar a techo o suspender
KONIC SURFACE luminaire for suspension or ceiling mounting
/XPLQDLUH.21,&683(5),&,(SRXUVXVSHQVLRQRX[DWLRQGLUHFWHSODIRQG
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Portalmp.
2x26 92.02.58.0 155,50 3,8 G24d-3
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Portalmp.
2x26/32
2x42
1x70
92.42.58.0
92.42.56.0
92.41.55.0
185,00
210,50
283,50
3,1
3,1
3,3
G24q-3
G24q-4
Rx7s
960
IP
20
CLASE
I
Suspensiones
Suspensions
Suspensions
Dos cables de acero trenzado
Two braided steel cables
Deux cbles acier tress
Rgida electromecnica
Electromechanical rigid
Rigide lectromecanique
Cdigo Color h(m) (XURV
96.07.49.0 max.3 19,50
Cdigo Color h(mm) (XURV
96.21.01.0
96.21.02.0
96.21.05.0
96.21.10.0
100
250
500
1000
12,50
16,00
17,50
20,50
TC-D
G24d-3
TC-DE
G24q-3
TC-TE
G24q-4
HIT-DE
RX7s
GLASS
TC-TE
G24q-3
43
'RZQOLJKWV6XSHUFLH
Blanco mate
Matt white
Blanc mat
Gris oscuro texturizado + Gris texturizado
Textured dark gray + Texturised grey
Textur gris fonc + Gris textur
44
3UR\HFWRUHV
AVANT 80
Proyector AVANT80 - Sistema LED
AVANT 80 spotlight - LED system
Spot AVANT 80 - Systme LED
Base Ceiling Patre
N LED W Cdigo Color (XURV Kg lm output
4 10 79.41.00.3 79.41.00.0 175,50 0,7 MFL 385
4 10 79.41.03.3 79.41.03.0 175,50 0,7 Flood 385
Carril Track Rail
4 10 79.41.10.3 79.41.10.0 223,00 0,8 MFL 385
4 10 79.41.04.3 79.41.04.0 223,00 0,8 Flood 385
IP
20
CLASE
I
Al
355 355
850
LED
Warm
Proyector AVANT 80 - Halgena
AVANT 80 spotlight - Halogen
Spot AVANT 80 - Halogne
IP
20
CLASE
I
Al
355 355
850
QR-CBC51
GU 5,3
(TXLSR(OHFWUyQLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
max.
50
79.41.01.3 79.41.01.0 92,50 0,8 10-60
max.
2x50
79.42.02.3 79.42.02.0 142,00 1,2 10-60
Carril Track Rail
max.
50
79.41.11.3 79.41.11.0 152,00 0,9 10-60
max.
2x50
79.42.12.3 79.42.12.0 175,50 1,3 10-60
AVANT 80 AVANT 145 AVANT LINEAL
N
45
3UR\HFWRUHV
AVANT 145
Proyector AVANT 145
AVANT 145 spotlight
Spot AVANT 145
IP
20
CLASE
I
Al
355 355
850
PAR30
E27
'LUHFWRDUHG
Base Ceiling Patre
W Cdigo Color (XURV Kg
max.
75
79.01.20.3 79.01.20.0 110,00 0,9 10-30
Carril Track Rail
max.
75
79.01.30.3 79.01.30.0 154,50 1 10-30
Proyector AVANT 145 - LED
AVANT 145 spotlight - LED
Spot AVANT 145 - LED
IP
20
CLASE
I
Al
355 355
850
LED
Warm
Base Ceiling Patre
N LED W Cdigo Color (XURV Kg lm Output
8 15 79.41.21.3 79.41.21.0 249,00 1,5 WFL 830
8 15 79.41.29.3 79.41.29.0 249,00 1,5 MFL 830
Carril Track Rail
8 15 79.41.31.3 79.41.31.0 296,00 1,7 WFL 830
8 15 79.41.39.3 79.41.39.0 296,00 1,5 MFL 830
Proyector AVANT145 - Halgena
AVANT145 spotlight - Halogen
Spot AVANT 145 - Halogne
IP
20
CLASE
I
355
850
Al
355
(TXLSR(OHFWUyQLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
max.
100
79.41.22.3 79.41.22.0 175,50 1,2 8-45
max.
50
79.41.23.3 79.41.23.0 196,00 1,3 34
Carril Track Rail
max.
100
79.41.32.3 79.41.32.0 219,50 1,3 8-45
max.
50
79.41.33.3 79.41.33.0 258,50 1,5 34
QR-111
G 53
QT 12
GY6,35
QR-111
G 53
QT 12
GY6,35
GLASS
GLASS
Blanco mate
Matt white
Blanc mat
Gris oscuro texturizado + Gris texturizado
Textured dark gray + Texturised grey
Textur gris fonc + Gris textur
46
3UR\HFWRUHV
AVANT 145
Proyector AVANT 145 - Descarga
AVANT 145 spotlight - Discharge
Spot AVANT 145 - Dcharge
IP
20
CLASE
I
355
850
Al
355
(TXLSR(OHFWUyQLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg J
20 79.41.24.3 79.41.24.0 309,50 1,3 32 1
70
70
79.41.25.3
79.41.26.3
79.41.25.0
79.41.26.0
320,50
320,50
1,7
1,7
39
24
2
2
35
2x35
70
79.41.27.3
79.42.27.3
79.41.28.3
79.41.27.0
79.42.27.0
79.41.28.0
269,50
480,00
269,50
1,6
2,3
1,6
10-40
10-40
10-40
2
3
2
Carril Track Rail
20 79.41.34.3 79.41.34.0 359,00 1,5 32 1
70
70
79.41.35.3
79.41.36.3
79.41.35.0
79.41.36.0
365,00
361,50
1,9
1,9
39
24
2
2
35
2x35
70
79.41.37.3
79.42.37.3
79.41.38.3
79.41.37.0
79.42.37.0
79.41.38.0
321,50
520,00
321,50
1,8
2,4
1,8
10-40
10-40
10-40
2
3
2
CDM-Tm
PGJ5
CDM-Tm
PGJ5
HIT-TC
G8,5
HIT-TC
G8,5
CDM-R111
GX 8,5
CDM-R111
GX 8,5
GLASS
GLASS
GLASS
GLASS
AVANT-145
Accesorios
Accessories
Accessoires
5HIUDFWRUSDUDGLVWULEXFLyQHOtSWLFDGHOXMROXPLQRVR
5HIUDFWRUIRUHOLSWLFDOGLVWULEXWLRQRIOXPLQRXVX[
/HQWLOOHSRXUGLVWULEXWLRQHOOLSWLTXHGXX[OXPLQHX[
Cdigo mm (XURV
96.00.22.0 109 35,50
*
Cdigo Color (XURV
96.00.02.2 55,00
Rejilla antideslumbrante tipo panal
Anti-glare honeycomb louvre
Grille anti-blouissement type
panneau
* Filtros de color
&RORUOWHUV
Filtres couleur
Cdigo Color mm (XURV
63.06.21.8
63.06.21.6
63.06.21.5
63.06.21.1 UVA
109
109
109
109
77,00
77,00
77,00
55,00
*
*&RPSDWLEOHFRQOiPSDUDVQRUHHFWRUDV\/('V
&RPSDWLEOHZLWKQRQUHHFWLQJODPSVDQG/('V
&RPSDWLEOHDYHFGHVODPSHVVDQVUpHFWHXUHW/('V
Cdigo Color (XURV
96.00.12.2 29,50
Visera antideslumbrante
Anti-glare screen
Visier anti-blouissement
147
47
3UR\HFWRUHV
AVANT LINEAL
Accesorios
Accessories
Accessoires
Cristal UVA
UVA glass
Verre UVA
Cdigo (XURV
63.06.30.1 17,00
Cdigo Color (XURV
96.00.30.2 60,00
Aletas direccionales
Directional louvre
Grilles directionelles
Proyector AVANT Lineal
AVANT Lineal spotlight
Spot AVANT Lineal
Proyector AVANT Lineal - Descarga
AVANT Lineal spotlight - Discharge
Spot AVANT Lineal - Dcharge
IP
20
IP
20
CLASE
I
CLASE
I
Al
Al
355
355
850
850
355
355
GLASS
GLASS
QT-DE
R7 s
HIT-DE
RX7s
'LUHFWRDUHG
Base Ceiling Patre
W Cdigo Color (XURV Kg
max.
150
79.01.60.3 79.01.60.0 173,00 1,3
Carril Track Rail
max.
150
79.01.70.3 79.01.70.0 213,00 1,5
(TXLSR(OHFWUyQLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
70
150
79.41.61.3
79.41.62.3
79.41.61.0
79.41.62.0
313,00
338,00
2
2,2
Carril Track Rail
70
150
79.41.71.3
79.41.72.3
79.41.71.0
79.41.72.0
358,00
391,00
2,2
2,3
80
60
275
AVANT LINEAL
Blanco mate
Matt white
Blanc mat
Gris oscuro texturizado + Gris texturizado
Textured dark gray + Texturised grey
Textur gris fonc + Gris textur
48
3UR\HFWRUHV
355 30
850 Al
CLASE
I
IP
20
15
SAT
Proyector SAT-1 con control remoto - Halgenas
Remote controlled SAT-1 spotlight - Halogen
Projecteur SAT-1 avec tlcommande squentielle - Halognes
(TXLSR(OHFWUQLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
100
max.
50
35
89.41.11.3
89.41.12.3
89.41.13.3
89.41.11.0
89.41.12.0
89.41.13.0
541,50
525,50
603,50
1,3
1,3
1,3
Carril Track Rail
100
max.
50
35
89.41.01.3
89.41.02.3
89.41.03.3
89.41.01.0
89.41.02.0
89.41.03.0
535,00
519,50
595,50
1,3
1,3
1,3
QR-111
G 53
QR-111
G 53
QR-CBC51
GU 5,3
QR-CBC51
GU 5,3
CDM-R111
GX 8,5
CDM-R111
GX 8,5
6-25 mm 65-70
6-25 mm 65-70
6-25 mm 65-70
Accesorios
Accessories
Accessoires
5HDFWRUSDUDGLVWULEXFLyQHOtSWLFDGHO
XMROXPLQRVR
5HDFWRUIRUHOLSWLFDOGLVWULEXWLRQRIWKH
OXPLQRXVX[
Lentille pour distribution elliptique du
X[OXPLQHX[
Rejilla antideslumbrante tipo panal
Anti-glare honeycomb louvre
Grille anti-blouissement type panneau
Control remoto
Remote controll
Tlcommande
Lente dicroica
Dichroic lenses
Verre dichroque
Cdigo (XURV
89.06.40.0 73,00
Cdigo (XURV
89.06.32.0 27,00
Cdigo (XURV Kg
89.08.00.3 288,00 0,145
Cdigo Color (XURV
89.06.50.5
89.06.50.8
125,00
125,00
SEQUENCING
Segn proyecto consultar precios de proyectores secuenciales
Prices for sequential spotlights to be consulted according to projects
Prix pour projecteurs squentiels consulter selon projet
Alcance mximo 30m
Maximum range 30m
Porte maximale 30m
Blanco mate
Matt white
Blanc mat
Plata
Silver
Argent
49
3UR\HFWRUHV
850
SAT
HIT
G12
355 30
Al
CLASE
I
IP
20
15
Proyector SAT-2 con control remoto - Descarga
Remote controlled SAT-2 spotlight - Discharge
Projecteur SAT-2 avec tlcommande squentielle - Dcharge
(TXLSR(OHFWUQLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
35
70
150
89.41.14.3
89.41.15.3
89.41.16.3
89.41.14.0
89.41.15.0
89.41.16.0
661,00
661,00
740,50
2,5
2,5
2,5
Carril Track Rail
35
70
150
89.41.04.3
89.41.05.3
89.41.06.3
89.41.04.0
89.41.05.0
89.41.06.0
661,00
661,00
740,50
2,5
2,5
2,5
1HFHVLWDUHHFWRU
,WQHHGVUHHFWRU
,ODEHVRLQGHUpHFWHXUV
*
1HFHVLWDUHHFWRU
,WQHHGVUHHFWRU
,ODEHVRLQGHUpHFWHXUV
*
Accesorios
Accessories
Accessoires
5HDFWRUSDUDGLVWULEXFLyQHOtSWLFDGHO
XMROXPLQRVR
5HDFWRUIRUHOLSWLFDOGLVWULEXWLRQRIWKH
OXPLQRXVX[
Lentille pour distribution elliptique du
X[OXPLHQX[
Control remoto
Remote controll
Tlcommande
Cdigo (XURV
89.06.60.0 68,50
Cdigo (XURV Kg
89.08.00.3 288,00 0,145
5HHFWRUFRQFULVWDO
UHHFWRUZLWKJODVV
6$7UHHFWHXUDYHFYHUUH
Cdigo
Color
Cristal
Color Cdigo
Color
Cristal
Color (XURV
89.06.30.3
89.06.35.3
89.06.36.3
89.06.38.3
89.06.30.0
89.06.35.0
89.06.36.0
89.06.38.0
86,00
156,50
156,50
156,50
Transp. Transp.

24 GLASS
6HJ~QSUR\HFWRGLVSRQLEOHVUHHFWRUHV
8QGHUSURMHFWDYDLODEOHUHHFWRUV
6HORQSURMHWVGLVSRQLEOHVUpHFWHXUV
SEQUENCING
Segn proyecto consultar precios de proyectores secuenciales
Prices for sequential spotlights to be consulted according to projects
Prix pour projecteurs squentiels consulter selon projet
6-25 mm 65-70
6-25 mm 65-70
6-25 mm 65-70
Alcance mximo 30m
Maximum range 30m
Porte maximale 30m
Blanco mate
Matt white
Blanc mat
Plata
Silver
Argent
50
3UR\HFWRUHV
VISSIO 130
Proyector VISSIO 130 - Descarga
VISSIO 130 spotlight - Discharge
Spot VISSIO 130 - Dcharge
IP
20
CLASE
I
30
850
Al
355
(TXLSR(OHFWUyQLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
70 63.48.03.3 63.48.03.0 237,00 1,6 10-40
35
70
63.48.22.3
63.48.20.3
63.48.22.0
63.48.20.0
303,00
308,00
1,6
1,6
15-22
15-22
35
70
63.48.21.3
63.48.09.3
63.48.21.0
63.48.09.0
303,50
308,50
1,6
1,6
36-70
36-70
Carril Track Rail
70 63.48.13.3 63.48.13.0 285,00 1,7 10-40
35
70
63.48.32.3
63.48.30.3
63.48.32.0
63.48.30.0
354,50
365,50
1,7
1,7
15-22
15-22
35
70
63.48.31.3
63.48.19.3
63.48.31.0
63.48.19.0
356,00
367,00
1,7
1,7
36-70
36-70
Base Ceiling Patre
20 63.41.20.3 63.41.20.0 246,00 1,6 30-40
Carril Track Rail
20 63.41.30.3 63.41.30.0 285,50 1,6 30-40
HI-PAR30
E27
HI-PAR30
E27
HIT-TC
G8,5
HIT-TC
G8,5
HIT-TC
G8,5
HIT-TC
G8,5
CDM-Tm
PGJ5
CDM-Tm
PGJ5
GLASS
GLASS
GLASS
GLASS
GLASS
GLASS
Blanco mate
Matt white
Blanc mat
Gris texturizado
Texturised grey
Gris textur
VISSIO 130 VISSIO 157 VISSIO 157
51
3UR\HFWRUHV
Proyector VISSIO 130 - Halgena
VISSIO 130 spotlight - Halogen
Spot VISSIO 130 - Halogne
IP
20
CLASE
I
30
GLASS
850
Al
355
(TXLSR(OHFWUyQLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
max.
100
63.48.23.3 63.48.23.0 173,00 1,5 60-70
Carril Track Rail
max.
100
63.48.33.3 63.48.33.0 221,50 1,6 60-70
QT 12
GY6,35
QT 12
GY6,35
VISSIO 130
VISSIO-130
Accesorios
Accessories
Accessoires
Refractor para distribucin elptica del
XMROXPLQRVR
Refractor for eliptical distribution of the
OXPLQRXVX[
Lentille pour distribution elliptique du
X[OXPLQHX[
Filtros de color
&RORUOWHUV
Filtres couleur
Cdigo Color mm (XURV
96.00.22.0 109 35,50
Cdigo Color mm (XURV
63.06.21.8
63.06.21.6
63.06.21.5
63.06.21.1 UVA
109
109
109
109
77,00
77,00
77,00
55,00
Cdigo Color (XURV
96.00.02.2 55,00
Cdigo Color mm (XURV
63.03.32.2 130x130 50,50
Rejilla antideslumbrante tipo panal
Anti-glare honeycomb louvre
Grille anti-blouissement type panneau
Aletas antideslumbrantes
Anti-glare louvre
Grilles anti-blouissement
*
* *
* &RPSDWLEOHFRQOiPSDUDVQRUHHFWRUDV
&RPSDWLEOHZLWKQRQUHHFWLQJODPSV
&RPSDWLEOHDYHFGHVODPSHVVDQVUpHFWHXU
Proyector VISSIO 130
VISSIO 130 spotlight
Spot VISSIO 130
'LUHFWRDUHG
Base Ceiling Patre
W Cdigo Color (XURV Kg
75 63.08.05.3 63.08.05.0 102,00 1,4310-30
Carril Track Rail
75 63.08.15.3 63.08.15.0 145,00 1,0 10-30
IP
20
CLASE
I
Al
355
850
30 PAR30
E27
52
3UR\HFWRUHV
VISSIO 157
Proyector VISSIO 157 - Descarga
VISSIO 157 spotlight - Discharge
Spot VISSIO 157 - Dcharge
(TXLSR(OHFWUyQLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
35 63.48.25.3 63.48.25.0 237,00 1,4 10-40
70 63.48.26.3 63.48.26.0 237,00 1,4 10-40
Carril Track Rail
35 63.48.35.3 63.48.35.0 283,50 1,5 10-40
70 63.48.36.3 63.48.36.0 283,50 1,5 10-40
IP
20
CLASE
I
Al
355
850
30 CDM-R111
GX 8,5
Proyector VISSIO 157 - Halgena
VISSIO 157 spotlight - Halogen
Spot VISSIO 157 - Halogne
(TXLSR(OHFWUyQLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
max.
100
63.08.06.3 63.08.06.0 147,00 1,4 4-45
Carril Track Rail
max.
100
63.08.16.3 63.08.16.0 197,00 1,5 4-45
IP
20
CLASE
I
Al
355
850
30 QR-111
G 53
Blanco mate
Matt white
Blanc mat
Gris texturizado
Texturised grey
Gris textur
Proyector VISSIO 157 - LED
VISSIO 157 spotlight - LED
Spot VISSIO 157 - LED
Base Ceiling Patre
N LED W Cdigo Color (XURV Kg lm Output
8
8
15
15
63.08.70.3
63.08.72.3
63.08.70.0
63.08.72.0
220,00
220,00
1,4
1,4
WFL
MFL
830
830
Carril Track Rail
8
8
15
15
63.08.80.3
63.08.82.3
63.08.80.0
63.08.82.0
260,00
260,00
1,5
1,5
WFL
MFL
830
830
IP
20
CLASE
I
Al
355
850
30
LED
Warm
53
3UR\HFWRUHV
Proyector VISSIO 157 - Descarga
VISSIO 157 spotlight - Discharge
Spot VISSIO 157 - Dcharge
(TXLSR(OHFWUyQLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
70
150
63.48.02.3
63.48.07.3
63.48.02.0
63.48.07.0
311,50
369,50
2,0
2,0
10-25
10-25
70
150
63.48.00.3
63.48.01.3
63.48.00.0
63.48.01.0
311,00
369,50
2,0
2,0
25-50
25-50
Carril Track Rail
70
150
63.48.12.3
63.48.17.3
63.48.12.0
63.48.17.0
361,50
419,00
2,0
2,0
10-25
10-25
70
150
63.48.10.3
63.48.11.3
63.48.10.0
63.48.11.0
357,50
418,50
2,0
2,0
25-50
25-50
IP
20
CLASE
I
355
850
GLASS
30
Al
HIT
G12
VISSIO 157
Proyector VISSIO 157 - Descarga
VISSIO 157 spotlight - Discharge
Spot VISSIO 157 - Dcharge
(TXLSR(OHFWURPDJQpWLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
100
70
150
70
150
63.08.04.3
63.08.02.3
63.08.07.3
63.08.00.3
63.08.01.3
63.08.04.0
63.08.02.0
63.08.07.0
63.08.00.0
63.08.01.0
349,00
255,00
270,00
255,00
269,50
5,8
4,5
5,7
4,5
5,7
20
10-25
10-25
25-50
25-50
Carril Track Rail
100
70
150
70
150
63.08.14.3
63.08.12.3
63.08.17.3
63.08.10.3
63.08.11.3
63.08.14.0
63.08.12.0
63.08.17.0
63.08.10.0
63.08.11.0
396,00
310,00
327,00
309,50
332,00
5,8
4,5
5,7
4,5
5,7
20
10-25
10-25
25-50
25-50
IP
20
CLASE
I
30
GLASS
850
Al
355
HST
PG12-1
HST
PG12-1
HIT
G12
HIT
G12
HIT
G12
HIT
G12
VISSIO-157
Accesorios
Accessories
Accessoires
Refractor para distribucin elptica del
XMROXPLQRVR
Refractor for eliptical distribution of the
OXPLQRXVX[
Lentille pour distribution elliptique du
X[OXPLQHX[
Filtros de color
&RORUOWHUV
Filtres couleur
Cdigo Color mm (XURV
96.00.21.0 130 39,00
Cdigo Color mm (XURV
63.06.20.8
63.06.20.6
63.06.20.5
63.06.20.1 UVA
130
130
130
130
65,00
65,00
65,00
46,00
Cdigo Color (XURV
96.00.01.2 67,50
Cdigo Color mm (XURV
63.03.31.2 157x157 40,50
Rejilla antideslumbrante tipo panal
Anti-glare honeycomb louvre
Grille anti-blouissement type panneau
Aletas antideslumbrantes
Anti-glare louvre
Grilles anti-blouissement
*
* *
*&RPSDWLEOHFRQOiPSDUDVQRUHHFWRUDV
&RPSDWLEOHZLWKQRQUHHFWLQJODPSV
&RPSDWLEOHDYHFGHVODPSHVVDQVUpHFWHXU
54
3UR\HFWRUHV
TWIN
Proyector TWIN para 1 lmpara QR-111
TWIN spotlight for 1 QR-111 lamp
Projecteur TWIN pour 1 lampe QR-111
(TXLSR(OHFWUyQLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
max.
1x100
73.41.03.3 89,50 0,6
Carril Track Rail
max.
1x100
73.41.13.3 142,00 0,6
IP
20
CLASE
I
355
850
355
Al
QR-111
G 53
Proyector TWIN para 2 lmparas QR-111
TWIN spotlight for 2 QR-111 lamps
Projecteur TWIN pour 2 lampes QR-111
(TXLSR(OHFWUyQLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
max.
2x100
73.42.03.3 136,00 0,8
Carril Track Rail
max.
2x100
73.42.13.3 179,50 0,8
IP
20
CLASE
I
355
850
355
Al
QR-111
G 53
Proyector TWIN para 2 lmparas LED
TWIN spotlight for 2 LED lamps
Projecteur TWIN pour 2 lampes LED
IP
20
CLASE
I
355
850
355
Al
LED
Warm
Gris texturizado
Texturised grey
Gris textur
Proyector TWIN para 1 lmpara LED
TWIN spotlight for 1 LED lamp
Projecteur TWIN pour 1 lampe LED
IP
20
CLASE
I
355
850
355
Al
LED
Warm
Base Ceiling Patre
N LED
W Cdigo Color (XURV Kg lm Output
8
8
15
15
73.41.06.3
73.41.07.3
196,00
196,00
0,9
0,9
WFL
MFL
830
830
Carril Track Rail
8
8
15
15
73.41.16.3
73.41.17.3
221,00
221,00
0,9
0,9
WFL
MFL
830
830
Base Ceiling Patre
N LED
W Cdigo Color (XURV Kg lm Output
2x8
2x8
2x15
2x15
73.42.06.3
73.42.07.3
371,00
371,00
0,9
0,9
WFL
MFL
2x830
2x830
Carril Track Rail
2x8
2x8
2x15
2x15
73.42.16.3
73.42.17.3
394,50
394,50
0,9
0,9
WFL
MFL
2x830
2x830
55
3UR\HFWRUHV
Proyector TWIN para 1 lmpara CDM-R111
TWIN spotlight for 1 CDM-R111 lamp
Projecteur TWIN pour 1 lampe CDM-R111
(TXLSR(OHFWUyQLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
1x35
1x70
73.41.04.3
73.41.05.3
225,50
225,50
1
1
Carril Track Rail
1x35
1x70
73.41.14.3
73.41.15.3
259,00
259,00
1
1
IP
20
CLASE
I
355
850
355
Al
CDM-R111
GX 8,5
TWIN
Proyector TWIN para lmpara PAR30
TWIN spotlight for PAR30 lamp
Projecteur TWIN pour lampe PAR30
'LUHFWRDUHG
Base Ceiling Patre
W Cdigo Color (XURV Kg
75 73.01.02.3 86,00 0,7
Carril Track Rail
75 73.01.12.3 125,00 0,7
IP
20
CLASE
I
355
850
355
Al
PAR30
E27
Proyector TWIN para lmparas PAR20
TWIN spotlight for PAR20 lamps
Projecteur TWIN pour lampes PAR20
'LUHFWRDUHG
Base Ceiling Patre
W Cdigo Color (XURV Kg
max.
50
73.01.01.3 85,50 0,6
Carril Track Rail
max.
50
73.01.11.3 124,00 0,6
IP
20
CLASE
I
355
850
355
Al
PAR20
E27
Proyector TWIN para 2 lmparas CDM-R111
TWIN spotlight for 2 CDM-R111 lamps
Projecteur TWIN pour 2 lampes CDM-R111
(TXLSR(OHFWUyQLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
2x35 73.42.04.3 374,00 1,2
Carril Track Rail
2x35 73.42.14.3 414,50 1,2
IP
20
CLASE
I
355
850
355
Al
CDM-R111
GX 8,5
56
3UR\HFWRUHV
MULTISPACE
355
355
90
90
960
960
Al
Al
CLASE
I
CLASE
I
IP
20
IP
20
QR-111
G 53
CDM-R111
GX 8,5
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
1x100
1x35
1x70
70.41.12.0
70.41.13.0
70.41.14.0
132,00
226,00
226,00
0,8
0,9
0,9
QR-111
G 53
CDM-R111
GX 8,5
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
1x100
1x35
1x70
70.41.15.0
70.41.16.0
70.41.17.0
118,50
213,00
213,00
0,8
0,9
0,9
Proyector MULTISPACE para carril
MULTISPACE track spotlight
Projecteur MULTISPACE pour rail
Proyector MULTISPACE a base
MULTISPACE ceiling spotlight
Projecteur MULTISPACE patrre
P.61 P.56 P.92 P.93
Blanco texturizado
Texturised white
Blanc textur
N LED
W Cdigo Color (XURV Kg lm Output
8
8
15
15
70.41.21.0
70.41.22.0
197,00
197,00
0,9
0,9
WFL
MFL
830
830
N LED
W Cdigo Color (XURV Kg lm Output
8
8
15
15
70.41.23.0
70.41.24.0
204,50
204,50
0,9
0,9
WFL
MFL
830
830
LED
Warm
LED
Warm
57
3UR\HFWRUHV
COMET
Proyector COMET para lmparas de descarga Bipin
COMET spotlight for Bipin discharge lamps
Spot COMET, pour lampe dcharge Bipin
Proyector COMET para lmparas lineales doble casquillo
COMET spotlight for double ended lamps
Spot COMET pour lampes linaires double culot
(TXLSR(OHFWURPDJQpWLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg
70
150
63.01.50.3
63.01.51.3
63.01.50.0
63.01.51.0
201,00
216,50
3,0
3,2
Carril Track Rail
70
150
63.01.60.3
63.01.61.3
63.01.60.0
63.01.61.0
205,50
219,50
3,0
3,2
(TXLSR(OHFWURPDJQpWLFR
Base Ceiling Patre
W Cdigo Color (XURV Kg Portalmp.
70
150
63.01.56.3
63.01.57.3
63.01.56.0
63.01.57.0
168,50
185,50
3,0
3,1
Rx7s
Rx7s-24
Carril Track Rail
70
150
63.01.66.3
63.01.67.3
63.01.66.0
63.01.67.0
189,00
215,50
3,0
3,1
Rx7s
Rx7s-24
IP
20
CLASE
I
IP
20
Al
CLASE
I
90
90
GLASS
GLASS
960
960
Al
355
355
HIT
G12
HIT-DE
HIT-DE
HIT
G12
QT-DE
R7 s
QT-DE
R7 s
Filtros de color
&RORUOWHUV
Filtres couleur
Cdigo Color (XURV
63.06.20.8
63.06.20.6
63.06.20.5
63.06.20.1 UVA
65,00
65,00
65,00
46,00
Cristal UVA
UVA glass
Verre UVA
Cdigo (XURV
63.06.30.1 17,00
Cdigo (XURV
63.03.33.2 38,00
Aletas antideslumbrantes
Anti-glare barn doors
Grilles anti-blouissement
'LUHFWRDUHG
Base Ceiling Patre
max.
300
63.01.52.3 63.01.52.0 107,00 3,0
Carril Track Rail
max.
300
63.01.62.3 63.01.62.0 127,00 3,0
Blanco mate
Matt white
Blanc mat
Gris texturizado
Texturised grey
Gris textur
58
3UR\HFWRUHV
FINELAMP
Proyector FINELAMP asimtrico para lmparas de descarga
FINELAMP assymetrical spotlight for metal discharge
Projecteur FINELAMP asymtrique pour lampes dcharge
3UR\HFWRU),1(/$03DVLPpWULFRSDUDXRUHVFHQFLDFRPSDFWD
),1(/$03DV\PPHWULFDOVSRWOLJKWIRUFRPSDFWXRUHVFHQWODPS
3URMHFWHXU),1(/$03DV\PpWULTXHSRXUODPSHVXRUHVFHQWHVFRPSDFWHV
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Portalmp.
1x70
1x150
63.02.01.3
63.02.00.3
63.02.01.0
63.02.00.0
322,50
348,00
4,2
4,6
Rx7s
Rx7s-24
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
1x36 63.02.02.3 63.02.02.0 220,00 3,4
(TXLSR(OHFWUyQLFR
1x55 63.42.03.3 63.42.03.0 258,50 3,2
IP
20
IP
20
CLASE
I
CLASE
I
Al
Al
355
355
960
960
0/30
0/30
GLASS
HIT-DE
TC-L
2 G 11
P.58 P.70 P.70 P.100
Blanco mate
Matt white
Blanc mat
Gris satinado
Satin gray
Gris satin
59
3UR\HFWRUHV
CARRIL
CARRIL trifsico 16 A.
16 A 3-circuit TRACK
RAIL triphas 16 A.
IP
20
CLASE
I
Al
Color Cdigo (XURV L mm Kg Cdigo (XURV L mm Kg Cdigo (XURV L mm Kg
46.05.06.0
46.05.06.2
46.05.06.3
34,00
34,00
34,00
1000
1000
1000
1,1
1,1
1,1
46.05.05.0
46.05.05.2
46.05.05.3
69,00
69,00
69,00
2000
2000
2000
2,3
2,3
2,3
46.05.04.0
46.05.04.2
46.05.04.3
101,00
101,00
101,00
3000
3000
3000
3,4
3,4
3,4
(3680W a 230V)
CARRIL trifsico empotrable 16 A.
16 A recessed 3-circuit TRACK
RAIL triphas universel encastrer 16 A.
IP
20
CLASE
I
Al
Color Cdigo (XURV L mm Kg Cdigo (XURV L mm Kg Cdigo (XURV L mm Kg
46.05.01.0 40,00 1000 1,1 46.05.02.0 85,00 2000 2,3 46.05.03.0 116,00 3000 3,4
(3680W a 230V)
Cdigo Color (XURV hm
46.08.53.0 22,00 3m
Cdigo Color (XURV hm
46.11.10.0
46.08.59.0
19,50
12,50
1m
Cdigo (XURV
46.07.53.0 5,00
Cdigo (XURV
46.07.08.0 3,50
Cable de acero
Steel cable
Cble en acier
Susp. rgida y unin
Rigid susp. and joint
Susp. rigide et union
Directa a techo
Direct for surface
Directe plafond
Empotrable
Recessed
encastrer
*
*
Suspensiones para carril
Suspensions for track
Suspensions pour rail
46.05.19.0 46.05.21.0
46.05.28.0
46.05.20.0
46.05.18.0 46.05.29.0 46.05.20.0
$FFHVRULRVSDUDUHDOL]DUJXUDVSODQDV $FFHVVRULHVWRFUHDWHDWV\VWHPV $FFHVVRLUHVSRXUUpDOLVHUGHVJXUHVSODWHV

Cdigo Color (XURV
46.06.40.0
46.06.40.2
46.06.40.3
2,00
2,00
2,00
Cdigo Color (XURV
46.05.24.0
46.05.24.2
46.05.24.3
63,00
63,00
63,00
Cdigo Color (XURV
46.05.25.0
46.05.25.2
46.05.25.3
69,00
69,00
69,00
7DSDQDO
End cover
&RXYHUFOHQDO
Unin "Cruz"
"Cross" joint
Union "Croix"
8QLyQFRGRH[LEOH
Flexible "U" corner
Union coude
H[LEOH
*
Cdigo Color (XURV
46.07.05.0
46.07.07.0
5,50
6,00
Cdigo Color (XURV
46.00.60.5 27,00
Cdigo Color (XURV
46.05.27.0
46.05.27.2
46.05.27.3
9,00
9,00
9,00
Cdigo Color (XURV
46.05.26.0
46.05.26.2
46.05.26.3
29,00
29,00
29,00
Embellecedor empotrable
Decorative recessed
Enjoliveur encastrer
Herramienta de doblado
Dubbing tool
Outil du pli
Unin recta sin distanciamiento
Straight without spacer joint
Union droite sans espacement
Alimentacin intermedia
Straight joint spacer
Alimentation centrale
*
*
*
*
&RUUHVSRQGHQFLDHQWUHDFFHVRULR\HPEHOOHFHGRUHPSRWUDEOH3DUDJXUDV
empotradas es necesario el uso del Embellecedor)
Correspondence between accessory and decorative recessed cover (For
UHFHVVHGJXUHVLVQHFHVVDU\WKHXVHRI'HFRUDWLYHUHFHVVHG
&RUUHVSRQGDQFHHQWUHDFFHVVRLUHHWHQMROLYHXU3RXUJXUHVHQFDVWUpHV
OXWLOLVDWLRQHQFDVWUHUHQMROLYHXUHVWQpFHVVDLUH
**
*
Cdigo Color (XURV
46.05.20.0
46.05.20.2
46.05.20.3
46.05.21.0
46.05.21.2
46.05.21.3
42,50
42,50
42,50
42,50
42,50
42,50
Cd. Int. Cd. Ext. Color (XURV
46.05.22.0
46.05.22.2
46.05.22.3
46.05.23.0
46.05.23.2
46.05.23.3
46.05.18.0
46.05.18.2
46.05.18.3
46.05.19.0
46.05.19.2
46.05.19.3
48,50
48,50
48,50
48,50
48,50
48,50
Cdigo Color (XURV
46.05.28.0
46.05.28.2
46.05.28.3
46.05.29.0
46.05.29.2
46.05.29.3
13,50
13,50
13,50
13,50
13,50
13,50
Unin codo 90
90 corner joint
Union coude 90
Unin "T"
"T" joint
Union "T"
Alimentacin
Main supply
Alimentation
Ext. dcha. dcha.
Ext. dcha. dcha.
Int. izqda. izqda.
Int. izqda. izqda.
* * * *
N
Int.
Ext. dcha.
izqda.
dcha.
izqda.
16
16
60
$SOLTXHV
850 Al
CLASE
I
IP
20
Aplique BLOC con radiacin directa-indirecta
BLOC direct-indirect wall mounted luminaire
Applique BLOC clairage direct-indirect
BLOC
P.64 P.161 P.160
QR-CBC51
GU 5,3
850 Al
CLASE
I
IP
20
Aplique BLOC con radiacin directa o indirecta
BLOC direct or indirect wall or ceiling mounted IP20 luminaire
Applique BLOC clairage direct ou indirect
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
35 67.41.30.3 67.41.30.0 155,50 0,95
Blanco mate
Matt white
Blanc mat
Gris oscuro texturizado + Gris texturizado
Textured dark gray + Texturised grey
Textur gris fonc + Gris textur
N LED W Cdigo Color (XURV Kg K lm LED
12
12
14,4
14,4
67.42.11.3
67.42.12.3
67.42.11.0
67.42.12.0
385,00
385,00
1,5
1,5
Neutral
Warm
684(D)+684(I)
524(D)+524(I)
LED
N
PC
DIFUSER
A-60/A-65
E27
PAR20
E27
TC-TSE
E 27
'LUHFWRDUHG
W Cdigo Color (XURV Kg
max. 2x75 67.02.22.3 67.02.22.0 166,50 1,5
max. 20W
850 Al
CLASE
I
IP
20
Aplique BLOC con radiacin directa o indirecta
BLOC direct or indirect wall or ceiling mounted luminaire
Applique BLOC clairage direct ou indirect
N LED W Cdigo Color (XURV Kg K lm LED
6
6
7,2
7,2
67.41.13.3
67.41.14.3
67.41.13.0
67.41.14.0
234,00
234,00
1,1
1,1
Neutral
Warm
684
524
LED
N
PC
DIFUSER
PAR20
E27
TC-TSE
E 27
A-60/A-65
E27
'LUHFWRDUHG
W Cdigo Color (XURV Kg
max. 1x75 67.01.22.3 67.01.22.0 137,50 1,1
max. 20W
61
$SOLTXHV
MULTISPACE
25
40
0
25
25
40
0
25
40
40
960
960
Al
Al
CLASE
I
CLASE
I
IP
20
IP
20
QR-111
G 53
CDM-R111
GX 8,5
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
1x100
1x35
1x70
70.41.09.0
70.41.10.0
70.41.11.0
98,50
202,00
202,00
0,8
0,9
0,9
QR-111
G 53
CDM-R111
GX 8,5
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
2x100
2x35
2x70
70.42.09.0
70.42.10.0
70.42.11.0
171,00
363,50
363,50
1,4
1,6
1,6
Aplique MULTISPACE para 1 lmpara
Wall mounted MULTISPACE for 1 lamp
Applique murale MULTISPACE pour 1 lampe
Aplique MULTISPACE para 2 lmparas
Wall mounted MULTISPACE for 2 lamps
Applique murale MULTISPACE pour 2 lampes
P.61 P.56 P.92 P.93
Blanco texturizado
Texturised white
Blanc textur
N LED
W Cdigo Color (XURV Kg lm Output
8
8
15
15
70.41.25.0
70.41.26.0
190,00
190,00
0,9
0,9
WFL
MFL
830
830
LED
Warm
N LED
W Cdigo Color (XURV Kg lm Output
2x8
2x8
2x15
2x15
70.42.25.0
70.42.26.0
350,00
350,00
0,9
0,9
WFL
MFL
2x830
2x830
LED
Warm
62
Apliques
A-60/A-65
E27
TC-DE
G24q-2/3
A-60/A-65
E27
PAR30
E27
TC-TSE
E 27
TC-TE
G24q-3/4
TC-TSE
E 27
PAR38
E27
850
850
850
PC
DIFUSER
PC
DIFUSER
PC
DIFUSER
Al
Al
Al
CLASE
I
CLASE
I
CLASE
I
IP
20
IP
20
IP
20
Directo a red
W Cdigo Color Euros Kg
1x100 87.00.61.3 249,00 1,5
Equipo Electrnico
W Cdigo Color Euros Kg
1x26/32/42
1x26/32/42
87.40.03.3
87.40.03.0
214,50
214,50
1,63
1,63
Directo a red
W Cdigo Color Euros Kg
max.100
max.100
87.00.01.3
87.00.01.0
183,50
183,50
1,51
1,51
Directo a red
W Cdigo Color Euros Kg
1x75/120 87.00.31.3 452,50 8,56
Cdigo Color Euros
87.06.40.8
87.06.40.5
87.06.40.7
60,00
60,00
60,00
Luminaria de sobremesa SATINA con difusor de policarbonato opal
SATINA table-top luminaire with opal polycarbonate diffuser
Lampe de bureau SATINA avec diffuseur en polycarbonate opal
Aplique SATINA con difusor de policarbonato opal
SATINA wall mounted luminaire with opal polycarbonate diffuser
Applique SATINA avec diffuseur en polycarbonate opal
Luminaria de pie SATINA con difusor de policarbonato opal
SATINA free standing luminaire with opal polycarbonate diffuser
Lampadaire SATINA avec diffuseur en polycarbonate opal
5HHFWRUVXSHULRUGHFRORU
6XSHULRUFRORXUUHHFWRU
5pHFWHXUVXSpULHXUGHFRXOHXU
SATINA
Filtro azul para lmparas TC-DE de 26W
%OXHOWHUIRU:7&'(ODPSV
Filtre bleu pour lampes TC-DE de 26W
Cdigo Color Euros
87.06.20.5 21,50
P.62 P.62 P.37 P.62 P.37
Blanco mate
Matt white
Blanc mat
Gris texturizado
Texturised grey
Gris textur
63
$SOLTXHV
max.
90
0
max.
90
960
GLASS
Al
CLASE
I
IK
08
IP
65
MICRO PROA
P.63 / P.178 P.180 P.182
HIT
G12
CDM-Tm
PGJ5
TC-TE
GX24q-2
TC-TE
GX24q-3
Aplique MICRO PROA de radiacin directa con ptica peatonal
MICRO PROA wall mounted for direct lighting with pedestrian optics
Applique murale MICRO PROA a lumire directe optique pitonnier
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
35
20
35
18
26
66.41.16.0
66.41.17.0
66.41.18.0
66.41.19.0
66.41.23.0
339,50
369,50
369,50
260,50
268,00
2,5
2,5
2,5
2,5
2,5
Blanco texturizado
Texturised white
Blanc textur
HIT
G12
CDM-Tm
PGJ5
TC-TE
GX24q-2
TC-TE
GX24q-3
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
35
20
35
18
26
66.41.26.0
66.41.27.0
66.41.28.0
66.41.29.0
66.41.22.0
337,00
365,50
365,50
268,50
278,50
2,5
2,5
2,5
2,5
2,5
QT-DE
R7 s
'LUHFWRDUHG
W Cdigo Color (XURV Kg
max.
1x150
66.01.31.0 208,50 2,4
Aplique MICRO PROA de radiacin directa con ptica asimtrica
MICRO PROA wall mounted for direct lighting with asymmetric optics
Applique murale MICRO PROA a lumire directe optique asymtrique
Aplique MICRO PROA LED con ptica spot
MICRO PROA LED wall mounted with spot optics
Applique murale MICRO PROA LED avec optique spot
LED
Neutral
N LED W Cdigo Color (XURV Kg lm LED
12 15 66.41.24.0 439,00 2,5 SP 1368
Aplique MICRO PROA con ptica simtrica
MICRO PROA wall mounted with symmetric optics
Applique murale MICRO PROA avec optique symtrique
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
35 66.41.25.0 364,00 2,5 25 HIT
G12
01
64
$SOLTXHV
TC-L
2 G 11
850
PC
DIFUSER
Al
CLASE
I
IP
40
$SOLTXH',1$0,&LQGLUHFWRGLUHFWRFRQGLIXVRUGHSROLFDUERQDWRVHULJUDDGR
DINAMIC indirect-direct wall mounted luminaire with polycarbonate deco diffuser
Applique DINAMIC direct-indirect avec diffuseur en polycarbonate serigraphi
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Y mm
1x55
2x55
61.41.00.3
61.42.00.3
267,50
346,50
2,5
3,6
170
260
DINAMIC
'LIXVRUGHSROLFDUERQDWRVHULJUDDGR
Polycarbonate deco diffuser
Diffuseur en polycarbonate serigraphi
P.64 P.65 P.96 P.97
Anodizado plata mate
Anodized Matt silver
anodis argent mat
Difusor superior de policarbonato transparente incluido
Transparent polycarbonate upper diffuser included
Diffuseur suprieur transparent en polycarbonate inclus
65
$SOLTXHV
PC
DIFUSER
850
TC-L
2 G 11
T5/T16
G5
Digital
DSI
850
Digital
DSI
Al
Al
CLASE
I
CLASE
I
IP
40
IP
40
/XPLQDULDGHSLH',1$0,&LQGLUHFWRGLUHFWR\UHJXODEOHFRQGLIXVRUGHSROLFDUERQDWRVHULJUDDGR
DINAMIC indirect-direct free standing luminaire with polycarbonate deco diffuser and dimmable ballast
/DPSDGDLUH',1$0,&LQGLUHFWGLUHFWDYHFGLIIXVHXUHQSRO\FDUERQDWHVHULJUDpHWJUDGDEOH
Aplique de pie DINAMIC directo-indirecto con celosa de alto confort visual y regulable
DINAMIC indirect-direct free standing luminaire with double parabolic louvre and dimmable ballast
Lampadaire DINAMIC direct-indirect avec grille double parabole et gradable
(TXLSR(OHFWUyQLFR
Simple
W Cdigo Color (XURV Kg
2x55 61.52.20.3 710,50 17 J
(TXLSR(OHFWUyQLFR7+(+2
Simple
W Cdigo Color (XURV Kg
2x14/24 61.52.10.3 714,00 16,5 J
Doble
W Cdigo Color (XURV Kg
4x55 61.54.20.3 1011,50 20,5 J
Doble
W Cdigo Color (XURV Kg
4x14/24 61.54.10.3 1035,50 19,5 J
DINAMIC
'LIXVRUGHSROLFDUERQDWRVHULJUDDGR
Polycarbonate deco diffuser
Diffuseur en polycarbonate serigraphi
Anodizado plata mate
Anodized Matt silver
anodis argent mat
Difusor superior de policarbonato transparente incluido
Transparent polycarbonate upper diffuser included
Diffuseur suprieur transparent en polycarbonate inclus
Difusor superior de policarbonato transparente incluido
Transparent polycarbonate upper diffuser included
Diffuseur suprieur transparent en polycarbonate inclus
J J
J J
66
$SOLTXHV
IP
40
CLASE
I
850
PC
DIFUSER
Al
'LUHFWRDUHG
W Cdigo Color (XURV Kg L mm
max.
1x300
72.01.03.0 146,50 1,8 450
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L mm
1x24
1x55
72.41.04.0
72.41.05.0
220,00
235,00
3
4
650
900
Aplique FLAT de radiacin indirecta
FLAT wall mounted luminaire of indirect radiation
Applique murale FLAT rayonnement indirecte
FLAT
QT-DE
R7 s
GLASS
TC-L
2 G 11
P.66 P.98
Blanco mate
Matt white
Blanc mat
67
$SOLTXHV
IP
40
IP
40
CLASE
I
CLASE
I
Al
PC
DIFUSER
Al
PC
DIFUSER
T5/T16
G5
850
850
DALI
T5/T16
G5
(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
2x28/54
2x35/49/80
72.42.11.0
72.42.12.0
357,50
434,00
4
5
1230
1530
(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
3x28/54 72.83.11.0 822,00 4 1230
Aplique FLAT de radiacin indirecta para lnea continua
FLAT wall mounted luminaire of indirect radiation for continuous mounting
Applique murale FLAT rayonnement indirecte pour ligne continue
Aplique FLAT SHOW RGB de radiacin indirecta para lnea continua
FLAT SHOW RGB wall mounted luminaire of indirect radiation for
continuous mounting
Applique murale FLAT SHOW RGB en radiation indirecte pour
ligne continue
FLAT L.C.
Pack de control
Control pack
Pack de control
Cdigo (XURV
96.86.01.0 576,00
Accesorios
Accessories
Accessoires
7DSDQDO
End cover
(PERXWQDO
Unin codo 90
90 elbow joint
Union coude 90
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Unin de 2 luminarias a 90
Joining piece coupler to 90
Pice union luminaires 90
Cdigo Color (XURV
72.06.40.0 16,00
Cdigo Color (XURV Lmm
72.05.20.0 59,50 215
Cdigo Color (XURV
72.05.24.0 42,50
Cdigo (XURV
96.06.01.0 1,50
2 unit/ref.
1 unit/ref.
125mm
215mm 325mm
68
$SOLTXHV
Al
AMBIENT
850
PC
DIFUSER
CLASE
I
IP
40
TC-L
2 G 11
TC-L
2 G 11
T8/T26
G13
T5/T16
G5
Baador de pared o techo AMBIENT
AMBIENT wall washer or ceiling washer
Applique au mur ou plafond asymtrique AMBIENT
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg L mm
18
36
58
36
88.01.00.3
88.01.01.3
88.01.02.3
88.01.03.3
88.01.00.0
88.01.01.0
88.01.02.0
88.01.03.0
156,50
216,00
252,50
149,50
2
3
3,5
1,2
750
1350
1650
550
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L mm
1x14/24
1x28/54
1x35/49/80
2x14/24
2x28/54
2x35/49/80
36
55
88.41.30.3
88.41.31.3
88.41.32.3
88.42.30.3
88.42.31.3
88.42.32.3
88.41.03.3
88.41.04.3
88.41.30.0
88.41.31.0
88.41.32.0
88.42.30.0
88.42.31.0
88.42.32.0
88.41.03.0
88.41.04.0
197,00
248,00
281,00
208,50
258,00
323,50
173,50
190,50
1,5
2,6
3,2
1,6
2,7
3,3
1,2
1,5
700
1300
1600
700
1300
1600
550
700
108 65
75 mm
L
Accesorios pag.63
Accessories pag.63
Accessoires pag.63
Blanco mate
Matt white
Blanc mat
Gris satinado
Satin gray
Gris satin
69
$SOLTXHV
AMBIENT L.C.
850
850
PC
DIFUSER
Al
PC
DIFUSER
Al
CLASE
I
CLASE
I
IP
40
IP
40
Baador de pared o techo AMBIENT intermedia para lnea continua
AMBIENT wall washer or ceiling washer intermediate for continuous mounting
Applique au mur ou plafond AMBIENT intermdiaire pour ligne continue
%DxDGRUGHSDUHGRWHFKR$0%,(17QDOSDUDOtQHDFRQWLQXD
AMBIENT wall washer or ceiling washer end for continuous mounting
$SSOLTXHDXPXURXSODIRQG$0%,(17QDOHSRXUOLJQHFRQWLQXH
Tapa ciega radiacin directa o indirecta
Blind cover for direct or indirect light
Couvercle vide pour clairage direct
ou indirect
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg L mm
18
36
58
88.01.90.3
88.01.91.3
88.01.92.3
88.01.90.0
88.01.91.0
88.01.92.0
137,50
195,50
225,00
1,8
2,8
3,3
700
1300
1600
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg L mm
18
36
58
88.01.93.3
88.01.94.3
88.01.95.3
88.01.93.0
88.01.94.0
88.01.95.0
151,00
222,50
212,00
1,9
2,9
3,4
725
1325
1625
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
14/24
28/54
35/49/80
88.41.60.3
88.41.61.3
88.41.62.3
88.41.60.0
88.41.61.0
88.41.62.0
171,50
227,00
264,00
1,3
2,3
3
650
1250
1550
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
14/24
28/54
35/49/80
88.41.63.3
88.41.64.3
88.41.65.3
88.41.63.0
88.41.64.0
88.41.65.0
183,50
238,50
270,50
1,4
2,5
3,1
675
1275
1575
W Cdigo Color (XURV L mm
36
18
36
58
14/24
28/54
35/49/80
88.06.36.3
88.06.33.3
88.06.34.3
88.06.35.3
88.06.30.3
88.06.31.3
88.06.32.3
88.06.36.0
88.06.33.0
88.06.34.0
88.06.35.0
88.06.30.0
88.06.31.0
88.06.32.0
8,50
9,00
16,50
20,00
9,00
16,50
20,00
500
700
1300
1600
650
1250
1550
108 65
75 mm
L
108 65
75 mm
L
T8/T26
G13
T8/T26
G13
T8/T26
G13
TC-L
2 G 11
T5/T16
G5
T5/T16
G5
T5/T16
G5
Accesorios
Accessories
Accessoires
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
96.06.01.0 1,50
2 unit/ref.
IP
40
70
$SOLTXHV
FINELAMP
$SOLTXHDVLPpWULFR),1(/$03SDUDXRUHVFHQFLDFRPSDFWD
),1(/$03DV\PPHWULFDOZDOOPRXQWHGOXPLQDLUHVIRUFRPSDFWXRUHVFHQWODPS
$SSOLTXHPXUDOHDV\PpWULTXH),1(/$03SRXUODPSHXRUHVFHQFHFRPSDFWH
Aplique FINELAMP para lmpara halgena lineal
FINELAMP wall mounted luminaire for linear halogen lamps
Applique murale FINELAMP pour lampes halognes lineires
Aplique FINELAMP para lmparas de descarga
FINELAMP wall mounted luminaire for discharge lamps
Applique murale FINELAMP pour lampe dcharge
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
1x36 61.01.12.3 61.01.12.0 193,00 3,4
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
1x55 61.41.13.3 61.41.13.0 219,00 3,2
'LUHFWRDUHG
W Cdigo Color (XURV Kg
max.
1x300
61.01.09.3 61.01.09.0 153,00 2,0
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Portalmp.
70
150
61.01.10.3
61.01.11.3
61.01.10.0
61.01.11.0
304,00
309,50
4,2
4,6
Rx7s
Rx7s-24
IP
20
IP
20
IP
20
CLASE
I
CLASE
I
CLASE
I
Al
0/30
0/30
0/30
GLASS
GLASS
960
960
960
Al
Al
TC-L
2 G 11
QT-DE
R7 s
HIT-DE
P.58 P.70 P.70 P.100
Blanco mate
Matt white
Blanc mat
Gris satinado
Satin gray
Gris satin
71
$SOLTXHV
GLASS
GLASS
TC-D
G24d-1
TC-D
G24d-3
172 x 235
235 x 335
3-25 mm
3-25 mm
Al
Al
CLASE
I
CLASE
I
IP
20
IP
20
URBAN
Baador asimtrico URBAN para empotrar 10W
URBAN asymmetrical wall recessed 10W
Applique encastre mur URBAN asymtrique 10W
Baador asimtrico URBAN para empotrar 26W
URBAN asymmetrical wall recessed 26W
Applique encastre mur URBAN asymtrique 26W
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
10 98.01.20.3 74,00 1,4
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
26 98.01.21.3 89,00 2,2
Gris oscuro satinado
Satin dark gray
Gris fonc satin
Slo para paredes tipo pladur
Only for drywall
Seulement pour des parois placo
Slo para paredes tipo pladur
Only for drywall
Seulement pour des parois placo
72
$SOLTXHV
TUB
T5/T16
G5
850 PC
IK
07
IP
54
Aplique TUB con difusor de policarbonato opal
TUB wall mounted luminaire with opal polycarbonate diffuser
Applique TUB avec diffuseur en polycarbonate opal
Blanco
White
Blanc
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
1x14/24
1x28/54
1x35/49/80
87.41.00.0
87.41.01.0
87.41.02.0
115,00
170,00
195,00
1,1
2,2
2,8
670
1270
1570
100
86 mm
NEW
Suspensiones
Suspensions
Suspensions
Cable de acero regulable niquelado
Niquel steel cable height-adjustable
Suspension chrome rglable
&DEOHGHDFHUR[UHJXODEOHSDUD
conexin electromecnica
6WHHOFDEOH[KHLJKWDGMXVWDEOHIRU
electromechanical connection
Fleuron dcoratif pour connexion
lectromecanique
Cdigo Color h(mm) (XURV
96.01.31.3
96.01.34.3
1000
4000
15,50
17,00 Cdigo Color h(mm) (XURV
96.21.31.0
96.21.34.0
1000
4000
26,50
48,50
30
cm
73
$SOLTXHV
MURAL
850
PC
DIFUSER
Al
CLASE
I
IP
42
T5/T16
G5
T8/T26
G13
Aplique MURAL de radiacin directa con difusor de policarbonato
MURAL wall mounted luminaire with polycarbonate diffuser
Applique murale MURAL directe avec diffuseur en polycarbonate
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
2x14/24 85.42.26.0 199,00 2,35 800
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg L mm
2x18 85.02.27.0 153,50 3,40 800
* Fijacin en pared incorporada de 50 cm
* Wall bracket included 50 cm
* Fixaton au mur incorpor de 50 cm
Blanco texturizado
Texturised white
Blanc textur
74
(VWUXFWXUDV
T5/T16
G5
T5/T16
G5
960
850
PC
DIFUSER
Al
Al
CLASE
I
CLASE
I
IP
20
IP
42
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Lmm Kg
1x14/24
1x28/54
1x35/49/80
47.41.61.3
47.41.62.3
47.41.63.3
47.41.61.0
47.41.62.0
47.41.63.0
111,50
131,50
159,50
660
1260
1560
1,0
1,8
2,2
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Lmm Kg
1x14/24
1x28/54
1x35/49/80
47.41.64.3
47.41.65.3
47.41.66.3
47.41.64.0
47.41.65.0
47.41.66.0
145,00
185,00
214,00
660
1260
1560
1,0
1,8
2,2
Luminaria FIL con difusor de policarbonato opal
FIL luminaire with opal polycarbonate diffuser
Luminaire FIL avec diffuseur en polycarbonate opal
Luminaria FIL con ptica parablica mate
FIL luminaire with matt parabolic louvre
Luminaire FIL optique parabolique mat
FIL
Unin soporte pared
Wall bracket
Jonction support mur
Soporte perpendicular para pared
Wall mounting accessories
Support mural perpendiculaire
Cdigo Color (XURV Lm
96.07.45.3
96.07.45.0
96.07.46.3
96.07.46.0
35,00
35,00
52,00
52,00
75
75
300
300
Cdigo (XURV
47.06.41.3 22,00
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
96.06.01.0 1,50
2 unit/ref.
2 unit/ref. 2 unit/ref.
2 unit/ref.
1 unit/ref.
355 355
130 mm
7DSDQDOJLUDWRULD
Revolving end cover
-XQFWLRQQDOJLUDWRLUH
Tapa intermedia giratoria
Revolving intermediate cover
Junction intermdiaire giratoire
Soporte pared orientable
Wall support adjustable
Support mural orientable
Cdigo Color (XURV
47.05.51.3
47.05.51.0
99,00
99,00
Cdigo Color (XURV
47.05.50.3
47.05.50.0
97,50
97,50
Cdigo Color (XURV
96.00.06.3
96.00.06.0
60,50
60,50
70 mm 70 mm
80 mm 80 mm
Accesorios
Accessories
Accessoires
3HUO\WDSD
3UROHDQGFRYHU
3UROHWFRXYHUFOH
7DSDQDO
End cover
(PERXWQDO
Unin codo 90
90 elbow joint
Union coude 90
Cdigo Color (XURVPO
47.05.00.3
47.05.00.0
47.05.10.3
47.05.10.0
40,00
40,00
18,00
18,00
Cdigo Color (XURV
47.06.40.3
47.06.40.0
5,50
5,50
Cdigo Color (XURV
47.05.20.3
47.05.20.0
21,50
21,50
47.05.10.3
max. 3m
47.05.00.3
Gris satinado
Satin gray
Gris satin
Blanco mate
Matt white
Blanc mat
Suspensiones (p.118)
Suspensions (p.118)
Suspensions (p.118)
75
(VWUXFWXUDV
Mx.40mm
Mx.40mm
T5/T16
G5
T5/T16
G5
PC
DIFUSER
Al
Al
CLASE
I
CLASE
I
IP
20
IP
42
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Lmm Kg X x Y
1x14/24
1x28/54
1x35/49/80
47.41.81.3
47.41.82.3
47.41.83.3
47.41.81.0
47.41.82.0
47.41.83.0
121,50
149,00
173,50
660
1260
1560
1,0
1,8
2,2
52x670
52x1270
52x1570
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Lmm Kg X x Y
1x14/24
1x28/54
1x35/49/80
47.41.84.3
47.41.85.3
47.41.86.3
47.41.84.0
47.41.85.0
47.41.86.0
155,50
203,50
229,50
660
1260
1560
1,0
1,8
2,2
52x670
52x1270
52x1570
Luminaria FIL para empotrar con difusor de policarbonato opal
FIL recessed luminaire with opal polycarbonate diffuser
Luminaire FIL pour encastrement avec diffuseur en polycarbonate opal
Luminaria FIL para empotrar con ptica parablica mate
FIL recessed luminaire with matt parabolic louvre
Luminaire FIL pour encastrement avec grille parabolique mat
Para lneas continuas: L x n luminarias + 10mm
For continuous mounting: L x n luminaires + 10mm
pour ligne continue: L x n luminaires + 10mm
FIL
850
960
Accesorios
Accessories
Accessoires
3HUO\WDSD
3UROHDQGFRYHU
3UROHWFRXYHUFOH
7DSDQDO
End cover
(PERXWQDO
Unin codo 90
90 elbow joint
Union coude 90
Cdigo Color (XURVPO
47.00.58.3
47.00.58.0
47.05.10.3
47.05.10.0
30,50
30,50
18,00
18,00
Cdigo Color (XURV
47.06.45.3
47.06.45.0
6,50
6,50
Cdigo Color (XURV
47.05.21.3
47.05.21.0
21,50
21,50
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
96.06.01.0 1,50
2 unit/ref.
47.05.10.3
47.00.58.3
*
*
*
90 mm 90 mm
max. 3m
P.81/84 P.90
P.75 P.86/89
P.74 P.76
Gris satinado
Satin gray
Gris satin
Blanco mate
Matt white
Blanc mat
P.78/80
80
80
76
(VWUXFWXUDV
FIL
+
T5/T16
G5
850
PC
DIFUSER
Al
CLASE
I
IP
42
70 mm
70
Luminaria FIL
+
),1$/FRQUHHFWRUWUHVEROLOOR
FIL
+
),1$/OXPLQDLUHZLWKVWDJJHUHGUHHFWRU
Luminaire FIL
+
),1$/DYHFGLIIXVHXUVDQVUXSWXUHGHX[
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg F mm
1x14/24
1x28/54
1x35/49/80
47.41.24.3
47.41.25.3
47.41.26.3
47.41.24.0
47.41.25.0
47.41.26.0
118,00
140,50
157,50
1,3
2,5
3
543
1143
1443
Luminaria FIL
+
,17(50(',$FRQUHHFWRUWUHVEROLOOR
FIL
+
,17(50(',$7(OXPLQDLUHZLWKVWDJJHUHGUHHFWRU
Luminaire FIL
+
,17(50e',$,5(DYHFGLIIXVHXUVDQVUXSWXUHGHX[
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg I mm
1x28/54
1x35/49/80
47.41.16.3
47.41.17.3
47.41.16.0
47.41.17.0
140,50
157,50
2,2
2,7
1080
1380
P.81 / 89 P.90
P.75 P.86 / 89
P.74 P.76
P.78/80
T5/T16
G5
850
PC
DIFUSER
Al
CLASE
I
IP
42
70 mm
70
Luminaria FIL
+
),1$/GHUDGLDFLyQGLUHFWDLQGLUHFWDFRQUHHFWRUWUHVEROLOOR
FIL
+
),1$/OXPLQDLUHGLUHFWLQGLUHFWOLJKWZLWKVWDJJHUHGUHHFWRU
Luminaire FIL
+
),1$/GLUHFWLQGLUHFWDYHFGLIIXVHXUVDQVUXSWXUHGHX[
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg F mm
1x14/24
1x28/54
1x35/49/80
47.41.77.3
47.41.78.3
47.41.79.3
47.41.77.0
47.41.78.0
47.41.79.0
143,00
173,00
199,00
1,3
2,5
3
543
1143
1443
Luminaria FIL
+
,17(50(',$GHUDGLDFLyQGLUHFWDLQGLUHFWDFRQUHHFWRUWUHVEROLOOR
FIL
+
,17(50(',$7(OXPLQDLUHGLUHFWLQGLUHFWOLJKWZLWKVWDJJHUHGUHHFWRU
Luminaire FIL
+
,17(50e',$,5(GLUHFWLQGLUHFWDYHFGLIIXVHXUVDQVUXSWXUHGHX[
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg I mm
1x28/54
1x35/49/80
47.41.08.3
47.41.09.3
47.41.08.0
47.41.09.0
159,00
199,00
2,2
2,7
1080
1380
Gris satinado
Satin gray
Gris satin
Blanco mate
Matt white
Blanc mat
77
(VWUXFWXUDV
FIL
+
Suspensiones
Suspensions
Suspensions
Cable de acero regulable niquelado
Niquel steel cable height-adjustable
Suspension chrome rglable
&DEOHGHDFHUR[UHJXODEOHSDUD
conexin electromecnica
6WHHOFDEOH[KHLJKWDGMXVWDEOHIRU
electromechanical connection
Fleuron dcoratif pour connexion
lectromecanique
Cdigo Color h(mm) (XURV
96.01.31.3
96.01.34.3
1000
4000
15,50
17,00 Cdigo Color h(mm) (XURV
96.21.31.0
96.21.34.0
1000
4000
26,50
48,50
30
cm
T5/T16
G5
850
PC
DIFUSER
Al
CLASE
I
IP
42
Luminaria FIL+ INDIVIDUAL
FIL+ INDIVIDUAL luminaire
Luminaire FIL+ INDIVIDUEL
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg F mm
1x14/24
1x28/54
1x35/49/80
47.41.36.3
47.41.37.3
47.41.38.3
47.41.36.0
47.41.37.0
47.41.38.0
125,50
154,50
179,50
1,3
2,4
3
604
1204
1504
70 mm
70
T5/T16
G5
850
PC
DIFUSER
Al
CLASE
I
IP
42
Luminaria FIL+ INDIVIDUAL de radiacin directa-indirecta
FIL+ INDIVIDUAL luminaire direct-indirect light
Luminaire FIL+ INDIVIDUEL direct-indirect avec diffuseur
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg F mm
1x14/24
1x28/54
1x35/49/80
47.41.87.3
47.41.88.3
47.41.89.3
47.41.87.0
47.41.88.0
47.41.89.0
154,50
173,50
198,00
1,3
2,4
3
604
1204
1504
70 mm
70
Gris satinado
Satin gray
Gris satin
Blanco mate
Matt white
Blanc mat
Codo 90 con difusor policarbonato
90 elbow with polycarbonate diffuser
Coude 90 avec diffuseur polycarboante
Cdigo Color (XURV
47.00.11.3
47.00.11.0
21,50
21,50
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
48.06.04.3 2,50
2 unit/ref.
Accesorios
Accessories
Accessoires
9 cm 9 cm
3HUO\WDSD
3UROHDQGFRYHU
3UROHWFRXYHUFOH
7DSDQDO
End cover
(PERXWQDO
Cdigo Color (XURVPO
47.00.48.3
47.00.48.0
47.00.39.3
47.00.39.0
44,50
44,50
20,50
20,50
Cdigo Color (XURV
47.00.67.3
47.00.67.0
8,50
8,50
47.00.39.3
47.00.48.3
max. 3m
78
(VWUXFWXUDV
FIL
+
T5/T16
G5
Mx.60mm
850
PC
DIFUSER
Al
CLASE
I
IP
42
Luminaria FIL
+
),1$/SDUDHPSRWUDUFRQUHHFWRUWUHVEROLOOR
FIL
+
),1$/UHFHVVHGOXPLQDLUHZLWKVWDJJHUHGUHHFWRU
Luminaire FIL
+
FINAL pour encastrement avec diffuseur
VDQVUXSWXUHGHX[
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg F mm X x Y mm
1x14/24
1x28/54
1x35/49/80
47.41.27.3
47.41.28.3
47.41.29.3
47.41.27.0
47.41.28.0
47.41.29.0
129,00
151,50
167,50
1,3
2,5
3
550
1150
1450
78 x 545
78 x 1145
78 x 1445
P.81 / 84 P.90
P.75 P.86 / 89
P.74 P.76
P.78/80
Luminaria FIL
+
,17(50(',$SDUDHPSRWUDUFRQUHHFWRUWUHVEROLOOR
FIL
+
,17(50(',$7(UHFHVVHGOXPLQDLUHZLWKVWDJJHUHGUHHFWRU
Luminaire FIL
+
INTERMDIAIRE pour encastrement avec diffuseur
VDQVUXSWXUHGHX[
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg I mm X x Y mm
1x28/54
1x35/49/80
47.41.18.3
47.41.19.3
47.41.18.0
47.41.19.0
151,50
167,50
2,2
2,7
1080
1380
78 x 1080
78 x 1380
Gris satinado
Satin gray
Gris satin
Blanco mate
Matt white
Blanc mat
Codo 90 con difusor policarbonato
90 elbow with polycarbonate diffuser
Coude 90 avec diffuseur polycarboante
Cdigo Color (XURV


47.00.12.3
47.00.12.0
23,00
23,00
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
48.06.04.3 2,50
2 unit/ref.
Accesorios
Accessories
Accessoires
10 cm 10 cm
7DSDQDO
End cover
(PERXWQDO
Cdigo Color (XURV
47.00.68.3
47.00.68.0
9,50
9,50
3HUO\WDSD
3UROHDQGFRYHU
3UROHWFRXYHUFOH
Cdigo Color (XURVPO
47.00.49.3
47.00.49.0
47.00.39.3
47.00.39.0
50,00
50,00
20,50
20,50
47.00.39.3
47.00.49.3
max. 3m
70 mm
70
89
85
Luminaria FIL
+
INDIVIDUAL para empotrar
Recessed FIL
+
INDIVIDUAL luminaire
Luminaire FIL
+
INDIVIDUEL pour encastrement
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg L mm XxY mm
1x14/24
1x28/54
1x35/49/80
47.41.45.3
47.41.46.3
47.41.47.3
47.41.45.0
47.41.46.0
47.41.47.0
134,50
165,50
191,50
1,3
4,2
3
618
1218
1518
78x610
78x1210
78x1510
79
(VWUXFWXUDV
FIL
+ TRIMLESS
T5/T16
G5
10-60 mm
850
PC
DIFUSER
Al
CLASE
I
IP
42
Luminaria FIL
+
75,0/(66),1$/SDUDHPSRWUDUFRQUHHFWRUWUHVEROLOOR
FIL
+
75,0/(66),1$/UHFHVVHGOXPLQDLUHZLWKVWDJJHUHGUHHFWRU
FIL
+
75,0/(66),1$/SRXUHQFDVWUHPHQWDYHFGLIIXVHXUVDQVUXSWXUHGHX[
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg F mm X x Y mm
1x14/24
1x28/54
1x35/49/80
47.41.90.0
47.41.91.0
47.41.92.0
142,00
166,50
184,50
1,3
2,5
3
543
1143
1443
90 x 545
90 x 1145
90 x 1445
Luminaria FIL
+
75,0/(66,17(50(',$SDUDHPSRWUDUFRQUHHFWRUWUHVEROLOOR
FIL
+
,17(50(',$7(75,0/(66UHFHVVHGOXPLQDLUHZLWKVWDJJHUHGUHHFWRU
FIL
+
75,0/(66,17(50e',$,5(SRXUHQFDVWUHPHQWDYHFGLIIXVHXUVDQVUXSWXUHGHX[
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg I mm X x Y mm
1x28/54
1x35/49/80
47.41.93.0
47.41.94.0
166,50
184,50
2,2
2,7
1080
1380
90 x 1080
90 x 1380
70 mm
70
86
85
Codo 90 con difusor policarbonato
90 elbow with polycarbonate diffuser
Coude 90 avec diffuseur polycarboante
Cdigo Color (XURV
47.00.95.0 25,50
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
48.06.04.3 2,50
2 unit/ref.
Accesorios
Accessories
Accessoires
10 cm 10 cm
NEW
LED
Neutral
850
Al
CLASE
I
IP
42
70 mm
70
Luminaria FIL
+
LED con difusor policarbonato opal
FIL
+
LED luminaire with opal polycarbonate diffuser
Luminaire FIL
+
LED avec diffuseur polycarbonate opal
W Cdigo Color Cdigo Color (XURV Kg L mm lm LED
28
35
47.41.48.3
47.41.49.3
47.41.48.0
47.41.49.0
345,50
385,00
2,5
3
1130
1410
2520
3150
Gris satinado
Satin gray
Gris satin
Blanco mate
Matt white
Blanc mat
W Cdigo Color Cdigo Color (XURV Kg L mm XxY mm lm LED
28
35
47.41.69.3
47.41.70.3
47.41.69.0
47.41.70.0
355,50
395,00
2,5
3
1130
1410
78x1135
78x1415
2520
3150
80
(VWUXFWXUDV
FIL + LED
NEW
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
48.06.04.3 2,50
2 unit/ref.
7DSDQDO
End cover
(PERXWQDO
Cdigo Color (XURV
47.00.67.3
47.00.67.0
8,50
8,50
Accesorios
Accessories
Accessoires
+ info. pag. 77
LED
Neutral
Mx.60mm
850
PC
DIFUSER
Al
CLASE
I
Luminaria FIL
+
LED para empotrar con difusor policarbonato opal
FIL
+
LED recessed luminaire with opal polycarbonate diffuser
Luminaire FIL
+
LED pour encastrement avec diffuseur polycarbonate opal
IP
42
70 mm
70
89
85
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVIRUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
48.06.04.3 2,50
2 unit/ref.
Accesorios
Accessories
Accessoires
+ info. pag. 78
7DSDQDO
End cover
(PERXWQDO
Cdigo Color (XURV
47.00.68.3
47.00.68.0
9,50
9,50
PC
DIFUSER
81
(VWUXFWXUDV
T5/T16
G5
850
PC
DIFUSER
Al
CLASE
I
IP
42
/XPLQDULD),/0('),1$/FRQUHHFWRUWUHVEROLOOR\GLIXVRUSROLFDUERQDWRRSDO
),/0('),1$/OXPLQDLUHZLWKVWDJJHUHGUHHFWRUDQGRSDOSRO\FDUERQDWHGLIIXVHU
/XPLQDLUH),/0('),1$/DYHFGLIIXVHXUVDQVUXSWXUHGHX[HQSRO\FDUERQDWHRSDO
Posibles combinaciones
Possible combinations
Possibles combinaisons
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg F mm
2x14/24
2x28/54
2x35/49/80
76.42.00.3
76.42.01.3
76.42.02.3
76.42.00.0
76.42.01.0
76.42.02.0
166,00
219,00
287,00
2,4
4,7
6,3
628
1228
1528
/XPLQDULD),/0(',17(50(',$FRQUHHFWRUWUHVEROLOOR\GLIXVRU
policarbonato opal
),/0(',17(50(',$7(OXPLQDLUHZLWKVWDJJHUHGUHHFWRUDQGRSDO
polycarbonate diffuser
Luminaire FIL MED INTERMDIAIRE avec diffuseur sans rupture de
X[HQSRO\FDUERQDWHRSDO
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg I mm
2x28/54
2x35/49/80
76.42.11.3
76.42.12.3
76.42.11.0
76.42.12.0
219,00
287,00
4,6
6,2
1175
1475
FIL MED
Luminaria FIL MED INDIVIDUAL con difusor policarbonato opal
FIL MED INDIVIDUAL luminaire with opal polycarbonate diffuser
Luminaire FIL MED INDIVIDUEL avec polycarbonate opal
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg F mm
2x14/24
2x/28/54
2x35/4980
76.42.03.3
76.42.04.3
76.42.05.3
76.42.03.0
76.42.04.0
76.42.05.0
156,50
209,00
270,00
2,5
4,8
6,4
670
1270
1570
Accesorios p.83
Accessories p.83
Accessoires p.83
Gris satinado
Satin gray
Gris satin
Blanco mate
Matt white
Blanc mat
P.81 / 84 P.90
P.75 P.86 / 89
P.74 P.76
P.78/80
N
82
(VWUXFWXUDV
FIL MED
T5/T16
G5
960
Al
CLASE
I
IP
20
Luminaria FIL MED con ptica de alto confort visual
FIL MED luminaire with high visual confort optics
Luminaire FIL MED avec optique haut confort visuel
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg F mm
1x14/24
1x28/54
1x35/49/80
2x14/24
2x28/54
2x35/49/80
76.41.17.3
76.41.18.3
76.41.19.3
76.42.20.3
76.42.21.3
76.42.22.3
76.41.17.0
76.41.18.0
76.41.19.0
76.42.20.0
76.42.21.0
76.42.22.0
193,00
264,00
302,00
203,00
274,50
312,00
2,8
5
6,5
2,8
5
6,5
730
1340
1640
730
1340
1640
Accesorios p.83
Accessories p.83
Accessoires p.83
/XPLQDULD),/0('FRQUHHFWRUDVLPpWULFR
),/0('OXPLQDLUHZLWKDV\PPHWULFUHHFWRU
/XPLQDLUH),/0('DYHFUpHFWHXUDV\PpWULTXH
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg F mm
1x14/24
1x28/54
1x35/49/80
76.41.30.3
76.41.31.3
76.41.32.3
76.41.30.0
76.41.31.0
76.41.32.0
145,50
188,00
220,50
2,3
4,5
6
730
1330
1630
Gris satinado
Satin gray
Gris satin
Blanco mate
Matt white
Blanc mat
83
(VWUXFWXUDV
FIL MED
Suspensiones
Suspensions
Suspensions
Cable de acero regulable en Y
Steel cable height adjustable in Y
Suspension cble en acier rglable en Y
Suspensin electromecnica regulable en Y
Electromechanical suspension height-
adjustable in Y
Suspension lectromechanique en acier
rglable en Y
Dos cables acero trenzado
Two braided steel cables
Deux cbles acier tress
Suspensin electromecnica de dos cables acero
Electromechanical suspension of two braided steel cables
Suspension lectromecanique deux cables acier tress rglable
Cdigo Color (XURV h(m)
96.08.63.3 16,00 max. 3
Cdigo Color (XURV h(m)
96.28.63.3
96.28.63.0
50,00
50,00
max. 3
max. 3
Cdigo Color (XURV h (m)
96.07.49.0
96.07.49.3
19,50
19,50
max. 3
max. 3
Cdigo Color (XURV h(m)
96.27.49.0
96.27.49.3
74,00
74,00
max. 3
max. 3
Accesorios
Accessories
Accessoires
3HUO\WDSD
3UROHDQGFRYHU
3UROHWFRXYHUFOH
Unin "T"
"T" joint
Union "T"
Unin codo 90
90 elbow joint
Union coude 90
Unin "cruz"
"Cross" joint
Union "croix"
Cdigo Color (XURVPO
76.05.00.3
76.05.00.0
76.05.10.3
76.05.10.0
63,50
63,50
16,00
16,00
Cdigo Color (XURV
76.05.23.3
76.05.23.0
37,00
37,00
Cdigo Color (XURV
76.05.20.3
76.05.20.0
30,00
30,00
Cdigo Color (XURV
76.05.22.3
76.05.22.0
42,50
42,50
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
48.06.04.3
96.06.01.0
2,50
1,50
max. 3 m
76.05.10.3
76.05.00.3 7DSDQDOGHDOXPLQLR
End aluminium cover
(PERXWQDOHQDOXPLQLXP
Cdigo Color (XURV
76.06.40.3
76.06.40.0
12,50
12,50
15 cm
18 cm 15 cm 18 cm 18 cm
Para FIL MED asimtrico
For FIL MED asymmetric
Pour FIL MED asymtrique *
*
96.06.01.0
48.06.04.3
84
(VWUXFWXUDV
FIL MED
355 355
13 cm
L
min. 30cm
max. 40cm
7DSDQDOJLUDWRULD
Revolving end cover
-RQFWLRQQDOJLUDWRLUH
Tapa intermedia giratoria
Revolving intermediate cover
Jonction intermdiaire giratoire
Soporte pared orientable
Wall support adjustable
Support mural orientable
Unin soporte pared
Wall bracket
Jonction support mur
Soporte pared orientable y extensible
Wall support adjustable and extensible
Support mural orientable et extensible
Cdigo Color (XURV
76.05.51.3
76.05.51.0
119,50
119,50
Cdigo Color (XURV
76.05.50.3
76.05.50.0
99,00
99,00
Cdigo Color (XURV
96.00.06.3
96.00.06.0
60,50
60,50
Cdigo Color (XURV L mm
96.07.45.3
96.07.45.0
96.07.46.3
96.07.46.0
35,00
35,00
52,00
52,00
75
75
300
300
Cdigo Color (XURV
96.00.05.3
96.00.05.0
119,50
119,50
2 unit/ref.
2 unit/ref.
2 unit/ref.
1 unit/ref. 2 unit/ref.
F I F I
F (76.05.51.3) + I (76.05.50.3) x 2
* * * *
Accesorios
Accessories
Accessoires
Posibles combinaciones
Possible combinations
Combinaisons possibles
Suspension rgida (pgina 118) o soporte a pared (96.07.46.3)
Rigid suspension (page 118) or wall support (96.07.46.3)
Suspensions rigide (page 118) ou support mural (96.07.46.3)
*
6 cm 6 cm
85
(VWUXFWXUDV
86
(VWUXFWXUDV
FIL MED
T5/T16
G5
Mx.60mm
850
PC
DIFUSER
Al
CLASE
I
IP
42
/XPLQDULD),/0('),1$//&SDUDHPSRWUDUFRQUHHFWRUWUHVEROLOOR
y difusor policarbonato opal
5HFHVVHG[WXUH),1$/),/0('/&OXPLQDLUHZLWKVWDJJHUHG
UHHFWRUDQGRSDOSRO\FDUERQDWHGLIIXVHU
Luminaire FIL MED FINAL LC pour encastrement avec diffuseur
SRO\FDUERQDWHRSDOVDQVUXSWXUHGHX[
/XPLQDULD),/0(',17(50(',$/&SDUDHPSRWUDUFRQUHHFWRUWUHVEROLOOR
y difusor policarbonato opal
Recessed INTERMEDIATE FIL MED LC luminaire with staggered
UHHFWRUDQGRSDOSRO\FDUERQDWHGLIIXVHU
Luminaire FIL MED INTERMDIAIRE LC pour encastrement avec diffuseur
SRO\FDUERQDWHRSDOVDQVUXSWXUHGHX[
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg F mm XxY mm
2x14/24
2x28/54
2x35/49/80
76.42.50.3
76.42.51.3
76.42.52.3
76.42.50.0
76.42.51.0
76.42.52.0
199,00
246,00
286,50
2,4
4,7
6,3
638
1238
1538
130x633
130x1233
130x1533
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg I mm XxY mm
2x28/54
2x35/49/80
76.42.61.3
76.42.62.3
76.42.61.0
76.42.62.0
246,00
286,50
4,6
6,2
1175
1475
130x1175
130x1475
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
48.06.04.3 2,50
2 unit/ref.
Accesorios
Accessories
Accessoires
16 cm
Unin codo 90
90 elbow joint
Union coude 90
Cdigo Color (XURV
76.05.21.3
76.05.21.0
31,50
31,50
Posibles combinaciones para lneas contnuas
Possible combinations for continous mounting
Possibles combinaisons pour ligne continue
P.81 / 84 P.90
P.75 P.86 / 89
P.74 P.76
Gris satinado
Satin gray
Gris satin
Blanco mate
Matt white
Blanc mat
P.78/80
110
87
(VWUXFWXUDV
FIL MED
T5/T16
G5
Mx.60mm
850
PC
DIFUSER
Al
CLASE
I
IP
42
/XPLQDULD),/0(',1',9,'8$/SDUDHPSRWUDUFRQUHHFWRUWUHVEROLOOR
y difusor policarbonato opal
Recessed FIL MED INDIVIDUAL luminaire with staggered
UHHFWRUDQGRSDOSRO\FDUERQDWHGLIIXVHU
Luminaire FIL MED INDIVIDUEL pour encastrement avec diffuseur
SRO\FDUERQDWHRSDOVDQVUXSWXUHGHX[
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg L mm XxY mm
2x14/24
2x28/54
2x35/49/80
76.42.53.3
76.42.54.3
76.42.55.3
76.42.53.0
76.42.54.0
76.42.55.0
161,50
218,00
281,00
2,5
4,8
6,4
691
1291
1591
130x675
130x1275
130x1575
Gris satinado
Satin gray
Gris satin
Blanco mate
Matt white
Blanc mat
L
110
88
(VWUXFWXUDV
FIL MED
Cdigo Color (XURVPO
76.05.00.3
76.05.10.3
63,50
16,00
Cdigo Color (XURVPO
76.05.01.3
76.05.10.3
73,50
16,00
3HUO\WDSDGHVXSHUFLH
3UROHDQGFRYHUVXUIDFH
3UROHOFRXYHUFOHVDLOOLH
3HUO\WDSDSDUDHPSRWUDU
5HFHVVHGSUROHDQGFRYHU
3UROHWFRXYHUFOHSRXUHQFDVWUHPHQW
max. 3m
76.05.10.3
76.05.10.3
76.05.00.3
76.05.01.3
Accesorios p.83
Accessories p.83
Accessoires p.83
Accesorios p.86
Accessories p.86
Accessoires p. 86
7DSDQDOGHDOXPLQLR
End aluminium cover
(PERXWQDOGDOXPLQLXP
Cdigo Color (XURV
76.06.42.3 12,50
Gris satinado
Satin gray
Gris satin
Anclaje para techo incluido
Bracket surface included
Fixation plafond inclus
110
89
(VWUXFWXUDV
FIL MED
Modulo B para 1 lmpara
Module B for 1 lamp
Module B pour 1 lampe
Modulo D para 2 lmparas
Module D for 2 lamps
Module D pour 2 lampes
Modulo C con proyector TWIN
Module C with TWIN projector
Module C avec projecteur TWIN
W Cdigo Color (XURV Kg L mm
1x50 76.41.70.3 80,50 1,3 300
W Cdigo Color (XURV Kg L mm
2x50 76.42.70.3 138,50 1,6 600
W Cdigo Color (XURV Kg L mm
1x35
2X35
76.41.74.3
76.42.74.3
223,50
371,50
1
1,1
400
400
QR-70
OSRAM
BA15d
QR-70
OSRAM
BA15d
CDM-R111
GX 8,5
Al
Al
Al
355
355
355
35
35
90
960
960
960
CLASE
I
CLASE
I
CLASE
I
IP
20
IP
20
IP
20
L
L
L
P.81 / 84 P.90
P.75 P.86 / 89
P.74 P.76
P.78/80
(TXLSR(OHFWUyQLFR
(TXLSR(OHFWUyQLFR
(TXLSR(OHFWUyQLFR
90
(VWUXFWXUDV
Cdigo Color (XURVPO
49.00.00.2
49.00.10.2
82,00
45,00
3HUO\WDSD
3UROHDQGFRYHU
3UROHWFRXYHUFOH
Cdigo Color (XURVPO
49.06.41.2 26,50
7DSDQDO
End cover
(PERXWQDO
FIL BOX
49.00.10.2
max. 3m
49.00.00.2
Mdulo A para 1 lmpara
Module A for 1 lamp
Module A pour 1 lampe
max.
max.
W Cdigo Color (XURV Kg L mm
1x75
1x100
1x100
49.01.70.2
49.41.71.2
49.41.78.2
80,00
84,50
124,50
0,8
0,85
0,9
250
250
250
PAR30
E27
QR-111
G 53
QT 12
GY6,35
Electronic
Electronic GLASS

Very Wide
Flood
35
35
35
35
960 Al
CLASE
I
IP
20
L
Mdulo B para 1 lmpara
Module B for 1 lamp
Module B pour 1 lampe
W Cdigo Color (XURV Kg L mm
1x35
1x70
1x35
1x70
49.41.76.2
49.41.77.2
49.41.79.2
49.41.83.2
236,50
236,50
233,00
233,00
1,35
1,35
1,25
1,25
500
500
500
500 CDM-R111
GX 8,5
HIT-TC
G8,5
GLASS

Very Wide
Flood
Electronic
35
35
35
35
960
Al
CLASE
I
IP
20
L
Negro mate
Matt black
Noir mat
P.81 / 84 P.90
P.75 P.86 / 89
P.74 P.76
P.78/80
91
(VWUXFWXUDV
FIL BOX
Mdulo C para 2 lmparas
Module C for 2 lamps
Module C pour 2 lampes
0yGXOR&\'SDUDXRUHVFHQFLD7+(+2
0RGXOH&DQG'IRU7+(XRUHVFHQWODPSV
0RGXOH&HW'SRXUODPSHXRUHVFHQWH7+(
(TXLSR(OHFWUyQLFR7+(+2
Difusor opal Opal diffuser Diffuseur opal
ptica doble parablica Double parabolic louvre Grille double parabolique
Mdulo B para 2 lmparas
Module B for 2 lamps
Module B pour 2 lampes
Mdulo C para 3 lmparas
Module C for 3 lamps
Module C pour 3 lampes
Mdulo B con proyector TWIN
Module B with TWIN projector
Module B avec projecteur TWIN
W Cdigo Color (XURV Kg L mm
2x75
2x100
2x100
49.02.70.2
49.42.71.2
49.42.78.2
150,50
146,50
230,50
1,6
1,7
1,8
500
500
500
W Cdigo Color (XURV Kg L mm
3x75
3x100
3x100
49.03.70.2
49.43.71.2
49.43.78.2
216,00
214,50
335,50
2,35
2,4
2,6
750
750
750
W Cdigo Color (XURV Kg L mm
1x35
1x70
49.41.89.2
49.41.84.2
278,50
278,50
1
1
500
500
W Cdigo Color (XURV Kg L mm
2x35
2x70
2x35
2x70
49.42.76.2
49.42.77.2
49.42.79.2
49.42.83.2
470,00
470,00
457,00
457,00
2,35
2,35
2,25
2,25
750
750
750
750
W Cdigo Color (XURV Kg L mm
2x14/24
2x28/54
49.42.93.2
49.42.94.2
190,50
216,50
2,8
5
750
1500
W Cdigo Color (XURV Kg L mm
2x14/24
2x28/54
49.42.90.2
49.42.91.2
223,50
249,00
2,8
5
750
1500
PAR30
E27
PAR30
E27
CDM-R111
GX 8,5
CDM-R111
GX 8,5
IP
42
960
QR-111
G 53
QR-111
G 53
HIT-TC
G8,5
IP
42
QT 12
GY6,35
QT 12
GY6,35
Electronic
Electronic
GLASS
PC
DIFUSER

Very Wide
Flood
850
Electronic
Electronic
GLASS
GLASS

Very Wide
Flood

Very Wide
Flood
Electronic
T5/T16
G5
35
35
35
35
35
35
35
35
Electronic
35
35
35
35
960
960
355
960
Al
Al
90
960
Al
Al
Al
CLASE
I
CLASE
I
CLASE
I
CLASE
I
CLASE
I
IP
20
IP
20
IP
20
IP
20
L
L
L
L
L
L
max.
max.
max.
max.
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Tirante (recomendado 1 ud. cada 2m)
Brace (1 unit recommended every 2m)
Raidisseur (recommand une unit chaque 2m)
Cdigo (XURV
96.06.01.0 1,50
Cdigo Color (XURV
96.06.06.0 9,50
2 unit/ref. 1 unit/ref.
Accesorios
Accessories
Accessoires
Suspensiones (p.118)
Suspensions (p.118)
Suspensions (p.118)
92
(VWUXFWXUDV
CLASE
I
Al
PC
DIFUSER
IP
42
850
T5/T16
G5
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
1x14/24
1x28/54
1x35/49/80
70.41.00.0
70.41.01.0
70.41.02.0
163,50
257,00
325,50
5,2
9,4
11,6
660
1260
1560
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
1x14/24
1x28/54
1x35/49/80
70.41.03.0
70.41.04.0
70.41.05.0
163,50
257,00
325,50
5,2
9,4
11,6
660
1260
1560
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
2x14/24
2x28/54
2x35/49/80
70.42.00.0
70.42.01.0
70.42.02.0
229,50
323,00
401,50
5,6
10
12,2
660
1260
1560
Cdigo (XURV
70.01.19.0 21,50
Luminaria MULTISPACE de radiacin directa y difusor de policarbonato opal
MULTISPACE luminarie of direct radiation and polycarbonate diffuser
Luminaire MULTISPACE direct avec diffuseur polycarbonate
Luminaria MULTISPACE de radiacin indirecta y difusor de policarbonato opal
MULTISPACE luminarie of indirect radiation and polycarbonate diffuser
Luminaire MULTISPACE indirect avec diffuseur polycarbonate
Luminaria MULTISPACE de radiacin directa-indirecta y difusor de policarbonato opal
MULTISPACE luminarie of direct-indirect radiation and polycarbonate diffuser
Luminaire MULTISPACE direct-indirect avec diffuseur polycarbonate
Soporte cartel para metacrilato
Support sign for methacrylate
6XSSRUWDIFKHSRXUPHWKDFU\ODWH
Metacrilato y rotulacin a consultar bajo demanda
Methacrylate and labelling consulting on request
Consulter quantits et prix pour methacrylate et enseignes
MULTISPACE
2 unit/ref.
Blanco texturizado
Texturised white
Blanc textur
N LED
W Cdigo Color (XURV Kg lm Output
8
8
15
15
70.41.27.0
70.41.28.0
190,50
190,50
0,9
0,9
WFL
MFL
830
830
LED
Warm
N LED
W Cdigo Color (XURV Kg lm Output
2x8
2x8
2x15
2x15
70.42.27.0
70.42.28.0
350,00
350,00
0,9
0,9
WFL
MFL
2x830
2x830
LED
Warm
93
(VWUXFWXUDV
Cdigo Color (XURVPO
70.05.00.0
70.05.10.0
105,00
20,50
Cdigo (XURV
48.06.06.3 5,50
Cdigo Color (XURV
70.05.20.0 50,50
Cdigo Color (XURV
70.06.40.0 21,00
3HUO\WDSD
3UROHDQGFRYHU
3UROHWFRXYHUFOH
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Unin codo 90
90 elbow joint
Union coude 90
7DSDQDO
End cover
(PERXWQDO
MULTISPACE
25
40
40
25
max.
40
0
max.
40
960
Al
CLASE
I
IP
20
QR-111
G 53
CDM-R111
GX 8,5
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
1x100
1x35
1x70
70.41.06.0
70.41.07.0
70.41.08.0
103,50
207,00
207,00
0,8
0,9
0,9
QR-111
G 53
CDM-R111
GX 8,5
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
2x100
2x35
2x70
70.42.06.0
70.42.07.0
70.42.08.0
172,00
364,00
364,00
1,4
1,6
1,6
Mdulo MULTISPACE para 1 lmpara
MULTISPACE module for 1 lamp
Module mural MULTISPACE pour 1 lampe
Mdulo MULTISPACE para 2 lmpara
MULTISPACE module for 2 lamp
Module MULTISPACE pour 2 lampes
Accesorios
Accessories
Accessoires
4 unit/ref.
Max. 3 m
Cdigo Color(XURV h(m)
96.28.67.0 70,50 max.3
Suspensin electromecnica
regulable en "Y"
Electromechanical suspension
height-adjustable in "Y"
Suspension lectromcanique
en acier rglable en "Y"
(5x1,5mm)
Cdigo Color (XURV h(m)
96.08.63.3 16,00 max.3
Cable de acero regulable en "Y"
Steel cable height-adjustable in "Y"
Cble en acier rglable en "Y"
P.61 P.56 P.92 P.93
70.05.00.0
70.05.10.0 18 mm
115 mm
Dos cables de acero trenzado
Two braided steel cables
Deux cbles acier tress
Cdigo Color h(m) (XURV
96.07.49.0
96.07.49.3
max.3
max.3
19,50
19,50
Suspensin electromecnica de dos cables acero
Electromechanical susp. of two braided steel cables
Susp. lectromcanique deux cables acier tress
Cdigo Color (XURV h(m)
96.27.49.0
96.27.49.3
74,00
74,00
max. 3
max. 3
94
TRIPLEX
T5/T16
G5
T5/T16
G5
850
850
Al
PC
DIFUSER
Al
PC
DIFUSER
CLASE
I
CLASE
I
IP
42
IP
40
Luminaria TRIPLEX de radiacin directa con difusor de policarbonato
TRIPLEX direct luminaire with polycarbonate diffuser
Luminaire TRIPLEX direct avec diffuseur en polycarbonate
Luminaria TRIPLEX de radiacin directa-indirecta con difusor de policarbonato
TRIPLEX direct-indirect luminaire with polycarbonate diffuser
Luminaire TRIPLEX direct-indirect avec diffuseur en polycarbonate
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
1x14/24
1x28/54
1x35/49/80
2x14/24
2x28/54
2x35/49/80
53.41.50.0
53.41.51.0
53.41.52.0
53.42.50.0
53.42.51.0
53.42.52.0
136,50
169,50
200,50
163,00
185,50
248,50
1,6
2,75
3,4
1,7
2,85
3,5
700
1300
1600
700
1300
1600
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
1x28/54
1x35/49/80
2x28/54
2x35/49/80
53.41.71.0
53.41.72.0
53.42.71.0
53.42.72.0
179,00
210,00
196,00
267,50
2,65
3,2
2,75
3,4
1300
1600
1300
1600
Blanco mate
Matt white
Blanc mat
(VWUXFWXUDV
95
(VWUXFWXUDV
TRIPLEX
T5/T16
G5
T5/T16
G5
960
850
Al
Al
CLASE
I
CLASE
I
IP
20
IP
20
Luminaria TRIPLEX de radiacin directa con ptica parablica mate
TRIPLEX direct luminaire with matt parabolic louvre
Luminaire TRIPLEX direct avec grille parabolique mt
Luminaria TRIPLEX de radiacin directa-indirecta con ptica parablica mate
TRIPLEX direct-indirect luminaire with matt parabolic louvre
Luminaire TRIPLEX direct-indirect avec grille parabolique mt
Difusor superior de policarbonato transparente incluido
Transparent polycarbonate upper diffuser included
Diffuseur suprieur transparent en polycarbonate inclus
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
1x14/24
1x28/54
1x35/49/80
2x14/24
2x28/54
2x35/49/80
53.41.53.0
53.41.54.0
53.41.55.0
53.42.53.0
53.42.54.0
53.42.55.0
159,50
195,50
239,00
182,00
208,00
269,00
1,6
2,75
3,4
1,7
2,85
3,4
700
1300
1600
700
1300
1600
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
1x28/54
1x35/49/80
2x28/54
2x35/49/80
53.41.74.0
53.41.75.0
53.42.74.0
53.42.75.0
208,00
249,00
223,00
279,50
2,65
3,2
2,75
3,4
1300
1600
1300
1600
110 mm
75 cm
Accesorios
Accessories
Accessoires
3HUO\WDSD
3UROHDQGFRYHU
3UROHWFRXYHUFOH
Unin soporte corto pared
Short wall bracket
Support court mural
Soporte de pared orientable
Wall support adjustable
Support mural orientable
Unin codo 90
90 elbow joint
Union coude 90
Unin soporte largo pared
Long wall bracked
Support long mural
Cdigo Color (XURVPO
53.05.30.0
53.05.31.0
41,00
20,50
Cdigo Color (XURV
96.07.45.0 35,00
Cdigo Color (XURV
96.00.06.0 60,50
Cdigo Color (XURV
53.05.24.0 29,00
Cdigo Color (XURV
96.07.46.0 52,00
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
96.06.01.0 1,50
2 unit/ref.
2 unit/ref.
max. 3 m
53.05.31.0
53.05.30.0
7DSDQDO
End cover
(PERXWQDO
Cdigo Color (XURV
53.06.42.0 7,50
13 cm
300 mm
2 unit/ref.
2 unit/ref.
S
c
e
n
in
g
Sistemas de control 1-10V p.148
Systems of control 1-10V p.148
Systmes de contrle 1-10V p.148
Suspensiones (p.118)
Suspensions (p.118)
Suspensions (p.118)
96
(VWUXFWXUDV
DINAMIC L.C.
T5/T16
G5
850
Al
PC
DIFUSER
CLASE
I
IP
40
Luminaria DINAMIC L.C. con difusor de policarbonato opal
DINAMIC L.C. luminaire with opal polycarbonate diffuser
Luminaire DINAMIC L.C. avec diffuseur en polycarbonate opal
(TXLSR(OHFWUyQLFR7+(+2
Directo Direct Direct
W Cdigo Color (XURV Kg L mm
2x28/54
2x35/49/80
64.42.06.0
64.42.08.0
261,50
309,50
5,0
6,2
1245
1545
Directo-indirecto Direct-indirect Direct-indirect
W Cdigo Color (XURV Kg L mm
2x28/54
2x35/49/80
64.42.07.0
64.42.09.0
277,00
327,50
5,0
6,2
1245
1545
Difusor superior de policarbonato transparente incluido
Transparent polycarbonate upper diffuser included
Diffuseur suprieur transparent en polycarbonate incl
212
57,5
T5/T16
G5
850
Al
CLASE
I
IP
20
Luminaria DINAMIC L.C. con optica de alto confort visual
DINAMIC L.C. luminaire with high visual confort optics
Luminarie DINAMIC L.C. avec optique haut confort visuel
(TXLSR(OHFWUyQLFR7+(+2
Directo Direct Direct
W Cdigo Color (XURV Kg L mm
2x28/54
2x35/49/80
64.42.10.0
64.42.12.0
273,00
320,50
4,8
6,0
1245
1545
Directo-indirecto Direct-indirect Direct-indirect
W Cdigo Color (XURV Kg L mm
2x28/54
2x35/49/80
64.42.11.0
64.42.13.0
288,00
339,00
4,8
6,0
1245
1545
Difusor superior de policarbonato transparente incluido
Transparent polycarbonate upper diffuser included
Diffuseur suprieur transparent en polycarbonate incl
212
57,5
2 unit. ref.
Accesorios
Accessories
Accessoires
Unin codo 90
90 elbow joint
Union coude 90
Cdigo Color (XURV
64.05.20.3 71,00
7DSDQDO
End cover
(PERXWQDO
Fijacin intermedia
Intermediate joint
Union intermdiaire
Cdigo Color (XURV
64.06.40.3 20,50
Cdigo (XURV
64.07.00.0 3,00
Anodizado plata mate
Anodized matt silver
Anodis argent mat
97
(VWUXFWXUDV
P.64 P.65 P.96 P.97
DINAMIC
Suspensiones
Suspensions
Suspensions
Suspensin electromecnica regulable en "Y"
Electromechanical suspension height-
adjustable in "Y"
Suspension lectromecnique en acier rglable
en "Y"
&DEOHGHDFHUR[UHJXODEOHSDUD
conexin electromecnica
6WHHOFDEOH[KHLJKWDGMXVWDEOHIRU
electromechanical connection
Fleuron dcoratif pour connexion
lectromecanique
Cdigo Color h(m) (XURV
96.28.65.0
96.28.65.3
max.3
max.3
47,50
47,50
Cable de acero regulable niquelado
Niquel steel cable height-adjustable
Suspension chrome rglable
Cdigo Color h(mm) (XURV
96.01.31.3
96.01.34.3
1000
4000
15,50
17,00
Cable de acero regulable en "Y"
Steel cable height-adjustable in "Y"
Cble en acier rglable en "Y"
Cdigo Color h(m) (XURV
96.08.65.3 max.3 18,16
Cdigo Color h(mm) (XURV
96.21.31.0
96.21.34.0
1000
4000
26,50
48,50
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L x A x H mm
4x14/24
2x28/54
64.44.00.0
64.42.00.0
445,00
414,00
6,2
6,3
650 x 650 x 57
1250 x 350 x 57
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L x A x H mm
4x14/24
2x28/54
64.44.01.0
64.42.01.0
445,50
455,50
6,1
6,2
650 x 650 x 57
1250 x 350 x 57
Luminaria DINAMIC DECO con difusor de policarbonato opal
DINAMIC DECO luminaire with opal polycarbonate diffuser
Luminaire DINAMIC DECO avec diffuseur polycarbonate opal
850
Al
T5/T16
G5
PC
DIFUSER
CLASE
I
IP
40
Directo
Directo - Indirecto
Difusor superior de policarbonato translcido incluido
Translucid polycarbonate upper diffuser included
Diffuseur suprieur translucide en polycarbonate inclus
Anodizado plata mate
Anodized matt silver
anodis argent mat
98
(VWUXFWXUDV
FLAT
T5/T16
G5
850
PC
DIFUSER
Al
CLASE
I
IP
40
Luminaria FLAT de radiacin indirecta
FLAT luminaire of indirect radiation
Luminaire FLAT rayonnement indirect
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
2x28/54
2x35/49/80
72.42.01.0
72.42.02.0
278,00
342,50
4
5
1230
1530
850
T5/T16
G5
DALI
PC
DIFUSER
Al
CLASE
I
IP
40
Luminaria FLAT SHOW RGB de radiacin indirecta
FLAT SHOW RGB luminaire of indirect radiation
Luminaire FLAT SHOW RGB rayonnement indirect
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
3x28/54 72.83.01.0 771,00 4 1230
Pack de control
Control pack
Pack de control
Cdigo (XURV
96.86.01.0 576,00
P.66 P.98
T5/T16
G5
QR-70
OSRAM
BA15d
PC
DIFUSER
850
Al
CLASE
I
IP
40
Luminaria FLAT de iluminacin directa-indirecta
FLAT luminaire for direct-indirect lighting
Luminaire FLAT rayonnement direct-indirect
2x28/54
+
2x50
2x35/49/80
+
2x50
(TXLSR(OHFWUyQLFR7+(+245
W Cdigo Color (XURV Kg L mm
72.44.24.0
72.44.25.0
480,00
506,50
3,5
3,5
1530
1830
Blanco mate
Matt white
Blanc mat
99
(VWUXFWXUDV
FLAT
Accesorios
Accessories
Accessoires
max. 3m
3HUO
3UROH
3URO
Cdigo Color (XURVPO
72.05.00.0 125,00
Unin de 3 luminarias a 90
Joining piece coupler to 90
Pice union luminaires en "T"
Cdigo Color (XURV
72.05.25.0 48,50
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
96.06.01.0 1,50
2 unit/ref.
Suspensiones
Suspensions
Suspensions
Suspensin electromecnica regulable en "Y"
Electromechanical suspension height-
adjustable in "Y"
Suspension electromecnique en acier rglable
en "Y"
Cable de acero regulable en "Y"
Steel cable height-adjustable in "Y"
Cble en acier rglable en "Y"
Dos cables de acero trenzado
Two braided steel cables
Deux cbles acier tress
Florn decorativo para conexin
elctrica 5P
Decorative ceiling rose for electrical
connection 5P
Fleuron dcoratif pour connexion
lectrique 5P
Cdigo Color h(m) (XURV
96.28.60.0 max.3 37,69
Cdigo Color h(m) (XURV
96.08.60.3 max.3 14,59
Cdigo Color h(m) (XURV
96.07.49.0
96.07.49.3
max.3
max.3
19,52
19,52
Cdigo Color (XURV
96.58.64.0 38,82
125mm
7DSDQDO
End cover
(PERXWQDO
Cdigo Color (XURV
72.06.40.0 16,00
215mm
Unin codo 90
90 elbow joint
Union coude 90
Cdigo Color (XURV
72.05.20.0 59,50
Unin de 4 luminarias a 90 en cruz
Joining piece coupler to 90 at cross
Pice union 4 luminaires 90 en croix
Cdigo Color (XURV
72.05.26.0 76,00
325mm
Unin de 2 luminarias a 90
Joining piece coupler to 90
Pice union luminaires 90
Cdigo Color (XURV
72.05.24.0 42,50
1 unit/ref.
(3 x 1,5 mm)
100
(VWUXFWXUDV
IP
20
850
T5/T16
G5
PC
DIFUSER
Al
CLASE
I
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
4x14/24
4x28/54
4x35/49/80
60.44.15.3
60.44.16.3
60.44.17.3
382,50
453,50
500,00
3,2
6,7
8,2
890
1500
1800
Luminaria FINELAMP de radiacin directa-indirecta con ptica de alto confort visual
FINELAMP luminaire direct-indirect light with high visual confort optics
Luminaire FINELAMP direct-indirect avec optique haut confort visuel
Difusor superior de policarbonato translcido incluido
Translucid polycarbonate upper diffuser included
Diffuseur suprieur translucide en polycarbonate inclus
FINELAMP
excepto
60.44.15.3
T5/T16
G5
Al
CLASE
I
IP
20
850
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
2x14/24
2x28/54
2x35/49/80
60.42.15.3
60.42.16.3
60.42.17.3
338,00
378,00
386,50
3,0
6,6
7,5
890
1500
1800
Luminaria FINELAMP de radiacin directa con ptica de alto confort visual
FINELAMP luminaire direct light high visual confort optics
Luminaire FINELAMP direct avec optique haut confort visuel
P.58 P.70 P.70 P.100
T5/T16
G5
PC
DIFUSER
Al
CLASE
I
IP
40
850
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
4x14/24
4x28/54
4x35/49/80
60.44.12.3
60.44.13.3
60.44.14.3
378,00
419,50
475,00
3,1
6,6
8,2
890
1500
1800
Luminaria FINELAMP de radiacin directa-indirecta con difusor de policarbonato
FINELAMP luminaire direct-indirect light with polycarbonate diffuser
Luminaire FINELAMP direct-indirect avec diffuseur en polycarbonate
Difusor superior de policarbonato translcido incluido
Translucid polycarbonate upper diffuser included
Diffuseur suprieur translucide en polycarbonate inclus
excepto
60.44.12.3
Gris satinado
Satin gray
Gris satin
101
(VWUXFWXUDV
FINELAMP
T5/T16
G5
850
Al
CLASE
I
IP
40
PC
DIFUSER
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
2x14/24
2x28/54
2x35/49/80
60.42.12.3
60.42.13.3
60.42.14.3
299,00
389,00
391,00
2,9
6,5
7,4
890
1500
1800
Luminaria FINELAMP de radiacin directa con difusor de policarbonato
FINELAMP luminaire direct light with polycarbonate diffuser
Luminaire FINELAMP direct avec diffuseur en polycarbonate
Accesorios y Suspensiones
Accessories and Suspensions
Accessoires et Suspensions
Cable de acero regulable en Y
Steel cable height adjustable in Y
Suspension cble en acier rglable en Y
Pieza unin luminarias lnea contnua
Joining piece in continous line
3LqFHGXQLRQOLJQHFRQWLQXH
Suspensin electromecnica regulable en Y
Electromachanical suspension height-
adjustable in Y
Suspension lectromecanique en acier
rglable en Y
Brazo rtula
Ball joint attachement
Union dcoratif pour rotule
Dos cables acero trenzado regulable
Two braided steel cables height adjustable
Deux cbles acier tress rglable
Rtula
Ball joint
Rotule
Cdigo Color (XURV h(m)
96.08.63.3 16,00 max. 3 Cdigo Color (XURV
60.06.00.3 11,00
Cdigo Color (XURV h(m)
96.28.63.3 50,00 max. 3
Cdigo Color (XURV
60.06.02.3 18,50
Cdigo Color (XURV h(m)
96.07.49.3 19,50 max. 3
Cdigo Color (XURV
96.06.04.3 58,00
2 unit/ref. (una pieza cableada y itra sin cablear)
2 unit/ref. (uncl. wiring - excl. wiring)
XQLWUHIXQHSLqFHFkEOpHHWODXWUHQRQFkEOpH
Max. 6 unidades/rtula/55
Max. 6 unit / ball joint/55
Max. 6 unit/rotule/55
Blanco brillo
Bright white
Blanc brillant
102
(VWUXFWXUDV
T8/T26
G13
960 Al
CLASE
I
IP
20
01
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L mm
1x18
1x36
1x58
2x18
2x36
2x58
52.41.00.0
52.41.01.0
52.41.02.0
52.42.00.0
52.42.01.0
52.42.02.0
88,00
112,00
124,50
96,50
113,00
135,50
3,2
5,2
6,4
2,9
4,8
5,6
730
1340
1640
730
1340
1640
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L mm
1x18
1x36
1x58
2x18
2x36
2x58
52.41.09.0
52.41.10.0
52.41.11.0
52.42.09.0
52.42.10.0
52.42.11.0
102,50
134,50
148,50
111,00
137,00
161,50
3,2
5,2
6,4
2,9
4,8
5,6
730
1340
1640
730
1340
1640
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L mm
1x18
1x36
1x58
52.43.70.0
52.43.71.0
52.43.72.0
115,50
147,00
164,50
3,6
5,0
6,1
730
1340
1640
Luminaria OVAL sin difusor
OVAL luminaire without diffuseur
Luminaire OVAL sans diffuseur
Luminaria OVAL con ptica parablica brillante
OVAL luminaire with bright parabolic diffuser
Luminaire OVAL avec diffuseur parabolique brillant
Luminaria OVAL asimtrica sin difusor
OVAL asymetric luminaire without diffuseur
Luminaire OVAL asymtrique sans diffuseur
OVAL
Celosas de lamas blancas
White louvre diffusser
Diffuseurs lame blanche
Difusores de policarbonato
Polycarbonate diffusers
Diffuseurs en polycarbonate
W Cdigo mm (XURV
18
36
58
52.06.10.0
52.06.11.0
52.06.12.0
565
1175
1475
13,00
20,00
24,50
W Cdigo mm (XURV
18
36
58
52.06.13.0
52.06.14.0
52.06.15.0
568
1178
1478
18,50
31,50
39,50
850
IP
40
103
(VWUXFWXUDV
OVAL
Suspensiones (p.118)
Suspensions (p.118)
Suspensions (p.118)
$FFHVRULRV29$/SDUDUHDOL]DUJXUDVSODQDV
29$/DFFHVVRULHVIRUFUHDWLQJDWV\VWHPV
$FFHVVRLUHV29$/SRXUUpDOLVHUGHVJXUHVSODWHV
3HUO\WDSD
3UROHDQGFRYHU
3UROHWFRXYHUFOH
Soporte de pared orientable
Wall support adjustable
Support mural orientable
Unin codo 90
90 elbow joint
Union coude 90
Unin soporte pared
Wall bracked
Support mural
Cdigo Color (XURVP
52.05.00.0
52.05.10.0
64,00
23,50
Cdigo Color (XURV
96.00.06.0 60,50
Cdigo Color (XURV
52.05.20.0 33,50
Cdigo Color (XURV
96.07.46.0 52,00
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
52.06.01.0 2,00
max. 3 m
52.05.10.0
52.05.00.0
7DSDQDO
End cover
(PERXWQDO
Cdigo Color (XURV
52.06.40.0 4,00
300 mm
143 mm
300 mm
3
0
0
m
m
2 unit/ref.
2 unit/ref.
50W 12V
mx. 6 unit. / mn. 55
Unin "T"
"T" joint
Union "T"
Unin "cruz"
"Cross" joint
Union "croix"
Cdigo Color (XURV
52.05.21.0 51,50
Cdigo Color (XURV
52.05.22.0 63,50
Rtula
Ball joint
Rotule
Soporte pared con tapa incorporada
Wall supports with cover included
Support mural avec embout incorpor
Cdigo Color (XURV
96.06.04.0 58,00
Cdigo Color (XURV
52.04.80.0 40,00
Cdigo Color (XURV
52.07.41.0 32,00
Tapa unin a rtula
Cover ball joint
(PERXWQDOURWXOH
Tapa con downlight orientable bajo voltaje
Cover with spot light adjustable positioning
Couvercle avec projecteur orientable TBT
Tapa con proyector TWIN
Cover with projector TWIN
Couvercle avec projecteur TWIN
Cdigo Color (XURV
52.06.41.0 27,00
Cdigo Color (XURV
52.07.02.0 66,50
Cdigo Color (XURV
52.07.03.0 174,50
Soporte pared orientable y extensible
Wall support adjustable and extensible
Support mural orientable et extensible
Cdigo Color (XURV
96.00.05.0 119,50
2 unit/ref. 2 unit/ref.
QR-CBC51
GU 5,3
QR-CBC51
GU 5,3
Electronic
Electronic
Final End Fin
Intermedia Intermediate part Intermdiaire
13 cm
min. 30cm
max. 40cm
1 unit/ref.
Blanco brillo
Bright white
Blanc brillant
104
(VWUXFWXUDV
BASIC
960 Al
CLASE
I
IP
20
01
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L mm
1x18
1x36
1x58
2x18
2x36
2x58
54.41.00.0
54.41.01.0
54.41.02.0
54.42.00.0
54.42.01.0
54.42.02.0
86,50
93,50
102,00
93,00
101,50
110,50
1,0
2,2
2,7
1,4
1,8
2,0
760
1370
1670
760
1370
1670
Luminaria BASIC sin difusor
BASIC luminaire without diffuseur
Luminaire BASIC sans diffuseur
850
IP
40
Celosas de lamas blancas
White louvre diffusser
Diffuseurs lame blanche
Difusores de policarbonato
Polycarbonate diffusers
Diffuseurs en polycarbonate
W Cdigo mm (XURV
18
36
58
24
54
80
54.06.10.0
54.06.11.0
54.06.12.0
54.06.16.0
54.06.17.0
54.06.18.0
565
1175
1475
525
1125
1425
16,00
30,00
29,00
15,50
22,50
28,00
W Cdigo mm (XURV
18
36
58
24
54
80
54.06.20.0
54.06.21.0
54.06.22.0
54.06.36.0
54.06.37.0
54.06.38.0
568
1178
1478
528
1128
1428
17,00
21,50
28,50
15,50
20,50
27,00
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
1x14/24
1x28/54
1x35/49/80
2x14/24
2x28/54
2x35/49/80
54.41.13.0
54.41.14.0
54.41.15.0
54.42.13.0
54.42.14.0
54.42.15.0
98,00
115,50
126,00
105,00
132,50
143,00
1,0
2,2
2,7
1,4
1,8
2,0
720
1320
1620
720
1320
1620
T8/T26
G13
T5/T16
G5
105
(VWUXFWXUDV
BASIC
$FFHVRULRV%$6,&SDUDUHDOL]DUJXUDVSODQDV
%$6,&DFFHVVRULHVIRUFUHDWLQJDWV\VWHPV
$FFHVVRLUHV%$6,&SRXUUpDOLVHUGHVJXUHVSODWHV
3HUO\WDSD
3UROHDQGFRYHU
3UROHWFRXYHUFOH
Unin codo 90
90 elbow joint
Union coude 90
Cdigo Color (XURVP
54.05.00.0
54.05.10.0
34,50
29,00
Cdigo Color (XURV
54.05.20.0 17,50
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
96.06.01.0 1,50
max. 3 m
54.05.10.0
54.05.00.0
7DSDQDO
End cover
(PERXWQDO
Cdigo Color (XURV
54.06.40.0 5,50
2 unit/ref.
Unin "T"
"T" joint
Union "T"
Unin "cruz"
"Cross" joint
Union "croix"
Cdigo Color (XURV
54.05.21.0 28,00
Cdigo Color (XURV
54.05.22.0 38,50
Rtula
Ball joint
Rotule
Cdigo Color (XURV
96.06.04.0 58,00
Tapa unin a rtula
Cover ball joint
(PERXWQDOURWXOH
Cdigo Color (XURV
54.06.41.0 30,50
mx. 9 unit. / mn. 40
Otros accesorios
Other accessories
Autres accessoires
Unin soporte pared
Wall bracked
Support mural
Cdigo Color L mm (XURV
96.07.45.0
96.07.46.0
75
300
35,00
52,00
L
300 mm
2 unit/ref.
2 unit/ref.
50W 12V
Soporte pared con tapa incorporada
Wall supports with cover included
Support mural avec couvercle incorpor
Cdigo Color (XURV
54.04.77.0 32,50
Cdigo Color (XURV
54.07.41.0 28,00
Tapa con proyector AVANT
Cover with projector AVANT
Couvercle avec projecteur AVANT
Cdigo Color (XURV
54.07.03.0 179,00
QR-CBC51
GU 5,3
Electronic
Final End Fin
Intermedia Intermediate part Intermdiaire
143 mm
Suspensiones (p.118)
Suspensions (p.118)
Suspensions (p.118)
1 unit/ref.
Blanco brillo
Bright white
Blanc brillant
106
(VWUXFWXUDV
LAMPTUB
850
T8/T26
G13
960
CLASE
I
IP
20
01
IP
40
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L mm
1x18
1x36
1x58
2x18
2x36
2x58
51.41.00.0
51.41.01.0
51.41.02.0
51.42.00.0
51.42.01.0
51.42.02.0
72,00
87,00
95,50
77,50
93,00
104,00
1,5
2,9
3,4
2,0
3,2
3,6
760
1370
1670
760
1370
1670
Luminaria LAMPTUB sin difusor
LAMPTUB luminaire without diffuseur
Luminaire LAMPTUB sans diffuseur
Celosas de lamas blancas
White louvre diffusser
Diffuseurs lame blanche
Difusores de policarbonato
Polycarbonate diffusers
Diffuseurs en polycarbonate
W Cdigo mm (XURV
18
36
58
51.06.10.0
51.06.11.0
51.06.12.0
565
1175
1475
11,00
15,00
17,50
W Cdigo mm (XURV
18
36
58
51.06.20.0
51.06.21.0
51.06.22.0
568
1178
1478
14,50
23,00
29,00
Al
107
(VWUXFWXUDV
LAMPTUB
$FFHVRULRV/$0378%SDUDUHDOL]DUJXUDVSODQDV
/$0378%DFFHVVRULHVIRUFUHDWLQJDWV\VWHPV
$FFHVVRLUHV/$0378%SRXUUpDOLVHUGHVJXUHVSODWHV
Otros accesorios
Other accessories
Autres accessoires
3HUO\WDSD
3UROHDQGFRYHU
3UROHWFRXYHUFOH
Unin codo 90
90 elbow joint
Union coude 90
Unin soporte pared
Wall bracked
Support mural
Cdigo Color (XURVP
51.05.00.0
51.05.10.0
42,50
26,50
Cdigo Color (XURV
51.05.20.0 13,50
Cdigo Color L mm (XURV
96.07.45.0
96.07.46.0
75
300
35,00
52,00
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
96.06.01.0 1,50
max. 3 m
51.05.10.0
51.05.00.0
7DSDQDO
End cover
(PERXWQDO
Cdigo Color (XURV
51.06.40.0 4,00
L
300 mm
2 unit/ref.
2 unit/ref.
2 unit/ref.
50W 12V
Unin "T"
"T" joint
Union "T"
Unin "cruz"
"Cross" joint
Union "croix"
Cdigo Color (XURV
51.05.21.0 19,50
Cdigo Color (XURV
51.05.22.0 33,50
Rtula
Ball joint
Rotule
Soporte pared con tapa incorporada
Wall supports with cover included
Support mural avec couvercle incorpor
Cdigo Color (XURV
96.06.04.0 58,00
Cdigo Color (XURV
51.04.77.0 31,00
Tapa unin a rtula
Cover ball joint
(PERXWQDOURWXOH
Anclaje para poder orientar la luminaria a
8 posiciones de 45
Anchoring to enable the position of the
luminaire to 8 positions at 45
Ancrage pour pouvoir orienter la luminaire
8 positions de 45
Tapa con proyector AVANT
Cover with projector AVANT
Couvercle avec projecteur AVANT
Cdigo Color (XURV
51.06.41.0 28,50
Cdigo Color (XURV
51.05.26.0 7,00
Cdigo Color (XURV
51.07.03.0 178,50
QR-CBC51
GU 5,3
Electronic
Final End Fin
mx. 9 unit. / mn. 40
Cdigo Color (XURV
51.07.41.0 30,00
Intermedia Intermediate part Intermdiaire
143 mm
Suspensiones (p.118)
Suspensions (p.118)
Suspensions (p.118)
1 unit/ref.
108
(VWUXFWXUDV
BCN CANAL
Luminaria TOULOUSE
TOULOUSE luminaire
Luminaire TOULOUSE
Luminaria BCN
BCN luminaire
Luminaire BCN
200 mm
168 mm
109
(VWUXFWXUDV
BCN CANAL
Accesorios generales
General accessories
Accessoires gnraux
Cdigo Color (XURV
62.07.55.0 12,50
Adaptador suspensin doble cable
Two braided suspension adaptor
Adaptateur suspension deux cbles
-XHJRGHMDFLRQHVSDUDXQLyQ
6HWRI[LQJVSHUMRLQW
-HXGH[DWLRQVSRXUXQLRQ
Cdigo (XURV
96.06.01.0 1,50
Cdigo Color (XURV
62.07.56.0 11,00
Suspensin basculante
Adjustable suspension
Suspension basculant
Cdigo Color (XURV
62.07.51.0 18,00
Suspensin extraplana
([WUDDWVXVSHQVLRQ
Suspension extra plate
Unin derivacin intermedia
Intermediate short-circuit joint
Union drivation intermdiaire
Cdigo Color (XURV
62.05.26.0 175,50
8QLyQGHULYDFLyQQDO
End conection joint
Union drivation finale
Cdigo Color (XURV
62.05.25.0 160,00
Cdigo Color (XURV
62.05.13.0 100,50
3HUOSDUDHPHUJHQFLDLQWHUPHGLD
3UROHIRUHPHUJHQF\XQLW
3UROSRXUEORFVHFRXUVLQWHUPHGLDLUH
Cdigo Color (XURV
62.06.02.0
62.06.03.0
62.06.04.0
492,50
502,50
500,00
85-105
105-125
125-180
Rtula horizontal
Horizontal ball joint
Rotule horizontale
Unin "T"
"T" joint
Union "T"
Cdigo Color (XURV
62.05.21.0 79,00
Unin codo 90
90 elbow joint
Union coude 90
Cdigo Color (XURV
62.05.20.0 57,00
Cdigo Color (XURV
62.06.01.0 431,50
Rtula vertical
Vertical ball joint
Rotule verticale
Cdigo Color (XURV
62.05.11.0 28,50
Tapa lateral para caja de
conexiones
Side cover for connection box
Couvercle latral pour modules
de connexions
Cdigo Color (XURV
62.05.12.0 29,50
Tapa lateral para acoplar emergencia
y caja de conexiones
Side cover for emergency and
connection box
Couvercle latral pour blocs secours
et modules de connexions
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg mm
1x18
1x36
2 (1x36)
2x18
2x36
2 (2x36)
62.41.03.0
62.41.04.0
62.41.05.0
62.42.03.0
62.42.04.0
62.42.05.0
225,50
311,00
546,50
226,00
311,50
590,50
4
7
13,5
4
8
15
650
1250
2500
650
1250
2500
Luminaria BCN con celosa de lamas (Lnea Continua)
BCN luminaire with louvre diffuser (Continuous Line)
Luminaire BCN avec diffuseur lames (Ligne Continue)
IP
20
CLASE
I
960
Al
T8/T26
G13
3HUO
3UROH
3URO
*Tapa lateral no incluida
*Side cover not included
*Embout latral not inclus
Cdigo Color (XURV
62.05.00.0 139,00
Tapa lateral
Side cover
Capot latral
Cdigo Color (XURVPO
62.05.10.0 22,00
SHUO
SHUO
SUROH
7DSDQDO
End cover
(PERXWQDO
Cdigo Color (XURV
62.06.40.0 6,50
110
(VWUXFWXUDV
Blanco mate
Matt white
Blanc mat
IP
20
960
CLASE
I
T8/T26
G13
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg L mm
2x18
2x36
2x58
78.02.30.0
78.02.31.0
78.02.32.0
78,50
94,00
122,00
3,9
5,2
5,9
662
1225
1538
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L mm
2x18
2x36
2x58
78.42.30.0
78.42.31.0
78.42.32.0
115,00
124,00
145,00
3,2
4,2
4,9
662
1225
1538
Luminaria EXTRAPLANA con ptica V-Brillante
EXTRAPLANA luminaire with V-Bright louvre
Luminaire EXTRAPLANA avec optique v-brillant
EXTRAPLANA T8
Suspensin electromecnica regulable en "Y"
Electromechanical suspension height-adjustable in "Y"
Suspension electromecnique en acier rglable en "Y"
Cdigo Color h(m) (XURV
96.28.63.0
96.28.63.3
max.3
max.3
50,00
50,00
Cable de acero regulable en "Y"
Steel cable height-adjustable in "Y"
Cble en acier rglable en "Y"
Cdigo Color h(m) (XURV
96.08.63.3 max.3 16,00
Suspensiones y accesorios T8
Suspensions and accessories T8
Suspensions et accessoires T8
Dos cables acero trenzado
Two braided steel cables
Deux cbles acier tress
Cdigo Color h(m) (XURV
96.07.49.0
96.07.49.3
max. 3
max. 3
19,50
19,50
1 unit/ref
Unin para pasar cables
Joint for passing cables through
Union pour passer les cbles
Cdigo Color (XURV
96.07.81.0 2,50
111
(VWUXFWXUDV
EXTRAPLANA T5
Luminaria EXTRAPLANA asimtrica
Asymmetric EXTRAPLANA luminaire
Luminaire EXTRAPLANA Asymtrique
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg L mm
1x28/54
1x35/49/80
78.41.05.0
78.41.06.0
78.41.05.2
78.41.06.2
120,00
123,00
3,5
4,1
1254
1554
NEW
Blanco mate
Matt white
Blanc mat
Negro mate
Matt black
Noir mat
IP
20
960
CLASE
I
T5/T16
G5
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg L mm
2x14/24
2x28/54
2x35/49/80
78.42.02.0
78.42.03.0
78.42.04.0
78.42.02.2
78.42.03.2
78.42.04.2
102,00
119,50
122,50
2,4
3,5
4,1
654
1254
1554
Luminaria EXTRAPLANA
EXTRAPLANA luminaire
Luminaire EXTRAPLANA
Luminaria EXTRAPLANA con ptica de alto confort visual
EXTRAPLANA luminaire with high visual comfort optics
Luminaire EXTRAPLANA avec optique haut confort visuel
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color Cdigo Color (XURV Kg L mm
2x28/54
2x35/49/80
78.42.00.0
78.42.01.0
78.42.00.2
78.42.01.2
168,00
180,00
3,5
4,1
1254
1554
177 mm
55
177 mm
55
177 mm
55
Suspensin electromecnica regulable en "Y"
Electromechanical suspension height-adjustable in "Y"
Suspension electromecnique en acier rglable en "Y"
Cdigo Color h(m) (XURV
96.28.63.0
96.28.63.3
max.3
max.3
50,00
50,00
Cable de acero regulable en "Y"
Steel cable height-adjustable in "Y"
Cble en acier rglable en "Y"
Cdigo Color h(m) (XURV
96.08.63.3 max.3 16,00
Suspensiones y accesorios T5
Suspensions and accessories T5
Suspensions et accessoires T5
Dos cables acero trenzado
Two braided steel cables
Deux cbles acier tress
Cdigo Color h(m) (XURV
96.07.49.0
96.07.49.3
max. 3
max. 3
19,50
19,50
1 unit/ref
Piezas unin luminarias lnea
contnua incluidas
Joining pieces for continous line
luminaires included
3LqFHVGXQLRQSDUOXPLQDLUHVOLJQH
continue inclus
112
(VWUXFWXUDV
Anclaje A 1 unit/ref.
Cdigo (XURV
48.05.96.3 26,50
Anclaje B 1 unit/ref.
Cdigo (XURV
48.05.93.3 26,50
MINI DUELAMP
Anclaje MINI DUELAMP para acoplar luminarias
MINI DUELAMP anchorage point for structures
Fixation MINI DUELAMP pour structures
Conjunto de downlight para MINI DUELAMP con sistema cardan
Combination with downlight for MINI DUELAMP with cardan system
Ensemble de Downlight pour MINI DUELAMP avec systme cardan
W Cdigo Color (XURV
max.100
35/70
35/70
48.09.36.3
48.09.37.3
48.09.38.3
63,00
98,00
89,00
QR-111
G 53
HI-PAR30
E27
CDM-R111
GX 8,5
CLASE
I
CLASE
I
BASIC
*
TRIPLEX
*
FIL
Pag.74 Pag.104 Pag.110
Pag.80
FILMED
COLOR STANDARD:
BLANCO
WHITE
BLANC
*
360 mm
IP
20
960
35
35
35
35
Gris oscuro satinado
Satin dark gray
Gris fonc satin
113
(VWUXFWXUDV
MINI DUELAMP
Conjunto MINI DUELAMP con 2 downlights RING orientables
MINI DUELAMP combination with two adjustable RING downlights
Ensemble MINI DUELAMP avec de 2 downlights RING orientables
Conjunto MINIDUELAMP con 2 downlight sistema cardan.
MINI DUELAMP combination with 2 downlight cardan system
Ensemble MINI DUELAMP avec 2 downlights systme cardan.
Conjunto MINI DUELAMP con 2 downlights QR-70 orientables con rotacin
MINI DUELAMP combination with two adjustable QR-70 downlights with rotation
Combination MINI DUELAMP ensemble de 2 downlights QR-70 orientables avec
rotation
Conjunto MINI DUELAMP con proyector VISSIO
MINI DUELAMP combination with VISSIO projector
Ensemble MINI DUELAMP avec projecteur VISSIO
Conjunto MINI DUELAMP con proyector VISSIO
MINI DUELAMP combination with VISSIO projector
Ensemble MINI DUELAMP avec projecteur VISSIO
W Cdigo Color (XURV
2x35/70 48.09.39.3 144,50
W Cdigo Color (XURV
2x50 48.09.30.3 53,50
W Cdigo Color (XURV
2x50 48.09.40.3 85,00
W Cdigo Color (XURV
70/150
70/150
35/100
63.08.50.3
63.08.52.3
63.08.56.3
182,00
182,00
129,00
W Cdigo Color (XURV
70
75
35/70
35/70
35/100
63.08.53.3
63.08.55.3
63.08.61.3
63.08.62.3
63.08.63.3
131,50
145,00
170,50
170,50
173,00

25-40
HI-PAR30
E27

10- 25
GLASS
GLASS
GLASS
HIT
G12
HIT
G12

10- 25

25-40
QT 12
GY6,35
HIT-TC
G8,5
HIT-TC
G8,5
CLASE
I
CLASE
I
CLASE
I
CLASE
I
CLASE
I
CLASE
I
GLASS
GLASS
PAR30
E27
QR-111
G 53
OSRAM
Equipos para conjuntos (pag. 155)
Control gear for combinations (pag. 155)
quipements pour ensamble (pag. 155)
600 mm
330 mm
182 mm
147 mm
330 mm
330 mm
330 mm
IP
20
960
35
35
35
35
CDM-R111
GX 8,5
IP
20
960
45 355 QR-CBC51
GU 5,3
IP
20
960
30 355
QR-70
OSRAM
BA15d
IP
20
850
355 30
IP
20
850
30 355
114
(VWUXFWXUDV
DUELAMP
Anclaje A 1 unit/ref.
Cdigo (XURV
48.06.07.3 35,00
Anclaje DUELAMP para acoplar luminarias
DUELAMP anchorage point for structures
Fixation DUELAMP pour structures
Pag.110 Pag.112 Pag.108
Pag.126 Pag.104 Pag.106
BASIC
*
LAMPTUB
*
COLOR STANDARD:
BLANCO
WHITE
BLANC
*
TRIPLEX
*
EXTRAPLANA
*
DINAMIC
LINIA CONTINUA
OVAL
*
&RQMXQWR'8(/$03FRQGRZQOLJKWGHSROLFDUERQDWRXRUHVFHQFLDFRPSDFWD
'8(/$03FRPELQDWLRQZLWKSRO\FDUERQDWHGRZQOLJKWFRPSDFWXRUHVFHQW
0RGXOH'8(/$03DYHF'RZQOLJKWHQ3RO\FDUERQDWHXRUHVFHQFHFRPSDFWH
W Cdigo Color (XURV X Y
2x18
2x26
2x18
2x26
48.06.10.3
48.06.11.3
48.06.12.3
48.06.13.3
129,50
129,50
134,00
134,00
500
500
500
500
150
150
150
150
GLASS
5HHFWRUPHWDOL]DGR
0HWDOOL]HGUHHFWRU
5pHFWHXU0pWDOOLVp
Difusor opalizado
Opal diffuser
Diffuseur en verre opalis
IP
20
CLASE
I
850
TC-D
G24
Gris oscuro satinado
Satin dark gray
Gris fonc satin
115
(VWUXFWXUDV
DUELAMP
Conjunto DUELAMP con downlight rectangular basculante
DUELAMP combination with adjustable rectangular dowlight
Module DUELAMP avec downlight rectangulaire basculant
Conjunto DUELAMP con downlight con sistema cardan
DUELAMP combination with downlight with cardan system
Module DUELAMP avec downlight systme cardan
Conjunto DUELAMP con downlight ORBIT basculante circular
DUELAMP combination with adjustable circular downlight ORBIT
Module DUELAMP avec downlight ORBIT basculant circulaire
Conjunto DUELAMP con 2 downlights de bajo voltaje orientables con rotacin 355
DUELAMP combination with two adjustable low-voltage downlights with 355 rotation
Ensemble DUELAMP de deux Downlights TBT orientables, rotation 355
W Cdigo Color (XURV X Y
70
150
48.06.16.3
48.06.17.3
110,00
110,00
500
500
150
150
W Cdigo Color (XURV X Y
50/100
35/70
48.06.19.3
48.06.22.3
92,50
143,00
350
350
150
150
W Cdigo Color (XURV X Y
35/70 48.06.28.3 132,50 350 170
W Cdigo Color (XURV X Y
2x50 48.06.20.3 74,00 350 150
QR-111
G 53
CDM-R111
GX 8,5
IP
20
CLASE
I
GLASS
960
HIT-DE
RX7s
60
HST-DE
RX7s
IP
20
CLASE
I
960
35
35
35
35
IP
20
CLASE
I
GLASS
960

Wide
Flood 40 355 HIT-TC
G8,5
IP
20
CLASE
I
960
355 45 QR-CBC51
GU 5,3
Equipos para conjuntos (pag. 155)
Control gear for combinations (pag. 155)
quipements pour ensamble (pag. 155)
116
(VWUXFWXUDV
MINIDUELAMP / DUELAMP
$FFHVRULRV'8(/$030,1,'8(/$03SDUDIRUPDUJXUDVSODQDV
'8(/$030,1,'8(/$03DFFHVVRULHVIRUFUHDWLQJDWJXUHV
Accessoires DUELAMP/MINIDUELAMP pour raliser des figures planes
Suspensiones
Suspensions
Suspensions
Barras de base
Base bars
Barres de base
7DSDQDOGHODVEDUUDV
End cover for bars
Embout des barres
Tapa unin a rtula
Cover ball joint
(PERXWQDOURWXOH
Mx. 4 tapas/rtula/75
Mx. 4 cover ball joint/ball joint/75
0i[HPERXWQDOURWXOHURWXOH
Mx. 5 tapas/rtula/90
Mx. 5 cover ball joint/ball joint/90
0i[HPERXWQDOURWXOHURWXOH
2 unit./ref
1 unit./ref
2 unit./ref 1 unit./ref
Unin entre barras incluidas
Bar joints included
Raccord barres inclues
Unin codo 90
90 elbow joint
Union coude 90
Puentes intermedios
Support bars parallel
Ponts intermdiaires
Cable de acero regulable en Y
Steel cable height adjustable in Y
Suspension cble en acier rglable en Y
Suspensin electromecnica regulable en Y
Electromechanical suspension height-
adjustable in Y
Suspension lectromecanique en acier
rglable en Y
Unin entre barras
Bar joint
Raccord barres
Anclaje para suspensin
Suspension anchorage point
Fixation pour suspension
Dos cables acero trenzado
Two braided steel cables
Deux cbles acier tress
Suspensin electromecnica dos cables acero
Electromechanical suspension of two braided steel cables
Suspension lectromecanique deux cables acier tress rglable
Rtula
Ball joint
Rotule
mm Cdigo Color (XURV
1000
2000
3000
48.05.00.3
48.05.01.3
48.05.02.3
24,50
47,00
70,50
Cdigo Color (XURV
48.06.01.3 11,00
Cdigo Color (XURV
48.06.02.3 49,00
Cdigo Color (XURV
48.05.21.3 35,00
Cdigo Color (XURV
48.06.05.3 11,50
Cdigo Color (XURV h(m)
96.08.66.3 15,00 max. 3
Cdigo Color (XURV h(m)
96.28.66.0
96.28.66.3
38,00
38,00
max. 3
max. 3
Cdigo Color (XURV
48.05.98.3 11,50
Cdigo Color (XURV
48.05.99.3 43,50
Cdigo Color (XURV
48.05.20.3 30,00
Cdigo Color (XURV
48.06.23.3 9,50
Cdigo Color (XURV h(m)
96.08.60.3 15,00 max. 3
Cdigo Color (XURV h(m)
96.28.60.0
96.28.60.3
38,50
38,50
max. 3
max. 3
Cdigo Color (XURV
48.06.04.3 2,50
Cdigo (XURV
48.06.09.3 2,00
Cdigo Color (XURV h(m)
96.07.49.0
96.07.49.3
19,50
19,50
max. 3
max. 3
Cdigo Color (XURV h(m)
96.27.49.0
96.27.49.3
74,00
74,00
max. 3
max. 3
Cdigo Color (XURV
96.06.04.3 58,00
'XHODPS
'XHODPS
'XHODPS
'XHODPS
'XHODPS
'XHODPS
0LQL'XHODPS
0LQL'XHODPS
0LQL'XHODPS
0LQL'XHODPS
0LQLGXHODPS)LOER[)ODW
0LQL'XHODPS)LO%R[)ODW
117
(VWUXFWXUDV
118
(VWUXFWXUDV
SUSPENSIONES
TRIPLEX, FIL, FIL+, FILMED, FILBOX, OVAL, BASIC, TUB (1 unit/ref.) Suspensiones para:
Suspensions for:
Suspensions pour:
Cdigo Color (XURV
96.21.00.0
96.21.00.3
14,50
14,50
Cdigo Color (XURV
96.08.59.0 6,50
Cdigo Color (XURV
96.07.61.0
96.07.61.3
7,50
6,50
Cdigo Color (XURV
96.08.64.0
96.08.64.3
96.58.64.0
96.58.64.3
37,00
37,00
39,00
39,00
Cdigo Color h(mm) (XURV
96.21.21.0
96.21.21.3
96.21.24.0
96.21.24.3
1000
1000
4000
4000
22,00
22,00
42,00
42,00
Cdigo Color h(mm) (XURV
96.21.31.0
96.21.31.3
96.21.34.0
96.21.34.3
1000
1000
4000
4000
26,50
26,50
48,50
48,50
Cdigo Color h(mm) (XURV
96.21.01.0
96.21.01.3
96.21.02.0
96.21.02.3
96.21.05.0
96.21.05.3
96.21.10.0
96.21.10.3
100
100
250
250
500
500
1000
1000
12,50
12,50
16,00
16,00
17,50
17,50
20,50
20,50
Cdigo Color h(mm) (XURV
96.07.51.0
96.07.54.0
96.07.51.3
96.07.54.3
1000
4000
1000
4000
7,50
11,50
7,00
11,00
Cdigo Color h(mm) (XURV
96.01.31.3
96.01.34.3
1000
4000
15,50
17,00
Cdigo Color h(mm) (XURV
96.01.01.0
96.01.02.0
96.01.05.0
96.01.10.0
100
250
500
1000
12,00
15,00
15,00
17,50
Fijacin directa decorativa para conexin elctrica
Decorative direct suspension or electrical connection
Fixation decorative directe pour connexion lectrique
Accesorio para unir suspensiones rgidas
Coupler for 2 rigid suspensions
Accesoire pour joindre 2 suspensions rigides
Anclaje desde el extremo Side bracket $QFUDJHGHVSDUOH[WUpPLWp
Anclaje rpido Quick bracket Ancrage rapide
Anclaje desde el extremo Side bracket $QFUDJHGHVSDUOH[WUpPLWp
Anclaje rpido Quick bracket Ancrage rapide
Fijacin directa
'LUHFW[LQJ
Fixation directe
Florn decorativo para conexin elctrica
Decorative ceiling rose for electrical connection
Fleuron dcoratif pour connexion lectrique
&DEOHGHDFHUR[UHJXODEOHSDUD
conexin electromecnica
6WHHOFDEOH[KHLJKWDGMXVWDEOHIRU
electromechanical connection
6XVSHQVLyQUpJODEOH[SRXUFRQQH[LRQ
lectromecanique
&DEOHGHDFHUR[UHJXODEOHSDUD
conexin electromecnica
6WHHOFDEOH[KHLJKWDGMXVWDEOHIRU
electromechanical connection
6XVSHQVLyQUpJODEOH[SRXUFRQQH[LRQ
lectromecanique
Suspensin rgida para conexin elctrica
Rigid suspension for electrical connection
Suspensin rigide pour connexion lectrique
Cable de acero regulable
Height-adjustable steel cable suspension
Cble en acier rglable
Cable de acero regulable
Height-adjustable steel cable suspension
Cble en acier rglable
Suspensin rgida
Rigid suspension
Suspensin rigide
Cable transp. 4m
(3x1,5mm) incluido
Cable transp. 4m
(5x1,5mm) incluido.
Para regulacin.
30
43 43
119
(VWUXFWXUDV
SUSPENSIONES / SOPORTES A PARED
Suspensiones para:
Suspensions for:
Suspensions pour:
Cable de acero regulable en Y
Steel cable height adjustable in Y
Suspension cble en acier rglable en Y
Suspensin electromecnica regulable en Y
Electromechanical suspension height-adjustable in Y
Suspension lectromecanique en acier rglable en Y
Dos cables acero trenzado
Two braided steel cables
Deux cbles acier tress
Suspensin electromecnica de dos cables acero
Electromechanical suspension of two braided steel cables
Suspension lectromecanique deux cables acier tress rglable
Cdigo Color (XURV h(m)
96.08.63.3
96.08.66.3
96.08.60.3
16,00
15,00
15,00
max. 3
max. 3
max. 3
Cdigo Color (XURV h(m)
96.28.67.0
96.28.63.3
96.28.63.0
96.28.66.3
96.28.66.0
96.28.60.3
96.28.60.0
70,50
50,00
50,00
38,00
38,00
38,50
38,50
max. 3
max. 3
max. 3
max. 3
max. 3
max. 3
max. 3
Cdigo Color (XURV h(m)
96.07.49.0
96.07.49.3
19,50
19,50
max. 3
max. 3
Cdigo Color (XURV h(m)
96.27.49.0
96.27.49.3
74,00
74,00
max. 3
max. 3
75 cm Unin soporte corto pared
Short wall bracket
Support court mural
Unin soporte largo pared
Long wall bracked
Support long mural
Cdigo Color (XURV
96.07.45.0
96.07.45.3
35,00
35,00
Cdigo Color (XURV
96.07.46.0
96.07.46.3
52,00
52,00
2 unit/ref.
2 unit/ref.
Soporte pared orientable
Wall support adjustable
Support mural orientable
Soporte pared orientable y extensible
Wall support adjustable and extensible
Support mural orientable et extensible
Cdigo Color (XURV
96.00.06.0
96.00.06.3
60,50
60,50
Cdigo Color (XURV
96.00.05.0
96.00.05.3
119,50
119,50
2 unit/ref. 2 unit/ref.
PUZZLE AIR, MINIDUELAMP, DUELAMP, FLAT, FILMED, FILBOX, FINELAMP, EXTRAPLANA, MULTISPACE (1 unit/ref.)
(5x1,5mm)
(3x1,5mm)
(3x1,5mm)
(3x1,5mm)
(3x1,5mm)
(3x1,5mm)
(3x1,5mm)
3X]]OH$LU)LOPHG)LQHODPS([WUDSODQD
0XOWLVSDFH
'XHODPS
0LQL'XHODPS)LO%R[)ODW
3X]]OH$LU)LOPHG)LQHODPS([WUDSODQD0XOWLVSDFH
'XHODPS
0LQLGXHODPS)LO%R[)ODW
Soportes a pared:
Wall supports:
Supports mural:
FIL, FIL+, FILMED, TRIPLEX, OVAL, BASIC, LAMPTUB, STEP, TUB
13 cm
min. 30cm
max. 40cm
300 mm
Blanco brillo
Shiny white
Blanc brillant
120
(VWUXFWXUDV
STYLAMP
ABS 650
CLASE
I
IP
20
Luminaria STYLAMP superfcie con ptica V-Brillo
Surface mounted STYLAMP luminaire with V-Bright louvre
Luminaire STYLAMP saillie grille parabolique V-brillant
T8/T26
G13
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
2x36
2x58
4x18
4x36
83.03.24.0
83.03.25.0
83.03.42.0
83.03.58.0
115,00
166,50
119,00
162,50
5,7
6,0
5,4
5,8
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L x A x H mm
2x36
2x58
4x18
4x36
83.43.24.0
83.43.25.0
83.43.42.0
83.43.58.0
133,00
168,50
154,50
209,50
3,3
4,2
4,7
4,9
1260 x 352 x 100
1610 x 352 x 100
652 x 652 x 100
1260 x 652 x 100
36
36
36
18
H
L
A
ABS 650
CLASE
I
IP
20
Luminaria STYLAMP superfcie con ptica de alto confort visual
Surface mounted STYLAMP luminaire with high visual comfort optics
Luminaire STYLAMP saillie avec optique haut confort visuel
T8/T26
G13
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
2x36
2x58
4x18
4x36
83.03.27.0
83.03.28.0
83.03.43.0
83.03.60.0
163,00
206,50
148,50
265,00
5,7
6,0
5,4
5,8
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L x A x H mm
2x36
2x58
4x18
4x36
83.43.27.0
83.43.28.0
83.43.43.0
83.43.60.0
173,00
216,00
189,00
295,50
3,3
4,2
4,7
4,9
1260 x 352 x 100
1610 x 352 x 100
652 x 652 x 100
1260 x 652 x 100
36
36
36
18
H
L
A
121
(VWUXFWXUDV
122
/XPLQDULDV(PSRWUDEOHV
MODULAR SLIM
T5/T16
G5
960
CLASE
I
IP
20
Luminaria MODULAR SLIM con ptica de alto confort visual
Luminaire MODULAR SLIM with high visual comfort optics
Luminaire MODULAR SLIM avec optique haut confort visuel
Sistema de anclaje para techos 3, 4, 5 y 6 (pag.127)
Adjustable ceiling support brackets for 3, 4, 5 and 6 (pag. 127)
6\VWqPHGDQFUDJHSODIRQG\SDJ
4 unidades por referencia, no incluidas en la luminaria
One reference includes 4 pieces, requested for each luminaire
4 units per reference, non included on the luminaire
Cdigo Color (XURV
65.07.41.0 8,00
Accesorios
Accessories
Accessoires
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L x A x H mm
2x28/54
3x14/24
4x14/24
65.42.60.0
65.43.60.0
65.44.60.0
147,50
146,00
147,50
5,0
5,0
5,0
1197 x 298 x 60
598 x 598 x 60
598 x 598 x 60
42
42
42
123
/XPLQDULDV(PSRWUDEOHV
Luminaria MODULAR con ptica V-Brillante
Luminaire MODULAR with V-Bright louvre
Luminaire MODULAR avec optique V-Brillant
Luminaria MODULAR con ptica V-Blanca
Luminaire MODULAR with V-White louvre
Luminaire MODULR avec optique V-Blanc
Luminaria MODULAR con ptica de alto confort visual
Luminaire MODULAR with high visual comfort optics
Luminaire MODULAR avec optique haut confort visuel
T8/T26
G13
TC-L
2 G 11
TC-L
2 G 11
TC-L
2 G 11
960
CLASE
I
IP
20
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
2x36
3x18
3x36
4x18
4x36
3x36
65.02.00.0
65.03.00.0
65.03.01.0
65.04.00.0
65.04.01.0
65.03.02.0
89,50
83,00
162,50
82,50
140,00
97,00
5,0
5,0
8,6
5,8
9,3
8,6
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
2x36
3x18
3x36
4x18
4x36
3x36
65.02.10.0
65.03.10.0
65.03.11.0
65.04.10.0
65.04.11.0
65.03.12.0
94,50
86,00
164,50
88,00
150,50
100,50
5,0
5,0
8,6
5,8
8,9
8,6
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
2x36
3x18
3x36
4x18
4x36
3x36
65.02.20.0
65.03.20.0
65.03.21.0
65.04.20.0
65.04.21.0
65.03.22.0
133,00
120,50
232,50
128,00
224,50
147,00
5,2
5,2
8,8
6,0
9,1
8,8
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L x A x H mm
2x36
3x18
3x36
4x18
4x36
3x36
65.42.00.0
65.43.00.0
65.43.01.0
65.44.00.0
65.44.01.0
65.43.02.0
100,00
106,50
180,50
112,00
170,00
146,50
4,3
4,3
7,5
5,1
7,8
7,5
1196 x 296 x 91
596 x 596 x 91
1196 x 596 x 91
596 x 596 x 91
1196 x 596 x 91
596 x 596 x 91
36
36
18
36
18
36
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L x A x H mm
2x36
3x18
3x36
4x18
4x36
3x36
65.42.10.0
65.43.10.0
65.43.11.0
65.44.10.0
65.44.11.0
65.43.12.0
104,00
110,00
185,50
115,00
177,00
150,50
4,7
4,7
8,3
5,5
8,6
8,3
1196 x 296 x 91
596 x 596 x 91
1196 x 596 x 91
596 x 596 x 91
1196 x 596 x 91
596 x 596 x 91
36
36
18
36
18
36
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L x A x H mm
2x36
3x18
3x36
4x18
4x36
3x36
65.42.20.0
65.43.20.0
65.43.21.0
65.44.20.0
65.44.21.0
65.43.22.0
145,00
133,00
232,00
143,50
229,00
178,00
4,9
4,9
8,5
5,7
8,8
8,5
1196 x 296 x 91
596 x 596 x 91
1196 x 596 x 91
596 x 596 x 91
1196 x 596 x 91
596 x 596 x 91
36
36
18
36
18
36
Sistema de anclaje para techos p.124
Adjustable ceiling support brackets p.124
6\VWqPHGDQFUDJHS
MODULAR
124
/XPLQDULDV(PSRWUDEOHV
MODULAR L.C.
T8/T26
G13
T8/T26
G13
T5/T16
G5
960
CLASE
I
IP
20
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L x A x H mm
2x28/54
2x35/49/80
65.42.61.0
65.42.62.0
162,00
182,00
2,8
2,8
1189 x 147 x 98
1490 x 147 x 98
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L x A x H mm
2x36
2x58
65.42.21.0
65.42.22.0
136,50
147,50
2,9
2,9
1243 x 147 x 98
1543 x 147 x 98
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg L x A x H mm
2x36
2x58
65.02.21.0
65.02.22.0
113,50
135,50
3,7
4,3
1243 x 147 x 98
1543 x 147 x 98
MODULAR L.C. con ptica de alto confort visual
MODULAR L.C. with high visual comfort optics
MODULAR L.C. avec optique haut confort visuel
7DSDQDO
End cover
(PERXWQDO
Sistema de anclaje para techos 3, 4, 5 y 6 (pag.127)
Adjustable ceiling support brackets for 3, 4, 5 and 6 (pag.127)
6\VWqPHGDQFUDJHSODIRQG\SDJ
4 unidades por referencia, no incluidas en la luminaria
One reference includes 4 pieces, requested for each luminaire.
4 units per reference, non included on the luminaire
Fijacin intermedia
Intermediate joint
Union intermdiaire
Cdigo Color (XURV
65.06.40.0 11,00
Cdigo Color (XURV
65.07.40.0 4,00
Cdigo (XURV
65.07.42.0 2,00
Accesorios
Accessories
Accessoires
98
147 mm
130
125
/XPLQDULDV(PSRWUDEOHV
MODULAR INDIRECTA
TC-L
2 G 11
TC-L
2 G 11
TC-L
2 G 11
960
960
CLASE
I
CLASE
I
IP
20
IP
20
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg L x A x H mm
2x36 65.02.74.0 138,50 6,1 596 x 596 x 104 36
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L x A x H mm
2x55 65.42.72.0 195,50 5,8 596 x 596 x 104 36
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L x A x H mm
2x36
2x55
4x55
65.42.74.0
65.42.70.0
65.44.70.0
152,50
152,50
330,00
5,8
5,8
9,0
596 x 596 x 104
596 x 596 x 104
1196 x 596 x 104
36
36
18
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L x A x H mm
2x28/54 65.42.73.0 298,00 5,8 1196 x 596 x 104 18
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L x A x H mm
2x28/54 65.42.71.0 260,00 8,6 1196 x 596 x 104 18
Luminaria MODULAR INDIRECTA de radiacin indirecta
MODULAR INDIRECT indirect lighting luminaire
Luminaire MODULAR INDIRECT clairage indirect
Luminaria MODULAR INDIRECTA directa-indirecta
con celosa doble parablica
MODULAR INDIRECT direct-indirect lighting luminaire
with double parabolic louvre
Luminaire MODULAR INDIRECT clairage direct-indirect
avec grille double parabole
Sistema de anclaje para techos p.124
Adjustable ceiling support brackets p.124
6\VWqPHGDQFUDJHS
T5/T16
G5
T5/T16
G5
126
/XPLQDULDV(PSRWUDEOHV
MODULAR TECH
T5/T16
G5
960
CLASE
I
IP
20
MODULAR TECH con ptica de alto confort visual
MODULAR TECH luminaire with high visual confort optics
MODULAR TECH avec optique haut confort visuel
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L x A x H mm
2x14/24
2x28/54
65.42.81.0
65.42.82.0
186,50
225,00
2,6
3,6
597 x 297 x 125
1197 x 297 x 125
60
30
Sistema de anclaje para techos p.124
Adjustable ceiling support brackets p.124
6\VWqPHGDQFUDJHS
127
/XPLQDULDV(PSRWUDEOHV
MODULAR ASIMETRICA
T5/T16
G5
960
CLASE
I
IP
20
TC-L
2 G 11
Luminaria MODULAR ASIMTRICA
Luminaire MODULAR ASIMETRICA
Luminaire MODULAR ASYMTRIQUE
Posibles techos de aplicacin de la luminaria
Typical ceiling types for this luminaire
Type de plafond pouvant recevoir ce luminaire
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L x A x H mm
1x14/24
1x28/54
65.41.11.0
65.41.12.0
101,50
124,50
2,2
2,8
596 x 147 x 60
1196 x 147 x 60
140
70
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L x A x H mm
1x55 65.41.13.0 118,00 2,8 596 x 297 x 91 72
Sistema de anclaje para techos p.122
Adjustable ceiling support brackets p.122
6\VWqPHGDQFUDJHDXSODIRQGS
5HHFWRUGHDOXPLQLR
$OXPLQLXPUHHFWRU
5pHFWHXUHQDOXPLQLXP
5HHFWRUODFDGRHQFRORUEODQFR
&RDWHGUHHFWRULQZKLWHFRORU
5pHFWHXUODTXpHFRXOHXUEODQF
1 2 3 4 5 6 7
3HUOHUtDYLVWD
Exposed T Lay-in
3UROYLVLEOH
3HUOHUtDSDUDWHFKRGH
placas metlicas
Snap T with
adjustable side supports
3UROSRXUSODIRQGHQ
plaque mtallique
Montaje suspendido para
techos de lamas o especiales
Open Cell or Special ceilings
with suspension assemblies
Montage suspendu pour
plafond lame ou spciale
3HUOHUtD7RFXOWDWHFKR
no desmontable
Concealed T with
adjustable side supports
3UROHQ7IHUPpSODIRQG
non dmontable
Techo de yeso, luminaria
semi-empotrada
Plaster ceiling with adjustable
side supports
Plafond pltre,
luminaire semi-encastr
3HUOHUtDYLVWDOXPLQDULD
semi-empotrada
Exposed T with adjustable
side supports
3UROYLVLEOHOXPLQDLUH
semi-encastr
3HUOHUtDYLVWDSODFDVHPL
empotrada
Exposed T Lay-in with
regressed tile
3UROYLVLEOHSODTXHVHPL
encastre
128
6LVWHPDV6DQLWDULRV
CLINIC
Cabezal CLINIC personalizada para iluminacin directa y/o indirecta con mecanismos opcionales
Personalized CLINIC head light luminaire for direct and/or indirect light with optional mechanisms
Tte de lit CLINIC personnalise direct et/ou indirect avec mcanismes optionnels.
El cabezal CLINIC para personalizar tiene un
cuerpo de extrusin de aluminio lacado en
color blanco mate texturizado. Posibilidad de
iluminacin directa y/o indirecta con lmparas
XRUHVFHQWHV 7 +2 3UHSDUDGD SDUD DORMDU
hasta 4 mecanismos opcionales.

Para personalizar el cabezal CLINIC deben
seguirse las siguientes indicaciones:
1- Elegir la longitud del cabezal a personalizar:
85.03.02.0 de 1270 mm
85.03.03.0 de 1860 mm
2- Escoger la iluminacin directa.
3- Escoger la iluminacin indirecta.
4- Indicar los mecanismos opcionales
que se Se debe indicar qu mecanismo
va en cada una de las 4 posiciones A,
B, C y D. La luminaria se servir con los
mecanismos montados en dos placas
dobles embellecedoras. Si se necesitan ms
mecanismos, se pueden realizar longitudes
especiales.
The customised CLINIC lamp has an extruded
DOXPLQLXP ERG\ QLVKHG LQ WH[WXUHG PDWW
white. Lighting can be direct/or indirect using
XRUHVFHQW7+2ODPSV7KHODPSLVGHVLJQHG
to house up to 4 optional mechanisms.
Instructions for personalising the CLINIC lamp:
1- Choose the length of the lamp to customi-se:
85.03.02.0, 1270 mm long
85.03.03.0, 1860 mm long
2- Choose direct light.
3- Choose indirect light.
4- Indicate which mechanism goes in each of
the 4 positions A, B, C and D. The luminaire will
be delivered with the mechanisms mounted on
two double trim plates. If more mechanisms
are needed, special lengths can be made.
La tte de lit CLINIC personnaliser possde
XQ FRUSV HQ H[WUXVLRQ GDOXPLQLXP ODTXp HQ
EODQF PDW WH[WXULVH 3RVVLELOLWp GpFODLUDJH
direct et/ou indirect avec des lampes
XRUHVFHQWHV7+23UpSDUpHSRXUDFFXHLOOLU
MXVTXjPpFDQLVPHVRSWLRQQHOV
Les indications pour personnaliser la tte de
lit Clinic:
1- Choisir la longueur de la tte de lit
personnaliser:
85.03.02.0 de 1270 mm
85.03.03.0 de 1860 mm
2-&KRLVLUOpFODLUDJHGLUHFW
3-&KRLVLUOpFODLUDJHLQGLUHFW
4- Indiquer pour chacune des positions A, B,
C et D le mcanisme installer. Le luminaire
sera livr avec les mcanismes monts
sur deux plaques enjoliveuses doubles. Si
plus de mcanismes sont ncessaires, des
longueurs spciales sont ralisables.
Blanco texturizado
Texturised white
Blanc textur
D 4 C 2 B 4 A
1
3
1.
2.
3.
129
6LVWHPDV6DQLWDULRV
850
PC
DIFUSER
CLASE
I
Al
IP
42
Cuerpo CLINIC para personalizar
CLINIC body to customize
Corps CLINIC personnaliser
Opciones para iluminacin directa
Options for direct lighting
Options pour clairage direct
Opciones para iluminacin indirecta
Options for indirect lighting
Options pour clairage indirect
CLINIC
Cdigo Color (XURV Kg L mm
85.03.02.0
85.03.03.0
285,50
320,00
6,7
9,8
1270
1860
Cdigo (XURV
85.41.01.0 74,50
Cdigo (XURV
85.41.11.0 77,50
Cdigo (XURV
*85.41.02.0 77,00
Cdigo (XURV
*85.41.12.0 84,00
Cdigo (XURV
85.42.01.0 94,50
Cdigo (XURV
85.42.11.0 98,00
Cdigo (XURV
*85.42.02.0 94,50
Cdigo (XURV
*85.42.12.0 98,50
T5/T16
G5
T5/T16
G5
5HHFWRU&/,1,&[:
5HHFWRU&/,1,&[:
5HHFWHXU&/,1,&[:
5HHFWRU&/,1,&[:
5HHFWRU&/,1,&[:
5HHFWHXU&/,1,&[:
5HHFWRU&/,1,&[:
5HHFWRU&/,1,&[:
5HHFWHXU&/,1,&[:
5HHFWRU&/,1,&[:
5HHFWRU&/,1,&[:
5HHFWHXU&/,1,&[:
Mecanismos para luminarias CLINIC personalizada pag.131
Optional mechanismes customized CLINIC luminaire pag.131
Mcanismes pour luminaires CLINIC personnaliss pag.131
No compatible con el cuerpo 85.03.02.0
Not compatible with the body 85.03.02.0
Non compatible avec le corps 85.03.02.0
*
5HHFWRU&/,1,&[:
5HHFWRU&/,1,&[:
5HHFWHXU&/,1,&[:
5HHFWRU&/,1,&[:
5HHFWRU&/,1,&[:
5HHFWHXU&/,1,&[:
5HHFWRU&/,1,&[:
5HHFWRU&/,1,&[:
5HHFWHXU&/,1,&[:
5HHFWRU&/,1,&[:
5HHFWRU&/,1,&[:
5HHFWHXU&/,1,&[:
(TXLSR(OHFWUyQLFR+(+2
(TXLSR(OHFWUyQLFR+(+2 (TXLSR(OHFWUyQLFR+(+2
(TXLSR(OHFWUyQLFR+(+2
130
6LVWHPDV6DQLWDULRV
Al
CLINIC GAS
Cdigo (XURV
85.05.16.0 6,50
Cdigo (XURV
85.05.18.0 14,00
Cdigo (XURV
85.05.13.0 11,00
Tapa para 1 toma de gases medicinales
Cover for 1 medical gases output
(PERXWSRXUVRUWLHGHXLGHPpGLFDO
Tomas de Gases medicinales
Medical gases outlets
Sorties Fluides mdicaux
Tapa para 3 tomas de gases medicinales
Cover for 3 medical gases outputs
(PERXWSRXUVRUWLHVGHXLGHVPpGLFDX[
Tapa para 2 tomas de gases medicinales
Cover for 2 medical gases outputs
(PERXWSRXUVRUWLHVGHXLGHVPpGLFDX[
1.
3.
850
PC
DIFUSER
CLASE
I
IP
42
Cuerpo CLINIC GAS para personalizar
CLINIC GAS body to customize
Corps CLINIC GAS personnaliser
Cdigo Color (XURV Kg L mm
85.03.04.0 480,50 19 1860
240
110 mm
2. Opciones para iluminacin directa o indirecta
Options for direct or indirect lighting
Options pour clairage direct ou indirect
(TXLSR(OHFWUyQLFR+(+2
Cdigo (XURV
85.41.01.0 74,50
Cdigo (XURV
85.41.02.0 77,00
(TXLSR(OHFWUyQLFR+(+2
Cdigo (XURV
85.42.01.0 94,50
Cdigo (XURV
85.42.02.0 94,50
T5/T16
G5
5HHFWRU&/,1,&[:
&/,1,&5HHFWRU[:
5HHFWHXU&/,1,&[:
5HHFWRU&/,1,&[:
&/,1,&5HHFWRU[:
5HHFWHXU&/,1,&[:
5HHFWRU&/,1,&[:
&/,1,&5HHFWRU[:
5HHFWHXU&/,1,&[:
5HHFWRU&/,1,&[:
&/,1,&5HHFWRU[:
5HHFWHXU&/,1,&[:
Blanco texturizado
Texturised white
Blanc textur
100
100
100 mm
200 mm
300 mm
Mecanismos para luminarias CLINIC personalizada pag.131
Optional mechanismes customized CLINIC luminaire pag.131
Mcanismes pour luminaires CLINIC personnaliss pag.131
131
6LVWHPDV6DQLWDULRV
CLINIC / CLINIC GAS
Mecanismos para luminarias CLINIC / CLINC GAS personalizada
Optional mechanisms personalized CLINIC / CLINIC GAS luminaire
Mcanismes pour luminaires CLINIC / CLINIC GAS personnaliss
Cdigo Color (XURV
85.07.84.0 16,00
Cdigo Color (XURV
85.07.86.0 19,00
Cdigo Color (XURV
85.07.92.0 25,00
Cdigo Color (XURV
85.07.99.0 43,50
Cdigo Color (XURV
85.07.91.0 19,50
Cdigo Color (XURV
85.08.09.7 256,00
Cdigo Color (XURV
85.07.85.0 31,00
Cdigo Color (XURV
85.07.87.0 35,50
Cdigo Color (XURV
85.07.81.0 51,00
Cdigo Color (XURV
85.07.89.0 31,00
Cdigo Color (XURV
85.07.90.0 37,50
Cdigo Color (XURV
85.08.10.7 122,50
Cdigo Color (XURV
85.07.82.0 272,50
Cdigo Color (XURV
85.08.89.0 51,50
Cdigo Color (XURV
85.07.88.0 16,00
Cdigo Color (XURV
85.08.88.0 21,00
Cdigo Color (XURV
85.07.93.0 9,50
Cdigo Color (XURV
85.08.11.7 817,00
Interruptor unipolar
Single-pole switch
Interrupteur unipolaire
Interruptor conmutado
Two way switch
Interrupteur va et vient
Toma telfono (RJ-11)
Telephone connection (RJ-11)
Connexion tlphonique (RJ-11)
Toma de datos (RJ-45)
Data socket (RJ-45)
Connexion de donnes (RJ-45)
Salida cable
Cable outlet
Sortie de cble
Interruptor unipolar doble
Double single-pole switch
Interrupteur unipolaire double
Interruptor conmutado doble
Double two way switch
Interrupteur double va et vient
Pulsador a distancia
Push-button with cable
Bouton poussoir distance
Pulsador con tirador
Pull cord
Interrupteur tirette
Luz de vigilancia
Night light
Lumire de veille
Mando a distancia
(2 interr.+ llamada enferm.)
Remote control
(2 switches + nurse caller)
Commande distance
LQWHUUXSWHXUVHWDSSHOLQUPLqUH
Interruptor tirador unipolar
Single-pole pull switch
Interrupteur tirette unipolaire
Base Schuko
Schuko socket outlet
Base Schuko
Base Schuko (Francia)
Schuko socket outlet (France)
Base Schuko (France)
Placa ciega
Blank cover
Couvercle vide
Altavoz y micrfono
Microphone and speaker
Hout parleur et microphone
Pulsador de llamada y de presencia
Call and presence push button
%RXWRQSRXVVRLUGDSSHO
et de prsence
Pulsador de llamada y de presencia,
con conector para mando de cama
Push button for call and presence
with connector for control
Bouton poussoirGDSSHOHWGHSUpVHQFH
avec connecteur pour commande de lit
E10-3W
B A
D C
4.
132
6LVWHPDV6DQLWDULRV
CLINIC
PC
DIFUSER
850
Al
CLASE
I
IP
42
T5/T16
G5
Luminaria CLINIC con difusor de policarbonato y con tirador
CLINIC luminaire with polycarbonate diffuser and switch cord
Luminaire CLINIC avec diffuseur polycarbonate et interrupteur tirette
(TXLSR(OHFWUyQLFR+(+2
W Cdigo Color (XURV Kg L mm
2x14/24(D)
+
2x14/24(I)
2x14/24(D)
+
1x28/54(I)
85.44.01.0
85.44.02.0
288,00
337,00
4,5
7,6
860
1450
Blanco texturizado
Texturised white
Blanc textur
ABS
850
PC
DIFUSER
CLASE
I
IP
20
17
PAR20
E27
Proyector exploracin CLINIC / CLINIC GAS
CLINIC / CLINIC GAS exploration projector
Projecteur exploration CLINIC / CLINIC GAS
W Cdigo Color (XURV Kg L mm
50 85.07.80.0 416,00 2,2 1100
Suministrado instalado en las luminarias Clinic y
Clinic Gas para personalizar
Only delivered installed in the luminaires Clinic and
Clinic Gas to customize
Liur install dans les luminaires Clinic et Clinic
Fluide personnaliser
133
6LVWHPDV6DQLWDULRV
CLINIC
134
6LVWHPDV6DQLWDULRV
HOSPITAL
Cabezal HOSPITAL personalizada para iluminacin directa y/o indirecta con mecanismos opcionales
Personalized HOSPITAL head light luminaire for direct and/or indirect light with optional mechanisms
Tete de lit HOSPITAL personnalis pour lumire direct et/ou indirect avec mcanismes optionnels
El cabezal HOSPITAL para personalizar
tiene un cuerpo de extrusin de aluminio
lacado en color blanco mate texturizado. Po-
sibilidad de iluminacin directa y/o indirecta
SDUDOiPSDUDVXRUHVFHQWHV77R7&/
Preparada para alojar hasta 4 mecanismos
opcionales.
Indicaciones para personalizar:
1- Elegir la longitud del cabezal:
85.03.01.0 de 1135 mm (standard)
2- Escoger la iluminacin directa.
D,QFRUSRUDGDDSHUO
E/XPLQDULDDGRVDGDDSHUO
3- Escoger la iluminacin indirecta.
4- Indicar los mecanismos opcionales
que se necesitan en las posiciones
A, B, C y D.
The customised HOSPITAL lamp has an
extruded aluminium body QLVKHGLQWH[WX-
red matt white. It has options of direct and/
RULQGLUHFWOLJKWIRU77RU7&/XRUHVFHQW
lamps. The lamp is designed to house up to 4
optional mechanisms.
Instructions for personalising:
1- Choose the length of the lamp:
85.03.01.0 de 1135 mm (standard)
2- Choose direct light.
2a-,QFRUSRUDWHGZLWKLQWKHSUROH.
2b-Luminaire [DJDLQVWWKHSUROH.
3- Choose indirect light.
4- Choose the optional mechanisms
needed in positions A, B, C and D.
La tte de lit HOSPITAL personnaliser
SRVVqGHXQFRUSVHQH[WUXVLRQGDOXPLQLXP
laqu en blanc mat texturis. Possibilit
GpFODLUDJHGLUHFWHWRXLQGLUHFWSRXUODPSHV
XRUHVFHQWHV77RX7&/3UpSDUpH
SRXUDFFXHLOOLUMXVTXjTXDWUHPpFDQLVPHV
optionnels.
Les indications pour personnaliser:
1- Choisir la longueur de la tte de lit:
85.03.01.0 de 1135 mm (standard)
2-&KRLVLUOpFODLUDJHGLUHFWDRXE
D'LUHFWLQFRUSRUpDXSURO
E/XPLQDLUHGLUHFWDGRVVpDXSURO
3- &KRLVLUOpFODLUDJHLQGLUHFW
4- Indiquer pour chacune des
positions A, B, C et D les
mcanismes optionnels installer.
Blanco texturizado
Texturised white
Blanc textur
mecanismo
POSICIN
A
mecanismo
POSICIN
B
mecanismo
POSICIN
C
mecanismo
POSICIN
D
iluminacin
OPCIN
3
iluminacin
OPCIN
DRE
1135 mm
1.
D
E
3.
135
6LVWHPDV6DQLWDULRV
HOSPITAL
850
PC
DIFUSER
Al
CLASE
I
IP
42
Cuerpo HOSPITAL para personalizar
HOSPITAL body to customize
Corps HOSPITAL personnaliser
Cdigo Color (XURV Kg L mm
85.03.01.0 281,00 7,5 1135
2SFLRQHVSDUDLOXPLQDFLyQGLUHFWDLQFRUSRUDGDDSHUO
2SWLRQVIRUGLUHFWOLJKWLQJLQFRUSRUDWHGZLWKLQWKHSUROH
2SWLRQVSRXUpFODLUDJHGLUHFWLQFRUSRUpDXSURO
(TXLSR(OHFWUyQLFR
W Cdigo (XURV
1x18
2x18
2x14/24
85.48.94.0
85.47.94.0
85.47.95.0
76,50
80,00
124,50
T5/T16
G5
T8/T26
G13
2SFLRQHVSDUDLOXPLQDFLyQLQGLUHFWDLQFRUSRUDGDDSHUO
2SWLRQVIRULQGLUHFWOLJKWLQJLQFRUSRUDWHGZLWKLQWKHSUROH
2SWLRQVSRXUpFODLUDJHLQGLUHFWLQFRUSRUpDXSURO
(TXLSR(OHFWUyQLFR
W Cdigo (XURV
1x18
2x14/24
1x36
1x55
85.47.96.0
85.47.97.0
85.48.06.0
85.47.98.0
59,50
100,00
62,50
83,00
T5/T16
G5
TC-L
2 G 11
T8/T26
G13
2SFLRQHVSDUDLOXPLQDFLyQGLUHFWDDGRVDGDDSHUO
2SWLRQVIRUGLUHFWOLJKWLQJWR[DJDLQVWWKHSUROH
2SWLRQVSRXUpFODLUDJHGLUHFWDGRVVpDXSURO
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV
2x18
2x14/24
85.42.27.0
85.42.26.0
151,50
199,00
T5/T16
G5
T8/T26
G13
Fijacin de la luminaria directa con el canal
Fixing section for luminaire to the channel
Fixation du luminaire direct avec la gaine
Cdigo (XURV
85.07.51.0 16,00
Blanco texturizado
Texturised white
Blanc textur
N
4.
136
6LVWHPDV6DQLWDULRV
HOSPITAL
Mecanismos para luminarias HOSPITAL personalizada
Optional mechanisms personalized HOSPITAL luminaire
Mcanismes pour luminaires HOSPITAL personnaliss
Cdigo Color (XURV
85.07.84.0 16,00
Cdigo Color (XURV
85.07.86.0 19,00
Cdigo Color (XURV
85.07.92.0 25,00
Cdigo Color (XURV
85.07.99.0 43,50
Cdigo Color (XURV
85.07.91.0 19,50
Cdigo Color (XURV
85.08.09.7 256,00
Cdigo Color (XURV
85.07.85.0 31,00
Cdigo Color (XURV
85.07.87.0 35,50
Cdigo Color (XURV
85.07.81.0 51,00
Cdigo Color (XURV
85.07.89.0 31,00
Cdigo Color (XURV
85.07.90.0 37,50
Cdigo Color (XURV
85.08.10.7 122,50
Cdigo Color (XURV
85.07.82.0 272,50
Cdigo Color (XURV
85.08.89.0 51,50
Cdigo Color (XURV
85.07.88.0 16,00
Cdigo Color (XURV
85.08.88.0 21,00
Cdigo Color (XURV
85.07.93.0 9,50
Cdigo Color (XURV
85.08.11.7 817,00
Interruptor unipolar
Single-pole switch
Interrupteur unipolaire
Interruptor conmutado
Two way switch
Interrupteur va et vient
Toma telfono (RJ-11)
Telephone connection (RJ-11)
Connexion tlphonique (RJ-11)
Toma de datos (RJ-45)
Data socket (RJ-45)
Connexion de donnes (RJ-45)
Salida cable
Cable outlet
Sortie de cble
Interruptor unipolar doble
Double single-pole switch
Interrupteur unipolaire double
Interruptor conmutado doble
Double two way switch
Interrupteur double va et vient
Pulsador a distancia
Push-button with cable
Bouton poussoir distance
Pulsador con tirador
Pull cord
Interrupteur tirette
Luz de vigilancia
Night light
Lumire de veille
Mando a distancia
(2 interr.+ llamada enferm.)
Remote control
(2 switches + nurse caller)
Commande distance
LQWHUUXSWHXUVHWDSSHOLQUPLqUH
Interruptor tirador unipolar
Single-pole pull switch
Interrupteur tirette unipolaire
Base Schuko
Schuko socket outlet
Base Schuko
Base Schuko (Francia)
Schuko socket outlet (France)
Base Schuko (France)
Placa ciega
Blank cover
Couvercle vide
Altavoz y micrfono
Microphone and speaker
Hout parleur et microphone
Pulsador de llamada y de presencia
Call and presence push button
%RXWRQSRXVVRLUGDSSHO
et de prsence
Pulsador de llamada y de presencia,
con conector para mando de cama
Push button for call and presence
with connector for control
Bouton poussoirGDSSHOHWGHSUpVHQFH
avec connecteur pour commande de lit
E10-3W
Blanco texturizado
Texturised white
Blanc textur
137
6LVWHPDV6DQLWDULRV
APLIQUE HOSPITAL
850
PC
DIFUSER
Al
CLASE
I
IP
42
T8/T26
G13
Luminaria HOSPITAL directa/indirecta con diffusor de policarbonato y con tirador
Direct/indirect HOSPITAL luminaire with polycarbonate diffuser and switch cord
Luminaire HOSPITAL direct/indirect avec diffuseur polycarbonate et interrupteur tirette
*Fijacin en pared incorporada de 50 cm
*Fixation for wall incorporated of 50 cm
*Fixation au mur incorpor de 50 cm
W Cdigo Color (XURV Kg L mm
3x18 85.03.00.0 247,00 5,6 800
Blanco texturizado
Texturised white
Blanc textur
138
Sistemas Sanitarios
Perfl HOSPITAL para gases medicinales o conducciones elctricas
HOSPITAL profle for medical gases or electrical conduits
Profl HOSPITAL pour fuides mdicaux ou conductions lectriques
Perfl HOSPITAL para conducciones elctricas
HOSPITAL profle for electrical conduits
Profl HOSPITAL pour conductions lectriques
Al
Al
CANAL GASES
Cdigo Color Euros
85.06.45.0 15,00
Cdigo Color Euros
85.06.44.0 16,00
Cdigo Color Euros
85.05.22.0 31,50
Cdigo Color Euros
85.07.53.0 7,00
Cdigo Color Euros
85.07.52.0
85.07.50.0
25,50
17,00
doble
simple
Cdigo Color Euros
85.05.16.0 6,00
Cdigo Color Euros
85.05.13.0 11,00
Cdigo Color Euros
96.06.01.0 1,50
Tapa fnal canal gases
End cover for channel
Embout fnal
Tapa fnal
End cover
Embout fnal
Codo canal gases
90 elbow for channel
Union coude 90
Soporte de elementos elctricos
Support for electrical elements
Support d`elments lectriques
Soporte de elementos electricos
Support for electrical elements
Support d`elments lectriques
Tapa para 1 toma de gases medicinales
Cover for 1 medical gases
Embout pour 1 fuide mdical
Tapa para 2 tomas de gases medicinales
Cover for 2 medical gases
Embout pour 2 fuides mdicaux
Juego de 2 fjaciones para unin
Set of 2 profle fxings joints
Jeu de 2 fxations pour union
Tapas frontales incluidas
Frontal covers included
Couvercles frontales incluses
Tapas frontales incluidas
Frontal covers included
Couvercles frontales incluses
Cdigo Color Euros Kg L mm
85.05.47.0
85.05.48.0
85.05.49.0
67,50
118,50
173,00
1,5
3,0
4,5
1000
2000
3000
Cdigo Color Euros Kg L mm
85.05.41.0 111,50 3,2 1000
Blanco texturizado
Texturised white
Blanc textur
139
6LVWHPDV6DQLWDULRV
MURAL / AMBIENT / MODULAR
TC-L
2 G 11
T5/T16
G5
T8/T26
G13
850
850
Al
PC
DIFUSER
CLASE
I
CLASE
I
IP
42
IP
20
Luminaria MURAL directa con difusor de policarbonato
Direct MURAL luminaire with polycarbonate diffuser
Luminaire MURAL direct avec diffuseur polycarbonate
Luminaria empotrable MODULAR HOSPITAL de reconocimiento
MODULAR HOSPITAL recessed luminaire for recognition
/XPLQDLUHHQFDVWUDEOH02'8/$,5(+3,7$/GDXVFXOWDWLRQ
*Fijacin en pared incorporada de 50 cm
*Fixation for wall incorporated of 50 cm
*Fixation au mur incorpor de 50 cm
Con tirador
With pull switch
Avec interr. tirette
Con tirador
With pull switch
Avec interr. tirette
Sin tirador
Without pull switch
Sans interr. tirette
Sin tirador
Without pull switch
Sans interr. tirette
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
2x14/24
2x14/24
85.42.24.0
85.42.26.0
235,00
197,00
2,35
2,35
800
800
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L x A x H mm
2x55 85.42.33.0 232,00 5,4 596 x 596 x 96
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg L mm
2x18 85.02.25.0 165,00 3,4 800
Cabezal AMBIENT con difusor de policarbonato y tirador
AMBIENT head light with polycarbonate diffuser and switch cord
Applique AMBIENT avec diffuseur polycarbonate et tirette
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Color (XURV Kg L mm
2x14/24
2x28/54
88.42.40.0
88.42.41.0
225,50
270,00
1,5
2,6
700
1300
850
PC
DIFUSER
Al
CLASE
I
IP
40
T5/T16
G5
Sistema de anclaje para techos 65.07.40.0 (p.124)
Adjustable ceiling support brackets 65.07.40.0 (p.124)
6\VWqPHGDQFUDJHDXSODIRQGS
T8/T26
G13
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L mm
2x18 85.42.27.0 151,50 3,4 800
140
6LVWHPDV6DQLWDULRV
IP
65
IP
65
IK
09
IK
09
IP
65
CLASE
I
CLASE
I
IK
09
Mx.70mm
GLASS
960
GLASS
35-100mm
960
CLASE
I
GLASS T5
G13
T8/T26
G13
960
Luminaria HERMTICA de fcil mantenimiento y conexin rpida
HERMETICA luminaire of easy maintennance and quickly connected
/XPLQDLUH+(50e7,&$IDFLOHGHQWUHWLHQHWFRQQH[LRQUDSLGH
Luminaria HERMTICA con ptica V-Brillante, registrable por la parte superior e inferior
Luminaire HERMETICA with V-Bright louvre, accesible from above and below
Luminaire HERMETICA avec grille parabolique V-brillant accessible sur la partie inf-
rieure et suprieure
Luminaria HERMTICA con ptica V-Brillante, registrable por la parte inferior
Luminaire HERMETICA with V-Bright louvre, accesible from below
Luminaire HERMATICA avec grille parabolique V-Brillant accessible sur la par-
tie infrieure
(TXLSR(OHFWURPDJQpWLFR
W Cdigo (XURV
2x36
4x18
4x36
82.03.28.0
82.03.48.0
82.03.49.0
448,00
421,00
622,50
(TXLSR(OHFWURPDJQpWLFR
W Cdigo (XURV
2x36
4x18
4x36
82.02.01.0
82.04.01.0
82.04.11.0
363,50
340,50
519,00
(TXLSR(OHFWUyQLFR7+(+2 (Perfilera "T" vista modulacin)
W Cdigo Color (XURV Kg 3HUOHUtD H mm.
4x14/24 82.43.50.0 426,00 10 600x600 120
(TXLSR(OHFWUyQLFR
Cdigo (XURV Color Kg L x A x H mm X x Y
82.43.28.0
82.43.48.0
82.43.49.0
466,50
438,50
641,50
16
16
30
1286x367x110
686x667x110
1286x667x110
345 x 1270
645 x 660
645 x 1270
(TXLSR(OHFWUyQLFR
Cdigo (XURV Color Kg L x A x H mm X x Y
82.42.01.0
82.44.01.0
82.44.11.0
381,50
358,50
539,50
16
16
30
1286x367x110
686x667x110
1286x667x110
345 x 1270
645 x 660
645 x 1270
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo (XURV Color Kg L x A x H mm X x Y
4x14/ 24 82.44.04.0 475,50 16 626x626x130 614 x 598
HERMTICA
Mx.80mm T8/T26
G13
T5/T16
G5
141
6LVWHPDV6DQLWDULRV
IP
65
IK
09
PC
DIFUSER
CLASE
I
850
Luminaria HERMTICA con difusor opalizado, registrable por la parte inferior
Luminaire HERMETICA with opal diffuser, accesible from below
Luminaire HERMETICA avec diffuseur opal accessible sur la partie infrieure
(TXLSR(OHFWURPDJQpWLFR
W Cdigo (XURV
2x36
2x58
4x18
4x36
82.02.00.0
82.02.03.0
82.04.00.0
82.04.10.0
279,50
370,50
259,50
364,00
(TXLSR(OHFWUyQLFR7+(+2 (Perfilera "T" vista modulacin)
W Cdigo Color (XURV Kg 3HUOHUtD H mm.
4x14/24 82.44.60.0 353,00 7 600x600 120
(TXLSR(OHFWUyQLFR
Cdigo (XURV Color Kg L x A x H mm X x Y
82.42.00.0
82.42.03.0
82.44.00.0
82.44.10.0
296,00
362,00
281,50
382,00
12
15
12
22
1286x367x110
1591x367x110
686x667x110
1286x667x110
345 x 1270
345 x 1570
645 x 660
645 x 1270
HERMTICA
Mx.80mm T8/T26
G13
T5
G13
S
c
e
n
in
g
Sistemas de control 1-10V p.148
Systems of control 1-10V p.148
Systmes de contrle 1-10V p.148
142
,QGXVWULDO
HANGAR
IP
20
CLASE
I
HIT/HST
E40
Al
HIE/HSE
E40
960
HME
E27/E40
Luminaria HANGAR 20
HANGAR 20 hi-bay luminaire
Luminaire HANGAR 20
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Equipo Kg Portalmparas
125
250
250
250
250
400
400
400
400
94.01.00.5
94.01.01.5
94.01.02.5
94.01.03.5
94.01.09.5
94.01.04.5
94.01.05.5
94.01.06.5
94.01.07.5
93,50
103,00
131,00
131,00
146,50
112,50
130,50
143,50
130,50
HME
HME
HIT/HIE 0,6KV
HIT/HST/HIE/HSE 4,5KV
HIT 4,5KV
HME
HIE/HIT 4,5KV
HSE/HST
HIE 0,6KV
4,5
6,6
6,9
6,9
6,6
6,6
6,9
8,2
6,9
E27
E40
E40
E40
G12
E40
E40
E40
E40
UHHFWRUHV
UHHFWRUHV
UHHFWRUHV
UHHFWRUHV
UHHFWRUHV
UHHFWRUHV
UHHFWRUHV
UHHFWRUHV
UHHFWRUHV
IP
65
CLASE
I
HIT/HST
E40
Al
HIE/HSE
E40
960
HME
E27/E40
Luminaria HANGAR 65
HANGAR 65 hi-bay luminaire
Luminaire HANGAR 65
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Equipo Kg Portalmparas
125
250
250
250
250
94.01.20.5
94.01.21.5
94.01.22.5
94.01.23.5
94.01.29.5
111,50
124,50
151,50
151,50
166,00
HME
HME
HIT/HIE 0,6KV
HIT/HST/HIE/HSE 4,5KV
HIT 4,5KV
4,5
6,6
6,9
6,9
6,6
E27
E40
E40
E40
G12
UHHFWRUHV
UHHFWRUHV
UHHFWRUHV
UHHFWRUHV
UHHFWRUHV
Azul oscuro texturizado
Texturised dark blue
Bleu fonc texturis
143
,QGXVWULDO
IP
65
CLASE
I
HIT/HST
E40
Al
HIE/HSE
E40
960
HME
E27/E40
Luminaria HANGAR 65
HANGAR 65 hi-bay luminaire
Luminaire HANGAR 65
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Equipo Kg Portalmparas
400
400
400
400
94.01.14.5
94.01.15.5
94.01.16.5
94.01.17.5
159,00
184,00
199,00
184,00
HME
HIE/HIT 4,5KV
HSE/HST
HIT/HIE 0,6KV
7,7
8,0
9,3
8,0
E40
E40
E40
E40
UHHFWRUHV
UHHFWRUHV
UHHFWRUHV
UHHFWRUHV
HANGAR 65
IP
65
IP
54
IK
10
IK
09
Accesorios
Accessories
Accessoires
5HHFWRUGHDOXPLQLR
$OXPLQLXPUHHFWRU
5pHFWHXUDOXPLQLXP
&ULVWDOGHSURWHFFLyQUHHFWRUDOXPLQLRFRQMXQWD
*ODVVSURWHFWRUIRUDOXPLQLXPUHHFWRU
9HUUHSURWHFWLRQSRXUUpHFWHXUDOXPLQLXP
5HMLOODGHSURWHFFLyQSDUDUHHFWRUDOXPLQLR
3URWHFWLRQORXYUHIRUDOXPLQLXPUHHFWRU
*ULOOHGHSURWHFWLRQSRXUUpHFWHXUDOXPLQLXP
Kit preencendido
Anallary lampkit
Kit pr-allumage
HANGAR 65 + 94.06.51.0 + 94.06.30.0 = IP 65
HANGAR 65 + 94.06.60.3 / 94.06.60.0 + 94.06.11.0 = IP 54
Difusor policarbonato
Polycarbonate diffuser
Diffuseur polycarbonate
5HHFWRUSROLFDUERQDWRPHWDOL]DGR
3RO\FDUERQDWHPHWDOOL]HGUHHFWRU
5pHFWHXUPpWDOOLVpSRO\FDUERQDWH
&LHUUHSDUDGLIXVRUHV\UHHFWRUHVSROLFDUERQDWR
3RO\FDUERQDWHGLIIXVHUVDQGUHHFWRUVFORVXUH
)HUPDWXUHSRXUGLIIXVHXUHWUpHFWHXUVSR-
lycarbonate
Cdigo (XURV h mm PP
94.06.51.0 38,50 300 490
Cdigo (XURV PP
94.06.30.0 30,00 490
Cdigo (XURV
94.06.31.0 18,00
W Cdigo (XURV Portalmparas
Max. 250 94.08.40.0 112,50 E27
Cdigo (XURV h mm PP
94.06.60.0 94,00 280 415
Cdigo (XURV h mm PP
94.06.60.3 157,50 280 415
Cdigo (XURV PP
94.06.11.0 58,00 415
Max. 250W
Max. 250W
Max. 250W
850
850
Solo combinable con el cristal
Single combineable with the crystal
Seulement assortissable avec verre
Suministrado instalado en la luminaria
Only delivered installed in the luminaire
Liur install dans le luminaire
Azul oscuro texturizado
Texturised dark blue
Bleu fonc texturis
Blanco brillante
Shiny white
Blanc brillant
TC-L
2 G 11
850
PC
DIFUSER
CLASE
I
IK
09
IP
43
Extensiva
Extensive
Intensiva
Intensive
(TXLSR(OHFWUyQLFR
W Cdigo Ex Cdigo In Color (XURV Kg
4x55
4x80
71.44.21.0
71.44.22.0
71.44.31.0
71.44.32.0
375,00
423,50
10,2
10,2
Luminaria HI-LUX IP43 para lmpara TC-L
HI-LUX IP43 luminaire for TC-L lamps
Luminaire HI-LUX IP43 pour lampes TC-L
PC
DIFUSER
T5
G5
850
CLASE
I
IK
09
IP
43
Extensiva
Extensive
Intensiva
Intensive
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Ex Cdigo In Color (XURV Kg L mm
2x28/54
2x35/49/80
71.42.23.0
71.42.24.0
71.42.33.0
71.42.34.0
328,00
394,50
11,4
13,4
1250
1550
(TXLSR(OHFWUyQLFR79+2
W Cdigo Ex Cdigo In Color (XURV Kg L mm
2x95
2x120
71.42.25.0
71.42.26.0
71.42.35.0
71.42.36.0
389,00
435,00
11,4
13,4
1250
1550
Luminaria HI-LUX IP43 para lmpara T5
HI-LUX IP43 luminaire for T5 lamps
Luminaire HI-LUX IP43 pour lampes T5
350
NEW
144
,QGXVWULDO
HI-LUX IP43
Blanco brillante
Shiny white
Blanc brillant
145
,QGXVWULDO
TC-L
2 G 11
850
PC
DIFUSER
CLASE
I
IK
09
IP
64
Extensiva
Extensive
Intensiva
Intensive
(TXLSR(OHFWUyQLFR
W Cdigo Ex Cdigo In Color (XURV Kg
4x55
4x80
71.44.01.0
71.44.02.0
71.44.11.0
71.44.12.0
462,50
510,50
12,4
12,4
Luminaria HI-LUX IP64 para lmpara TC-L
HI-LUX IP64 luminaire for TC-L lamps
Luminaire HI-LUX IP64 pour lampes TC-L
Soporte para techo TC-L
Support for ceiling TC-L
Support pour plafond TC-L
Cdigo Color (XURV
71.00.90.0 44,00
PC
DIFUSER
T5
G5
850
CLASE
I
IK
09
IP
64
Extensiva
Extensive
Intensiva
Intensive
(TXLSR(OHFWUyQLFR7+(+2
W Cdigo Ex Cdigo In Color (XURV Kg L mm
2x28/54
2x35/49/80
71.42.03.0
71.42.04.0
71.42.13.0
71.42.14.0
413,00
513,00
12
14
1250
1550
(TXLSR(OHFWUyQLFR79+2
W Cdigo Ex Cdigo In Color (XURV Kg L mm
2x95
2x120
71.42.05.0
71.42.06.0
71.42.15.0
71.42.16.0
491,50
557,00
12
14
1250
1550
Luminaria HI-LUX IP64 para lmpara T5
HI-LUX IP64 luminaire for T5 lamps
Luminaire HI-LUX IP64 pour lampes T5
Soporte para techo T5/HIT/HST
Support for ceiling T5/HIT/HST
Support pour plafond T5/HIT/HST
Cdigo Color (XURV
71.00.91.0 40,00
350
HI-LUX IP64
Soporte para techo T5/HIT/HST
Support for ceiling T5/HIT/HST
Support pour plafond T5/HIT/HST
Cdigo Color (XURV
71.00.91.0 40,00
10-60 mm
960
960
600 x 395
GLASS
GLASS
CLASE
I
CLASE
I
IK
09
IK
09
IP
64
IP
64
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
150
250
71.01.27.0
71.01.28.0
418,50
419,50
11,3
11,4
Luminaria HI-LUX IP64 lmpara HIT/HST y cristal templado
HI-LUX IP64 luminaire HIT/HST lamps and tempered glass
Luminaire HI-LUX IP64 lampes HIT/HST et verre tremp
HIT/HST
E40
HIT/HST
E40
600 mm
350
145
Rejilla de proteccin
Protection louvre
Grille de protection
Cdigo Color (XURV
71.00.88.2 34,00
HI-LUX IP64
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
150
250
71.01.07.0
71.01.08.0
550,00
560,00
11,3
11,4
Luminaria HI-LUX IP64 para empotrar lmpara HIT/HST
HI-LUX IP64 recessed luminaire HIT/HST lamps
Luminaire HI-LUX IP64 lampes HIT/HST pour encastrement
Rejilla de proteccin
Protection louvre
Grille de protection
Cdigo Color (XURV
71.00.89.2 34,00
Anclaje para techo incluido
Bracket surface included
Fixation plafond inclus
670 mm
420
155
Blanco brillante
Bright white
Blanc brillant
146
,QGXVWULDO
147
,QGXVWULDO
148
'RPyWLFD
SCENING
SCENING, sistema de control y regulacin de la luz
SCENING, light monitoring and regulation system
6&(1,1*V\VWqPHGHFRPPDQGHHWGHUpJXODWLRQGpFODLUDJH
El sistema de control y regulacin de ilumi-
nacin SCENING utiliza la red elctrica para
controlar la luz creando escenarios para dis-
tintas necesidades en un nico espacio. La
tecnologa utilizada es la Powerline, que utili-
za la red elctrica como medio de transmisin
de datos. La ventaja de SCENING respecto a
otros sistemas de control y regulacin es que
nos permite la reduccin de costes y tiempo
de instalacin debido a que no implica un ca-
bleado adicional a la instalacin elctrica.
El sistema est formado por una botonera
tctil, un mando a distancia opcional, regula-
dores Powerline, convertidores, transforma-
dores y fuentes de alimentacin. La botonera
tctil SCENING es capaz de controlar hasta
cinco escenarios, cada uno de ellos puede
estar compuesto por cinco grupos de lumi-
narias denominados canales. Ideal par espa-
cios como salas de juntas, salas de reunio-
QHVDXGLWRULRVRFLQDVHWF
The SCENING lighting, monitoring and re-
gulation system uses the electrical network
to monitor the light thus creating scenes for
different needs in a single space. It uses
Powerline technology, which uses the electri-
cal network as a means of data transmission.
The advantage of SCENING, as opposed to
other monitoring and regulation systems, is
that it enables reducing costs and installation
time, as it does not require any additional ca-
bling to the electrical installation.
The system consists of a touch panel, an op-
tional remote control, regulators, converters
and transformers. The SCENING touch pa-
QHO LV FDSDEOH RI PRQLWRULQJ XS WR YH VFH-
QHVHDFKRIZKLFKPD\EHFRPSRVHGRIYH
groups of luminaires called channels. This
system is designed for spaces such as boar-
drooms, meeting and conference rooms, au-
GLWRULXPVRIFHVVKRSVUHVWDXUDQWVHWF
Le systme de commande et de rgulation
GpFODLUDJH 6&(1,1* XWLOLVH OH UpVHDX pOHF-
trique pour contrler la lumire en crant
plusieurs ambiances dans un espace unique
en fonction des besoins. Ce systme fait
appel la technologie Powerline utilisant le
courant porteur en tant que moyen de trans-
PLVVLRQ GHV GRQQpHV /DYDQWDJH GH 6&(-
NING en comparaison avec les autres sys-
tmes de commande et de rgulation rside
dans la rduction des cots et de la dure
GLQVWDOODWLRQpWDQWGRQQpTXLOQHUHTXLHUWDX-
FXQFkEODJHVXSSOpPHQWDLUHYHQDQWVDMRXWHU
jOLQVWDOODWLRQpOHFWULTXH
/H V\VWqPH HVW FRPSRVp GXQ SDQQHDX[
WDFWLOHGHFRPPDQGHVGXQHWpOpFRPPDQGH
fournie en option, de rgulateurs, de conver-
tisseurs et de transformateurs. Le panneaux
tactile de commandes SCENING est capable
GH FRQWU{OHU MXVTXj FLQT VFqQHV GLIIpUHQWHV
GRQWFKDFXQHGHQWUHHOOHVSHXWrWUHFRPSR-
se de cinq groupes de luminaires appels
canaux. Ce systme est idal pour des es-
paces tels que les salles de runion et con-
frence, auditoriums, bureaux, magasins,
restaurants, etc
Escena 1
Iluminacin general
Escena 2
Speaker
Escena 3
Reunin
Escena 5
Proyeccin
Escena 4
Ambiente
149
'RPyWLFD
SCENING
Escena iluminacin general
(Todas las luminarias encendidas al 100%)
General lighting scene
(All luminaires switched on 100%)
Scne eclairage gnrale
(tous les luminaires allums 100%)
Escena lectura
(Luminarias ambiente encendas al
100%, luminarias escritorio y de ilumina-
cin general apagadas)
Reading scene
(ambient luminaries lighted to 100%,
writing-desk luminaries and general
illumination are switched off)
Scne Lecture
OXPLQDLUHVGDPELDQFHDOOXPpVj
luminaires bureau et clairage gnral
teins)
Escena Reunin
(Luminarias de iluminacin general y de
ambientes encendidas al 100%, lumina-
rias escritorio apagadas)
Meeting scene
(general illumination and ambient lumi-
naries switched on 100%, writing-desk
luminaries switched off)
Scne runion
OXPLQDLUHVGDPELDQFHHWpFODLUDJH
gnral allums 100%, luminaires
bureau teins)
%LVEDWGH7HUUDVVD Terrassa (Espaa)
150
'RPyWLFD
SCENING
SCENING, sistema de control y regulacin de la luz
SCENING, light monitoring and regulation system
6&(1,1*V\VWqPHGHFRPPDQGHHWGHUpJXODWLRQGpFODULDJH
Caractersticas del Sistema Scening:
Para el control del sistema, utilizamos la tecnologa
Powerline que consiste en utilizar la red elctrica
como medio de transmisin de datos.
La ventaja de Scening respecto a otros sistemas
de control y regulacin, es que nos permite la re-
duccin de costes y tiempo de instalacin debido
a que no implica un cableado adicional a la insta-
lacin elctrica.
El sistema esta formado por una botonera tctil, un
mando a distancia opcional, reguladores, transfor-
madores y sensor de luminosidad y presencia.
La Botonera Tctil Scening, es capaz de controlar
hasta cinco escenarios, cada uno de ellos puede
estar compuesto por cinco grupos de luminarias
denominados canales.
En cada grupo o canal tenemos la posibilidad de
encender/apagar y regular si las luminarias estn
equipadas con equipos 1-10V.
Cada canal necesita como mnimo 1 regulador
Powerline.
Campo de aplicacin:
Este sistema esta pensado bsicamente para es-
pacios tales como:
Salas de juntas, de reuniones y de conferencias,
DXGLWRULRV RFLQDV WLHQGDV UHVWDXUDQWHV KDELWD-
ciones de hotel y gimnasios, etc.
1. Characteristics of the Scening System:
In order to control the system, we use Powerline te-
chnology which consists of using the 230 V electric
grid for data transfer.
The advantage of the Scening system with respect
to other control and regulation systems is that it
allows us to reduce costs and installation time be-
cause it does not involve additional wiring to the
electrical system.
The system is formed by a touch pad, an optional
remote control, regulators, transformers and Lumi-
nosity sensor and presence.
7KH6FHQLQJWRXFKSDGLVDEOHWRFRQWUROXSWRYH
VFHQHVHDFKRQHRIWKHVHFDQEHPDGHXSRIYH
JURXSVRIOLJKW[WXUHVFDOOHGFKDQQHOV
In each group or channel, it is possible to turn on/off
DQG UHJXODWH LI WKH OLJKW [WXUHV DUH HTXLSSHG ZLWK
1-10 V units.
Each channel requires at least 1 Powerline regu-
lator.
2. Field of application:
This system is generally for spaces such as:
Board rooms, meeting rooms, conference rooms,
KDOOVRIFHVVKRSZLQGRZVUHVWDXUDQWVHWF
1. Caractristiques du systme Scening:
Pour le contrle du systme, nous utilisons la tech-
nologie Powerline qui consiste utiliser le rseau
lectrique de 230 V comme moyen de transmission
de donnes.
/DYDQWDJHGH6FHQLQJSDUUDSSRUWjGDXWUHVV\VWq-
PHVGHFRQWU{OHHWGHUpJODJHHVWTXLOQRXVSHUPHW
GHUpGXLUHOHVFRWVHWOHWHPSVGLQVWDOODWLRQFDULO
QHVW SDV QpFHVVDLUH GXWLOLVHU XQ FkEODJH VXSSOp-
PHQWDLUHjFHOXLGHOLQVWDOODWLRQpOHFWULTXH
/H V\VWqPH HVW FRPSRVp GXQ SDQQHDX[ GH ERX-
WRQV WDFWLOHV GXQH WpOpFRPPDQGH RSWLRQQHOOH GH
rgulateurs, de transformateurset de capteur de
luminosit et de prsence.
Le panneaux de boutons tactiles Scening est capa-
EOHGHFRQWU{OHUMXVTXjFLQTVFqQHVFKDFXQHSRX-
vant tre compose de cinq groupes de luminaires
appels canaux.
Dans chaque groupe ou canal, nous pouvons allu-
mer/teindre et rgler si les luminaires sont munis
GpTXLSHPHQWV9
&KDTXH FDQDO D EHVRLQ GDX PRLQV UpJXODWHXU
Powerline.
'RPDLQHGDSSOLFDWLRQ
Ce systme est essentiellement conu pour des
espaces tels que:
VDOOHGDVVHPEOpHVVDOOHGHUpXQLRQVVDOOHGHFRQIp-
rences, auditoriums, bureaux, vitrines, restaurants, etc.
Mando a distancia por infrarojos
Remote control by infrared
Commande distance par infrarouge
Sensor de luminosidad y presencia para regulador 1-10V POWERLINE
Luminosity sensor and presence for regulator 1-10V POWERLINE
Capteur de luminosit et de prsence pour rgulateur 1-10V POWERLINE
Regulador 1-10V POWERLINE
Regulator 1-10V POWERLINE
Rgulateur 1-10V POWERLINE
Cdigo Color (XURV
96.51.23.0 48,00
Cdigo (XURV
96.51.30.0 202,00
Cdigo (XURV
96.51.21.0
96.51.26.0
200,00
312,50
96.51.20.0
max. 750W max. 105W
96.01.22.0
95-250 V
50-60 Hz
230 V
50 Hz
24V - max.20W
12V - max.10W
350 mA - max.15W
700 mA - max.25W
230-240V
50-60Hz
1 unid. - 2 fases
2 unid. - 3 fases
95-250 V
50-60 Hz
Botonera tctil POWERLINE para empotrar (controlador de escenarios)
32:(5/,1(WRXFKSDQHOWREHWWHGUHJXODWRURIVHWWLQJV
eFUDQWDFWLOH32:(5/,1(jHQFDVWUHUFRQWU{OHXUGpFODULDJHV
scenographiques)
Cdigo Color (XURV L mm
96.51.20.0
96.01.22.0
440,00
5,00
128x115
117x106x52
Convertidor de tensin mediante seal (luminarias incandescentes)
Voltage regulator with signal 1-10V (incandescent lights)
Rgulateur de tensin par signal 1-10V (luminaires incandescents)
Transformador electrnico regulable mediante
seal 1-10V (bajo voltaje)
Electronic transformer regulable for signal 1-10V
Transformateur lectronique rgulable par
signal 1-10V
Cdigo (XURV
96.51.24.0 194,50
Cdigo (XURV
96.57.51.0 48,00
Cdigo (XURV
96.51.25.0 58,00
Acoplador de fases para instalaciones
trifsicas (R-S-T)
Coupler phases for 3 phase installations (RST)
Accoupleur phases pour installations
triphases (R-S-T)
Cdigo (XURV
96.50.74.0 130,00
Fuente de alimentacin 1-10V (LED)
Power supplies for signal 1-10V (LED)
6RXUFHGDOLPHQWDWLRQVLJQDO9/('
Componentes del sistema
Components of the system
Composants du systme
3.
2.
1.
Luminarias
Luminaires
Luminaires
Persianas max. 100W
Travelling shutes
Volet roulant
Angulo apertura 100
Angle of opening 100
Angle ouverture 100
Altura mxima: 2,5 a 3
Height: 2.5 to 3 m
Hauteur maximale: 2.5 3
N
151
'RPyWLFD
SCENING
Ejemplos de escenarios con botonera tctil
Examples of scenes with touch panel
Exemples de scnes avec le Clavier de commande
Escena general:
Todas las luminarias encendidas al 100%
Escena iluminacin zona izquierda
Esquema del sistema
System diagram
Schma du systme
4.
5.
Sensor de
luminosidad
y presencia para
regulador 1-10V
POWERLINE
Regulators
152
6LVWHPDVGH&RQWURO
CONTROL Y REGULACIN 1-10V
Control y regulacin manual de las luminarias
Manual control and adjustment of the luminaries
Contrle et regulation manuelle des luminaires
5HJXODFLyQGHODLQWHQVLGDGGHXMR
mediante: Dimmers universales /
'LPPHUVGHXRUHVFHQFLD9
Tecla sensora con regulador univer-
VDOXRUHVFHQFLD9
6HQVRUGHOXPLQRVLGDGSDUDDFRSODUHQXRUHVFHQWHV7+(\7
/XPLQRVLW\VHQVRUWREXLOGLQXRUHVFHQW7+(DQG7
&DSWHXUGHOXPLQRVLWpjFOLSVHUjGHVXRUHVFHQWV7+(HW7
Sensor de luminosidad para integrar en luminarias (bajo pedido)
Luminosity sensor to integrate into luminaires (Under request)
Capteur de luminosit intgrer dans des luminaires (Sur demande)
6HQVRUGHOXPLQRVLGDGSDUDDFRSODUHQXRUHVFHQWHV7HLQWHJUDUHQOXPLQDULDVEDMRSHGLGR
/XPLQRVLW\VHQVRUWREXLOGLQXRUHVFHQW7DQGWRLQWHJUDWHLQWROXPLQDLUHV8QGHUUHTXHVW
&DSWHXUGHOXPLQRVLWpjDFFRXSOHUGDQVGHVXRUHVFHQWV7HWLQWpJUHUGDQVGHVOXPLQDLUHV6XUGHPDQGH
6HQVRUGHOXPLQRVLGDG\SUHVHQFLDGHVXSHUFLH
Luminosity sensor and surface presence
Capteur de luminosit et de prsence saillie
Hasta 10 balastos 1-10V
Angulo apertura 50
Para alturas de 2,5 a 3m
Hasta 20 balastos 1-10V
Para alturas de 2,5 a 3m
Hasta 100 balastos 1-10V
Angulo apertura 90
Para alturas de 2,5 a 3m
Hasta 50 balastos 1-10V
Angulo apertura 100
Altura mxima: 2,5 a 3
Up to 10 ballasts 1-10V
Angle of opening 50
2.5 to 3 m high
Up to 20 ballasts 1-10V
2.5 to 3 m high
-XVTXjEDOODVWV9
Pour des hauteurs de 2.5 3m
Up to 100 ballasts 1-10V
Angle 90 opening ample
2.5 to 3 m high
Up to 50 ballasts 1-10V
Angle of opening 100
Height: 2.5 to 3 m
-XVTXjEDOODVWV9
Angle ouverture 50
Pour des hauteurs de 2.5 3m
-XVTXjEDOODVWV9
Angle ouverture 90
Pour des hauteurs de 2.5 3m
-XVTXjEDOODVWV9
Angle ouverture 100
Hauteur maximale: 2.5 3
Sistemas de control y regulacin 1-10V
1-10V control and adjustment systems
Systmes de contrle et rgulation 1-10V
Cdigo (XURV
96.50.14.0 29,00
Cdigo (XURV
96.50.15.0 84,00
Cdigo (XURV
96.51.31.0 293,00
5HJXODWLRQRIWKHLQWHQVLW\RIRZ
by means of: Universal dimmers,
1-10V Fluorescent dimmers and
9XQLYHUVDOXRUHVFHQWUHJXOD-
tor sensor key.
5pJODJHGHOLQWHQVLWpGHX[
au moyen: Dimmers universels,
'LPPHUVGHXRUHVFHQFH9HW
Touche sensorielle avec rgulateur
XQLYHUVHOXRUHVFHQFH9
153
Sistemas de Control
CONTROL Y REGULACIN DALI
Sistemas de control y regulacin DALI
DALI control and adjustment systems
Systmes de contrle et rgulation DALI
6HQVRUGHOXPLQRVLGDG\SUHVHQFLDSDUDHPSRWUDURGHVXSHUFLH
/XPLQRVLW\DQGSUHVHQFHVHQVRUWREHUHFHVVHGRUVXUIDFH
&DSWHXUGHOXPLQRVLWpHWGHSUpVHQFHjHQFDVWUHURXVXUIDFH
Permite controlar hasta 15
EDODVWRV'$/,
$QJXORDSHUWXUD[
$WXUDUHFRPHQGDGDDP
,QFRUSRUDPRGRVSUHSURJUDPD
GRV\RWURSDUDVHUSURJUDPDGR
Dispone de embellecedor
SDUDLQVWDODFLyQHQVXSHUFLH

Posibilidad de mando a dis


tancia para una programacin
SHUVRQDOL]DGD
3HUPHWGHFRQWU{OHUMXVTXj
EDOODVWV'$/,
$QJOHRXYHUWXUH[
+DXWHXUUHFRPPDQGpHjP
,QWqJUHPRGHVGHSUpSURJUDP
PDWLRQHWXQDXWUHjSURJUDPPHU
'LVSRVHGXQHQMROLYHXUSRXU
une installation en surface

Possibilit de tlcommande pour


XQHSURJUDPPDWLRQSHUVRQQDOLVpH
Can control up to 15 DALI
EDOODVWV
$QJOHRIRSHQLQJ[
Recommended height 2,5 to 3,5m
,WLQFOXGHVSUHSURJUDPPHGPR
GHVDQGRWKHUWREHSURJUDPPHG
It has a trim to be installed
VXUIDFHPRXQWHG
Remote control option for perso
QDOLVHGSURJUDPPH

+

Cdigo Euros

143,00
20,50
6HQVRUGHOXPLQRVLGDG\SUHVHQFLDSDUDLQWHJUDUHQOXPLQDULDVEDMRSHGLGR
/XPLQRVLW\DQGSUHVHQFHVHQVRUWRLQWHJUDWHLQWROXPLQDLUHV8QGHUUHTXHVW
&DSWHXUGHOXPLQRVLWpHWGHSUpVHQFHjLQWpJUHUGDQVGHVOXPLQDLUHV6XUGHPDQGH
3HUPLWHFRQWURODUKDVWDEDODVWRV'$/,
$OWXUDPi[LPDP
PRGRVDXOD\RFLQDGLiIDQD
2 niveles de regulacin: Pasillos y
YHQWDQDV
$QJXORDSHUWXUD[
3RVLELOLGDGGHPDQGRDGLVWDQFLD
3HUPHWGHFRQWU{OHUMXVTXjEDOODVWV'$/,
+DXWHXUPD[LPDOHP
PRGHVVDOOHGHFODVVHHWEXUHDXGLDSKDQH
QLYHDX[GHUpJODJH&RXORLUVHWIHQrWUHV
$QJOHRXYHUWXUH[
3RVVLELOLWpGHWpOpFRPPDQGH
&DQFRQWUROXSWR'$/,EDOODVWV
0D[LPXPKHLJKWP
PRGHVEULJKWRIFHDQGFODVVURRP
2 adjustment levels: Corridors and
ZLQGRZV
$QJOHRIRSHQLQJ[
5HPRWHFRQWURORSWLRQ
Control automtico de luminarias
Luminaires automatic control
Contrleur automatique de luminaires
Para grandes instalaciones existir
la posibilidad de utilizar los sistemas
GH UHJXODFLyQ GH OD OX] PiV VRVWL
FDGRVGHOPHUFDGR
Gracias a la tecnologia digital tipo
DALI, DSI, EIB, se podr controlar:
/D LQWHQVLGDG GHO XMR OXPLQRVR
HQFHQGLGRDSDJDGR SRU FRQWURO KR
rario, control individual de lumina
rias, realizacin de escenas, control
desde PC, control global de la insta
ODFLyQHWF
Debido a sus elevadas prestacio
nes, estos sistemas requieren un
estudio personalizado para cada
SUR\HFWR X REUD (O 'HSDUWDPHQWR
de Proyectos de LAMP, les asesora
r del sistema ms adecuado para
VXSUR\HFWR
Light regulation systems can be
XVHGIRUELJLQVWDOODWLRQV
Thanks to digital technology such as
DALI, DSI, EIB it can be controlled:
/XPLQRXVLQWHQVLW\2QRIIWLPHFRQ
trol, Control of individual luminaires,
Scene setting, PC control, Global
control of the installation, etc
Due to the high performance quali
ties, these systems require a perso
QDOL]HGVWXG\IRUHYHU\SURMHFWRUMRE
The LAMP Technical Department
will indicate the suitable system for
\RXUSURMHFW
Pour de grandes installations il y
DXUD OD SRVVLELOLWp GXWLOLVHU OHV V\V
tmes avec contrle de lumire les
SOXVVRSKLVWLTXpVGXPDUFKp
Grce a la technologie digital type
DALI, DSI, EIB on pourra contrler:
OLQWHQVLWpGXX[OXPLQHX[DOOXPDJH
RXOH[WLQFWLRQSDUXQFRQWU{OHXUKRUDL
re, contrle individuel des luminaires,
ralisation de scnes, contrle des
3& FRQWU{OH JOREDO GH OLQVWDOODWLRQ
etc
En raison de leur haute technicit,
ces systmes demandent une tude
personnalise pour chaque projet
RXFKDQWLHU/HVHUYLFHWHFKQLTXHGH
LAMP vous conseillera le systme le
SOXVDSSURSULpSRXUYRWUHSURMHW
Pulsador DALI con funciones de encendido/apagado y regulacin
DALI touch panel with On/Off and diming functions
Bouton DALI avec fonctions On/Off et rgulation
Permite controlar hasta 18
EDODVWRV'$/,
6HDOLPHQWDGLUHFWRDUHG
3DUDPRQWDMHVHPLHPSRWUDGR
HQVRSRUWHPHFDQLVPR
Permet de contrler jusqu' 18
EDOODVWV'$/,
'LUHFW9
0RQWDJHVHPLHQFDVWUpVXUOH
PpFDQLVPHGHVRXWLHQ
Can control control up to 18
'$/,EDOODVWV
Ballasts with main supply
FRQQH[LRQ
6HPLUHFHVVLQJPRXQWLQJLQ
VXSSRUWPHFKDQLVP
Cdigo Euros
280,00
N
154
'RPyWLFD
Controlador externo DMX
External controller DMX
Contrleur externe DMX
DMX (Digital Multiplexing) es un
protocolo digital de regulacin
de alta velocidad que puede
gobernar un mximo de 512
direcciones. Para poder contro-
lar las luminarias que integran
el sistema es necesario abrir
las luminarias para asignar las
direcciones DMX.
Mediante el software DMX
podemos personalizar escenas
segn necesidades y crear ml-
tiples y sugestivos efectos de
luz y color de una forma simple
e intuitiva.
Le DMX (Digital Multiplexing)
est un protocole numrique de
contrle haute vitesse qui peut
JpUHUMXVTXjDGUHVVHV
Pour contrler les luminaires qui
intgrent le systme, il est nces-
VDLUHGRXYULUOHVOXPLQDLUHVSRXU
assigner les adresses DMX.
On peut au moyen du logiciel
DMX personnaliser des scnes en
fonction des besoins et crer de
multiples et suggestifs effets de
lumire et de couleur de manire
simple et intuitive.
DMX (Digital Multiplexing) is a
high-speed regulation digital
protocol which it can govern a
maximum of 512 directions. In
order to be able to control the
luminaires which go to make up
the system, it is necessary to
open the luminaires to assign
the DMX directions.
By way of the DMX software
we can personalise scenes
according to need and create
multiple, suggestive light and
colour effects in simple, intuitive
fashion.
Cdigo (XURV
96.45.03.0 1.193,00
Pack de control por infrarrojos
Infrared control pack
Control pack infrarouge
Pack de control remoto para el
driver RGB (92.47.84.0).
Se compone de un receptor IR
(infrarrojos) y su mdulo interfa-
ce con el driver RGB.
El mando a distancia permite
un sencillo control de la
instalacin RGB, encendido y
apagado, ciclo automtico y
seleccin de colores.
Pack commande distance pour
driver RGB (92.47.84.0).
&RPSRVpGXQUpFHSWHXU,5LQIUD-
rouge) et de son module interface
avec driver RGB.

La tlcommande distance
permet un simple contrle de
OLQVWDOODWLRQ5*%DOOXPDJHHW
extinction, cycle automatique et
slection des couleurs.
Remote control Pack for RGB
driver (92.47.84.0).
Consists of an IR (Infrared) re-
ceiver and its interface module
with an RGB
driver.
The remote control allows easy
control of the RGB installation,
turning on and off, automatic
cycle
and colour selection.
Cdigo (XURV
92.47.84.0
92.47.85.0
91,50
125,50
92.47.84.0
92.47.85.0
Pack Control USB-DMX/RDM
Control Pack USB-DMX/RDM
Contrleur USB-DMX/RDM
Las luminarias Bauline y Shot
RGB se controlan mediante
protocolo DMX-RDM. DMX (Di-
gital Multiplexing) es un proto-
colo digital de regulacin de alta
velocidad que puede gobernar
un mximo de 512 direcciones.
Gracias a la bidireccionalidad
RDM (Remote Device Mana-
gement), no es necesario abrir
las luminarias para asignar las
direcciones DMX, facilitando as
la instalacin de las luminarias
y su programacin.
Les clairages Bauline et Shot
RGB sont contrls par un
protocole DMX-RDM. DMX (Digital
Multiplexing) est un protocole
numrique de rglage haute
vitesse qui peut contrler un maxi-
mum de 512 adresses. Grce
la bidirectionnalit RDM (Remote
'HYLFH0DQDJHPHQWLOQHVWSDV
QpFHVVDLUHGRXYULUOHVOXPLQDLUHV
pour attribuer les directions DMX,
HQIDFLOLWDQWDLQVLOLQVWDOODWLRQGH
ceux-ci et leur programmation.
Bauline and Shot RGB lumi-
naires are controlled with the
DMX-RDM system. DMX (Digi-
tal Multiplexing) is a high-speed
adjustment digital protocol that
can control up to 512 directions.
Thanks to its bidirectional
Remove Device Management,
the luminaries do not need to
be opened to assign the DMX
directions. This facilitates the
installation and programming of
luminaires.
Cdigo (XURV
96.40.79.0 775,00
230V
DMX IN
DMX OUT
D
M
X
IN
D
M
X
O
U
T
DRIVER
USB RDM/DMX
Controlador externo
(96.40.79.0)
CONTROL Y REGULACIN
T
Luminaria Master
Luminaria Master
230 V
DMX
DMX IN
PWM IN
DMX IN
DMX OU
DMX IN
PWM IN
PWM OUT
PWM OUT
Luminaria Master
Luminaria Esclava
Luminaria Esclava
CONTROLADOR
EXTERNO DMX
(96.45.03.0)
DMX
Para personalizar escenas utilizar software DMX
G
R
B
L
N
-
+ On/Of f
Color
Re d Green Blue White
Star t Stop
On/Off
Brightnes s
Speed
-
+
Mando a
distancia IR
Receptor IR
Mdulo interface
Pack de control remoto (92.47.85.0)
Driver RGB (92.47.84.0)
155
6LVWHPDVGH$OLPHQWDFLyQ
EQUIPOS
Equipo electromagntico para lmparas de Descarga compatible con MINI DUELAMP
Electromagnetic control gear for Discharge lamps compatible with MINI DUELAMP
Platine lectromagntique pour lampes Dcharge compatible avec le MINI DUELAMP
Equipos electrnicos para lmparas de Halogenuros Metlicos
Electronic control gear for Metal Halide lamps
Transformateur lectronique pour lampes Iodures Mtalliques
Equipos electrnicos para lmparas halgenas / LED
Electronic control gear for halogen lamps / LED lamp
Transformateur lectronique pour lampes halognes / LED
Fuente de alimentacin LED
LED power supplies
6RXUFHGDOLPHQWDWLRQSRXU/('
Equipo electromagntico clase II para lmparas de Descarga
Electromagnetic control gear clas II for Discharge lamps
Platine lectromagntique clase II pour lampes Dcharge
Equipos electromagnticos
Electromagnetic control gear
quipements lectromagntiques
Equipos electrnicos
Electronic control gear
quipements lectroniques
W Cdigo (XURV Lamp. V Kg h mm x mm y mm
35
70
150
100
92.07.78.0
92.07.72.0
92.07.73.0
92.07.71.0
65,00
64,50
72,50
156,00
HI
HI / HS
HI / HS
HS
230
230
230
230
3,0
2,1
3,2
3,0
97
97
97
97
174
174
174
174
131
131
131
131
W Cdigo (XURV Lamp. V Kg h mm x mm y mm
20
35
70
150
2x35
2x70
92.47.79.0
92.47.78.0
92.47.74.0
92.47.75.0
92.47.76.0
92.47.81.0
104,50
98,50
98,50
160,00
174,00
174,00
HI
HI
HI
HI
HI
HI
230
230
230
230
230
230
0,2
0,3
0,3
0,75
0,3
0,44
30
32
32
40
32
35
97
150
150
185
175
210
43
80
80
90
73
80
W Cdigo (XURV Lamp. V Kg h mm x mm y mm
10/60
35/105
92.47.71.0
92.47.77.0
14,00
21,00
LED / HALGENA
LED / HALGENA
12
12
0,1
0,1
21,5
28
110
128
36
38
W Cdigo (XURV Lamp. V Kg h mm x mm y mm
20
20
30
60
100
92.47.70.0
92.47.46.0
92.40.02.0
92.42.53.0
92.46.80.0
55,00
51,00
56,00
94,50
170,50
LED
LED
LED
LED
LED
12
24
24
24
24
0,13
0,13
0,3
0,45
0,63
19
19
31
36
30
146
146
133
192
241
55
55
40
87
43
W Cdigo (XURV Lamp. mA Kg h mm x mm y mm
max.9
max.15
10-18
max.24
92.47.73.0
92.47.82.0
92.47.47.0
92.47.80.0
34,00
34,00
60,00
48,50
LED
LED
LED
LED
350
350
350
700
0,1
0,06
0,11
0,1
28
19
28
28
117
115
140
138
50
34
44
40
W Cdigo (XURV Lamp. V Kg h mm x mm y mm
35
70
150
92.07.69.0
92.07.76.0
92.07.77.0
60,50
83,50
91,50
HI / HS
HI / HS
HI / HS
230
230
230
1,4
1,6
2,8
69
69
69
210
210
260
78
78
78
h
x
y
IP
20
Cable de conexin incorporado
Lamp conection cable incorpored
Cble de connexion inclus
Cable de conexin incorporado
Lamp conection cable incorpored
Cble de connexion inclus
Cable de conexin incorporado
Lamp conection cable incorpored
Cble de connexion inclus
01
IP
40
h
x
y
IP
20
x
h
y
100
100
SELV
equiv.
SELV
equiv.
IP
20
IP
20
M M
M M
x
h
y
h
x
y
N
N
156
%DOL]DV
Gris texturizado
Texturised grey
Gris textur
Antracita
Anthracite
Anthracite
B-SIDE LED
IP
65
IK
10
CLASE
I
850 Al
PC
DIFUSER
LED
Neutral
(TXLSR(OHFWUyQLFR
N LED W Cdigo Color Cdigo Color (XURV Kg lm LED
1
1
1,2
2,4
58.41.05.3
58.41.06.3
58.41.05.4
58.41.06.4
215,00
229,00
3,7
3,7
114
187
Baliza B-SIDE LED 850
B-SIDE LED 850 bollard
Borne B-SIDE LED 850
850
mm
(TXLSR(OHFWUyQLFR
N LED W Cdigo Color Cdigo Color (XURV Kg lm LED
1
1
1,2
2,4
58.41.15.3
58.41.16.3
58.41.15.4
58.41.16.4
209,50
223,00
2,8
2,8
114
187
Baliza B-SIDE LED 450
B-SIDE LED 450 bollard
Borne B-SIDE LED 450
450
mm
(TXLSR(OHFWUyQLFR
N LED W Cdigo Color Cdigo Color (XURV Kg lm LED
2 2,4 58.41.25.3 58.41.25.4 144,00 1,8 228
Baliza B-SIDE LED 135
B-SIDE LED 135 bollard
Borne B-SIDE LED 135
Tratamiento anti corrosivo Alodine 1200
Anticorrosive treatment Alodine 1200
Traitement anticorrosif Alodine 1200
135
mm
Posibilidad de LEDS de color
Possibility LED color
Possibilit LEDS couleur
157
%DOL]DV
850
mm
a
450
mm
a
250
mm
a
IP
65
IK
06
960 Al
GLASS
CLASE
I
TC-TSE
E 27
TC-TSE
E 27
CDM-Tm
PGJ5
CDM-Tm
PGJ5
CDM-Tm
PGJ5
TC-TE
GX24q-3
TC-TE
GX24q-3
HIT
G12
HIT
G12
HIT
G12
'LUHFWRDUHG
W Cdigo Color Cdigo Color (XURV Kg a
23 58.01.04.3 58.01.04.4 285,50 5,2 120
'LUHFWRDUHG
W Cdigo Color Cdigo Color (XURV Kg a
23 58.01.14.3 58.01.14.4 283,00 4,1 120
%DODVWR(OHFWUyQLFR
W Cdigo Color Cdigo Color (XURV Kg a
20
26
35
58.41.02.3
58.41.03.3
58.41.01.3
58.41.02.4
58.41.03.4
58.41.01.4
399,50
314,00
387,00
4,8
5,2
4,8
56
120
56
%DODVWR(OHFWUyQLFR
W Cdigo Color Cdigo Color (XURV Kg a
20
26
35
58.41.12.3
58.41.13.3
58.41.11.3
58.41.12.4
58.41.13.4
58.41.11.4
394,00
308,50
381,50
3,9
4,1
3,9
56
120
56
%DODVWR(OHFWUyQLFR
W Cdigo Color Cdigo Color (XURV Kg a
20
35
58.41.22.3
58.41.21.3
58.41.22.4
58.41.21.4
299,50
287,50
2,9
2,9
56
56
Baliza B-SIDE 850
B-SIDE 850 bollard
Borne B-SIDE 850
Baliza B-SIDE 450
B-SIDE 450 bollard
Borne B-SIDE 450
Baliza B-SIDE 250
B-SIDE 250 bollard
Borne B-SIDE 250
Accesorios
Accessories
Accessoires
Pantalla direccional 180
Directional screen 180
cran directionnel 180
Cdigo Color (XURV a
58.00.70.3
58.00.71.3
18,00
9,00
120
56
Tratamiento anti corrosivo Alodine 1200
Anticorrosive treatment Alodine 1200
Traitement anticorrosif Alodine 1200
a
Gris texturizado
Texturised grey
Gris textur
Antracita
Anthracite
Anthracite
B-SIDE
158
%DOL]DV
IP
54
IP
54
IK
08
IK
08
850
850
Al
Al
PC
DIFUSER
PC
DIFUSER
TC-TSE
E 27
TC-TSE
E 27
HIT
G12
HIT
G12
CLASE
I
CLASE
I
'LUHFWRDUHG
W Cdigo Color (XURV Kg
20 59.01.20.3 152,50 4,6
'LUHFWRDUHG
W Cdigo Color (XURV Kg
20 59.01.30.3 215,00 6,6
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
35 59.01.21.3 224,00 5,6
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
35 59.01.31.3 279,50 7,6
Baliza FAR 520
FAR bollard 520
Borne FAR 520
Baliza FAR 1000
FAR bollard 1000
Borne FAR 1000
FAR
520
mm
1000
mm
Gris texturizado
Texturised grey
Gris textur
159
%DOL]DV
STICK
IP
54
IP
54
IK
08
IK
08
850
850
Al
Al
PC
DIFUSER
PC
DIFUSER
TC-TSE
E 27
TC-TSE
E 27
CLASE
I
CLASE
I
'LUHFWRDUHG
W Cdigo Color (XURV Kg
20 59.01.00.3 82,00 1,2
'LUHFWRDUHG
W Cdigo Color (XURV Kg
20 59.01.10.3 102,50 1,6
Baliza STICK 350
STICK bollard 350
Borne STICK 350
Baliza STICK 600
STICK bollard 600
Borne STICK 600
350
mm
600
mm
Gris texturizado
Texturised grey
Gris textur
160
%DOL]DV
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg h mm
18
18
35
35
67.04.04.3
67.04.07.3
67.04.05.3
67.04.06.3
287,50
317,00
323,50
358,00
2,0
3,7
4,0
5,7
355
800
355
800
'LUHFWRDUHG
W Cdigo Color (XURV Kg h mm
60
60
67.04.08.3
67.04.09.3
284,50
316,50
2,0
3,7
355
800
Baliza BLOC con multiradiacin lateral
BLOC bollard with multiple distribution
Borne BLOC multi clairage latral
BLOC
IP
65
IP
65
IK
06
IK
06
960
960
Al
Al
GLASS
GLASS
CLASE
I
CLASE
I
TC-T
G24d-2
HIT
G12
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg h mm
18
18
35
35
67.01.04.3
67.01.07.3
67.01.05.3
67.01.06.3
215,50
244,00
252,50
268,50
2,0
3,7
4,0
5,7
355
800
355
800
'LUHFWRDUHG
W Cdigo Color (XURV Kg h mm
60
60
67.01.08.3
67.01.09.3
210,00
236,00
2,0
3,7
355
800
Baliza BLOC con radiacin lateral
BLOC bollard with lateral distribution
Borne BLOC clairage latral
TC-T
G24d-2
HIT
G12
A-60/A-65
E27
A-60/A-65
E27
Aletas antideslumbrantes incluidas
Antiglare louvre included
Grilles anti-blouissement inclues
Disponible en cristal opal
Available in opal glass
Disponible en verre opal
P.60 P.161 P.160
Gris oscuro texturizado + Gris texturizado
Textured dark grey + Texturised grey
Textur gris fonc + Gris textur
N LED W Cdigo Color (XURV Kg h mm lm LED
6
6
7,2
7,2
67.41.17.3
67.41.18.3
257,50
315,50
1,7
3,2
355
800
684
684
LED
Neutral
N
Baliza BLOC LED con radiacin lateral
BLOC LED bollard with lateral distribution
Borne BLOC LED clairage latral
Gris oscuro texturizado + Gris texturizado
Textured dark grey + Texturised grey
Textur gris fonc + Gris textur
161
$SOLTXHV
BLOC BLOC
P.60 P.161 P.160
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
18
35
67.01.03.3
67.01.00.3
242,50
277,50
2,0
3,6
'LUHFWRDUHG
W Cdigo Color (XURV Kg
60 67.01.02.3 234,50 1,7
Aplique BLOC de pared con radiacin directa extensiva
BLOC wall mounted luminaire with wide direct distribution
Applique murale BLOC clairage direct extensif
IP
65
IK
06
960 Al
GLASS
CLASE
I
TC-T
G24d-2
HIT
G12
A-60/A-65
E27
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
18
35
67.02.03.3
67.02.00.3
260,00
295,00
1,7
3,8
'LUHFWRDUHG
W Cdigo Color (XURV Kg
60 67.02.02.3 248,00 1,7
Aplique BLOC de pared con radiacin directa extensiva e indirecta intensiva
BLOC wall mounted luminaire with wide direct and narrow indirect distribution
Applique murale BLOC clairage direct extensif et indirect intensif
IP
65
IK
06
960 Al
GLASS
CLASE
I
TC-T
G24d-2
HIT
G12
A-60/A-65
E27
Gris texturizado
Texturised grey
Gris textur
162
$SOLTXHV
Aplique NIC-105 radiacin directa
NIC-105 direct radiation wall mounted luminaire
Applique murale NIC-105 clairage direct
Aplique NIC-105 radiacin directa e indirecta
NIC-105 direct-indirect radiation wall mounted luminaire
Applique murale NIC-105 clairage direct ou indirect
NIC-105
'LUHFWRDUHG
W Cdigo Color (XURV Kg
50 91.01.01.3 98,50 1,5 PAR20
E27
'LUHFWRDUHG
W Cdigo Color (XURV Kg
2x50 91.02.01.3 128,00 2,2 PAR20
E27
IP
65
IP
65
IK
09
IK
09
960
960
Al
Al
GLASS
GLASS
CLASE
I
CLASE
I
N LED W Cdigo Color (XURV Kg lm LED
6 7,2 91.41.05.3 272,50 1,2 684
N
LED
Neutral
N LED W Cdigo Color (XURV Kg lm LED
12 14,4 91.42.06.3 450,50 2 684(D)+684(I)
N
LED
Neutral
Gris texturizado
Texturised grey
Gris textur
163
$SOLTXHV
NIC-175
Downlight cilndrico NIC-175 de superfcie
NIC-175 cylinder surface mounted downlight
Downlight cylindrique NIC-175 de saillie
Aplique de pared NIC-175 radiacin directa
NIC-175 direct radiation wall mounted luminaire
Applique murale NIC-175 clairage direct
Aplique de pared NIC-175 radiacin directa e indirecta
NIC-175 direct-indirect radiation wall mounted luminaire
Applique murale NIC-175 clairage direct ou indirect
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
26
70
91.01.64.3
91.06.78.3
204,50
281,50
4,4
5
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
35
70
91.01.03.3
91.01.04.3
282,00
289,00
4,5
5,1
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
91.41.02.3 243,50 3,6
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
35
70
91.02.03.3
91.02.04.3
390,50
402,50
4,9
5,5
TC-D
G24d-3
HIT
G12
HIT
G12
TC-TE
GX24q-3/4
HIT
G12
IP
65
IP
65
IP
65
IK
09
IK
09
IK
09
960
960
960
Al
Al
Al
GLASS
GLASS
GLASS
CLASE
I
CLASE
I
CLASE
I
26/32/42
Gris texturizado
Texturised grey
Gris textur
164
$SOLTXHV
POINT
Aplique de pared POINT con difusor de policarbonato
POINT wall mounted luminaire with polycarbonate diffuser
Applique murale POINT avec diffuseur polycarbonate
Aplique asimtrico de pared POINT con difusor de policarbonato
POINT assymetric wall mounted luminaire with polycarbonate diffuser
Applique asymtrique murale POINT avec diffuseur polycarbonate
Aplique de pared POINT con difusor de policarbonato y reja de proteccin
POINT wall mounted luminaire with polycarbonate diffuser and protection grid
Applique murale POINT avec diffuseur polycarbonate et grille de protection
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Xmm Ymm Portalmp.
1x9
1X18
2X26
74.41.01.3
74.41.00.3
74.42.00.3
36,00
82,00
144,00
0,5
1,8
3,9
132
265
360
55
125
170
GX53
G24q-2
G24q-3
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Xmm Ymm Portalmp.
1x9
1X18
2X26
74.41.11.3
74.41.10.3
74.42.10.3
37,00
87,50
152,00
0,5
2,0
4,2
132
265
360
55
125
170
GX53
G24q-2
G24q-3
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Xmm Ymm Portalmp.
1x9
1X18
2X26
74.41.21.3
74.41.20.3
74.42.20.3
37,00
88,00
155,50
0,5
2,0
4,2
132
265
360
55
125
170
GX53
G24q-2
G24q-3
IP
65
IP
65
IP
65
IK
08
IK
08
IK
08
850
850
850
Al
Al
Al
PC
DIFUSER
PC
DIFUSER
PC
DIFUSER
CLASE
I
CLASE
I
CLASE
I
827
TC-DE
G24q-2/3
Gx53
827
TC-DE
G24q-2/3
Gx53
827
TC-DE
G24q-2/3
Gx53
165
$SOLTXHV
B-SIDE LED
IP
65
IK
10
CLASE
I
850 Al
PC
DIFUSER
LED
Neutral
Aplique / Baliza B-SIDE LED 135
B-SIDE LED 135 wall mounted / bollard
Applique murale / borne B-SIDE LED 135
Tratamiento anti corrosivo Alodine 1200
Anticorrosive treatment Alodine 1200
Traitement anticorrosif Alodine 1200
135
mm
Gris texturizado
Texturised grey
Gris textur
Antracita
Anthracite
Anthracite
N LED W Cdigo Color Cdigo Color (XURV Kg lm LEDS
2 2,4 58.41.25.3 58.41.25.4 144,00 1,8 228
Posibilidad de LEDS de color
Possibility LED color
Possibilit LEDS couleur
166
(PSRWUDEOHV
BAULINE E
IK
09
Al
IP
67
GLASS
INOX
AISI 304
960 LED
N LED W Cdigo Color (XURV Kg K L mm lm LED
20
20
20
20
40
40
40
40
23
23
23
23
46
46
46
46
57.01.52.3
57.01.53.3
57.01.54.3
57.01.55.3
57.01.62.3
57.01.63.3
57.01.64.3
57.01.65.3
536,50
536,50
536,50
536,50
949,00
949,00
949,00
949,00
2,3
2,3
2,3
2,3
4,3
4,3
4,3
4,3
Spot
Spot
MFL
MFL
Spot
Spot
MFL
MFL
Warm
Neutral
Warm
Neutral
Warm
Neutral
Warm
Neutral
679
679
679
679
1268
1268
1268
1268
1748
2280
1748
2280
3496
4560
3496
4560
BAULINE para empotrar
Recessing BAULINE
BAULINE a encastrer
57.00.13.3
57.00.14.3
24V
24V
80
3
9
1
0
0
80
J
Caja empotramiento BAULINE sin equipo
BAULINE recessing box without gear
%RvWLHUGHQFDVWUHPHQW%$8/,1(VDQVpTXLSHPHQW
Cdigo (XURV L mm
57.00.11.3
57.00.12.3
52,00
72,00
683
1272
7
2
72
Caja empotramiento BAULINE con equipo
BAULINE recessing box with gear
%RvWLHUGHQFDVWUHPHQW%$8/,1(SRXUpTXLSHPHQW
Cdigo (XURV L mm
57.00.01.3
57.00.02.3
51,50
77,00
683
1272
1
0
7
72
Equipo externo BAULINE
BAULINE external gear
quipement externe BAULINE
Cdigo Color (XURV Kg L mm
25 (24V)
60 (24V)
57.00.13.3
57.00.14.3
120,00
150,00
1,1
1,4
350
350
6
4
50
W
IK
10
CLASE
I
Al
IP
67
J
J
Para ms informacin ver pgina 154
For more information page 154
3RXUSOXVGLQIRUPDWLRQYRLUSDJH
Pack Control USB-DMX/RDM
Control Pack USB-DMX/RDM
Contrleur USB-DMX/RDM
Cdigo (XURV
96.40.79.0 775,00
Caja empotramiento BAULINE con equipo
BAULINE recessing box with gear
%RvWLHUGHQFDVWUHPHQW%$8/,1(SRXUpTXLSHPHQW
Cdigo (XURV L mm
57.00.01.3
57.00.02.3
51,50
77,00
683
1272
1
0
7
72
Para ambientes salinos se recomienda INOX 316
For ambient saline it is recommended INOX 316
Pour des atmosphres salines il est recommand
INOX 316
IK
09
CLASE
I
Al
IP
67
DMX
RDM
GLASS
INOX
AISI 304
960
LED
RGB
N LED W RGB Cdigo Color (XURV Kg K L mm lm LED
6
12
19,2
38,4
57.41.51.3
57.41.61.3
751,00
1028,50
3,5
5,5
MFL
MFL
RGB
RGB
680
1268
630
1260
BAULINE RGB para empotrar con equipo
Recessing BAULINE RGB with included gear
BAULINE RGB a encastrer avec quipement
1
0
0
80
Para ambientes salinos se recomienda INOX 316
For ambient saline it is recommended INOX 316
Pour des atmosphres salines il est recommand
INOX 316
Acero inoxidable AISI 304
Stainless steel AISI 304
Acier inoxydable AISI 304
167
(PSRWUDEOHV
STEP
IP
67
IK
09
CLASE
I
960
INOX
AISI 304
mx
1000 Kg
OPAL
GLASS
GLASS
Al
T5/T16
G5
(TXLSR(OHFWUyQLFR7+(+2
Simtrica Symetric Symtrique
W Cdigo Color (XURV Kg T cristal L mm
1x14/24
1x28/54
68.41.02.3
68.41.03.3
335,50
484,00
3,5
6,0
45
60
720
1320
(TXLSR(OHFWUyQLFR7+(+2
Asimtrica Assymetric Asymtrique
W Cdigo Color (XURV Kg T cristal L mm
1x14/24
1x28/54
68.41.05.3
68.41.06.3
313,50
480,00
3,5
6,0
35
50
720
1320
Luminaria STEP IP 67 para empotrar con ptica simtrica
67(3,3IRURRUUHFHVVLQJZLWKV\PPHWULFRSWLFV
Luminaire STEP IP 67 a encastrer avec optique symtrique
Para ambientes salinos se recomienda INOX 316
For ambient saline it is recommended INOX 316
Pour des atmosphres salines il est recommand
INOX 316
Para ambientes salinos se recomienda INOX 316
For ambient saline it is recommended INOX 316
Pour des atmosphres salines il est recommand
INOX 316
IP
67
IK
09
CLASE
I
mx
1000 Kg GLASS
960
INOX
AISI 304
Al
TC-L
2 G 11
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg T cristal L mm
18 68.41.07.3 219,50 1,7 40 370
Luminaria STEP IP 67 para empotrar asimtrica y aletas antideslumbrantes
67(3,3IRURRUUHFHVVLQJDVV\PHWULFDQGDQWLJODUHORXYUH
Luminaire STEP IP 67 a encastrer, asymtrique et grilles anti-blouissement
Para ambientes salinos se recomienda INOX 316
For ambient saline it is recommended INOX 316
Pour des atmosphres salines il est recommand
INOX 316
Acero inoxidable AISI 304
Stainless steel AISI 304
Acier inoxydable AISI 304
Caja de empotramiento
Recessing box
%RvWLHUGHQFDVWUHPHQW
Cdigo Color (XURV L mm
68.08.70.3
68.08.71.3
68.08.72.3
37,50
46,50
63,50
370
720
1320
95 mm
mm
95 mm
mm
Evite su colocacin en depresiones del terreno
Avoid its placing in ground depression
(YLWH]OLQVWDOODWLRQVXUXQWHUUDLQHQSHQWH
18W
24W
Accesorios
Accessories
Accessoires
54W
Luminaria STEP IP 67 para empotrar con ptica asimtrica
67(3,3IRURRUUHFHVVLQJZLWKDV\PPHWULFRSWLFV
Luminaire STEP IP 67 a encastrer avec optique asymtrique
90 90
168
(PSRWUDEOHV
GAP
Uplight / Downlight GAP orientable y basculante
Directional and adjustable Uplight / Downlight GAP
Uplight / Downlight GAP orientable et basculant
HIT
G12
&ODVH,(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
20
35
70
93.41.56.3
93.41.57.3
93.41.58.3
386,50
386,50
386,50
4,1
4,2
4,2
8SOLJKW'RZQOLJKW*$3MRDVLPpWULFR2ULHQWDEOHHQHMHYHUWLFDO
Fixed asimetric Uplight / Downlight GAP (Directional vertical axis)
8SOLJKW'RZQOLJKW*$3[HDV\PpWULTXH2ULHQWDEOHD[HYHUWLFDO
CDM-Tm
PGJ5
HIT
G12
&ODVH,,(TXLSR(OHFWUyQLFRH[WHUQR
W Cdigo Color (XURV Kg
20
20
35
35
70
70
93.41.60.3
93.41.61.3
93.41.62.3
93.41.63.3
93.41.64.3
93.41.65.3
490,00
490,00
490,00
490,00
490,00
490,00
4,1
4,1
4,2
4,2
4,2
4,2
Spot
Flood
Spot
Flood
Spot
Flood
CDM-Tm
PGJ5
8SOLJKW'RZQOLJKW*$3MR
Fixed Uplight / Downlight GAP
8SOLJKW'RZQOLJKW*$3[H
&ODVH,(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
18 93.41.59.3 322,00 4 WFL TC-D
G24
&ODVH,,(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
18 93.41.69.3 350,00 4 WFL TC-D
G24
HIT
G12
&ODVH,(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
20
20
35
35
70
70
9341503
9341513
9341523
9341533
9341543
9341553
386,50
386,50
386,50
386,50
386,50
386,50
4,1
4,1
4,2
4,2
4,2
4,2
Spot
Flood
Spot
Flood
Spot
Flood
CDM-Tm
PGJ5
HIT
G12
&ODVH,,(TXLSR(OHFWUyQLFRH[WHUQR
W Cdigo Color (XURV Kg
20
35
70
93.41.66.3
93.41.67.3
93.41.68.3
490,00
490,00
490,00
4,1
4,2
4,2
CDM-Tm
PGJ5
IP
67
IK
10
Al
355
INOX
AISI 304
30
mx
2000 Kg
960
GLASS
GLASS
GLASS
GLASS
GLASS
GLASS
GLASS
GLASS
OPAL
GLASS
OPAL
GLASS
NEW
Acero inoxidable AISI 304
Stainless steel AISI 304
Acier inoxydable AISI 304
IP
67
IK
10
mx
2000 Kg
Al
355
960
INOX
AISI 304
ero inoxidable AISI 304
inless steel AISI 304
er inoxydable AISI 304
163
230 mm
107
344
169
(PSRWUDEOHV
GAP LED
IK
10
Al
GLASS
IP
67
30
960
INOX
AISI 304
LED
355
mx
2000 Kg
&ODVH,
N LED W Cdigo Color (XURV Kg K lm LED
5
5
5
5
10
10
10
10
10
11
11
11
11
19
19
19
19
30
93.41.70.3
93.41.71.3
93.41.72.3
93.41.73.3
93.41.74.3
93.41.75.3
93.41.76.3
93.41.77.3
93.41.78.3
547,50
547,50
547,50
547,50
644,00
644,00
644,00
644,00
DFRQVXOWDU
4,3
4,3
4,3
4,3
4,4
4,4
4,4
4,4
4,5
Warm
Neutral
Warm
Neutral
Warm
Neutral
Warm
Neutral
RGB
Spot
Spot
MFL
MFL
Spot
Spot
MFL
MFL
-
1.000
1.065
1.000
1.065
2.000
2.130
2.000
2.130
1060
Uplight / Downlight GAP LED orientable y basculante
Directional and adjustable Uplight / Downlight GAP LED
Uplight / Downlight GAP LED orientable et basculant
&ODVH,,
N LED W Cdigo Color (XURV Kg K lm LED
5
5
5
5
10
10
10
10
11
11
11
11
19
19
19
19
93.41.80.3
93.41.81.3
93.41.82.3
93.41.83.3
93.41.84.3
93.41.85.3
93.41.86.3
93.41.87.3
589,00
589,00
589,00
589,00
689,00
689,00
689,00
689,00
4,3
4,3
4,3
4,3
4,4
4,4
4,4
4,4
Warm
Neutral
Warm
Neutral
Warm
Neutral
Warm
Neutral
Spot
Spot
MFL
MFL
Spot
Spot
MFL
MFL
1.000
1.065
1.000
1.065
2.000
2.130
2.000
2.130
Accesorios GAP/GAP LED
Accessories GAP/GAP LED
Accessoires GAP/GAP LED
Posibilidad de aro embellecedor
Possibility of DQJHVWDLQOHVV
Possibilit de collerette inox
Buffer antideslumbrante HIT - G12
Anti-glare Buffer HIT - G12
Buffer anti-blouissement HIT - G12
Cdigo (XURV
93.00.28.2 DFRQVXOWDU
KIT Zona accesible
KIT accessible zone
KIT Zone accessible
Cdigo (XURV
93.00.26.0 30,00
*
NEW
Acero inoxidable AISI 304
Stainless steel AISI 304
Acier inoxydable AISI 304
Aro empotramiento falso techo
Recess ceiling ring
Anneau plafond encastr
Cdigo (XURV
93.00.27.3 70,00
Mx.30mm
Caja de empotramiento hormign
Concrete recessed box
Boitier encastrement bton
Cdigo (XURV
93.00.25.2 70,00
514
304
163
230 mm
344
107
Posibilidad de otras pticas
Possibility of other optics
3RVVLELOLWpGRSWLTXHVGLIIHUHQWHV
6XSHUVSRW:LGHRRG(OtSWLFDO
S
GA
Pack Control USB-DMX/RDM
Control Pack USB-DMX/RDM
Contrleur USB-DMX/RDM
Cdigo (XURV
96.40.79.0 775,00
Para ms informacin ver p. 154
For more information p. 154
3RXUSOXVGLQIRUPDWLRQYRLUS
DMX
RDM
255
INOX
AISI 304
Acero inoxidable AISI 304
Stainless steel AISI 304
Acier inoxydable AISI 304
IP
68
IK
08
IK
08
IK
09
CLASE
I
CLASE
I
INOX
AISI 304
INOX
AISI 304
IP
65
IP
65
80
PC
DIFUSER
GLASS
GLASS
mx
600 Kg
960
960
960
mx
1000 Kg
mx
2000 Kg
mx
2000 Kg
HIT
G12
HIT
G12
INOX
AISI 304
LED
SIGN
165
260
UPLIGHTS
N LED W Cdigo Color (XURV Kg T cristal luz
9
9
1
1
93.01.09.0
93.01.09.5
165,50
165,50
0,2
0,2
40
40
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg T cristal
70
150
93.01.02.3
93.01.03.3
330,00
342,00
6,5
7,3
150
160
90
90
Para ambientes salinos se recomienda INOX 316
For ambient saline it is recommended INOX 316
Pour des atmosphres salines il est recommand
Caja de empotramiento incluida
Recessing box included
%RvWLHUGHQFDVWUHPHQWLQFOXV
Caja de empotramiento incluida
Recessing box included
%RvWLHUGHQFDVWUHPHQWLQFOXV
Caja de empotramiento incluida
Recessing box included
%RvWLHUGHQFDVWUHPHQWLQFOXV
UPLIGHT exterior para lmparas LEDS de sealizacin
Exterior UPLIGHT for signaling LEDs lamps
UPLIGHT exterieur pour lampes LEDS de signalisation
UPLIGHT IP65 exterior orientable
Directional exterior UPLIGHT IP65
UPLIGHT IP65 extrieur orientable
1m H07RN-F
;
1m H07RN-F
;
min. 150 mm min. 150 mm
min.
300
mm
Se recomienda una capa de grava, alrededor de la caja del uplight, para
un drenaje correcto. Evite su colocacin en depresiones del terreno.

It is recommended a crushed stone surounding all around the uplight box
for a correct drainage. Avoid its placing in ground depression.
Pour un drainage correct, il est recommand une chape de gravier autour
HWHQIRQGGXERvWLHUGHQFDVWUHPHQWGXXSOLJKW(YLWH]OLQVWDOODWLRQ
Tapa para uplight
Cover for uplight
Plaque pour encastr
Cdigo Color (XURV
93.06.40.2 17,50
TC-TSE
E 27
QT 12
GY6,35
TC-TE
GX24q-2
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg T cristal
20
50
18
93.01.05.3
93.01.10.0
93.01.11.0
160,00
194,50
198,50
2,3
2,4
2,3
65
145
70
114
36
100
83/,*+7,3H[WHULRUMR
Fixed exterior UPLIGHT IP65
83/,*+7,3H[WpULHXU[H
170
(PSRWUDEOHV
*
*
171
Empotrables
IK
10
CLASE
I
Al
IP
67
355
960
GLASS
30
UPLIGHTS
Caja de empotramiento incluida
Recessing box included
Botier d'encastrement inclus
UPLIGHT IP67 exterior orientable
Directional exterior UPLIGHT IP67
UPLIGHT IP67 extrieur orientable
mx
2000 Kg
1m H07RN-F
(3 X 1'5)
Accesorios IP67
Accessories IP67
Accessoires IP67
Aro embellecedor INOX 304
Flange stainless
Collerette inox
Cristal media luna
Semi-opal glass
Verre demi-opal
Rejilla antideslumbrante HIT-G12
Anti-glare louvre HIT-G12
Grille anti-blouissante HIT-G12
Cristal Opal
Opal glass
Verre Opal
Anti-deslizante
Nonskid
Anti-drapant
Filtros de color
&RORUOWHUV
Filtres couleur
Cdigo Euros
93.06.11.3 138,50
Cdigo Euros
93.06.14.0 90,00
Cdigo Euros
93.06.15.0 68,00
Cdigo Euros
93.06.13.0 90,00
Cdigo Euros
93.06.12.0 90,00
Cdigo Color Euros
93.06.21.8
93.06.21.5
93.06.21.6
93.06.21.7
51,50
51,50
51,50
51,50
KIT Zona accesible
KIT accessible zone
KIT Zone accessible
No compatible con 150W
*
Cdigo Euros
93.06.10.0 162,00
TC-TE
GX24q-3/4
Equipo Electrnico
W Cdigo Color Euros Kg T cristal T Kit
1x26
/ 32
/ 42
93.41.30.3 537,00 7,8
58
70
101
37
52
68
114
Caja de empotramiento incluida
Recessing box included
Botier d'encastrement inclus
83/,*+7,3H[WHULRUMR
Fixed exterior UPLIGHT IP67
83/,*+7,3H[WpULHXU[H
*
Para ambientes salinos se recomienda INOX 316
For ambient saline it is recommended INOX 316
Pour des atmosphres salines il est recommand INOX 316
Gris negruzco mate
Matte black grey
Gris noir mat
No compatible con 93.01.30.3
LED
Cool
N LED W Cdigo Color Euros Kg T cristal T Kit lm LED
24 30 93.41.24.3 1500,00 8 40 - 32 2400
*
UPLIGHT LED IP67 exterior orientable
Directional exterior UPLIGHT LED IP67
UPLIGHT LED IP67 extrieur orientable
Caja de empotramiento incluida
Recessing box included
Botier d'encastrement inclus
Conector de tres polos IP68
Connector of three poles IP68
Connecteur de trois ples IP68
Cdigo Color Euros mm
96.00.17.0
96.00.18.0
27,50
37,00
8-10
6,5-12
HIT
G12
HIT-DE
RX7s
HST-DE
RX7s
HIT-DE
RX7s-24
HST-DE
RX7s-24
Equipo Electromagntico
W Cdigo Color Euros Kg T cristal T Kit
35
35
35
35
70
70
70
70
150
150
150
150
70
150
93.01.18.3
93.01.12.3
93.01.13.3
93.01.19.3
93.01.20.3
93.01.14.3
93.01.15.3
93.01.21.3
93.01.22.3
93.01.16.3
93.01.17.3
93.01.23.3
93.01.31.3
93.01.32.3
531,50
531,50
531,50
531,50
539,50
539,50
539,50
539,50
614,00
614,00
614,00
614,00
539,50
614,00
8,6
8,6
8,6
8,6
8,9
8,9
8,9
8,9
9,8
9,8
9,8
9,8
7,5
7,5
79
79
79
87
120
120
120
129
187
187
187
195
118
167
54
54
54
62
78
78
73
95
-
-
-
-
91
-
8
14
40
50
8
14
40
50
8
14
40
50
96
96
*
*Para garantizar la estanquidad IP65 es necesario utilizar cajas de empotramiento
In order to guarantee the water tightness IP65 it is necessary to use recessing boxes
3RXUJDUDQWLUOpWDQFKpLWp,3LOHVWQpFHVVDLUHGXWLOLVHUGHVERLWLHUVGHQFDVWUHPHQW
*
*
*
*
172
(PSRWUDEOHV
XTREMA
/XPLQDULD;75(0$SDUDHPSRWUDUFRQR/('VGHSUR\HFFLyQ
;75(0$UHFHVVHGOXPLQDLUHZLWKRU/('VRISURMHFWLRQ
/XPLQDLUH;75(0$SRXUHQFDVWUHUDYHFRX/('VGHSURMHFWLRQ
IK
08
INOX
AISI 304
IP
65
350 mA
850
35

Wide
Flood
PMMA
DIFUSER
LED
N LED W Cdigo Color (XURV Kg luz K lm LED
2
2
3
2
2,4
2,4
3,2
2,4
98.02.05.3
98.02.06.3
98.02.07.3
98.02.08.3
56,00
56,00
75,00
56,00
0,1
0,1
0,1
0,1
Cool
Warm
RGB
-
214
161
84
-
Caja empotramiento XTREMA 80
XTREMA 80 recessing box
%RvWLHUGHQFDVWUHPHQW;75(0$
Cdigo (XURV Kg L mm
98.00.97.3 64,00 0,47 85 suelo
42
mm
21
33
Luminaria XTREMA 80 para empotrar con 6 LEDs de proyeccin
;75(0$UHFHVVHGOXPLQDLUHZLWK/('VRISURMHFWLRQ
/XPLQDLUH;75(0$SRXUHQFDVWUHUDYHF/('VGHSURMHFWLRQ
IP
65
IK
08
350 mA
PMMA
DIFUSER
850
57
INOX
AISI 304
LED
N LED W Cdigo Color (XURV Kg K lm LED
6
6
6
6
7,2
7,2
7,2
7,2
98.06.15.3
98.06.16.3
98.06.17.3
98.06.18.3
187,00
187,00
195,00
195,00
0,4
0,4
0,4
0,4
VWFL
VWFL
MFL
MFL
Neutral
Warm
Neutral
Warm
684
524
684
524
56
56
80
mm
Acero inoxidable
Stainless steel
Acier inoxydable
Pack de control por infrarojos
Infrared control pack
Control pack infrarouge
Cdigo (XURV
92.47.85.0 125,50
Caja empotramiento XTREMA 40
XTREMA 40 recessing box
%RvWLHUGHQFDVWUHPHQW;75(0$
Cdigo (XURV Kg L mm
98.00.99.3
98.00.98.3
19,00
10,00
0,04
0,03
80 suelo
40 pared
L
44
37
L
80
Convertidor DMX - DALI
DMX - DALI converter
Convertisseur DMX - DALI
Cdigo (XURV
92.47.86.0 82,00
Conectores 3 polos IP67
Connector of 3 poles IP67
Connecteur de 3 ples IP67
Cdigo (XURV
96.00.98.0 36,00
Driver led RGB y Monocolor
RGB and one-color led driver
Driver led RGB et Monocouleur
Cdigo (XURV
92.47.84.0 91,50
Accesorios
Accessories
Accessoires
1 unid. - 13 Xtrema 40 or 4 Xtrema 40 RGB
1 unid. - 4 Xtrema 80
Para ms informacin ver pgina 154
For more information page 154
3RXUSOXVGLQIRUPDWLRQYRLUSDJH
1 unid. - 50 drivers 92.47.84.0
(p.155)
(p.155)
IP
65
IP
65
173
(PSRWUDEOHV
XTREMA SIGN
Luminaria XTREMA SIGN para empotrar con 9 LEDs de sealizacin
;75(0$6,*1OXPLQDLUHUHFHVVHGOXPLQDLUHZLWK/('VRIVLJQDOLQJ
/XPLQDLUH;75(0$6,*1SRXUHQFDVWUHUDYHF/('VGHVLJQDOLVDWLRQ
Para ambientes salinos se recomienda INOX 316
For ambient saline it is recommended INOX 316
Pour des atmosphres il est recommand INOX 316
IP
67
IK
09
24V
OPAL
GLASS
960
INOX
AISI 304
LED
SIGN
N LED W Cdigo Color (XURV Kg luz K
9
9
9
9
0,5
0,5
0,5
0,5
98.01.40.0
98.01.40.5
98.01.40.6
98.01.40.8
70,00
70,00
70,00
70,00
0,4
0,4
0,4
0,4
Cool
-
-
-
(p.155)
Caja de empotramiento incluida
Recessing box included
%RvWLHUGHQFDVWUHPHQWLQFOXV
174
(PSRWUDEOHV
URBAN 65
N
Baador de pared MINI URBAN 65 para empotrar
MINI URBAN 65 recessed wall luminaire
Applique encastr e murale MINI URBAN 65 asymtrique
IP
65
IK
08
Al
960
GLASS 106 x 106
TC-DE
G24q-3
HIT
G12
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg L
26 98.41.01.3 159,50 2,8 90
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg L
35 98.01.02.3 260,50 2,8 145
Caja de empotramiento incluida
Recessing box included
%RvWLHUGHQFDVWUHPHQWLQFOXV
QT 9
G4
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
20 98.01.03.3 18,00 0,7
'LUHFWRDUHG
N LED W Cdigo Color (XURV Kg lm LED K
1
1
4
4
98.01.04.3
98.01.05.3
51,00
51,00
0,7
0,7
200
200
Cool
Warm
Baador de pared URBAN 65 para empotrar
URBAN 65 recessed wall luminaire
Applique encastr e murale URBAN 65 asymtrique
IP
65
IK
08
CLASE
I
960 Al
GLASS 247 x 273
Caja de empotramiento incluida
Recessing box included
%RvWLHUGHQFDVWUHPHQWLQFOXV
120 mm
120
105
90
75
10
LED
12V
CLASE
I
Gris texturizado
Texturised grey
Gris textur
175
/XPLQDULDV
BAULINE AIR
IK
10
Al
IP
67
PC
DIFUSER
850 LED
N LED W Cdigo Color (XURV Kg K L mm lm LED
20
20
20
20
40
40
40
40
23
23
23
23
46
46
46
46
57.01.72.3
57.01.73.3
57.01.74.3
57.01.75.3
57.01.82.3
57.01.83.3
57.01.84.3
57.01.85.3
484,50
484,50
484,50
484,50
861,50
861,50
861,50
861,50
1,2
1,2
1,2
1,2
2
2
2
2
Spot
Spot
MFL
MFL
Spot
Spot
MFL
MFL
Warm
Neutral
Warm
Neutral
Warm
Neutral
Warm
Neutral
650
650
650
650
1240
1240
1240
1240
1748
2280
1748
2280
3496
4560
3496
4560
Luminaria BAULINE AIR
BAULINE AIR luminaire
Luminaire BAULINE AIR
57.00.13.3
57.00.14.3
24V
24V
Accesorios
Accessories
Accessoires
50
3
5
IK
10
CLASE
I
Al
IP
67
DMX
RDM
PC
DIFUSER
850
LED
RGB
N LED W RGB Cdigo Color (XURV Kg K L mm lm LED
6
12
19,2
38,4
57.41.71.3
57.41.81.3
720,00
970,00
2,4
3,3
MFL
MFL
RGB
RGB
650
1240
630
1260
Luminaria BAULINE AIR RGB con equipo
BAULINE AIR luminaire RGB with included gear
Luminaire BAULINE AIR RGB saillie avec quipement
30
9
5
50
Soporte a pared
Wall support
Support mural
Cdigo (XURV
57.00.04.3 22,00 30
Pack Control USB-DMX/RDM
Control Pack USB-DMX/RDM
Contrleur USB-DMX/RDM
Cdigo (XURV
96.40.79.0 775,00
Para ms informacin ver p. 154
For more information p. 154
3RXUSOXVGLQIRUPDWLRQYRLUS
J
Equipo externo BAULINE
BAULINE external gear
quipement externe BAULINE
W Cdigo Color (XURV Kg L mm
25 (24V)
60 (24V)
57.00.13.3
57.00.14.3
120,00
150,00
1,1
1,4
350
350
6
4
50
IK
10
CLASE
I
Al
IP
67
J
30
9
5
50
J
6RSRUWHQDORULHQWDEOH
$GMXVWDEOHQDOVXSSRUW
6XSSRUWQDORULHQWDEOH
Cdigo (XURV
57.00.03.3 36,00
180
2 unit. / ref.
Soporte pared orientable y extensible
Wall support adjustable - extensibe
Support mural orientable - extensible
Cdigo (XURV
96.00.05.3 119,50
Soporte a pared orientable
Wall support adjustable
support mural orientable
2 unit. / ref.
Cdigo (XURV
96.00.06.3 60,50
0
+90
-90
120 mm
0
+90
-90
280 - 380 mm
Anodizado plata mate
Anodized matte silver
Anodis argent mat
176
/XPLQDULDV
STEP AIR
IP
65
IK
10
CLASE
I
PC
DIFUSER
TC-L
2 G 11
T5/T16
G5
T5/T16
G5
Al 850
(TXLSR(OHFWUyQLFR
Simtrica Symetric Symtrique
W Cdigo Color (XURV Kg L mm
55/80
1x14/24
1x28/54
68.42.20.3
68.42.21.3
68.42.22.3
188,00
216,50
272,00
2,3
2,2
4,3
745
705
1305
Asimtrica Assymetric Asymtrique
W Cdigo Color (XURV Kg L mm
1x14/24
1x28/54
68.42.23.3
68.42.24.3
205,00
274,50
2,2
4,3
705
1305
Luminaria STEP IP65
STEP IP65 luminaire
Luminaire STEP IP65
Gris satinado
Gloss gray
Gris satin
177
/XPLQDULDV
STEP AIR
Unin soporte corto pared
Short wall bracket
Jonction support court mural
Accesorios y Suspensiones
Accessories and Suspensions
Accessoires et Suspensions
Cable de acero regulable niquelado
Height-adjustable nickel steel cable
Suspension chrome rglable
1 unit. / ref.
Se necesitan 2 unit. / lum.
Unin lnea continua
Continous line union
Union ligne continue
Cdigo Color (XURV
96.07.45.3 35,00
Conector IP68 6,5-12 mm para derivaciones
IP68 connector 6,5-12 mm for branching
Connecteur IP 68 6,5-12 mm pour drivations
Cdigo Color (XURV
96.00.18.0 37,00
Cdigo Color mm (XURV
96.01.31.3
96.01.34.3
1000
4000
15,50
17,00
1 Step
2 Step
$EUD]DGHUDVGHDOXPLQLR6WHSSDUDFROXPQDPP
67(3DOXPLQLXPDQFKRUDJHIRUPPFROXPQ
$QFUDJHHQDOXPLQLXP67(3SRXUPkWPP
Cdigo Color (XURV Kg
96.07.47.3
96.07.48.3
179,00
284,00
1,65
2,20
Cdigo Color (XURV
96.06.02.3 3,00
6RSRUWHSDUDDGRVDUVXSHUFLHV
Support for surface mounting
Support pour adosser aux surfaces
Cdigo Color (XURV
96.08.49.3 17,50
2 unit. / ref.
75
mm
Soporte a pared orientable y extensible
Wall support adjustable and extensible
Support mural orientable et extensible
Cdigo Color (XURV
96.00.05.3 119,50
2 unit. / ref.
0
+90
-90
min. 30 cm
max. 40 cm
Soporte pared orientable
Wall support adjustable
support mural orientable
Cdigo Color (XURV
96.00.06.3 60,50
2 unit. / ref.
0
+90
-90
mm
Sistema vial brazo intermedio individual 1 Step
Intermediate support for road system 1 Step
Eclariage public support intermdiaire individuel 1 Step
Cdigo Color (XURV mm Kg
96.01.35.3 189,50 870 6
Para columnas min. 80 - max. 120 mm
For columns min. 80 - max. 120 mm
Pour mts min. 80 - max. 120 mm
Conector IP68 8-10 mm
IP68 connector 8-10 mm
Connecteur IP68 8-10 mm
Cdigo Color (XURV
96.00.17.0 27,50
Aplique MICRO PROA con ptica peatonal
0,&52352$ZDOOWWLQJZLWKSHGHVWULDQRSWLFV
Applique murale MICRO PROA avec optique pitonnier
178
/XPLQDULDV
MICRO PROA
HIT
G12
CDM-Tm
PGJ5
TC-TE
GX24q-2
TC-TE
GX24q-3
max.
90
0
max.
90
960
GLASS
Al
CLASE
I
IK
07
IP
65
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
35
20
35
18
26
66.41.16.3
66.41.17.3
66.41.18.3
66.41.19.3
66.41.23.3
331,50
362,50
362,50
255,50
262,50
2,5
2,5
2,5
2,5
2,5
Aplique MICRO PROA con ptica asimtrica
0,&52352$ZDOOWWLQJZLWKDV\PPHWULFRSWLFV
Applique murale MICRO PROA avec optique asymtrique
HIT
G12
QT-DE
R7 s
CDM-Tm
PGJ5
TC-TE
GX24q-2
TC-TE
GX24q-3
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
35
20
35
18
26
66.41.26.3
66.41.27.3
66.41.28.3
66.41.29.3
66.41.22.3
330,00
365,50
365,50
263,00
273,50
2,5
2,5
2,5
2,5
2,5
'LUHFWRDUHG
W Cdigo Color (XURV Kg
max.
1x150
66.01.31.3 204,50 2,4
P.67 / 178 P.180 P.182
Aplique MICRO PROA LED con ptica spot
0,&52352$/('ZDOOWWLQJZLWKVSRWRSWLFV
Applique murale MICRO PROA LED avec optique spot
LED
Neutral
N LED W Cdigo Color (XURV Kg lm LED
12 15 66.41.24.3 439,00 2,5 SP 1368
Aplique MICRO PROA con ptica simtrica
0,&52352$ZDOOWWLQJZLWKV\PPHWULFRSWLFV
Applique murale MICRO PROA avec optique symtrique
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
35 66.41.25.3 355,00 2,5 25
HIT
G12
Gris texturizado
Texturised grey
Gris textur
01
179
/XPLQDULDV
SISTEMA MICRO PROA
Columna en aluminio (60x60 mm)
Aluminium pole (60x60 mm)
Mt en aluminium (60x60 mm)
Anclaje para hormign M8
Concrete anchor M8
7LJHVGDQFUDJH0
Estoque
Stake
Piquet
3ODQWLOODMDFLyQDQFODMHFROXPQD
Pattern for pole bracket
3DWURQGH[DWLRQGDQFUDJHGHPkW
Rejilla de proteccin
Protection louvre
Grille de protection
Tratamiento anti corrosivo Alodine 1200
Anticorrosive treatment Alodine 1200
Traitement anticorrosif Alodine 1200
Tratamiento anti corrosivo bicromatado
Bichromatized anticorrosive treatment
Traitement anticorrosif bicromatife
*
*
*
*
*
*
Soporte pared 1m
Wall supports 1m
Support mural 1m
Cdigo Color (XURV Kg Lm J Microproa
66.00.83.3
66.00.84.3
182,00
287,50
1,7
3
1
2,5
1/2
3/4
1 o 2
1 o 2
Cdigo Color (XURV Kg J
66.00.86.3 34,00 0,1 6
Cdigo Color (XURV Kg J
66.00.85.3 137,00 1 5
Cdigo Color (XURV Kg
66.00.87.3 65,00 0,5
Cdigo Color (XURV Kg
66.00.99.3 9,50 0,2
Cdigo Color (XURV Kg
66.00.88.2 44,50 0,11
25
180
120mm
150
130
65 mm
185
mm
Aplique MINI PROA de radiacin directa con ptica simtrica
0,1,352$ZDOOWWLQJIRUGLUHFWOLJKWLQJZLWKV\PPHWULFRSWLFV
$SSOLTXHPXUDOH0,1,352$DOXPLqUHGLUHFWHRSWLTXHV\PpWULTXH
180
Luminarias
IP
65
IK
07
CLASE
I
960 Al
GLASS
QT-DE
R7 s
HIT-DE
RX7s
HIT-DE
RX7s
TC-TE
G24q-3
HST-DE
RX7s
max.
60
0
max.
60
Directo a red
W &yGLJR Color Euros .J
300 66.01.50.3 217,50 5,7
Equipo Electromagntico
W &yGLJR Color Euros .J
70
150
66.01.51.3
66.01.52.3
266,50
285,50
6,2
6,5
Equipo Electrnico
W &yGLJR Color Euros .J
70
150
66.41.51.3
66.41.52.3
66.42.53.3
346,00
419,00
335,00
6
6,2
6,2
MINI PROA
max
2x26/32
$SOLTXH0,1,352$GHUDGLDFLyQGLUHFWDFRQUHHFWRUYLDO
0,1,352$ZDOOWWLQJIRUGLUHFWOLJKWLQJZLWKURDGUHHFWRU
$SSOLTXHPXUDOH0,1,352$DOXPLqUHGLUHFWHDYHFUpHFWHXUHFODULDJHSXEOLF
HST
E27
HIT
G12
HST-DE
RX7s
CPO-T
PGZ12
HIT
G12
$FFHVRULRVVLVWHPDYLDOS
$FFHVVRULHVURDGV\VWHPS
$FFHVVRLUHVV\VWqPHpFODLUDJHSXEOLTXHS
Equipo Electromagntico
W &yGLJR Color Euros .J
50
70
70
150
70
150
66.01.33.3
66.01.34.3
66.01.54.3
66.01.55.3
66.01.35.3
66.01.37.3
212,00
213,50
287,00
305,50
218,00
240,50
6,0
6,2
6,2
6,5
6,2
6,5
Equipo Electrnico
W &yGLJR Color Euros .J
60
70
150
66.41.56.3
66.41.54.3
66.41.55.3
637,00
364,00
437,50
6,2
6
6,2
Aplique MINI PROA LED con ptica spot
0,1,352$/('ZDOOWWLQJZLWKVSRWRSWLFV
$SSOLTXHPXUDOH0,1,352$/('DYHFRSWLTXHVSRW
N LED W &yGLJR Color luz T.color Euros .J lm LED
24
24
24
24
30
30
30
30
66.41.58.3
66.41.63.3
66.41.64.3
66.41.65.3
Neutral
-
-
-
950,50
950,50
950,50
950,50
7
7
7
7
2736
-
-
-
Aplique MINI PROA de radiacin directa con ptica asimtrica
0,1,352$ZDOOWWLQJIRUGLUHFWOLJKWLQJZLWKDV\PPHWULFRSWLFV
$SSOLTXHPXUDOH0,1,352$DOXPLqUHGLUHFWHRSWLTXHDV\PpWULTXH
HIT-DE
RX7s
HIT-DE
RX7s
HST-DE
RX7s
HST-DE
RX7s
QT-DE
R7 s
Equipo Electrnico
W &yGLJR Color Euros .J
70
150
66.41.61.3
66.41.62.3
346,00
426,50
6
6,2
Equipo Electromagntico
W &yGLJR Color Euros .J
70
150
66.01.61.3
66.01.62.3
266,50
285,50
6,2
6,5
Directo a red
W &yGLJR Color Euros .J
300 66.01.60.3 217,50 5,7
max
Gris texturizado
7H[WXULVHGJUH\
Gris textur
LED
01
465 mm
181
Luminarias
MINI PROA
IP
65
IK
07
CLASE
I
960 Al
GLASS
QT-DE
R7 s
HIT-DE
RX7s
HIT-DE
RX7s
HST-DE
RX7s
max.
60
0
max.
60
Aplique de pared MINI PROA de iluminacin directa-indirecta con ptica simtrica
0,1,352$ZDOOPRXQWHGOXPLQDLUHIRUGLUHFWLQGLUHFWOLJKWLQJZLWKV\PPHWULFRSWLFV
$SSOLTXHPXUDOH0,1,352$DOXPLqUHGLUHFWLQGLUHFWRSWLTXHV\PpWULTXH
Directo a red
W &yGLJR Color Euros .J
300 66.01.70.3 251,50 5,8
Equipo Electromagntico
W &yGLJR Color Euros .J
70
150
66.01.71.3
66.01.72.3
299,00
318,00
6,2
6,5
Equipo Electrnico
W &yGLJR Color Euros .J
70
150
66.41.71.3
66.41.72.3
376,00
449,50
6,2
6,4
HIT-DE
RX7s
Equipo Electrnico
W &yGLJR Color Euros .J
70
150
66.41.81.3
66.41.82.3
376,00
449,50
6,2
6,4
HIT-DE
RX7s
HST-DE
RX7s
QT-DE
R7 s
Equipo Electromagntico
W &yGLJR Color Euros .J
70
150
66.01.81.3
66.01.82.3
299,00
299,00
6,2
6,5
Directo a red
W &yGLJR Color Euros .J
300 66.01.80.3 251,50 5,8
P.63 / 178 P.180 P.182
Aplique de pared MINI PROA de iluminacin directa-indirecta con ptica asimtrica
0,1,352$ZDOOPRXQWHGOXPLQDLUHIRUGLUHFWLQGLUHFWOLJKWLQJZLWKDV\PPHWULFRSWLFV
$SSOLTXHPXUDOH0,1,352$DOXPLqUHGLUHFWLQGLUHFWRSWLTXHDV\PpWULTXH
KIT Indicador luminoso para MINI PROA para modelos electrnicos
.,73DQHOPRXQWEHDFRQIRU0,1,352$IRUHOHFWURQLFPRGHOV
.,7)HX[HQFDVWUDEOHSRXU0,1,352$SRXUGHVPRGqOHVpOHFWURQLTXHV
&yGLJR Euros
96.07.80.0 614,50
Accesorios
Accessories
Accessoires
Suministrado instalado en la luminaria
2QO\GHOLYHUHGLQVWDOOHGLQWKHOXPLQDLUH
Liur install dans le luminaire
N
01
465 mm
Aplique PROA de radiacin directa con ptica simtrica
352$ZDOOWWLQJIRUGLUHFWOLJKWLQJZLWKV\PPHWULFRSWLFV
$SSOLTXHPXUDOH352$DOXPLqUHGLUHFWHRSWLTXHV\PpWULTXH
182
Luminarias
PROA
IP
65
IK
07
CLASE
I
01
Al
GLASS
960
HIT-DE
FC-2
TC-TE
max.
60
0
max.
60
Equipo Electromagntico
W &yGLJR Color Euros .J
250
400
66.01.12.3
66.01.13.3
465,50
470,00
10,5
10,7
Equipo Electrnico
W &yGLJR Color Euros .J Portalamp.
1x57
2x42
2x57
66.41.30.3
66.42.31.3
66.42.30.3
439,00
431,50
490,00
9,9
10
10
GX24-q5
GX24-q4
GX24-q5
Aplique PROA de radiacin directa con ptica asimtrica
352$ZDOOWWLQJIRUGLUHFWOLJKWLQJZLWKDV\PPHWULFRSWLFV
$SSOLTXHPXUDOH352$DOXPLqUHGLUHFWHRSWLTXHDV\PpWULTXH
HIT-DE
FC-2
Equipo Electromagntico
W &yGLJR Color Euros .J
250
400
66.01.02.3
66.01.03.3
465,50
470,00
10,5
10,7
P.67 / 178 P.180 P.182
CPO-T
PGZ12
Equipo Electrnico
W &yGLJR Color Euros .J
140 66.41.36.3 663,50 10,1
$FFHVRULRVVLVWHPDYLDOS
$FFHVVRULHVURDGV\VWHPS
$FFHVVRLUHVV\VWqPHpFODLUDJHSXEOLTXHS
$SOLTXH352$GHUDGLDFLyQGLUHFWDFRQFRQUHHFWRUYLDO
352$ZDOOWWLQJIRUGLUHFWOLJKWLQJZLWKURDGUHHFWRU
$SSOLTXHPXUDOH352$DOXPLqUHGLUHFWHDYHFUpHFWHXUHFODULDJHSXEOLF
Gris texturizado
7H[WXULVHGJUH\
Gris textur
535 mm
183
Luminarias
PROA
IP
65
IK
07
CLASE
I
01
Al
GLASS
960
HIT-DE
FC-2
max.
60
0
max.
60
Equipo Electromagntico
W &yGLJR Color Euros .J
250
400
66.01.10.3
66.01.11.3
487,00
491,00
10,6
10,9
Aplique de pared PROA de iluminacin directa-indirecta con ptica simtrica
352$ZDOOPRXQWHGOXPLQDLUHIRUGLUHFWLQGLUHFWOLJKWLQJZLWKV\PPHWULFRSWLFV
$SSOLTXHPXUDOH352$DOXPLqUHGLUHFWLQGLUHFWRSWLTXHV\PpWULTXH
HIT-DE
FC-2
Equipo Electromagntico
W &yGLJR Color Euros .J
250
400
66.01.00.3
66.01.01.3
487,00
491,00
10,6
10,9
Aplique de pared PROA de iluminacin directa-indirecta con ptica asimtrica
352$ZDOOPRXQWHGOXPLQDLUHIRUGLUHFWLQGLUHFWOLJKWLQJZLWKDV\PPHWULFRSWLFV
$SSOLTXHPXUDOH352$DOXPLqUHGLUHFWLQGLUHFWRSWLTXHDV\PpWULTXH
535 mm
184
/XPLQDULDV
SISTEMA VIAL PROA / MINI PROA
Gris texturizado
Texturised grey
Gris textur
185
/XPLQDULDV
SISTEMA VIAL PROA / MINI PROA
%UD]RQDOLQGLYLGXDOFRUWR352$0,1,352$
6KRUWLQGLYLGXDOQDOVXSSRUWIRU352$0,1,352$
Support final individuel court PROA/ MINI PROA
%UD]RQDOLQGLYLGXDOODUJR352$0,1,352$
6XSSRUWQDOLQGLYLGXHOORQJIRU352$0,1,352$
Support final individuel long PROA/ MINI PROA
%UD]RQDOGREOHFRUWR352$0,1,352$
6KRUWGRXEOHQDOVXSSRUWIRU352$0,1,352$
Support final double court PROA/ MINI PROA
%UD]RQDOGREOHODUJR352$0,1,352$
/RQJGRXEOHQDOVXSSRUWIRU352$0,1,352$
Support final double long PROA/ MINI PROA
Brazo intermedio individual corto PROA/MINI PROA
Short individual intermediate support for PROA/MINI PROA
Support intermdiaire individuel court PROA/MINI PROA
Brazo intermedio individual largo Proa/MINI PROA
Long individual intermediate support for Proa/MINI PROA
Support intermdiaire individuel long Proa/MINI PROA
Brazo pared largo PROA/ MINI PROA
Support wall mounted long for PROA/ MINI PROA
Support applique long PROA/ MINI PROA
1 2 3 4 5 / 3 6 / 3
Cdigo Color PP (XURV Kg J
96.01.18.3
96.03.18.3
60
76
110,50
110,50
2,6
2,6
1
1
Cdigo Color PP (XURV Kg J
96.01.17.3
96.03.17.3
60
76
165,50
165,50
4,2
4,2
3
3
Cdigo Color PP (XURV Kg J
96.02.18.3
96.04.18.3
60
76
126,50
126,50
3,9
3,9
2
2
Cdigo Color PP (XURV Kg J
96.02.17.3
96.04.17.3
60
76
250,00
250,00
7
7
4
4
Cdigo Color PP (XURV Kg J
96.01.27.3 110,50 2,5 5
Cdigo Color PP (XURV Kg J
96.01.26.3 189,00 3,8 6
Cdigo Color m (XURV Kg J
96.01.82.3 0,8 113,00 2,9 7
min. 80
max. 120
min. 80
max. 120
min. 4 m
max. 5 m
min. 4 m
max. 5 m
N
Columna Troncocnica gris
Gray Trunkated Cone Column
Mt Tronco-conique gris
Cdigo H (mm) (XURV
96.35.87.3
96.36.87.3
96.37.87.3
96.38.87.3
4.000
6.000
8.000
10.000
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
60 mm
Para ms informacin
ver pagina 212
For more information
page 212
3RXUSOXVGLQIRUPDWLRQ
voir page 212
186
/XPLQDULDV
Cdigo Color (XURV Kg
66.08.02.3 196,00 4
Brazo pared para PROA / MINI PROA
Wall arm for PROA / MINI PROA
Bras mural pour PROA / MINI PROA
Cdigo Color &ROXPQD (XURV Kg
66.08.08.3
66.08.07.3
60-80 mm
75-105 mm
130,50
133,50
4,5
4,5
Abrazaderas de acero PROA / MINI PROA para columna
352$0,1,352$VWHHO[LQJEUDFNHWIRUFROXPQ
Ancrage en acier PROA / MINI PROA pour mt
De 1 a 4 luminarias
From 1 for 4 luminaires
De 1 4 luminaires
Cdigo Color (XURV Kg
1 proyct.
2 proyct.
96.08.36.3
96.07.36.3
74,00
84,00
1,2
1,2
Abrazadera de aluminio PROA / MINI PROA / SHOT para columna 120-130 mm
352$0,1,352$6+27DOXPLQLXPDQFKRUDJHIRUPPFROXPQ
$QFUDJHHQDOXPLQLXP352$0,1,352$6+27SRXUPkWPP
Cdigo Color (XURV
66.07.20.3 72,50
Rtula decorativa para PROA / MINI PROA
Decorative ball joint for PROA / MINI PROA
Rotule Enjoliveur pour PROA / MINI PROA
ACC. PROA / MINI PROA
Cdigo Color (XURV Kg
1 proyct. 96.07.35.3 70,50 1,4
6RSRUWHMDFLyQ352$0,1,352$6+27GHDOXPLQLRSDUDFROXPQDPP
352$0,1,352$6+27DOXPLQLXP[LQJVXSSRUWIRUPPFROXPQ
6XSSRUW[DWLRQ352$0,1,352$6+27RIDOXPLQLXPSRXUPkWPP
137 mm
187
/XPLQDULDV
P.194 P.191 P.192 P.193 P.188 P.190
188
3UR\HFWRUHV
SHOT 190
Gris texturizado
Texturised grey
Gris textur
Proyector SHOT 190
SHOT 190 spotlight
Projecteur SHOT 190
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
20
20
35
35
50
50
75.41.52.3
75.41.53.3
75.41.50.3
75.41.51.3
75.41.54.3
75.41.55.3
259,00
259,00
257,00
257,00
168,00
168,00
2,5
2,5
2,5
2,5
2,5
2,5
Spot
Flood
Spot
Flood
Spot
Flood
IP
65
IK
09
960 Al
GLASS
HIT
G12
CDM-Tm
PGJ5
QT 12
GY6,35
Posibilidad de refractor para distribucin elptica
Possibilit refractor for eliptical distribution
Possibilit lentille pour distribution elliptique
Visera antideslumbrante 190
Antiglare shade 190
Visre anti-blouissante 190
Cdigo Color (XURV
75.07.71.2 35,50
Accesorios
Accessories
Accessoires
210 mm
299
122
190
Proyector SHOT 190 con soporte para accesorios
SHOT 190 spotlight with support for accessories
Projecteur SHOT 190 avec support pour accessoires
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
20
20
35
35
50
50
75.41.62.3
75.41.63.3
75.41.60.3
75.41.61.3
75.41.64.3
75.41.65.3
250,50
250,50
249,50
249,50
160,00
160,00
2,3
2,3
2,3
2,3
2,3
2,3
Spot
Flood
Spot
Flood
Spot
Flood
HIT
G12
CDM-Tm
PGJ5
QT 12
GY6,35
210 mm
410
190
122
189
3UR\HFWRUHV
SISTEMA SHOT 190 - MINI SHOT LED
Tratamiento anti corrosivo Alodine 1200
Anticorrosive treatment Alodine 1200
Traitement anticorrosif Alodine 1200
Tratamiento anti corrosivo bicromatado
Bichromatized anticorrosive treatment
Traitement anticorrosif bicromatife
*
*
Anclaje para hormign M8
Concrete anchor M8
7LJHVGDQFUDJH0
*
Cdigo Color (XURV Kg
66.00.87.3 65,00 0,5
Columna en aluminio (60x60 mm)
Aluminium pole (60x60 mm)
Mt en aluminium (60x60 mm)
*
*
Cdigo Color (XURV Kg Lm J Microproa
66.00.83.3
66.00.84.3
182,00
287,50
1,7
3
1
2,5
1/2
3/4
1 o 2
1 o 2
25
180
Soporte pared 1m
Wall supports 1m
Support mural 1m
Cdigo Color (XURV Kg J
66.00.85.3 137,00 1 5
130
65 mm
3ODQWLOODMDFLyQDQFODMHFROXPQD
Pattern for pole bracket
3DWURQGH[DWLRQGDQFUDJHGHPkW
Cdigo Color (XURV Kg
66.00.99.3 9,50 0,2
120mm
150
Estoque
Stake
Piquet
*
Cdigo Color (XURV Kg J
66.00.86.3 34,00 0,1 6
185
mm
P.194 P.191 P.192 P.193 P.188 P.190
Accesorios sistema SHOT 190 - MINI SHOT LED p.189
Accessories SHOT 190 - MINI SHOT LED system p.189
Accessoires systme SHOT 190 - MINI SHOT LED p.189
190
Proyectores
MINI SHOT LED
Gris texturizado
Texturised grey
Gris textur
Proyector MINI SHOT LED
MINI SHOT LED spotlight
Projecteur MINI SHOT LED
IP
65
IK
09
960 Al
GLASS
NEW
Proyector MINI SHOT LED con soporte para accesorios
MINI SHOT LED spotlight with support for accessories
Projecteur MINI SHOT LED avec support pour accessoires
N LED W Cdigo Color Euros Kg . lm LED
5
5
10
10
5
5
10
10
11
11
19
19
11
11
19
19
75.41.80.3
75.41.81.3
75.41.82.3
75.41.83.3
75.41.84.3
75.41.85.3
75.41.86.3
75.41.87.3
290,00
290,00
385,00
385,00
290,00
290,00
385,00
385,00
2,8
2,8
2,9
2,9
2,8
2,8
2,9
2,9
Spot
Spot
Spot
Spot
MFL
MFL
MFL
MFL
Neutral
Warm
Neutral
Warm
Neutral
Warm
Neutral
Warm
1.065
1.000
2.130
2.000
1.065
1.000
2.130
2.000
LED
N LED W Cdigo Color Euros Kg . lm LED
5
5
10
10
5
5
10
10
11
11
19
19
11
11
19
19
75.41.90.3
75.41.91.3
75.41.92.3
75.41.93.3
75.41.94.3
75.41.95.3
75.41.96.3
75.41.97.3
282,00
282,00
377,00
377,00
282,00
282,00
377,00
377,00
2,6
2,6
2,7
2,7
2,6
2,6
2,7
2,7
Spot
Spot
Spot
Spot
MFL
MFL
MFL
MFL
Neutral
Warm
Neutral
Warm
Neutral
Warm
Neutral
Warm
1.065
1.000
2.130
2.000
1.065
1.000
2.130
2.000
200 mm
250
122
127
Posibilidad de otras pticas
Possibility of other optics
Possibilit d'autre optiques
6XSHUVSRW:LGHRRG(OtSWLFDO
Visera antideslumbrante
Antiglare shade
Visre anti-blouissante
Cdigo Color Euros
75.07.79.2 79,00
Accesorios
Accessories
Accessoires
200 mm
360
127
122
P.194 P.191 P.192 P.193 P.188 P.190
191
3UR\HFWRUHV
SHOT LED
Proyector SHOT LED
SHOT LED spotlight
Projecteur SHOT LED
Proyector SHOT LED RGB
SHOT LED RGB spotlight
Projecteur SHOT LED RGB
N LED W Cdigo Color (XURV Kg . lm LED
36
36
36
36
43
43
43
43
75.41.38.3
75.41.39.3
75.41.40.3
75.41.41.3
865,00
865,00
865,00
865,00
7,4
7,4
7,4
7,4
Spot
Spot
MFL
MFL
Neutral
Warm
Neutral
Warm
4104
3146
4104
3146
N LED W Cdigo Color (XURV Kg . lm LED
24 92 75.41.42.3 1.996,00 7,2 MFL RGB 2544
IP
65
IK
09
960
CLASE
I
LED
GLASS
Al
235
310
180 mm
230V
D
M
X
IN
D
M
X
IN
D
M
X
O
U
T
D
M
X
O
U
T
DRIVER
USB RDM/DMX
Controlador externo
(96.40.79.0)
Accesorios
Accessories
Accessoires
Pack Control USB-DMX/RDM
Control Pack USB-DMX/RDM
Contrleur USB-DMX/RDM
Cdigo (XURV
96.40.79.0 775,00
Para ms informacin ver pagina 154
For more information page 154
3RXUSOXVGLQIRUPDWLRQYRLUSDJH
Gris texturizado
Texturised grey
Gris textur
Posibilidad de otras opticas
Possibility of other optics
3RVVLELOLWpGDXWUHRSWLTXHV
6XSHUVSRW:LGHRRG(OLSWLFDO
DMX
RDM
Visera antideslumbrante
Antiglare shade
Visre anti-blouissante
Cdigo Color (XURV
75.07.78.2 89,00
N
P.194 P.191 P.192 P.193 P.188 P.190
192
3UR\HFWRUHV
SHOT 290
Proyector SHOT 290
SHOT 290 spotlight
Projecteur SHOT 290
6+27FRQUHHFWRUYLDO
5RDGUHHFWRU6+27
6+27DYHFUpHFWHXUHFODULDJHSXEOLF
Accesorios sistema vial p.195
Accessories road system p.195
Accessoires systme clairage publique p.195
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
70
70

75.01.20.3
75.01.21.3
412,50
412,50
9,8
9,8
Spot
MFL

(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
60 75.41.23.3 685,50 10 Street
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
70
35
70
75.01.24.3
75.01.33.3
75.01.25.3
412,50
412,50
412,50
9,8
9,8
9,8
Street
Street
Street
IP
65
IK
09
960 Al
GLASS
HIT-DE
RX7s
HIT
G12
CPO-T
PGZ12
HIT
G12
HST-DE
RX7s
HIT
G12
235
425
290 mm
Accesorios
Accessories
Accessoires
Antideslumbrante circular 290
Circular antiglare 290
Anti-blouissant circulaire 290
Visera antideslumbrante 290
Antiglare shade 290
Visre anti-blouissante 290
Cdigo Color (XURV
75.07.76.2 94,00
Cdigo Color (XURV
75.07.77.2 58,00
Gris texturizado
Texturised grey
Gris textur
193
3UR\HFWRUHV
P.194 P.191 P.192 P.193 P.188 P.190
SHOT 380
Proyector SHOT 380
SHOT 380 spotlight
Projecteur SHOT 380
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
70
100
100
150
150
75.01.45.3
75.01.26.3
75.01.27.3
75.01.28.3
75.01.29.3
450,50
652,50
652,50
541,50
541,50
10,6
12,5
12,5
12,9
12,9
Flood
Spot
MFL
Spot
MFL
IP
65
IK
09
Al
GLASS
HSE
E27
HST
PG12-1
475
380 mm
235
Accesorios
Accessories
Accessoires
Antideslumbrante circular 380
Circular antiglare 380
Anti-blouissant circulaire 380
Visera antideslumbrante 380
Antiglare shade 380
Visre anti-blouissante 380
Cdigo Color (XURV
75.07.74.2 119,50
Cdigo Color (XURV
75.07.75.2 72,00
Gris texturizado
Texturised grey
Gris textur
960
Accesorios sistema vial p.195
Accessories road system p.195
Accessoires systme clairage publique p.195
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
150
150
75.01.31.3
75.01.32.3
541,50
541,50
13
13
Street
Street
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
140 75.41.30.3 711,50 11,6 Street
HIT-DE
RX7s
HST-DE
RX7s
CPO-T
PGZ12
HIT
G12
6+27FRQUHHFWRUYLDO
5RDGUHHFWRU6+27
6+27DYHFUpHFWHXUHFODULDJHSXEOLF
HIT
G12
P.194 P.191 P.192 P.193 P.188 P.190
194
3UR\HFWRUHV
SHOT 530
Accesorios
Accessories
Accessoires
Antideslumbrante circular 530
Circular antiglare 530
Anti-blouissant circulaire 530
Cdigo Color (XURV
75.07.72.2 95,50
Visera antideslumbrante 530
Antiglare shade 530
Visre anti-blouissante 530
Cdigo Color (XURV
75.07.73.2 90,00
Proyector SHOT 530
SHOT 530 spotlight
Projecteur SHOT 530
(TXLSR(OHFWUyPDJQpWLFR
W Cdigo Color (XURV Equipo Portalmparas Kg
250
250
400
400
400
75.01.34.3
75.01.35.3
75.01.36.3
75.01.37.3
75.01.38.3
608,50
584,00
613,50
607,50
630,00
HIE/HSE/HIT/HST 4,5KV
HIE/HIT 0,6KV
HIE/HIT 4,5KV
HIE/HIT 0,6KV
HSE/HST
E40
E40
E40
E40
E40
13,5
13,5
14,8
14,8
14,8
Flood/Spot
Flood/Spot
Flood/Spot
Flood/Spot
Flood/Spot
HST
E40
HIT
E40
HIE
E40
HSE
E40
960
GLASS
Al
CLASE
I
IK
09
IP
65
620
530 mm
235
Gris texturizado
Texturised grey
Gris textur
ACC. SHOT
Cdigo Color (XURV Kg
1 proyct.
2 proyct.
96.08.36.3
96.07.36.3
74,00
84,00
1,2
1,2
$EUD]DGHUDGHDOXPLQLR6+27352$0,1,352$SDUDFROXPQDPP
6+27352$0,1,352$DOXPLQLXPDQFKRUDJHIRUPPFROXPQ
$QFUDJHHQDOXPLQLXP6+27352$0,1,352$SRXUPkWPP
Cdigo Color (XURV Kg
1 proyct. 96.07.35.3 70,50 1,4
6RSRUWHMDFLyQ6+27352$0,1,352$GHDOXPLQLRSDUDFROXPQDPP
6+27352$0,1,352$DOXPLQLXP[LQJVXSSRUWIRUPPFROXPQ
6XSSRUW[DWLRQ6+27352$0,1,352$RIDOXPLQLXPSRXUPkWPP
137 mm
60 mm
195
3UR\HFWRUHV
196
3UR\HFWRUHV
SISTEMA VIAL SHOT
Gris texturizado
Texturised grey
Gris textur
197
3UR\HFWRUHV
SISTEMA VIAL SHOT
%UD]RQDOLQGLYLGXDOFRUWR6+27
6KRUWLQGLYLGXDOQDOVXSSRUWIRU6+27
Support final individuel court SHOT
%UD]RQDOLQGLYLGXDOODUJR6+27
6XSSRUWQDOLQGLYLGXHOORQJIRU6+27
Support final individuel long SHOT
%UD]RQDOGREOHFRUWR6+27
6KRUWGRXEOHQDOVXSSRUWIRU6+27
Support final double court SHOT
%UD]RQDOGREOHODUJR6+27
/RQJGRXEOHQDOVXSSRUWIRU6+27
Support final double long SHOT
Brazo intermedio individual corto SHOT
Short individual intermediate support for SHOT
Support intermdiaire individual court SHOT
Brazo intermedio individual largo SHOT
Long individual intermediate support for SHOT
Support intermdiaire individuel long SHOT
Brazo pared largo SHOT
Support wall mounted long for SHOT
Support applique long SHOT
Cdigo Color PP (XURV Kg J
96.01.33.3
96.03.33.3
60
76
110,50
110,50
2,6
2,6
1
1
Cdigo Color PP (XURV Kg J
96.01.32.3
96.03.32.3
60
76
165,50
165,50
4,2
4,2
3
3
Cdigo Color PP (XURV Kg J
96.02.33.3
96.04.33.3
60
76
126,50
126,50
3,9
3,9
2
2
Cdigo Color PP (XURV Kg J
96.02.32.3
96.04.32.3
60
76
250,00
250,00
7
7
4
4
Cdigo Color PP (XURV Kg J
96.01.69.3 110,50 2,5 5
Cdigo Color PP (XURV Kg J
96.01.68.3

189,00 3,8 6
Cdigo Color m (XURV Kg J
96.01.85.3 0,8 113,00 2,9 8
min. 80
max. 120
min. 80
max. 120
N
1 2 5 / 1 5 / 3 6 / 3 4
8
min. 4 m
max. 5 m
3
Columna Troncocnica gris
Gray Trunkated Cone Column
Mt Tronco-conique gris
Cdigo H (mm) (XURV
96.35.87.3
96.36.87.3
96.37.87.3
96.38.87.3
4.000
6.000
8.000
10.000
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
60 mm
Para ms informacin
ver pagina 212
For more information
page 212
3RXUSOXVGLQIRUPDWLRQ
voir page 212
198
3UR\HFWRUHV
IP
65
IP
65
IK
06
IK
06
CLASE
I
CLASE
I
HIT-DE
HIT-DE
GLASS
GLASS
960
960
Al
Al
HST-DE
HST-DE
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Portalmparas
70
150
84.01.52.3
84.01.51.3
109,00
119,00
6,3
6,6
RX 7s
RX 7s-24
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Portalmparas
70
150
84.01.54.3
84.01.53.3
109,00
119,00
6,3
6,6
RX 7s
RX 7s-24
Proyector simtrico FLASH 4
)/$6+V\PPHWULFDORRGOLJKW
Projecteur FLASH 4 symtrique
Proyector asimtrico FLASH 4
)/$6+DV\PPHWULFDORRGOLJKW
Projecteur FLASH 4 asymtrique
FLASH 4
Aletas antideslumbrantes
Anti-glare louvre
Grilles anti-blouissement
Accesorios generales
General accessories
Accessoires gnraux
Cdigo Color (XURV
84.06.00.2 69,00
N N
Gris texturizado
Texturised grey
Gris textur
Rejilla de proteccin
Protection louvre
Grille de protection
Cdigo Color (XURV
84.06.03.3 27,00
199
3UR\HFWRUHV
FLASH 5
IP
65
IP
65
IK
06
IK
06
CLASE
I
CLASE
I
HIT/HST
E40
960
GLASS
960
Al
GLASS
Al
HME
E40
HIT/HST
E40
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Equipo Portalmparas
250
250
250
400
400
400
84.01.76.3
84.01.56.3
84.01.58.3
84.01.55.3
84.01.57.3
84.01.77.3
162,50
162,50
117,50
160,00
162,50
160,00
8,8
8,8
7,4
8,8
10
8,8
HIT Philips 0,6 KV
HIT-HST Osram 4,5KV
HME
HIT Osram 4,5 KV
HST
HIT Philips 0,6 KV
E 40
E 40
E 40
E 40
E 40
E 40
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Equipo Portalmparas
250
250
400
400
400
84.01.78.3
84.01.73.3
84.01.74.3
84.01.75.3
84.01.79.3
162,50
162,50
160,00
186,00
160,00
8,8
8,8
8,5
10
8,8
HIT Philips 0,6 KV
HIT-HST Osram 4,5KV
HIT Osram 4,5 KV
HST
HIT Philips 0,6 KV
E 40
E 40
E 40
E 40
E 40
Proyector simtrico FLASH 5
)/$6+V\PPHWULFDORRGOLJKW
Projecteur FLASH 5 symtrique
Proyector asimtrico FLASH 5
)/$6+DV\PPHWULFDORRGOLJKW
Projecteur FLASH 5 asymtrique
N N
Gris texturizado
Texturised grey
Gris textur
Accesorios generales
General accessories
Accessoires gnraux
Aletas antideslumbrantes
Anti-glare louvre
Grilles anti-blouissement
Cdigo Color (XURV
84.06.01.2 80,50
Rejilla de proteccin
Protection louvre
Grille de protection
Cdigo Color (XURV
84.06.02.3 36,50
1m (3x0,75)
IP
66
IK
07
GLASS
960
IP
66
Al
Proyector GREEN 96 para lmparas QR-CBC 51 y PAR20
GREEN 96 spotlight for QR-CBC 51 and PAR20 lamps
Spot GREEN 96 pour lampes QR-CBC 51 et PAR20
W Cdigo Color (XURV Kg
50
50
63.01.20.3
63.01.21.3
44,50
48,00
0,6
0,6
QR-CBC51
GU 5,3
PAR20
E27
CLASE
I
Proyector GREEN 96 para lmpara QR-CBC 51 con equipo incorporado
GREEN 96 spotlight for QR-CBC 51 lamps with included control gear
Spot GREEN 96 pour lampes QR-CBC 51 avec quipement inclus
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
50 63.01.23.3 149,00 1,2
IP
66
IK
07
960 Al
GLASS QR-CBC51
GU 5,3
Visera antideslumbrante
Anti-glare screen
cran anti-blouissement
Caja estanca
Watertight connection box
Bote tanche
Vacia
Empty
Accesorios
Accessories
Accessoires
Cdigo Color (XURV
63.07.43.3 16,50
W Cdigo Color (XURV
50 63.07.20.3
63.07.21.3
70,00
41,00
6
177 mm
127 mm
59
Estoque
Stake
Piquet
Cdigo Color (XURV
63.07.40.3 20,50
170
mm
Gris texturizado
Texturised grey
Gris textur
200
3UR\HFWRUHV
GREEN
LED
Warm
Proyector GREEN 96 con lmparas LEDS
GREEN 96 spotlight with LEDS lamps
Spot GREEN 96 avec lampes LEDS
N LED W Cdigo Color (XURV Kg lm output
4
4
10
10
63.01.22.3
63.01.25.3
89,00
89,00
1,2
1,2
Flood
MFL
385
385
N
201
3UR\HFWRUHV
NEW
202
9LDO\8UEDQD
NIU
Luminaria NIU con ptica rotosimtrica
NIU luminaire with circular symmetrical optics
Luminaire NIU avec optique rotosymtrique
Luminaria NIU vial con ptica vial
NIU luminaire with road optics
Luminaire NIU avec optique urbaine
&ODVH,(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Lamp. Portalamp.
45
60
90
140
81.41.28.3
81.41.29.3
81.41.30.3
81.41.31.3
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
16
16
16,1
16,1
CPO-T
CPO-T
CPO-T
CPO-T
PGZ12
PGZ12
PGZ12
PGZ12
&ODVH,(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Lamp. Portalamp.
35
50
70
100
150
81.01.32.3
81.01.33.3
81.01.34.3
81.01.35.3
81.01.36.3
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
16,5
16,5
16,5
17
18,4
HIT
HST
HIT/ HST
HST
HIT/ HST
G12
E27
E27
E40
E40
&ODVH,(TXLSR(OHFWURPDJQpWLFR'REOH1LYHO
W Cdigo Color (XURV Kg Lamp. Portalamp.
100
150
81.01.37.3
81.01.38.3
DFRQVXOWDU
DFRQVXOWDU
17
18,4
HST
HIT/ HST
E40
E40
&ODVH,,(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Lamp. Portalamp.
45
60
90
140
81.41.39.3
81.41.40.3
81.41.41.3
81.41.42.3
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
16,2
16,2
16,3
16,3
CPO-T
CPO-T
CPO-T
CPO-T
PGZ12
PGZ12
PGZ12
PGZ12
&ODVH,,(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Lamp. Portalamp.
35
50
70
100
150
81.01.43.3
81.01.44.3
81.01.45.3
81.01.46.3
81.01.47.3
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
16,6
16,6
16,6
17
17
HIT
HST
HIT/ HST
HST
HIT/ HST
G12
E27
E27
E40
E40
&ODVH,(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Lamp. Portalamp.
35
70
70
150
81.01.20.3
81.01.21.3
81.01.22.3
81.01.23.3
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
20
20
20
20,5
HIT
HIT
HIT-DE/ HST-DE
HIT-DE/ HST-DE
G12
G12
RX 7s
RX 7s
&ODVH,,(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Lamp. Portalamp.
35
70
70
150
81.01.24.3
81.01.25.3
81.01.26.3
81.01.27.3
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
20,2
20,2
20,2
21,7
HIT
HIT
HIT-DE/ HST-DE
HIT-DE/ HST-DE
G12
G12
E27
E40
IK
10
Al
GLASS
IP
66
HIT/HST
E27
HIT
G12
HST-DE
RX7s
HIT-DE
RX7s
CPO-T
PGZ12
960
HIT/HST
E40
Gris texturizado
Texturised grey
Gris textur
159
537
60
537
159
60
434
Posibilidad de equipo de doble nivel para
luminarias de clase II
Possibility of equipment of double level
for luminaires Class II
3RVVLELOLWpGpTXLSHPHQWGRXEOH
niveau pour luminaires Classe II
NEW
203
9LDO\8UEDQD
NIU LED
IP
66
IK
10
960
GLASS
Al
LED
Neutral
Luminaria NIU LED con ptica rotosimtrica
NIU LED luminaire with circular symmetrical optics
Luminaire NIU LED avec optique rotosymtrique
N LED W Cdigo Color (XURV Kg lm LED
24
48
24
48
54
107
54
107
81.41.50.3
81.41.51.3
81.41.52.3
81.41.53.3
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
9,8
10
9,9
10,1
5.112
10.224
5.112
10.224
CLASE
I
Luminaria NIU LED con ptica vial
NIU LED luminaire with road optics
Luminaire NIU LED avec optique urbaine
N LED W Cdigo Color (XURV Kg lm LED
24
48
24
48
54
107
54
107
81.41.54.3
81.41.55.3
81.41.56.3
81.41.57.3
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
6,4
6,5
6,5
6,6
5.112
10.224
5.112
10.224
CLASE
I
Accesorios NIU/NIU LED
Accessories NIU/NIU LED
Accessoires NIU/NIU LED
Adaptador columnas 76mm
Column adapter 76mm
Adaptateur de mt 76mm
Brazo Final 60mm
Final support 60mm
6XSSRUWQDOPP
Cdigo (XURV
96.00.31.3 DFRQVXOWDU
Abrazadera columna 60-135mm
Anchorage for column 60-135mm
Ancorage pour mt 60-135mm
Cdigo (XURV
96.00.32.3 DFRQVXOWDU
Brazo a pared
Arm wall
Bras applique
Cdigo (XURV
96.00.36.3 DFRQVXOWDU
Soporte a bculo
Lighting pole
Support dport
Cdigo (XURV
96.00.33.3
96.00.34.3
DFRQVXOWDU
DFRQVXOWDU
48mm
60mm
Cdigo (XURV
96.00.35.3 DFRQVXOWDU
Gris texturizado
Texturised grey
Gris textur
545
126
70
434
60
545
126
70
60
Columna Troncocnica gris
Grey Trunkated Cone Column
Mt Tronco-conique gris
Cdigo H (mm) (XURV
96.35.87.3
96.36.87.3
96.37.87.3
96.38.87.3
4.000
6.000
8.000
10.000
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
60 mm
Para ms informacin ver pagina 212
For more information page 212
3RXUSOXVGLQIRUPDWLRQYRLUSDJH
204
9LDO\8UEDQD
IP
65
IK
08
960
GLASS
30
SMAP
Al
HIT
G12
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
70
70
150
150
81.01.07.3
81.01.08.3
81.01.09.3
81.01.10.3
405,00
405,00
408,00
408,00
11,1
11,1
12,5
12,5
Spot
MFL
Spot
MFL
Proyector SMAP
SMAP spotlight
Projecteur SMAP
0
30
185
275
290 mm
60 350
535
138
Gris texturizado
Texturised grey
Gris textur
HIT
G12
CPO-T
PGZ12
HST-DE
RX7s
HIT-DE
RX7s
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg
60
140
81.41.03.3
81.41.04.3
551,50
579,00
11,3
11,3
Street
Street
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg
35
70
150
70
150
81.01.00.3
81.01.01.3
81.01.02.3
81.01.05.3
81.01.06.3
396,00
396,00
412,00
362,50
401,00
11,1
11,1
12,5
11,1
12,5
Street
Street
Street
Street
Street
Luminaria SMAP vial
Street luminaire SMAP
Luminaire SMAP urbain
LED
Neutral
W Cdigo Color (XURV Kg lm LED
80 81.41.15.3 DFRQVXOWDU 11,3 Street 8000
N
Esquema de posibles combinaciones de
luminarias en columnas SMAP Standard.
Bajo pedido se puede personalizar la
columna con diferente distribucin de los
puntos de anclaje.
Schma de possibles combinaisons de
luminaires dans les mts du SMAP Stan-
dard. Sur demande, on peut personnali-
ser le mt avec une distribution diffrente
GHVSRLQWVGDQFUDJH
2XWOLQHRIGLIIHUHQWFRPELQDWLRQVRI[WXUHV
in columns SMAP Standard. Customizing
of column with a different distribution of
anchor points is available under request.
9 m
7 m
6 m
5 m
4 m
0,4 m
0 m
0,35
J J J J J J J
J
h
J
0,6m
0,9
205
9LDO\8UEDQD
SMAP
AENOR
Cdigo Color (XURV Kg h (m) Fig.
96.01.90.3
96.01.91.3
96.01.92.3
96.01.93.3
96.02.93.3
96.01.94.3
96.02.94.3
96.03.94.3
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
35
48
63
69
69
125
124
126
4,3
5,3
6,3
7,3
7,3
9,2
9,2
9,2
0
1
2
3
4
5
6
7
Columnas SMAP
SMAP columns
Mts SMAP
Cdigo (XURV M L(mm) h Colum (m) Fig.
96.00.95.3
96.00.97.3
37,00
86,50
18
22
500
750
4,3 / 5,3
6,3 / 7,3 / 9,2
0-1
2-7
Pernos de anclaje SMAP
SMAP rag bolt
9LVGDQFUDJH60$3
Cdigo Color (XURV Kg Fig.
81.00.01.3 163,00 12 8
Brazo a pared SMAP 1M
SMAP arm wall 1M
Bras applique 1M
Cdigo (XURV Fig.
96.00.89.3
96.00.91.3
38,00
54,00
0-1
2-7
3ODQWLOODGHMDFLyQ
Pattern bracket
3DWURQGH[DWLRQ
N
206
9LDO\8UEDQD
CPO-T
PGZ12
HIT/HST
E40
HIT/HST
E27
GLASS
max.
15
0
max.
15
960
Al
IK
08
IP54
BODY
IP 66
OPTIC
01
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Lamp. Portalamp.
70
150
50
100
69.01.20.3
69.01.22.3
69.01.23.3
69.01.24.3
298,50
317,00
302,00
304,00
6,2
7
6
6,8
HIT/HST/HIE/HSE
HIT / HST
HST
HST
E27
E40
E27
E40
(TXLSR(OHFWUyQLFR
W Cdigo Color (XURV Kg Lamp. Portalamp.
140 69.41.25.3 565,50 6,5 CPO-T PGZ12
Luminaria vial DUNE
DUNE street luminaire
Luminaire de rue DUNE
DUNE
Classe I
Classe II
Posibilidad de equipo de doble nivel y
seccionador de corriente
Possibility of equipment of double level
and disconnecting switch of current
3RVVLELOLWpGpTXLSHPHQWGRXEOH
niveau et de sectionneur
Seccionador de corriente incorporado
Incorporated disconnecting switch of current
Incorpor de sectionneur
&ODVH,
&ODVH,
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Lamp. Portalamp.
70
150
50
100
69.01.60.3
69.01.62.3
69.01.63.3
69.01.64.3
306,50
325,00
310,00
312,00
6,2
7
6
6,8
HIT/HST/HIE/HSE
HIT / HST
HST
HST
E27
E40
E27
E40
&ODVH,,
*ULVWH[WXUL]DGR*UDWRWH[WXUL]DGR
Texturised grey + Graphite
Gris textur + Graphite textur
Cdigo Color (XURV Kg
96.07.34.3 140,00 12
Brazo a pared DUNE / DUNE LEDS
DUNE / DUNE LEDS arm wall
Bras applique DUNE / DUNE LEDS
8 m
6 m
5 m
4 m
DUNE DUNE LEDS
866 cm
507
Columna Troncocnica gris
Grey Trunkated Cone Column
Mt Tronco-conique gris
Cdigo H (mm) (XURV
96.35.87.3
96.36.87.3
96.37.87.3
96.38.87.3
4.000
6.000
8.000
10.000
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
60 mm
Para ms informacin ver pagina 212
For more information page 212
3RXUSOXVGLQIRUPDWLRQYRLUSDJH
N
207
9LDO\8UEDQD
DUNE LEDS
N LED
LED
Neutral
max.
15
0
max.
15
960
GLASS
Al
CLASE
I
IK
08
IP
66
W Cdigo Color (XURV Kg Equipo lm LED
48
48
55
98
69.41.26.3
69.41.09.3
860,50
1.131,00
8,5
8,5
Street
Street
350 mA
700 mA
5480
8976
Luminaria vial DUNE LEDS
DUNE LEDS street luminaire
Luminaire de rue DUNE LEDS
687 mm
81
&ODVH,
N LED
&ODVH,,
W Cdigo Color (XURV Kg Equipo lm LED
48
48
55
98
69.41.15.3
69.41.10.3
860,50
1.131,00
8,5
8,5
Street
Street
350 mA
700 mA
5480
8976
*ULVWH[WXUL]DGR*UDWRWH[WXUL]DGR
Texturised grey + Graphite
Gris textur + Graphite textur
208
9LDO\8UEDQD
FAMA
Punto de luz solar FaMA para personalizar
Personalized FaMA solar streetlight
Lampadaire solaire FaMA pour personnalise
FaMA is an autonomous modular streetlight
thanks to its photovoltaic power.
At its top there are two photovoltaic modules
that also act as luminosity sensors, thereby
controlling the turning ON and OFF of the
luminaire.
The energy captured is stored in a battery
of 10-15 years duration (depending on the
weather conditions) and which does not require
maintenance. It is endowed an autonomy of 24
hours (3 nights) during the most unfavourable
irradiations of the year.
In turn, the DUNE LEDS luminaire is equipped
with high-power leds and lenses which provide
a photometric curve on the road. Its 48 leds with
neutral white colour temperature (4650K) provide
DOLJKWRZRIOXPHQVDQGDQ,5&RI
To customize the streetlight FAMA (69.40.16.3)
should be choosen between the One Level
Mode option or Doble Level Mode option.
2QH/HYHO0RGHIXQFWLRQV
212))ZLWKLWVOLJKWVHQVRUJ
2 Self-reguODWHG OLJKW X[ DFFRUGLQJ WR WKH
EDWWHU\VWDWXVJ
'REOH/HYHO0RGHIXQFWLRQV
212))ZLWKLWVOLJKWVHQVRUJ
2 Self-reguODWLRQRIOLJKWX[DFFRUGLQJWRWKH
EDWWHU\VWDWXVJ
3 - Self-regulaWLRQ ZLWK D GREOH OLJKW X[ OHYHO
programmed according to the geographical
DUHDJ
FaMA est un lampadaire modulaire autonome
grce son alimentation photovoltaque.
A son sommet sont placs deux modules
SKRWRYROWDwTXHVTXLIRQWpJDOHPHQWRIFHGH
capteur de luminosit, contrlant ainsi le on
and off de la luminaire.
/pQHUJLH FDSWpH HVW VWRFNpH GDQV XQH
EDWWHULHGXQHGXUDWLRQGHDQVVHORQ
les conditions climatiques) et ne ncessitant
SDVGHPDLQWHQDQFH(OOHHVWFDSDEOHGRIIULU
une autonomie de 24 heures (3 nuits)
GDQV OHV FRQGLWLRQV GLUUDGLDWLRQ OHV SOXV
GpIDYRUDEOHVGHODQQpH
Pour sa part, le luminaire DUNE LEDS est
quip de led haute puissance et de verres
qui fournissent une courbe photomtrique
SRXU OHV YRLHV SXEOLTXHV 6HV OHG GXQH
temprature de couleur blanc neutre
. RIIUHQW XQ X[ OXPLQHX[ GH
lumens et un IRC de 70.
Pour personnaliser la lampadaire solaire
)$0$ RQ GRLV FKRLVLU ORSWLRQ
0RGH 8Q 1LYHDX RX ORSWLRQ 0RGH 'RXEOH
Niveau.
)RQFWLRQVGX0RGH8Q1LYHDX
1 - ON / OFF avec son capteur de lumire. (Fig.1)
2 - Auto-rgulation de luminosit en fonction
GHOpWDWGHODEDWWHULH)LJ
)RQFWLRQVGH0RGH'RXEOH1LYHDX
1 - ON / OFF avec son capteur de lumire. (Fig.1)
2 - Auto-rgulation de luminosit en fonction
GHOpWDWGHODEDWWHULH)LJ
3 - Auto-rgulation avec un double niveau
lumineuse programm selon la zone
gographique. (Fig.3)
Zona geogrfica
Geographical area
Zone gographique
100%
80%
60%
40%
20%
0%
12:00 14:00 16:00 18:00 20:00 22:00 00:00 02:00 04:00 06:00 08:00 10:00 12:00
P.ex. Programme de rgulation zone Madrid (Espagne), Mars
Eg Dimming programme area Madrid (Spain), March
Ej: Programa de regulacin zona Madrid (Espaa) Marzo
On Off
100% <100%
Fig. 1 Fig. 2
Fig. 3
FaMA es una farola modular autnoma
gracias a su alimentacin fotovoltaica.
En su coronacin se encuentran dos mdulos
fotovoltaicos que ejercen a la vez de sensor
de luminosidad, controlando as el encendido
y apagado de la luminaria.
La energa captada es almacenada en una
batera con una duracin de 10-15 aos (segn
condiciones climatolgicas) y que no requiere
mantenimiento. sta es capaz de ofrecer una
autonoma de 24 horas (3 noches) en las
irradiaciones ms desfavorables del ao.
Por su parte, la luminaria DUNE LEDS est
equipada con leds de alta potencia y lentes
que proporcionan una curva fotomtrica vial.
Sus 48 leds con temperatura de color blanco
QHXWUR.RIUHFHQXQXMROXPLQRVRGH
5.480 lumens y un IRC de 70.

Para personalizar el punto de luz FaMA
(69.40.16.3) debe escojerse la opcin Modo
Un Nivel o la opcin Modo Doble Nivel.
)XQFLRQHV0RGR8Q1LYHO
1- 212))JUDFLDVDVXVHQVRUOXPtQLFRJ
2- Autorregulacin de la luminosidad segn
HVWDGRGHODEDWHUtDJ
)XQFLRQHV0RGR'REOH1LYHO
1- 212))JUDFLDVDVXVHQVRUOXPtQLFRJ
2- Autorregulacin de la luminosidad segn
HVWDGRGHODEDWHUtDJ
3- Autorregulacin: doble nivel por programa-
FLyQVHJ~Q]RQDJHRJUiFDJ
NEW
209
9LDO\8UEDQD
FAMA
Columna anodizada
Anodized column
Mt anodis
Punto de luz solar FaMA para personalizar
FaMA solar streetlight to customize
Lampadaire solaire FaMA personnaliser
N LED W Cdigo Color (XURV Kg lm LED
48 55 69.40.16.3 DFRQVXOWDU 134 Street 5480
LED
Neutral
960
GLASS
Al
IK
08
IP
66
/XPLQDULD*ULV*UDWRWH[WXUL]DGR
Texturised grey + Graphite luminaire
Luminaire Gris + Graphite textur
8
4
5
544 544

5
3
0
0
5
7
8
0
5
9
7
,
1
7
7
8
,
5
Batera - Battery - Batterie
(QHUJ\ 9ROWDJH &DSDFLW\ $XWRQRP\
720 Wh 36 V 20 Ah 24h
&KDUJLQJ7LPH 'LDPHWHU /HQJWK
12h 140 mm 710 mm
Mdulo fotovoltaico
Photovoltaic modules
Module photovoltaque
(QHUJ\ 6XUIDFH /LJKWVHQVRU
120 Wp 0,92 m
2
included
Posibilidad de difusor de policarbonato
Possibility of polycarbonate diffuser
Possibilit de polycabonate diffuseur
210
9LDO\8UEDQD
MINI ECO
HIT/HST
E40
HIT/HST
E27
960
GLASS
Al
IK
07
IP44
BODY
IP66
OPTIC
01

(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Lamp. Portalamp. Level
70
150
100
69.01.06.3
69.01.07.3
69.01.08.3
157,50
172,00
165,50
5
5,5
5,5
HIT/HST/HIE/HSE
HIT / HST
HST
E27
E40
E40
1N
1N
1N
Luminaria vial MINI ECO
MINI ECO street luminaire
Luminaire de rue MINI ECO
&ODVH,
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Lamp. Portalamp.
70
150
100
69.01.16.3
69.01.17.3
69.01.18.3
228,50
230,00
217,00
5
5,5
5,5
HIT/HST/HIE/HSE
HIT / HST
HST
E27
E40
E40
&ODVH,,
Gris texturizado + Gris oscuro texturizado
Texturised grey + Textured dark grey
Gris textur + Textur gris fonc
(TXLSR(OHFWURPDJQpWLFR'REOH1LYHO&RQOLQHDGHPDQGR
W Cdigo Color (XURV Kg Lamp. Portalamp. Level
150
100
69.01.47.3
69.01.46.3
250,00
243,50
5,5
5,5
HIT / HST
HST
E40
E40
2N
2N
Posibilidad de seccionador de corriente
Possibility of disconnecting switch of current
Possibilit de sectionneur
IK
10
211
9LDO\8UEDQD
ECO
HST
E40
HIT
E40
960
GLASS
Al
IK
07
IP65
BODY
IP 66
OPTIC
01
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Lamp. Portalamp.
150
250
250
400
400
69.01.01.3
69.01.02.3
69.01.04.3
69.01.03.3
69.01.05.3
223,50
230,50
201,00
231,00
225,50
6,5
7,5
7,5
8
8
HIT / HST
HIT/HST/4,5KV
HIT/0,6KV
HIT/4,5KV
HIT/0,6KV
E40
E40
E40
E40
E40
Luminaria vial ECO
ECO street luminaire
Luminaire de rue ECO
Posibilidad de seccionador de corriente
Possibility of disconnecting switch of current
Possibilit de sectionneur
&ODVH,
(TXLSR(OHFWURPDJQpWLFR
W Cdigo Color (XURV Kg Lamp. Portalamp.
150
250
250
400
400
69.01.26.3
69.01.27.3
69.01.28.3
69.01.29.3
69.01.30.3
268,50
286,50
271,50
288,00
286,00
6,5
7,5
7,5
8
8
HIT / HST
HIT/HST/4,5KV
HIT/0,6KV
HIT/4,5KV
HIT/0,6KV
E40
E40
E40
E40
E40
&ODVH,,
Gris texturizado + Gris oscuro texturizado
Texturised grey + Textured dark grey
Gris textur + Textur gris fonc
(TXLSR(OHFWURPDJQpWLFR'REOH1LYHO
W Cdigo Color (XURV Kg Lamp. Portalamp.
250
400
69.01.44.3
69.01.45.3
279,50
283,00
7,5
8
HIT/HST/4,5KV
HIT/4,5KV
E40
E40
ECO MINI ECO
Cdigo Color (XURV Kg
96.07.34.3 140,00 12
Brazo a pared ECO / MINI ECO
ECO / MINI ECO arm wall
Bras applique ECO / MINI ECO
830 cm
470
Columna Troncocnica gris
Grey Trunkated Cone Column
Mt Tronco-conique gris
Cdigo H (mm) (XURV
96.35.87.3
96.36.87.3
96.37.87.3
96.38.87.3
4.000
6.000
8.000
10.000
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
DFRQVXOWDU
60 mm
Para ms informacin ver pagina 212
For more information page 212
3RXUSOXVGLQIRUPDWLRQYRLUSDJH
N
212
9LDO\8UEDQD
COLUMNA TRONCOCNICA
&ROXPQD7521&2&1,&$IDEULFDGDHQXQVRORWUDPRGLiPHWURHQSXQWDPP
7581.$7('&21(FROXPQPDGHLQDVLQJOHVHFWLRQGLDPHWHULQHQGPP
Mt TRONCONIQUE fabrique en un seul tronon, diamtre en pointe 60mm
Caractersticas :
0DWHULDO: Columna fabricada en acero, galvanizada
en caliente.
3HUQRVGHDQFODMH No incluidos. Diferentes dimen-
siones segn longitudes: M18 para columnas de 4 y
6 m, M22 para columnas de 8 y 10 m.
&HUWLFDFLyQ: Segn la norma UNE EN-40-5.
&DMDGHIXVLEOHV No incluida.
&RORUHV: Consultar cantidades y precio para pintado
color Ral o Gris texturizado.
7UDQVSRUWH: Portes no incluidos (a consultar).
&DUJDV Vientos inferiores a 28 m/s. El peso de las
luminarias y accesorios instalados ha de ser igual o
inferior a 40 kg. La rea efectiva de las luminarias
instaladas ha de ser igual o inferior 0.45 m2. El c.d.g
de las luminarias y accesorios no debe estar a ms
de 1 metro de la columna.
$SOLFDFLyQ Monumentos, rotondas, plazas, parques,
vias peatonales, vias de prioridad invertidas, vias urba-
nas secundarias, vias urbanas principales, vias interur-
banas secundarias, vias interurbanas primarias.
Characteristics:
0DWHULDO: Column made in galvanized steel.
5DJEROW Not including. Different dimensions accor-
ding to lengths, M18 for columns of 4 and 6 m, M22
for columns of 8 and 10 m.
&HUWLFDWLRQ: According Norm UNE-40-5.
%R[RIIXVHnot included.
&RORUVLQTXLU\TXDQWLWLHVSULFHWRQLVKLQ5$/FRORU
or Texturised grey.
7UDQVSRUW: Freight not included (to be consulted).
/RDG Wind under 28 m/s. The weight of the lighting
and installed accessories must be less than or equal
to 40 kg. The effective area of the installed lighting
must be less than or equal to 0.45 m2. The CoG of
the lighting and accessories must not be more than 1
metre from the column.
$SSOLFDWLRQ0RQXPHQWVWUDIFFLUFOHSODFHVSDUNV
pedestrain routes, inverted priority route, secundary
local route, main local route, secondary interurban
ways, main interurban ways.
Caractristiques :
0DWpULHO: mt fabriqu en acier galvanis
9LV GDQFUDJH non inclues, diffrentes dimensions
selon longueurs M18 pour mt de 4 et 6 m, M22 pour
mt de 8 et 10 m
&HUWLFDWLRQ: selon norme UNE EN-40-5.
%RvWHGHIXVLEOHV non inclue
CoXOHXUV: consulter quantits et prix pour peinture
couleur Ral ou Gris textur.
7UDQVSRUW: frais ports non inclus ( consulter).
&KDUJHV Vitesses du vent infrieures 28 m/s. Le
poids des luminaires et accessoires installs doit tre
infrieur ou gal 40 kg. La surface relle des lumi-
naires installs doit tre infrieure ou gale 0,45
m2. Le CDG des luminaires et accessoires ne doit
SDVVHWURXYHUjSOXVGXQPqWUHGHODPkW
$SSOLFDWLRQ: Monuments, ronds-points, places, par-
cs, voies pitonnires, voies de priorit inverse,
voies urbaines principaux, routes urbaines principa-
les, voies interurbaines secondaires, voies interurbai-
nes principales.
Mini Eco / Eco pag. 210-211 Dune pag. 206 Mini Proa / Proa pag.184 Shot pag.196
60
H
A
B
y
x
550
D
C
C
Columna Troncocnica
Trunkated Cone Column
Mt Troncoconique
Placa
de asiento
Puerta
registro
Dado de cimentacin
Foundation block
D de fondation
Ref. Color H (mm) Kg (XURV A B X Y C (mm) D (mm)
96.05.87.3
4.000 34
256,00
205 300
80
450
350 500
96.35.87.3 FRQVXOWDU
96.06.87.3
6.000 51
350,00
90
400 650
96.36.87.3 FRQVXOWDU
96.07.87.3
8.000 78
454,50
285 400
500 800
96.37.87.3 FRQVXOWDU
96.08.87.3
10.000 136
598,00
100 600 950
96.38.87.3 FRQVXOWDU
*
AENOR
3ODQWLOODGHMDFLyQ
Pattern bracket
3DWURQGH[DWLRQ
Ref. (XURV
96.00.89.3
(205x205)
38,00
96.00.91.3
(285x285)
Conjunto 4 pernos
Set 4 rag bolt
(QVHPEOHYLVGDQFUDJH
Ref. M L (XURV
96.00.95.3 18 500 37,00
96.00.97.3 22 750 86,50
*
Galvanizado
Galvanised
Galvanise
Gris texturizado
Texturised grey
Gris textur
N
213
9LDO\8UEDQD
COLUMNA CILNDRICA
Columna CILNDRICA 127 mm
CYLINDRICAL column 127 mm
Mt CYLINDRIQUE diamtre 127 mm
Caractersticas :
0DWHULDO: Columna fabricada en acero, galvanizada en
caliente.
3HUQRVGHDQFODMHNo incluidos. Diferentes dimen-
siones segn longitudes, M18 para columnas de 4 y
6m, M22 para 8 m.
&HUWLFDFLyQ: Segn norma UNE EN-40-5.
&DMDGHIXVLEOHVNo incluida.
&RORUHV: Consultar cantidades y precio para pintado
color Ral o Gris texturizado.
7UDQVSRUWH: Portes no incluidos (a consultar).
&DUJDV Vientos inferiores a 28 m/s. El peso de las
luminarias y accesorios instalados ha de ser igual o
inferior a 40 kg. La rea efectiva de las luminarias
instaladas ha de ser igual o inferior 0.45 m2. El c.d.g
de las luminarias y accesorios no deben estar a ms
de 1 metro de la columna.
$SOLFDFLyQ: Fachadas, monumentos, rotondas, plazas,
parques, vias peatonales, vias de prioridad invertidas.
Characteristics:
0DWHULDO: Column made in galvanized steel.
5DJEROW Not including. Different dimensions accor-
ding to lengths, M18 for columns of 4 and 6 m, M22
for 8 m.
&HUWLFDWLRQ: According Norm UNE-40-5.
%R[RIIXVH not including.
&RORUVLQTXLU\TXDQWLWLHVSULFHWRQLVKLQ5$/FRORU
or Texturised grey..
7UDQVSRUW: Freight not included (to be consulted).
LoDGWind under 28 m/s. The weight of the lighting
and installed accessories must be less than or equal
to 40 kg. The effective area of the installed lighting
must be less than or equal to 0.45 m2. The CoG of
the lighting and accessories must not be more than 1
metre from the column.
$SSOLFDWLRQ)DFDGHVPRQXPHQWVWUDIFFLUFOHSOD-
ces, parks, pedestrain routes, inverted priority route.
Caractristiques :
0DWpULHO: mt fabriqu en acier galvanis
9LVGDQFUDJH non inclues, diffrentes dimensions se-
lon longueurs M18 pour mt de 4 et 6 m, M22 pour 8 m.
&HUWLFDWLRQ: selon norme UNE EN-40-5.
%RvWHGHIXVLEOHV non inclue
CoXOHXUV: consulter quantits et prix pour peinture
couleur Ral ou Gris textur.
7UDQVSRUW: frais ports non inclus ( consulter).
&KDUJHV Vitesses du vent infrieures 28 m/s. Le
poids des luminaires et accessoires installs doit tre
infrieur ou gal 40 kg. La surface relle des lumi-
naires installs doit tre infrieure ou gale 0,45
m2. Le CDG des luminaires et accessoires ne doit
SDVVHWURXYHUjSOXVGXQPqWUHGHODPkW
$SSOLFDWLRQ Faades, monuments, ronds-points,
places, parcs, voies pitonnires, voies a priorit in-
verse.
y
H
x
3RVLEOHVFRPELQDFLRQHVFROXPQDPiVDEUD]DGHUDGHDOXPLQLRPP
3RVVLEOHFROXPQFRPELQDWLRQVDQG6KRWDOXPLQLXPDQFKRUDJHPP
3RVVLEOHVFRPELQDLVRQVPkWHWDQFUDJHHQDOXPLQLXPPP
Mini Proa / Proa pag. 186 Shot pag. 195 Shot pag.195 Step /Shot pag.177/195
*

mm
550
Columna Cilndrica
Cylindrical Cone Column
Mt Cylindrique
Placa
de asiento
Puerta
registro
Dado de cimentacin
Foundation block
D de fondation
Ref. Color H(mm) Kg (XURV A B X Y C (mm) D (mm)
96.04.88.3
4.000 45
348,50
205 300
90 450
400 500
96.34.88.3 FRQVXOWDU
96.05.88.3
6.000 65
492,00
450 650
96.35.88.3 FRQVXOWDU
96.06.88.3
8.000 122
532,50
285 400 550 800
96.36.88.3 FRQVXOWDU

D
C
C
A
B
*
Dado autoportante de cimentacin
Self-supporting foundation block.
D de fondation autoportant.
AENOR
3ODQWLOODGHMDFLyQ
Pattern bracket
3DWURQGH[DWLRQ
Ref. (XURV
96.00.89.3
(205x205)
38,00
96.00.91.3
Conjunto 4 pernos
Set 4 rag bolt
(QVHPEOHYLVGDQFUDJH
Ref. M L (XURV
96.00.95.3 18 500 37,00
96.00.97.3 22 750 86,50
Galvanizado
Galvanised
Galvanise
Gris texturizado
Texturised grey
Gris textur
N
214
,QIRUPDFLyQ
CLCULO PRECIOS ESPECIALES
LUMINARIAS FLUORESCENTES CON EQUIPOS REGULABLES
FLUORESCENT LUMINAIRES WITH DIMMABLE EQUIPMENT
LUMINAIRES FLUORESCENTS AVEC QUIPEMENTS RGLABLES
PVP 1-10V / DSI PVP DALI
Con 1-2 LMPARAS (CUALQUIER WATAGE, excepto TC-TE 70W)
With 1-2 LAMPS (ANY WATTAGE, except for TC-TE 70W)
$YHF/$03(61,03257(48(//(38,66$1&((1:$776H[FHSWpH7&7(:
+ 55,00 + 69,00
Con 3-4 LMPARAS T8 18W
With 3-4 LAMPS 3-4 LAMPS T8 18W
Avec 3-4 LAMPES ou 3-4 LAMPES T8 18W
+ 85,00 + 99,00
Con 3-4 LMPARAS DEL RESTO DE WATAGES T8
With 3-4 LAMPS REGARDING OTHER WATAGES T8
Avec 3-4 LAMPES POUR LE RESTE DES PUISSANCES EN WATT T8
+ 170,00 + 198,00
LUMINARIAS FLUORESCENTES T5 CON EQUIPOS REGULABLES MULTIPOTNCIA
FLUORESCENT T5 LUMINAIRES WITH DIMMABLE EQUIPMENT MULTIPOWER
LUMINAIRES FLUORESCENTS T5 AVEC QUIPEMENTS RGLABLES MULTIPUISSANCE
PVP 1-10V / DSI PVP DALI
Con 1-2 LMPARAS T5 HE-HO
With 1-2 LAMPS T5 HE-HO
Avec 1-2 LAMPES T5 HE-HO
+ 65,00 + 69,00
Con 3-4 LMPARAS T5 HE-HO 14/24W
With 3-4 LAMPS T5 HE-HO 14/24W
Avec 3-4 LAMPES T5 HE-HO 14/24W
+ 100,00 + 100,00
Con 3-4 LMPARAS DEL RESTO DE WATAGES T5 HE-HO
With 3-4 LAMPS REGARDING OTHER WATAGES T5 HE-HO
Avec 3-4 LAMPES POUR LE RESTE DES PUISSANCES EN WATT T5 HE-HO
+ 200,00 + 200,00
LUMINARIAS FLUORESCENTES CON EMERGENCIA
EMERGENCY FLUORESCENT LUMINAIRES
LUMINAIRES FLUORESCENTS AVEC URGENCE
Emergencia 1 H Emergencia 3 H
Con LMPARAS T5 35/49/80 W
With LAMPS T5 35/49/80 W
Avec LAMPES T5 35/49/80 W
+ 162,00 + 232,00
Con EL RESTO DE WATAGES
LAMPS WITH OTHER WATTAGES
Avec LE RESTE DES PUISSANCES EN WATT
+ 144,00 + 186,00
Nota: Para luminarias de cuerpos no lineales o largo inferior a 1.200mm, solicitar viabilidad y precio
Note For non-linear luminaires or length lower than 1.200mm, request feasibility and price
Note : Pour luminaires de corps non linaires ou de longueur infrieure 1200 mm, demander la faisabilit et le prix.
LUMINARIAS CON CONECTOR WIELAND + CABLE + ANTITRACK
LUMINAIRES WITH WIELAND CONNECTOR + CABLE + ANTITRACK
LUMINAIRES AVEC CONNEXION WIELAND + CBLE + ANTITRACK
OPCIONES
OPTIONS
OPTIONS
PVP
Con WIELAND Macho 3P + cable 0,5 m + antitrack
With WIELAND Socket 3P + cable 0,5 m + antitrack
Avec WIELAND Mle 3P + cble 0,5 m + antitrack
Estndar
Standard
Standard
+ 5,00
Con WIELAND Hembra 3P + cable 0,5 m + antitrack
With WIELAND Plug 3P + cable 0,5 m + antitrack
Avec WIELAND Femelle 3P + cble 0,5 m + antitrack
Estndar
Standard
Standard
+ 5,00
Con WIELAND Macho 3P + cable 1 m + antitrack
With WIELAND Socket 3P + cable 1 m + antitrack
Avec WIELAND Mle 3P + cble 1 m + antitrack
Estndar
Standard
Standard
+ 10,00
Con WIELAND Hembra 3P + cable 1 m + antitrack
With WIELAND Plug 3P + cable 1 m + antitrack
Avec WIELAND Femelle 3P + cble 1 m + antitrack
Estndar
Standard
Standard
+ 10,00
Con WIELAND Macho 3P + cable 3 m + antitrack
With WIELAND Socket 3P + cable 3 m + antitrack
Avec WIELAND Mle 3P + cble 3 m + antitrack
Estndar
Standard
Standard
+ 17,00
Con WIELAND Hembra 3P + cable 3 m + antitrack
With WIELAND Plug 3P + cable 3 m + antitrack
Avec WIELAND Femelle 3P + cble 3 m + antitrack
Estndar
Standard
Standard
+ 17,00
Con WIELAND Macho 5P + cable 1 m + antitrack
With WIELAND Socket 5P + cable 1 m + antitrack
Avec WIELAND Mle 5P + cble 1 m + antitrack
Regulable / Doble encendido
Dimmable / Dual Ignition
Rglable / Double allumage
+ 23,00
Con WIELAND Hembra 5P + cable 1 m + antitrack
With WIELAND Plug 5P + cable 1 m + antitrack
Avec WIELAND Femelle 5P + cble 1 m + antitrack
Regulable / Doble encendido
Dimmable / Dual Ignition
Rglable / Double allumage
+ 23,00
Con WIELAND Macho 5P + cable 3 m + antitrack
With WIELAND Socket 5P + cable 3 m + antitrack
Avec WIELAND Mle 5P + cble 3 m + antitrack
Regulable / Doble encendido
Dimmable / Dual Ignition
Rglable / Double allumage
+ 36,00
Con WIELAND Hembra 5P + cable 3 m + antitrack
With WIELAND Plug 5P + cable 3 m + antitrack
Avec WIELAND Femelle 5P + cble 3 m + antitrack
Regulable / Doble encendido
Dimmable / Dual Ignition
Rglable / Double allumage
+ 36,00
&iOFXOR3UHFLRV(VSHFLDOHV
6SHFLDO3ULFHV&DOFXODWLRQ
&DOFXOGHSUL[VSpFLDX[
215
,QIRUPDFLyQ
Custom-Made
/XPLQDULDV(VSHFLDOHV
INCLUIR LMPARA EN LA LUMINARIA
LAMP INCLUDED IN THE LUMINAIRE
INCLURE LAMPE DANS LE LUMINAIRE
A CONSULTAR
PINTURA COLORES CARTA RAL DE LAMP PARA LUMINARIAS Y ACCESORIOS
3$,17,1*&2/2856,1/$03&28/285&+$57)25/80,1$,5(6$1'$&&(6625,(6
PEINTURE COULEURS CARTE RAL DE LAMP POUR LUMINAIRES ET ACCESSOIRES
+ 15% SOBRE P.V.P
PINTURA OTROS COLORES
3$,17,1*27+(5&2/2856
PEINTURE AUTRES COULEURS
A CONSULTAR
(-(03/2&/&8/235(&,26(63(&,$/(63$5$),/
(;$03/(2)63(&,$/35,&(&$/&8/$7,21)25),/
(;(03/('(&$/&8/'(35,;63e&,$8;3285),/
OPCIONES
OPTIONS
OPTIONS
PVP
Luminaria FIL con difusor de policarbonato opal (47.41.62.3 - 1x54 W)
FIL luminaire with opal polycarbonate diffuser
Luminaire FIL avec diffuseur en polycarbonate opal
- 131,50
REGULABLE 1-10V / DSI con 1-2 LMPARAS
1-10V / DSI DIMMABLE with 1-2 LAMPS
RGLABLES 1-10V / DSI Avec 1-2 LAMPES
1-10V / DSI
131,50 + 65,00 =
196,50
REGULABLE DALI con 1-2 LMPARAS
DALI DIMMABLE with 1-2 LAMPS
RGLABLES DALI Avec 1-2 LAMPES
DALI
131,50 + 68,00 =
199,50
Con EMERGENCIA 1 H EL RESTO DE WATAGES
With EMERGENCY 1 H OTHER WATTAGES
Avec URGENCE 1 H LE RESTE DES PUISSANCES EN WATT
EMERGENCIA 1 H
EMERGENCY 1 H
URGENCE 1 H
131,50 + 144,00 =
275,50
Con WIELAND Macho 3P + cable 0,5m + antitrack
With WIELAND Socket 3P + cable 0,5 m + antitrack
Avec WIELAND Mle 3P + cble 0,5 m + antitrack
CONECTOR WIELAND
WIELAND CONNECTOR
CONNEXION WIELAND
131,50 + 5,00 =
136,50
PINTURA CUERPOS + ACCESORIOS COLORES CARTA RAL DE LAMP
PAINTING: COLOURS IN LAMP COULOUR CHART FOR LUMINAIRES AND ACCESSORIES
PEINTURE COULEURS CARTE RAL DE LAMP POUR LUMINAIRES ET ACCESSOIRES
COLORES CARTA RAL
COLOURS IN COULOUR CHART
COULEURS CARTE RAL
131,50 + 15% =
151,20
2EUDVVLQJXODUHVFRQOXPLQDULDVHVSHFLDOHV
6LQJXODUZRUNVZLWKVSHFLDOOXPLQDLUHV
7UDYDX[VSpFLDX[DYHFGHVOXPLQDLUHVVSpFLDX[
Pabelln 8 Fira de Barcelona - Architect: Toyo Ito
Pavilion 8 Trade Fair Barcelona
Pavillon 8 Foire de Barcelona
Torre Diagonal Zero Zero - Architect: EMBA_Estudi Massip-Bosch Arquitectes
Diagonal Zero Zero Tower
Tour Diagonal Zero Zero
La Caja Mgica - Architect: Dominique Perrault
The Magic Box
La Bote Magique
Torre del Agua - Architect: Enrique de Teresa
The Water Tower
/D7RXUGHO(DX
216
,QIRUPDFLyQ
PICTOGRAFA
'HQLFLyQ Meaning 'pQLWLRQ
CLASE
I
Luminaria en que la proteccin contra los choques
elctricos est provista, aparte del aislamiento prin-
cipal, por la conexin de las partes conductoras ac-
cesibles a tierra.
Luminaire in which protection against electric
shocks is based, in addition to the main insulation,
upon the earthing of accessible conductive parts.
Dans ce type de luminaire, la protection contre
OHVFKRFVpOHFWULTXHVHVWDVVXUpHSDUOLVRODWLRQ
principale et par la connexion la terre des parties
conductrices accessibles.
Luminaria en que la proteccin contra los choques
elctricos no recae en el aislamiento principal, sino que
comprende medidas de seguridad complementarias
como el doble aislamiento.
Luminaire in which protection against electric
shocks is not based upon the main insulation, but
rather upon complementary safety measures such
as double insulation.
Dans ce type de luminaire, la protection contre les
FKRFVpOHFWULTXHVQHVWSDVDVVXUpHSDUOLVRODWLRQ
principale mais par des mesures de scu rit su-
pplmentaires, comme la double isolation.
Luminaria en que la proteccin contra los choques
elctricos recae en la alimentacin a muy baja ten-
sin de seguridad (MBTS).
Luminaire in which protection against electric
shocks is based on a very low safety voltage.
Dans ce type de luminaire, la protection contre les
FKRFVpOHFWULTXHHVWDVVXUpHSDUODOLPHQWDWLRQGH
scurit trs basse tension (MBTS).
Luminarias no adecuadas para cubrirse con mate-
rial aislante trmico.
Luminaires should never be covered with any heat
insulating material.
Luminaires non adquats pour couvrir avec matriel
isol thermique.
100
Luminaria protegida de Temperaturas mximas de
&HQVXSHUFLH
Luminaire protected of maximum temperatures of
100 C in surface.
Luminaire protg de tempratures maximales de
100C en surface.
M M
Equipo adequado para el montaje directo en madera. Adequate equipment for direct mounting in wood. quipement adquat pour montage direct en bois.
XX
ngulo mximo de basculacin de la luminaria. Maximum adjustment angle of the luminaire. $QJOHPD[LPDOGLQFOLQDLVRQGXOXPLQDLUH
XXX
ngulo mximo de giro horizontal
de la luminaria.
Maximum adjustment angle of the luminaire. Angle maximal de rotation horizontale du luminaire.
XX
XX
XX
XX
ngulo mximo de basculacin en los dos
ejes de una luminaria de sistema cardan.
Maximum adjustment angle of the two axes of a
cardan system luminaire.
$QJOHPD[LPDOGLQFOLQDLVRQVXUOHVGHX[D[HVGXQ
luminaire de systme cardan.
SEQUENCING
Luminaria motorizada accionada con control
remoto (movimientos, programacin de escenas y
regulacin)
Motorised luminaire, remote controlled (move-
ments, programming of scenes and regulation).
Luminaire motoris par tlecommande (mouve-
ments, programmer de scnes et rgulation).
GLASS
Luminaria con cristal incorporado. Luminaire with built-in glass screen. Luminaire avec verre incorpor.
INOX
AISI XXX
Acero Inoxidable. Stainless Steel. Acier Inoxydable.
PC
Cuerpo de policarbonato. Polycarbonate body. Corps polycarbonate.
Al
Cuerpo de aluminio. Aluminium body. &RUSVGDOXPLQLXP
XXX
El material ha superado con xito la prueba del hilo
incandescente a la temperatura indicada.
Material which has successfully passed the incan-
GHVFHQWODPHQWWHVWDWWKHLQGLFDWHGWHPSHUDWXUH
/HPDWpULHODVXLYLDYHFVXFFqVOHWHVWGXO
incandescent la temprature indique.
XXX Diametro de empotramiento de suelo. Floor aperture diameter. 'LDPqWUHGHQFDVWUHPHQWGXVRO
XXX
Dimetro de recorte de techo. Ceiling aperture diameter. Diamtre de la dcoupe du plafond.
XXX x XXX
Medidas de recorte de techo rectangular. Rectangular ceiling aperture dimensions. Mesures dcoupe de plafond rectangulaire.
217
,QIRUPDFLyQ
PICTOGRAFA
'HQLFLyQ Meaning 'pQLWLRQ
01
ENEC: marca de conformidad europea ENEC: trademark in accordance with European
Standards CE.
ENEC: marque selon normes Europennes CE.
&HUWLFDFLyQ$(125 $(125FHUWLFDWLRQ &HUWLFDWLRQ$(125
$XWRFHUWLFDFLyQ&( &(VHOIFHUWLFDWLRQ $XWRFHUWLFDWLRQ&(
Mx. m XX mm
Altura mxima del panel para adaptar el
anclaje de la luminaria.
Maximum panel thickness for luminaire anchoring
point.
Hauteur maximale du panneau pour adapter la
[DWLRQGXOXPLQDLUH
Luminaria que necesita equipo pero no lo lleva in-
corporado.
Luminaire without required control gear built-in. Luminaire qui ncessite un ballast mais nous livr
avec.
1-10V
Equipo 1-10V. Control gear 1-10V. quipement 1-10V.
DALI
Equipo DALI. DALI Control gear. quipement DALI.
Digital
DSI
Equipo DSI. DSI Control gear. quipement DSI.
DMX
RDM
Las luminarias se controlan mediante protocolo
DMX-RDM.
The luminaires are controlled with the DMX-RDM
system.
Les clairages sount contrls par un protocole
DMX-RDM
Luminaria con lmpara incluida. Luminaire with lamp included. Luminaire avec lampe inclue.
/XPLQDULDFRQODVWDSDVQDOHVQRLQFRUSRUDGDV Luminaire not including end covers. Luminaire fourni sans embouts.
Manguera de 1m HO7RN-F (3x1,5) incluida. Manguera de 1m HO7RN-F (3x1,5) incluida. Cble HO7RNF de 1m (3x1,5) inclus
Luminaria preparada para doble encendido. Luminaire designed for double switching. Luminaire prpar pour un double allumage.
mx XXX Kg
Luminaria Uplight para trnsito no rodado. Walkover uplight. Luminaire Uplight transitable pour pietons
(voies sans circulation de vhicules).
Equipo electrnico de posible instalacin indepen-
diente.
Electronic transformer for possible independent
installation.
Transformateur lectronique pour possible installa-
tion indpendant.
ABS
Polmero de alto brillo. High-brilliance polymer. Polymre de brillance leve.

XX
Haz de luz. Beam of light. Faisceau
218
,QIRUPDFLyQ
LMPARAS
Descripcin Potencia W Ra Flujo luminoso (lm) Portalmparas mm. L mm
A-60/A-65
E27

Lmpara incandescente A60/A65
Incandescent lamp A60 / A65
Lampe incandescent A60 / A65
60
75
100
1A
700
915
1330
E27
E27
60
65
105
123
QT 9
G4
Lmpara halgena QT-9
QT-9 halogen lamp
Lampe halgene QT-9
10 1A 140 G4 9 33
QT 12
GY6,35 Lmpara halgena QT-12
QT-12 halogen lamp
Lampe halgene QT-12
20
35
50
75
100
1A
300
600
950
1.575
2.200
GY6,35 12 44
PAR20
E27 Lmpara halgena PAR 20
PAR 20 halogen lamp
Lampe halgene PAR-20
50 1A --- cd E 27 64,5 91
PAR30
E27 Lmpara halgena PAR 30
PAR-30 halogen lamp
Lampe halgene PAR-30
75 1A --- cd E 27 97 90,5
PAR38
E27 Lmpara halgena PAR-38
PAR-38 halogen lamp
Lampe halgene PAR-38
75
100
120
1A --- cd
E 27
E 27
E 27
123,5
123,5
122
136
136
136
QR-70
OSRAM
BA15d /iPSDUDKDOyJHQDGHFRQUHHFWRUGHDOXPLQLR
+DORJHQODPSZLWKDOXPLQLXPUHHFWRU
/DPSHKDOzJHQHDYHFUpHFWHXUHQDOXPLQLXP
50 1A --- cd BA15d 70 50
QR-111
G 53
/iPSDUDKDOyJHQDFRQUHHFWRUGHDOXPLQLR
+DORJHQODPSZLWKDOXPLQLXPUHHFWRU
/DPSHKDOzJHQHDYHFUpHFWHXUHQDOXPLQLXP
30/35
50
75
100
1A --- cd
G53
G53
G53
G53
111
111
111
111
46
46
49
49
QR-CBC51
GU 5,3 /iPSDUDKDOyJHQDFRQUHHFWRUGLFURLFR9PP
+DORJHQODPSZLWK9PPPPGLFKURLFUHHFWRU
/DPSHKDOzJHQHDYHFUpHFWHXUGLFKURwTXH9PPPP
20
35
50
1A --- cd
GU5,3/GU4
GU5,3/GU4
GU5,3
51/35
51/35
51
45
45
45
QT-DE
R7 s
Lmpara halgena lineal doble casquillo
Double ended halogen lamp
Lampe halgene Linaire Double Culot
150
200
300
500
1000
1500
1A
2200
3200
5000
9500
22000
33000
Rx7s R7s 12
114,2
114,2
114,2
114,2
185,7
250,7
T8/T26
G13

Lmpara Fluorescente dimetro 26 mm
)OXRUHVFHQWPP
)OXRUHVFHQWPP
18
36
58
1B
1350
3350
5200
G13 26
590
1200
1500
T5/T16
G5
Lmpara Fluorescente dimetro 16 mm
)OXRUHVFHQWPP
)OXRUHVFHQWPP
HE
14
-
28
35
HO
24
39
54
80
VHO
-
-
95
120
1B
HE
1200
-
2850
3650
HO
1750
3100
4450
6150
VHO
-
-
7200
9300
G5 16
HE
549
-
1149
1449
HO
549
849
1149
1449
VHO
-
-
1149
1449
TC-D
G24d-1
Lmpara Fluorescente Compacta Doble
Compact Fluorescent Double
Fluorescent Compacte Double
13
18
26
1B
900
1200
1800
G 24-d1
G 24-d2
G 24-d3
34
138
153
172
TC-DE
G24q-2
Lmpara Fluorescente Compacta Doble Electrnica
Compact Fluorescent Double Electronic
Fluorescent Compacte Double Electronique
13
18
26
1B
900
1200
1800
G 24-q1
G 24-q2
G 24-q3
34
131
146
165
TC-T
GX24d Lmpara Fluorescente Compacta Triple
Compact Fluorescent Triple
Fluorescent Compacte Triple
18 1B 1200 G 24-d2 49 123
TC-TE
GX24q Lmpara Fluorescente Compacta Triple Electrnica
Compact Fluorescent Triple Electronic
Fluorescent Compacte Triple Electronique
26
32
42
57
70
1B
1800
2400
3200
4300
5200
GX 24-q3
GX 24-q3
GX 24-q4
GX 24-q5
GX 24-q6
49
49
49
58
58
131
142
163
178
208
TC-L
2 G 11
Lmpara Fluorescente Compacta larga
Compact Fluorescent Long
Fluorescent Compacte Allong
18
24
36
55
80
1B
1200
1800
2900
4800
6000
2G 11 -
225
315
415
535
575
TC-TSE
E 27
Lmpara Fluorescente Compacta con reactanca
Compact Fluorescent whit ballast
Fluorescent Compacte avec ballast
20
23
1B
1200
1500
E 27
52
58
153,5
178
Gx53
Lmpara Fluorescente Compacta disco
Disc Compact Fluorescent
Fluorescent Compacte Disque
9 1B
280
250
360
GX53 75
24
29
26
PL-R
GR14q-1 Lmpara Fluorescente Compacta ECO
ECO Compact Fluorescent
Fluorescent Compacte ECO
14
17
1B
1200
1500
GR14q-1
40
40
123
145
TL5c
2GX13
Lmpara Fluorescente Compacta Circular
Circular Compact Fluorescent
Fluorescent Compacte Circulaire
60 1B 5000 2GX13 16 379
Incandescencia Incandescent Incandescent
Fluorescentes Fluorescents Lamps Lampes Flourescents
219
,QIRUPDFLyQ
LMPARAS
Descripcin Potencia W Ra Flujo luminoso (lm) Portalmparas mm. L mm
CDM-Tm
PGJ5

Lmpara Halogenuros Metlicos CDM-Tm
CDM-Tm Metal Halide
Lampe Iodures Mtalliques CDM-Tm
20
30
1A-1B
1650
3000
PGJ5 17 52
HI-PAR30
E27 Lmpara Halogenuros Metlicos HI-PAR30
HI-PAR30 Metal Halide
Lampe Iodures Mtalliques HI-PAR30
35
70
1A-1B --- cd E 27 97 125
CDM-R111
GX 8,5 /iPSDUD+DORJHQXURV0HWiOLFRVFRQUHHFWRUGHDOXP
0HWDO+DOLGHODPSZLWKDOXPLQLXPUHHFWRU
/DPSHj,RGXUHV0pWDOOLTXHVDYHFUpHFWHXUHQDOXPLQ
35
70
1A --- cd GX8,5 111 95
HIT
E40 Lmpara Halogenuros Metlicos Tubular
Metal Halide Tubular
Lampe Iodures Mtalliques Tubulaire
250
400
1B
20000
32000
E 40
46
62
225
275
HIT-DE
Lmpara Halogenuros Metlicos Tubular Doble Casquillo
Double Endend Metal Halide Tubular
Lampe Iodures Mtalliques Tubulaire Double Culot
70
150
250
400
1A/1B
5000
11000
20500
35000
RX7s
RX7s-24
FC 2
FC 2
20
23
25
25
114,2
132
163
206
HIT
G12
Lmpara Halogenuros Metlicos Bipin
Bipin Metal Halide lamp
Lampe Iodures Mtalliques Bipin
35
70
150
250
1A/1B
3300
6600
12700
23000
G12
20
20
20
23
100
100
110
130
HIT-TC
G8,5 Lmpara Halogenuros Metlicos compacta
Compact Metal Halide lamp
Lampe Iodures Mtalliques compacte
35
70
1A/1B
3300
6400
G8,5 14
max.
85
HIE
E40 Lmpara Halogenuros Metlicos Elipsoidal
Metal Halide Elipsoidal
Lampe Iodures Mtalliques Ellipsoidale
250
400
1B
19000
32000
E 40
90
120
226
290
CPO-T
PGZ12
Lmpara Halogenuros Metlicos CPO-T
Metal Halide lamp CPO-T
Lampe Iodures mtalliques CPO-T
60
140
2A
6600
16500
PGZ 12 19
128
143
SDW-TG
GX12-1 Lmpara Mini Sodio Blanco Alta Presin
High Pressure Mini White SON lamp
Lampe Mini Sodium Blanc Haute Pression
50
100
1B
2400
4900
GX12-1 20
90
97
HST
PG12-1 Lmpara Sodio Blanco Alta Presin
High Pressure White Sodium lamp
Lampe Sodium Blanc Haute Pression
50
100
1B
2300
4700
PG 12-1 31
16,8
19,2
HST
E27/E40 Lmpara de Sodio de Alta Presin Tubular
High Pressure Sodium Tubular
Sodium Haute pression Tubulaire
50
70
100
150
250
400
600
1000
4
4400
6600
10700
17500
33200
56500
90000
130000
E27
E27
E40
E40
E40
E40
E40
E40
38
38
48
48
48
48
47
66
156
156
210
210
257
283
283
355
HST-DE
Lmpara de Sodio de Alta Presin Tubular doble casquillo
High Pressure Sodium Tubular
Sodium Haute Pression Tubulaire
70
150
250
400
4
6800
15000
25000
48000
R x 7s
R x 7s - 24
FC2
FC2
20
23
70
70
114,2
132
156
156
HSE
E27/E40 Lmpara de Sodio de Alta Presin Elipsoidal
High Pressure Sodium Elipsoidal
Sodium Haute Pression Ellipsoidale
70
100
150
250
400
4 2B/4
4 2B/4
2B/4
5600
9500
15500
30000
54000
E 27
E40
E40
E40
E40
71
75
90
90
120
156
186
226
226
290
HME
E27/E40
Lmpara de Vapor de Mercurio Elipsoidal
High Pressure Mercury Vapour Ellipsoidal
Vapeur de Mercure Ellipsoidal
80
125
250
400
3
4000
6500
14000
24000
E 27
E 27
E 40
E 40
70
75
90
125
156
170
226
290
Descripcin Potencia W Equipo Tipo
LED
Diodo de emisin de luz
Light emitting diode
Diodes de haute mission
1,2
2,4
3,6
1,2
1,2
350 mA
700 mA
1000 mA
12 V
24 V
Led proyeccin
LED
SIGN
Diodo de emisin de luz de sealizacin
Light emitting diode for signaling
Diodes de haute mission pour signalisation
0,06 - 0,1
12 V
24 V
Led sealizacin
Lmparas
Potencia W Flujo (FLHQFLDOPZ Vida media (h) CRI
&
X
D
G
U
R

G
H

F
L
H
Q
F
L
D
V
Incandescente Standard 100 1380 14 1000 100
Incandescente Halogena 300 5000 17 2000 100
Fluorescente Compacta 26 1800 75 15000 >80
Fluorescente Tubular 36 3350 93 20000 >80
Halogenuros Metlicos 150 14000 93 15000 >80
Sodio Alta Presin 100 10700 107 32000 >25
Sodio Baja Presin 135 22600 167 22000 -
Led de potencia 1,2 107-130 89-108 50000 70-93
Descarga de alta intensidad Glow discharge 'pFKDUJHGKDXWHLQWHQVLWp
Diodo de alta emisin Diode of high emission Diodes de haute mission
Caract. Generales Fuentes de Luz General chair. light sources Carac. gnraux sources de lumire
Color Min. Max.
Cool White 5.000 K 10.000 k
Neutral White 3.700 K 5.000 K
Warm White 2.600 K 3.700 K
RGB - -
220
,QIRUPDFLyQ
GRADO DE PROTECCIN IP, IK
FLIUD
3URWHFFLyQGHOPDWHULDOIUHQWHDODOWUDFLyQGHHOHPHQWRVVyOLGRVH[WUDxRV
y polvo, as como de las persona respecto a la tensin de los componentes
de la luminaria.
0 - No protegida.
1 - Protegida frente a cuerpos slidos mayores de 50 mm.
2 - Protegida frente a cuerpos slidos mayores de 12 mm.
3 - Protegida frente a cuerpos slidos mayores de 2,50 mm.
4 - Protegida frente a cuerpos slidos mayores de 1 mm.
5 - Protegida contra el polvo.
6 - Completa proteccin contra el polvo.
VWJXUH
3URWHFWLRQRIWKHPDWHULDODJDLQVWWKHOWUDWLRQRIVROLGHOHPHQWVDQGGXVW
as well as to the people in respect to the tension of the components of the
luminaire.
0 - Not protected.
1 - Protection against solid bodies bigger than 50 mm.
2 - Protection against solid bodies bigger than 12 mm.
3 - Protection against solid bodies bigger than 2,50 mm.
4 - Protection against solid bodies bigger than 1 mm.
5 - Protection against the dust.
6 - Complete protection against the dust.
HUFKLIIUH
3URWHFWLRQGXPDWpULDXGHODOWUDWLRQGpOpPHQWVVROLGHVpWUDQJHUVHWGHOD
poussire, ainsi que des personnes par rapport la tension des compo-
sants du luminaire.
0 - Non protg.
3URWHFWLRQjOpJDUGGHFRUSVVROLGHVGHSOXVGHPP
3URWHFWLRQjOpJDUGGHFRUSVVROLGHVGHSOXVGHPP
3URWHFWLRQjOpJDUGGHFRUSVVROLGHVGHSOXVGHPP
3URWHFWLRQjOpJDUGGHFRUSVVROLGHVGHSOXVGHPP
3URWHFWLRQjOpJDUGGHODSRXVVLqUH
6 - Protection complte contre la poussire.
FLIUD
Proteccin del material a la penetracin de lquido.
0 - No protegida.
1 - Protegida a la cada vertical de gotas de agua.
2 - Protegida frente a la cada de gotas hasta un ngulo de 15 respecto
a la vertical.
3 - Protegida frente la lluvia.
4 - Protegida contra la proyeccin de agua.
5 - Protegida al chorro de agua.
6 - Protegida a los golpes de mar.
7 - Protegida a la inmersin.
8 - Material sumergible.
Cdigo IK IK00 IK01 IK02 IK03 IK04 IK05 IK06 IK07 IK08 IK09 IK10
*
0,15 0,2 0,35 0,5 0,7 1 2 5 10 20
QGJXUH
Protection of the material to the penetration of liquid
0 - Not protected.
1 - Protected against steady dripping.
2 - Protected against falling water to a maximum 15.
3 - Protected against rain.
4 - Protected against sprays.
5 - Protected against water jets.
6 - Protected against waves.
7 - Water-tight immersion.
8 - Water-tight against immersion.
pPHFKLIIUH
3URWHFWLRQGXPDWpULDXjOpJDUGGHODSpQpWUDWLRQRXOWUDWLRQGHOLTXLGHV
0 - Non protg.
3URWpJpGHODWRPEpHYHUWLFDOHGHJRXWWHVGHDXGHSOXLH
3URWpJpGHVJRXWHVGHDXGHSOXLHTXLHQWRPEDQWIRUPHQWXQDQJOH
de 15 par rapport la ligne verticale.
3URWHFWLRQjOpJDUGGHODSOXLH
3URWHFWLRQjOpJDUGGHODSURMHFWLRQGHDX
3URWHFWLRQjOpJDUGGHVMHWVGHDX
3URWHFWLRQjOpJDUGGHVKHXUWVSURGXLWVSHUODPHU
3URWHFWLRQjOLPPHUVLRQ
8 - Matriau submersible.
'HDFXHUGRFRQOD1RUPD(1ODVOXPLQDULDVVHFODVLFDQHQIXQFLyQGHODSURWHFFLyQGHULYDGDGHVXVHOHPHQWRVFRQVWUXFWLYRV/DQRPHQFODWXUDYLHQHVLPEROL-
zada por las letra IP seguidas de tres cifras, aunque se indiquen las dos primeras.
&yGLJR,.
6LVWHPDGHFRGLFDFLyQSDUDLQGLFDUHOJUDGRGHSURWHFFLyQSURSRUFLRQDGR
por una envolvente contra los impactos mecnicos nocivos.
Code system which indicates the degree of protection given by a body
and the protector against harmful mechanic impacts.
6\VWqPHGHFRGLFDWLRQSRXULQGLTXHUOHGHJUpGHSURWHFWLRQSURSRUWLRQQp
pour une enveloppe, contre les impacts mcaniques nocifs.
Energa de impacto (J)
Impact energy (J)
(QHUJLHGLPSDFW-
*
Sin proteccin Not protected Sans protection
,QDJUHHPHQWZLWKWKHQRUP(1WKHOXPLQDLUHVDUHFODVVLHGDFFRUGLQJWRWKHGHULYHGSURWHFWLRQRILWVFRQVWUXFWLYHHOHPHQWV7KHQRPHQFODWXUHFRPHVV\PEROL-
VHGE\WKHOHWWHUV,3IROORZHGRIWKUHHJXUHVDOWKRXJKWKHWZRUVWRQHVDUHLQGLFDWHG
Conformment la Norme EN 60598-1, les luminaires sont classs en fonction de la protection drive des lments qui le composent. La nomenclature est reprsen-
te au moyen des symboles IP, suivis de trois chiffres, mme si les deux premirs sont indiqus.
IP
20
IP
20
IP
20
IK
09
221
,QIRUPDFLyQ
CARTA DE COLORES
&RORUHVHVSHFLDOHV 6SHFLDOFRORXUV &RXOHXUVVSpFLDOHV
Colores distintos a los establecidos en la tarifa, se
consideranHMHFXFLRQHVHVSHFLDOHV Precio y plazo
de entrega a consultar.
Segn su aplicacin, pueden advertirse pequeas
diferencias, entre los colores originales y los conse-
guidos en determinados productos.
Different colours from the ones settled on the price list
are considered as VSHFLDOH[HFXWLRQV. Enquire for
price and delivery time.
When applied, there may be small differences between
WKHRULJLQDOFRORXUVDQGWKRVHREWDLQHGRQFHUWDLQQDO
products
Les couleurs diffrentes que celles tablies sur le tarif
sont considres comme H[pFXWLRQVVSpFLDOHV. Prix
et dlais de livrasion consulter.
En fonction de leur application, de petites diffrences
peuvent tre observes entre les couleurs origina-
les et celles qui peuvent tre obtenues sur certains
produits.
*DPD5DOEiVLFD 5DOEDVLFUDQJH *DPPH5DOEDVLTXH
*DPD5DOSDVWHO 5DOSDVWHOUDQJH *DPPH5DOSDVWHO *DPDPHWDOL]DGD 0HWDOOLFUDQJH *DPPHPHWDOOLVp
RAL 5015 RAL 5010 RAL 5002
RAL 9010 RAL 9011 RAL 7000 RAL 8011 RAL 6029 RAL 6018
RAL 3020 RAL 2008 RAL 1021 RAL 1016 RAL 3003
RAL 1013 RAL 1017 RAL 3017 RAL 5024 RAL 6027
GRIS LAMP
Esta carta de colores debe de utilizarse slo como
gua de referencia. La reproduccin por cuatricroma
OLPLWDODGHOLGDGGHOFRORU
This colours card should be used as a guide for
reference only. The reproduction for four colour limits
WKHFRORXUVGHOLW\
Cette carte de couleurs ne doit tre utilise que
comme guide de rfrence. La reproduction par qua-
GULFKURPLHOLPLWHODGpOLWpGHODFRXOHXUUpHOOH
2SWLFDV 2SWLF 2SWLTXH
&RORUHV\DFDEDGRVHVWDQGDUG 6WDQGDUGFRORXUVDQGQLVK &RXOHXUVHWQLWLRQVWDQGDUG
Los cuadrados de color , que estan despues
del cdigo, indican el acabado estandard de cada
referencia.
Blanco White Blanc
Gris Grey Grise
Negro Black Noir
Azul Blue Bleu
Crema Ral 1013 Cream Ral 1013 Crme Ral 1013
The colouredsquares placed after the code,
LQGLFDWHWKHVWDQGDUGQLVKRIHDFKUHIHUHQFH
Antracita Anthracite Anthracite
Gris oscuro + Gris Dark gray + Grey Gris fonc + Gris
*ULV*UDWRGrey + Graphite Gris + Graphite
Anodizado + Negro Anodized + black Anodis + Noir
Anodizado + Gris Anodized + Grey Anodis + Gris
Les carrs de coleur , qui se trouvent aprs
OHFRGHLQGLTXHQWODQLWLRQVWDQGDUGGHFKDTXH
rfrence.
Anonizado Anodised Anodis
Niquelado Nickel plated Nickelage
Galvanizado Galvanised Galvanise
Acero inoxidable Steinless steel Acier inoxydable
Cromado Chrome Chrome
Las pticas permiten tener un control de la direccin
GHOXMROXPLQRVR(VLPSUHVFLQGLEOHXWLOL]DUORVySWLPRV
materiales para obtener tanto las mnimas prdidas del
XMROXPLQRVRFRPRODPtQLPDGLVWRUVLyQGHOFRORU
The lenses enable us to control the direction of the
OXPLQRXVX[,WLVHVVHQWLDOWRXVHWKHEHVWPDWHULDOV
WRHQVXUHPLQLPDOORVVRIOXPLQRXVX[DQGPLQLPDO
colour distortion.
Les optiques permettent de contrler la direction du
X[OXPLQHX[,OHVWLQGLVSHQVDEOHGXWLOLVHUOHVPDWp-
riels optimaux pour obtenir des pertes minimales du
X[OXPLQHX[HWXQHGLVWRUVLRQPLQLPDOHGHODFRXOHXU
2SWLF
Superspot (SSP) 0 - 9
Spot (SP) 10 - 19
Medium Flood (MFL) 20 - 29
Flood (FL) 30 - 39
Wide Flood (WFL) 40 - 69
Very wide Flood (VWFL) >70
Eliptical 12 x 30
Street -
222
,QIRUPDFLyQ
REF. / PAG.
Codigo Plazo Descripcin Euros Pg. Codigo Plazo Descripcin Euros Pg.
47 FIL / FIL + / FIL + TRIMLESS / FIL + LED
4705003
4705100
4705103
4705200
4705203
4705210
4705213
4705500
4705503
4705510
4705513
4706400
4706403
4706413
4706450
4706453
4741080
4741083
4741090
4741093
4741160
4741163
4741170
4741173
4741180
4741183
4741190
4741193
4741240
4741243
4741250
4741253
4741260
4741263
4741270
4741273
4741280
4741283
4741290
4741293
4741360
4741363
4741370
4741373
4741380
4741383
4741450
4741453
4741460
4741463
4741470
4741473
4741480
4741483
4741490
4741493
4741610
4741613
4741620
4741623
4741630
4741633
4741640
4741643
4741650
4741653
4741660
4741663
4741690
4741693
4741700
4741703
4741770
4741773
4741780
4741783
4741790
4741793
4741810
4600605
4605010
4605020
4605030
4605040
4605042
4605043
4605050
4605052
4605053
4605060
4605062
4605063
4605180
4605182
4605183
4605190
4605192
4605193
4605200
4605202
4605203
4605210
4605212
4605213
4605220
4605222
4605223
4605230
4605232
4605233
4605240
4605242
4605243
4605250
4605252
4605253
4605260
4605262
4605263
4605270
4605272
4605273
4605280
4605282
4605283
4605290
4605292
4605293
4606400
4606402
4606403
4607050
4607070
4607080
4607530
4608530
4608590
4611100
4700110
4700113
4700120
4700123
4700390
4700393
4700480
4700483
4700490
4700493
4700580
4700583
4700670
4700673
4700680
4700683
4700950
4705000
46 CARRIL TRIFSICO
ACC. HERRAMIENTA CARRIL
CARRIL TRIFASICO EMPOTRABLE 1 M. BLANCO
CARRIL TRIFASICO EMPOTRABLE 2 M. BLANCO
CARRIL TRIFASICO EMPOTRABLE 3 M. BLANCO
CARRIL TRIFASICO 3 MTS BLANCO
CARRIL TRIFASICO 3 MTS NEGRO
CARRIL TRIFASICO 3 MTS GRIS
CARRIL TRIFASICO 2 MTS BLANCO
CARRIL TRIFASICO 2 MTS NEGRO
CARRIL TRIFASICO 2 MTS GRIS
CARRIL TRIFASICO 1 MTS BLANCO
CARRIL TRIFASICO 1 MTS NEGRO
CARRIL TRIFASICO 1 MTS GRIS
UNION T TIERRA DERECHA EXTERIOR BLANCO
UNION T TIERRA DERECHA EXTERIOR NEGRO
UNION T TIERRA DERECHA EXTERIOR GRIS
UNION T TIERRA IZQUIERDA EXTERIOR BLANCO
UNION T TIERRA IZQUIERDA EXTERIOR NEGRO
UNION T TIERRA IZQUIERDA EXTERIOR GRIS
UNION CODO 90 TIERRA EXTERIOR BLANCO
UNION CODO 90 TIERRA EXTERIOR NEGRO
UNION CODO 90 TIERRA EXTERIOR GRIS
UNION CODO 90 TIERRA INTERIOR BLANCO
UNION CODO 90 TIERRA INTERIOR NEGRO
UNION CODO 90 TIERRA INTERIOR GRIS
UNION T TIERRA DERECHA INTERIOR BLANCO
UNION T TIERRA DERECHA INTERIOR NEGRO
UNION T TIERRA DERECHA INTERIOR GRIS
UNION T TIERRA IZQUIERDA INTERIOR BLANCO
UNION T TIERRA IZQUIERDA INTERIOR NEGRO
UNION T TIERRA IZQUIERDA INTERIOR GRIS
UNION EN CRUZ BLANCO
UNION EN CRUZ NEGRO
UNION EN CRUZ GRIS
UNION CODO FLEXIBLE BLANCO
UNION CODO FLEXIBLE NEGRO
UNION CODO FLEXIBLE GRIS
ALIMENTACION INTERMEDIA BLANCA
ALIMENTACION INTEMEDIA NEGRA
ALIMENTACION INTEMEDIA GRIS
UNION SIN DISTANCIAMENTO BLANCO
UNION SIN DISTANCIAMENTO NEGRO
UNION SIN DISTANCIAMENTO GRIS
ALIMENTACION DERECHA BLANCO (XTS11)
ALIMENTACION DERECHA NEGRO
ALIMENTACION DERECHA GRIS
ALIMENTACION IZQUIERDA BLANCO
ALIMENTACION IZQUIERDA NEGRO
ALIMENTACION IZQUIERDA GRIS
TAPA FINAL CARRIL TRIFASICO BLANCO
TAPA FINAL CARRIL TRIFASICO NEGRO
TAPA FINAL CARRIL TRIFASICO GRIS
EMBELLECEDOR ALIMENTACION FINAL EMP.
EMBELLECEDOR ALIMENTACION INTERM. EMP.
SUSPENSION CARRIL TRIFASICO EMP. BL.
SUSPENSION DIRECTA CARRIL TRIFASICO BL.
SUSP. CABLE CARRIL 3000MM BLANCA
ACC. UNION SUSP. RIGIDA CARRIL BLANCO
SUSP. RIGIDA CARRIL 1000MM BLANCA
ACC. UNION CODO 90 FIL PLUS SUPERF. BL.
ACC. UNION CODO 90 FIL PLUS SUPERF. GR.
ACC. UNION CODO 90 FIL PLUS EMPOTR. BL.
ACC. UNION CODO 90 FIL PLUS EMPOTR. GR.
ACC. TAPA CIEGA FIL PLUS X/MM BL.
ACC. TAPA CIEGA FIL PLUS X/MM GRIS
ACC. PERFIL FIL PLUS SUP. X/MM BL.
ACC. PERFIL FIL PLUS SUP. X/MM GRIS
ACC. PERFIL FIL PLUS EMP. X/MM Bl.
ACC. PERFIL FIL PLUS EMP. X/MM GR.
ACC. PERFIL FIL EMPOTRAR (x/mm) BLANCO
ACC. PERFIL FIL EMPOTRAR (x/mm) 2009
ACC. TAPA FINAL FIL PLUS SUP. BL.
ACC. TAPA FINAL FIL PLUS SUP. GR.
ACC. TAPA FINAL FIL PLUS EMP. BL.
ACC. TAPA FINAL FIL PLUS EMP. GRIS
ACC. UNION CODO 90 FIL PLUS TRIML. BL
PERFIL FIL X/ML BLANCO
PERFIL FIL X/ML GRIS
PFL. TAPA FIL X/ML BLANCO
PFL. TAPA FIL X/ML GRIS
ACC. UNION CODO 90 FIL BLANCO
ACC. UNION CODO 90 FIL GR.
UNION CODO 90 FIL EMPOTR. BLANCO
UNION CODO 90 FIL EMPOTR. 2009 GR.
ACC. MODULO GIRATORIO INTERMEDIO FIL BL.
ACC. MODULO GIRATORIO INTERMEDIO FIL GR.
ACC. 2 MODULOS GIRATORIOS FINALES FIL BL
ACC. 2 MODULOS GIRATORIOS FINALES FIL
TAPA FINAL FIL BLANCO
TAPA FINAL LUM. FIL
ACC. SOP.PERP.PARED LUM.FIL + TAPA FINAL
TAPA FINAL FIL EMPOTRADA BLANCO
TAPA FINAL FIL EMPOTRADA GRIS
FIL PLUS D/IN INT. 1X28/54W OPAL TRESB. BL
FIL PLUS D/IN INT. 1X28/54W OPAL TRESB. GR.
FIL PLUS D/IN INT. 1X35/49/80W OPAL TRESB. BL.
FIL PLUS D/IN INT. 1X35/49/80W OPAL TRESB. GR
FIL PLUS INTERM. 1X28/54W OPAL TRESBOL. BL
FIL PLUS INTERM. 1X28/54W OPAL TRESBOL. GR
FIL PLUS INTERM. TRESBOL. 1X35/49/80W OPAL BL.
FIL PLUS INTERM. TRESBOL. 1X35/49/80W OPAL GR
FIL PLUS EMP.INTERM.TRESBOL1X28/54W OPAL BL
FIL PLUS EMP.INTERM.TRESBOL1X28/54W OPAL GR
FIL PLUS EMP.INTERM.TRESBOL 1X35/49/80W OPALBL
FIL PLUS EMP.INTERM.TRESBOL 1X35/49/80W OPALGR
FIL PLUS FINAL TRESBOLILLO 1X14/24W OPAL BL
FIL PLUS FINAL TRESBOLILLO 1X14/24W OPAL GR
FIL PLUS FINAL TRESBOLILLO 1X28/54W OPAL BL
FIL PLUS FINAL TRESBOLILLO 1X28/54W OPAL GR
FIL PLUS FINAL TRESBOLILLO 1X35/49/80W OPAL BL
FIL PLUS FINAL TRESBOLILLO 1X35/49/80W OPAL GR
FIL PLUS EMP FINAL TRESBOL.1X14/24W OPAL BL
FIL PLUS EMP.FINAL TRESBOL.1X14/24W OPAL GR
FIL PLUS EMP. FINAL TRESBOL. 1X28/54W OPAL
FIL PLUS EMP. FINAL TRESBOL. 1X28/54W OPAL
FIL PLUS EMP.FINAL TRESBOL.1X35/49/80W OPAL BL
FIL PLUS EMP.FINAL TRESBOL.1X35/49/80W OPAL GR
FIL PLUS INDIVIDUAL 1X14/24W OPAL BL.
FIL PLUS INDIVIDUAL 1X14/24W OPAL GRIS
FIL PLUS INDIVIDUAL 1X28/54W OPAL BL.
FIL PLUS INDIVIDUAL 1X28/54W OPAL GRIS
FIL PLUS INDIVIDUAL 1X35/49/80W OPAL BL.
FIL PLUS INDIVIDUAL 1X35/49/80W OPAL GRIS
FIL PLUS INDIVI. EMPOTR. 1X14/24W OPAL BL.
FIL PLUS INDIVI. EMPOTR. 1X14/24W OPAL GRIS
FIL PLUS INDIVI. EMPOTR. 1X28/54W OPAL BL.
FIL PLUS INDIVI. EMPOTR. 1X28/54W OPAL GRIS
FIL PLUS INDIVI. EMPOTR. 1X35/49/80W OPAL BL.
FIL PLUS INDIVI. EMPOTR. 1X35/49/80W OPAL GRIS
FIL PLUS LED 28W NW BL.
FIL PLUS LED 28W NW GR.
FIL PLUS LED 35W NW BL.
FIL PLUS LED 35W NW GR.
FIL T5 1X14/24W OPAL BLANCO
FIL T5 1X14/24W OPAL GRIS
FIL T5 1X28/54W OPAL BLANCO
FIL T5 1X28/54W OPAL GRIS
FIL T5 1X35/49/80W OPAL BLANCO
FIL T5 1X35/49/80W OPAL GRIS
FIL T5 1X14/24W PARABOLICO BLANCO
FIL T5 1X14/24W PARABOLICO GRIS
FIL T5 1X28/54W PARABOLICO BLANCO
FIL T5 1X28/54W PARABOLICO GRIS
FIL T5 1X35/49/80W PARABOLICO BLANCO
FIL T5 1X35/49/80W PARABOLICO GRIS
FIL PLUS LED EMPOTRAR 28W NW BL.
FIL PLUS LED EMPOTRAR 28W NW GR.
FIL PLUS LED EMPOTRAR 35W NW BL.
FIL PLUS LED EMPOTRAR 35W NW GR.
FIL PLUS D/IN FINAL 1X14/24W OPAL TRESB. BL
FIL PLUS D/IN FINAL 1X14/24W OPAL TRESB. GR
FIL PLUS D/IN FINAL 1X28/54W OPAL TRESB. BL
FIL PLUS D/IN FINAL 1X28/54W OPAL TRESB. GR
FIL PLUS D/IN FINAL 1X35/49/80W OPAL TRESB. BL
FIL PLUS D/IN FINAL 1X35/49/80W OPAL TRESB. GR
FIL EMPOTRAR T5 1X14/24W OPAL BL.
40,00
18,00
18,00
21,50
21,50
21,50
21,50
97,50
97,50
99,00
99,00
5,50
5,50
22,00
6,50
6,50
159,00
159,00
199,00
199,00
140,50
140,50
157,50
157,50
151,50
151,50
167,50
167,50
118,00
118,00
140,50
140,50
157,50
157,50
129,00
129,00
151,50
151,50
167,50
167,50
125,50
125,50
154,50
154,50
179,50
179,50
134,50
134,50
165,50
165,50
191,50
191,50
345,50
345,50
385,00
385,00
111,50
111,50
131,50
131,50
159,50
159,50
145,00
145,00
185,00
185,00
214,00
214,00
355,50
355,50
395,00
395,00
143,00
143,00
173,00
173,00
199,00
199,00
121,50
27,00
40,00
85,00
116,00
101,00
101,00
101,00
69,00
69,00
69,00
34,00
34,00
34,00
48,50
48,50
48,50
48,50
48,50
48,50
42,50
42,50
42,50
42,50
42,50
42,50
48,50
48,50
48,50
48,50
48,50
48,50
63,00
63,00
63,00
69,00
69,00
69,00
29,00
29,00
29,00
9,00
9,00
9,00
13,50
13,50
13,50
13,50
13,50
13,50
2,00
2,00
2,00
5,50
6,00
3,50
5,00
22,00
12,50
19,50
21,50
21,50
23,00
23,00
20,50
20,50
44,50
44,50
50,00
50,00
30,50
30,50
8,50
8,50
9,50
9,50
25,50
40,00

74
74
74
74
74
75
75
74
74
74
74
74
74
74
75
75
76
76
76
76
76
76
76
76
78
78
78
78
76
76
76
76
76
76
78
78
78
78
78
78
77
77
77
77
77
77
79
79
79
79
79
79
80
80
80
80
74
74
74
74
74
74
74
74
74
74
74
74
80
80
80
80
76
76
76
76
76
76
75
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
59
77
77
78
78
77
77
77
77
78
78
75
75
77
77
78
78
79
74
223
,QIRUPDFLyQ
REF. / PAG.
Codigo Plazo Descripcin Euros Pg. Codigo Plazo Descripcin Euros Pg.
4901470
4901473
4901500
4901502
4901600
4901602
4901702
4902000
4902001
4902010
4902011
4902030
4902031
4902070
4902071
4902080
4902081
4902090
4902091
4902343
4902400
4902401
4902500
4902502
4902702
4903000
4903001
4903010
4903011
4903020
4903021
4903110
4903111
4903500
4903502
4903702
4904000
4904001
4904010
4904011
4904323
4904343
4905000
4905002
4905020
4905022
4905100
4905102
4905110
4905112
4906003
4906013
4906090
4906092
4906100
4906102
4906110
4906112
4906120
4906122
4906130
4906132
4906140
4906142
4906150
4906152
4906160
4906162
4906170
4906172
4906180
4906182
4906190
4906193
4906200
4906203
4906210
4906213
4906220
4741813
4741820
4741823
4741830
4741833
4741840
4741843
4741850
4741853
4741860
4741863
4741870
4741873
4741880
4741883
4741890
4741893
4741900
4741910
4741920
4741930
4741940
4805003
4805013
4805023
4805203
4805213
4805933
4805963
4805983
4805993
4806013
4806023
4806043
4806053
4806063
4806073
4806093
4806103
4806113
4806123
4806133
4806163
4806173
4806193
4806203
4806223
4806233
4806283
4809303
4809363
4809373
4809383
4809393
4809403
4900002
4900102
4901020
4901021
4901030
4901031
4901050
4901051
4901090
4901091
4901110
4901111
4901120
4901121
4901140
4901141
4901150
4901151
4901400
4901401
4901460
4901463
MINI PUZZLE ORIENTABLE ASIMETRICO BL.
MINI PUZZLE ORIENTABLE ASIMETRICO GR.
MINIPUZZLE INDIVIDUAL QR-CBC51 50W BL.
MINIPUZZLE INDIVIDUAL QR-CBC51 50W GR.
MINI PUZZLE ORIENT. QR-CB51 12V/50W BL.
MINI PUZZLE ORIENT. QR-CB51 50W GRIS
MOD-A FIL BOX SIST. CARDAN PAR30S NG.
PUZZLE DOBLE 2 X PAR 30 BL.
PUZZLE DOBLE 2X PAR30 75W NG
PUZZLE DOBLE 2X QR-111 100W BL
PUZZLE DOBLE 2X QR-111 100W NG
PUZZLE DOBLE 2X HI-PAR30 35/70W BL
PUZZLE DOBLE 2X HI-PAR30 35/70W NG
PUZZLE DOBLE 2X HIT-TC 35/70W EXT. BL
PUZZLE DOBLE 2X HIT-TC 35/70W EXT. NG
PUZZLE DOBLE 2X QT12 100W BL
PUZZLE DOBLE 2X QT12 100W NG
PUZZLE DOBLE 2X CDMR-111 35/70W BL
PUZZLE DOBLE 2X CDMR-111 35/70W NG.
PUZZLE AEREO DOBLE 2XPAR30 75W
PUZZLE DOBLE 2X HIT G12 35/70/150W BL
PUZZLE DOBLE 2X HIT G12 35/70/150W NG
MINIPUZZLE DOBLE 2X QR-CBC51 50W BL.
MINIPUZZLE DOBLE 2X QR-CBC51 50W GR.
MOD-B FIL BOX SIST. CARDAN 2XPAR30 NG.
PUZZLE TRIPLE 3X PAR30 75W BL
PUZZLE TRIPLE 3X PAR30 75W NG
PUZZLE TRIPLE 3X QR-111 MAX. 100W BL
PUZZLE TRIPLE 3X QR-111 MAX. 100W NG
PUZZLE TRIPLE 3X HI-PAR30 35/70W BL
PUZZLE TRIPLE 3X HI-PAR30 35/70W NG
PUZZLE TRIPLE QR111+HI-PAR 30+QR111 BL
PUZZLE TRIPLE QR111+HI-PAR 30+QR111 NG
MINIPUZZLE TRIPLE 3X QR-CBC51 50W BL.
MINIPUZZLE TRIPLE 3X QR-CBC51 50W GR.
MOD-C FIL BOX SIST. CARDAN 3XPAR30 NG.
PUZZLE CUADRUPLE 4X PAR30 75W BL
PUZZLE CUADRUPLE 4X PAR30 75W NG
PUZZLE CUADRUPLE 4X QR-111 MAX. 100W BL
PUZZLE CUADRUPLE 4X QR-111 MAX. 100W NG
PUZZLE AEREO PARA 4 X PAR30S Y BASIC 18W
PUZZLE AEREO CUADRUPLE 4XPAR30 75W
PERFIL MARCO OCULTO PUZZLE 1M BL
PERFIL MARCO OCULTO PUZZLE 1M NG.
PERFIL MARCO OCULTO PUZZLE 3M BL
PERFIL MARCO OCULTO PUZZLE 3M NG.
BASE CIEGA MODULO-A PUZZLE BLANCO
BASE CIEGA MODULO-A PUZZLE NEGRO
BASE CIEGA MODULO-B PUZZLE BL.
BASE CIEGA MODULO-B PUZZLE NEGRO
SOPTE.CON TAPA PARED/TECHO PUZZLE AEREO
SOPTE.CON TAPA PARA CARRIL PUZZLE AEREO
MARCO OCULTO PUZZLE EMP. N 1 BL.
MARCO OCULTO PUZZLE EMP. N 1 NG.
MARCO OCULTO PUZZLE EMP. N 2 BL.
MARCO OCULTO PUZZLE EMP. N 2 NG.
MARCO OCULTO PUZZLE EMP. N 3 BL.
MARCO OCULTO PUZZLE EMP. N 3 NG.
MARCO OCULTO PUZZLE EMP. N 4 BL.
MARCO OCULTO PUZZLE EMP. N 4 NG
MARCO OCULTO PUZZLE EMP. N 5 BL
MARCO OCULTO PUZZLE EMP. N 5 NG.
MARCO OCULTO PUZZLE EMP. N 6 BL.
MARCO OCULTO PUZZLE EMP. N 6 NG.
MARCO OCULTO PUZZLE EMP. N 7 BL.
MARCO OCULTO PUZZLE EMP. N 7 NG.
MARCO OCULTO PUZZLE EMP. N 8 BL.
MARCO OCULTO PUZZLE EMP. N 8 NG.
MARCO OCULTO PUZZLE EMP. N 9 BL.
MARCO OCULTO PUZZLE EMP. N 9 NG.
MARCO OCULTO (U) PUZZLE EMP. BL.
MARCO OCULTO (U) PUZZLE EMP. NG.
MARCO PUZZLE EMPOTRABLE N 1 BL
MARCO PUZZLE EMPOTRABLE N 1 GRIS
MARCO PUZZLE EMPOTRABLE N 2 BL
MARCO PUZZLE EMPOTRABLE N 2 GRIS
MARCO PUZZLE EMPOTRABLE N 3 BL.
MARCO PUZZLE EMPOTRABLE N 3 GRIS
MARCO PUZZLE EMPOTRABLE N4 BL.
FIL EMPOTRAR T5 1X14/24W OPAL GRIS
FIL EMPOTRAR T5 1X28/54W OPAL BL.
FIL EMPOTRAR T5 1X28/54W OPAL GRIS
FIL EMPOTRAR T5 1X35/49/80W OPAL BL
FIL EMPOTRAR T5 1X35/49/80W OPAL GRIS
FIL EMPOTRAR T5 1X14/24W PARABOLICO BL.
FIL EMPOTRAR T5 1X14/24W PARABOLICO GRIS
FIL EMPOTRAR T5 1X28/54W PARABOLICO BL.
FIL EMPOTRAR T5 1X28/54W PARABOLICO GRIS
FIL EMPOTRAR T5 1X35/49/80W PARABOLICO BL.
FIL EMPOTRAR T5 1X35/49/80W PARABOLICO GRIS
FIL PLUS D/IN IND. 1X14/24W OPAL TRESB. BL.
FIL PLUS D/IN IND. 1X14/24W OPAL TRESB. GR.
FIL PLUS D/IN IND. 1X28/54W OPAL TRESB. BL.
FIL PLUS D/IN IND. 1X28/54W OPAL TRESB. GR.
FIL PLUS D/IN IND. 1X35/49/80W OPAL TRESB. BL.
FIL PLUS D/IN IND. 1X35/49/80W OPAL TRESB. GR.
FIL PLUS TRIML. FINAL 1X14/14/24W OPAL BL
FIL PLUS TRIML. FINAL 1X28/54 OPAL BL
FIL PLUS TRIML. FINAL 1X35/49/80 OP. BL
FIL PLUS TRIML. INT. 1X28/54 OPAL BL
FIL PLUS TRIML. INT. 1X35/49/80 OP. BL
PERFIL DUELAMP 1000MM
PERFIL DUELAMP 2000MM
PERFIL DUELAMP 3000MM
UNION PERFIL M-DUELAMP CODO 90
UNION PERFIL DUELAMP CODO 90
ACC. ANCLAJE MOD. C MINI-DUELAMP
ACC. ANCLAJE MOD. A MINI-DUELAMP
TAPA FINAL MINI-DUELAMP
TAPA FINAL MINI-DUELAMP ROTULA
TAPA FINAL DUELAMP
TAPA FINAL DUELAMP ROTULA
CONJ. 2 UNIONES BARRAS DUELAMP / FILMED
PUENTE INTERMEDIO DUELAMP GR.
JUEGO DE 4 FIJACIONES PARA UNION
ANCLAJE A PARA ESTRUCTURAS
ANCLAJE PARA SUSPENSION DUELAMP
CONJUNTO CON DOWNLIGHT METALIZADO 2X18W
CONJUNTO CON DOWNLIGHT METALIZADO 2X26W
CONJUNTO CON DOWNLIGHT BLANCO 2X18W
CONJUNTO CON DOWNLIGHT BLANCO 2X26W
CONJUNTO CON DOWNLIGHT RECT. HIT-DE 70W
CONJUNTO CON DOWNLIGHT RECT. HIT-DE 150W
CONJUNTO DOWNLIGHT SIST.CARDAN QR-111
CONJUNTO 2 KONIC BAJO VOLTAJE ORIENT.
CONJUNTO DOWNLIGHT SIST.CARDAN CDM-R111
PUENTE INTERMEDIO MINI-DUELAMP GR.
DUELAMP ORBIT HIT-TC 35/70W 40 GR.
CONJ. 2 DOW.BAJO V.ORIENT. M-DUELAMP
BASE DOW.SIST.CARDAN QR-111 M-DUELAMP
CONJ. DOW.SIST.CARDAN HI-PAR30 M-DUELAMP
BASE DOW.SIST.CARDAN CDM-R111 M-DUELAMP
BASE DOW.SIST.CARDAN 2CDM-R111 M-DUELAMP
BASE DOW.SIST.CARDAN 2 QR-70 M-DUELAMP
ACC. PERFIL FIL BOX (x/ml)
ACC. PFL. TAPA FIL BOX (x/ml)
PUZZLE INDIVIDUAL PAR30 75W BL
PUZZLE INDIVIDUAL PAR30 75W NG
PUZZLE INDIVIDUAL QR-111 100W BL.
PUZZLE INDIVIDUAL QR-111 100W NG.
PUZZLE INDIVIDUAL HI-PAR30 35/70W BL
PUZZLE INDIVIDUAL HI-PAR30 35/70W NG.
PUZZLE INDIVIDUAL HIT-TC 35/70W EXT. BL
PUZZLE INDIVIDUAL HIT-TC 35/70W EXT. NG.
PUZZLE INDIVIDUAL CDM-Tm 20W EXT. BL.
PUZZLE INDIVIDUAL CDM-Tm 20W EXT. NG
PUZZLE INDIVIDUAL CDM-Tm 20W INT. BL
PUZZLE INDIVIDUAL CDM-Tm 20W INT. NG
PUZZLE INDIVIDUAL QT-12 100W BL
PUZZLE INDIVIDUAL QT-12 100W NG
PUZZLE INDIVIDUAL CDMR-111 35/70W BL
PUZZLE INDIVIDUAL CDMR-111 35/70W NG
PUZZLE INDIVIDUAL HIT G12 35/70/150W BL
PUZZLE INDIVIDUAL HIT G12 35/70/150W NG
MINI PUZZLE ORIENTABLE CRISTAL OPAL BL.
MINI PUZZLE ORIENTABLE CRISTAL OPAL GR.
11,00
11,00
20,50
20,50
14,50
14,50
80,00
95,00
95,00
63,50
63,50
104,00
104,00
147,00
147,00
131,00
131,00
137,50
137,50
127,00
235,50
235,50
39,00
39,00
150,50
133,50
133,50
95,00
95,00
173,50
173,50
124,50
124,50
58,00
58,00
216,00
176,50
176,50
132,00
132,00
359,50
217,00
16,50
16,50
35,00
35,00
6,50
6,50
8,50
8,50
31,50
84,00
20,50
20,50
23,00
23,00
25,50
25,50
32,50
32,50
35,00
35,00
41,50
41,50
49,00
49,00
54,00
54,00
39,50
39,50
19,50
19,50
20,00
20,00
23,00
23,00
27,00
27,00
31,50
121,50
149,00
149,00
173,50
173,50
155,50
155,50
203,50
203,50
229,50
229,50
154,50
154,50
173,50
173,50
198,00
198,00
142,00
166,50
184,50
166,50
184,50
24,50
47,00
70,50
30,00
35,00
26,50
26,50
11,50
43,50
11,00
49,00
2,50
11,50
5,50
35,00
2,00
129,50
129,50
134,00
134,00
110,00
110,00
92,50
74,00
143,00
9,50
132,50
53,50
63,00
98,00
89,00
144,50
85,00
125,00
45,00
68,00
68,00
45,50
45,50
77,00
77,00
84,00
84,00
128,50
128,50
121,00
121,00
78,00
78,00
75,00
75,00
123,50
123,50
12,00
12,00

26
26
25
25
26
26
90
23
23
23
23
23
23
23
23
23
23
23
23
40
23
23
25
25
91
23
23
23
23
23
23
23
23
25
25
91
23
23
23
23
40
40
21
21
21
21
23
23
23
23
41
41
21
21
21
21
21
21
21
21
21
21
21
21
21
21
21
21
21
21
21
21
20
20
20
20
20
20
20
75
75
75
75
75
75
75
75
75
75
75
77
77
77
77
77
77
79
79
79
79
79
116
116
116
116
116
112
112
116
116
116
116
77
116
93
114
116
114
114
114
115
115
115
115
115
115
116
115
112
112
112
112
112
112
90
90
22
22
22
22
22
22
22
22
22
22
22
22
22
22
22
22
22
22
26
26
49 PUZZLE / MINI PUZZLE / PUZZLE AIR / FIL BOX
48 DUELAMP - MINI DUELAMP
224
,QIRUPDFLyQ
REF. / PAG.
Codigo Plazo Descripcin Euros Pg. Codigo Plazo Descripcin Euros Pg.

4943782
4944333
4944353
4944363
5104770
5105000
5105100
5105200
5105210
5105220
5105260
5106100
5106110
5106120
5106200
5106210
5106220
5106400
5106410
5107030
5107410
5141000
5141010
5141020
5142000
5142010
5142020
5204800
5205000
5205100
5205200
5205210
5205220
5206010
5206100
5206110
5206120
5206130
5206140
5206150
5206400
5206410
5207020
5207030
5207410
5241000
5241010
5241020
5241090
5241100
5241110
5242000
5242010
5242020
5242090
5242100
5242110
5243700
5243710
5243720
5305240
5305300
5305310
5306420
5341500
5341510
5341520
5341530
5341540
5341550
5341710
5341720
5341740
5341750
5342500
5342510
4906223
4906240
4906243
4906250
4906253
4906260
4906263
4906270
4906273
4906280
4906283
4906403
4906412
4906450
4906452
4941110
4941112
4941120
4941122
4941130
4941132
4941290
4941291
4941430
4941431
4941460
4941463
4941470
4941473
4941500
4941502
4941600
4941602
4941650
4941652
4941660
4941662
4941670
4941672
4941680
4941682
4941712
4941762
4941772
4941782
4941792
4941832
4941842
4941892
4942120
4942122
4942130
4942132
4942323
4942333
4942363
4942500
4942502
4942712
4942720
4942722
4942730
4942732
4942740
4942742
4942750
4942752
4942762
4942772
4942782
4942792
4942832
4942902
4942912
4942932
4942942
4943500
4943502
4943712
MOD-C FIL BOX SIST. CARDAN 3XQT-12 NG.
PUZZLE AEREO CUADRUPLE 4QR111 100W/E
PUZZLE AEREO CUADRUP. 4CDMR111 35W/E
PUZZLE AEREO CUADRUP. 4CDMR111 70W/E
PACK SUSP. PARED LAMPTUB80 (2)
PERFIL LAMPTUB80 (x/mm)
TAPA LAMPTUB80 (x/mm)
UNION PERFIL LAMPTUB80 CODO 90
UNION PERFIL LAMPTUB80 (T)
UNION PERFIL LAMPTUB80 CRUZ
UNION PERFIL LAMPTUB80 ROTULA 8 POS.
DIF. LAMAS LAMPTUB80 565mm
DIF. LAMAS LAMPTUB80 1175mm
DIF. LAMAS LAMPTUB80 1475mm
DIF. POLICARBONATO LAMPTUB80 18W 568MM
DIF. POLICARBONATO LAMPTUB80 36W 1178MM
DIF. POLICARBONATO LAMPTUB80 58W 1478MM
TAPA FINAL LAMPTUB80
TAPA FINAL ROTULA LAMPTUB80
PROY.AVANT QR-CBC51 PARA LAMPTUB80 BL.
SUS. PARED INTERMEDIA LAMPTUB80
LUM. LAMPTUB80 1X18W/E
LUM. LAMPTUB80 1X36W/E
LUM. LAMPTUB80 1X58W/E
LUM. LAMPTUB80 2X18W/E
LUM. LAMPTUB80 2X36W/E
LUM. LAMPTUB80 2X58W/E
PACK SUS.PARED OVAL (2)
PFL. OVAL PERFIL X M
PERFIL OVAL/TRIPLY TAPA X M
UNION PERFIL OVAL CODO 90
UNION PERFIL OVAL (T)
UNION PERFIL OVAL CRUZ
FIJACION INTERMEDIA OVAL
DIF. LAMAS OVAL/TRIPLY 565mm
DIF. LAMAS OVAL/TRIPLY 1175mm
DIF. LAMAS OVAL/TRIPLY 1475mm
DIF. POLICARBONATO OVAL/TRIPLY 568mm
DIF. POLICARBONATO OVAL/TRIPLY 1178mm
DIF. POLICARBONATO OVAL/TRIPLY 1478mm
TAPA FINAL OVAL
TAPA FINAL ROTULA OVAL
TAPA + DOWN.ORIENTABLE BV. C/EQUIPO BL.
PROY. TWIN QR-CBC51 PARA OVAL/FILMED BL.
SUS. PARED INTERMEDIA OVAL
LUM. OVAL 1X18W/ E
LUM. OVAL 1X36W/ E
LUM. OVAL 1X58W/ E
LUM. OVAL 1X18W PARABOLICO/ E
LUM. OVAL 1X36W PARABOLICO/ E
LUM. OVAL 1X58W PARABOLICO/ E
LUM OVAL 2X18W/ E
LUM. OVAL 2X36W/ E
LUM. OVAL 2X58W/ E
LUM. OVAL 2X18W PARABOLICO/ E
LUM. OVAL 2X36W PARABOLICO/ E
LUM. OVAL 2X58W PARABOLICO/ E
LUM. OVAL 1X18W ASIMETRICO/ E
LUM. OVAL 1X36W ASIMETRICO/ E
LUM. OVAL 1X58W ASIMETRICO/ E
UNION CODO 90 TRIPLEX
PERFIL TRIPLEX X/ML
PFL. TAPA TRIPLEX X/ML
TAPA FINAL TRIPLEX
LUM. TRIPLEX T5 1X14/24W OPAL BL.
LUM. TRIPLEX T5 1X28/54W OPAL BL.
LUM. TRIPLEX T5 1X35/49/80W OPAL BL.
LUM. TRIPLEX T5 1X14/24W PARABOLICO BL.
LUM. TRIPLEX T5 1X28/54W PARABOLICO BL.
LUM. TRIPLEX T5 1X35/49/80W PARABOLICO BL.
LUM. TRIPLEX DIR/IND T5 1X28/54W OPAL BL
LUM. TRIPLEX DIR/IND T5 1X35/49/80W OPAL BL
LUM. TRIPLEX DIR/IND T5 1X28/54W PBCO. BL
LUM. TRIPLEX DIR/IND T5 1X35/49/80W PBCO BL.
LUM. TRIPLEX T5 2X14/24W OPAL BL.
LUM. TRIPLEX T5 2X28/54W OPAL BL.
MARCO PUZZLE EMPOTRABLE N4 GRIS
MARCO PUZZLE EMPOTRABLE N5 BL
MARCO PUZZLE EMPOTRABLE N5 GRIS
MARCO PUZZLE EMPOTRABLE N6 BL
MARCO PUZZLE EMPOTRABLE N6 GRIS
MARCO PUZZLE EMPOTRABLE N7 BL.
MARCO PUZZLE EMPOTRABLE N7 GRIS
MARCO PUZZLE EMPOTRABLE N8 BL.
MARCO PUZZLE EMPOTRABLE N8 GRIS
MARCO PUZZLE EMPOTRABLE N9 BL
MARCO PUZZLE EMPOTRABLE N9 GRIS
TAPA FINAL DOBLE PUZZLE AEREO
ACC. TAPA FINAL FIL BOX NG
MARCO OCULTO CODO 90 PUZZLE EMP. BL.
MARCO OCULTO CODO 90 PUZZLE EMP. NG.
PUZZLE ASIM. PARA T5 1X14/24W BL.
PUZZLE ASIM. PARA T5 1X14/24W NG.
PUZZLE ASIM. PARA T5 1X28/54W BL
PUZZLE ASIM. PARA T5 1X28/54W NG.
PUZZLE PARA TC-L 55W DIF. OPAL BL.
PUZZLE PARA TC-L 55W DIF. OPAL NG.
PUZZLE INDIVIDUAL QR-LEDS WARM 40 BL.
PUZZLE INDIVIDUAL QR-LEDS WARM 40 NG
PUZZLE INDIVIDUAL QR-LEDS WARM 24 BL.
PUZZLE INDIVIDUAL QR-LEDS WARM 24 NG
MINI PUZZLE OR. C.OPAL LED WW 36 BL.
MINI PUZZLE OR. C.OPAL LED WW 36 GR.
MINI PUZZLE ORIENT. ASIM. LED WW 24 BL.
MINI PUZZLE ORIENT. ASIM. LED WW 24 GR.
MINIPUZZLE INDIV. LED WW 36 BL.
MINIPUZZLE INDIV. LED WW 36 GR.
MINI PUZZLE ORIENT. LED WW 24 BL.
MINI PUZZLE ORIENT. LED WW 24 GR.
PUZZLE INDIVIDUAL LED 32W MFL WW BL.
PUZZLE INDIVIDUAL LED 32W MFL WW NG.
PUZZLE INDIVIDUAL LED 32W FL WW BL.
PUZZLE INDIVIDUAL LED 32W FL WW NG.
PUZZLE INDIVIDUAL LED 43W MFL WW BL.
PUZZLE INDIVIDUAL LED 43W MFL WW NG.
PUZZLE INDIVIDUAL LED 43W FL WW BL.
PUZZLE INDIVIDUAL LED 43W FL WW NG.
MOD-A FIL BOX SIST. CARDAN QR-111 NG.
MOD-B FIL BOX SIST. CARDAN HIT-TC 35W NG
MOD-B FIL BOX SIST. CARDAN HIT-TC 70W NG
MOD-A FIL BOX SIST. CARDAN QT-12 NG.
MOD-B FIL BOX CARDAN CDMR-111 35W NG
MOD-B FIL BOX CARDAN CDMR-111 70W NG
MOD-B FIL BOX PROY. TWIN CDMR-111 70W NG
MOD-B FIL BOX PROY. TWIN CDMR-111 35W NG
PUZZLE PARA T5 2X14/24W DIF. OPAL BL.
PUZZLE PARA T5 2X14/24W DIF. OPAL NG.
PUZZLE PARA T5 2X28/54W DIF. OPAL BL.
PUZZLE PARA T5 2X28/54W DIF. OPAL NG.
PUZZLE AEREO DOBLE 2 X QR111 100W/E
PUZZLE AEREO DOBLE 2XCDMR111 35W/E
PUZZLE AEREO DOBLE 2XCDMR111 70W/E
MINIPUZZLE DOBLE LED WW 36 BL.
MINIPUZZLE DOBLE LED WW 36 GR.
MOD-B FIL BOX SIST. CARDAN 2XQR-111 NG.
PUZZLE DOBLE LED 32W MFL WW BL.
PUZZLE DOBLE LED 32W MFL WW NG.
PUZZLE DOBLE LED 32W FL WW BL.
PUZZLE DOBLE LED 32W FL WW NG.
PUZZLE DOBLE LED 43W MFL WW BL.
PUZZLE DOBLE LED 43W MFL WW NG.
PUZZLE DOBLE LED 43W FL WW BL.
PUZZLE DOBLE LED 43W FL WW NG.
MOD-C FIL BOX SIST.CARDAN HIT-TC 2X35 NG
MOD-C FIL BOX SIST.CARDAN HIT-TC 2X70 NG
MOD-A FIL BOX SIST. CARDAN 2XQT-12 NG.
MOD-C FIL BOX CARDAN 2XCDMR-111 35W NG
MOD-C FIL BOX CARDAN 2XCDM-R111 70W NG
MOD-C FIL BOX T5 2X14/24W BLUM. NG
MOD-D FIL BOX T5 2X28/54W BLUM. NG
MOD-C FIL BOX T5 2X14/24W PCAR. NG.
MOD-D FIL BOX T5 2X28/54W PCAR. NG.
MINIPUZZLE TRIPLE LED WW 36 BL.
MINIPUZZLE TRIPLE LED WW 36 GR.
MOD-C FIL BOX SIST. CARDAN 3XQR111 NG.
335,50
235,50
781,50
813,00
31,00
42,50
26,50
13,50
19,50
33,50
7,00
11,00
15,00
17,50
14,50
23,00
29,00
4,00
28,50
178,50
30,00
72,00
87,00
95,50
77,50
93,00
104,00
40,00
64,00
23,50
33,50
51,50
63,50
2,00
13,00
20,00
24,50
18,50
31,50
39,50
4,00
27,00
66,50
174,50
32,00
88,00
112,00
124,50
102,50
134,50
148,50
96,50
113,00
135,50
111,00
137,00
161,50
115,50
147,00
164,50
29,00
41,00
20,50
7,50
136,50
169,50
200,50
159,50
195,50
239,00
179,00
210,00
208,00
249,00
163,00
185,50
31,50
35,00
35,00
41,50
41,50
49,00
49,00
54,00
54,00
39,50
39,50
23,00
26,50
24,00
24,00
160,00
160,00
195,50
195,50
142,00
142,00
168,00
168,00
168,00
168,00
66,50
66,50
64,50
64,50
67,00
67,00
67,50
67,50
240,00
240,00
240,00
240,00
308,50
308,50
308,50
308,50
84,50
236,50
236,50
124,50
233,00
233,00
278,50
278,50
242,00
242,00
293,50
293,50
135,50
439,00
465,50
135,00
135,00
146,50
478,50
478,50
478,50
478,50
614,50
614,50
614,50
614,50
470,00
470,00
230,50
457,00
457,00
223,50
249,00
190,50
216,50
200,50
200,50
214,50

91
40
40
40
107
107
107
107
107
107
107
106
106
106
106
106
106
107
107
107
107
106
106
106
106
106
106
103
103
103
103
103
103
103
102
102
102
102
102
102
103
103
103
103
103
102
102
102
102
102
102
102
102
102
102
102
102
102
102
102
95
95
95
95
94
94
94
95
95
95
94
94
95
95
94
94
20
20
20
20
20
20
20
20
20
20
20
41
90
21
21
24
24
24
24
24
22
22
22
22
22
26
26
26
26
25
25
26
26
22
22
22
22
22
22
22
22
90
90
90
90
90
90
91
91
24
24
24
24
40
40
40
25
25
91
23
23
23
23
23
23
23
23
91
91
91
91
91
91
91
91
91
25
25
91
51 LAMPTUB
53 TRIPLEX
52 OVAL
225
,QIRUPDFLyQ
REF. / PAG.
Codigo Plazo Descripcin Euros Pg. Codigo Plazo Descripcin Euros Pg.
5553332
5553430
5553432
5700013
5700023
5700033
5700043
5700113
5700123
5700133
5700143
5701523
5701533
5701543
5701553
5701623
5701633
5701643
5701653
5701723
5701733
5701743
5701753
5701823
5701833
5701843
5701853
5741513
5741613
5741713
5741813
5800703
5800713
5801043
5801044
5801143
5801144
5841013
5841014
5841023
5841024
5841033
5841034
5841053
5841054
5841063
5841064
5841113
5841114
5841123
5841124
5841133
5841134
5841153
5841154
5841163
5841164
5841213
5841214
5841223
5841224
5841253
5841254
5901003
5901103
5901203
5901213
5901303
5901313
6006003
6006023
6042123
6042133
6042143
6042153
5342520
5342530
5342540
5342550
5342710
5342720
5342740
5342750
5404770
5405000
5405100
5405200
5405210
5405220
5406100
5406110
5406120
5406160
5406170
5406180
5406200
5406210
5406220
5406360
5406370
5406380
5406400
5406410
5407030
5407410
5441000
5441010
5441020
5441130
5441140
5441150
5442000
5442010
5442020
5442130
5442140
5442150
5550010
5550012
5550110
5550112
5550210
5550212
5551020
5551022
5551040
5551042
5551050
5551052
5551220
5551222
5551240
5551242
5551250
5551252
5551320
5551322
5551340
5551342
5551350
5551352
5551420
5551422
5551440
5551442
5551450
5551452
5553030
5553032
5553230
5553232
5553330
DUET SUS. IND. 60W + 3xQR-111 NG
DUET SEMI-EMP. IND. 60W + 3xQR-111 BL
DUET SEMI-EMP. IND. 60W + 3xQR-111 NG
CAJA EMPOTRAMIENTO BAULINE 600 C/EQ.
CAJA EMPOTRAMIENTO BAULINE 1200 C/EQ.
SOP. FINAL ORIENTABLE BAULINE PLATA MATE
SOPORTE BAULINE PLATA MATE
CAJA EMPOTRAMIENTO BAULINE 600 S/EQ.
CAJA EMPOTRAMIENTO BAULINE 1200 S/EQ.
EQUIPO AUXILIAR BAULINE 24V 25W
EQUIPO AUXILIAR BAULINE 24V 60W
BAULINE 650 EMPOT. SPOT 20 LED WW
BAULINE 650 EMPOTRADO SPOT 20 LED OW
BAULINE 650 EMPOT. MEDIUM 20 LED WW
BAULINE 650 EMPOT. MEDIUM 20 LED OW
BAULINE 1240 EMPOT. SPOT 40 LED WW
BAULINE 1240 EMPOT. SPOT 40 LED OW
BAULINE 1240 EMPOT. MEDIUM 40 LED WW
BAULINE 1240 EMPOT. MEDIUM 40 LED OW
BAULINE AIR 650 SPOT 20 LED WW
BAULINE AIR 650 SPOT 20 LED OW
BAULINE AIR 650 MEDIUM 20 LED WW
BAULINE AIR 650 MEDIUM 20 LED OW
BAULINE AIR 1240 SPOT 40 LED WW
BAULINE AIR 1240 SPOT 40 LED OW
BAULINE AIR 1240 MEDIUM 40 LED WW
BAULINE AIR 1240 MEDIUM 40 LED OW
BAULINE 650 EMPOTRADO MEDIUM 6 LED RGB
BAULINE 1240 EMPOTRADO RGB MEDIUM
BAULINE AIR 650 MEDIUM 6 LED RGB
BAULINE AIR 1240 MEDIUM 12 LED RGB
PANTALLA DIREC.180 FLUORESCENCIA B-SIDE
PANTALLA DIREC.180 DESCARGA B-SIDE
B-SIDE 850 TC-TSE 1X23W E27 GR.
B-SIDE 850 TC-TSE 1X23W E27 ANTRACITA
B-SIDE 450 TC-TSE 1X23W E27 GRIS
B-SIDE 450 TC-TSE 1X23W E27 ANTRACITA
B-SIDE 850 HIT 35W G12 GR.
B-SIDE 850 HIT 35W G12 ANTRACITA
B-SIDE 850 CDM-Tm 20W PGJ5 GR.
B-SIDE 850 CDM-Tm 20W PGJ5 ANTRACITA
B-SIDE 850 TC-DE 1X26W GX24-Q3 GR.
B-SIDE 850 TC-DE 1X26W GX24-Q3 ANTRACITA
B-SIDE 850 LED 1W GR.
B-SIDE 850 LED 1W ANTRACITA
B-SIDE 850 LED 3W GR.
B-SIDE 850 LED 3W ANTRACITA
B-SIDE 450 HIT 35W G12 GR.
B-SIDE 450 HIT 35W G12 ANTRACITA
B-SIDE 450 CDM-Tm 20W PGJ5 GR.
B-SIDE 450 CDM-Tm 20W PGJ5 ANTRACITA
B-SIDE 450 TC-DE 1X26W GX24-Q3 GR.
B-SIDE 450 TC-DE 1X26W GX24-Q3 ANTRACITA
B-SIDE 450 LED 1W GR.
B-SIDE 450 LED 1W ANTRACITA
B-SIDE 450 LED 3W GR.
B-SIDE 450 LED 3W ANTRACITA
B-SIDE 250 HIT 35W G12 GR.
B-SIDE 250 HIT 35W G12 ANTRACITA
B-SIDE 250 CDM-Tm 20W PGJ5 GR.
B-SIDE 250 CDM-Tm 20W PGJ5 ANTRACITA
B-SIDE 135 LED 2W GR.
B-SIDE 135 LED 2W ANTRACITA
BALIZA STICK 350 TC-TSE 20W E-27 GR
BALIZA STICK 600 TC-TSE 20W E-27 GR
BALIZA FAR 520 TC-TSE 20W E-27 GR
BALIZA FAR 520 HIT 35W G12 GR
BALIZA FAR 1000 TC-TSE 20W E-27 GR
BALIZA FAR 1000 HIT 35W G12 GR
PIEZA DE UNION FINELAMP GRIS
BRAZO ROTULA FINELAMP GRIS
LUM. FINELAMP 2X14/24W PCAR. GRIS
LUM. FINELAMP 2X28/54W PCAR. GRIS
LUM. FINELAMP 2X35/49/80W PCAR. GRIS
LUM. FINELAMP 2X14/24W PBCO. GRIS
LUM. TRIPLEX T5 2X35/49/80W OPAL BL.
LUM. TRIPLEX T5 2X14/24W PARABOLICO BL
LUM. TRIPLEX T5 2X28/54W PARABOLICO BL.
LUM. TRIPLEX T5 2X35/49/80W PARABOLICO BL.
LUM. TRIPLEX DIR/IND T5 2X28/54W OPAL BL.
LUM. TRIPLEX DIR/IND T5 2X35/49/80W OPAL BL
LUM. TRIPLEX DIR/IND T5 2X28/54W PBCO. BL
LUM. TRIPLEX DIR/IND T5 2X35/49/80W PBCO BL.
PACK SUS. PARED BASIC (2)
PERFIL BASIC PERFIL X M
PERFIL BASIC TAPA X M
UNION PERFIL BASIC CODO 90
UNION PERFIL BASIC (T)
UNION PERFIL BASIC CRUZ
DIF. LAMAS BASIC 18W (565mm)
DIF. LAMAS BASIC 36W
DIF. LAMAS BASIC 58W (1475mm)
DIF. LAMAS BASIC 14/14/24W. (525mm)
DIF. LAMAS BASIC 28/28/54W (1125mm)
DIF. LAMAS BASIC 35/35/49/80W (1425mm)
DIF. POLICARBONATO BASIC 18W (568mm)
DIF. POLICARBONATO BASIC 36W (1178mm)
DIF. POLICARBONATO BASIC 58W (1478mm)
DIF. POLICARBONATO BASIC 14/24W (528mm)
DIF. POLICARBONATO BASIC 28/54W (1128mm)
DIF. POLICARBONATO BASIC 35/49/80W (1428mm)
TAPA FINAL BASIC
TAPA FINAL ROTULA BASIC
PROY.AVANT QR-CBC51 PARA BASIC BL.
SUS. PARED INT. BASIC
LUM. BASIC 1X18W/E
LUM. BASIC 1X36W/E
LUM. BASIC 1X58W/E
BASIC T5 HO 1X14/24W BL.
BASIC T5 HO 1X28/54W BL.
BASIC T5 HO 1X35/49/80W BL.
LUM. BASIC 2X18W/E
LUM. BASIC 2X36W/E
LUM. BASIC 2X58W/E
BASIC T5 HO 2X14/24W BL.
BASIC T5 HO 2X28/54W BL.
BASIC T5 HO 2X35/49/80W BL.
DUET SUSPENDIDO DIR. 60W BL
DUET SUSPENDIDO DIR. 60W NG
DUET SUPERFICIE DIR. 60W BL
DUET SUPERFICIE DIR. 60W NG
DUET SEMI-EMPOTRADO DIR. 60W BL
DUET SEMI-EMPOTRADO DIR. 60W NG
DUET SUS. DIR. 60W + QR-111 BL
DUET SUS. DIR. 60W + QR-111 NG
DUET SUS. DIR. 60W + CDMR-111 35W BL
DUET SUS. DIR. 60W + CDMR-111 35W NG
DUET SUS. DIR. 60W + CDMR-111 70W BL
DUET SUS. DIR. 60W + CDMR-111 70W NG
DUET SEMI-EMP. DIR. 60W + QR-111 BL
DUET SEMI-EMP. DIR. 60W + QR-111 NG
DUET SEMI-EMP.DIR. 60W + CDMR-111 35W BL
DUET SEMI-EMP.DIR. 60W + CDMR-111 35W NG
DUET SEMI-EMP.DIR. 60W + CDMR-111 70W BL
DUET SEMI-EMP.DIR. 60W + CDMR-111 70W NG
DUET SUS. IND. 60W + QR-111 BL
DUET SUS. IND. 60W + QR-111 NG
DUET SUS. IND. 60W + CDMR-111 35W BL
DUET SUS. IND. 60W + CDMR-111 35W NG
DUET SUS. IND. 60W + CDMR-111 70W BL
DUET SUS. IND. 60W + CDMR-111 70W NG
DUET SEMI-EMP. IND. 60W + QR-111 BL
DUET SEMI-EMP. IND. 60W + QR-111 NG
DUET SEMI-EMP.IND. 60W + CDMR-111 35W BL
DUET SEMI-EMP.IND. 60W + CDMR-111 35W NG
DUET SEMI-EMP.IND. 60W + CDMR-111 70W BL
DUET SEMI-EMP.IND. 60W + CDMR-111 70W NG
DUET SUS. DIR. 60W + 3xQR-111 BL
DUET SUS. DIR. 60W + 3xQR-111 NG
DUET SEMI-EMP.DIR. 60W + 3xQR-111 BL
DUET SEMI-EMP.DIR. 60W + 3xQR-111 NG
DUET SUS. IND. 60W + 3xQR-111 BL
442,50
450,00
450,00
51,50
77,00
36,00
22,00
52,00
72,00
120,00
150,00
536,50
536,50
536,50
536,50
949,00
949,00
949,00
949,00
484,50
484,50
484,50
484,50
861,50
861,50
861,50
861,50
751,00
1028,50
720,00
970,00
18,00
9,00
285,50
285,50
283,00
283,00
387,00
387,00
399,50
399,50
314,00
314,00
215,00
215,00
229,00
229,00
381,50
381,50
394,00
394,00
308,50
308,50
209,50
209,50
223,00
223,00
287,50
287,50
299,50
299,50
144,00
144,00
82,00
102,50
152,50
224,00
215,00
279,50
11,00
18,50
299,00
389,00
391,00
338,00
248,50
182,00
208,00
269,00
196,00
267,50
223,00
279,50
32,50
34,50
29,00
17,50
28,00
38,50
16,00
30,00
29,00
15,50
22,50
28,00
17,00
21,50
28,50
15,50
20,50
27,00
5,50
30,50
179,00
28,00
86,50
93,50
102,00
98,00
115,50
126,00
93,00
101,50
110,50
105,00
132,50
143,00
306,00
306,00
283,00
283,00
310,00
310,00
352,00
352,00
374,50
374,50
374,50
374,50
383,00
383,00
392,00
392,00
392,00
392,00
352,00
352,00
374,50
374,50
374,50
374,50
383,00
383,00
392,00
392,00
392,00
392,00
442,50
442,50
450,00
450,00
442,50

34
34
34
166
166
175
175
166
166
166
166
166
166
166
166
166
166
166
166
175
175
175
175
175
175
175
175
166
166
175
175
157
157
157
157
157
157
157
157
157
157
157
157
156
156
156
156
157
157
157
157
157
157
156
156
156
156
157
157
157
157
156
156
159
159
158
158
158
158
101
101
101
101
101
100
94
95
95
95
94
94
95
95
105
105
105
105
105
105
104
104
104
104
104
104
104
104
104
104
104
104
105
105
105
105
104
104
104
104
104
104
104
104
104
104
104
104
34
34
35
35
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
34
54 BASIC
55 DUET
57 BAULINE / BAULINE AIR
58 B-SIDE
59 STICK / FAR
60 FINELAMP
226
,QIRUPDFLyQ
REF. / PAG.
Codigo Plazo Descripcin Euros Pg. Codigo Plazo Descripcin Euros Pg.
6042163
6042173
6044123
6044133
6044143
6044153
6044163
6044173
6101090
6101093
6101100
6101103
6101110
6101113
6101120
6101123
6141003
6141130
6141133
6142003
6152103
6152203
6154103
6154203
6205000
6205100
6205110
6205120
6205130
6205200
6205210
6205250
6205260
6206010
6206020
6206030
6206040
6206400
6207510
6207550
6207560
6241030
6241040
6241050
6242030
6242040
6242050
6301203
6301213
6301223
6301233
6301253
6301500
6301503
6301510
6301513
6301520
6301523
6301560
6301563
6301570
6301573
6301600
6301603
6301610
6301613
6301620
6301623
6301660
6301663
6301670
6301673
6302000
6302003
6302010
6302013
6302020
6302023
6303312
6303322
6303332
6306201
6306205
6306206
6306208
6306211
6306215
6306216
6306218
6306301
6307203
6307213
6307403
6307433
6308000
6308003
6308010
6308013
6308020
6308023
6308040
6308043
6308050
6308053
6308060
6308063
6308070
6308073
6308100
6308103
6308110
6308113
6308120
6308123
6308140
6308143
6308150
6308153
6308160
6308163
6308170
6308173
6308503
6308523
6308533
6308553
6308563
6308613
6308623
6308633
6308700
6308703
6308720
6308723
6308800
6308803
6308820
6308823
6341200
6341203
6341300
6341303
6342030
6342033
6348000
6348003
6348010
6348013
6348020
6348023
6348030
6348033
6348070
6348073
6348090
PROY. CARRIL FINELAMP TC-L 36W BL.MATE
PROY. CARRIL FINELAMP TC-L 36W GRIS
ACC. ALETAS ANTIDESLUM. PROY. VISSIO
ACC. ALETAS ANTIDESLUM. PROY. VISSIO-2
$&&$/(7$6352<(&725&20(7
ACC. CRISTAL UVA VISSIO / AVANT 175
FILTRO VISSIO / AVANT 175 COLOR AZUL
FILTRO VISSIO / AVANT 175 COLOR VERDE
CRISTAL DEC. VISSIO-130 / AVANT 175 ROJO
CRISTAL UVA VISSIO-2 / AVANT 145
FILTRO VISSIO-2 / AVANT 145 COLOR AZUL
FILTRO VISSIO-2 / AVANT 145 COLOR VERDE
FILTRO VISSIO-2 / AVANT 145 COLOR ROJO
CRISTAL UVA COMET / AVANT LINEAL
CAJA CON TRAFO 50W / 12V IP66
CAJA VACIA D 126MM IP67
ESTOQUE PARA PROY. GREEN PEQUEO
ACC. VISERA ANTIDES. PROY. GREEN PEQUEO
VISSIO BASE HIT 70W EXT. BL.
VISSIO BASE HIT 70W EXT. GR.
VISSIO BASE HIT 150W EXT. BL.
VISSIO BASE HIT 150W EXT. GR.
VISSIO BASE HIT 70W INT. BL.
VISSIO BASE HIT 70W INT. GR.
VISSIO BASE HST 100W BL.
VISSIO BASE HST 100W GR.
VISSIO BASE PAR30 75W BLANCO
VISSIO BASE PAR30 75W GRIS
VISSIO BASE QR-111 100W BL./E
VISSIO BASE QR-111 100W GR./E
VISSIO BASE HIT 150W INT. BL.
VISSIO BASE HIT 150W INT. GR.
VISSIO CARRIL HIT 70W EXT. BL.
VISSIO CARRIL HIT 70W EXT. GR.
VISSIO CARRIL HIT 150W EXT. BL.
VISSIO CARRIL HIT 150W EXT. GR.
VISSIO CARRIL HIT 70W INT. BL.
VISSIO CARRIL HIT 70W INT. GR.
VISSIO CARRIL HST 100W BL.
VISSIO CARRIL HST 100W GR.
VISSIO CARRIL PAR30 75W BLANCO
VISSIO CARRIL PAR30 75W GRIS
VISSIO CARRIL QR-111 100W BL./E
VISSIO CARRIL QR-111 100W GR./E
VISSIO CARRIL HIT 150W INT. BL.
VISSIO CARRIL HIT 150W INT. GR.
BASE VISSIO M-DUELAMP EXT. HIT 70-150W
BASE VISSIO M-DUELAMP INT. HIT 70-150W
BASE VISSIO M-DUELAMP HI-PAR30 70W
BASE VISSIO M-DUELAMP PAR30 75W
BASE VISSIO M-DUELAMP QR-111 100W
BASE VISSIO M-DUELAMP EXT. HIT-TC 35W
BASE VISSIO M-DUELAMP INT. HIT-TC 35W
BASE VISSIO M-DUELAMP QT12 100W
VISSIO BASE QR-LEDS WARM 40 BL.
VISSIO BASE QR-LEDS WARM 40 GR.
VISSIO BASE QR-LEDS WARM 24 BL.
VISSIO BASE QR-LEDS WARM 24 GRIS
VISSIO CARRIL QR-LEDS WARM 40 BL.
VISSIO CARRIL QR-LEDS WARM 40 GR.
VISSIO CARRIL QR-LEDS WARM 24 BL.
VISSIO CARRIL QR-LEDS WARM 24 GRIS
VISSIO BASE HIT-TM 20W BL./E
VISSIO BASE HIT-TM 20W GR./E
VISSIO CARRIL HIT-TM 20W BL./E
VISSIO CARRIL HIT-TM 20W GR./E
PROY. CARRIL FINELAMP TC-L 55W BL.
PROY. CARRIL FINELAMP TC-L 55W GRIS
VISSIO BASE HIT 70W EXT. BL. /E.
VISSIO BASE HIT 70W EXT. GR. /E.
VISSIO BASE HIT 150W EXT. BL. /E.
VISSIO BASE HIT 150W EXT. GR. /E.
VISSIO BASE HIT 70W INT. BL. /E.
VISSIO BASE HIT 70W INT. GR. /E.
VISSIO BASE HI-PAR30 70W BL. /E.
VISSIO BASE HI-PAR30 70W GR. /E.
VISSIO BASE HIT 150W INT. BL. /E.
VISSIO BASE HIT 150W INT. GR. /E.
VISSIO BASE HIT-TC 70W EXT.BL./ E.
LUM. FINELAMP 2X28/54W PBCO. GRIS
LUM. FINELAMP 2X35/49/80W PBCO. GRIS
LUM.D/I. FINELAMP 4X14/24W PCAR. GRIS
LUM.D/I. FINELAMP 4X28/54W PCAR. GRIS
LUM.D/I. FINELAMP 4X35/49/80W PCAR. GRIS
LUM.D/I. FINELAMP 4X14/24W PBCO GRIS
LUM.D/I. FINELAMP 4X28/54W PBCO GRIS
LUM.D/I. FINELAMP 4X35/49/80W PBCO GRIS
APLIQUE FINELAMP QT-DE MAX.300W BL.MATE
APLIQUE FINELAMP QT-DE MAX.300W GRIS
APLIQUE FINELAMP HIT-DE 70W BL.MATE
APLIQUE FINELAMP HIT-DE 70W GRIS
APLIQUE FINELAMP HIT-DE 150W BL.MATE
APLIQUE FINELAMP HIT-DE 150W GRIS
APLIQUE FINELAMP TC-L 36W BL.MATE
APLIQUE FINELAMP TC-L 36W GRIS
APLIQUE DINAMIC 1X55W TC-L
APLIQUE FINELAMP 1X55W TC-L BL.MATE
APLIQUE FINELAMP 1X55W TC-L GRIS
APLIQUE DINAMIC 2X55W TC-L
LUM. PIE DINAMIC DIR/IND. 2X14/24W BLUM DSI
LUM. PIE DINAMIC DIR/IND. 2X55W OPAL DSI
LUM. PIE DINAMIC DIR/IND. 4X14/24W BLUM DSI
LUM. PIE DINAMIC DIR/IND. 4X55W OPAL DSI
PERFIL BCN-CANAL PERFIL X M
PERFIL BCN-CANAL TAPA X M
TAPA LATERAL PARA CAJA DERIV. (600MM)
TAPA LATERAL CAJA-EMER (600MM)
CAJA-EMER EMPOTRADA (400MM)
UNION PERFIL BCN-CANAL CODO 90O
UNION PERFIL BCN-CANAL "T"
UNION PERFIL BCN-CANAL DERIVACION
UNION INT.PERFIL BCN-CANAL DERIV.
UNION ROTULA BCN-CANAL VERTICAL.
UNION ROTULA BCN-CANAL HOR. 85-105
UNION ROTULA BCN-CANAL HOR.105-125
UNION ROTULA BCN-CANAL HOR.125-180
TAPA FINAL BCN-CANAL
SUS. EXTRAPLANA BCN-CANAL
ADAPTADOR SUSP. DOBLE CABLE PARA BCN
SUS. BASCULANTE BCN VARILLA CENTRAL
LUM. BCN-CANAL 1X18W./E LAMAS (650MM)
LUM. BCN-CANAL 1X36W./E LAMAS (1250MM)
LUMINARIA BCN 2X136W./E LAMAS (2500MM)
LUM. BCN-CANAL 2X18W./E LAMAS (650MM)
LUM. BCN-CANAL 2X36W./E LAMAS (1250MM)
LUMINARIA BCN 2X236W./E LAMAS (2500MM)
PROYECTOR GREEN LIRA QR-CB51 50W IP66
PROYECTOR GREEN LIRA PAR-20 50W IP66
PROYECTOR GREEN LIRA IP66 LED WW 36
PROYECTOR GREEN QR-CB51 CON CAJA
PROYECTOR GREEN LIRA IP66 LED WW 24
PROYECTOR COMET BASE HIT G12 70W BL.
PROYECTOR COMET BASE HIT G12 70W GR.
PROYECTOR COMET BASE HIT G12 150W BL.
PROYECTOR COMET BASE HIT G12 150W GR.
PROYECTOR COMET BASE QT-DE BL.
PROYECTOR COMET BASE QT-DE GR.
PROYECTOR COMET BASE HIT-DE/HST 70W BL.
PROYECTOR COMET BASE HIT-DE/HST 70W GR.
PROYECTOR COMET BASE HIT-DE/HST150W BL.
PROYECTOR COMET BASE HIT-DE/HST150W GR.
PROYECTOR COMET CARRIL HIT G12 70W BL.
PROYECTOR COMET CARRIL HIT G12 70W GR.
PROYECTOR COMET CARRIL HIT G12 150W BL.
PROYECTOR COMET CARRIL HIT G12 150W GR.
PROYECTOR COMET CARRIL QT-DE BL.
PROYECTOR COMET CARRIL QT-DE GR.
PROY. COMET CARRIL HIT-DE/HST 70W BL
PROY. COMET CARRIL HIT-DE/HST 70W GR.
PROY. COMET CARRIL HIT-DE/HST 150W BL.
PROY. COMET CARRIL HIT-DE/HST 150W GR.
PROY. CARRIL FINELAMP HIT-DE 150W BL.
PROY. CARRIL FINELAMP HIT-DE 150W GRIS
PROY. CARRIL FINELAMP HIT-DE 70W BL.MATE
PROY. CARRIL FINELAMP HIT-DE 70W GRIS
378,00
386,50
378,00
419,50
475,00
382,50
453,50
500,00
153,00
153,00
304,00
304,00
309,50
309,50
193,00
193,00
267,50
219,00
219,00
346,50
714,00
710,50
1035,50
1011,50
139,00
22,00
28,50
29,50
100,50
57,00
79,00
160,00
175,50
431,50
492,50
502,50
500,00
6,50
18,00
12,50
11,00
225,50
311,00
546,50
226,00
311,50
590,50
44,50
48,00
89,00
149,00
89,00
201,00
201,00
216,50
216,50
107,00
107,00
168,50
168,50
185,50
185,50
205,50
205,50
219,50
219,50
127,00
127,00
189,00
189,00
215,50
215,50
348,00
348,00
322,50
322,50
220,00
220,00
40,50
50,50
38,00
46,00
65,00
65,00
65,00
55,00
77,00
77,00
77,00
17,00
70,00
41,00
20,50
16,50
255,00
255,00
269,50
269,50
255,00
255,00
349,00
349,00
102,00
102,00
147,00
147,00
270,00
270,00
309,50
309,50
332,00
332,00
310,00
310,00
396,00
396,00
145,00
145,00
197,00
197,00
327,00
327,00
182,00
182,00
131,50
145,00
129,00
170,50
170,50
173,00
220,00
220,00
220,00
220,00
260,00
260,00
260,00
260,00
246,00
246,00
285,50
285,50
258,50
258,50
311,00
311,00
369,50
369,50
311,50
311,50
237,00
237,00
369,50
369,50
308,50

58
58
53
51
57
53
53
53
53
46
46
46
46
47
200
200
200
200
53
53
53
53
53
53
53
53
51
51
52
52
53
53
53
53
53
53
53
53
53
53
51
51
52
52
53
53
113
113
113
113
113
113
113
113
53
53
53
53
53
53
53
53
50
50
50
50
58
58
52
52
52
52
52
52
50
50
52
52
50
100
100
100
100
100
100
100
100
70
70
70
70
70
70
70
70
64
70
70
64
65
65
65
65
109
109
109
109
109
109
109
109
109
109
109
109
109
109
109
109
109
109
109
109
109
109
109
200
200
200
200
200
57
57
57
57
57
57
57
57
57
57
57
57
57
57
57
57
57
57
57
57
58
58
58
58
$3/,48(6/$03$5$6'(3,(),1(/$03',1$0,&
62 BCN
352<(&725(6*5((1&20(7),1(/$039,66,2
227
,QIRUPDFLyQ
REF. / PAG.
Codigo Plazo Descripcin Euros Pg. Codigo Plazo Descripcin Euros Pg.
6348093
6348100
6348103
6348110
6348113
6348120
6348123
6348130
6348133
6348170
6348173
6348190
6348193
6348200
6348203
6348210
6348213
6348220
6348223
6348230
6348233
6348250
6348253
6348260
6348263
6348300
6348303
6348310
6348313
6348320
6348323
6348330
6348333
6348350
6348353
6348360
6348363
6405203
6406403
6407000
6442000
6442010
6442060
6442070
6442080
6442090
6442100
6442110
6442120
6442130
6444000
6444010
6502000
6502100
6502200
6502210
6502220
6502740
6503000
6503010
6503020
6503100
6503110
6503120
6503200
6503210
6503220
6504000
6504010
6504100
6504110
6504200
6504210
6506400
6507400
6507410
6507420
6541110
6541120
6541130
6542000
6542100
6542200
6542210
6542220
6542600
6542610
6542620
6542700
6542710
6542720
6542730
6542740
6542810
6542820
6543000
6543010
6543020
6543100
6543110
6543120
6543200
6543210
6543220
6543600
6544000
6544010
6544100
6544110
6544200
6544210
6544600
6544700
6600833
6600843
6600853
6600863
6600873
6600882
6600993
6601003
6601013
6601023
6601033
6601103
6601113
6601123
6601133
6601310
6601313
6601333
6601343
6601353
6601373
6601503
6601513
6601523
6601543
6601553
6601603
6601613
6601623
6601703
6601713
6601723
6601803
6601813
6601823
6607203
6608023
6608073
6608083
6641160
6641163
6641170
LUM. MODULAR ASIMETRICA T5 1X14/24W
LUM. MODULAR ASIMETRICA T5 1X28/54W
LUM. MODULAR ASIMETRICA TC-L 1X55W
LUM. MODULAR ST T8 2X36W V.BR. /E
LUM. MODULAR ST T8 2X36W V.BL. /E
LUM. MODULAR ST T8 2X36W BLUM. /E
LUM.MODULAR/POL.LC 2X36W. BLUM/ E.
LUM.MODULAR/POL.LC 2X58W. BLUM /E.
LUM. MODULAR SLIM T-5 2X28/54W
LUM.MODULAR/POL.LC 2X28/54W. BLUM
LUM.MODULAR/POL.LC 2X35/49/80W. BLUM
LUM. MOD./POL. IND. 2X55W TC-L /E
LUM. MOD./POL. IND. 2X54W
LUM. MOD./POL. IND. 2X55W TC-L BLUM
LUM. MOD./POL. IND. 2X54W BLUM.
LUM. MOD./POL. IND. 2X36W TC-L /E
LUM. MODULAR TECH 2X14/24W
LUM. MODULAR TECH 2X28/54W
LUM. MODULAR ST T8 3X18W V.BR. /E
LUM. MODULAR ST T8 3X36W V. BR. /E
LUM. MODULAR ST TC-L 3X36W. V.BR. /E
LUM. MODULAR ST T8 3X18W V.BL. /E
LUM. MODULAR ST T8 3X36W V.BL. /E
LUM. MODULAR ST TC-L 3X36W V.BL. /E
LUM. MODULAR ST T8 3X18W B.LUM. /E
LUM. MODULAR ST T8 3X36W B.LUM. /E
LUM. MODULAR ST TC-L 3X36W B.LUM. /E
MODULAR SLIM T-5 3X14/24W
LUM. MODULAR ST T8 4X18W V. BR. /E
LUM. MODULAR ST T8 4X36W V.BR. /E
LUM. MODULAR ST T8 4X18W V.BL. /E
LUM. MODULAR ST T8 4X36W V.BL. /E
LUM. MODULAR ST T8 4X18W B.LUM. /E
LUM. MODULAR ST T8 4X36W B.LUM. /E
MODULAR SLIM T-5 4X14/24W
LUM. MOD./POL. IND. 4X55W TC-L /E
COLUMNA ALUMINIO MICRO PROA 1M
COLUMNA ALUMINIO MICRO PROA 2.5M
SOPORTE PARED MICRO PROA 1M
ESTOQUE MICRO PROA/SHOT 190
ACC. BASE FIJACION COLUMNA MICRO PROA
REJILLA PROTECCION MICRO PROA NEGRO
PLANTILLA TALADROS COLUMNA MICRO PROA
PROA ASIM. D/I HIT-DE 250W 4,5KV IP65
PROA ASIM. D/I HIT-DE 400W 4,5KV IP65
PROA ASIM. DIR. HIT-DE 250W 4,5KV IP65
PROA ASIM. DIR. HIT-DE 400W 4,5KV IP65
PROA SIM. D/I HIT-DE 250W 4,5KV IP65
PROA SIM. D/I HIT-DE 400W 4,5KV IP65
PROA SIM. DIR. HIT-DE 250W 4,5KV IP65
PROA SIM. DIR. HIT-DE 400W 4,5KV IP65
MICRO PROA ASIM. QT-DE 150W BL.
MICRO PROA ASIM. QT-DE 150W GR.
MINI PROA VIAL HST 50W E-27
MINI PROA VIAL HST 70W E-27
MINI PROA VIAL HST-DE 70W Rx7s
MINI PROA VIAL HST-DE 150W Rx7s
MINI PROA SIM. DIR. QT-DE 300W IP65
MINI-PROA SIM. DIR. HIT/HST-DE 70W IP65
MINI PROA SIM. DIR. HIT/HST-DE 150W IP65
MINI PROA VIAL SIM. DIR. G12 70W IP65
MINI PROA VIAL SIM. DIR. G12 150W IP65
MINI PROA ASIM. DIR. QT-DE 300W IP65
MINI PROA ASIM. DIR. HIT/HST-DE 70W IP65
MINI PROA ASIM.DIR. HIT/HST-DE 150W IP65
MINI PROA SIM. D/I. QT-DE 300W IP65
MINI PROA SIM. D/I. HIT/HST-DE 70W IP65
MINI PROA SIM. D/I. HIT/HST-DE 150W IP65
MINI PROA ASIM. D/I. QT-DE 300W IP65
MINI PROA ASIM. D/I. HIT/HST-DE 70W IP65
MINI PROA ASIM. D/I. HIT/HS-DE 150W IP65
ROTULA PROA / M-PROA DECORATIVA GRIS
ACC. SOPORTE PARED FIJ. LUM. PROA GRIS
$%5$=$'(5$&2/801$352$*5,6
$%5$=$'(5$&2/801$352$*5,6
MICRO PROA SIM. DIR. HIT G12 35W BL.
MICRO PROA SIM. DIR. HIT G12 35W GR
MICRO PROA SIM. CDM-TM 20W BL.
VISSIO BASE HIT-TC 70W EXT.GR./ E.
VISSIO CARRIL HIT 70W EXT. BL./E
VISSIO CARRIL HIT 70W EXT. GR./E
VISSIO CARRIL HIT 150W EXT. BL./E
VISSIO CARRIL HIT 150W EXT. GR./E
VISSIO CARRIL HIT 70W INT. BL. /E.
VISSIO CARRIL HIT 70W INT. GR. /E.
VISSIO CARRIL HI-PAR30 70W BL/ E
VISSIO CARRIL HI-PAR30 70W GR/ E
VISSIO CARRIL HIT 150W INT. BL./E
VISSIO CARRIL HIT 150W INT. GR./E
VISSIO CARRIL HIT-TC 70W EXT. BL/E
VISSIO CARRIL HIT-TC 70W EXT. GR /E
VISSIO BASE HIT-TC 70W INT. BL/ E.
VISSIO BASE HIT-TC 70W INT. GR/ E.
VISSIO BASE HIT-TC 35W EXT. BL/ E.
VISSIO BASE HIT-TC 35W EXT. GR/ E.
VISSIO BASE HIT-TC 35W INT. BL/ E.
VISSIO BASE HIT-TC 35W INT. GR/ E.
VISSIO BASE QT12 100W BL./E
VISSIO BASE QT12 100W GR./E
VISSIO BASE CDMR-111 35W BL./E
VISSIO BASE CDMR-111 35W GR./E
VISSIO BASE CDMR-111 70W BL./E
VISSIO BASE CDMR-111 70W GR./E
VISSIO CARRIL HIT-TC70W INT. BL/E.
VISSIO CARRIL HIT-TC70W INT. GR/E.
VISSIO CARRIL HIT-TC35W EXT. BL/E.
VISSIO CARRIL HIT-TC35W EXT. GR/E.
VISSIO CARRIL HIT-TC35W INT. BL/ E
VISSIO CARRIL HIT-TC35W INT. GR/ E
VISSIO CARRIL QT12 100W BL./E
VISSIO CARRIL QT12 100W GR./E
VISSIO CARRIL CDMR-111 35W BL./E
VISSIO CARRIL CDMR-111 35W GR./E
VISSIO CARRIL CDMR-111 70W BL./E
VISSIO CARRIL CDMR-111 70W GR./E
UNION DINAMIC CODO 90
TAPA FINAL DINAMIC LC
FIJACION INTERMEDIA DINAMIC LC
LUM. DINAMIC DECO 2X28W PCAR.
LUM. D/I DINAMIC DECO 2X28W PCAR.
LUM. DINAMIC LC 2X28/54W OPAL
LUM. D/I DINAMIC LC 2X28/54W OPAL
LUM. DINAMIC LC 2X35/49/80W OPAL
LUM. D/I DINAMIC LC 2X35/49/80W OPAL
LUM. DINAMIC LC 2X28/54W BLUM.
LUM. D/I DINAMIC LC 2X28/54W BLUM.
LUM. DINAMIC LC 2X35/49/80W BLUM.
LUM. D/I DINAMIC LC 2X35/49/80W BLUM.
LUM. DINAMIC DECO 4X14W PCAR.
LUM. D/I DINAMIC DECO 4X14W PCAR.
LUM. MODULAR ST T8 2X36W V.BR.
LUM. MODULAR ST T8 2X36W V.BL.
LUM. MODULAR ST T8 2X36W B.LUM.
LUM.MODULAR/POL.LC 2X36W. BLUM
LUM.MODULAR/POL.LC 2X58W. BLUM
LUM. MOD./POL. IND. 2X36W TC-L
LUM. MODULAR ST T8 3X18W V.BR.
LUM. MODULAR ST T8 3X36W V.BR.
LUM. MODULAR ST TC-L 3X36W V.BR.
LUM. MODULAR ST T8 3X18W V.BL.
LUM. MODULAR ST T8 3X36W V.BL.
LUM. MODULAR ST TC-L 3X36W V.BL.
LUM. MODULAR ST T8 3X18W BLUM
LUM. MODULAR ST T8 3X36W BLUM
LUM. MODULAR ST TC-L 3X36W B.LUM.
LUM. MODULAR ST T8 4X18W V.BR.
LUM .MODULAR ST T8 4X36W V.BR.
LUM. MODULAR ST T8 4X18W V.BL
LUM. MODULAR ST T8 4X36W V. BL.
LUM. MODULAR ST T8 4X18W B.LUM.
LUM. MODULAR ST T8 4X36W B.LUM.
ACC. TAPA FINAL MODULAR/POL. LC
ACC. FIJACION LUM. MODU/POL. T8
ACC. FIJACION LUM. MODU/POL. T5
ACC. UNION LUM. MODULAR/POL. LC.
308,50
357,50
357,50
418,50
418,50
361,50
361,50
285,00
285,00
419,00
419,00
367,00
367,00
308,00
308,00
303,50
303,50
303,00
303,00
173,00
173,00
237,00
237,00
237,00
237,00
365,50
365,50
356,00
356,00
354,50
354,50
221,50
221,50
283,50
283,50
283,50
283,50
71,00
20,50
3,00
414,00
455,50
261,50
277,00
309,50
327,50
273,00
288,00
320,50
339,00
445,00
445,50
89,50
94,50
133,00
113,50
135,50
138,50
83,00
162,50
97,00
86,00
164,50
100,50
120,50
223,50
147,00
82,50
140,00
88,00
150,50
128,00
224,50
11,00
4,00
8,00
2,00
101,50
124,50
118,00
100,00
104,00
145,00
136,50
147,50
147,50
162,00
182,00
152,50
260,00
195,50
298,00
152,50
186,50
225,00
106,50
180,50
146,50
110,00
185,50
150,50
133,00
232,00
178,00
146,00
112,00
170,00
115,00
177,00
143,50
229,00
147,50
330,00
182,00
287,50
137,00
34,00
65,00
44,50
9,50
487,00
491,00
465,50
470,00
487,00
491,00
465,50
470,00
208,50
204,50
212,00
213,50
218,00
240,50
217,50
266,50
285,50
287,00
305,50
217,50
266,50
285,50
251,50
299,00
318,00
251,50
299,00
299,00
72,50
196,00
133,50
130,50
339,50
331,50
369,50

127
127
127
123
123
123
124
124
122
124
124
125
125
125
125
125
126
126
123
123
123
123
123
123
123
123
123
122
123
123
123
123
123
123
122
125
179
179
179
179
179
179
179
183
183
182
182
183
183
182
182
63
178
180
180
180
180
180
180
180
180
180
180
180
180
181
181
181
181
181
181
186
186
186
186
63
178
63
50
52
52
52
52
52
52
50
50
52
52
50
50
50
50
50
50
50
50
51
51
52
52
52
52
50
50
50
50
50
50
51
51
52
52
52
52
96
96
96
97
97
96
96
96
96
96
96
96
96
97
97
123
123
123
124
124
125
123
123
123
123
123
123
123
123
123
123
123
123
123
123
123
124
124
122
124
64 DINAMIC
02'8/$5/,1($&217,18$,1',5(&7$6/,07(&+$6,0
66 PROA / MINI PROA / MICRO PROA
228
,QIRUPDFLyQ
REF. / PAG.
Codigo Plazo Descripcin Euros Pg. Codigo Plazo Descripcin Euros Pg.
6841053
6841063
6841073
6842203
6842213
6842223
6842233
6842243
6901013
6901023
6901033
6901043
6901053
6901063
6901073
6901083
6901163
6901173
6901183
6901203
6901223
6901233
6901243
6901263
6901273
6901283
6901293
6901303
6901443
6901453
6901463
6901473
6901603
6901623
6901633
6901643
6940163
6941093
6941103
6941153
6941253
6941263
7001190
7005000
7005100
7005200
7006400
7041000
7041010
7041020
7041030
7041040
7041050
7041060
7041070
7041080
7041090
7041100
7041110
7041120
7041130
7041140
7041150
7041160
7041170
7041210
7041220
7041230
7041240
7041250
7041260
7041270
7041280
7042000
7042010
7042020
7042060
6641173
6641180
6641183
6641190
6641193
6641220
6641223
6641230
6641233
6641240
6641243
6641250
6641253
6641260
6641263
6641270
6641273
6641280
6641283
6641290
6641293
6641303
6641363
6641513
6641523
6641543
6641553
6641563
6641583
6641613
6641623
6641713
6641723
6641813
6641823
6642303
6642313
6642533
6701003
6701023
6701033
6701043
6701053
6701063
6701073
6701083
6701093
6701220
6701223
6702003
6702023
6702033
6702220
6702223
6704043
6704053
6704063
6704073
6704083
6704093
6741130
6741133
6741140
6741143
6741173
6741183
6741300
6741303
6742110
6742113
6742120
6742123
6808703
6808713
6808723
6841023
6841033
70 MULTISPACE
STEP ASIM. T5 1X14/24W IP 67
STEP ASIM. T5 1X28/54W IP 67
STEP ASIM. TC-L 18W IP 67
STEP AIR PL-L 55-80W IP 65
STEP AIR T5 1X14/24W IP65
STEP AIR T5 1X28/54W IP65
STEP AIR ASIM. T5 1X14/24W IP65
STEP AIR ASIM. T5 1X28/54W IP65
ECO HIT-HST 150W E40
ECO HIT-HST 4,5KV 250W E40
ECO HIT 400W 4,5KV E40
ECO HIT 250W 0,6KV E40
ECO HIT 400W 0,6KV E40
MINI-ECO HIT/HST/HIE/HSE 70W E27
MINI-ECO HIT-HST 150W E40
MINI-ECO HST 100W E40
MINI-ECO HIT/HST/HIE/HSE 70W E27 CLASEII
MINI-ECO HIT-HST 150W E40 CLASE II
MINI-ECO HST 100W E40 CLASE II
DUNE HIT/HST/HIE/HSE 70W E27 GR.
DUNE HIT/HST 150W E40 GR.
DUNE HST 50W E27 GR.
DUNE HST 100W E40 GR.
ECO HIT/HST E40 150W CLASE II GRIS
ECO HIT/HST 4,5KV E40 250W CLASE II GRIS
ECO HIT 0,6KV E40 250W CLASE II GRIS
ECO HIT 4,5KV E40 400W CLASE II GRIS
ECO HIT 0,6KV E40 400W CLASE II GRIS
ECO HIT/HST 4,5KV 250W E40 DOBLE NIVEL
ECO HIT 4,5KV 400W E40 DOBLE NIVEL
MINI-ECO HST 100W E40 DOBLE NIVEL
MINI-ECO HIT/HST 150W E40 DOBLE NIVEL
DUNE HIT/HST/HIE/HSE 70W E27 CLASE II GR
DUNE HST 150W E40 CLASE II GR.
DUNE HST 50W E27 CLASE II GR.
DUNE HST 100W E40 CLASE II GR.
FAROLA MODULAR FOTOVOLTAICA FAMA
DUNE LEDS 48 LEDS NW 700MA CLASE I GR.
DUNE LEDS 48 LEDS NW 700MA CLASE II GR.
DUNE LEDS 48 LEDS NW 350MA CLASE II GR.
DUNE CPO-T 140W GR.
DUNE LEDS 48 LEDS NW 350MA CLASE I GR.
ACC.SOPORTE CARTEL MULTISPACE
PERFIL MULTISPACE (x/mm)
TAPA MULTISPACE (x/mm)
UNION PERFIL MULTISPACE CODO 90
TAPA FINAL MULTISPACE BL.
MULTISPACE 1X14/24W DIR. OPAL BL.
MULTISPACE 1X28/54W DIR. OPAL BL.
MULTISPACE 1X35/49/80W DIR. OPAL BL.
MULTISPACE 1X14/24W INDIR. OPAL BL.
MULTISPACE 1X28/54W INDIR. OPAL BL.
MULTISPACE 1X35/49/80W INDIR. OPAL BL.
MODULO MULTISPACE 1XQR-111 100W BL.
MODULO MULTISPACE 1XCDM-R111 35W BL.
MODULO MULTISPACE 1XCDM-R111 70W BL.
APLIQUE MULTISPACE 1XQR-111 100W BL.
APLIQUE MULTISPACE 1XCDM-R111 35W BL.
APLIQUE MULTISPACE 1XCDM-R111 70W BL.
PROY. MULTISPACE CARRIL QR-111 100W
PROY. MULTISPACE CARRIL CDM-R111 35W
PROY. MULTISPACE CARRIL CDM-R111 70W
PROY. MULTISPACE SUPERFICIE QR-111 100W
PROY. MULTISPACE SUPERF.CDM-R111 35W
PROY. MULTISPACE SUPERF.CDM-R111 70W
MULTISPACE BASE QR-LEDS WARM WFL BL.
MULTISPACE BASE QR-LEDS WARM MFL BL.
MULTISPACE CARRIL QR-LEDS WARM WFL BL.
MULTISPACE CARRIL QR-LEDS WARM MFL BL.
APLI. MULTISPACE QR-LEDS WARM WFL BL.
APLI. MULTISPACE QR-LEDS WARM MFL BL.
MOD. MULTISPACE QR-LEDS WARM WFL BL.
MOD. MULTISPACE QR-LEDS WARM MFL BL.
MULTISPACE 2X14/24W DIR/IND. OPAL BL.
MULTISPACE 2X28/54W DIR/IND. OPAL BL.
MULTISPACE 2X35/49/80W DIR/IND. OPAL BL.
MODULO MULTISPACE 2XQR-111 100W BL.
MICRO PROA SIM. CDM-TM 20W GR
MICRO PROA SIM. CDM-TM 35W BL.
MICRO PROA SIM. CDM-TM 35W GR.
MICRO PROA SIM. TC-TE 18W GX24-Q2 BL.
MICRO PROA SIM. TC-TE 18W GX24-Q2 GR.
MICRO PROA ASIM. TC-TE 26W GX24-Q3 BL
MICRO PROA ASIM. TC-TE 26W GX24-Q3 GR
MICRO PROA SIM. TC-TE 26W GX24-Q3 BL
MICRO PROA SIM. TC-TE 26W GX24-Q3 GR
MICRO PROA SPOT NW BL.
MICRO PROA SPOT NW GR.
MICRO PROA FLOOD G12 35W BL.
MICRO PROA FLOOD G12 35W GR
MICRO PROA ASIM. DIR. HIT G12 35W BL
MICRO PROA ASIM. DIR. HIT G12 35W GR
MICRO PROA ASIM. CDM-TM 20W BL
MICRO PROA ASIM. CDM-TM 20W GR
MICRO PROA ASIM. CDM-TM 35W BL
MICRO PROA ASIM. CDM-TM 35W GR
MICRO PROA ASIM. TC-TE 18W GX24-Q2 BL
MICRO PROA ASIM. TC-TE 18W GX24-Q2 GR
PROA DIR. SIM. TC-TE 1X57W IP65
PROA VIAL SIM. DIR. CPO-T 140W IP65
MINI PROA SIM. DIR. HIT-DE 70W /E IP65
MINI PROA SIM. DIR. HIT-DE 150W /E IP65
MINI PROA VIAL SIM. DIR. G12 70W IP65
MINI PROA VIAL SIM. DIR. G12 150W IP65
MINI PROA VIAL SIM. DIR. CPO-T 60W IP65
MINI PROA SPOT NW GRIS
MINI PROA ASIM. DIR. HIT-DE 70W /E IP65
MINI PROA ASIM. DIR. HIT-DE 150W /E IP65
MINI PROA SIM. D/I. HIT-DE 70W /E IP65
MINI PROA SIM. D/I. HIT-DE 150W /E IP65
MINI PROA ASIM. D/I. HIT-DE 70W /E IP65
MINI PROA ASIM. D/I. HIT-DE 150W /E IP65
PROA DIR. SIM. TC-TE 2X57W IP65
PROA DIR. SIM. TC-TE 2X42W IP65
MINI PROA SIM. DIR. TC-TE 2X26/32W IP65
APLIQUE BLOC RAD. DIR. EXTEN. HIT 35W
APLIQUE BLOC RAD. DIR. EXTEN. E-27 60W
APLIQUE BLOC RAD. DIR. EXTEN. TC-T 18W
BALIZA BLOC RAD. LAT. EXTEN. TC-T 18W
BALIZA BLOC RAD. LAT EXTEN. HIT-35W
BALIZA BLOC RAD. LAT.EXT.HIT-35W ALT.
BALIZA BLOC RAD.LAT.EXTEN.TC-T18W ALT
BALIZA BLOC RAD.LAT EXTENS. E-27 60W
BALIZA BLOC RAD.LAT.EXTEN.ALT. E-27 60W
LUM. BLOC INTERIOR DIR. E-27 BLANCO
LUM. BLOC INTERIOR DIR. E-27 GRIS
APLIQUE BLOC RAD. DIR/IND. HIT 35W
APLIQUE BLOC RAD. DIR/IND. E-27 60W
APLIQUE BLOC RAD. DIR/IND. TC-T 18W
LUM. BLOC INTERIOR DIR/IND. E-27 BLANCO
LUM. BLOC INTERIOR DIR/IND. E-27 GRIS
BALIZA BLOC MULTIRAD. EXTEN. TC-T 18W
BALIZA BLOC MULTIRAD. EXTEN. HIT-35W
BALIZA BLOC MULTIRAD.EXT.HIT-35W ALT
BALIZA BLOC MULTIR.EXTEN.TC-T18W ALT
BALIZA BLOC MULTIRAD.EXTENS. E-27 60W
BALIZA BLOC MULTIRAD. EXT.ALT. E-27 60W
APLI. BLOC DIR. 6 LEDS C-WHITE BL.
APLI. BLOC DIR. 6 LEDS C-WHITE GR.
APLI. BLOC DIR. 6 LEDS W-WHITE BL.
APLI. BLOC DIR. 6 LEDS W-WHITE GR.
BALIZA BLOC RAD.LAT.EXT.6LED C.W. GR.
BALIZA BLOC RAD.LAT.EXT.6LED C.W. ALT.GR
LUM. BLOC INTERIOR DIR. GU-5,3 BLANCO
LUM. BLOC INTERIOR DIR. GU-5,3 GRIS
APLI. BLOC DIR-IND 12 LEDS C-WHITE BL.
APLI. BLOC DIR-IND 12 LEDS C-WHITE GR.
APLI. BLOC DIR-IND 12 LEDS W-WHITE BL.
APLI. BLOC DIR-IND 12 LEDS W-WHITE GR.
CAJA EMPOTRAMIENTO STEP 18W / 12 LEDS
CAJA EMPOTRAMIENTO STEP 24W 30 LEDS
CAJA EMPOTRAMIENTO STEP 54W
STEP SIM. T5 1X14/24W IP 67 OPAL
STEP SIM. T5 1X28/54W IP 67 OPAL
313,50
480,00
219,50
188,00
216,50
272,00
205,00
274,50
223,50
230,50
231,00
201,00
225,50
157,50
172,00
165,50
228,50
230,00
217,00
298,50
317,00
302,00
304,00
268,50
286,50
271,50
288,00
286,00
279,50
283,00
243,50
250,00
306,50
325,00
310,00
312,00
a consultar
1131,00
1131,00
860,50
565,50
860,50
21,50
105,00
20,50
50,50
21,00
163,50
257,00
325,50
163,50
257,00
325,50
103,50
207,00
207,00
98,50
202,00
202,00
132,00
226,00
226,00
118,50
213,00
213,00
197,00
197,00
204,50
204,50
190,00
190,00
190,50
190,50
229,50
323,00
401,50
172,00
362,50
369,50
362,50
260,50
255,50
278,50
273,50
268,00
262,50
439,00
439,00
364,00
355,00
337,00
330,00
365,50
365,50
365,50
365,50
268,50
263,00
439,00
663,50
346,00
419,00
364,00
437,50
637,00
950,50
346,00
426,50
376,00
449,50
376,00
449,50
490,00
431,50
335,00
277,50
234,50
242,50
215,50
252,50
268,50
244,00
210,00
236,00
137,50
137,50
295,00
248,00
260,00
166,50
166,50
287,50
323,50
358,00
317,00
284,50
316,50
234,00
234,00
234,00
234,00
257,50
315,50
155,50
155,50
385,00
385,00
385,00
385,00
37,50
46,50
63,50
335,50
484,00

167
167
167
176
176
176
176
176
211
211
211
211
211
210
210
210
210
210
210
206
206
206
206
211
211
211
211
211
211
211
210
210
206
206
206
206
209
207
207
207
206
207
92
93
93
93
93
92
92
92
92
92
92
93
93
93
61
61
61
56
56
56
56
56
56
56
56
56
56
61
61
93
93
92
92
92
93
178
63
178
63
178
63
178
63
178
63
178
63
178
63
178
63
178
63
178
63
178
182
182
180
180
180
180
180
180
180
180
181
181
181
181
182
182
180
161
161
161
160
160
160
160
160
160
60
60
161
161
161
60
60
160
160
160
160
160
160
60
60
60
60
160
160
60
60
60
60
60
60
167
167
167
167
167
68 STEP AIR / STEP
67 BLOC
69 ECO / MINI ECO / DUNE / DUNE LEDS
229
,QIRUPDFLyQ
REF. / PAG.
Codigo Plazo Descripcin Euros Pg. Codigo Plazo Descripcin Euros Pg.
7342063
7342073
7342133
7342143
7342163
7342173
7441003
7441013
7441103
7441113
7441203
7441213
7442003
7442103
7442203
7501203
7501213
7501243
7501253
7501263
7501273
7501283
7501293
7501313
7501323
7501333
7501343
7501353
7501363
7501373
7501383
7501453
7507712
7507722
7507732
7507742
7507752
7507762
7507772
7507782
7507792
7541233
7541303
7541383
7541393
7541403
7541413
7541423
7541503
7541513
7541523
7541533
7541543
7541553
7541603
7541613
7541623
7541633
7541643
7541653
7541803
7541813
7541823
7541833
7541843
7541853
7541863
7541873
7541903
7541913
7541923
7541933
7541943
7541953
7541963
7541973
7042070
7042080
7042090
7042100
7042110
7042250
7042260
7042270
7042280
7100882
7100892
7100900
7100910
7101070
7101080
7101270
7101280
7142030
7142040
7142050
7142060
7142130
7142140
7142150
7142160
7142230
7142240
7142250
7142260
7142330
7142340
7142350
7142360
7144010
7144020
7144110
7144120
7144210
7144220
7144310
7144320
7201030
7205000
7205200
7205240
7205250
7205260
7206400
7241040
7241050
7242010
7242020
7242110
7242120
7244240
7244250
7283010
7283110
7301013
7301023
7301113
7301123
7301213
7301223
7341033
7341043
7341053
7341063
7341073
7341133
7341143
7341153
7341163
7341173
7342033
7342043
TWIN BASE 2XQR-LEDS WARM WFL GR.
TWIN BASE 2XQR-LEDS WARM MFL GR.
PROYECTOR CARRIL TWIN 2X QR-111
PROYECTOR CARRIL TWIN 2X35W CDM-R111
TWIN CARRIL 2XQR-LEDS WARM WFL GR.
TWIN CARRIL 2XQR-LEDS WARM MFL GR.
32,17;:*4*5,6
POINT 132 9W GX53 GRIS
32,17$6,0;:*4*5
POINT 132 ASIMETRICO 9W GX53 GRIS
32,175(-$;:*4*5
POINT 132 REJA 9W GX53 GRIS
32,17;:*4*5,6
32,17$6,0;:*4*5,6
32,175(-$;:*4*5,6
SHOT 290 SPOT HIT G12 70W GRIS
SHOT 290 FLOOD HIT G12 70W GRIS
SHOT 290 VIAL HST-DE RX7S 70W GRIS
SHOT 290 VIAL HIT G12 70W GRIS
SHOT 380 SPOT HST PG12 100W GRIS
SHOT 380 FLOOD HST PG12 100W GRIS
SHOT 380 SPOT HIT G12 150W GRIS
SHOT 380 FLOOD HIT G12 150W GRIS
SHOT 380 VIAL HST-DE RX7S 150W GRIS
SHOT 380 VIAL HIT G12 150W GRIS
SHOT 290 VIAL HIT G12 35W GRIS
SHOT 530 HM - VSAP 4,5KV 250W GR.
SHOT 530 HM 0,6 KV 250W GR.
SHOT 530 HM 4,5 KV 400W GR.
SHOT 530 HM 0,6 KV 400W GR.
SHOT 530 VSAP 400W GR.
SHOT 380 FLOOD E27 70W GR.
VISERA ANTIDESLUMBRANTE SHOT 190
ANTIDESLUMBRANTE CIRCULAR SHOT 530
VISERA ANTIDESLUMBRANTE SHOT 530
ACC. ANTIDESLUMBRANTE CIRCULAR SHOT 380
ACC. VISERA ANTIDESLUMBRANTE SHOT 380
ACC. ANTIDESLUMBRANTE CIRCULAR SHOT 290
ACC. VISERA ANTIDESLUMBRANTE SHOT 290
ACC. VISERA ANTIDESLUMBRANTE SHOT LEDS
ACC. VISERA ANTIDESLUMB. MINI SHOT LEDS
SHOT 290 VIAL CPO-T PGZ12 60W GRIS
SHOT 380 VIAL CPO-T PGZ12 140W GRIS
6+27/('6327/('V1(875$/:+,7(*5
6+27/('6327/('V:$50:+,7(*5,6
6+27/(')/22'/('V1(875$/*5,6
6+27/(')/22'/('V:$50:+,7(*5,6
SHOT LED FLOOD 24 LEDS RGB GRIS
SHOT190 SPOT HIT G12 35W GR.
SHOT 190 FLOOD HIT G12 35W GR.
SHOT 190 SPOT CDM-TM PGJ5 20W GR.
SHOT 190 FLOOD CDM-TM PGJ5 20W GR.
SHOT 190 SPOT QT12 GY6,35 50W GR.
SHOT 190 FLOOD QT12 GY6,35 50W GR.
SHOT 190 ACC. SPOT HIT G12 35W GR.
SHOT 190 ACC. FLOOD HIT G12 35W GR.
SHOT 190 ACC. SPOT CDM-TM PGJ5 20W GR.
SHOT 190 ACC. FLOOD CDM-TM PGJ5 20W GR.
SHOT 190 ACC. SPOT QT12 GY6,35 50W GR.
SHOT 190 ACC. FLOOD QT12 GY6,35 50W GR.
MINI SHOT 5 LEDS SPOT NW GRIS
MINI SHOT 5 LEDS SPOT WW GRIS
MINI SHOT 10 LEDS SPOT NW GRIS
MINI SHOT 10 LEDS SPOT WW GRIS
MINI SHOT 5 LEDS M.FLOOD NW GRIS
MINI SHOT 5 LEDS M.FLOOD WW GRIS
MINI SHOT 10 LEDS M.FLOOD NW GRIS
MINI SHOT 10 LEDS M.FLOOD WW GRIS
MINI SHOT ACC. 5 LEDS SPOT NW GRIS
MINI SHOT ACC. 5 LEDS SPOT WW GRIS
MINI SHOT ACC. 10 LEDS SPOT NW GRIS
MINI SHOT ACC. 10 LEDS SPOT WW GRIS
MINI SHOT ACC. 5 LEDS M.FLOOD NW GRIS
MINI SHOT ACC. 5 LEDS M.FLOOD WW GRIS
MINI SHOT ACC. 10 LEDS M.FLOOD NW GRIS
MINI SHOT ACC. 10 LEDS M.FLOOD WW GRIS
MODULO MULTISPACE 2XCDM-R111 35W BL.
MODULO MULTISPACE 2XCDM-R111 70W BL.
APLIQUE MULTISPACE 2XQR-111 100W BL.
APLIQUE MULTISPACE 2XCDM-R111 35W BL.
APLIQUE MULTISPACE 2XCDM-R111 70W BL.
APLI. MULTISPACE 2XQR-LEDS WARM WFL BL.
APLI. MULTISPACE 2XQR-LEDS WARM MFL BL.
MOD. MULTISPACE 2XQR-LEDS WARM WFL BL.
MOD. MULTISPACE 2XQR-LEDS WARM MFL BL.
REJILLA PROTECCION HI-LUX
REJILLA PROTECCION HI-LUX EMPOTRAR
SOPORTE TECHO HI-LUX TC-L
SOPORTE TECHO HI-LUX T5- HIT/HST
HI LUX EMP. HIT/HST 150W EXT IP64 BL.
HI LUX EMP. HIT/HST 250W EXT IP64 BL.
HI-LUX HIT E-40 150W EXT IP64
HI-LUX HIT E-40 250W EXT IP64
HI-LUX T5-HO 2X28/54W EXT IP64
HI-LUX T5-HO 2X35/49/80W EXT IP64
HI-LUX T5-VHO 2X95W EXT IP64
HI-LUX T5-VHO 2X120W EXT IP64
HI-LUX T5-HO 2X28/54W INT IP64
HI-LUX T5-HO 2X35/49/80W INT IP64
HI-LUX T5-VHO 2X95W INT IP64
HI-LUX T5-VHO 2X120W INT IP64
HI-LUX T5 HE-HO 2X28/54W EXT IP43 BL.
HI-LUX T5 HE-HO 2X35/49/80W EXT IP43 BL.
HI-LUX T5 VHO 2X95W EXT IP43 BL.
HI-LUX T5 VHO 2X120W EXT IP43 BL.
HI-LUX T5 HE-HO 2X28/54W INT IP43 BL.
HI-LUX T5 HE-HO 2X35/49/80W INT IP43 BL.
HI-LUX T5 VHO 2X95W INT IP43 BL.
HI-LUX T5 VHO 2X120W INT IP43 BL.
HI-LUX TC-L 4X55W EXT IP64
HI-LUX TC-L 4X80W EXT IP64
HI-LUX TC-L 4X55W INT IP64
HI-LUX TC-L 4X80W INT IP64
HI-LUX TC-L 4X55W EXT IP43 BL.
HI-LUX TC-L 4X80W EXT IP43 BL.
HI-LUX TC-L 4X55W INT IP43 BL.
HI-LUX TC-L 4X80W INT IP43 BL.
LUM. APLI-FLAT QT-DE 300W BL.
ACC. PERFIL FLAT L.C. BL
ACC. UNION CODO 90 FLAT BL.
ACC. UNION 90 LUM. FLAT BL.
ACC. UNION "T" LUM. FLAT BL.
ACC. UNION CRUZ LUM. FLAT BL.
ACC. TAPA FINAL FLAT BL.
LUM. APLI-FLAT TC-L 14/24W BL.
LUM. APLI-FLAT TC-L 55W BL.
LUM. FLAT L.C. 2X28/54W BL
LUM. FLAT L.C. 2X35/49/80W BL
LUM. APLI-FLAT L.C. 2X28/54W BL
LUM. APLI-FLAT L.C. 2X35/49/80W BL
FLAT L.C. 2X28/54W + 2 PROY. QR-70 50W BL.
FLAT L.C. 2X35/49/80W + 2 PROY. QR-70 50W BL.
LUM. FLAT SHOW 3X28/54W RGB
LUM. APLI-FLAT SHOW 3X28/28/54W RGB
PROYECTOR BASE TWIN PAR20 50W
PROYECTOR BASE TWIN PAR30 75W
PROYECTOR CARRIL TWIN PAR20 50W
PROYECTOR CARRIL TWIN PAR30 75W
LUM. PENDULAR TWIN PAR 20 BASE
LUM. PENDULAR TWIN PAR 30 BASE
PROYECTOR BASE TWIN QR-111
PROY. TWIN BASE CDM-R111 35W GR./E
PROYECTOR TWIN BASE CDM-R111 70W
TWIN BASE QR-LEDS WARM WFL GR.
TWIN BASE QR-LEDS WARM MFL GR.
PROYECTOR CARRIL TWIN QR-111
PROY. TWIN CARRIL CDM-R111 35W GR./E
PROYECTOR TWIN CARRIL CDM-R111 70W
TWIN CARRIL QR-LEDS WARM WFL GR.
TWIN CARRIL QR-LEDS WARM MFL GR.
PROYECTOR BASE TWIN 2X QR-111
PROYECTOR BASE TWIN 2X35W CDM-R111
371,00
371,00
179,50
414,50
394,50
394,50
82,00
36,00
87,50
37,00
88,00
37,00
144,00
152,00
155,50
412,50
412,50
412,50
412,50
652,50
652,50
541,50
541,50
541,50
541,50
412,50
608,50
584,00
613,50
607,50
630,00
450,50
35,50
95,50
90,00
119,50
72,00
94,00
58,00
89,00
79,00
685,50
711,50
865,00
865,00
865,00
865,00
1996,00
257,00
257,00
259,00
259,00
168,00
168,00
249,50
249,50
250,50
250,50
160,00
160,00
290,00
290,00
385,00
385,00
290,00
290,00
385,00
385,00
282,00
282,00
377,00
377,00
282,00
282,00
377,00
377,00
364,00
364,00
171,00
363,50
363,50
350,00
350,00
350,00
350,00
34,00
34,00
44,00
40,00
550,00
560,00
418,50
419,50
413,00
513,00
491,50
557,00
413,00
513,00
491,50
557,00
328,00
394,50
389,00
435,00
328,00
394,50
389,00
435,00
462,50
510,50
462,50
510,50
375,00
423,50
375,00
423,50
146,50
82,00
59,50
42,50
48,50
76,00
16,00
220,00
235,00
278,00
342,50
357,50
434,00
480,00
506,50
771,00
822,00
85,50
86,00
124,00
125,00
35,00
35,50
89,50
225,50
225,50
196,00
196,00
142,00
259,00
259,00
221,00
221,00
136,00
374,00

54
54
54
55
54
54
164
164
164
164
164
164
164
164
164
192
192
192
192
193
193
193
193
193
193
192
194
194
194
194
194
193
188
194
194
193
193
192
192
191
190
192
193
191
191
191
191
191
188
188
188
188
188
188
188
188
188
188
188
188
190
190
190
190
190
190
190
190
190
190
190
190
190
190
190
190
93
93
61
61
61
61
61
93
93
146
146
145
145
146
146
146
146
145
145
145
145
145
145
145
145
144
144
144
144
144
144
144
144
145
145
145
145
144
144
144
144
66
99
67
67
99
99
67
66
66
98
98
67
67
98
98
98
67
55
55
55
55
36
36
54
55
55
54
54
54
55
55
54
54
54
55
72 FLAT
73 TWIN
74 POINT
75 SHOT
71 HI-LUX
230
,QIRUPDFLyQ
REF. / PAG.
Codigo Plazo Descripcin Euros Pg. Codigo Plazo Descripcin Euros Pg.
7605000
7605003
7605013
7605100
7605103
7605200
7605203
7605210
7605213
7605220
7605223
7605230
7605233
7605500
7605503
7605510
7605513
7606400
7606403
7606423
7641170
7641173
7641180
7641183
7641190
7641193
7641300
7641303
7641310
7641313
7641320
7641323
7641703
7641743
7642000
7642003
7642010
7642013
7642020
7642023
7642030
7642033
7642040
7642043
7642050
7642053
7642110
7642113
7642120
7642123
7642200
7642203
7642210
7642213
7642220
7642223
7642500
7642503
7642510
7642513
7642520
7642523
7642530
7642533
7642540
7642543
7642550
7642553
7642610
7642613
7642620
7642623
7642703
7642743
7802300
7802310
7802320
7841050
7841052
7841060
7841062
7842000
7842002
7842010
7842012
7842020
7842022
7842030
7842032
7842040
7842042
7842300
7842310
7842320
7901200
7901203
7901300
7901303
7901600
7901603
7901700
7901703
7941000
7941003
7941010
7941013
7941030
7941033
7941040
7941043
7941100
7941103
7941110
7941113
7941210
7941213
7941220
7941223
7941230
7941233
7941240
7941243
7941250
7941253
7941260
7941263
7941270
7941273
7941280
7941283
7941290
7941293
7941310
7941313
7941320
7941323
7941330
7941333
7941340
7941343
7941350
7941353
7941360
7941363
7941370
7941373
7941380
7941383
7941390
7941393
7941610
7941613
7941620
7941623
7941710
EXTRAPLANA ASIM. T5 HE-HO 1X28/54W BL.
EXTRAPLANA ASIM. T5 HE-HO 1X28/54W NG.
EXTRAPLANA ASIM. T5 HE-HO 1X35/49/80 BL.
EXTRAPLANA ASIM. T5 HE-HO 1X35/49/80 NG.
EXTRAPLANA DIR. BLUM T5 2X28/54W BL.
EXTRAPLANA DIR. BLUM T5 2X28/54W NG.
EXTRAPLANA DIR. BLUM T5 2X35/49/80W BL.
EXTRAPLANA DIR. BLUM T5 2X35/49/80W NG.
EXTRAPLANA T5 2X14/24W BL.
EXTRAPLANA T5 2X14/24W NG.
EXTRAPLANA T5 2X28/54W BL.
EXTRAPLANA T5 2X28/54W NG.
EXTRAPLANA T5 2X35/49/80W BL.
EXTRAPLANA T5 2X35/49/80W NG.
EXTRAPLANA 2X18W V-BRILLO /E
EXTRAPLANA 2X36W V-BRILLO /E
EXTRAPLANA 2X58W V-BRILLO /E
PROY. AVANT-145 BASE PAR 30 BL.
PROY. AVANT-145 BASE PAR 30 GR.
PROY. AVANT-145 CARRIL PAR 30 BL.
PROY. AVANT-145 CARRIL PAR 30 GR.
PROY. AVANT-LINEAL BASE QT-DE 150W BL.
PROY. AVANT-LINEAL BASE QT-DE 150W GR.
PROY. AVANT-LINEAL CARRIL QT-DE 150W BL.
PROY. AVANT-LINEAL CARRIL QT-DE 150W GR.
PROY. AVANT-80 BASE LED WW 24 BL.
PROY. AVANT-80 BASE LED WW 24 GR.
PROY. AVANT-80 BASE 1X QR-CBC51 BL.
PROY. AVANT-80 BASE 1X QR-CBC51 GR.
PROY. AVANT-80 BASE LED WW 36 BL.
PROY. AVANT-80 BASE LED WW 36 GR.
PROY. AVANT-80 CARRIL LED WW 36 BL.
PROY. AVANT-80 CARRIL LED WW 36 GR.
PROY. AVANT-80 CARRIL LED WW 24 BL.
PROY. AVANT-80 CARRIL LED WW 24 GR.
PROY. AVANT-80 CARRIL 1X QR-CBC51 BL.
PROY. AVANT-80 CARRIL 1X QR-CBC51 GR.
AVANT-145 BASE QR-LEDS WARM 40 BL.
AVANT-145 BASE QR-LEDS WARM 40 GR.
PROY. AVANT-145 BASE QR-111 100W BL
PROY. AVANT-145 BASE QR-111 100W GR.
PROY. AVANT-145 BASE QT-12 100W EXT. BL
PROY. AVANT-145 BASE QT-12 100W EXT. GR.
PROY. AVANT-145 BASE CDM-TM 20W BL.
PROY. AVANT-145 BASE CDM-TM 20W GR.
PROY. AVANT-145 BASE HIT-TC 70W EXT. BL
PROY. AVANT-145 BASE HIT-TC 70W EXT. GR.
PROY. AVANT-145 BASE HIT-TC 70W INT. BL.
PROY. AVANT-145 BASE HIT-TC 70W INT. GR.
PROY. AVANT-145 BASE CDM-R111 35W BL.
PROY. AVANT-145 BASE CDM-R111 35W GR.
PROY. AVANT-145 BASE CDM-R111 1X70W BL.
PROY. AVANT-145 BASE CDM-R111 1X70W GR.
AVANT-145 BASE QR-LEDS WARM 24 BL.
AVANT-145 BASE QR-LEDS WARM 24 GR.
AVANT-145 CARRIL QR-LEDS WARM 40 BL.
AVANT-145 CARRIL QR-LEDS WARM 40 GR.
PROY. AVANT-145 CARRIL QR-111 100W BL
PROY. AVANT-145 CARRIL QR-111 100W GR.
PROY. AVANT-145 CARRIL QT-12 100W EXT.BL
PROY. AVANT-145 CARRIL QT-12 100W EXT.GR
PROY. AVANT-145 CARRIL CDM-TM 20W BL.
PROY. AVANT-145 CARRIL CDM-TM 20W GR.
PROY. AVANT-145 CARRIL HIT-TC 70W EXT.BL
PROY. AVANT-145 CARRIL HIT-TC 70W EXT.GR
PROY. AVANT-145 CARRIL HIT-TC 70W INT.BL
PROY. AVANT-145 CARRIL HIT-TC 70W INT.GR
PROY. AVANT-145 CARRIL CDM-R111 35W BL
PROY. AVANT-145 CARRIL CDM-R111 35W GR.
PROY. AVANT-145 CARRIL CDM-R111 70W BL.
PROY. AVANT-145 CARRIL CDM-R111 70W GR.
AVANT-145 CARRIL QR-LEDS WARM 24 BL.
AVANT-145 CARRIL QR-LEDS WARM 24 GR.
PROY. AVANT-LINEAL BASE HIT-DE 70W BL.
PROY. AVANT-LINEAL BASE HIT-DE 70W GR.
PROY. AVANT-LINEAL BASE HIT-DE 150W BL.
PROY. AVANT-LINEAL BASE HIT-DE 150W GR.
PROY. AVANT-LINEAL CARRIL HIT-DE 70W BL.
ACC. PERFIL FILMED (X/MTS) BL.
ACC. PERFIL FILMED (X/MTS) GR.
ACC. PERFIL FILMED EMPOTRAR (X/MTS) GR.
ACC. PFL. TAPA FILMED (X/MTS) BL.
ACC. PFL. TAPA FILMED (X/MTS) GR.
ACC. UNION CODO 90 FILMED BL.
ACC. UNION CODO 90 FILMED GR.
ACC. UNION CODO 90 FILMED EMPOTRAR BL.
ACC. UNION CODO 90 FILMED EMPOTRAR GR.
ACC. UNION CRUZ FILMED BL.
ACC. UNION CRUZ FILMED GR.
ACC. UNION "T" FILMED BL.
ACC. UNION "T" FILMED GR.
ACC. MODULO GIRATORIO INTERMEDIO FILMED
ACC. MODULO GIRATORIO INTERMEDIO FILMED
ACC. 2 MODULOS GIRATORIOS FINALES FILMED
ACC. 2 MODULOS GIRATORIOS FINALES FILMED
TAPA FINAL FILMED BLANCO
TAPA FINAL FILMED GRIS
TAPA FINAL FILMED EMPOTRADO GRIS
FILMED 1X14/14/24W BLUM BL.
FILMED 1X14/14/24W BLUM GR.
FILMED 1X28/28/54W BLUM BL.
FILMED 1X28/28/54W BLUM GR.
FILMED 1X35/49/35/49/80W BLUM BL.
FILMED 1X35/49/35/49/80W BLUM GR.
FILMED 1X14/24W ASIM. BL.
FILMED 1X14/24W ASIM. GR.
FILMED 1X28/54W ASIM. BL.
FILMED 1X28/54W ASIM. GR.
FILMED 1X35/49/80W ASIM BL.
FILMED 1X35/49/80W ASIM GR.
MOD-B FILMED 1X50W QR-70 50W
MOD-C FILMED 1 PROY. TWIN CDMR-111 35W
FILMED FINAL 2X14/24W OPAL TRESBOLILLO BL.
FILMED FINAL 2X14/24W OPAL TRESBOLILLO GR.
FILMED FINAL 2X28/54W OPAL TRESBOLILLO BL.
FILMED FINAL 2X28/54W OPAL TRESBOLILLO GR.
FILMED FINAL 2X35/49/80W OPAL TRESBOLILLO BL.
FILMED FINAL 2X35/49/80W OPAL TRESBOLILLO GR.
FILMED INDIVIDUAL 2X14/24W OPAL BL.
FILMED INDIVIDUAL 2X14/24W OPAL GR.
FILMED INDIVIDUAL 2X28/54W OPAL BL.
FILMED INDIVIDUAL 2X28/54W OPAL GR.
FILMED INDIVIDUAL 2X35/49/80W OPAL BL.
FILMED INDIVIDUAL 2X35/49/80W OPAL GR.
FILMED INTER 2X28/54W OPAL TRESBOLILLO BL.
FILMED INTER 2X28/54W OPAL TRESBOLILLO GR.
FILMED INTER 2X35/49/80W OPAL TRESBOLILLO BL.
FILMED INTER 2X35/49/80W OPAL TRESBOLILLO GR.
FILMED 2X14/24W BLUM BL.
FILMED 2X14/24W BLUM GR.
FILMED 2X28/54W BLUM BL.
FILMED 2X28/54W BLUM GR.
FILMED 2X35/49/80W BLUM BL.
FILMED 2X35/49/80W BLUM GR.
FILMED EMP.FINAL TRESBOLILLO 2X14/24W BL.
FILMED EMP.FINAL TRESBOLILLO 2X14/24W GR.
FILMED EMP. FINAL TRESBOLILLO 2X28/54W BL.
FILMED EMP. FINAL TRESBOLILLO 2X28/54W GR.
FILMED EMP. FINAL TRESBOLILLO 2X35/49/80W BL.
FILMED EMP. FINAL TRESBOLILLO 2X35/49/80W GR.
FILMED INDIVIDUAL EMPOTR. 2X14/24W OPAL BL.
FILMED INDIVIDUAL EMPOTR. 2X14/24W OPAL GR.
FILMED INDIVIDUAL EMPOTR. 2X28/54W OPAL BL.
FILMED INDIVIDUAL EMPOTR. 2X28/54W OPAL GR.
FILMED INDIVIDUAL EMPOTR. 2X35/49/80W OPAL BL.
FILMED INDIVIDUAL EMPOTR. 2X35/49/80W OPAL GR.
FILMED EMPOTR. INTERM. TRESBOL. 2X28/54W BL
FILMED EMPOTR. INTERM. TRESBOL. 2X28/54W GR
FILMED EMPOTR. INTERM. TRESBOL. 2X35/49/80W BL
FILMED EMPOTR. INTERM. TRESBOL. 2X35/49/80W GR
MOD-D FILMED 2X50W QR-70 50W GR.
MOD-C FILMED 2 PROY. TWIN CDMR-111 35W
EXTRAPLANA 2X18W V-BRILLO
EXTRAPLANA 2X36W V-BRILLO
EXTRAPLANA 2X58W V-BRILLO
120,00
120,00
123,00
123,00
168,00
168,00
180,00
180,00
102,00
102,00
119,50
119,50
122,50
122,50
115,00
124,00
145,00
110,00
110,00
154,50
154,50
173,00
173,00
213,00
213,00
175,50
175,50
92,50
92,50
175,50
175,50
223,00
223,00
223,00
223,00
152,00
152,00
249,00
249,00
175,50
175,50
196,00
196,00
309,50
309,50
320,50
320,50
320,50
320,50
269,50
269,50
269,50
269,50
249,00
249,00
296,00
296,00
219,50
219,50
258,50
258,50
359,00
359,00
365,00
365,00
361,50
361,50
321,50
321,50
321,50
321,50
296,00
296,00
313,00
313,00
338,00
338,00
358,00
63,50
63,50
73,50
16,00
16,00
30,00
30,00
31,50
31,50
42,50
42,50
37,00
37,00
99,00
99,00
119,50
119,50
12,50
12,50
12,50
193,00
193,00
264,00
264,00
302,00
302,00
145,50
145,50
188,00
188,00
220,50
220,50
80,50
223,50
166,00
166,00
219,00
219,00
287,00
287,00
156,50
156,50
209,00
209,00
270,00
270,00
219,00
219,00
287,00
287,00
203,00
203,00
274,50
274,50
312,00
312,00
199,00
199,00
246,00
246,00
286,50
286,50
161,50
161,50
218,00
218,00
281,00
281,00
246,00
246,00
286,50
286,50
138,50
371,50
78,50
94,00
122,00

111
111
111
111
111
111
111
111
111
111
111
111
111
111
110
110
110
45
45
45
45
47
47
47
47
44
44
44
44
44
44
44
44
44
44
44
44
45
45
45
45
45
45
46
46
46
46
46
46
46
46
46
46
45
45
45
45
45
45
45
45
46
46
46
46
46
46
46
46
46
46
45
45
47
47
47
47
47
83
83
88
83
83
83
83
86
86
83
83
83
83
84
84
84
84
83
83
88
82
82
82
82
82
82
82
82
82
82
82
82
89
89
81
81
81
81
81
81
81
81
81
81
81
81
81
81
81
81
82
82
82
82
82
82
86
86
86
86
86
86
87
87
87
87
87
87
86
86
86
86
89
89
110
110
110
78 EXTRAPLANA
79 AVANT
76 FILMED
231
,QIRUPDFLyQ
REF. / PAG.
Codigo Plazo Descripcin Euros Pg. Codigo Plazo Descripcin Euros Pg.
7941713
7941720
7941723
7942020
7942023
7942120
7942123
7942270
7942273
7942370
7942373
8100013
8101003
8101013
8101023
8101053
8101063
8101073
8101083
8101093
8101103
8101203
8101213
8101223
8101233
8101243
8101253
8101263
8101273
8101323
8101333
8101343
8101353
8101363
8101373
8101383
8101433
8101443
8101453
8101463
8101473
8101483
8101493
8141033
8141043
8141153
8141283
8141293
8141303
8141313
8141393
8141403
8141413
8141423
8141503
8141513
8141523
8141533
8141543
8141553
8141563
8141573
8202000
8202010
8202030
8203280
8203480
8203490
8204000
8204010
8204100
8204110
8242000
8242010
8242030
8243280
8243480
8243490
8243500
8244000
8244010
8244040
8244100
8244110
8244600
8303240
8303250
8303270
8303280
8303420
8303430
8303580
8303600
8343240
8343250
8343270
8343280
8343420
8343430
8343580
8343600
8401513
8401523
8401533
8401543
8401553
8401563
8401573
8401583
8401733
8401743
8401753
8401763
8401773
8401783
8401793
8405000
8405010
8405020
8405030
8405040
8405050
8406002
8406012
8406023
8406033
8407203
8407413
8407423
8407433
8407443
8447323
8447353
8447373
8502250
8502270
8503000
8503010
8503020
8503030
8503040
8505130
8505160
8505180
8505220
8505410
8505470
8505480
8505490
8506440
8507500
8507510
LUM. HERMETICA 4X36W /E V-BRILLO (2 REG)
LUM. HERMETICA 4X14/24W T-VIS 60X60 V-BR
LUM. HERMETICA 4X18W /E OPAL (1REG.)
LUM. HERMETICA 4X18W /E V-BRILLO (1REG.)
HERMETICA 4X14W EQ. DESMONTABLE V-BR
LUM. HERMETICA 4X36W /E OPAL (1REG.)
LUM. HERMETICA 4X36W /E V-BRILLO (1REG.)
LUM. HERMETICA 4X14/24W T-VIS 60X60 OPAL
STYLAMP 2X36W V-BRILLO
STYLAMP 2X58W V-BRILLO
STYLAMP 2X36W BLUM
STYLAMP 2X58W BLUM
STYLAMP 4X18W V-BRILLO
STYLAMP 4X18W BLUM
STYLAMP 4X36W V-BRILLO
STYLAMP 4X36W BLUM
STYLAMP 2X36W V-BRILLO /E
STYLAMP 2X58W V-BRILLO /E
STYLAMP 2X36W BLUM /E
STYLAMP 2X58W BLUM /E
STYLAMP 4X18W V-BRILLO /E
STYLAMP 4X18W BLUM /E
STYLAMP 4X36W V-BRILLO /E
STYLAMP 4X36W BLUM /E
FLASH-4 HIT-DE 150W SIM.
FLASH-4 HIT-DE 70W SIM.
FLASH-4 HIT-DE 150W ASIM.
FLASH-4 HIT-DE 70W ASIM.
FLASH-5 HIT 400W 4,5KV E40 SIM.
FLASH-5 HIT/HST 250W 4,5KV E40 SIM
FLASH-5 HST- 400W SIM.
FLASH-5 HME 250W. SIM.
FLASH-5 HIT/HST 250W 4,5KV E40 ASIM
FLASH-5 HIT 400W 4,5KV E40 ASIM.
FLASH-5 HST 400W ASIM.
FLASH-5 HIT 250W 0,6KV E40 SIM
FLASH-5 HIT 400W 0,6KV E40 SIM.
FLASH-5 HIT 250W 0,6KV E40 ASIM
FLASH-5 HIT 400W 0,6KV E40 ASIM.
ACC. REFLECTOR MINI-YES METALIZADO MATE
ACC. DIFUSOR MINI-YES GLASEADO
ACC. REFLECTOR Y DIF. IND. MINI-YES
ACC. CRISTAL TRANSPARENTE M-YES
ACC. CRISTAL SEMI-OPAL M-YES
ACC. CRISTAL OPAL M-YES
ACC. ALETAS ANTIDESLUMBRANTE FLASH 4
ACC. ALETAS ANTIDESLUMBRANTES FLASH5
ACC. REJILLA PROTECCION FLASH5
ACC. REJILLA PROTECCION FLASH 4
LUM. PENDULAR MINI-YES E-27 (S)
LUM. PENDULAR MINI-YES HIE 70W
LUM. PENDULAR MINI-YES HIE 150W
LUM. PENDULAR MINI-YES HIT 70W G12
LUM. PENDULAR MINI-YES HIT 150W G12
LUM. PENDULAR MINI-YES TC-TE 26/32/42W
LUM. PENDULAR MINI-YES TC-TE 57W
LUM. PENDULAR MINI-YES TC-TE 70W
APLIQUE-HOL 2X18W PCAR. CON TIRADOR BL
APLIQUE HOL 2X18W PCAR. S/TIRADOR BL
LUM. BASICA HOSPITAL 3X18W
LUM. HOSPITAL PARA PERSONALIZAR
CUERPO CLINIC PARA PERSONALIZAR 14/24W
CUERPO CLINIC PARA PERSONALIZAR 28/54W
CUERPO CLINIC GASES PARA PERSONALIZAR
ACC. TAPA PARA 2 TOMA GAS MEDIC. BL.TEXT
ACC. TAPA PARA 1 TOMA GAS MEDIC. BL.TEXT
ACC. TAPA PARA 3 TOMA GAS MEDIC. BL.TEXT
UNION CODO 90 CANAL GAS
PERFIL CANAL ELECTRICO HOSPITAL 1 MTS.
PERFIL CANAL GASES MEDICINALES 1 MT
PERFIL CANAL GASES MEDICINALES 2 MTS
PERFIL CANAL GASES MEDICINALES 3 MTS
TAPA FINAL CANAL ELECT. HOSPITAL
ACC. SOP. SIMPLE MECANISMOS CLINIC BL
ACC. FIJACION LUM. HOSPITAL DIRECTA
PROY. AVANT-LINEAL CARRIL HIT-DE 70W GR.
PROY. AVANT-LINEAL CARRIL HIT-DE 150W BL
PROY. AVANT-LINEAL CARRIL HIT-DE 150W GR
PROY. AVANT-80 BASE 2X QR-CBC51 BL.
PROY. AVANT-80 BASE 2X QR-CBC51 GR.
PROY. AVANT-80 CARRIL 2X QR-CBC51 BL.
PROY. AVANT-80 CARRIL 2X QR-CBC51 GR.
PROY. AVANT-145 BASE CDM-R111 2X35W BL.
PROY. AVANT-145 BASE CDM-R111 2X35W GR.
PROY. AVANT-145 CARRIL CDM-R111 2X35W BL
ROY. AVANT-145 CARRIL CDM-R111 2X35W GR
BRAZO A PARED SMAP 1 METRO GRIS
LUMINARIA SMAP VIAL HIT G12 35W GRIS
LUMINARIA SMAP VIAL HIT G12 70W GRIS
LUMINARIA SMAP VIAL HIT G12 150W GRIS
LUMINARIA SMAP VIAL HST-DE RX7S 70W GRIS
LUMINARIA SMAP VIAL HST-DE RX7S 150W GRI
PROYECTOR SMAP SPOT HIT G12 70W GRIS
PROYECTOR SMAP MEDIUM HIT G12 70W GRIS
PROYECTOR SMAP SPOT HIT G12 150W GRIS
PROYECTOR SMAP MEDIUM HIT G12 150W GR.
NIU ROTOSIM. HIT G12 35W CLASE I GR.
NIU ROTOSIM. HIT G12 70W CLASE I GR.
NIU ROT. HST-DE/HIT-DE RX7s 70W CL. I GR
NIU ROT. HST-DE/HIT-DE RX7s 150W CL.I GR
NIU ROTOSIM. HIT G12 35W CLASE II GR.
NIU ROTOSIM. HIT G12 70W CLASE II GR.
NIU ROT. HST-DE/HIT-DE 70W CL. II GR.
NIU ROT. HST-DE/HIT-DE 150W CL. II GR.
NIU VIAL HIT G12 35W CLASE I GR.
NIU VIAL HST 50W E27 CLASE I GR.
NIU VIAL HIT/HST 70W E27 CL. I GR.
NIU VIAL HST 100W E40 CL.I GR.
NIU VIAL HIT/HST 150W E40 CL. I GR.
NIU VIAL HST 100W E40 2N CL.I GR.
NIU VIAL HIT/HST 150W E40 2N CL. I GR.
NIU VIAL HIT G12 35W CLASE II GR.
NIU VIAL HST 50W E27 CLASE II GR.
NIU VIAL HIT/HST 70W E27 CL. II GR.
NIU VIAL HST 100W E40 CL.II GR.
NIU VIAL HIT/HST 150W E40 CL. II GR.
NIU VIAL HST 100W E40 2N CL.I GR.
NIU VIAL HIT/HST 150W E40 2N CL. II GR.
LUMINARIA SMAP VIAL CPO-T PGZ12 60W GRIS
LUMINARIA SMAP VIAL CPO-T PGZ12 140W GR.
LUMINARIA SMAP LED NEUTRAL 80W VIAL GRIS
NIU VIAL CPO-T 45W CLASE I GR.
NIU VIAL CPO-T 60W CLASE I GR.
NIU VIAL CPO-T 90W CLASE I GR.
NIU VIAL CPO-T 140W CLASE I GR.
NIU VIAL CPO-T 45W CLASE II GR.
NIU VIAL CPO-T 60W CLASE II GR.
NIU VIAL CPO-T 90W CLASE II GR.
NIU VIAL CPO-T 140W CLASE II GR.
NIU LED ROTOSIM. 24 LEDS CLASE I GR.
NIU LED ROTOSIM. 48 LEDS CLASE I GR.
NIU LED ROTOSIM. 24 LEDS CLASE II GR.
NIU LED ROTOSIM. 48 LEDS CLASE II GR.
NIU LED VIAL 24 LEDS CLASE I GR.
NIU LED VIAL 48 LEDS CLASE I GR.
NIU LED VIAL 24 LEDS CLASE II GR.
NIU LED VIAL 48 LEDS CLASE II GR.
LUM. HERMETICA 2X36W OPAL (1REG.)
LUM. HERMETICA 2X36W V-BRILLO (1REG.)
LUM. HERMETICA 2X58W OPAL (1REG.)
LUM. HERMETICA 2X36W V-BRILLO (2 REG.)
LUM. HERMETICA 4X18W V-BRILLO (2 REG.)
LUM. HERMETICA 4X36W V-BRILLO (2 REG.)
LUM. HERMETICA 4X18W OPAL (1REG.)
LUM. HERMETICA 4X18W V-BRILLO (1REG.)
LUM. HERMETICA 4X36W OPAL (1REG.)
LUM. HERMETICA 4X36W V-BRILLO (1REG.)
LUM. HERMETICA 2X36W /E OPAL (1REG.)
LUM. HERMETICA 2X36W /E V-BRILLO (1REG.)
LUM. HERMETICA 2X58W /E OPAL (1REG.)
LUM. HERMETICA 2X36W /E V-BRILLO (2 REG)
LUM. HERMETICA 4X18W /E V-BRILLO (2 REG)
641,50
426,00
281,50
358,50
475,50
382,00
539,50
353,00
115,00
166,50
163,00
206,50
119,00
148,50
162,50
265,00
133,00
168,50
173,00
216,00
154,50
189,00
209,50
295,50
119,00
109,00
119,00
109,00
160,00
162,50
162,50
117,50
162,50
160,00
186,00
162,50
160,00
162,50
160,00
47,00
31,50
50,50
33,00
37,00
35,00
69,00
80,50
36,50
27,00
30,00
100,50
113,50
106,50
120,00
97,50
111,50
124,00
165,00
153,50
247,00
281,00
285,50
320,00
480,50
11,00
6,50
14,00
31,50
111,50
67,50
118,50
173,00
16,00
17,00
16,00
358,00
391,00
391,00
142,00
142,00
175,50
175,50
480,00
480,00
520,00
520,00
163,00
396,00
396,00
412,00
362,50
401,00
405,00
405,00
408,00
408,00
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
551,50
579,00
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
279,50
363,50
370,50
448,00
421,00
622,50
259,50
340,50
364,00
519,00
296,00
381,50
362,00
466,50
438,50

140
140
141
140
140
141
140
141
120
120
120
120
120
120
120
120
120
120
120
120
120
120
120
120
198
198
198
198
199
199
199
199
199
199
199
199
199
199
199
39
39
39
39
39
39
198
199
199
198
38
38
38
38
38
38
38
38
139
73
137
137
129
129
130
130
130
130
138
138
138
138
138
138
138
135
47
47
47
44
44
44
44
46
46
46
46
205
204
204
204
204
204
204
204
204
204
202
202
202
202
202
202
202
202
202
202
202
202
202
202
202
202
202
202
202
202
202
202
204
204
204
202
202
202
202
202
202
202
202
203
203
203
203
203
203
203
203
141
140
141
140
140
140
141
140
141
140
141
140
141
140
140
81 SMAP
82 HERMETICA
83 STYLAMP
84 FLASH
84 MINI YES
85 HOSPITAL / MURAL / CLINIC
232
,QIRUPDFLyQ
REF. / PAG.
Codigo Plazo Descripcin Euros Pg. Codigo Plazo Descripcin Euros Pg.
8507520
8507530
8507800
8507810
8507820
8507840
8507850
8507860
8507870
8507880
8507890
8507900
8507910
8507920
8507930
8507990
8508097
8508107
8508117
8508880
8508890
8541010
8541020
8541110
8541120
8542010
8542020
8542110
8542120
8542240
8542260
8542270
8542330
8544010
8544020
8547940
8547950
8547960
8547970
8547980
8548060
8548940
8600500
8600513
8600523
8600533
8601002
8601022
8601042
8601102
8601122
8601142
8601162
8601203
8601223
8601243
8601263
8601990
8601993
8601994
8602002
8602022
8602042
8602990
8602993
8602994
8603002
8603022
8603042
8604002
8604022
8604042
8604840
8604843
8604844
8604850
8604853
8604854
8604990
8604993
8604994
8606120
8606123
8606140
8606143
8606150
8606160
8640600
8640610
8640630
8640640
8640650
8640660
8640680
8640690
8640700
8640720
8640730
8640740
8640750
8640760
8640770
8641303
8641323
8641343
8641363
8680600
8680610
8680620
8680640
8680650
8680670
8680680
8680690
8680710
8680720
8680730
8700010
8700013
8700110
8700113
8700210
8700213
8700313
8700613
8700710
8700713
8706205
8706405
8706407
8706408
8740030
8740033
8740130
8740133
8740230
8740233
8740730
8740733
8741000
8741010
8741020
8801000
8801003
8801010
8801013
8801020
8801023
8801030
8801033
8801900
8801903
8801910
8801913
8801920
MARCO 2X2 ELEMENTOS BL.
MARCO 2X2 ELEMENTOS GR.
MARCO 2X2 ELEMENTOS CR.
ACC. CRISTAL OPAL DOMO BL.
ACC. CRISTAL OPAL DOMO GR.
ACC. CRISTAL TRANSPARENTE DOMO BL.
ACC. CRISTAL TRANSPARENTE DOMO GR.
DIFUSOR INTERIOR DOMO/DOMO TRIMLESS
DIFUSOR INTERIOR DOMO SQUARE
DOMO 10 LEDS WARM WHITE BL.
DOMO 15 LEDS WARM WHITE BL.
DOMO 5 LEDS WARM WHITE BL.
DOMO-TRIMLESS 10 LEDS WARM WHITE BL.
DOMO-TRIMLESS 15 LEDS WARM WHITE BL.
DOMO-TRIMLESS 5 LEDS WARM WHITE BL.
DOMO SQUARE 10 LEDS WARM WHITE BL.
DOMO SQUARE 15 LEDS WARM WHITE BL.
DOMO SQUARE 5 LEDS WARM WHITE BL.
DOMO ASIMETRICO 10 LEDS WARM WHITE BL.
DOMO ASIMETRICO 15 LEDS WARM WHITE BL.
DOMO PROY. 32W M.FLOOD WW BL.
DOMO PROY. 32W FLOOD WW BL.
DOMO PROY. 43W M.FLOOD WW BL.
DOMO PROY. 43W FLOOD WW BL.
PROY. FINE LED SUPERFICIE 1W 70 4200K
PROY. FINE LED SUPERFICIE 1W 10 4200K
PROY. FINE LED SUPERFICIE 1W 30 4200K
PROY. FINE LED SUPERF. 1W 12x30 4200K
DOMO 10 LEDS WW. REG. BL.
DOMO 15 LEDS WW. REG. BL.
DOMO 20 LEDS BL. DINAMICO REG. BL.
DOMO-TRIMLESS 10 LEDS WW. REG. BL.
DOMO-TRIMLESS 15 LEDS WW. REG. BL.
DOMO-TRIMLESS 20 LEDS BL. DIN. REG. BL.
DOMO SQUARE 10 LEDS WW. REG. BL.
DOMO SQUARE 15 LEDS WW. REG. BL.
DOMO SQ. 20 LEDS BL. DINAM. REG. BL.
DOMO ASIMETRICO 10 LEDS WW. REG. BL.
DOMO ASIMETRICO 15 LEDS WW. REG. BL.
APLIQUE PARED SATINA E-27 BL.
APLIQUE PARED SATINA E-27 GR.
LUM. SUPERFICIE SATINA E-27 BL.
LUM. SUPERFICIE SATINA E-27 GR.
LUM. SATINA E-27 PARA SUSP. RIGIDA BL
LUM. SATINA E-27 PARA SUSP. RIGIDA GR
PIE SATINA PAR30/38 75/120W OPAL GR.
LUM. SOBREMESA SATINA E-27 GR.
LUM. SATINA E-27 CON SUSPENSION CABLE BL
LUM. SATINA E-27 CON SUSPENSION CABLE GR
ACC. FILTRO SATINA AZUL
ACC. TAPA DIF. PIE SATINA GRIS / AZUL
ACC. TAPA DIF. PIE SATINA GRIS / AMBAR
ACC. TAPA DIF. PIE SATINA GRIS / ROJO
APLIQUE PARED SATINA TC-D 26/32/42W BL
APLIQUE PARED SATINA TC-D 26/32/42W GR
LUM. SUPERFICIE SATINA TC-D 26/32/42W BL
LUM. SUPERFICIE SATINA TC-D 26/32/42W GR
LUM. SATINA TC-D PARA SUSP. RIGIDA BL
LUM. SATINA TC-D PARA SUSP. RIGIDA GR.
LUM. SATINA TC-D CON SUSPENSION CABLE BL
LUM. SATINA TC-D CON SUSPENSION CABLE GR
TUB T5 HE-HO 14/24W CL.II BL.
TUB T5 HE-HO 28/54W CL.II BL.
TUB T5 HE-HO 35/49/80W CL.II BL.
APLI AMBIENT 1X18W PCAR. BL.
APLI AMBIENT 1X18W PCAR. GR.
APLI AMBIENT 1X36W PCAR. BL.
APLI AMBIENT 1X36W PCAR. GR.
APLI AMBIENT 1X58W PCAR. BL
APLI AMBIENT 1X58W PCAR. GR.
APLI AMBIENT TC-L 36W PCAR. BL
APLI AMBIENT TC-L 36W PCAR. GR.
LINEA CONTINUA AMBIENT 18W PCAR. BL
LINEA CONTINUA AMBIENT 18W PCAR. GR.
LINEA CONTINUA AMBIENT 36W PCAR. BL
LINEA CONTINUA AMBIENT 36W PCAR. GR.
LINEA CONTINUA AMBIENT 58W PCAR. BL
ACC. SOP. DOBLE MECANISMOS CLINIC BL.
$&&6236,03/(0(&$1,6026&$1$/*$6
PROY. EXPLORACION HOSP. E27 MAX 60W BL.
ACC. PULSADOR A DISTANCIA HOSPITAL BL.
ACC. MANDO A DISTANCIA PARA HOSPITAL BL
ACC. MEC. INTERRUPTOR UNIPOLAR BL.
ACC. MEC. INTERRUPTOR UNIPOLAR DOBLE BL
ACC. MEC. CONMUTADOR BL.
ACC. MEC. CONMUTADOR DOBLE BL.
ACC. MEC. BASE SHUCKO BL.
ACC. MEC. PULSADOR CON TIRADOR BL.
ACC. MEC. LUZ VIGILANCIA BL.
ACC. MEC. SALIDA CABLE BL.
ACC. MEC. TELEFONO RJ-11 BL.
ACC. MEC. PLACA CIEGA BL
ACC. MEC. SALIDA DATOS RJ-45 BL.
ACC. MICRO Y ALTAVOZ PARA HOSPITAL
ACC. PULSADOR LLAMADA Y PRESENCIA
ACC. PULSADOR LLAMADA Y PRESENCIA +MANDO
ACC. MEC. BASE SHUCKO FRANCES BL.
ACC. MEC. INTERRUPTOR TIRADOR BL.
ACC. REFLECTOR DIR. CLINIC 1X14/24W
ACC. REFLECTOR DIR. CLINIC 1X28/54W
ACC. REFLECTOR INDIR. CLINIC 1X14/24W
ACC. REFLECTOR INDIR. CLINIC 1X28/54W
ACC. REFLECTOR DIR. CLINIC 2X14/24W
ACC. REFLECTOR DIR. CLINIC 2X28/54W
ACC. REFLECTOR INDIR. CLINIC 2X14/24W
ACC. REFLECTOR INDIR. CLINIC 2X28/54W
APLIQUE-HOL 2X14/24W PCAR. CON TIRADOR
LUM. APLI-HOL 2X14/24W PCAR. S/TIRADOR BL
LUM. APLI-HOL 2X18W PCAR. S/TIRADOR BL.
LUM. IND. ASIM. HOL. 2X55W TC-L 60X60
APLI CLINIC 2X14/24W + 2X14/24W BL
APLI CLINIC 2X14/24W + 1X28/54W BL
ACC. ILUMINACION DIRECTA 2X18W /E
ACC. ILUMINACION DIRECTA 2X14/24W
ACC. ILUMINACION INDIRECTA 1X18W /E
ACC. ILUMINACION INDIRECTA 2X14/24W
ACC. ILUMINACION INDIRECTA 1XTC-L55W
ACC. ILUMINACION INDIRECTA 1XTC-L36W /E
ACC. ILUMINACION DIRECTA 1X18W /E
GRAPA SUJECCION FINE LEDS SUPERFICIE
PERFIL EMPOTRAR FINE LEDS 6W
PERFIL EMPOTRAR FINE LEDS 12W
PERFIL EMPOTRAR FINE LEDS 18W
FINE LEDS HI-DIS. 6W WW EXT.
FINE LEDS HI-DIS. 12W WW EXT.
FINE LEDS HI-DIS. 18W WW EXT.
DOWN. FINE LED FIJO 70 4200K
DOWN. FINE LED FIJO 10 4200K
DOWN. FINE LED FIJO 30 4200K
DOWN. FINE LED FIJO 12x30 4200K
DOWN. FINE LED ORIENTABLE 70 4200K
DOWN. FINE LED ORIENTABLE 10 4200K
DOWN. FINE LED ORIENTABLE 30 4200K
DOWN. FINE LED ORIENTABLE 12x30 4200K
MARCO 1 ELEMENTO BL.
MARCO 1 ELEMENTO GR.
MARCO 1 ELEMENTO CR.
FINE LEDS HI-DIS. 6W WW S-EXT.
FINE LEDS HI-DIS. 12W WW S-EXT.
FINE LEDS HI-DIS. 18W WW S-EXT.
MARCO 2 ELEMENTOS BL..
MARCO 2 ELEMENTOS GR.
MARCO 2 ELEMENTOS CR.
FINE LEDS HI-OUT. 6W NW EXT.
FINE LEDS HI-OUT. 12W NW EXT.
FINE LEDS HI-OUT. 18W NW EXT.
FINE LEDS HI-OUT. 6W NW S-EXT.
FINE LEDS HI-OUT. 12W NW S-EXT.
FINE LEDS HI-OUT. 18W NW S-EXT.
QBYTO VW. FLOOD 4 LEDS C.WHITE BL.
QBYTO VW. FLOOD 4 LEDS C.WHITE GR.
QBYTO VW. FLOOD 4 LEDS C.WHITE CR.
QBYTO VW. FLOOD 4 LEDS W.WHITE BL.
QBYTO VW. FLOOD 4 LEDS W.WHITE GR.
QBYTO VW. FLOOD 4 LEDS W.WHITE CR.
25,50
7,00
416,00
51,00
272,50
16,00
31,00
19,00
35,50
16,00
31,00
37,50
19,50
25,00
9,50
43,50
256,00
122,50
817,00
21,00
51,50
74,50
77,00
77,50
84,00
94,50
94,50
98,00
98,50
235,00
199,00
151,50
232,00
288,00
337,00
80,00
124,50
59,50
100,00
83,00
62,50
76,50
1,50
32,00
36,50
39,00
51,00
75,00
102,00
39,50
39,50
39,50
39,50
50,50
50,50
50,50
50,50
21,50
21,50
21,50
52,50
77,50
105,50
27,00
27,00
27,00
118,00
200,00
289,00
121,50
202,50
293,00
66,00
66,00
66,00
66,00
66,00
66,00
37,50
37,50
37,50
10,50
10,50
9,50
9,50
34,00
34,00
246,00
349,00
180,00
280,00
379,00
212,00
246,00
349,00
180,00
303,00
410,00
289,50
289,50
377,50
377,50
81,50
81,50
81,50
81,50
389,50
566,50
617,00
416,50
590,00
640,50
389,50
566,50
617,00
468,00
649,00
183,50
183,50
183,00
183,00
173,50
173,50
452,50
249,00
246,00
246,00
21,50
60,00
60,00
60,00
214,50
214,50
214,00
214,00
204,50
204,50
280,00
280,00
115,00
170,00
195,00
156,50
156,50
216,00
216,00
252,50
252,50
149,50
149,50
137,50
137,50
195,50
195,50
225,00

30
30
30
6
6
6
6
6
8
6
6
6
6
6
8
8
8
6
7
7
7
7
7
7
32
32
32
32
6
6
6
6
6
6
8
8
8
7
7
62
62
37
37
37
37
62
62
37
37
37
62
62
62
62
62
37
37
37
37
37
37
72
72
72
68
68
68
68
68
68
68
68
69
69
69
69
69
138
138
132
131
131
131
131
131
131
131
131
131
131
131
131
131
131
131
131
131
131
129
129
129
129
129
129
129
129
139
73
139
139
132
132
135
135
135
135
135
135
135
33
33
33
33
33
33
33
32
32
32
32
32
32
32
32
30
30
30
33
33
33
30
30
30
33
33
33
33
33
33
30
30
30
30
30
30
86 FINE LEDS / QBYTO / DOMO
87 SATINA
88 AMBIENT
233
,QIRUPDFLyQ
REF. / PAG.
Codigo Plazo Descripcin Euros Pg. Codigo Plazo Descripcin Euros Pg.
8801923
8801930
8801933
8801940
8801943
8801950
8801953
8806300
8806303
8806310
8806313
8806320
8806323
8806330
8806333
8806340
8806343
8806350
8806353
8806360
8806363
8841030
8841033
8841040
8841043
8841300
8841303
8841310
8841313
8841320
8841323
8841600
8841603
8841610
8841613
8841620
8841623
8841630
8841633
8841640
8841643
8841650
8841653
8842300
8842303
8842310
8842313
8842320
8842323
8842400
8842410
8906300
8906303
8906320
8906350
8906353
8906360
8906363
8906380
8906383
8906400
8906505
8906508
8906600
8908003
8941010
8941013
8941020
8941023
8941030
8941033
8941040
8941043
8941050
8941053
8941060
8941063
8941110
8941113
8941120
8941123
8941130
8941133
8941140
8941143
8941150
8941153
8941160
8941163
9000110
9000120
9000123
9000130
9000133
9000140
9000143
9000200
9000203
9001000
9001010
9001050
9001060
9001070
9001100
9001110
9002640
9002650
9006100
9006103
9006120
9006123
9006130
9006133
9006140
9006143
9006150
9006153
9006170
9006173
9006183
9006200
9006203
9006250
9006253
9041020
9041030
9041040
9041050
9041590
9042240
9042250
9042510
9042520
9042640
9042650
9101013
9101033
9101043
9101643
9102013
9102033
9102043
9106783
9141023
9141053
9142063
9200060
9200063
9200070
9200073
9200120
9200123
9200130
9200133
9200140
PROY. SAT-1 BASE QR-111 100W GRIS
PROY. SAT-1 BASE QR-CBC51 BL.
PROY. SAT-1 BASE QR-CBC51 GRIS
PROY. SAT-1 BASE CDMR-111 35W BL.
PROY. SAT-1 BASE CDMR-111 35W GRIS
PROY. SAT-2 BASE HIT 35W G12 BL.
PROY. SAT-2 BASE HIT 35W G12 GRIS
PROY. SAT-2 BASE HIT 70W G12 BL.
PROY. SAT-2 BASE HIT 70W G12 GR.
PROY. SAT-2 BASE HIT 150W G12 BL
PROY. SAT-2 BASE HIT 150W G12 GRIS
ACC DIF. CRISTAL EXT. EMBELL. MINI KUBIC
ACC. DIF. CRISTAL OPAL MINI-KUBIC BL.
ACC. DIF. CRISTAL OPAL MINI-KUBIC GR.
ACC.DIF. CRIST.SEMI-OPAL MINI-KUBIC BL.
ACC.DIF. CRIST.SEMI-OPAL MINI-KUBIC GR.
ACC. DIF. CRISTAL TRANSP. MINI-KUBIC BL
ACC. DIF. CRISTAL TRANSP. MINI-KUBIC GR.
ACC. MARCO EMBELLECEDOR MINI-KUBIC BL.
ACC. MARCO EMBELLECEDOR MINI-KUBIC GR.
KUBIC HIT/HST-DE 70W SIM. TRANSPARENTE
KUBIC HIT/HST-DE 150W SIM. TRANSPARENTE
KUBIC HIT/HST-DE 70W SIM. OPAL
KUBIC HIT/HST-DE 150W SIM. OPAL
MINI KUBIC 20W TC-TSE E27 9010 BR.
KUBIC HIT/HST-DE 70W ASIM. TRANSPARENTE
KUBIC HIT/HST-DE 150W ASIM. TRANSPARENTE
KUBIC 2X18W G24d-2 AF
KUBIC 2X26W G24d-3 AF
ACC. DIF. DARKLIGHT 4 CELDAS KUBIC BL.
ACC. DIF. DARKLIGHT 4 CELDAS KUBIC GR.
ACC. DIF. CRISTAL OPAL KUBIC IP 54 BL.
ACC. DIF. CRISTAL OPAL KUBIC IP 54 GR.
ACC.DIF. CRIST.SEMI-OPAL KUBIC IP 54 BL.
ACC.DIF. CRIST.SEMI-OPAL KUBIC IP 54 GR.
ACC. DIF. CRISTAL TRANSP. KUBIC IP54 BL
ACC. DIF. CRISTAL TRANSP KUBIC IP 54 GR.
ACC. KUBIC PC TRANSP. IK07 BL.
ACC. KUBIC PC TRANSP. IK07 GR.
ACC. KUBIC PC OPAL IK07 BL.
ACC. KUBIC PC OPAL IK07 GR.
ACC. KUBIC CRISTAL OPAL ESPEJO
ACC. MARCO EMBELLECEDOR KUBIC BL.
ACC. MARCO EMBELLECEDOR KUBIC GR.
DIF.DARKLIGHT 4CEL.+CR. KUBIC IP 54 BL.
DIF.DARKLIGHT 4CEL.+CR. KUBIC IP 54 GR.
MINI KUBIC 13W TC-DE G24-Q1/E 9010 BR.
MINI KUBIC 18W TC-DE G24-Q2/E 9010 BR.
MINI KUBIC 26W TC-TE GX24-Q3/E 9010 BR.
MINI KUBIC 32W TC-TE GX24-Q3 9010 BR.
MINI KUBIC 14W PL-R GR14Q-1/E 9010 BR.
KUBIC 2X18W G24q-2 CLASE II
KUBIC 2X26/32/42W GX24q-3/4 CLASE II
KUBIC 2x14W GR14q-1
KUBIC 2x17W GR14q-1
KUBIC 2X18W GX24q-2
KUBIC 2X26/32/42W GX24q-3/4
NIC-105 DIR. PAR 20 50W E-27 GR
NIC-175 DIR. HIT 35W G12 GR
NIC-175 DIR. HIT 70W G12 GR
NIC-175 SUPERFICIE TC-D 1X26W IP65 GR.
NIC-105 DIR/IND. PAR 20 2X50W E-27 GR
NIC-175 DIR/IND HIT 35W G12 GR
NIC-175 DIR/IND HIT 70W G12 GR
NIC-175 SUPERFICIE HIT 70W G12 IP65 GR.
NIC-175 DIR. TC-TE 26/32/42W GR
NIC 105 DIRECTO 6 LEDS C-WHITE GR.
NIC 105 DIR-IND 12 LEDS C-WHITE GR.
RING FIJO QR-CBC51 12V/50W BL
RING FIJO QR-CBC51 12V/50W GRIS
RING ORIENTABLE 30 QR-CBC51 12V/50W BL
RING ORIENTABLE 30 QR-CBC51 12V/50W GRS
ACC. CRISTAL OPAL MINI-KONIC BL.
ACC. CRISTAL OPAL MINI-KONIC GR.
ACC. CRISTAL SEMI-OPAL MINI-KONIC BL.
ACC. CRISTAL SEMI-OPAL MINI-KONIC GR.
ACC. CRISTAL TRANSPARENTE MINI-KONIC BL.
LINEA CONTINUA AMBIENT 58W PCAR. GR.
LINEA CONTINUA FINAL AMBIENT 18W PCAR.BL
LINEA CONTINUA FINAL AMBIENT 18W PCAR.GR
LINEA CONTNUA FINAL AMBIENT 36W PCAR.BL
LINEA CONTNUA FINAL AMBIENT 36W PCAR.GR.
LINEA CONTINUA FINAL AMBIENT 58W PCAR.BL
LINEA CONTINUA FINAL AMBIENT 58W PCAR.GR
TAPA CIEGA BAADOR AMBIENT T5 14/24 - 55W BL
TAPA CIEGA BAADOR AMBIENT T5 14/24 - 55W GR.
TAPA CIEGA BAADOR AMBIENT T5 28/54W BL
TAPA CIEGA BAADOR AMBIENT T5 28/54W GR.
TAPA CIEGA BAADOR AMBIENT T5 35/49/80W BL
TAPA CIEGA BAADOR AMBIENT T5 35/49/80W GR.
TAPA CIEGA BAADOR AMBIENT T8 18W BL
TAPA CIEGA BAADOR AMBIENT T8 18W GR.
TAPA CIEGA BAADOR AMBIENT T8 36W BL
TAPA CIEGA BAADOR AMBIENT T8 36W GR.
TAPA CIEGA BAADOR AMBIENT T8 58W BL
TAPA CIEGA BAADOR AMBIENT T8 58W GR.
TAPA CIEGA LUM. AMBIENT TC-L 36W BL
TAPA CIEGA LUM. AMBIENT TC-L 36W GR.
APLI AMBIENT TC-L 36W /E PCAR. BL
APLI AMBIENT TC-L 36W /E PCAR. GR.
APLI AMBIENT TC-L 55W PCAR. BL.
APLI AMBIENT TC-L 55W PCAR. GR.
APLI AMBIENT 1X14/24W PCAR. BL.
APLI AMBIENT 1X14/24W PCAR. GR.
APLI AMBIENT 1X28/54W PCAR. BL
APLI AMBIENT 1X28/54W PCAR. GR.
APLI AMBIENT 1X35/49/80W PCAR. BL
APLI AMBIENT 1X35/49/80W PCAR. GR.
LINEA CONTINUA AMBIENT 14/24W PCAR. BL
LINEA CONTINUA AMBIENT 14/24W PCAR. GR.
LINEA CONTINUA AMBIENT 28/54W PCAR. BL
LINEA CONTINUA AMBIENT 28/54W PCAR. GR.
LINEA CONTINUA AMBIENT 35/49/80W PCAR. BL
LINEA CONTINUA AMBIENT 35/49/80W PCAR. GR.
LINEA CONTINUA FINAL AMBIENT 14/24W PCAR.BL
LINEA CONTINUA FINAL AMBIENT 14/24W PCAR.GR
LINEA CONTINUA FINAL AMBIENT 28/54W PCAR.BL
LINEA CONTINUA FINAL AMBIENT 28/54W PCAR.GR
LINEA CONTINUA FINAL AMBIENT 35/49/80W PCAR.BL
LINEA CONTINUA FINAL AMBIENT 35/49/80W PCAR.GR
APLI AMBIENT 2X14/24W PCAR. BL
APLI AMBIENT 2X14/24W PCAR. GR.
APLI AMBIENT 2X28/54W PCAR. BL
APLI AMBIENT 2X28/54W PCAR. GR.
APLI AMBIENT 2X35/49/80W PCAR. BL
APLI AMBIENT 2X35/49/80W PCAR. GR.
APLI AMBIENT 2X14/24W CON TIRADOR PCAR. BL
APLI AMBIENT 2X28/54W CON TIRADOR PCAR. BL
ACC. REFLECTOR BL. SAT-2 24+CR. TRANSP.
ACC. REFLECTOR GR. SAT-2 24+CR. TRANSP.
ACC. DIFUSOR PANEL DE ABEJA PARA SAT-1
ACC. REFLECTOR BL. SAT-2 24 + CR. AZUL
ACC. REFLECTOR GR. SAT-2 24 + CR. AZUL
ACC. REFLECTOR BL. SAT-2 24 + CR. VERDE
ACC. REFLECTOR GR. SAT-2 24 + CR. VERDE
ACC. REFLECTOR BL. SAT-2 24 + CR. ROJO
ACC. REFLECTOR GR. SAT-2 24 + CR. ROJO
ACC. REFRACTOR ELIPTICO DE FLUJO SAT-1
ACC. LENTE DICROICA AZUL PARA SAT-1
ACC. LENTE DICROICA ROJA PARA SAT-1
ACC. REFRACTOR ELIPTICO DE FLUJO SAT-2
CONTROL REMOTO PROYECTORES SAT
PROY. SAT-1 CARRIL QR-111 100W BL.
PROY. SAT-1 CARRIL QR-111 100W GRIS
PROY. SAT-1 CARRIL QR-CBC51 BLANCO
PROY. SAT-1 CARRIL QR-CBC51 GRIS
PROY. SAT-1 CARRIL CDMR-111 35W BL
PROY. SAT-1 CARRIL CDMR-111 35W GRIS
PROY. SAT-2 CARRIL HIT 35W G12 BL.
PROY. SAT-2 CARRIL HIT 35W G12 GRIS
PROY. SAT-2 CARRIL HIT 70W G12 BL.
PROY. SAT-2 CARRIL HIT 70W G12 GRIS
PROY. SAT-2 CARRIL HIT 150W G12 BL
PROY. SAT-2 CARRIL HIT 150W G12 GRIS
PROY. SAT-1 BASE QR-111 100W BL.
541,50
525,50
525,50
603,50
603,50
661,00
661,00
661,00
661,00
740,50
740,50
24,00
6,50
6,50
7,00
7,00
6,00
6,00
5,50
5,50
94,00
94,00
106,00
106,00
41,50
97,00
97,00
62,00
63,50
36,00
36,00
11,00
11,00
11,50
11,50
10,00
10,00
20,00
20,00
22,50
22,50
32,00
8,00
8,00
47,00
47,00
58,50
58,50
59,50
73,00
79,00
75,00
75,00
95,00
95,00
93,50
93,50
98,50
282,00
289,00
204,50
128,00
390,50
402,50
281,50
243,50
272,50
450,50
5,00
5,00
11,50
11,50
6,50
6,50
7,00
7,00
6,00
225,00
151,00
151,00
222,50
222,50
242,00
242,00
9,00
9,00
16,50
16,50
20,00
20,00
9,00
9,00
16,50
16,50
20,00
20,00
8,50
8,50
173,50
173,50
190,50
190,50
197,00
197,00
248,00
248,00
281,00
281,00
171,50
171,50
227,00
227,00
264,00
264,00
183,50
183,50
238,50
238,50
270,50
270,50
208,50
208,50
258,00
258,00
323,50
323,50
225,50
270,00
86,00
86,00
27,00
156,50
156,50
156,50
156,50
156,50
156,50
73,00
125,00
125,00
68,50
288,00
535,00
535,00
519,50
519,50
595,50
595,50
661,00
661,00
661,00
661,00
740,50
740,50
541,50

48
48
48
48
48
49
49
49
49
49
49
10
10
10
10
10
10
10
10
10
9
9
9
9
10
9
9
11
11
11
11
11
11
11
11
11
11
11
11
11
11
11
11
11
11
11
10
10
10
10
10
11
11
11
11
11
11
162
163
163
163
162
163
163
163
163
162
162
29
29
29
29
12
12
12
12
12
69
69
69
69
69
69
69
69
69
69
69
69
69
69
69
69
69
69
69
69
69
68
68
68
68
68
68
68
68
68
68
69
69
69
69
69
69
69
69
69
69
69
69
68
68
68
68
68
68
139
139
49
49
48
49
49
49
49
49
49
48
48
48
49
48
48
48
48
48
48
48
49
49
49
49
49
49
48
89 SAT
90 MINI KUBIC / KUBIC
91 / 92 KONIC / NIC / MINI KONIC / GALA/ RING / RING LEDS / ALUMIC / ORBIT / EQUIPOS
234
,QIRUPDFLyQ
REF. / PAG.
Codigo Plazo Descripcin Euros Pg. Codigo Plazo Descripcin Euros Pg.
9203443
9203510
9203513
9204000
9204003
9204010
9204013
9206100
9206103
9206120
9206123
9206130
9206133
9206140
9206143
9206150
9206153
9206160
9206163
9206170
9206173
9206200
9206203
9206220
9206223
9206230
9206233
9206250
9206253
9206320
9206350
9206360
9206380
9206400
9206403
9206430
9206433
9206500
9206505
9207120
9207125
9207127
9207690
9207710
9207720
9207730
9207760
9207770
9207780
9240020
9241020
9241030
9241040
9241050
9241060
9241063
9241270
9241273
9241280
9241282
9241290
9241292
9241300
9241303
9241550
9241590
9241640
9241650
9242240
9242250
9242260
9242270
9242510
9242520
9242530
9242560
9242580
9242610
9242620
9200143
9200200
9200203
9201010
9201060
9201063
9201090
9201100
9201170
9201173
9201180
9201190
9201200
9201203
9201270
9201273
9201280
9201282
9201290
9201292
9201300
9201303
9201400
9201403
9201410
9201413
9201430
9201433
9201440
9201443
9201450
9201453
9201480
9201483
9201490
9201493
9201510
9201513
9201640
9201650
9201700
9201703
9201710
9201713
9201720
9201723
9201730
9201733
9201740
9201743
9201750
9201753
9201760
9201763
9201770
9201773
9201780
9201783
9202580
9202610
9202620
9202630
9202640
9202650
9202660
9202670
9203020
9203023
9203030
9203033
9203050
9203053
9203060
9203063
9203070
9203073
9203110
9203113
9203440
RING LEDS FLOOD 3 LEDS NEUTRAL WHITE GR.
RING LEDS FLOOD 3 LEDS WARM WHITE BL.
RING LEDS FLOOD 3 LEDS WARM WHITE GR.
DOWNLIGHT GALA FIJO 12V/50W QRCB51 BL.
DOWNLIGHT GALA FIJO 12V/50W QRCB51 GR.
DOWNLIGHT GALA ORIENT.12V/50W QRCB51 BL.
DOWNLIGHT GALA ORIENT.12V/50W QRCB51 GR.
DIF. DARKLIGHT 4 CELDAS KONIC BL.
DIF. DARKLIGHT 4 CELDAS KONIC GR.
DIF. CRISTAL OPAL KONIC IP54 BL.
DIF. CRISTAL OPAL KONIC IP54 GR
DIF.CRISTAL SEMI-OPAL KONIC IP54 BL
DIF.CRISTAL SEMI-OPAL KONIC IP54 GR.
DIF. CRISTAL TRANSP KONIC IP54 BL.
DIF. CRISTAL TRANSP KONIC IP54 GR.
DIF. PCAR. TRANSP. KONIC IP54 BL.
DIF. PCAR. TRANSP. KONIC IP54 GR.
DIF. CRISTAL SERIGRAFIADO KONIC IP54 BL.
DIF. CRISTAL SERIGRAFIADO KONIC IP54 GR.
ACC. DIF. PCAR. OPAL KONIC IP54 BL.
ACC. DIF. PCAR. OPAL KONIC IP54 GR.
ARO DECORATIVO KONIC COLOR BLANCO
ARO DECORATIVO KONIC COLOR GRIS
DIF. DARKLIGHT 9 CELDAS KONIC BL.
DIF. DARKLIGHT 9 CELDAS KONIC GR.
DIFUSOR DARKLIGHT TURBO KONIC BL.
DIFUSOR DARKLIGHT TURBO KONIC GR.
DIF.DARKLIGHT 4 CELDAS+CRISTAL IP54 BL.
DIF.DARKLIGHT 4 CELDAS+CRISTAL IP54 GR.
FILTRO UVA PUZZLE / ORBIT RECT.ORIENT.
FILTRO UVA PARA ALUMIC HIT-DE 70W
FILTRO UVA PARA ALUMIC HIT-DE 150W
DIF.CRISTAL SEMI-OPAL EXT. KONIC BL.
ACC.GALA CRISTAL SEMI OPAL CENTRAL BL
ACC.GALA CRISTAL SEMI OPAL CENTRAL GRIS
ACC.GALA DOBLE REFLECTOR INTERIOR BL.
ACC.GALA DOBLE REFLECTOR INTERIOR GR.
DIF. CRISTAL EXT. OPAL KONIC BL
DIF. CRISTAL AZUL EXT. KONIC BL.
DIFUSOR CILINDRICO KONIC OPAL BLANCO
DIFUSOR CILINDRICO KONIC OPAL AZUL
DIFUSOR CILINDRICO KONIC OPAL AMBAR
ACC. EQUIPO HIT/HST 35W CLASE II
ACC. EQUIPO ELECTROMAG. HST 100W
ACC. EQUIPO ELECTROMAG. HIT/HST 70W
ACC. EQUIPO ELECTROMAG. HIT/HST 150W
ACC. EQUIPO HIT/HST 70W CLASE II
ACC. EQUIPO HIT/HST 150W CLASE II
ACC. EQUIPO ELECTROMAG. HIT 35W
ACC.TRANSFORMADOR LEDS 30W 24V
MINI-KONIC TC-DE 13W
MINI-KONIC TC-DE 18W
MINI-KONIC TC-TE 26W
MINI-KONIC TC-TE 32W
RING DARKLIGHT REDONDO LED WW 24 BL.
RING DARKLIGHT REDONDO LED WW 24 GR.
RING DARKLIGHT OVAL LED WW 24 BL.
RING DARKLIGHT OVAL LED WW 24 GR.
RING THINNER FRAME RED. LED WW 24 BL.
RING THINNER FRAME RED. LED WW 24 NG.
RING THINNER FRAME CUAD. LED WW 24 BL.
RING THINNER FRAME CUAD. LED WW 24 NG.
MINI ORBIT SIST.CARDAN LED WW 36 BL.
MINI ORBIT SIST.CARDAN LED WW 36 GR.
KONIC SUPERFICIE RX7S 70W/E.
MINI-KONIC 1X14W GR14q-1
KONIC 1X18W G24q-2
KONIC 1X26/32/42W GX24q-3/4
KONIC 2X18W G24q-2 CLASE II
KONIC 2X26/32/42W GX24q-3/4 CLASE II
KONIC 2X18W G24q-2 OPAL IP54 CLASE II
KONIC 2X26/32W G24q-3 OPAL IP54 CLASE II
KONIC 2x14W GR14q-1
KONIC 2x17W GR14q-1
ACC.TRANSFORMADOR LEDS 24V 60W
KONIC SUPERFICIE GX24Q-4 2X42W /E
KONIC SUPERFICIE G24Q-3 2X26-32W
DOWNLIGHT ALUMIC G24q-2 2X18W /E H220
DOWNLIGHT ALUMIC G24q-3 2X26/32W /E H220
ACC. CRISTAL TRANSPARENTE MINI-KONIC GR.
ACC. ARO EMBELLECEDOR MINI-KONIC BL.
ACC. ARO EMBELLECEDOR MINI-KONIC GR.
MINI-KONIC TC-TSE 20W
RING DARKLIGHT FIJO REDONDO BL.
RING DARKLIGHT FIJO REDONDO GR.
DOWN. ALUMIC COMFORT HIT/HST-DE 1X70W
DOWN. ALUMIC COMFORT HIT/HST-DE 1X150W
ORBIT RECTANGULAR BASCULANTE 70W BL.
ORBIT RECTANGULAR BASCULANTE 70W GR.
DOWNLIGHT ALUMIC HIT/HST-DE 150W
DOWNLIGHT ALUMIC HIT/HST-DE 70W
ORBIT RECTANGULAR BASCULANTE 150W BL.
ORBIT RECTANGULAR BASCULANTE 150W GR.
RING DARKLIGHT ORIENTABLE OVAL BL.
RING DARKLIGHT ORIENTABLE OVAL GR.
RING THINNER FRAME REDONDO BL.
RING THINNER FRAME REDONDO NG.
RING THINNER FRAME CUADRADO BL.
RING THINNER FRAME CUADRADO NG.
MINI ORBIT SIST.CARDAN 50W QR-CBC51 BL
MINI ORBIT SIST.CARDAN 50W QR-CBC51 GR
ORBIT BASCULANTE INT. HIT 35-150W BL
ORBIT BASCULANTE INT. HIT 35-150W GR
ORBIT BASCULANTE EXT. HIT 35-150W BL
ORBIT BASCULANTE EXT. HIT 35-150W GR
ORBIT BASCULANTE HST 100W EXT. 80 BL
ORBIT BASCULANTE HST 100W EXT. 80 GR.
RING LEDS M-FLOOD 1 LED NEUTRAL WHITE BL.
RING LEDS M-FLOOD 1 LED NEUTRAL WHITE GR.
ORBIT BASCULANTE QR-LEDS WARM 24 BL.
ORBIT BASCULANTE QR-LEDS WARM 24 GR.
ORBIT SIST. CARDAN QR-LEDS WARM 40 BL
ORBIT SIST. CARDAN QR-LEDS WARM 40 GR
ORBIT SIST.CARDAN QR-LEDS WARM 24 BL
ORBIT SIST.CARDAN QR-LEDS WARM 24 GR
RING LEDS M-FLOOD 1 LED WARM WHITE BL.
RING LEDS M-FLOOD 1 LED WARM WHITE GR.
KONIC 1X18W G24d-2 AF
KONIC 1X26W G24d-3 AF
ORBIT BASCULANTE INT. HIT-TC 35/70W BL
ORBIT BASCULANTE INT. HIT-TC 35/70W GR
ORBIT BASCULANTE EXT. HIT-TC 35/70W BL
ORBIT BASCULANTE EXT. HIT-TC 35/70W GR
ORBIT BASCULANTE INT. QT-12 MAX.100W BL
ORBIT BASCULANTE INT. QT-12 MAX.100W GR
ORBIT BASCULANTE EXT. QT-12 MAX.100W BL
ORBIT BASCULANTE EXT. QT-12 MAX.100W GR
ORBIT BASCULANTE INT. CDM-TM 20/35W BL
ORBIT BASCULANTE INT. CDM-TM 20/35W GR
ORBIT BASCULANTE EXT. CDM-TM 20/35W BL
ORBIT BASCULANTE EXT. CDM-TM 20/35W GR
ORBIT BASCULANTE CDMR-111 35/70W BL
ORBIT BASCULANTE CDMR-111 35/70W GR
ORBIT BASCULANTE QR-111 MAX.100W BL
ORBIT BASCULANTE QR-111 MAX.100W GR
ORBIT BASCULANTE QR-LEDS WARM 40 BL.
ORBIT BASCULANTE QR-LEDS WARM 40 GR.
KONIC SUPERFICIE G24D-3 2X26W
DOWNLIGHT ALUMIC G24D-2 2X18W AF H220
DOWNLIGHT ALUMIC G24D-3 2X26W AF H220
KONIC 2X13W G24d-1 AF
KONIC 2X18W G24d-2 AF
KONIC 2X26W G24d-3 AF
KONIC 2X18W G24d-2 AF OPAL IP54
KONIC 2X26W G24d-3 AF OPAL IP54
RING BAJO VOLTAJE ABATIBLE 50W BL.
RING BAJO VOLTAJE ABATIBLE 50W GR.
ORBIT SISTEMA CARDAN 35/70W CDM-R111 BL
ORBIT SISTEMA CARDAN 35/70W CDM-R111 GR
ORBIT SISTEMA CARDAN 50/100W QR-111 BL
ORBIT SISTEMA CARDAN 50/100W QR-111 GR
ORBIT SISTEMA CARDAN 75W PAR30 BL.
ORBIT SISTEMA CARDAN 75W PAR30 GR,
ORBIT SISTEMA CARDAN 35/70W HI-PAR30 BL
ORBIT SISTEMA CARDAN 35/70W HI-PAR30 GR
RING DECO FIJO IP65 QR-CBC51 12V/50W BL.
RING DECO FIJO IP65 QR-CBC51 12V/50W GR.
RING LEDS FLOOD 3 LEDS NEUTRAL WHITE BL.
59,00
59,00
59,00
21,50
21,50
29,00
29,00
23,50
23,50
11,00
11,00
11,50
11,50
10,50
10,50
24,00
24,00
13,00
13,00
25,00
25,00
8,00
8,00
27,00
27,00
32,00
32,00
32,00
32,00
20,50
28,00
29,00
14,50
8,00
8,00
10,50
10,50
31,00
31,00
40,00
54,00
54,00
60,50
156,00
64,50
72,50
83,50
91,50
65,00
56,00
52,50
53,00
53,50
75,50
66,50
66,50
66,50
66,50
63,50
63,50
63,50
63,50
67,50
67,50
283,50
73,00
85,50
85,50
73,00
73,00
80,00
80,00
89,00
89,00
94,50
210,50
185,00
115,50
116,00
6,00
5,00
5,00
38,00
11,50
11,50
77,00
77,00
33,00
33,00
41,50
42,00
33,00
33,00
11,50
11,50
10,00
10,00
10,00
10,00
17,50
17,50
82,50
82,50
82,50
82,50
112,00
112,00
49,00
49,00
159,00
159,00
163,00
163,00
163,00
163,00
49,00
49,00
61,00
63,50
63,00
63,00
63,00
63,00
86,00
86,00
86,00
86,00
93,00
93,00
93,00
93,00
104,00
104,00
50,50
50,50
159,00
159,00
155,50
86,00
87,50
63,50
63,50
65,50
67,50
70,50
12,50
12,50
87,50
87,50
49,00
49,00
72,00
72,00
76,50
76,50
18,50
18,50
59,00

31
31
31
27
27
27
27
15
15
15
15
15
15
15
15
15
15
15
15
15
15
15
15
15
15
15
15
15
15
18
17
17
15
27
27
27
27
15
15
15
15
15
155
155
155
155
155
155
155
155
12
12
12
12
28
28
28
28
28
28
28
28
18
18
42
12
14
14
14
14
13
13
14
14
155
42
42
16
16
12
12
12
12
28
28
17
17
18
18
17
17
18
18
28
28
28
28
28
28
18
18
19
19
19
19
19
19
31
31
19
19
18
18
18
18
31
31
14
14
19
19
19
19
19
19
19
19
19
19
19
19
19
19
19
19
19
19
42
16
16
14
14
14
13
13
29
29
18
18
18
18
18
18
18
18
29
29
31
235
,QIRUPDFLyQ
REF. / PAG. REF. / PAG.
Codigo Plazo Descripcin Euros Pg. Codigo Plazo Descripcin Euros Pg.
9242640
9242650
9242660
9242670
9243110
9243113
9244000
9244003
9244010
9244013
9246800
9247460
9247470
9247700
9247710
9247730
9247740
9247750
9247760
9247770
9247780
9247790
9247800
9247810
9247820
9247840
9247850
9247860
9262640
9262650
9262660
9262670
9300252
9300260
9300273
9300282
9301023
9301033
9301053
9301090
9301095
9301100
9301110
9301123
9301133
9301143
9301153
9301163
9301173
9301183
9301193
9301203
9301213
9301223
9301233
9301313
9301323
9306100
9306113
9306120
9306130
9306140
9306150
9306215
9306216
9306217
9306218
9306402
9341243
9341303
9341503
9341513
9341523
9341533
9341543
9341553
9341563
9341573

KONIC 2X18W G24q-2


KONIC 2X26/32/42W GX24q-3/4
KONIC 2X18W G24q-2 OPAL IP54
KONIC 2X26/32W GX24q-3 OPAL IP54
RING DECO FIJO IP65 LED WW 36 BL.
RING DECO FIJO IP65 LED WW 36 GR.
DOWNLIGHT GALA FIJO LED WW 36 BL.
DOWNLIGHT GALA FIJO LED WW 36 GR.
DOWNLIGHT GALA ORIENT. LED WW 36 BL.
DOWNLIGHT GALA ORIENT. LED WW 36 GR.
ACC.TRANSFORMADOR LEDS 100W 24V
ACC.TRANSFORMADOR LEDS 20W 24V
FUENTE ALIMENTACION LEDS 10-18W 350mA
ACC. TRANSFORMADOR LEDS 20W 12V
ACC. EQ. TRAFO. ELECTRONICO 20-60W/12V
FUENTE ALIMENTACION LEDS 1-9W 350mA
ACC. EQUIPO ELECTRONICO HIT 70W
ACC. EQUIPO ELECTRONICO HIT 150W
ACC. EQUIPO ELECTRONICO HIT 2X35W
ACC. EQ. TRAFO. ELECTRONICO 35-105W/12V
ACC. EQUIPO ELECTRONICO HIT 35W
ACC. EQUIPO ELECTRONICO HIT-TM 20W
FUENTE ALIMIENTACION LEDS 24W 700mA
ACC. EQUIPO ELECTRONICO HIT 2X70W
FUENTE ALIMENTACION LEDS 15W 350mA
DRIVER LED RGB
PACK DE CONTROL POR INFRAROJOS
CONVERTIDOR DMX/DALI
KONIC 2X18W G24d-2/q-2 + EMERGENCIA
KONIC 2X26W G24d-3/q-3 + EMERGENCIA
KONIC 2X18W G24d-2/q-2 OPAL + EMERGENCIA
KONIC 2X26W G24d-3/q-3 OPAL + EMERGENCIA
ACC. GAP CAJA EMPOTRAMIENTO HORMIGON
ACC. GAP KIT ZONA ACCESIBLE-DOBLE VIDRIO
ACC. GAP EMPOTRAMIENTO FALSO TECHO
ACC. GAP BUFFER
UPLIGHT EXTERIOR HIT 70W ORIENTABLE
UPLIGHT EXTERIOR PARA HIT 150W ORIENT
UPLIGHT EXTERIOR PARA TC-TSE 20W
UPLIGHT SEALIZACION LEDS BLANCOS
UPLIGHT SEALIZACION LEDS AZULES
UPLIGHT EXTERIOR PARA QT-12 50W
UPLIGHT EXTERIOR PARA Gx24Q-2 TC-TE 18W
UPLIGHT EXTERIOR ORIENTABLE HIT 35W 14
UPLIGHT EXTERIOR ORIENTABLE HIT 35W 40
UPLIGHT EXTERIOR ORIENTABLE HIT 70W 14
UPLIGHT EXTERIOR ORIENTABLE HIT 70W 40
UPLIGHT EXTERIOR ORIENTABLE HIT 150W 14
UPLIGHT EXTERIOR ORIENTABLE HIT 150W 40
UPLIGHT EXTERIOR ORIENTABLE HIT 35W 8
UPLIGHT EXTERIOR ORIENTABLE HIT 35W 60
UPLIGHT EXTERIOR ORIENTABLE HIT 70W 8
UPLIGHT EXTERIOR ORIENTABLE HIT 70W 60
UPLIGHT EXTERIOR ORIENTABLE HIT 150W 8
UPLIGHT EXTERIOR ORIENTABLE HIT 150W 60
UPLIGHT EXTERIOR FIJO HIT/HST-DE 70W
UPLIGHT EXTERIOR FIJO HIT/HST-DE 150W
ACC. CRISTAL UPLIGHT AISLAMIENTO TERMICO
ACC. ARO EMBELLECDOR UPLIGHT INOX. 304
ACC. CRISTAL ANTIDESLIZANTE UPLIGHT
ACC. CRISTAL OPAL UPLIGHT
ACC. CRISTAL MEDIA-LUNA UPLIGHT
ACC. REJILLA ANTIDESLUMBRANTE UPLIGHT
ACC. FILTRO CRISTAL AZUL UPLIGHT
ACC. FILTRO CRISTAL VERDE UPLIGHT
ACC. FILTRO CRISTAL AMARILLO UPLIGHT
ACC. FILTRO CRISTAL ROJO UPLIGHT
ACC.TAPA UPLIGHT EXTERIOR PARA HIT/QT-32
UPLIGHT EXTERIEUR ORIENTABLE 24LEDS 1,2W
UPLIGHT EXTERIOR FIJO TC-TE 26/32/42W
GAP CDM-TM PGJ5 20W ORIENT. SPOT CL.I
GAP CDM-TM 20W PGJ5 ORIENT. FLOOD CL.I
GAP HIT G12 35W ORIENT. SPOT CL.I
GAP HIT G12 35W ORIENT. FLOOD CL.I
GAP HIT G12 70W ORIENT. SPOT CL.I
GAP HIT G12 70W ORIENT. FLOOD CL.I
GAP CDM-TM 20W PGJ5 ASIM. CL.I
GAP HIT G12 35W ASIM. CL.I
84,50
84,50
93,00
93,00
69,50
69,50
69,50
69,50
73,00
73,00
170,50
51,00
60,00
55,00
14,00
34,00
98,50
160,00
174,00
21,00
98,50
104,50
48,50
174,00
34,00
91,50
125,50
82,00
191,50
196,00
195,50
196,00
70,00
30,00
70,00
a consultar
330,00
342,00
160,00
165,50
165,50
194,50
198,50
531,50
531,50
539,50
539,50
614,00
614,00
531,50
531,50
539,50
539,50
614,00
614,00
539,50
614,00
162,00
138,50
90,00
90,00
90,00
68,00
51,50
51,50
51,50
51,50
17,50
1500,00
537,00
386,50
386,50
386,50
386,50
386,50
386,50
386,50
386,50
14
14
13
13
29
29
27
27
27
27
155
155
155
155
155
155
155
155
155
155
155
155
155
155
155
154
172
172
14
14
13
13
169
169
169
169
170
170
170
170
170
170
170
171
171
171
171
171
171
171
171
171
171
171
171
171
171
171
171
171
171
171
171
171
171
171
171
170
171
171
168
168
168
168
168
168
168
168
9341583
9341593
9341603
9341613
9341623
9341633
9341643
9341653
9341663
9341673
9341683
9341693
9341703
9341713
9341723
9341733
9341743
9341753
9341763
9341773
9341783
9341803
9341813
9341823
9341833
9341843
9341853
9341863
9341873
9401005
9401015
9401025
9401035
9401045
9401055
9401065
9401075
9401095
9401145
9401155
9401165
9401175
9401205
9401215
9401225
9401235
9401295
9406110
9406300
9406310
9406510
9406600
9406603
9408400
9600012
9600022
9600050
9600053
9600060
9600063
9600122
9600160
9600170
9600180
9600210
9600220
9600302
9600313
9600323
9600333
9600343
9600353
9600363
9600893
9600913
9600953
9600973

GAP HIT G12 70W ASIM. CL.I


GAP TC-DE 18W WIDE FLOOD CL.I
GAP CDM-TM PGJ5 20W ORIENT. SPOT CL.II
GAP CDM-TM PGJ5 20W ORIENT. FLOOD CL.II
GAP HIT G12 35W ORIENT. SP CL.II
GAP HIT G12 35W ORIENT. FL CL.II
GAP HIT G12 70W ORIENT. SPOT CL.II
GAP HIT G12 70W ORIENT. FLOOD CL.II
GAP CDM-TM PGJ5 20W ASIM. CL.II
GAP HIT G12 35W ASIM. CL.II
GAP HIT G12 70W ASIM. CL.II
GAP TC-DE 18W WIDE FLOOD CL.II
GAP 5 LEDS SPOT ORIENT. WW. CL.I
GAP 5 LEDS SPOT ORIENT NW. CL.I
GAP 5 LEDS MFL ORIENT WW. CL.I
GAP 5 LEDS MFL ORIENT NW. CL.I
GAP 10 LEDS SPOT ORIENT WW. CL.I
GAP 10 LEDS SPOT ORIENT NW. CL.I
GAP 10 LEDS MFL ORIENT WW. CL.I
GAP 10 LEDS MFL ORIENT NW. CL.I
GAP 10 LEDS ORIENT. RGB CL.I
GAP 5 LEDS SPOT ORIENT. WW. CL.II
GAP 5 LEDS SPOT ORIENT NW. CL.II
GAP 5 LEDS MFL ORIENT WW. CL.II
GAP 5 LEDS MFL ORIENT NW. CL.II
GAP 10 LEDS SPOT ORIENT WW. CL.II
GAP 10 LEDS SPOT ORIENT NW. CL.II
GAP 10 LEDS MFL ORIENT WW. CL.II
GAP 10 LEDS MFL ORIENT NW. CL.II
HANGAR-20 HME 125W E27
HANGAR-20 HME 250W E40
HANGAR-20 HIE / HIT 250W 0.6KV E40
HANGAR-20 HIT/HST/HIE/HSE 250W 4.5kV E40
HANGAR-20 HME 400W E40
HANGAR-20 HIE/HIT 400W 4.5kV E40
HANGAR-20 HSE/HST 400W E40
HANGAR-20 HIE / HIT 400W 0.6kV E40
HANGAR-20 HIT 250W 4.5kV G12
HANGAR-65 HME 400W E40
HANGAR-65 HIE/HIT 400W 4.5kV E40
HANGAR-65 HSE/HST 400W E40
HANGAR-65 HIE 400W 0.6kV E40
HANGAR-65 HME 125W E27
HANGAR-65 HME 250W E40
HANGAR-65 HIE 250W 0.6kV E40
HANGAR-65 HIT/HST/HIE/HSE 250W 4.5kV E40
HANGAR-65 HIT 250W 4.5kV G12
CIERRE REFLECTOR PCAR. CON JUNTA HANGAR
CRISTAL PROTECTOR REFL. AL. HANGAR
REJILLA PROTECCION HANGAR
REFECTOR. LAMP. ELIPSOIDAL HANGAR
REFLECTOR POLICARBONATO HANGAR
REFL. POLICARBONATO HANGAR METALIZADO
ACC. KIT PREENCENDIDO HANGAR
REJILLA ANTIDES PROYECTOR AVANT-175
REJILLA ANTIDES PROYECTOR AVANT-145
2 SOP. PARED EXTENSIBLE Y ORIENTABLE BL.
2 SOP. PARED EXTENSIBLE Y ORIENTABLE GR
2 SOPORTE PARED ORIENTABLE BL.
2 SOPORTE PARED ORIENTABLE GR.
ACC. VISERA PROYECTOR AVANT-145
EMBELLECEDOR LUMINOSIDAD-PRESENCIA DALI
CONECTOR IP68 8-10 mm
CONECTOR IP68 6,5-12 mm PARA DERIVACIONES
REFRACTOR ELIPTICO DE FLUJO AVANT-175
REFRACTOR ELIPTICO DE FLUJO AVANT-145
ACC. ALETAS DIRECCIONALES AVANT LINEAL
$&&1,8%5$=2,1'326772300
ACC. NIU ABRAZADERA COLUMNA 60-135MM
$&&1,8623257($%&8/200
$&&1,8623257($%&8/200
$&&1,8$'$37$'25&2/801$600
ACC. NIU BRAZO A PARED
PLANTILLA FIJACION PERNOS M18 (205x205)
PLANTILLA FIJACION PERNOS M22 (285x285)
CONJUNTO PERNOS M18X500
CONJUNTO PERNOS M22X750
386,50
322,00
490,00
490,00
490,00
490,00
490,00
490,00
490,00
490,00
490,00
350,00
547,50
547,50
547,50
547,50
644,00
644,00
644,00
644,00
a consultar
589,00
589,00
589,00
589,00
689,00
689,00
689,00
689,00
93,50
103,00
131,00
131,00
112,50
130,50
143,50
130,50
146,50
159,00
184,00
199,00
184,00
111,50
124,50
151,50
151,50
166,00
58,00
30,00
18,00
38,50
94,00
157,50
112,50
67,50
55,00
119,50
119,50
60,50
60,50
29,50
20,50
27,50
37,00
39,00
35,50
60,00
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
38,00
54,00
37,00
86,50
168
168
168
168
168
168
168
168
168
168
168
168
169
169
169
169
169
169
169
169
169
169
169
169
169
169
169
169
169
142
142
142
142
142
142
142
142
142
143
143
143
143
142
142
142
142
142
143
143
143
143
143
143
143
53
46
84
84
74
74
46
153
171
171
53
46
47
203
203
203
203
203
203
205
205
205
205
93 GAP / UPLIGHTS
94 HANGAR
96 SUSPENSIONES / ACCESORIOS / COLUMNA / SCENING
236
,QIRUPDFLyQ
REF. / PAG.
Codigo Plazo Descripcin Euros Pg. Codigo Plazo Descripcin Euros Pg.
9600980
9601010
9601020
9601050
9601100
9601133
9601173
9601183
9601220
9601263
9601273
9601313
9601323
9601333
9601343
9601353
9601543
9601683
9601693
9601823
9601853
9601903
9601913
9601923
9601933
9601943
9602173
9602183
9602323
9602333
9602933
9602943
9603173
9603183
9603323
9603333
9603943
9604173
9604183
9604323
9604333
9604883
9605873
9605883
9606010
9606023
9606040
9606043
9606050
9606060
9606873
9606883
9607343
9607353
9607363
9607450
9607453
9607460
9607463
9607473
9607483
9607490
9607493
9607510
9607513
9607540
9607543
9607610
9607613
9607800
9607810
9607873
9608363
9608493
9608590
9608603
9608633
9608640
9608643

CONECTORES 3 POLOS IP67


SUSPENSION RIGIDA 100MM BLANCA
SUSPENSION RIGIDA 250MM BLANCA
SUSPENSION RIGIDA 500MM BLANCA
SUSPENSION RIGIDA 1000MM BLANCA
SUSP. VERTICAL DOBLE CABLE PUZZLE AEREO
$&&),1$//$5*2352$0,1,352$
$&&),1$/&2572352$0,1,352$
ACC. CAJA EMPOTRAR BOTONERA SCENING
ACC. INTERMEDIO LARGO 1 PROA / MINI PROA
ACC. INTERM. CORTO 1 PROA / MINI PROA
SUSP. CABLE REGULABLE RAPIDA 1000mm NQ
$&&),1$//$5*26+27
$&&),1$/&25726+27
SUSP. CABLE REGULABLE RAPIDA 4000mm NQ
ACC. INTERMEDIO CORTO 1 STEP
SUSP. CABLE REGULABLE MINIYES-B NIQUEL
$&&,17(50(',2/$5*26+27
$&&,17(50(',2&25726+27
ACC. PARED LARGO 1 PROA / MINI PROA
ACC. PARED LARGO 1 SHOT
COLUMNA SMAP 4 M
COLUMNA SMAP 5M
COLUMNA SMAP 6M
COLUMNA SMAP 7M (TIPO A)
COLUMNA SMAP 9M (TIPO A)
$&&),1$//$5*2352$0,1,352$
$&&),1$/&2572352$0,1,352$
$&&),1$//$5*26+27
$&&),1$/&25726+27
COLUMNA SMAP 7M (TIPO B)
COLUMNA SMAP 9M (TIPO B)
$&&),1$//$5*2352$0,1,352$
$&&),1$/&2572352$0,1,352$
$&&),1$//$5*26+27
$&&),1$/&25726+27
COLUMNA SMAP 9M (TIPO C)
$&&),1$//$5*2352$0,1,352$
$&&),1$/&2572352$0,1,352$
$&&),1$//$5*26+27
$&&),1$/&25726+27
COLUMNA CILNDRICA 4 M V2010
COLUMNA TRONCOCONICA 4 M V2010
COLUMNA CILNDRICA 6 M V2010
KIT 2 FIJACIONES PARA UNION ESTRUCTURAS
ACC. UNION LINEA CONTINUA STEP AIR
ROTULA DIAMETRO 170MM BLANCO
ROTULA DIAMETRO 170MM GRIS
FIJACION INTERMEDIA MARCO OCULTO PUZZLE
ACC. TIRANTE FIL BOX
COLUMNA TRONCOCNICA 6 M V2010
COLUMNA CILNDRICA 8 M V2010
SOPORTE PARED ECO-DUNE 1M GRIS
ACC. COLUMNA PROA-MINIPROA-SHOT GRIS
ACC. ABRAZADERA COLUMNA 2 PROYECTORES
SOPORTE PARED 75MM BLANCO
SOPORTE PARED 75MM GRIS
SOPORTE PARED 300MM BLANCO
SOPORTE PARED 300MM GRIS
ACC. ABRAZADERA COLUMNA 1 STEP AIR
ACC. ABRAZADERA COLUMNA 2 STEP AIR
SUSP. DOBLE CABLE REGULABLE BLANCA
SUSP. DOBLE CABLE REGULABLE GRIS
SUSP. CABLE REGULABLE 1000MM BLANCA
SUSP. CABLE REGULABLE 1000MM NIQUEL.
SUSP. CABLE REGULABLE 4000MM BLANCA
SUSP. CABLE REGULABLE 4000MM NIQUEL.
SUSP. DIRECTA BLANCA
SUSP. DIRECTA NIQUEL.
KIT INDICADOR LUMINOSO PARA MINI-PROA
ACC. UNION PASACABLES INT. EXTRAPLANA
COLUMNA TRONCOCONICA 8M V2010
ACC. ABRAZADERA COLUMNA 1 PROYECTOR
ACC. FIJ. SUPERFICIE STEP
ACC. UNION SUSP. RIGIDA M13/100 BLANCO
SUSP. CABLE "Y" 3000mm MINI-DUELAMP NQ.
SUSP. CABLE "Y" 3000mm ESTRUCTURAS NQ.
ACC. FLORON DECO. ALIMENT. 4MTS BLANCO
ACC. FLORON DECO. ALIMENTACION 4MTS GR.
36,00
12,00
15,00
15,00
17,50
70,50
165,50
110,50
5,00
189,00
110,50
15,50
165,50
110,50
17,00
189,50
13,00
189,00
110,50
113,00
113,00
a consultar
a consultar
a consultar
a consultar
a consultar
250,00
126,50
250,00
126,50
a consultar
a consultar
165,50
110,50
165,50
110,50
a consultar
250,00
126,50
250,00
126,50
348,50
256,00
492,00
1,50
3,00
58,00
58,00
5,00
9,50
350,00
532,50
140,00
70,50
84,00
35,00
35,00
52,00
52,00
179,00
284,00
19,50
19,50
7,50
7,00
11,50
11,00
7,50
6,50
614,50
2,50
454,50
74,00
17,50
6,50
15,00
16,00
37,00
37,00
172
118
118
118
118
41
185
185
150
185
185
77
197
197
77
177
39
197
197
185
197
205
205
205
205
205
185
185
197
197
205
205
185
185
197
197
205
185
185
197
197
213
212
213
67
177
103
101
21
91
212
213
211
186
186
74
74
74
74
177
177
41
41
118
118
118
118
118
118
181
110
212
186
177
118
116
41
118
118
9608653
9608663
9608873
9621000
9621003
9621010
9621013
9621020
9621023
9621050
9621053
9621100
9621103
9621210
9621213
9621240
9621243
9621310
9621313
9621340
9621343
9621543
9622023
9622053
9622103
9627490
9627493
9628600
9628603
9628630
9628633
9628650
9628653
9628660
9628663
9628670
9631513
9634883
9635873
9635883
9636873
9636883
9637873
9638873
9640790
9645030
9650140
9650150
9650740
9651200
9651210
9651230
9651240
9651250
9651260
9651300
9651310
9657510
9658640
9658643
9680160
9680770
9686010
9800973
9800983
9800993
9801023
9801033
9801043
9801053
9801203
9801213
9801400
9801405
9801406
9801408
9802053
9802063

SUSP. CABLE "Y" 3000mm DINAMIC NIQUEL.


SUSP. CABLE "Y" 3000mm DUELAMP NQ.
COLUMNA TRONCOCNICA 10M V2010
SUSP. DIRECTA DECO. ELECTRO-MEC.BL.
SUSP. DIRECTA DECO. ELECTRO-MEC.GR.
SUSP. RIGIDA DECO. ELECTRO-MEC. 100MM BL
SUSP. RIGIDA DECO. ELECTRO-MEC. 100MM GR
SUSP. RIGIDA DECO. ELECTRO-MEC. 250MM BL
SUSP. RIGIDA DECO. ELECTRO-MEC. 250MM GR
SUSP. RIGIDA DECO. ELECTRO-MEC. 500MM BL
SUSP. RIGIDA DECO. ELECTRO-MEC. 500MM GR
SUSP. RIGIDA DECO.ELECTRO-MEC. 1000MM BL
SUSP. RIGIDA DECO.ELECTRO-MEC. 1000MM GR
SUSP. CABLE REG. ELECTRO-MEC. 1000MM BL
SUSP. CABLE REG. ELECTRO-MEC. 1000MM GR.
SUSP. CABLE REG. ELECTRO-MEC. 4000MM BL
SUSP. CABLE REG. ELECTRO-MEC. 4000MM GR.
SUSP. CABLE REG.ELECTR-MEC. RAPIDA 1M BL
SUSP. CABLE REG.ELECTR-MEC. RAPIDA 1M GR
SUSP. CABLE REG.ELECTR-MEC. RAPIDA 4M BL
SUSP. CABLE REG.ELECTR-MEC. RAPIDA 4M GR
SUSP.CABLE REG.ELECTRO-MEC. MINIYES-B GR
BRAZO SUSP. RIGIDA SATINA 250MM GR.
BRAZO SUSP. RIGIDA SATINA 500MM GR.
BRAZO SUSP. RIGIDA SATINA 1000MM GR.
SUSP. DOBLE CABLE ELECTROMECANICA BL.
SUSP. DOBLE CABLE ELECTROMECANICA GR
SUSP. ELECTROMECANICA "Y" M-DUELAMP BL.
SUSP. ELECTROMECANICA "Y" M-DUELAMP GR.
SUSP. ELECTROMECANICA "Y" ESTRUCTURAS BL
SUSP. ELECTROMECANICA "Y" ESTRUC. GR
SUSP. ELECTROMECANICA "Y" DINAMIC BL
SUSP. ELECTROMECANICA "Y" DINAMIC GR
SUSP. ELECTROMECANICA "Y" DUELAMP BL.
SUSP. ELECTROMECANICA "Y" DUELAMP GR.
SUSP. ELECTROMEC. 5P "Y" ESTRUCTURAS BL.
SUSP.CABLE REG.ELECTRO-MEC. M-YES CARRIL
COLUMNA CILNDRICA 4M V2010 GRIS
COLUMNA TRONCOCONICA 4M V2010 GRIS
COLUMNA CILNDRICA 6M V2010 GRIS
COLUMNA TRONCOCONICA 6M V2010 GRIS
COLUMNA CILNDRICA 8M V2010 GRIS
COLUMNA TRONCOCONICA 8M V2010 GRIS
COLUMNA TRONCOCONICA 10M V2010 GRIS
USB-DMX/RDM Interface
ACC. CONTROLADOR EXTERNO DMX
SENSOR LUMINOSIDAD 1-10V PARA T5/T8
SENSOR LUMINOSIDAD 1-10V MICO T8 Y LUM.
ACOPLADOR DE FASES /BOTONERA POWERLINE
BOTONERA TACTIL SCENING PARA EMPOTRAR
ACC.REGULADOR LUMINARIAS 1-10V POWERLINE
ACC. MANDO DISTANCIA IrDA PARA SCENING
ACC.CONVERTIDOR TENSION 230V-750W(1-10V)
ACC. TRANSFORMADOR /E 12V-105W (1-10V)
ACC. REGULADOR DE PERSIANAS POWERLINE
SENSOR LUMIN.-PRES. POWERLINE EMPOT.
ACC. DETECTOR DE PRESENCIA Y REGULACION
FUENTE ALIMENTACION LEDS DIM 1-10V
ACC. FLORON ALIMENTACION + DIM 4MTS BL.
ACC. FLORON ALIMENTACION + DIM 4MTS GR.
SENSOR LUMINOSIDAD-PRESENCIA DALI EMPOT.
PULSADOR SEMI-EMPOTRADO DALI
PACK CONTROL MODULAR/POL SHOW 6X14/24W
CAJA EMPOTRAMIENTO XTREMA 80
CAJA EMPOTRAMIENTO XTREMA 40 PARA PARED
CAJA EMPOTRAMIENTO XTREMA 40 PARA SUELO
URBAN ASIMETRICO HIT 35W G12 IP 65
MINI URBAN 65 ASIMETRICO QT-9 IP 65 GR.
MINI URBAN 65 ASIM. LED 4W IP 65 GRIS
MINI URBAN 65 ASIM. LED 4W WARM W. GRIS
URBAN INTERIOR ASIMETRICA TC-D 1X10W
URBAN INTERIOR ASIMETRICA TC-D 1X26W
XTREMA SIGN SEALIZ. 9 LEDS C-BL. INOX
XTREMA SIGN SEALIZ. 9 LEDS AZUL INOX
XTREMA SIGN SEALIZ. 9 LEDS VERDE INOX
XTREMA SIGN SEALIZ. 9 LEDS ROJO INOX
XTREMA 40 W-FLOOD 2 LEDS C-WHITE INOX.
XTREMA 40 W-FLOOD 2 LEDS W-WHITE INOX.
18,00
15,00
598,00
14,50
14,50
12,50
12,50
16,00
16,00
17,50
17,50
20,50
20,50
22,00
22,00
42,00
42,00
26,50
26,50
48,50
48,50
34,00
16,00
17,50
20,50
74,00
74,00
38,50
38,50
50,00
50,00
47,50
47,50
38,00
38,00
70,50
64,50
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
a consultar
775,00
1193,00
29,00
84,00
130,00
440,00
200,00
48,00
194,50
58,00
312,50
202,00
293,00
48,00
39,00
39,00
143,00
280,00
576,00
64,00
10,00
19,00
260,50
18,00
51,00
51,00
74,00
89,00
70,00
70,00
70,00
70,00
56,00
56,00
97
116
212
118
118
42
118
42
39
42
39
42
39
118
118
118
188
77
118
77
118
39
37
37
37
83
83
116
116
41
41
97
97
116
114
93
39
213
175
213
175
213
175
175
154
154
152
152
150
150
150
150
150
150
150
150
152
150
118
118
153
153
67
172
172
172
174
174
174
174
71
71
173
173
173
173
172
172
98 XTREMA / MINI URBAN / URBAN
237
,QIRUPDFLyQ
REF. / PAG.
Codigo Plazo Descripcin Euros Pg.
9802073
9802083
9806153
9806163
9806173
9806183
9841013

XTREMA 40 W-FLOOD 3 LEDS RGB INOX.


XTREMA 40 W-FLOOD 2 LEDS BLUE INOX.
XTREMA 80 VW. FLOOD 6 LEDS C. WHITE INOX
XTREMA 80 VW FLOOD 6 LEDS W. WHITE INOX
XTREMA 80 M. FLOOD 6 LEDS C. WHITE INOX.
XTREMA 80 M. FLOOD 6 LEDS W. WHITE INOX
URBAN ASIMETRICO TC-DE 26W IP 65 GR.
75,00
56,00
187,00
187,00
195,00
195,00
159,50
172
172
172
172
172
172
174
238
,QIRUPDFLyQ
CONDICIONES DE VENTA
6HUiQGHDSOLFDFLyQDORVVXPLVWURVHIHFWXDGRVSRU/DPS6$8ODVFRQGLFLRQHVGHGHYROXFLyQGHPDWHULDOHVGHLOXPLQDFLyQTXHVH
LQGLFDQDFRQWLQXDFLyQ
1 Toda devolucin que no se produzca por error del fabricante, necesita una autorizacin previa, por parte de la empresa.
2 No se aceptarn devoluciones de material especial, es decir, fuera de tarifa vigente.
3 Toda devolucin har siempre referencia a la factura y/o albarn, con que fu suministrado.
4 No se admitir devolucin en ningn caso de material alguno que tenga una antigedad superior a 90 dias, referidos a la fecha de la factura del suministro.
5 En caso de que se acepte expresamente la devolucin de un material, este deber estar en su embalaje original, en cajas completas, sin abrir y en buen estado de
conservacin, como si de un producto nuevo se tratara.
6 La devolucin del material se efectuar a portes pagados, y por cuenta y riesgo del cliente.
7 El abono relativo a toda devolucin autorizada conllevar una depreciacin mnima del 15% del importe neto de la factura.
&RQGLFLRQHV*HQHUDOHVGH9HQWD
Todos los pedidos cursados implican la aceptacin ntegra, por parte del comprador, de las presentes
Condiciones Generales de Venta.
3UHFLRV
Se aplicarn las tarifas vigentes en la fecha de recepcin del pedido con los descuentos acordados. Para
artculos fuera de catlogo y ejecuciones especiales se tendr que solicitar oferta explcita.
(QWUHJDV
El lugar que se considera de entrega del material, por lo tanto de venta, es siempre nuestra fbrica o
almacn, por lo que las mercancas viajan por cuenta y riesgo del comprador. Los riesgos relativos a la
GHYROXFLyQGHORVSURGXFWRVFRUUHUiQVLHPSUHDFDUJRGHOFRPSUDGRU(QFDVRGHGLFXOWDGHVJUDYHV/$03
atender los pedidos en funcin de sus posibilidades.
3OD]RVGHGLVSRQLELOLGDGIUDQFRIiEULFD
3DUDRULHQWDUDQXHVWURVFOLHQWHVVREUHODGLVSRQLELOLGDGGHSURGXFWRHQQXHVWURDOPDFpQKHPRVFODVLFDGR
nuestras referencias de la siguiente forma:
Plazo de disponibilidad orientativo: GtDVODERUDEOHV
(contados a partir de la formalizacin del pedido)
Plazo de disponibilidad orientativo: GHDGtDVODERUDEOHV
(contados a partir de la formalizacin del pedido)
Plazo de disponibilidad orientativo:DGHWHUPLQDUSRU/$03
(contados a partir de la formalizacin del pedido)
Los puntos azules estn indicados antes del cdigo de cada referencia.
/RVSOD]RVGHHQWUHJDVHGHEHUiQFRQUPDUSDUDFDGDSHGLGR7RGRVHVWRVSOD]RVSXHGHQYHUVHLQFUHPHQ-
tados en un da debido a los procesos de expedicin. LAMP S.A.U. no incurrir en ninguna responsabilidad
ni penalizacin por el incumplimiento de los mismos.
7UDQVSRUWH
Los portes sern siempre a cargo del comprador, salvo en los casos en que se pacte lo contrario.
El destinatario tiene la obligacin de examinar la mercanca a su recepcin, y hacer constar las incidencias,
si las hubiere en el albarn de entrega o reclamar en un plazo mximo de 48 horas a su agencia de trans-
portes si se envi a portes debidos o a Lamp si fue a portes pagados.
$QXODFLyQGHSHGLGRV
Todos los pedidos deben ser anulados por escrito. Si la anulacin se produjese posteriormente a la expedi-
cin del pedido, se proceder a tratar como una devolucin, cuyo procedimiento se explica en el punto 10.
Los pedidos de ejecucin especial no podrn ser anulados, si ya estn en el proceso de produccin.
0XHVWUDV
Todas las muestras de material debern ser solicitadas bajo pedido y sern facturadas. Una vez devueltas
VHUiQDERQDGDVtQWHJUDPHQWHVDOYRHQORVFDVRVTXHKD\DQVXIULGRGHVSHUIHFWRVRPRGLFDFLRQHV
(MHFXFLRQHVHVSHFLDOHV
Cualquier realizacin fuera de catlogo se ha de consultar de forma individualizada para conocer su viabili-
dad, precio y plazo de entrega.
'LVWLQFLyQGHJUXSR
Familia de grupo 1 Familia de grupo 2 Familia de grupo 3
3UR\HFWRVGHLOXPLQDFLyQ
Ponemos a disposicin de todos nuestros clientes, el servicio gratuito de nuestro Departamento Tcnico de
Proyectos, donde les podemos desarrollar un estudio de clculo de alumbrado.
Juntamente con el informe tcnico ser entregado el presupuesto y un plano para facilitarles la ejecucin
de la obra.
Puede solicitar gratuitamente nuestro programa de clculo de iluminacin.
6HUYLFLRGHGHYROXFLRQHV
LAMP S.A.U. aceptar devoluciones de todos los materiales que aparezcan en la lista de precios marcados
con el smbolo (un solo punto azul).
5HTXLVLWRVIRUPDOHV
- El cliente debe haber formulado su pedido original SRUHVFULWR (fax, e-mail, carta....)
- Debe haberse solicitado a LAMP S.A.U. un Q~PHURGHDXWRUL]DFLyQGHGHYROXFLyQ
- El material no debe haber sufrido QLQJ~QWLSRGHGHVSHUIHFWR
3OD]RV
- El plazo para solicitar el nmero de autorizacin de devolucin ser como Pi[LPRGHGtDVQDWXUDOHV
FRQWDGRVDSDUWLUGHODIHFKDGHH[SHGLFLyQGHODPHUFDQFtD
- El plazo para la devolucin de la mercanca ser como Pi[LPRGHGtDVQDWXUDOHVFRQWDGRVDSDUWLUGH
ODIHFKDGHUHFHSFLyQGHOQ~PHURGHDXWRUL]DFLyQGHGHYROXFLyQHOFXDOVHUiQRWLFDGRSRU/$036$8
por escrito)
&RQGLFLRQHV
-LAMP S.A.U. estar facultada a no aceptar ninguna devolucin, cualquiera que fuese el motivo de sta, en los
siguientes casos:
,QFXPSOLPLHQWRGHORVUHTXLVLWRVIRUPDOHV\RGHSOD]RV
0DWHULDOHVIXHUDGHFDWiORJR
(MHFXFLRQHVHVSHFLDOHVHOHFWULFDGRPHGLGDVHWFGLVWLQWRVGHOHVWiQGDUG
0DWHULDOSLQWDGRHQFRORUGLVWLQWRDOHVWiQGDU
0DWHULDOHVTXHDSDUH]FDQHQODOLVWDGHSUHFLRVPDUFDGRVFRQORVVtPERORV
(dos puntos azules) y/o (tres puntos azules).
- Todas las devoluciones de material que hayan sido debidamente autorizadas, se remitirn a LAMP S.A.U.
con los portes pagados
$ERQRV
LAMP S.A.U. proceder a abonar todas las devolucionesTXHFXPSODQWRGRV\FDGDXQRGHORVUHTXLVLWRV
IRUPDOHVGHSOD]RV\FRQGLFLRQHVSRUXQLPSRUWHGHOGHOIDFWXUDGRRULJLQDOPHQWH(OUHVWDQWH
LUiGHVWLQDGRDVRSRUWDUORVFRVWHVRULJLQDGRVSRUODVGHYROXFLRQHVPDQLSXODFLyQHPEDODMHFRQWURO
GHFDOLGDG
Los abonos que se originen por causas diferentes a devoluciones (diferencias de precios, portes, errores,
etc...) tambin estarn condicionados a los requisitos formales y de plazos, es decir el pedido original debe
haberse formulado por escrito y ser reclamado como mximo GtDVQDWXUDOHVFRQWDGRVDSDUWLUGHOD
IHFKDGHH[SHGLFLyQGHODIDFWXUD
Ser imprescindible que el cliente est al corriente de sus obligaciones de pago.
&DOLGDG
Todos los productos suministrados por LAMP S.A.U.,GLVSRQHQGHODFHUWLFDFLyQ&(DGHPiVGHRWUDVQRUPD-
tivas y han sido sometidos a rigurosos controles de calidad que garantizan su correcto funcionamiento.
LAMP. S.A., trabaja permanentemente para mejorar y adecuar sus fabricados. Por ello nos reservamos el
GHUHFKRDPRGLFDUVXSULPLURDPSOLDUQXHVWURVSURGXFWRVVLQSUHYLRDYLVR\VLQTXHHOORVHDPRWLYRGH
reclamaciones.
*DUDQWtD
Todos los productos de LAMP S.A.U., gozan de un periodo de garanta contra defectos de fabricacin de 2
aos a partir del momento de su compra. Sern reparados o reemplazados, segn proceda, sin cargo alguno.
Para los productos que utilizan lmparas Led, la garanta es de 5 aos. LAMP no garantiza la comercialidad
o idoneidad de los productos para un destino concreto. La responsabilidad de LAMP se limita al precio del
producto defectuosos, y no le ser exigible ninguna otra responsabilidad por garanta o cualquier otro concep-
to, explicita o inexplcita, salvo la aqu establecida. Los productos perdern su garanta en caso de que sean
manipulados por tcnicos no autorizados por LAMP.
5HVHUYDGHSURSLHGDG
LAMP S.A.U. se reserva el derecho de propiedad de todos los materiales que suministre, hasta que el compra-
dor haya satisfecho el pago total de los mismos.
-XULVGLFFLyQ
Para cualquier discrepancia o litigio que se derive de las citadas Condiciones Generales de Venta, ambas par-
tes se someten a la competencia de los Juzgados y Tribunales de Terrassa (Barcelona), con expresa renuncia
a su fuero propio.

127$(VWDWDULIDDQXODODVDQWHULRUHV3UHFLRVYiOLGRVSDUDSHGLGRVFXUVDGRVDSDUWLUGHOGH0DU]RGH
Adscritos a ECOTIC Fundacin para el Medio Ambiente, en aplicacin de la Directiva Comunitaria
&(5$((6SDUDHOUHFLFODMHGHORVUHVtGXRVGHDSDUDWRVHOpFWULFRV\HOHFWUyQLFRVGHLOXPLQD-
cin. El coste de gestin ECORAEE de las luminarias queda asumido por LAMP. Por lo que respeta a
las lmparas incluidas en algunas de nuestras luminarias, se les repercutir la tasa ECORAEE que a su
vez nos aplica el fabricante.
$WWDFKHGWR(&27,&)RXQGDWLRQIRUWKH(QYLURQPHQWDSSO\LQJWKH&RPPXQLW\'LUHFWLYH&(5$((6
for recycling waste from electrical and electronic lighting devices. The ECORAEE economic management cost
of luminaires is borne by LAMP. As regards the Lamps included in some of our luminaires, they shall be subject
to the ECORAEE rate charged to us by the manufacturer.
,QVFULWVDXSUqVG(&27,&)RQGDWLRQSRXUO(QYLURQQHPHQWHQDSSOLFDWLRQGHOD'LUHFWLYHFRPPXQDXWDLUH
&(5$((6SRXUOHUHF\FODJHGHVGpFKHWVGDSSDUHLOVpOHFWULTXHVHWpOHFWURQLTXHVGpFODLUDJH/HFRW
de gestion ECORAEE des luminaires est assum par LAMP. En ce qui concerne les lampes incluses dans cer-
tains de nos luminaires, il leur sera rpercut le cot ECORAEE que nous applique quant lui le fabricant.
0HGLR$PELHQWH(&27,&
239
,QIRUPDFLyQ
CONDICIONES DE VENTA
*HQHUDO7HUPVDQG&RQGLWLRQVRI6DOH
The acceptance by LAMP S.A. of any order implies complete acceptation by the purchaser of these General
Terms and Conditions of Sale.
3ULFHV
3ULFHVVKDOOEHWKRVHDSSOLFDEOHDWWKHGDWHRIUHFHLSWRIWKHRUGHUDSSO\LQJDJUHHGGLVFRXQWV$VSHFLF
quotation must be sought for out-of-catalogue and specially-executed articles.
'HOLYHULHV
The place of delivery of the material ordered and thus that of the associated sale, is always deemed to be
RXUIDFWRU\RUVWRUDJHIDFLOLW\H[ZRUNV*RRGVWKHUHDIWHUWUDYHODWWKHSXUFKDVHUVRZQULVNDQGH[SHQVH
unless the order is accepted on a carriage paid basis. The risks relating to product return will always be
DVVXPHGE\WKHSXUFKDVHU,QWKHHYHQWRIVHULRXVGLIFXOWLHV/$03ZLOOFRYHUWKHRUGHUVGHSHQGLQJRQWKHLU
possibilities.
'HOLYHU\SHULRG
7RSURYLGHRXUFXVWRPHUVZLWKJXLGDQFHRQOLNHO\DYDLODELOLW\RISURGXFWLQRXUZDUHKRXVHZHKDYHFODVVLHG
our products as follows:
Guiding availability term: ZRUNLQJGD\V
(from the date of the formalization of the order)
Guiding availability term: ZRUNLQJGD\V
(from the date of the formalization of the order)
Guiding availability term:WREHGHWHUPLQHGE\/$03
(from the date of the formalization of the order)
The blue dots are indicated before each product code.
&RQUPDWLRQRIGHOLYHU\SHULRGVPXVWEHVRXJKWIRUHDFKRUGHU$OOWKHVHWHUPVFDQEHLQFUHDVHWLQRQHGD\
due to the expedition process. LAMP S.A. shall not be answerable nor liable for any penalty in the case of
failure to meet such delivery periods.
7UDQVSRUW
Unless agreement is reached to the contrary, carriage shall always be borne by the purchaser.
The recipient shall have a duty to examine goods upon receipt and place on record any problems on the
goods delivery note or make a claim with 48 hours to their transport agency if sent on a carriage forward
basis, or to Lamp, if made on a freight paid basis.
&DQFHOODWLRQRIRUGHUV
All cancellations of orders must be made in writing. Should cancellation occur after delivery of an order, it will
be treated as a return, the procedure for which is governed by Clause 10. Specially-executed orders cannot
be cancelled when production thereof has already commenced.
6DPSOHV
All samples of materials must be requested by means of an order and shall be invoiced. When returned,
WKH\VKDOOEHFUHGLWHGLQIXOOXQOHVVGDPDJHGRUPRGLHG
6SHFLDOO\H[HFXWHGRUGHUV
6SHFLFLQTXLULHVRIDQ\RXWRIFDWDORJXHPXVWEHPDGHSULRUWRDQRUGHUEHLQJSODFHGWRDVFHUWDLQLWV
viability, price and delivery period.
*URXSW\SHV
Group 1 Products Group 2 Products Group 3 Products
/LJKWLQJSURMHFWV
We are happy to offer all our customers the free service provided by our 7HFKQLFDO3URMHFWV'HSDUWPHQW
which can carry out a lighting calculation study.
Together with the technical report, you will receive a lighting quotation and plan to assist with the implemen-
tation of the works.
You can also request, free of charge, our lighting calculation program on CD.
5HWXUQV
LAMP S.A. will accept returns of all those goods marked in the price list with a symbol (a single blue dot).
5HTXLUHGSURFHGXUHV
- Customers must have made the original order in writing (fax, e-mail, letter, etc.)
- They must request a return merchandise authorisation (RMA) number from LAMP S.A.
- The relevant goods must not be damaged in any way.
5HWXUQGHDGOLQH
- RMA numbers must be requestedZLWKLQFDOHQGDUGD\VRIWKHGDWHRIVKLSPHQWRIWKHUHOHYDQWJRRGV
- Returns must be made ZLWKLQFDOHQGDUGD\VRIWKHGDWHRIUHFHLSWRIWKH50$QXPEHU(which LAMP
S.A. shall notify in writing).
&RQGLWLRQV
-LAMP S.A. shall be entitled not to accept any return, whatever the reason therefor, in any of the following
cases:
%UHDFKRIUHTXLUHGSURFHGXUHVDQGRUGHDGOLQHV
2XWRIFDWDORJXHLWHPV
6SHFLDOO\H[HFXWHGRUGHUVQRQVWDQGDUGHOHFWULFVPHDVXUHPHQWVHWF
*RRGVSDLQWHGLQQRQVWDQGDUGFRORXUV
*RRGVPDUNHGLQWKHSULFHVOLVWZLWKWKHIROORZLQJV\PEROV (two blue dots) and/or (three blue dots).
- All duly-authorised returns shall be sent to LAMP S.A. carriage paid.
&UHGLWQRWHV
LAMP S.A. shall issue credit notes for all returns which meet each and every one of the above requirements
in respect of procedures, deadlines and conditions for 85% of the originally-invoiced sum. The remaining 15%
shall be set aside to cover the costs in respect of the return (handling, packaging, quality control...
Credit notes arising due to causes other than returns (differences in prices, carriage, errors, etc.) shall also be
subject to the above procedural and deadline requirements, that is, the original order must be made in writing
and the related claim must be made within 90 calendar days of the date of issuing of the invoice.
A further prerequisite is that customer is fully up to date with all its payment duties.
4XDOLW\
$OOSURGXFWVVXSSOLHGE\/$036$KDYHUHFHLYHG&(FHUWLFDWLRQPHHWRWKHUVWDQGDUGVDQGUHJXODWLRQVDQG
have been subject to strict quality controls which guarantee their proper working.
LAMP. S.A. is continually working to improve and update its products. It therefore reserves the right to change,
withdraw or expand its products without prior notice and without this giving rise to the right to make any form of
claim or complaint.
:DUUDQW\
All LAMP S.A. products have a guarantee period against manufacturing defects lasting for 2 years from the
moment of purchase. During this period any of those products shall be repared or replaced free of charge.
For products that use LED lamps, the warranty is 5 years LAMP does not guarantee the commerciality or
VXLWDELOLW\RIWKHSURGXFWVIRUDVSHFLFHQG/$03VUHVSRQVLELOLW\LVOLPLWHGWRWKHSULFHRIWKHGHIHFWLYHSURGXFW
and it cannot be required to take on any other type of responsibility under the guarantee or any other explicit
or inexplicit concept unless it is established here. The products will loose their guarantee if they have been
manipulated by technicians who are not authorised by LAMP.
5HVHUYDWLRQRIWLWOH
LAMP S.A. reserves title over all the goods it supplies until the purchaser has paid for them in full.
-XULVGLFWLRQ
In the case of any disagreement or dispute over these General Terms and Conditions of sale, both parties,
expressly waiving any other jurisdiction, submit themselves to the authority of the Courts and Tribunals of the
city of Terrassa (Barcelona).

1%7KLVSULFHOLVWUHSODFHVDOOSUHYLRXVYHUVLRQV3ULFHVYDOLGIRURUGHUVUHFHLYHGDIWHU0DUFKVW
&RQGLWLRQVJpQpUDOHVGHYHQWH
7RXWHSDVVDWLRQGHFRPPDQGHVLJQLHODFFHSWDWLRQLQWpJUDOHGHODSDUWGHODFKHWHXUGHVSUpVHQWHVFRQGL-
tions gnrales de vente.
3UL[
Les tarifs appliqus seront ceux en vigueur la date de rception de la commande, avec, le cas chant,
les remises dont il aura t convenu. En ce qui concerne les articles hors catalogue et les commandes
spciales, il sera ncessaire de demander expressment les prix.
/LYUDLVRQV
'DQVWRXVOHVFDVFHVWWRXMRXUVQRWUHXVLQHRXQRWUHHQWUHS{WTXLHVWFRQVLGpUpOLHXGHOLYUDLVRQGHVPDU-
chandises, et donc lieu de vente. En consquence, le transport des marchandises est effectu au compte et
DX[ULVTXHVGXFOLHQW/HVULVTXHVUHODWLIVDXUHWRXUGHVSURGXLWVVHURQWWRXMRXUVjODFKDUJHGHODFKHWHXU(Q
FDVGHJUDYHVGLIFXOWpV/$03GRQQHUDVXLWHDX[FRPPDQGHVHQIRQFWLRQGHVHVSRVVLELOLWpV
'pODLVGHGLVSRQLELOLWpIUDQFRXVLQH
$QGHGRQQHUjQRVFOLHQWVXQHRULHQWDWLRQGHODGLVSRQLELOLWpGHVSURGXLWVGDQVQRWUHVWRFNQRXVDYRQV
class nos rfrences de la faon suivante:
Dlai de disponibilit indicatif: MRXUVRXYUDEOHV
( partir de la saisie de commande)
Dlai de disponibilit indicatif: MRXUVRXYUDEOHV
( partir de la saisie de commande)
Dlai de disponibilit indicatif: jGpWHUPLQHUSDU/$03
( partir de la saisie de commande)
Les points bleus sont indiqus avant le code de chaque rfrence.
/HVGpODLVGHOLYUDLVRQGHYURQWrWUHFRQUPpVSRXUFKDTXHFRPPDQGH7RXVFHVGpODLVSHXYHQWrWUHYDULD-
EOHjXQMRXUSUpVGXVDX[SURFHVVXVGH[SpGLWLRQLAMP S.A. ne sera pas tenue responsable et ne sera
pas pnalise pour manquement ces dlais.
7UDQVSRUW
/HVSRUWVVHURQWjODFKDUJHGHODFKHWHXUH[FHSWpGDQVOHVFDVROHFRQWUDLUHDXUDpWpH[SUHVVpPHQW
convenu.
/HGHVWLQDWDLUHDOREOLJDWLRQGH[DPLQHUODPDUFKDQGLVHjVRQDUULYpHHWOHFDVpFKpDQWGLQGLTXHUOHV
SUREOqPHVVXUOHERUGHUHDXGHOLYUDLVRQRXGHIIHFWXHUVRXVKHXUHVXQHUpFODPDWLRQjVRQDJHQFHGH
WUDQVSRUWVLOH[SpGLWLRQVHVWIDLWHHQSRUWGRXj/DPSVLHOOHVHVWIDLWHWRXVSRUWVSD\pV
$QQXODWLRQGHFRPPDQGH
/HVDQQXODWLRQVGHFRPPDQGHVHURQWHIIHFWXpHVSDUpFULW6LODQQXODWLRQLQWHUYLHQWDSUqVOH[SpGLWLRQGHOD
commande, elle sera traite en tant que retour de marchandises selon les conditions expliques au point
/HVFRPPDQGHVVSpFLDOHVQHSHXYHQWIDLUHOREMHWGXQHDQQXODWLRQVLOHSURFHVVXVGHIDEULFDWLRQDGpMj
commenc.
eFKDQWLOORQV
/HVpFKDQWLOORQVGHPDWpULHOIHURQWOREMHWGXQHFRPPDQGHHQERQQHHWGXHIRUPHHWVHURQWIDFWXUpV8QH
IRLVUHWRXUQpLOVVHURQWLQWpJUDOHPHQWUHPERXUVpVVDXIVLOVRQWVXELGHVGRPPDJHVRXGHVPRGLFDWLRQV
&RPPDQGHVVSpFLDOHV
7RXWHFRPPDQGHKRUVFDWDORJXHGHPDQGDQWXQHIDEULFDWLRQVSpFLDOHIHUDOREMHWGXQHFRQVXOWDWLRQLQGLYL-
GXDOLVpHSHUPHWWDQWGHQGpWHUPLQHUODYLDELOLWpOHSUL[HWOHGpODLGHOLYUDLVRQ
'LVWLQFWLRQGHJURXSH
Famille de groupe 1 Famille de groupe 2 Famille de groupe 3
3URMHWVGpFODLUDJH
Nous tenons la disposition de nos clients le service gratuit de notre Dpartement technique de Projets, qui
GpYHORSSHUDVXUGHPDQGHXQHpWXGHGHFDOFXOGpFODLUDJH
8QUDSSRUWWHFKQLTXHDXTXHOVHURQWMRLQWVXQGHYLVHWXQSODQGHVWLQpjIDFLOLWHUOH[pFXWLRQGHVWUDYDX[VHUD
alors remis au client.
9RXVSRXYH]GHPDQGHUJUDWXLWHPHQWQRWUHSURJUDPPHGHFDOFXOGpFODLUDJH
6HUYLFHGHUHWRXUGHVPDUFKDQGLVHV
/$036$DFFHSWHOHUHWRXUGHWRXWHVOHVPDUFKDQGLVHVJXUDQWGDQVODOLVWHGHVSUL[DXF{WpGXV\PERO
(un seul point bleu).

&RQGLWLRQVIRUPHOOHV
- Le client doit avoir formul sa commande originale par crit (fax, e-mail, lettre....)
- Il doit avoir demand LAMP S.A. un QXPpURGDXWRULVDWLRQGHUHWRXUGHPDUFKDQGLVHV
- Les marchandises ne doivent avoir subi DXFXQGRPPDJH
'pODLV:
/HGpODLGHGHPDQGHGXQXPpURGDXWRULVDWLRQGHUHWRXUVHUDDXPD[LPXPGHMRXUVFLYLOVjFRPSWHUGH
ODGDWHGH[SpGLWLRQGHVPDUFKDQGLVHV
- Le dlai de retour des marchandises sera au PD[LPXPGHMRXUVFLYLOVjFRPSWHUGHODGDWHGHUpFHS-
WLRQGXQXPpURGDXWRULVDWLRQGHUHWRXUTXLDXUDpWpQRWLpSDUpFULWSDU/$036$
&RQGLWLRQV
-LAMP S.A.VHUDHQGURLWGHQDFFHSWHUDXFXQUHWRXUGHPDUFKDQGLVHVTXHOTXHVRLWOHPRWLIGHGHPDQGHGH
celui-ci, dans les cas suivants :
0DQTXHPHQWDX[FRQGLWLRQVIRUPHOOHVHWRXDXGpODLV
0DUFKDQGLVHVKRUVFDWDORJXH
)DEULFDWLRQVVSpFLDOHVpOHFWULFDWLRQPHVXUHVHWFKRUVVWDQGDUG
0DWpULHOSHLQWGDQVGHVFRXOHXUVKRUVVWDQGDUG
0DWpULHOJXUDQWVXUODOLVWHGHVSUL[DXF{WpGXV\PEROH (deux points bleus) et/ou (trois points
bleus).
- Les retours de marchandise dment autoriss seront adresss LAMP S.A. tous ports pays
5HPERXUVHPHQWV :
LAMP S.A. remboursera les retours de marchandiseUHPSOLVVDQWWRXWHVOHVFRQGLWLRQVIRUPHOOHVGHGpODLV
HWWRXWHVOHVFRQGLWLRQVJpQpUDOHV hauteur de GXPRQWDQWIDFWXUpDXGpSDUW. Les 15 % restants
seront destins supporter les cots engendrs par le retour des marchandises (manipulation, emballage,
contrle de qualit)
Les remboursements drivs de causes autres que des retours de marchandise (diffrences de prix, ports,
erreurs, etc.) seront eux aussi soumis des conditions formelles et des conditions de dlais. Ainsi, la com-
mande de dpart devra avoir t formule par crit et la rclamation devra tre effectue sous MRXUVFLYLOV
jFRPSWHUGHODGDWHGH[SpGLWLRQGHODIDFWXUH
Pour tre rembours, le client devra imprativement avoir rgl tous ses paiements.
4XDOLWp
Tous les produits fournis par LAMP S.A.VRQWFRQIRUPHVjODFHUWLFDWLRQ&(DLQVLTXjGDXWUHVQRUPHVHWRQW
t soumis de rigoureux contrles de qualit qui garantissent leur parfait fonctionnement.
LAMP. S.A.VHIIRUFHHQSHUPDQHQFHGDPpOLRUHUHWGHSHUIHFWLRQQHUVHVSURGXLWVUDLVRQSRXUODTXHOOHQRXV
QRXVUpVHUYRQVOHGURLWGHPRGLHUVXSSULPHURXFRPSOpWHUQRVSURGXLWVVDQVSUpDYLVHWVDQVTXHFHODSXLVVH
constituer un motif de rclamation.
*DUDQWLH
Tous les produits de LAMP S.A.EpQpFLHQWGXQHSpULRGHGHJDUDQWLHFRQWUHOHVYLFHVGHIDEULFDWLRQGHDQV
compter du moment de leur achat. Durant cette priode, ils seront repars ou remplacs sans aucun frais.
Pour les produits qui utilisent des lampes LED, la garantie est tendue 5 ans. LAMP ne saurait garantir le ca-
UDFWqUHFRPPHUFLDOLVDEOHRXDSSURSULpGHVSURGXLWVSRXUXQHQFRQFUqWH/DUHVSRQVDELOLWpGH/$03VHOLPLWH
au prix du produit dfectueux et aucune autre responsabilit ne pourra lui tre exige au titre de la garantie
RXDXWUHH[SOLFLWHRXLPSOLFLWHVDXIFHOOH[pHDX[SUpVHQWHV/HVSURGXLWVSHUGURQWOHXUJDUDQWLHHQFDVGH
manipulation par des techniciens non autoriss par LAMP.
5pVHUYHGHSURSULpWp
/$036$FRQVHUYHODSURSULpWpGHVPDUFKDQGLVHVMXVTXjOHXUSDLHPHQWLQWpJUDOGHODSDUWGXFOLHQW
-XULGLFWLRQ
Pour tout diffrend ou litige relatif aux prsentes Conditions Gnrales de Vente, les parties seront soumises
la juridiction du Tribunal de Terrassa (province de Barcelone, Espagne) et renonceront expressment aux
autres tribunaux dans le ressort desquels ils pourraient se trouver.
127(&HWDULIDQQXOHOHVSUpFpGHQWV3UL[HQYLJXHXUDXSUHPLHU0DUV
Edita:
Published by:
Edition:
LAMP S.A.
&RUGLQDFLyQ'LVHxR*UiFR0DTXHWDFLyQ\5HGDFFLyQ
Co-ordination, Graphic Desing, Layout and Editorial:
Coordination, Design Graphique, Maquete et Rdaction:
Dept. Marketing LAMP
)RWRJUDD
Photography:
Photographie:
Xavier Graells, Miquel Llonch, Dept. Marketing LAMP,
Pablo Sarabia, Jose Manuel Bielsa, Santos-Diez,
Pablo Arza, Joan Villaplana, Biel Calafat, Jordi Pujol,
Marc Sellars, Emma Faucheux, Joan Roig, Julien
Daviron, Isabel Marqus, Rafael Vargas, Meritxell Ar-
jalaguer, Maria de Miguel.
Impresin:
Printed by:
Impression:
/LWRJUDD5RVpV
Depsito legal:
Legal reserves:
Marque dpose:
B-1819-2011
LAMP 9500250, (01/2012)
LAMP EUROPA
LAMP HEADQUARTER
Crdoba, 16
08226 TERRASSA (Spain)
T. 902 20 40 10 (Desde Espaa)
T. +34 93 736 68 00 (From broad)
F. +34 937 86 15 51
lamp@lamp.es
LAMP FRANCE
Zac Garossos
100 Rue de Riou
31700 BEAUZELLE (France)
T. +33 (0) 5 62 13 91 14
F. +33 (0) 5 61 25 46 63
france@lamp.es
LAMP UK
Bromwich House, Flat n1
45 Richmond Hill
Richmond, Greater LONDON
TW10 6RU
T. +44 (0) 2036 016030
M. +44 (0) 7585 448258
uk@lamp.es
LAMP BALTICS
Satiju km., Abrikosu 14,
KAUNPO raj., LT-54432, (Lituania)
T. +370 37 470005
M. +370 61698739
baltics@lamp.es
LAMP AMERICA
LAMP CHILE
DILAMPSA
Exequiel Fernndez, 2251 Macul
SANTIAGO (Chile)
T. 2371770-2371762-2389538
F. 3755273
chile@lamp.cl
LAMP MXICO
VOLTA G
Medicina No.5 Copilco Universidad
04360 MXICO DF (Mxico)
T. (52 55) 5339 5010
F, (52 55) 5659 3193
mexico@lamp.es
LAMP COLOMBIA
Carrera 55 A N 128 A 48
BOGOT (Colombia)
T / F +57 (1) 2717024
colombia@lamp.com.co
LAMP ASIA - OCEANIA
LAMP CHINA - SALES OFFICE
Rm. 1609, Building C, Focus International Center,
No. 6 Fu Tong East Street, Chaoyang District,
Post Code: 100102
BEIJING (China)
T. +86 10 84785877 / +86 10 84785977
F. +86 10 84780876
china@lamp.es

6 C1609 100102
+{86 10) 8478 5877 +{86 10) 8478 5977 - +{86 10) 8478 0876
LAMP CHINA - FACTORY
3DUWRIVWRRU1RRI+XDML5RDG
Siji, Ronggui Town, Shunde District, Foshan City,
Guangdong Province, P.R.C. (China)
T. +86 757 266 17 690
F. +86 159 89 962 125
china@lamp.es

+86 757.266.17.690 - +86 757.266.17.692


LAMP ASIA - PACIFIC
2/179 17 Floor, The Royal Place 1
Soi Mahat Lek Luang 1
Lumpini, Pathumwan, BANGKOK 10330
T. +66 81 692 8066
DVLDSDFLF#ODPSHV
LAMP MIDDLE EST
Al Mesk Tower - Ap.2402
P.O. BOX 212239 Dubai Marina - DUBAI UAE
T. +971 50 2530223
uae@lamp.es
Crdoba 16, 08226 Terrassa (Barcelona) SPAIN / T +34 93 736 68 00 / F +34 93 786 15 51
lamp@lamp.es / lamp.es