You are on page 1of 250

CARACTERIZACIÓN DE NUEVAS XILANASAS BACTERIANAS.

INGENIERÍA DE ENZIMAS CON LA XILANASA B DE


PAENIBACILLUS BARCINONENSIS

Tesis Doctoral
Óscar Gallardo Román
Barcelona, 2007
UNIVERSITAT DE BARCELONA
FACULTAT DE BIOLOGIA
DEPARTAMENT DE MICROBIOLOGIA

CARACTERIZACIÓN DE NUEVAS XILANASAS BACTERIANAS.


INGENIERÍA DE ENZIMAS CON LA XILANASA B DE
PAENIBACILLUS BARCINONENSIS

Memoria presentada por Óscar Gallardo Román para optar al grado de Doctor por la
Universitat de Barcelona

Programa de doctorado: Microbiologia Ambiental i Biotecnologia (1999 – 2001)

Tesis realizada bajo la dirección del Dr. Francisco I. Javier Pastor Blasco, en el
Departamento de Microbiología de la Universitat de Barcelona.

VºBº del Director de Tesis Memoria presentada por

Dr. Francisco I. Javier Pastor Blasco Óscar Gallardo Román

Barcelona, Octubre del 2007


AGRADECIMIENTOS
En primer lugar quiero dar mi más sincero Mil gracias también a toda la gente del LoKal
agradecimiento al Dr. Francisco I. Javier por su cariño, su amistad y su comprensión
Pastor, por haber dirigido este trabajo de tesis. durante tantos años, y en especial a Xavier
Sin su guía, su apoyo y su comprensión en los Cuartiella, alma pater del LoKal.
momentos difíciles este trabajo no habría sido
posible. Y como no, darles las gracias a mis padres,
Antonio y Pilar, a mi hermana, Mª Eugenia, y
Quiero darles las gracias también al resto de a toda mi familia por haberme apoyado
los compañeros que han pasado por el grupo incondicionalmente desde el día en que nací.
de investigación a lo largo de estos años, por
su ayuda, su apoyo y su amistad, a la Dra.
Pilar Díaz, a Marga, Marta, Núria P., Pere,
Cristina, Iulia, Serena, Arnau, Noelia, Nikolia,
Eric, y en especial a Cristian, que lleva
soportándome desde que nos conocimos en el
instituto.

Mi agradecimiento también al Dr. Julio


Polaina, y a los integrantes de su grupo de
investigación durante mi estancia en València,
Txiqui, Maela, Ana-Cris y Lorena.

También quiero agradecerles su amistad y los


buenos momentos compartidos dento y fuera
del departamento a Xavi Bonjoch, Quim,
Marc, Javi del Campo, Núria F., Laura y
Sonia.

También dar las gracias a Natalia, Sandra,


Rocío, Markus, Pili, Silvia, Nestor, Ayalke,
Rosa, Tony, Cristina Garcia, Xavi Vilanova,
Salva, Núria J., Damir, Unai, Lluis, y al resto
de compañeros del Departamento de
Microbiología, por compartir tantas horas de
trabajo y tantas cenas.
ABREVIATURAS
Abreviatura Definición
Å ångström
ADN ácido desoxiribonucleico
Amp ampicilina
AOX adsorbable organic halogens
ARN ácido ribonucleico
Bl % ISO porcentaje de blancura ISO
bp pares de bases
BSA seroalbúmina bovina
C- control negativo
C+ control positivo
CBD cellulose binding domain (dominio de unión a celulosa)
CBM carbohydrate binding module (módulo de unión a carbohidratos)
Cm cloramfenicol
CMC carboximetil celulosa
Da dalton
ECF elemental chlorine free
et al. y otros / y colaboradores
FDA food and drug administration
FPLC fast protein liquid chromatography
g gramo
GRAS generally recognized as safe
h hora
HexA ácidos hexenurónicos
ICDH isocitrato deshidrogenasa
Ik índice kappa
IPTG isopropil-β-tiogalactopiranósido
ISO international organization for standardization
kb kilobases
kDa kilodalton
Km kanamicina
kPa kilopascal
l litro
M molar (mol/l)
MDH malato deshidrogenasa
mg miligramo
min minuto
ml mililitro
Abreviatura Definición
mM milimolar
MP motivo Pir
MPa megapascales
ng nanogramo
nm nanómetro
o orto
oNPX oNitrofenil-β-D-Xilopiranósido
p para
PEG polietilenglicol
pg picogramo
pI punto isoeléctrico
pNAf pNitrofenil-α-L-Arabinofuranósido
pNAp pNitrofenil-α-L-Arabinopiranósido
pNPG pNitrofenil-β-D-Glucopiranósido
pNPG2 pNitrofenil-β-Celobiósido
pNPG3 pNitrofenil-β-Celotriósido
pNPG4 pNitrofenil-β-Celotetraósido
pNPG5 pNitrofenil-β-Celopentaósido
pNPX pNitrofenil-β-D-Xilopiranósido
psi pound per square inch (libra por pulgada cuadrada)
r.p.m. revoluciones por minuto
RBB Remazol Brilliant Blue
SDS PAGE electroforesis en geles de poliacrilamida con dodecil sulfato sódico
sp. especie
ssp. subespecie
TCF total chlorine free
U unidad de actividad
V voltios
W vatios
X gal 5 bromo-4-cloro-3-indolil-β-D-galactopiranósido
XBD xylan binding domains (dominios de unión a xilano)
µg microgramo
µl microlitro
µm micrómetro / micra
µM micromolar
μmol micromol
I
ÍNDICE
I

Introducción 1
1. Introducción...................................................................................... .......................3
1.1. La pared celular vegetal.........................................................................................3
1.1.1. Estructura y composición................................................................... ......................3
1.1.2. Celulosa.............................................................................................................. ......5
1.1.3. Hemicelulosas................................................................................... .......................5
1.1.4. Pectinas............................................................................................ ........................7
1.1.5. Lignina................................................................................................ .....................8
1.2. El xilano.................................................................................................................9
1.3. Enzimas degradadoras de xilano..........................................................................11
1.3.1. β-xilosidasas............................................................................................... ............12
1.3.2. α-L-arabinofuranosidasas.................................................................. .....................13
1.3.3. α-D-glucuronidasas...................................................................... ..........................13
1.3.4. Esterasas....................................................................................................... ..........13
1.4. Xilanasas..............................................................................................................14
1.4.1. Características generales........................................................................................ .14
1.4.2. Clasificación de las xilanasas.......................................................... .......................16
1.4.3. Mecanismo catalítico...................................................................................... ........18
1.4.4. Estructura....................................................................................... ........................20
1.4.5. Aplicaciones de las xilanasas................................................................................. .26
2 - Objetivos e interés del trabajo realizado............................................................ .31
2.1. Clonación e identificación de xilanasas de Bacillus sp. BP-7.............................31
2.2. Caracterización de la xilanasa B (XynB) de Paenibacillus barcinonensis y
sobreexpresión en huéspedes homólogos...................................................................31
2.3. Estudio estructural e ingeniería de proteínas con XynB de Paenibacillus
barcinonensis..............................................................................................................32

Materiales y Métodos 33
1. Microorganismos utilizados........................................................................ ..........35
2. Cultivo y mantenimiento de microorganismos............................................... .....35
2.1. Medios de cultivo.................................................................................................35
2.2. Mantenimiento de cepas......................................................................................38
2.3. Fraccionamiento celular.......................................................................................38
2.3.1. Sonicación............................................................................................... ...............38
2.3.2. French Press................................................................................ ..........................38
2.3.3. Lisis celular seguida de ultracentrifugación......................................................... ...39
3. Ensayos de actividad enzimática......................................................................... .39
3.1. Determinación de actividad hidrolítica sobre polisacáridos mediante el método
de Nelson-Somogyi.....................................................................................................39
3.2. Ensayo cromogénico de actividad xilanasa.........................................................41
3.3. Ensayo de actividad sobre aril derivados.............................................................42
3.4. Determinación del pH óptimo..............................................................................43
3.5. Determinación de la temperatura óptima.............................................................43
II

3.6. Cuantificación de la actividad malato deshidrogenasa........................................43


3.7. Cuantificación de la actividad isocitrato deshidrogenasa....................................44
4. Vectores plasmídicos utilizados.............................................................. .............45
5. Análisis y manipulación del ADN recombinante........................ .........................46
5.1. Extracción de ADN plasmídico...........................................................................46
5.1.1. Minipreparación de ADN plasmídico por lisis alcalina........................ ..................46
5.1.2. Midipreparación de ADN plasmídico.......................................................... ...........46
5.2. Digestión con enzimas de restricción y tratamiento con RNAsa.........................47
5.2.1. Digestión con enzimas de restricción........................................... ..........................47
5.2.1. Tratamiento con RNAsa......................................................................... ................47
5.3. Ligación de moléculas de ADN...........................................................................47
5.4. Amplificación por PCR........................................................................................47
5.4.1. Amplificación de alta fidelidad.................................................. ............................47
5.4.2. PCR mutagénica........................................................................................ .............48
5.5. Gene Shuffling (recombinación in vitro por PCR)...............................................48
5.6. Transformación....................................................................................................51
5.6.1. Transformación de Escherichia coli....................................................... ................51
5.6.2. Transformación de Bacillus subtilis........................................................................ 51
6. Secuenciación y análisis de secuencia........................................................... .....53
6.1. Secuenciación......................................................................................................53
6.2. Análisis informático de secuencias......................................................................53
7. Dicroismo circular............................................................................................... ...54
8. Análisis electroforético.......................................................................................... 54
8.1. Electroforesis en geles de poliacrilamida desnaturalizantes................................54
8.2. Electroforesis en geles de poliacrilamida en condiciones nativas.......................55
8.3. Tinción de proteínas con azul de Coomassie.......................................................56
8.4. Revelado zimográfico (zimograma)....................................................................56
8.5. Isoelectroenfoque.................................................................................................57
8.6. Electroforesis y transferencia de proteínas para su secuenciación N-terminal....57
8.7. Electroforesis en geles de agarosa.......................................................................58
9. Purificación de proteínas........................................................... ...........................59
9.1. Preparación de las muestras.................................................................................59
9.2. Cromatografía en columna...................................................................................60
9.2.1. Cromatografía de gel filtración......................................................................... ......60
9.2.2. Cromatografía de intercambio iónico.............................................. .......................61
9.2.3. Tercer paso opcional de cromatografía.......................................................... .........61
9.3. Concentración de proteínas por ultrafiltración....................................................62

Capítulo I. La xilanasa XynA de Bacillus sp. BP-7 63


1. - Introducción y Objetivos...................................................................... ...............65
2. - Resultados............................................................................. ..............................65
2.1. Clonación e identificación de xilanasas de Bacillus sp. BP-7.............................65
2.1.1. Construcción y escrutinio de la genoteca de Bacillus sp. BP-7............................. ..65
III

2.1.2. Análisis de los clones con actividad xilanasa............................... ..........................67


2.1.2.1. - Análisis de los plásmidos recombinantes.............................................................67
2.1.2.2. - Subclonaje del inserto de pXA3............................................................................67
2.1.3. Secuenciación e identificación del gen xynA.................................. .......................68
2.2. Caracterización bioquímica de la xilanasa XynA de Bacillus sp. BP-7..............70
2.2.1. Determinación del peso molecular y del punto isoeléctrico.............................. ......70
2.2.2. Propiedades enzimáticas.................................................................................. .......71
2.2.2.1. - Especificidad de sustrato.......................................................................................71
2.2.2.2. - pH óptimo y Temperatura óptima.........................................................................72
2.2.2.3. - Termorresistencia..................................................................................................73
2.2.2.4. - Influencia de iones metálicos sobre la actividad..................................................73
2.3. Expresión de la xilanasa XynA en levadura........................................................74
2.3.1. Antecedentes................................................................................... .......................74
2.3.2. Análisis de actividad de los clones recombinantes......................... ........................76
2.3.3. - Localización celular........................................................................ .....................77

Capítulo II. Las xilanasas YnfF y XynD de Bacillus sp. BP-7 79


1. - Introducción y Objetivos...................................................................... ...............81
2. - Resultados............................................................................. ..............................81
2.1. Aislamiento de las xilanasas del clon Escherichia coli/pXA5............................81
2.1.1. Subclonaje del inserto del plásmido pXA5.................................................... .........81
2.1.2. Secuenciación e identificación de los genes de pXA5............................. ...............82
2.1.2.1.- Secuencia y homología de xynD de Bacillus sp. BP-7..........................................83
2.1.2.1.- Secuencia y homología de ynfF de Bacillus sp. BP-7...........................................83
2.1.2. Aislamiento de los genes xynD e ynfF de Bacillus sp. BP-7..................................87
2.2. Caracterización bioquímica de la enzima YnfF de Bacillus sp. BP-7.................88
2.2.1. Determinación del peso molecular.......................................................................... 88
2.2.2. Propiedades enzimáticas.................................................................................. .......89
2.2.2.1. - Especificidad de sustrato.......................................................................................89
2.2.2.2. - pH óptimo y Temperatura óptima........................................................................89
2.2.2.3. - Termorresistencia..................................................................................................90
2.2.2.4. - Influencia de iones metálicos sobre la actividad..................................................91

Capítulo III. Estudio de la xilanasa XynB de Paenibacillus


barcinonensis 93
1. - Introducción y Objetivos...................................................................... ...............95
2. - Resultados............................................................................. ..............................95
2.1. Especificidad de sustrato de XynB de Paenibacillus barcinonensis...................95
2.2. Producción de XynB de Paenibacillus barcinonensis en huéspedes homólogos96
2.2.1. Clonación en vectores lanzadera E. coli-Bacillus subtilis.....................................96
2.2.1.1. - Amplificación de xynB para su clonación en Escherichia coli............................96
2.2.1.2. - Transformación en las cepas de Bacillus subtilis MB216 y MW15.....................98
2.2.2. Expresión en Bacillus subtilis............................................................................ .....99
IV

2.2.2.1. - Análisis de expresión de la xilanasa en las cepas recombinantes de Bacillus


subtilis...................................................................................................................................99
2.2.2.2. - Expresión en diferentes medios de cultivo.........................................................100
2.3. Localización celular de XynB............................................................................101
2.3.1. Localización de XynB en Bacillus subtilis MW15/pRBSPO2X20.......................101
2.3.2. Localización de XynB en Paenibacillus barcinonensis.............................. ..........102
2.3.3. Análisis de péptido señal................................................................... ..................106
2.4. Estudio de las homologías de XynB..................................................................108
2.4.1. Homologías de XynB...................................................................... .....................108

Capítulo IV. Ingeniería de Proteínas con la xilanasa XynB de


Paenibacillus barcinonensis 111
1. - Introducción y Objetivos................................................................... ................113
2. - Resultados.......................................................................... ...............................113
2.1. Análisis estructural y funcional de XynB de Paenibacillus barcinonensis ......113
2.1.1 Análisis de la estructura primaria.................................................. ........................113
2.1.2. Predicción de estructura secundaria y terciaria........................................ .............114
2.1.3. Mutagénesis dirigida................................................................. ...........................116
2.2. Purificación y cristalización de XynB...............................................................117
2.2.1. Obtención de clones sobreproductores de XynB.......................... ........................117
2.2.2. Resultados de cristalografía........................................................................ ..........119
2.3. Aumento de la termorresistencia de XynB de Paenibacillus barcinonensis.....121
2.3.1 Mutagénesis aleatoria.......................................................................... ..................121
2.3.2 Selección de mutantes termorresistentes............................................................... .122
2.3.3 Secuenciación de los mutantes seleccionados y aislamiento de las mutaciones.....125
2.3.4 Purificación de las xilanasas mutantes............................................................. ......127
2.3.5 Termoestabilidad de las xilanasas mutantes................................ ..........................128
2.3.6 Obtención de dobles mutantes................................................................ ...............129
2.3.7 Purificación y ensayos de termoestabilidad de las xilanasas dobles mutantes.......131
2.3.8 Efectos de las mutaciones sobre la estructura de XynB............................ .............132
2.3.9 Estudio de las constantes cinéticas de XynB y de las xilanasas mutantes..............133

Anexo I. Aplicación de las xilanasas estudiadas en el Blanqueo


de la Pasta de Papel 135
1. - Introducción y Objetivos................................................................... ................137
2. - Resultados y Discusión.................................................................................. ...137
2.1. Producción en fermentador de las xilanasas a evaluar.......................................137
2.2. Determinaciones de actividad enzimática..........................................................138
2.3. Ensayos papeleros..............................................................................................138
2.3.1. Características de las pastas papeleras..................................................... .............138
2.3.2. Secuencia de blanqueo XDP............................................................................ .....139
2.3.3. Secuencia de blanqueo XDEOPD1................................................................... ....140
V

Discusión 143
1. Xilanasas de Bacillus sp. BP-7............................................................................ 145
1.1.- Identificación y caracterización de XynA........................................................145
1.2.- Identificación y caracterización de YnfF..........................................................146
1.3.- Identificación de XynD....................................................................................148
1.4.- Sistema xilanolítico de Bacillus sp. BP-7.........................................................149
1.5.- Expresión de xilanasas en levaduras................................................................150
2. XynB de Paenibacillus barcinonensis ................................................... ............152
2.1. Expresión en huéspedes homólogos..................................................................152
2.2. Localización celular...........................................................................................154
2.3. Relación estructura-función...............................................................................158
2.4. Termoestabilidad................................................................................................161
3. Aplicación de las xilanasas estudiadas en el blanqueo de la pasta de papel.165

Conclusiones 167

Bibliografía 171
A........................................................................................................... .....................173
B........................................................................................................... .....................173
C........................................................................................................... .....................176
D........................................................................................................... .....................177
E..................................................................................................... ...........................178
F............................................................................................................................... ..178
G................................................................................................................. ...............179
H........................................................................................................... .....................180
I.......................................................................................................................... ........181
J......................................................................................................................... ........181
K........................................................................................................... .....................182
L............................................................................................................................... ..183
M....................................................................................................................... .........184
N........................................................................................................... .....................185
O................................................................................................................. ...............186
P..................................................................................................... ...........................186
Q................................................................................................................. ...............188
R........................................................................................................... .....................188
S..................................................................................................... ...........................188
T............................................................................................................................... ..191
U........................................................................................................... .....................192
V..................................................................................................... ...........................192
W................................................................................................... ............................193
Y..................................................................................................... ...........................193
Z............................................................................................................................... ..194
VI

Publicaciones 195
INTRODUCCIÓN
2 µm
3

excesiva expansión de la célula debida a la


1. INTRODUCCIÓN entrada y circulación de agua, actúa de barrera
El trabajo de la presente tesis doctoral se frente a patógenos y es el compartimento
centra en el estudio de xilanasas microbianas. celular que media todas las relaciones de la
Como enzimas que son, las xilanasas son célula vegetal con el entorno.
biocatalizadores (incrementan la velocidad de
las reacciones químicas al reducir la energía de
1.1.1. Estructura y composición
activación necesaria para la transformación de
La pared celular vegetal es una red compleja
sustratos en productos), que catalizan la
altamente organizada, formada por
degradación del xilano, polisacárido abundante
microfibrillas de celulosa unidas entre sí por
en la pared celular vegetal.
hemicelulosas, embebidas en una matriz
Debido a esta propiedad y al uso frecuente de
gelatinosa de sustancias pécticas, y reforzada
materiales de origen vegetal en la industria, las
por glicoproteínas estructurales y, en
xilanasas presentan, además de su interés
ocasiones, por compuestos aromáticos como la
científico, un gran interés a nivel
lignina.
biotecnológico. En este sentido, la aplicación
industrial de xilanasas, al igual que la de
La pared celular vegetal se estructura en tres
muchas otras enzimas (como proteasas,
partes fundamentales (Figura IN.1.1):
amilasas y celulasas), presenta claras ventajas
– Lámina media: es la primera capa que se
respecto a los procesos industriales
deposita durante la división celular vegetal,
convencionales, como pueden ser la elevada
y una vez completada ésta queda
eficiencia, su bajo impacto medioambiental y
localizada entre las paredes primarias de
su rentabilidad económica (Ahuja et al., 2004;
las células resultantes. Está formada
Schäfer et al., 2007).
principalmente por sustancias pécticas, que
cementan las paredes primarias de células
1.1. La pared celular vegetal adyacentes manteniendo la unión entre

La pared celular de las células vegetales se éstas (Zarra y Revilla, 1993; Heredia et al.,

localiza en la zona exterior de la célula, en 1995).

contacto íntimo con la membrana plasmática. – Pared primaria: está presente en todas las

Proporciona rigidez, soporte estructural y células vegetales y es producto de la

mecánico a las células, determinando la acumulación de microfibrillas de celulosa,

morfología y el crecimiento celular, y por orientadas en diversas direcciones,

tanto, en última instancia, la arquitectura de la formando una red relativamente laxa que

planta. Además, la pared celular previene la permite el crecimiento celular.


4

Esta compuesta por celulosa, – Pared secundaria: cuando existe, es la capa


hemicelulosas, pectina y en menor medida más adyacente a la membrana plasmática.
por glicoproteínas estructurales (como Se forma en algunos tipos celulares
extensinas y lectinas) unidas entre ellas o vegetales una vez se ha detenido el
con los polisacáridos mediante enlaces crecimiento celular, y generalmente está
covalentes, y otras proteínas solubles formada por 3 subcapas: S1 (la más
(como enzimas y proteínas externa), S2 y S3 (la más interna).
transportadoras). La pared primaria A diferencia de la pared primaria, contiene
continua creciendo en área y espesor una mayor proporción de celulosa, una
mientras las células crecen en tamaño baja cantidad de hemicelulosas y, en
(Goodwin y Mercer, 1983; Smith, 1993). algunos tipos celulares (como las fibras de
xilema y las traqueidas), lignina y/o ceras

Lámina media
Pared secundaria

Pared primaria
1 μm

Pectina

Lámina media

Pared primaria

Membrana plasmática
Hemicelulosas

Proteína fibrilar

Microfibrilla de celulosa

Proteína soluble

Figura IN.1.1: Esquema de la pared celular de una célula vegetal en crecimiento, e imagen de microscopía
electrónica de transmisión de la pared celular en células de tejidos rígidos.
5

(suberina y cutina). Resulta así una contener microfibrillas de mananos o de


estructura más gruesa y compacta que la xilanos β(1→3).
pared primaria, proporcionando una mayor
rigidez y resistencia (Heredia et al., 1995; Es un homopolímero lineal no ramificado
Smith, 1993). formado por moléculas de β-D-glucosa unidas
entre sí por enlaces glucosídicos β(1→4), en el
Los principales polímeros que componen la que cada residuo de D-glucosa presenta una
pared celular vegetal son pues la celulosa, la rotación de 180º respecto al residuo anterior,
pectina, las hemicelulosas y la lignina, que en por lo que la unidad estructural básica
conjunto constituyen la denominada repetitiva de la celulosa es la celobiosa
lignocelulosa (Thomson, 1993; Heredia et al., (formada por 2 residuos de D-glucosa) y no la
1995; Wong et al., 1998). D-glucosa (Delmer y Amor, 1995).
La constitución molecular y estructural precisa Las cadenas de celulosa se encuentran
de la pared celular depende del tipo de célula, asociadas entre sí intra e intermolecularmente
tejido y especie vegetal, siendo más variable la mediante puentes de hidrógeno y fuerzas de
composición de la pared celular secundaria van der Waals, dando lugar a una estructura
(que en algunos tipos celulares es inexistente) fibrilar rígida, insoluble y cristalina
que la de la pared celular primaria. De esta denominada microfibrilla (Figura IN.1.2).
manera, a pesar de las variaciones, una pared Cada microfibrilla de celulosa está formada
celular primaria típica en las dicotiledóneas por unas 36 cadenas de celulosa, y su diámetro
estaría formada por un 25 - 30% de celulosa, es de unos 3 nm (Lerouxel et al., 2006).
un 20 - 35% de hemicelulosa, un 35% de
pectina y un 5 - 10% de proteínas, en base al
1.1.3. Hemicelulosas
peso seco (Kolek y Kozinka, 1992; Fry, 2001).
Las hemicelulosas son polisacáridos
heterogéneos, neutros, que presentan una
1.1.2. Celulosa cadena principal con ramificaciones cortas.
La celulosa es el componente más abundante Suponen habitualmente el 20 - 35% del peso
de la biomasa vegetal, y se considera el seco de la pared celular vegetal (De Vries y
biopolímero más abundante de la Tierra Visser, 2001), donde, juntamente con la
(Saxena y Brown, 2005). Se encuentra pectina, la lignina y las proteínas, constituyen
formando parte de la denominada fase la denominada matriz amorfa de la pared
microfibrilar de la pared vegetal (altamente celular, dentro de la cual se encuentra
cristalina), la cual, además de celulosa, puede embebida la fase microfibrilar cristalina.
6

Cadena de celulosa

β-D-Gluc osa Celobiosa

200 nm
Microfibrilla

Cadenas de celulosa
unidas por puentes
de hidrógeno

Figura IN.1.2: Micrografía electrónica de microfibrillas de celulosa de la pared primaria de células


epiteliales de guisante (Somerville et al., 2004), y esquema de la organización de la celulosa.

Las hemicelulosas se caracterizan por requerir 4 - 24%). Se encuentran formando uniones


para su extracción de la pared soluciones entre sí, con otros polisacáridos, como las
alcalinas (como NaOH al 17,5% o KOH al microfibrillas de celulosa y las pectinas, y con

Tabla IN.1.1: Hemicelulosas.

Xilano Cadenas de xilosa β(1→4) con cadenas laterales


cortas de otros azúcares unidas a la cadena principal
mediante el C2 y el C3 de las xilosas.
Manano puro Polímero no ramificado de manosa β(1→4). Muy
compacto debido a la presencia de numerosos
puentes de hidrógeno intramoleculares.
Glucomanano Cadenas de manosa β(1→4) que contienen residuos
de glucosa. La relación manosa:glucosa es de 3:1.
Mananos

Galactomanano Cadenas de manosa β(1→4) con cadenas laterales


de residuos de galactosa simples unidos por enlaces
α(1→6) a los residuos de manosa de la cadena
principal.
Galactoglucomanano Como el glucomanano, pero con cadenas laterales
de residuos de galactosa simples unidos por enlaces
α(1→6) a los residuos de glucosa o manosa de la
cadena principal.
Xiloglucano Cadenas de glucosa β(1→4) con cadenas laterales
cortas de xilosa unidas por enlaces α(1→6) a los
residuos de glucosa de la cadena principal.
Calosa Polímero no ramificado de glucosa β(1→3).
7

la lignina, mediante enlaces tanto covalentes 1.1.4. Pectinas


como no covalentes. Las pectinas o polisacáridos pécticos son una
La hemicelulosa más abundante en los cereales mezcla compleja de heteropolímeros ácidos y
y las maderas duras (angiospermas) es el neutros, que se caracterizan por su capacidad
xilano, mientras que en las maderas blandas para formar geles. Forman parte de la matriz
(gimnospermas) es el galactoglucomanano. amorfa de la pared celular, actuando como
Otras hemicelulosas frecuentes en vegetales lubricantes y cementantes tanto en la pared
son el xiloglucano, el galactomanano, el primaria como en la lámina media (donde se
glucomanano, el manano puro y la calosa encuentran en mayor concentración). A
(Tabla IN.1.1) (De Vries y Visser, 2001). diferencia de las hemicelulosas, pueden
extraerse de la pared celular mediante métodos
relativamente suaves, como pueden ser
tratamientos con agua caliente, con agentes

Tabla IN.1.2: Pectinas.

Galacturonanos Cadenas de ácido galacturónico α(1→4), metiladas


en diferente proporción en el C6 de los grupos
carboxilos.
Ramnogalacturonano I Cadenas de galacturonano interrumpidas por
residuos ocasionales de L-ramnosa unidos mediante
enlaces α(1→2) a los residuos de ácido
galacturónico adyacentes. Al O4 de estos residuos
de ramnosa pueden unirse largas cadenas de
arabinanos o galactanos.
También pueden encontrarse grupos acetilos unidos
al O2 o al O3 de los residuos de ácido galacturónico
de la cadena principal.
Ramnogalacturonano II Cadenas cortas de galacturonano (mínimo de 8
residuos) que presentan 4 cadenas laterales
diferentes que contienen azúcares poco comunes
como la 2-O-metil-L-fucosa, el ácido 3-deoxi-D-
mano-2-octulosónico, el ácido acérico o la D-apiosa.
Puede formar dímeros mediante puentes borato
entre dos enlaces éster.
Galactanos Cadenas de D-galactosa β(1→4), que pueden
presentar residuos de ácido ferúlico unidos al O6 de
algunas galactosas.
Arabinogalactanos Como los galactanos pero con cadenas laterales de
L-arabinosa unidas al C3 de residuos de galactosa
de la cadena principal.
Arabinanos Cadenas de L-arabinosa α(1→5) que pueden
presentar residuos laterales de L-arabinosa unidas
mediante enlaces α(1→3) a la cadena principal, y/o
residuos de ácido ferúlico unidos al O2 de la
arabinosa terminal.
8

quelantes, como el EDTA, o con ácidos a guaiaquil


b c
propanol
diluidos (Zarra y Revilla, 1993). CH2OH CH2OH CH2OH

CH CH CH
Entre las pectinas se encuentran el CH CH CH

galacturonano, el ramnogalacturonano I, el
ramnogalacturonano II, el galactano, el
OCH3 CH3O OCH3
arabinogalactano y el arabinano (Tabla IN.1.2) OH OH OH

(Heredia, 1995; De Vries y Visser, 2001). p-hidroxifenil siringil


propanol propanol

Deshidrogenación y
polimerización
1.1.5. Lignina
La lignina es un polímero heterogéneo
formado por fenilpropanoides (alcoholes
fenólicos) unidos entre sí por enlaces éter
(C-O-C) o C-C. Los fenilpropanoides que
forman la lignina son los alcoholes
p-cumarílico (p-hidroxifenil propanol),
coniferílico (guaiaquil propanol) y sinapílico
(siringil propanol). Su proporción en la lignina
depende del tipo celular y de la especie vegetal
Lignina
(Figura IN.1.3).
La lignina es la sustancia más abundante en la Figura IN.1.3: Precursores de la lignina y lignina.
matriz amorfa de la pared de plantas leñosas,
encontrándose sobre todo en la lámina media y
en la pared secundaria.
Debido a su carácter hidrofóbico desplaza el
agua de las paredes celulares secundarias,
dando lugar a una red hidrofóbica
tridimensional que interacciona con los demás
componentes de la pared y los mantiene
unidos, aumentando de esta manera la rigidez
de la pared y su resistencia frente a la
degradación química y biológica (Martínez et
al., 2005).
9

Normalmente, la cadena de β-D-xilopiranosas


1.2. El xilano presenta ramificaciones laterales de diferente
El xilano es un polisacárido muy abundante en naturaleza, ya que, aunque en algunas plantas
la naturaleza; el más abundante después de la terrestres y algas se han encontrado
celulosa (Collins et al., 2005). Forma parte de homoxilanos formados exclusivamente por
las hemicelulosas presentes en la matriz xilosa, lo más frecuente es que el xilano se
amorfa de la pared celular secundaria de los encuentre en forma de heteropolisacárido (Beg
tejidos lignificados de las plantas leñosas et al., 2001). El número y la naturaleza de
(Timell, 1967), aunque también se puede estas ramificaciones laterales dependen de la
encontrar en la matriz de paredes primarias de especie vegetal y del tipo de tejido, siendo las
células en crecimiento y de semillas y bulbos, más comunes aquellas formadas por
donde tiene función de reserva. (Figura IN.1.4):
Es la principal hemicelulosa de las maderas - α-L-arabinofuranosa: unida al C3 y/o al
duras (angiospermas), representando un C2 (aunque al C2 con menor frecuencia) de
15 - 30% del peso seco de la pared vegetal, y residuos de β-D-xilopiranosa en xilanos de
es menos abundante en el caso de las maderas maderas blandas (13% de la xilosas) y de
blandas (gimnospermas), donde representa un plantas herbáceas.
7 - 12% del peso seco (Wong et al., 1988).
- Ácido α-D-glucurónico y/o ácido 4-O-
Su función parece ser básicamente estructural,
metil-α-D-glucurónico: unido al C2 de
manteniendo la integridad de la pared celular
β-D-xilopiranosas tanto en xilanos de
junto con otras hemicelulosas, la celulosa, las
maderas duras (10% de las xilosas) como
pectinas y la lignina. Además, junto con la
en los de maderas blandas (20% de las
lignina, ayuda a proteger las microfibrillas de
xilosas) y en los de plantas herbáceas
celulosa de la biodegradación.
(Coughlan y Hazlewood, 1993).
- O-acetilos: unidos al C2, C3 o a ambos
El xilano está formado por un esqueleto de
carbonos de β-D-xilopiranosas en los
moléculas de β-D-xilosa unidas entre sí por
xilanos de maderas duras (70% de xilosas
enlaces β(1→4), salvo en algas marinas donde
acetiladas) y de plantas herbáceas, mientras
estos enlaces son también β(1→3). Esta
que los xilanos de maderas blandas no están
cadena de β-D-xilopiranosas puede tener
acetilados (Timell, 1967; Coughlan y
diferente grado de polimerización, siendo éste
Hazlewood, 1993). La acetilación del
mayor en el caso de maderas duras (150 - 200
xilano aumenta su solubilidad en agua
residuos de xilosa) que en el de maderas
(Biely, 1985).
blandas (70 - 130 residuos) (Kulkarni et al.,
1999).
10

Figura IN.1.4: Esquema de la estructura de una molécula de xilano y sus ramificaciones.

- Ácidos ferúlico y p-cumárico: compuestos - Glucuronoxilanos: son los xilanos de


fenólicos unidos por enlaces éster al C5 de maderas duras, que poseen cadenas laterales
los residuos de arabinosa. de ácido α-D-glucurónico y/o ácido
Además, se ha descrito la presencia de 4-O-metil-α-D-glucurónico, además de
ramnosa y galactosa en xilanos de algunas grupos O-acetilo.
plantas (Wong et al., 1988). - Glucuronoarabinoxilanos: los xilanos de
maderas blandas; denominados así por
En función de las ramificaciones laterales
presentar cadenas laterales de
podemos clasificar los xilanos en 4 familias
α-L-arabinofuranosa, ácido
principales (Joseleau et al., 1992):
α-D-glucurónico y/o ácido
- Arabinoxilanos: se denominan así los
4-O-metil-α-D-glucurónico y ácidos
xilanos de plantas herbáceas, debido a la
ferúlico y cumárico.
gran cantidad de residuos laterales de
- Homoxilanos lineales: no presentan
α-L-arabinofuranosa. Además presentan
ramificaciones en las cadenas de
grupos laterales acetilo, de ácido
β-D-xilopiranosa. Sólo se han encontrado
glucurónico y de ácido ferúlico y
en esparto (Chanda et al., 1950), en el tallo
p-cumárico.
11

del tabaco (Eda et al., 1976), y en algunas rumen. Estos microorganismos poseen
algas. complejos sistemas enzimáticos para llevar a
cabo la degradación del xilano.
El xilano se encuentra unido a otros La necesidad de un conjunto amplio de
componentes de la pared celular, actuando diferentes enzimas, cada una con un papel
como nexo de unión entre la lignina y el resto definido y determinado, para la completa
de polímeros de la pared secundaria de las degradación del xilano, es debida a la
plantas (Wong et al., 1988). heterogeneidad y elevada complejidad
Puede unirse a la celulosa y a otras cadenas de estructural de éste (Biely, 1985; Coughlan y
xilano y hemicelulosas mediante enlaces Hazlewood, 1993).
covalentes y no covalentes (puentes de Las enzimas degradadoras del xilano se
hidrógeno y fuerzas de Van der Waals). clasifican en dos grupos principales
También puede unirse a la lignina mediante (Figura IN.1.5):
enlaces covalentes (Dekker, 1989), que pueden - Enzimas implicadas en la
ser enlaces éter entre la lignina y los ácidos despolimerización del esqueleto principal
cumárico y ferúlico esterificados a residuos de de xilosas: Endoxilanasas (β-1,4-D-xilan-
arabinosa (arabinoxilanos y xilanohidrolasas) y β-xilosidasas
glucuronoarabinoxilanos), y enlaces éster entre (β-1,4-D-xilan-xilohidrolasas).
la lignina y el ácido 4-O-metil glucurónico - Enzimas encargadas de la eliminación de
(glucuronoxilanos y glucuronoarabinoxilanos). las cadenas laterales del xilano, llamadas
Las cadenas de arabinoxilanos y también accesorias o desramificantes:
glucuronoarabinoxilanos además pueden α-L-arabinofuranosidasas,
unirse entre ellas y con otras hemicelulosas y α-D-glucuronidasas, acetilxilano esterasas,
lignina a través de la formación de diferulatos y ferúlico y p-cumárico esterasas
(enlace covalente entre 2 residuos de ácido (hidroxicinámico esterasas).
ferúlico) tal como se puede apreciar en la Entre estas enzimas existe frecuentemente
Figura IN.1.4 (Markwalder y Neukom, 1976). relaciones de sinergismo, de modo que,
generalmente, las enzimas desramificantes
permiten una mayor accesibilidad de las
1.3. Enzimas degradadoras de
xilanasas al esqueleto principal de xilosas, y a
xilano
su vez estas enzimas accesorias liberan los
La capacidad de degradar xilano está sustituyentes laterales más fácilmente a partir
ampliamente distribuida entre los de fragmentos de xilano que no a partir del
microorganismos saprófítos, tanto bacterias xilano polimérico. De esta manera, se ha visto
como hongos, así como entre la microbiota del que existe frecuentemente sinergismo entre
12

Figura IN.1.5: Enzimas necesarias para la degradación del xilano y lugares sobre los que actúan.

xilanasas y enzimas desramificantes, entre enzimas intracelulares, aunque también las hay
xilanasas y β-xilosidasas, y entre diferentes extracelulares (Coughlan et al., 1993).
xilanasas (Coughlan et al., 1993; De Vries et Muchas β-xilosidasas disponen además de
al., 2000). actividad transferasa o transxilosidasa (Lee y
Zeikus, 1993), por lo que pueden generar

1.3.1. β-xilosidasas productos de mayor tamaño que los


oligosacáridos iniciales, lo cual las hace de
Las β-1,4-xilosidasas (EC 3.2.1.37) son
interés para su utilización en biosíntesis de
enzimas que actúan sobre xilobiosa y
oligosacáridos (De Vries y Visser, 2001).
xilooligosacáridos cortos no sustituidos,
El mecanismo catalítico utilizado por estas
hidrolizando los enlaces β(1→4) y liberando
enzimas puede ser de inversión o de retención
así residuos de D-xilosa a partir del extremo
de la configuración anomérica. En este último
no reductor de estos sustratos (Reilly, 1981).
caso, para la hidrólisis del sustrato se produce
La afinidad de las β-xilosidasas por los
un doble desplazamiento, lo que permite a
xilooligosacáridos disminuye al aumentar el
algunas enzimas que usan este mecanismo de
grado de polimerización de éstos, no siendo
retención catalizar reacciones de
activas sobre el xilano polimérico.
transglicosilación (Rye y Withers, 2000).
Complementan pues la acción degradadora de
Las β-xilosidasas suelen ser de elevado peso
las endoxilanasas al romper los xilooligómeros
molecular (hasta 360 kDa) y pueden estar
que éstas generan a partir del xilano.
formadas por 2 o más subunidades (Coughlan
Dado que los oligosacáridos pueden penetrar
y Hazlewood, 1993).
dentro de la célula, las β-xilosidasas suelen ser
Pertenecen a las familias 3, 39, 43 y 52 de
glicosil hidrolasas.
13

1.3.2. α-L-arabinofuranosidasas tamaño adecuado a partir del xilano. Sin


Estas enzimas (EC 3.2.1.55) liberan las embargo, hay excepciones a este hecho, como
moléculas de L-arabinosa unidas por enlaces por ejemplo una α-glucuronidasa de
α-1,2 o α-1,3 a las cadenas de xilosa del xilano Thermoascus aurantiacus, que presenta más
(Kaji, 1984) o a otros polisacáridos que actividad cuanto mayor es el grado de
contienen arabinosa (Saha, 2000). Con esta polimerización del xilano (Khandke et al.,
rotura permiten la creación de zonas no 1989).
ramificadas susceptibles entonces de ser Se encuentran exclusivamente dentro de la
atacadas por endoxilanasas, existiendo un familia 67 de glicosil hidrolasas.
importante sinergismo entre estas enzimas.
La especificidad de sustrato y del tipo de
1.3.4. Esterasas
enlace que hidrolizan varía mucho de una
Actúan hidrolizando los enlaces éster
α-L-arabinofuranosidasa a otra, siendo estas
presentes en el polímero de xilano.
características específicas de cada enzima.
Esto propicia el hecho de que un mismo
Las acetilxilano esterasas (EC 3.1.1.72)
microorganismo pueda producir múltiples
hidrolizan los enlaces que unen grupos acetilo
α-L-arabinofuranosidasas, cada una con
a residuos de xilosa del esqueleto principal del
diferentes propiedades físico-químicas (Tajana
xilano (Tenkanen y Poutanen, 1992).
et al., 1992).
La degradación completa del xilano requiere
Las α-L-arabinofuranosidasas han sido
necesariamente de este tipo de enzimas, puesto
clasificadas en las familias 43, 51, 54 y 62 de
que su acción permite la accesibilidad de otras
glicosil hidrolasas.
enzimas a la pared celular, así como al
esqueleto de xilosa del xilano (Coughlan et al.,
1.3.3. α-D-glucuronidasas 1993).
Las α-glucuronidasas (EC 3.2.1.131) eliminan
los residuos laterales de ácido glucurónico y Las ferúlico y p-cumárico esterasas, también
ácido 4-O-metil glucurónico, pero denominadas en conjunto como
generalmente sólo a partir de xilooligómeros hidroxicinámico esterasas, actúan sobre los
sustituidos, disminuyendo su actividad de enlaces que unen residuos laterales de
manera inversamente proporcional al grado de arabinosa a ácido ferúlico y cumárico,
polimerización de estos xilooligosacáridos respectivamente (Mackenzie et al., 1987).
(Puls et al., 1987), por lo que suelen requerir Permiten de esta manera romper uniones entre
de la acción de endoxilanasas que cadenas de xilano y entre la lignina y el xilano.
proporcionen xilooligómeros sustituidos del
14

1.4. Xilanasas tipo de ramificación adyacente al sitio de corte


(Coughlan y Hazlewood, 1993).
1.4.1. Características generales
Las endoxilanasas o xilanasas Dado que el xilano es un polímero de elevado
(endo-β-1,4-xilanasas; EC 3.2.1.8) son las grado de polimerización, no puede penetrar
enzimas que actúan sobre la cadena principal dentro de los microorganismos para ser
del xilano hidrolizando los enlaces internos degradado, de manera que las xilanasas han de
β(1→4) entre moléculas de xilosa, dando lugar ser secretadas al medio extracelular,
a una mezcla de xilooligosacáridos de normalmente mediante sistemas de secreción
diferentes tamaños (Biely, 1985). Además de de tipo II (“sec dependientes”, es decir, que
xilano pueden hidrolizar xilooligómeros de requieren del sistema de secreción Sec, el Sec
diferente grado de polimerización (siendo más pathway) (Tjalsma et al., 2004). Sin embargo,
activas cuanto mayor es el grado de en algunas bacterias del rumen y en Cellvibrio
polimerización) pero no hidrolizan la mixtus se han descrito xilanasas que no son
xilobiosa, lo que permite distinguirlas secretadas al espacio extracelular, quedando
claramente de las β-xilosidasas. localizadas en el espacio periplásmico (Fontes
Las xilanasas son pues las principales enzimas et al., 2000). Probablemente, la función de
implicadas en la degradación del xilano. estas xilanasas periplásmicas no es la
degradación del xilano, sino la de
En los microbios xilanolíticos hay una gran xilooligosacáridos de pequeño tamaño que
multiplicidad de xilanasas (varios genes puedan atravesar la membrana externa,
distintos que además cada uno de ellos puede estando protegidas al mismo tiempo de la
dar lugar a diferentes xilanasas en función del acción de las proteasas extracelulares.
procesamiento post-transcripcional y
post-traduccional), que difieren en su En algunos microorganismos, principalmente
especificidad respecto al xilano (Wong et al., anaeróbicos, las xilanasas pueden encontrarse
1988). Esta gran diversidad de xilanasas está también formando parte de unas estructuras
relacionada con el hecho de que el xilano es un extracelulares denominadas celulosomas. Los
polímero muy complejo y se requieren celulosomas son complejos multienzimáticos
xilanasas distintas para degradar las diferentes anclados en la superficie celular que permiten
regiones del xilano y los diferentes xilanos. a los microorganismos que los poseen la unión
Así, muchas xilanasas sólo pueden actuar a sustratos lignocelulósicos y el aumento de la
sobre regiones del xilano no sustituidas, eficiencia degradadora de la celulosa y las
mientras que otras requieren un determinado hemicelulosas (Bayer et al., 2004).
15

Los celulosomas contienen una proteína no con él los CBM presentes tanto en la proteína
catalítica de andamiaje (scaffolding protein) de andamiaje como en algunas de las
que por un lado permite el anclaje a la subunidades enzimáticas (Figura IN.1.6).
superficie celular a través de una proteína de El termino xilanosoma ha sido propuesto para
anclaje (anchoring protein), por otro contiene designar aquellas agrupaciones enzimáticas
dominios cohesina (cohesin modules) para unir extracelulares similares a celulosomas, en que
las diferentes enzimas hidrolíticas que forman las enzimas mayoritarias son xilanasas en
el celulosoma, y además puede contener lugar de celulasas (Beg et al., 2001; Jiang et
módulos de unión a carbohidratos (CBM). A al., 2005).
parte de esta proteína de andamiaje, los
celulosomas presentan una gran cantidad de En cuanto a la regulación de la expresión de
enzimas hidrolíticas que se unen mediante xilanasas, generalmente no son enzimas
dominios de ensamblaje o acoplamiento constitutivas, induciéndose su expresión al
(docking or dockerin domains) a los dominios crecer el microorganismo en medios que
cohesina previamente mencionados (Bayer et contienen xilano o xilobiosa. La xilosa es el
al., 2004). La mayoría de las enzimas que principal inductor de la expresión de los genes
forman parte de los celulosomas son celulasas, de xilanasas (Biely, 1985), de manera que para
pero también se encuentran xilanasas (Pason que un microorganismo pueda aprovechar el
et al., 2006), otras glicosil hidrolasas, y en xilano del medio, son necesarios pequeños
algunos casos incluso esterasas (Shoham et al., niveles de expresión basal de xilanasas que
1999). Todas estas enzimas actúan de manera puedan degradar en cierta medida el xilano,
sinérgica para degradar el sustrato liberándose finalmente las cantidades de xilosa
lignocelulósico, el cual resulta fácilmente suficientes para inducir la expresión de las
accesible gracias a las uniones que establecen

Microorganismo Dominios Dominios de


c ohesina ac oplamiento

Xilanasas
Proteína de
andamiaje

Proteína CBM
de anclaje CBM

Celulasas Xilano

Celulosa

Xilano

Figura IN.1.6: Representación esquemática de un celulosoma.


16

xilanasas (Kulkarni et al., 1999; Stülke y En general, las xilanasas, tanto de bacterias
Hillen, 2000). como de hongos, son mayoritariamente
Además, en la mayoría de microorganismos la monoméricas, y ampliamente variables en
expresión de xilanasas está sometida a cuanto a su peso molecular y punto
represión por catabolito, a través de la acción isoeléctrico (pI).
del represor CreA (Cho y Choi, 1999; De
Vries y Visser, 2001), equivalente a CcpA en En base al peso molecular y el punto
especies del género Bacillus (Stülke y Hillen, isoeléctrico, Wong y colaboradores (1988)
2000). Esto permite la utilización de fuentes de dividieron las xilanasas en dos grupos:
carbono más fácilmente asimilables (como – Un primer grupo de xilanasas de bajo peso
glucosa y xilosa) cuando éstas se encuentran molecular (menos de 30 kDa) y pI alcalino.
disponibles en el medio. – Un segundo grupo de xilanasas de mayor
De esta manera, la xilosa juega un doble papel peso molecular (más de 30 kDa) y pI
como regulador de la expresión de xilanasas, ácido.
en función de su concentración: a bajas Progresivamente, el número de xilanasas
concentraciones de xilosa, ésta actúa como caracterizadas fue en aumento, de manera que
inductor de la expresión de xilanasas, ya que empezaron a describirse enzimas con
sólo ejerce una represión débil a través del características intermedias, y que por tanto no
sistema CreA; pero a altas concentraciones, la encajaban en ninguno de estos dos grupos.
xilosa actúa reprimiendo la expresión de genes
xilanolíticos (a través del sistema CreA) Gilkes y colaboradores (1991) realizaron un
(De Vries et al., 1999). estudio de las secuencias de xilanasas y
No obstante, existen excepciones, como por celulasas. Atendiendo principalmente a
ejemplo una de las xilanasas de Bacillus homologías de secuencia, estas enzimas se
subtilis (Lindner et al., 1994) que presenta clasificaron en 9 familias, quedando las
expresión constitutiva durante el crecimiento xilanasas distribuidas en las familias F y G:
exponencial. – La familia F incluye las xilanasas del
grupo de mayor peso molecular y bajo pI
definido por Wong y colaboradores (1988),
1.4.2. Clasificación de las xilanasas
además de otras xilanasas y otras enzimas
Como ya se ha comentado, dada la como exocelulasas y endo-β-1,3-xilanasas.
complejidad y heterogeneidad del xilano, – La familia G es una familia formada
existe una gran variedad de xilanasas distintas, exclusivamente por xilanasas, entre las que
que se diferencian en cuanto a su especificidad se incluyen las xilanasas de bajo peso
de sustrato, su secuencia y su estructura.
17

molecular y alto pI (Wong et al., 1988), determinante en algunas características físico-


además de otras xilanasas. químicas de estas enzimas. Así, la estructura
tridimensional del centro activo de las
Posteriormente, las glicosil hidrolasas se xilanasas de la familia 10 hace que estas sean
clasificaron en 35 familias en base a menos estrictas en cuanto al sustrato y más
comparación de secuencias (Henrissat, 1991) y activas sobre xilooligosacáridos de bajo grado
al análisis de las regiones de hidrofobicidad de de polimerización que las xilanasas de la
las mismas (Henrisat y Bairoch, 1993, 1996). familia 11 (Biely et al., 1997; Leggio et al.,
Estudios posteriores han corroborado que, tal 2000; Sabini et al., 2001).
como sugerían éstos y otros autores en
estudios previos (Chothia y Lesk, 1986), existe Un pequeño número de xilanasas
una correlación entre la secuencia primaria de caracterizadas más recientemente no presenta
una proteína y su conformación homología de secuencia con las familias
tridimensional. clásicas de xilanasas 10 u 11, y en su lugar
Actualmente existen más de 100 familias de presentan homología con otras familias de
glicosil hidrolasas (Carbohydrate Active glicosil hidrolasas, como las familias 5, 7, 8 y
enZYmes database, http://www.cazy.org/; 43 (Collins et al., 2005).
Coutinho y Henrissat, 1999), las cuales se
encuentran agrupadas en diferentes clanes o
Por último, cabe mencionar que se ha descrito
superfamilias (grupos de familias que
un tipo de xilanasas con un modo de acción
comparten un motivo de plegamiento terciario,
tipo exo, que se han denominado exoxilanasas
aminoácidos catalíticos conservados y similar
(Reilly, 1981; Kubata et al., 1995). En estas
mecanismo catalítico; hechos que sugieren un
enzimas, el ataque de la molécula de xilano se
origen evolutivo común).
produciría a partir de un extremo de la misma
(y no en el interior de la molécula como
En base a esta clasificación, las xilanasas
sucede en las endoxilanasas), generándose un
quedan distribuidas en las familias 10 y 11,
único tipo de xilooligosacárido como producto
que se corresponden con las familias F y G de
de la hidrólisis del xilano. Este modo de
Gilkes y colaboradores (1991).
acción equivaldría a la degradación procesiva
La diferencia entre estas 2 familias de
de celulosa por parte de las exocelulasas
xilanasas se encuentra principalmente a nivel
(Sánchez et al., 2003). De todas formas, la
de secuencia y estructura tridimensional, no
existencia de auténticas exoxilanasas no ha
existiendo diferencias importantes a nivel de
sido admitida unánimemente debido a que un
sus características catalíticas. No obstante, las
mecanismo catalítico de este tipo requeriría
diferencias estructurales influyen de manera
18

primero la eliminación de todos los En el caso de las xilanasas de las familias 10 y


sustituyentes laterales de la cadena de xilosas. 11 el mecanismo utilizado en la hidrólisis del
Por ello, el uso del término exoxilanasas no es sustrato es el de doble desplazamiento con
aceptado formalmente. retención de la configuración anomérica
(β→β) (Figura IN.1.7).

1.4.3. Mecanismo catalítico


En la hidrólisis del enlace glucosídico por este
El mecanismo catalítico de la mayoría de mecanismo intervienen 2 residuos glutamato
glicosil hidrolasas consiste o bien en un conservados del centro activo de la xilanasa,
desplazamiento simple (que produce la separados entre sí 5,4 - 5,5 Å, actuando uno de
inversión de la configuración anomérica), o ellos como catalizador ácido/base y el otro
bien en un doble desplazamiento (que conlleva como residuo nucleófilo (Davies y Henrissat,
la retención de la configuración anomérica) 1995).
(Rye y Withers, 2000; Yip y Withers, 2004).

A C

Figura IN.1.7: Mecanismo catalítico de retención en xilanasas de las familias 10 y 11.


19

Una vez el esqueleto de xilosas ha sido En el caso de las xilanasas pertenecientes a las
posicionado correctamente entre los dos ácidos familias 5 y 7, el mecanismo catalítico es
glutámicos catalíticos, uno de ellos (el similar al de las familias 10 y 11.
catalizador ácido/base) realiza un ataque ácido
sobre el enlace glucosídico, protonando el Por el contrario, las enzimas de las familias 8 y
oxígeno de dicho enlace, mientras el otro 43 de glicosil hidrolasas (entre las que se
glutamato realiza un ataque nucleofílico sobre incluyen algunas xilanasas de reciente
el carbono anomérico del enlace caracterización) utilizan el mecanismo de
(Figura IN.1.7.A). El resultado de este primer desplazamiento simple, lo que comporta la
paso es la liberación de uno de los productos inversión de la configuración del carbono
de reacción y la formación de un intermediario anomérico (β→α). En este caso, los residuos
α-glicosilo-enzima. aminoacídicos implicados en la hidrólisis del
A continuación, el glutamato ácido/base pasa a enlace glucosídico no serían dos glutamatos
actuar como base, “robándole” un protón a una sino un glutamato y un aspartato, actuando uno
molécula de agua, lo que permite que ésta como catalizador ácido y otro como
ataque el enlace entre el glutamato nucleófilo catalizador básico.
y el carbono anomérico (Figura IN.1.7.B), En este tipo de hidrólisis en un solo
produciendo su hidrólisis, y dando como desplazamiento, es necesaria una distancia
resultado un producto cuyo carbono anomérico mayor entre los aminoácidos catalíticos
vuelve a la misma configuración que en el (alrededor de 9,5 - 10 Å), para que entre ellos
sustrato (β→β), liberándose la enzima de su se pueda disponer el sustrato con el enlace
unión al sustrato para poder iniciar un nuevo glucosídico a romper junto con una molécula
proceso de catálisis (Figura IN.1.7.C) (Davies de agua que ha de posicionarse entre el
y Henrissat, 1995; Collins et al., 2005). carbono anomérico de dicho enlace y el
catalizador básico (Figura IN.1.8).

Ácido Base

A B

9,5 Å

Base Ácido
Intermediario
temporal

Figura IN.1.8: Mecanismo catalítico de inversión en glicosil hidrolasas de las familias 8 y 43.
20

1.4.4. Estructura (fibronectin type 3-like repeats)


(Kataeva et al., 2002).
1.4.4.1. - Arquitectura Molecular La xilanasa XynC de Paenibacillus
Atendiendo a su arquitectura molecular, al barcinonensis (Blanco et al., 1999) sería
igual que muchas otras enzimas, las xilanasas un ejemplo de xilanasa multidominio.
se pueden dividir en:
– Enzimas de un sólo dominio estructural y En las xilanasas modulares los dominios más
funcional: sólo contienen el dominio abundantes después de los dominios catalíticos
catalítico. La xilanasa Xyn10A de Bacillus son los módulos de unión a carbohidratos
halodurans (Hatti-Kaul et al., 2006), con (CBM), que median la unión de estas enzimas
su único dominio catalítico perteneciente a a carbohidratos. Estos CBM se encuentran
la familia 10 de glicosil hidrolasas sería un clasificados en familias en base a similitud de
ejemplo. secuencia de aminoácidos (Boraston et al.,
– Enzimas multidominio o modulares: 2004). En general son bastante específicos en
además del dominio catalítico contienen cuanto al tipo de carbohidrato que reconocen,
otros dominios unidos entre sí mediante pero existen variaciones en esta afinidad.
secuencias conectoras (linkers). Estos Los primeros CBM que se caracterizaron
dominios no catalíticos independientes fueron los dominios de unión a celulosa
pueden ser: (CBD), que median la unión a diferentes
• Módulos de unión a carbohidratos formas de celulosa amorfa o cristalina, y
(carbohydrate binding modules, además pueden ayudar a desorganizar las
CBM), que permiten la unión a microfibrillas de celulosa cristalina, facilitando
celulosa (cellulose binding domains, la acción de las celulasas (Linder y Teeri,
CBD), a xilano (xylan binding 1997; Tomme et al., 1998). La eliminación de
domains, XBD), o a otros los CBD puede disminuir la actividad
carbohidratos poliméricos. hidrolítica de las celulasas. Así, como ejemplo,
• Dominios de ensamblaje o en el caso de los CBD de la familia IIIc
acoplamiento (docking domains), para (CBM3c) asociados a dominios glicosil
mediar la unión a proteínas de hidrolasa de la familia 9, su eliminación causa
andamiaje de celulosomas o una drástica disminución de la capacidad
xilanosomas. hidrolítica de estas celulasas sobre celulosa
• Dominios con funciones no totalmente cristalina, ya que la función de estos CBM3c
conocidas, como los dominios SLH sería ayudar a la aproximación del sustrato al
(surface layer homology domains) (St. centro activo de la enzima, y en algunos casos,
John et al., 2006a) o los dominios Fn3 ayudarían también a que estas enzimas
21

actuaran de manera procesiva sobre el sustrato


A
(Irwin et al., 1998; Bayer et al., 2000).
Existen también CBM que median la unión a
xilano: dominios de unión al xilano (XBD).
Uno de los primeros XBD identificados fue el
de la xilanasa D (XylD) de Cellulomonas fimi
(Black et al., 1995). Dentro de este grupo de
CBM, se incluyen también dominios
previamente considerados como putativos
dominios de termoestabilidad (Clarke et al., B
1996; Blanco et al., 1999), que posteriormente
han sido identificados como dominios de
unión a xilano (Sunna et al., 2000),
clasificándose dentro de la familia CBM22.
Además de los CBD y los XBD
(Figura IN.1.9), se han identificado otros CBM
que median la unión a otros carbohidratos
como la quitina, el almidón, los mananos, los
galactanos y algunos glicanos de superficie
Figura IN.1.9: (A) Estructura en β jelly roll (típica
celular (Boraston et al., 2004). de gran número de CBMs) de un CBD de la
familia IV (CBM4) unido a celopentaosa (Boraston
et al., 2002), y (B) de un XBD de la familia XIII
(CBM13) con plegamiento en β trefoil de 12
1.4.4.2. - Estructura Tridimensional hebras β (Notenboom et al., 2002).

Existe gran cantidad de xilanasas fúngicas y familia, que engloba a aquellas familias de
bacterianas de las familias 10 y 11 cuya proteínas que comparten una estructura
estructura tridimensional ha sido resuelta, y terciaria similar, y que a su vez conservan los
también, aunque en menor número, ha sido aminoácidos catalíticos y el mecanismo
determinado experimentalmente el enzimático. Así, mientras las familias agrupan
plegamiento de bastantes xilanasas de las proteínas principalmente en función de su
familias 5 y 8. similitud de secuencia, los clanes o
superfamilias agrupan familias de proteínas
Las familias 5 y 10 de glicosil hidrolasas son básicamente en función de sus similitudes
miembros del clan GH-A, junto a otras 15 estructurales (Henrissat y Bairoch, 1996).
familias más. El clan o superfamilia, es un Los miembros del clan GH-A, a pesar de sus
nivel jerárquico de clasificación superior a la diferencias en tamaño y secuencia, presentan
22

un dominio catalítico de 250 a 450


aminoácidos con un plegamiento de tipo barril
(α/β)8 o TIM-barrel, consistente en 8 regiones
de conformación β dispuestas en el interior en
forma cilíndrica o de barril, rodeadas a su vez
de 8 hélices α. Asimismo, los miembros de
este clan tiene un surco catalítico altamente
conservado.
En el caso de las xilanasas de la familia 10, la
mayoría son enzimas multidominio que Figura IN.1.10: Estructura 3D de la xilanasa
multidominio Xyn10C de Cellvibrio japonicus
presentan dominios de unión a carbohidratos (Pell et al., 2004a) perteneciente a la familia 10 de
glicosil hidrolasas (GH10). Se puede observar el
enlazados mediante linkers flexibles al modulo de unión a carbohidratos (CBM), a la
dominio catalítico. Posiblemente ha sido la izquierda, y el dominio catalítico con plegamiento
en barril (α/β)8, a la derecha.
presencia de estos linkers flexibles la que ha Entre ambos dominios debería observarse el
linker, pero su elevada flexibilidad dificulta su
dificultado la cristalización y obtención de resolución estructural.
estructuras tridimensionales de xilanasas
modulares completas de esta familia. Así,
salvo en los casos concretos de Xyn10A de
Streptomyces olivaceoviridis (Fujimoto et al.,
2000) y de Xyn10C de Cellvibrio japonicus
(Pell et al., 2004a), el resto de estructuras
resueltas para miembros de la familia 10
corresponden a dominios individuales
cristalizados por separado (Figura IN.1.10).
Respecto a la familia 5, se ha resuelto la
estructura de la xilanasa A de Erwinia
chrysanthemi, la cual contendría, además del
Figura IN.1.11: Estructura 3D de la xilanasa
dominio catalítico con estructura de barril multidominio XynA de Erwinia chrysanthemi
(Larson et al., 2003) perteneciente a la familia 5 de
(α/β)8, un putativo dominio de unión a xilano glicosil hidrolasas (GH5). Se puede observar en
en su región C-terminal (Larson et al., 2003). C-terminal, a la izquierda, un putativo modulo de
unión a carbohidratos (CBM) además del dominio
Así pues, la estructura de esta xilanasa de la catalítico con plegamiento en barril (α/β)8, a la
derecha.
familia 5 podría confundirse con la de una
xilanasa de la familia 10 (Figura IN.1.11). La familia 11 de glicosil hidrolasas pertenece
al clan GH-C, al cual pertenece también la
familia 12, formada básicamente por celulasas.
23

Las xilanasas de la familia 11 presentan de glicosil hidrolasas. Al igual que en el resto


dominios catalíticos de 180 a 200 aminoácidos de proteínas de dicho clan, el dominio
que se pliegan en una conformación de catalítico de estas xilanasas presenta un
lámina β curvada sobre sí misma, conocida plegamiento en barril (α/α)6, consistente en 6
como β jelly roll (Figura IN.1.12). hélices α en el centro del barril, rodeadas por
otras 6 hélices α (Figura IN.1.13). Este
plegamiento también está presente en otras
glicosil hidrolasas que usan el mecanismo
catalítico de inversión, como las pertenecientes
al clan GH-L (familias 15 y 65) y a la
familia 9.

Figura IN.1.12: Estructura 3D de la xilanasa


Xyn11X de Bacillus subtilis B230, de la familia 11
de glicosil hidrolasas (GH11) (Oakley et al.,
2003). Se puede observar el plegamiento en β jelly
roll del dominio catalítico.

Estas xilanasas suelen contener únicamente el


dominio catalítico, aunque hay excepciones, Figura IN.1.13: Estructura 3D de la xilanasa
pXyl de la bacteria antártica Pseudoalteromonas
como el caso de TfxA de Thermomonospora haloplanktis (Van Petegem et al., 2003),
fusca que posee un CBM unido al dominio perteneciente a la familia 8 de glicosil hidrolasas
(GH8). Se puede observar el plegamiento en barril
catalítico (Irwin et al., 1994). (α/α)6 del dominio catalítico.

Actualmente, sólo se conoce la estructura de 2 No se conoce la estructura de las xilanasas de


xilanasas de la familia 8, la xilanasa psicrófila las familias 7 y 43, aunque es de esperar que la
pXyl de Pseudoalteromonas haloplanktis y la xilanasa A de Penicillium funiculosum,
supuesta exoxilanasa Rex (también perteneciente a la familia 7, presente un
denominada xilanasa Y) de Bacillus dominio catalítico con plegamiento en β jelly
halodurans C-125 (Van Petegem et al., 2003; roll, como las enzimas ya cristalizadas de esta
Honda y Kitaoka, 2004; respectivamente). familia (Figura IN.1.14); y que igualmente las
Esta familia de glicosil hidrolasas pertenece al xilanasas de la familia 43 presenten un
clan GH-M, conjuntamente con la familia 48 dominio catalítico con plegamiento muy
24

parecido al que presentan las proteínas ya


cristalizadas de la familia 43, denominado
5-fold β-propeller (o 5-blade β-propeller), y
consistente en un superbarril de 5 laminas β
antiparalelas formadas cada una por 4 hebras β
(Collins et al., 2005) (Figura IN.1.15).

Figura IN.1.15: Estructura 3D de la


exoarabinanasa Arb43A de Cellvibrio japonicus
(Proctor et al., 2005), perteneciente a la familia 43
de glicosil hidrolasas (GH43). Se puede observar
el plegamiento en 5-fold β-propeller del dominio
catalítico.

El centro activo de las xilanasas consiste en


una hendidura más o menos profunda,
localizada en la superficie de la proteína, y
generalmente bastante amplia. Estas
Figura IN.1.14: Estructura 3D de la características concuerdan con el modo de
endoglucanasa I (EG I) del hongo termófilo acción de tipo endo de las xilanasas.
Fusarium oxysporum (Sulzenbacher et al., 1997),
perteneciente a la familia 7 de glicosil hidrolasas Normalmente esta hendidura catalítica o surco
(GH7). Se puede observar el plegamiento en
β jelly roll del dominio catalítico. catalítico contiene entre cuatro y siete subsitios
de unión.
Los subsitios de unión se encargan de
posicionar correctamente los anillos de
1.4.4.3. - Estructura del centro activo
xilopiranosa del sustrato de manera que el
Las estructuras de diferentes xilanasas salvajes
enlace a hidrolizar quede a la distancia y en la
y mutantes unidas a oligosacáridos e
orientación correctas respecto a los
inhibidores han permitido estudiar el centro
aminoácidos catalíticos.
activo de estas enzimas, cómo se une el
Estos subsitios de unión se designan por un
sustrato a éste, y el mecanismo de catálisis
número que depende de su posición respecto a
(Leggio et al., 2000; Sabini et al., 2001).
los aminoácidos del centro catalítico:
25

– Los subsitios más cercanos al centro glucuronoxilano y xilano β-1,3-β-1,4


catalítico reciben un número más bajo, (rhodimenano), lo que indicaría la existencia
comenzando por +1 ó -1. Los subsitios +1 de un sitio de unión más pequeño en estas
y -1 flanquean el enlace a hidrolizar. xilanasas (Kolenová et al., 2005).
– Los situados hacia el extremo no reductor
del sustrato reciben números negativos, y La estructura del centro activo también resulta
los situados hacia el extremo reductor del importante a la hora de discriminar
sustrato (aglycone) números positivos. sustituyentes laterales en la cadena de xilano.
De estos subsitios, son el -1 y el -2 los más Se ha descrito que las xilanasas de la familia
conservados en las familias 10 y 11 de 11 acostumbran a hidrolizar regiones no
xilanasas, siendo mucho más variables los sustituidas de la cadena de xilosas, mientras
subsitios positivos. que las xilanasas de la familia 10 son capaces
de degradar el polisacárido en aquellas
A parte de las similitudes, existen también regiones con sustituyentes laterales (Leggio et
diferencias estructurales importantes en el al., 2000; Sabini et al., 2001).
centro activo entre las xilanasas de la familia Estudios recientes, en los cuales se han
10 y la familia 11. Así, en las xilanasas de la cristalizado xilanasas de la familia 10
familia 10 el lugar de unión al sustrato es una acomplejadas con sustratos que contenían
hendidura poco profunda (shallow groove), diferentes sustituyentes laterales, han
mientras que en las de la familia 11 el lugar de permitido comprobar como las xilanasas de
unión al sustrato es una hendidura más esta familia presentan subsitios de unión al
profunda (deep cleft). sustrato capaces de acomodar sustituyentes de
Estas diferencias estructurales en la hendidura α-L-arabinofuranosa y ácido
catalítica hace que las xilanasas de la familia 4-O-metil-α-D-glucurónico (los más
10 sean menos estrictas en cuanto al sustrato, abundantes), permitiendo además evitar la
mostrando una mayor versatilidad catalítica formación de productos de punto muerto
que las xilanasas de la familia 11. Esta menor (dead-end) y facilitando la posterior actuación
especificidad de sustrato permite que algunas de enzimas desramificantes, como las
xilanasas de la familia 10 muestren actividad α-D-glucuronidasas, sobre los productos
sobre sustratos celulósicos tales como los sustituidos resultantes (Pell et al., 2004b).
aril-celobiósidos (Biely et al., 1997). Algunos autores llegan incluso a sugerir que
Además, las xilanasas de la familia 10 son más algunos de estos sustituyentes laterales
activas sobre xilooligosacáridos de bajo grado actuarían como determinantes de especificidad
de polimerización, y liberan productos de para esta familia de xilanasas, debido a las
hidrólisis más pequeños a partir de estrechas interacciones que se han observado
26

entre estos sustituyentes y los subsitios de biotecnológica de xilanasas. Sus primeros usos
unión del centro activo que los acomodan en este sentido consistieron en su adición a las
(Vardakou et al., 2005). formulaciones de piensos animales,
expandiéndose después su utilización a las
industrias de alimentación, textil y papelera.
1.4.5. Aplicaciones de las xilanasas
Desde entonces el uso biotecnológico de estas
Los sistemas enzimáticos microbianos enzimas se ha incrementado de manera
suponen actualmente un importante potencial importante, cubriendo un amplio rango de
biotecnológico aplicable en numerosas sectores industriales. Así, en la actualidad, las
industrias en el ámbito de las denominadas xilanasas juntamente con celulasas y
tecnologías limpias o tecnologías sostenibles. pectinasas representan el 20% del mercado
En ellas se han introducido etapas global de enzimas industriales (Polizeli et al.,
biotecnológicas en procesos productivos 2005).
convencionales para dar lugar a unos procesos
de producción alternativos de impacto El xilano está presente en grandes cantidades
ambiental minimizado. Las industrias que más en los desechos de las industrias
se han beneficiado o se pueden beneficiar de la agroalimentarias, por lo que las xilanasas
aplicación de enzimas son principalmente las juegan un papel importante en la
papeleras, textiles, agrícolas y de alimentación, bioconversión de estos residuos ricos en
aunque recientemente está aumentando el lignocelulosa (incluyendo residuos sólidos
interés por parte de industrias de urbanos) en xilosa y otros azúcares
bioconversión y síntesis de nuevos fermentables para la producción de etanol
compuestos. (biofuel) (Lee, 1997; Sun y Cheng, 2002; St.
John et al., 2006a). Otro campo prometedor
En este sentido, las hemicelulasas bacterianas, para el uso de xilanasas es la bioconversión de
y en especial las xilanasas, tienen importantes xilano a xilitol, un edulcorante bajo en calorías
aplicaciones en la industria debido a su utilizado también en salud dental y como
enorme potencial para modificar y transformar laxante (Parajo et al., 1998; Polizeli et al.,
la lignocelulosa y otros materiales de la pared 2005).
celular vegetal, muy abundantes en la biomasa Otras aplicaciones potenciales de las xilanasas,
vegetal, ampliamente utilizada como materia pero menos documentadas, incluyen su uso
prima en un gran número de procesos como aditivos de detergentes, en la producción
industriales. de oligosacáridos farmacológicamente activos
Fue en la década de los 80 del pasado siglo como antioxidantes, en la preparación de
XX cuando comenzó la aplicación protoplastos a partir de células vegetales, y en
27

la síntesis de nuevos tensioactivos gracias a la piensos para pollos basados en trigo y centeno
actividad transxilosidasa que poseen algunas aumenta la eficiencia de conversión de la
xilanasas (Bhat, 2000; Collins et al., 2005). En comida suministrada, y por tanto el peso de los
la industria textil también pueden utilizarse las pollos (Bedford y Classen, 1992). Beneficios
xilanasas conjuntamente con las pectinasas similares pueden obtenerse en la alimentación
para degradar la hemicelulosa y pectina de de cerdos gracias a dietas basadas en trigo
materias primas vegetales como lino o suplementadas con xilanasas y fosfolipasas
cáñamo, liberándose así las fibras de celulosa (Diebold et al., 2005).
para la fabricación del tejido. Actualmente este
proceso se realiza mediante el enriado, En la industria vinícola y de zumos la
consistente en sumergir las fibras textiles en aplicación de xilanasas junto con pectinasas
agua para que puedan actuar los facilita la extracción y clarificación del
microorganismos degradadores. El problema producto final (Bhat, 2000). Además, estas
del enriado por microorganismos es su lentitud enzimas pueden incrementar la estabilidad de
y dependencia de las condiciones la pulpa y la liberación de precursores
climatológicas, de manera que el empleo de aromáticos. En este sentido, se ha comprobado
enzimas supondría una alta reproducibilidad que el uso de levaduras recombinantes que
del proceso, mejor producción y mayor expresan la xilanasa XlnA de Aspergillus
resistencia de las fibras (Hoondal et al., 2002). nidulans permite obtener un vino con mayor
aroma afrutado (Ganga et al., 1999).
Tal como se ha mencionado anteriormente, las También pueden utilizarse xilanasas en la
xilanasas se utilizan ampliamente como elaboración de cervezas para reducir la
aditivos de piensos para animales viscosidad y turbidez de éstas, y mejorar a la
monogástricos (como cerdos y gallinas), junto vez el filtrado de la malta (Polizeli et al.,
a otras enzimas despolimerizantes (celulasas y 2005).
pectinasas), para aumentar el valor nutricional Como aditivos en panificación, las xilanasas
de los piensos. En estos casos, la degradación degradan las hemicelulosas de la harina, lo que
de los arabinoxilanos contenidos en este tipo resulta en una redistribución del agua de los
de piensos reduce la viscosidad del material, pentosanos al gluten, hecho que acaba
con lo que se facilita el tránsito intestinal y la comportando un aumento del volumen y de la
absorción de otros nutrientes, además de calidad de la miga, además de un aumento en
potenciar la asimilación de los oligosacáridos la durabilidad del pan (Linko et al., 1997).
resultantes de la degradación del xilano Estos efectos pueden incrementarse aún más si
(Polizeli et al., 2005). De esta manera, se ha se usan amilasas en combinación con las
observado que la incorporación de xilanasas en xilanasas (Monfort et al., 1996).
28

cloro para obtener el mismo grado de blancura


Actualmente, la principal aplicación industrial y calidad en la pasta de papel, reduciéndose de
de las xilanasas se da en la industria papelera. esta forma la generación de residuos
En ella, el tratamiento con xilanasas de la organoclorados (AOX) un 15 - 20% (Viikari et
pasta de papel, previo al blanqueo químico, al., 2001; Bajpai, 2004). Además, la reducción
comporta importantes beneficios económicos y en la cantidad de agentes químicos requeridos
ventajas medioambientales (Viikari et al., para el blanqueo ha contribuido a la
1994, 2001; Bajpai, 2004). sustitución del cloro elemental (Cl2) por el
Un elevado porcentaje de las pastas papeleras dióxido de cloro (ClO2), mucho menos
son obtenidas por el proceso de cocción kraft contaminante, dando lugar a las secuencias de
(altas temperaturas y condiciones alcalinas), blanqueo ECF (elemental chlorine free), o
que tiene por objetivo liberar las fibras de incluso a la eliminación total de compuestos
celulosa mediante la solubilización de la clorados y su reemplazo por otros agentes
lignina. Pero la lignina residual, que queda en blanqueantes como el peróxido de hidrógeno
la pasta de papel tras la cocción kraft, produce (H2O2) y el ozono (O3), en las denominadas
un color oscuro, por lo que la pasta de papel ha secuencias de blanqueo TCF (total chlorine
de someterse a un tratamiento de blanqueo free).
para poder fabricar papel de calidad. El
proceso de blanqueo se realiza Se ha evaluado la actividad como
tradicionalmente con cloro y derivados potenciadoras del blanqueo de diferentes
clorados (hipoclorito y dióxido de cloro), que xilanasas fúngicas y bacterianas, observándose
reaccionan con la lignina y la solubilizan, que a pesar de la elevada eficiencia de muchas
dando lugar a la formación de compuestos de las enzimas ensayadas, existen notables
organoclorados (AOX: adsorbable organic diferencias entre ellas, en función de la familia
halogens), los cuales resultan altamente a que pertenecen y de las características
tóxicos. particulares de cada xilanasa (factores
Las xilanasas no eliminan directamente los endógenos de la enzima) (Elegir et al., 1995;
cromóforos de lignina residual, pero facilitan Clarke et al., 1997). Asimismo, se ha
su extracción de la pasta de papel al degradar constatado que el tipo de madera utilizada, el
el xilano, presente en los complejos método de pasteado y la secuencia de
xilano-lignina o reprecipitado sobre las fibras blanqueo elegida (factores exógenos) también
tras la cocción kraft. De esta manera, la influyen de manera significativa en la
aplicación de xilanasas potencia el blanqueo eficiencia de las xilanasas (Suurnäkki et al.,
químico posterior, por lo que su utilización 1996; Christov et al., 2000). En la actualidad
permite reducir un 20 - 25% el empleo de existen diversas xilanasas microbianas
29

disponibles en el mercado que se utilizan de de ácidos hexenurónicos (HexA). Estos HexA


manera regular para el blanqueo en empresas se pueden originar a partir de los grupos de
papeleras (Beg et al., 2001). ácido 4-O-metil-α-D-glucurónico, presentes en
los xilanos, durante el proceso de cocción kraft
La aplicación de xilanasas en el blanqueo de (Figura IN.1.16); de manera que al reducir el
pastas papeleras puede modificar las xilano de estas pastas mediante el uso de
propiedades del refino de éstas, observándose xilanasas se reduce también el contenido de
en algunos casos que las pastas tratadas HexA y por tanto puede aumentar la
enzimáticamente requieren un mayor número estabilidad del papel frente al envejecimiento
de revoluciones en el proceso de refinado para (Buchert et al., 1997).
alcanzar las mismas propiedades que las pastas
no tratadas (Vicuña et al., 1995). También se A parte de las xilanasas, se han ensayado otras
ha observado que la hidrólisis del xilano ayuda hemicelulasas en el blanqueo de pastas
al desgote posterior de las pastas, durante la papeleras, obteniéndose diversos resultados.
elaboración del papel, ya que se reduce la Se ha observado así que las β-mananasas
retención de agua por las hemicelulosas. En también facilitan el blanqueo al ayudar a
cualquier caso, las propiedades físicas de eliminar la lignina residual y aumentar el
resistencia del papel obtenido no se ven grado de blancura del papel. Sin embargo,
afectadas de manera significativa por la generalmente el efecto de las β-mananasas
aplicación de xilanasas (Roncero et al., 2003). sobre la blancura no es tan pronunciado como
En relación con el efecto de las xilanasas sobre el de las xilanasas (Bhat, 2000; Montiel et al.,
la blancura del papel, se ha visto que su 2002).
utilización puede reducir además el
envejecimiento o el amarilleamiento (la Otra estrategia más reciente para el blanqueo
reversión del grado de blancura) del papel enzimático de pastas papeleras consiste en
procedente de pastas kraft. La reversión del eliminar directamente la lignina residual
grado de blancura en pastas blanqueadas se utilizando para ello enzimas degradadoras de
debe en gran medida a la temperatura de lignina (lacasas y peroxidasas). Los avances en
conservación del papel y a la presencia en éste el conocimiento del modo de actuación de

Figura IN.1.16: Formación de


ácido hexenurónico (derecha) a
partir de ácido
4-O-metil-α-D-glucurónico
(izquierda) presente en el xilano
(Petit-Breuilh et al., 2004).
30

estas enzimas ha permitido ensayar con éxito


lacasas fúngicas y de Streptomyces para el
blanqueo (Burbonnais et al., 1997; Arias et al.,
2003; Sigoillot et al., 2005; González Arzola
et al., 2006), aunque en estos casos, es
necesaria la presencia de un mediador para
obtener buenos resultados.

Volviendo a las xilanasas y sus aplicaciones en


la industria papelera, es preciso comentar que
éstas no se restringen al blanqueo. Los buenos
resultados obtenidos en esta etapa del proceso
de elaboración del papel han propiciado su
ensayo en otras etapas, como pueden ser el
pasteado mecánico, el drenaje o desgote de la
pasta, o el destintado de las fibras de papel
reciclado. Los prometedores resultados
obtenidos están determinando una expansión
del uso de xilanasas en la industria, con el
consiguiente aumento de la importancia de
éstas en el mercado mundial de enzimas.
31

- La construcción de una genoteca en


2 - OBJETIVOS E INTERÉS DEL
Escherichia coli de la cepa Bacillus sp.
TRABAJO REALIZADO BP-7, previamente aislada y caracterizada
en el grupo de investigación (López et al.,
Dado el interés de la aplicación de enzimas
1998), y la selección de los clones
como las xilanasas en la industria, en las
recombinantes portadores de genes
denominadas tecnologías limpias, así como el
codificantes de xilanasas.
interés por ampliar el conocimiento de los
aspectos básicos de biología molecular de - La identificación y caracterización genética
estas enzimas, el presente trabajo se enmarca y bioquímica de las enzimas codificadas en
dentro de un proyecto más amplio que tiene estos genes.
por objeto la búsqueda y caracterización de
enzimas microbianas con actividades Los capítulos I y II del presente trabajo
degradadoras sobre diferentes polímeros abarcan estos objetivos.
vegetales y el estudio de su aplicación en
procesos industriales.
2.2. Caracterización de la
Por ello, nos planteamos dos objetivos
principales:
xilanasa B (XynB) de
– Por un lado, la identificación y Paenibacillus barcinonensis y
caracterización de nuevas enzimas sobreexpresión en huéspedes
xilanolíticas. homólogos
– Y por otro lado la sobreexpresión de
Uno de los factores necesarios para facilitar la
xilanasas y el estudio y mejora de sus
aplicación y el estudio de enzimas es que éstas
características, con el fin de posibilitar su
puedan obtenerse de manera económica y en
aplicación industrial.
alta cantidad. Por ello son importantes los
ensayos de sobreexpresión de enzimas. Así
Estos objetivos principales se concretaron en
pues, los objetivos de este apartado fueron:
los apartados que se describen a continuación.
- El análisis detallado de la especificidad de
sustrato de la xilanasa B (XynB) de
2.1. Clonación e identificación de Paenibacillus barcinonensis. Esta xilanasa
había sido previamente caracterizada en el
xilanasas de Bacillus sp. BP-7
grupo de investigación y presentaba una
Con el fin de encontrar y caracterizar nuevas
actividad sobre aril-xilósidos inusualmente
xilanasas, los objetivos de este apartado
alta (Blanco et al., 1996).
fueron:
32

- La clonación de XynB de Paenibacillus


barcinonensis en vectores lanzadera
E. coli - Bacillus subtilis para su
transformación en cepas huéspedes de
Bacillus subtilis y el estudio de su
expresión en las cepas recombinantes
obtenidas.

Estos objetivos quedan cubiertos por los


resultados que se presentan en el capítulo III.

2.3. Estudio estructural e


ingeniería de proteínas con XynB
de Paenibacillus barcinonensis
Para profundizar en el conocimiento de esta
enzima, así como para mejorar sus cualidades
para una posible aplicación en la industria, se
decidió realizar estudios de estructura-función
y experimentos de ingeniería de proteínas.
En base a esto, los objetivos generales de este
apartado fueron:
- El análisis estructural y el estudio de la
relación estructura-función en la xilanasa B
de Paenibacillus barcinonensis.
- Ensayos de mutagénesis dirigida y
mutagénesis aleatoria (PCR mutagénica y
gene shuffling) para aumentar la
termoestabilidad de la xilanasa B.

Los resultados presentados en el capítulo IV


del presente trabajo comprenden estos últimos
objetivos.
MATERIALES Y MÉTODOS
35

- Escherichia coli XL1-Blue (Bullock et al.,


1. MICROORGANISMOS UTILIZADOS 1987): recA1 endA1 gyrA96 thi-1 hsdR17
Las enzimas estudiadas en el presente trabajo supE44 relA1 lac [F′proAB lacIqZ∆M15
provienen de las cepas bacterianas Tn10 (Tetr)].
Paenibacillus barcinonensis BP-23 (Blanco - Escherichia coli DH5α (Hanahan, 1983):
et al., 1993; Sánchez et al., 2005) y
F- φ80dlacZΔM15 Δ(lacZYA-argF)U169
Bacillus sp. BP-7 (López et al., 1998). Estas
deoR recA1 endA1 hsdR17(rk-, mk+) phoA
cepas fueron aisladas a partir de suelo de
arrozal del Delta de L'Ebre (lugar rico en supE44 λ- thi-1 gyrA96 relA1.

materia vegetal en descomposición y por tanto - Escherichia coli BL21(DE3) (Studier y


adecuado para aislar degradadores de celulosa Moffatt, 1986): contiene el lisógeno λDE3
y xilano), mediante cultivos de en su cromosoma, por lo que es capaz de
enriquecimiento en paja de arroz. Estas cepas expresar la ARN polimerasa de T7 al
presentaban elevada actividad degradadora de añadirse al medio de cultivo IPTG. hsdS
xilano, celulosa, pectina, tributirina y aceite de gal (λcIts857 ind1 Sam7 nin5 lacUV5-T7).
oliva. - Saccharomyces cerevisiae BY4741
(Andrés, 2003): MATa ura3Δ0 leu2Δ0
En los experimentos de clonación se usaron las met15Δ0 his3Δ1.
siguientes cepas huéspedes: - Saccharomyces cerevisiae mnn9
- Bacillus subtilis MW15 (Wolf et al., (Hernández et al., 1989): cepa deficiente en
1995): es una cepa deficiente en las glicosilación. MATa ura3Δ0 leu2Δ0
proteasas neutra y alcalina, en una celulasa, met15Δ0 his3Δ1 ypl050c::kanMX4.
una lichenasa y una xilanasa. his nprR2
nprE18 ΔaprA3 ΔeglS102 ΔbglT-bglSRV
ΔxynA CmR. 2. CULTIVO Y MANTENIMIENTO DE

- Bacillus subtilis MB216 (Lampen et al., MICROORGANISMOS


1986): Stp leuA8 arg-15 thrA recE4 hsrR
hsrM. 2.1. Medios de cultivo
- Escherichia coli 5K (Godessart et al., Los medios de cultivo más comúnmente
- - -
1988): F rk mk rpsL thr thi leu lacZ. utilizados se describen en las Tablas MM.2.1 y
- Escherichia coli HB101 (Bolivar y MM.2.2.
Backman, 1979): supE44 hsd20 rb- mb-
recA56 ara-14 proA2 lacY1 galK2 rpsL20 En el caso de medios sólidos, al medio líquido
xyl-5 mtl-1. correspondiente se añadía agar al 1,5%.
36

Tabla MM.2.1: Preparación de los medios de cultivo bacterianos comúnmente utilizados.


Composición por litro Preparación
LB (Luria Broth) Bactotriptona 10 g Tras disolver se llevaba a pH 7 y se
Extracto de levadura 5g esterilizaba en autoclave.
NaCl 10 g
Agua destilada
Caldo nutritivo Extracto de carne 1g Tras disolver se llevaba a pH 7 y se
Extracto de levadura 2g esterilizaba en autoclave.
Peptona 5g
NaCl 5g
Agua destilada
BREC1 NH4Cl 8g Se disolvían los 5 primeros
(Overbeeke et al., KH2PO4 4g componentes en agua y se autoclavaba.
1990) MgSO4·7H2O 1g Se autoclavaba el extracto de levadura
Sacarosa 40 g aparte, y se mezclaba todo antes de
NaCl 2g usar.
Extracto de levadura 10 g
Agua bidestilada
Solución traza 1 ml
Solución de vitaminas 1 ml
Solución traza para Tritriplex III (EDTA) 45 g Se disolvía el tritriplex llevando la
medio BREC1 CaCl2 95% 4,37 g solución a pH 8. Se añadían el resto de
FeSO4·7H2O 3,75 g componentes previamente diluidos y se
MnSO4·H2O 1,4 g esterilizaba en autoclave.
ZnSO4·7H2O 2,2 g
CuSO4·5H2O 0,4 g
CoCl2·6H2O 0,45 g
Na2MoO4·2H2O 0,26 g
H3BO3 0,4 g
KI 0,26 g
Agua destilada
Solución de Biotina 0,05 g Se disolvía y se esterilizaba por
vitaminas para Tiamina 5g filtración.
medio BREC1 Meso-inositol 4,7 g
Clorhidrato de piridoxina 1,46 g
Ácido D-pantoténico 23 g
Agua destilada
MG (NH4)2SO4 2g Se disolvían las sales de manera
K2HPO4 14 g secuencial en agua destilada. Para
KH2PO4 6g medios sólidos se disolvía el agar en
Citrato de sodio 1g agua destilada aparte. Se autoclavaban
MgSO4·7H2O 0,2 g por separado, se mezclaba a 50 ºC y se
Glucosa 50% 10 ml añadía la glucosa, la histidina y los
Histidina al 0.5% 10 ml casaminoácidos, previamente
Casaminoácidos al 5% 4 ml esterilizados.
MG2 (NH4)2SO4 2g Se disolvían las sales de manera
K2HPO4 14 g secuencial en agua destilada. En el caso
KH2PO4 6g de preparar medios sólidos se disolvía
Citrato de sodio 1g el agar en agua destilada aparte.
MgSO4·7H2O 0,2 g Se autoclavaban por separado, se
Sacarosa 5g mezclaban a 50 ºC y se añadía la
Histidina al 0,5% 10 ml histidina y los casaminoácidos,
Casaminoácidos al 5% 4 ml previamente esterilizados.
37

Tabla MM.2.2: Preparación de los medios de cultivo de levaduras utilizados.


Composición por litro Preparación
YPD Bactotriptona 20 g Tras disolver se llevaba a pH 7 y se
Extracto de levadura 10 g esterilizaba en autoclave.
Glucosa 20 g
Agua destilada
SD (medio mínimo Base nitrogenada para levaduras Tras disolver se llevaba a pH 6 y se
sintético para (sin aminoácidos) 7g esterilizaba en autoclave.
levaduras) Glucosa 20 g Antes de utilizar se añadían los
Sulfato amónico 5g aminoácidos y nucleótidos necesarios
Agua bidestilada (a concentraciones finales entre 0,002%
y 0,008%).

Cuando el experimento lo requería los medios etanol absoluto. La concentración final de


se suplementaban con diferentes sustratos, a uso era de 5 - 50 µg/ml.
las concentraciones finales indicadas: xilano
de madera de abedul (0,2 - 0,4%), xilano de En ocasiones, para la selección de cepas
espelta de avena (1%), xilano-RBB (0,1%), recombinantes de E. coli XL1-Blue y E. coli
paja de arroz (1%), ácido poligalacturónico DH5α, se usaron medios de cultivo
(0,4%), CMC (Carboximetil Celulosa; 0,5%), suplementados con IPTG (isopropil-β-
tributirina o aceite de oliva (1%). tiogalactopiranósido) y X-gal (5-bromo-4-
cloro-3-indolil-β-D-galactopiranósido):
Cuando era necesario se añadían antibióticos a - IPTG: se utilizaba como inductor de ls
los medios de cultivo: expresión génica. Se preparó una solución
- Ampicilina: se preparó una solución concentrada de IPTG 20 mg/ml en agua
concentrada de ampicilina 100 mg/ml en bidestilada y se esterilizó por filtración. La
agua bidestilada a la que se añadió NaOH concentración final de uso era de
hasta la completa solubilización de la 100 µg/ml.
ampicilina, y se esterilizó por filtración. La - X-gal: sustrato cromogénico de la
concentración final de uso en el medio era β-galactosidasa. Se preparó una solución
de 50 ó 100 µg/ml. concentrada de X-gal 200 mg/ml en
- Tetraciclina: se preparó una solución dimetilformamida. La concentración final
concentrada de tetraciclina 12,5 mg/ml en los medios era de 40 µg/ml.
etanol al 50%, y se esterilizó por filtración.
La concentración final en los medios era de Cuando se cultivaban en medio mínimo SD las
15 µg/ml. cepas S. cerevisiae BY4741 y S. cerevisiae
- Cloramfenicol: se preparó una solución mnn9 sin haber sido transformadas con
concentrada de cloramfenicol 100 mg/ml en plásmidos recombinantes que compensasen
38

sus auxotrofías, se suplementaba el medio con centrífuga de sobremesa, a 3000 r.p.m. durante
los siguientes aminoácidos y nucleótidos: 15 min a 4 ºC.
– Histidina 0,0080%. Se recuperaba los sobrenadantes (medio de
– Leucina 0,0020%. cultivo) en tubos aparte. Los pellets de células
– Uracilo 0,0035%. se resuspendían en 1 ml de Ringer 1/4 para
– Adenina 0,0020%. lavar las células, se transferían a tubos
eppendorf, y se centrifugaban en una
centrífuga eppendorf a 14000 r.p.m. durante
2.2. Mantenimiento de cepas 10 min a 4 ºC para sedimentar nuevamente las
Las cepas de Bacillus y Paenibacillus se células, descartando el sobrenadante.
mantenían a 4 ºC resembrándolas cada 15 días Para obtener los extractos celulares, las células
en placas de Agar Nutritivo (suplementado con se resuspendían en 1/10 del volumen original
los antibióticos necesarios), las cuales se de tampón Tris-HCl 100 mM pH 7 y se lisaban
incubaban a 30 ºC durante unas 16 - 24 h. por sonicación mediante 2 pulsos de 2 min a
Las cepas de E. coli se mantenían también a 50 W. Después de sonicar no se centrifugaba,
4 ºC resembrándolas cada 30 días en placas de de manera que los extractos obtenidos
Agar LB (suplementado con los antibióticos contenían tanto el citoplasma celular como los
necesarios), las cuales se incubaban a 37 ºC restos de membrana y pared bacterianas.
durante unas 16 - 24 h.

2.3.2. French Press


Asimismo, todas las cepas se mantenían
también congeladas a -80 ºC en glicerol al Fue el método habitual para grandes
15 %. volúmenes de cultivo.
Se repartían los cultivos líquidos (1 - 2 l) de
toda la noche de las cepas a estudiar en tubos
2.3. Fraccionamiento celular Beckman de 450 ml, y tras medir la D.O.600nm
se centrifugaba para sedimentar las células,
2.3.1. Sonicación usando para ello una centrífuga Beckman
Fue el método habitual para pequeños high-speed, a 7000 r.p.m. durante 15 min a
volúmenes de cultivo. 4 ºC.
Las muestras de cultivos líquidos (5 - 10 ml) Se recuperaban los sobrenadantes (medio de
de toda la noche de las cepas a estudiar, tras cultivo) en tubos aparte. Para lavar las células,
medir su D.O.600nm, se centrifugaban para los pellets se resuspendían en 50 ml de
sedimentar las células, usando para ello una Ringer 1/4 o tampón a pH 7, se transferían a
tubos Beckman de 35 ml, y se centrifugaba en
39

una centrífuga Beckman high-speed a 3. ENSAYOS DE ACTIVIDAD ENZIMÁTICA


7000 r.p.m. durante 15 min a 4 ºC para
sedimentar las células, descartando el 3.1. Determinación de actividad
sobrenadante.
hidrolítica sobre polisacáridos
Para obtener los extractos celulares, las células
mediante el método de
se resuspendían en 50 ml de tampón a pH 7 y
se lisaban por presión, utilizando un aparato de Nelson-Somogyi
French Press, en el que se sometían las células Este método permite cuantificar azúcares
bacterianas a presiones de 1000 psi reductores (extremos reductores), con lo que
(6894,76 kPa). permite valorar la actividad de enzimas
hidrolíticas que rompen polisacáridos
Después de lisar las células, se centrifugaba en generando nuevos extremos reductores, como
una centrífuga Beckman high-speed a es el caso de xilanasas, celulasas, pectinasas,
10000 r.p.m. durante 30 min a 4 ºC para amilasas, liquenasas (Spiro, 1966).
sedimentar las células no lisadas y la mayor Fue el método principalmente utilizado para
parte de restos celulares particulados, que se determinar las actividades enzimáticas que se
descartaban. Los sobrenadantes resultantes indican en la Tabla MM.3.3.
eran extractos celulares que contenían
Tabla MM.3.3: Actividades enzimáticas
básicamente la fracción citoplasmática.
ensayadas mediante el método de Nelso-Somogyi.

Actividad Polisacáridos utilizados


2.3.3. Lisis celular seguida de enzimática como sustrato en el ensayo
ultracentrifugación Xilanasa Principalmente xilano de
madera de abedul, aunque
Fue el método utilizado para la obtención de
también otros, como el xilano
fracciones celulares solubles desprovistas de de espelta de avena y
arabinoxilanos.
membranas.
Celulasa Carboximetil Celulosa y
Avicel
Partiendo de extractos celulares obtenidos por Pectinasa Pectina y ácido
cualquiera de los métodos anteriores, se poligalacturónico
repartían en tubos Beckman de 8 ml, y se Amilasa Almidón

centrifugaban usando una ultracentrífuga Liquenasa Liquenano


Laminarinasa Laminarina
Beckman a 38000xg durante 1 h a 4 ºC.

Para valorar la actividad hidrolítica sobre un


determinado polisacárido, las muestras
40

(5 - 25 µl) se incubaban con una solución de La valoración de la actividad se hacía frente a


dicho polisacárido a una concentración final una recta patrón del monosacárido que
del 0,5% en el tampón apropiado para obtener constituía el polisacárido sobre el que se
el pH deseado, y a la temperatura adecuada evaluaba la actividad hidrolítica, preparado en
para cada enzima. El volumen final de las mismas condiciones que en el ensayo de
reacción era de 100 μl. actividad. Una unidad de actividad enzimática
Por cada muestra se incubaban 3 tubos se define como la cantidad de enzima que
eppendorf: 2 réplicas y un blanco (al cual la libera 1 μmol de azúcar reductor por minuto en
muestra se añadía tras el reactivo de cobre). las condiciones de ensayo.
Después de la incubación a una temperatura
adecuada para las enzimas a ensayar, durante Soluciones:
el tiempo necesario, se enfriaban los tubos en - Reactivo alcalino de cobre:
hielo durante 5 min y se añadía agua Solución I: Tartrato sódico potásico 15 g
(1 litro) Na2CO3 30 g
bidestilada hasta 250 µl. NaHCO3 20 g
A continuación se añadían 250 µl de reactivo Na2SO4 180 g
de cobre (el cual se preparaba inmediatamente
Para preparar la Solución I se disolvían
antes de usar mezclando Solución I y
primero el tartrato sódico potásico y el Na2CO3
Solución II en una proporción 4:1 en
en agua bidestilada; y después se añadían el
volumen). Se mezclaba mediante vortex y se
NaHCO3 y el Na2SO4 ya disuelto en agua
calentaba al baño maría (a 100 ºC) durante
bidestilada.
10 min. Esto permitía que se diera la reducción
del Cu2+ en función de las sustancias
Solución II: CuSO4·5H2O 5g
reductoras del medio. (250 ml) Na2SO4 45 g
Tras enfriar en agua, se añadían 250 µl de
reactivo de arsenomolibdato (preparado Para preparar la Solución II se disolvían los

previamente a partir de una solución de dos reactivos en agua bidestilada.

arsenomolibdato y una de H2SO4 1,5 N en una


proporción 1:2 en volumen). Se mezclaba - Reactivo de arsenomolibdato:

usando vortex y se añadían 750 μl de agua Solución de (NH4)6Mo7O24·4H2O 25 g


arsenomolibdato: H2SO4 96% 21 ml
bidestilada (volumen final de 1,5 ml). (500 ml) Na2HAsO4·7H2O 3g
Por último, se centrifugaba durante 5 min a NaHCO3 20 g

4 ºC para precipitar sólidos y evitar así


Para preparar esta solución, se disolvía el
interferencias en la lectura espectrofotométrica
(NH4)6Mo7O24·4H2O en agua bidestilada, se
de la absorbancia de los sobrenadantes a
añadía el H2SO4 al 96%, se agitaba y se añadía
520 nm.
41

a continuación el Na2HAsO4·7H2O que cada lote de xilano-RBB ha de ser


previamente disuelto en agua bidestilada. Por estandarizado antes de utililizarse.
último, se incubaba a 37 ºC durante 24 - 48 h y
se guardaba en una botella opaca para Para valorar la actividad xilanasa se incubaban
protegerla de la luz. las muestras (50 - 125 µl) con xilano-RBB
(Sigma, 16% de marcaje) a una concentración
final del 5,92 mg/ml (equivalente a 0,5% de
3.2. Ensayo cromogénico de
xilano no marcado), en el tampón apropiado
actividad xilanasa para obtener el pH deseado, a la temperatura
El método utilizado es una modificación del adecuada y durante el tiempo necesario, en un
método descrito por Biely et al. (1998). volumen final de 0,5 ml.
Por cada muestra se incubaban 3 tubos
En este método se utiliza como sustrato de la eppendorf: 2 réplicas y un blanco.
reacción el xilano-RBB (xilano-Remazol Después de la incubación se añadía 1 ml
Brilliant Blue), un xilano marcado con el (2 volúmenes) de etanol absoluto y se
cromógeno Remazol Brilliant Blue R. Cuando mezclaba. El etanol detenía la reacción y hacía
este sustrato es degradado por endoxilanasas y precipitar el sustrato no hidrolizado y los
se añade etanol precipitan los fragmentos de fragmentos de alto peso molecular.
alto peso molecular, mientras los fragmentos En este punto se añadía también la muestra al
de menor peso molecular liberados por el blanco.
enzima quedan en solución, pudiéndose medir A continuación se mantenía 30 min a
fotométricamente el color solubilizado. temperatura ambiente (equilibración térmica
Las ventajas respecto a los métodos basados de las muestras), tras los cuales se centrifugaba
en la liberación de azúcares reductores son: a 2000xg durante 3 min, y se recuperaba el
- No se ve interferido por sustancias sobrenadante, sobre el cual se hacía la medida
reductoras del medio. de absorbancia a 595 nm (D.O.595).

- Es específico para endoxilanasas: las


enzimas de tipo exo no interfieren ni La valoración de la actividad se hacía frente a

producen falsos positivos. una recta patrón elaborada midiendo la D.O.595

Y las desventajas son: de ensayos con concentraciones crecientes del


enzima en las mismas condiciones y
- Es aproximadamente seis veces menos
correlacionando los valores obtenidos con
sensible que el método de Nelson-Somogyi.
cuantificaciones obtenidas mediante el método
- El marcaje del xilano no puede ser
Nelson-Somogyi de las mismas
controlado de manera precisa, de manera
concentraciones de enzima.
42

3.3. Ensayo de actividad sobre concentración final de 5 mg/ml (para los

aril derivados ensayos de especificidad de sustrato), 5 mM


(para los ensayos de actividad rutinarios) o
Se utilizó un método fotométrico basado en el
variable (para los ensayos de cinética
uso de aril derivados como sustratos. Los aril
enzimática), en el tampón apropiado para
derivados utilizados en los ensayos del
obtener el pH deseado, en un volumen final de
presente trabajo, adquiridos a Sigma-Aldrich,
0,25 ml, y a una temperatura adecuada para
se recogen en la Tabla MM.3.4.
cada enzima.
Tabla MM.3.4: Aril derivados y su abreviatura. Por cada muestra se incubaban 3 tubos
eppendorf: 2 réplicas y un blanco (al cual la
Aril derivado Abreviatura
pNitrofenil-β-D-Xilopiranósido pNPX muestra se añadía tras parar la reacción).
oNitrofenil-β-D-Xilopiranósido oNPX Después de incubar, los tubos se mantenían en
pNitrofenil-β-D-Glucopiranósido pNPG
hielo durante 5 min, y a continuación se añadía
pNitrofenil-β-Celobiósido pNPG2
pNitrofenil-β-Celotriósido pNPG3 1 ml de Na2CO3 1 M a cada tubo para parar la
pNitrofenil-β-Celotetraósido pNPG4 reacción.
pNitrofenil-β-Celopentaósido pNPG5
Por último, se medía la absorbancia a 400 nm
pNitrofenil-α-L-Arabinopiranósido pNAp
pNitrofenil-α-L-Arabinofuranósido pNAf (D.O.400nm) en un espectrofotómetro.

La valoración de la actividad se hacía frente a


Estos aril derivados eran prácticamente
una recta patrón de paranitrofenol u
incoloros y estaban formados por un
ortonitrofenol (dependiendo del grupo arilo
sustituyente carbohidratado (por ejemplo
presente en el aril derivado utilizado)
xilosa o glucosa) unido a un grupo arilo
preparada en las mismas condiciones.
(paranitrofenol, pNP, u ortonitrofenol, oNP),
simulando ser sustratos diméricos u
En los experimentos de cinética enzimática y
oligómeros cortos. La ruptura enzimática del
de termoestabilidad, se sustituyó el ensayo en
enlace entre el sustituyente y el grupo arilo,
tubo eppendorf por un ensayo en placas de
permite la liberación de este este último en
microtiter de 96 pocillos, que permiten realizar
forma soluble, la cual presenta coloración
un mayor número de ensayos simultáneos. En
amarilla que puede ser cuantificada
estos casos, el volumen final por pocillo era de
fotométricamente.
0,2 ml, y no se paraba la reacción con Na2CO3,
realizándose la lectura de absorbancia en el
Para valorar la actividad de las enzimas sobre
lector de placas inmediatamente tras la
estos sustratos, se incubaban las muestras
incubación.
(5 - 50 µl) con el aril derivado a una
43

3.4. Determinación del pH óptimo La MDH cataliza la siguiente reacción


enzimática:
Para determinar el pH óptimo (pH al que una
enzima tiene máxima actividad), se hicieron Oxalacetato + NADH + H+ ↔ Malato + NAD+
los ensayos de actividad enzimática, sobre los
sustratos adecuados, a diferentes pH en En nuestros experimentos, se cuantificó la
intrrvalos de 0,5 puntos de pH, usando para conversión de NADH + H+ a NAD+ midiendo
ello soluciones tampón distintas en función del la absorbancia a 334 nm (midiendo pues el
rango de pH a cubrir: decremento de NADH + H+).
Rango de pH
Tampón cubierto
A partir de cultivos líquidos se obtenían las
Citrato sódico 50 mM 3,0 - 4,0
Acetato sódico 50 mM 4,0 - 6,0 muestras a analizar: sobrenadantes de cultivo y
Fosfato sódico 50 mM 6,0 - 7,5 extractos celulares libres de restos celulares y
Tris-HCl 50 mM 7,0 - 9,0 membranas.
Glicina sódica 50 mM 9,0 - 12,0
La reacción enzimática se realizaba en una
cubeta espectrofotométrica de cuarzo, en la
3.5. Determinación de la que se mezclaban 1 ml de tampón fosfato
temperatura óptima potásico 200 mM pH 7,8, la muestra (máximo
1,2 ml), agua bidestilada esterilizada hasta
Para determinar la temperatura óptima
2,2 ml y 100 μl de NADH 6 mM.
(temperatura a la que una enzima muestra
A continuación se hacía el blanco de
máxima actividad), se hicieron los ensayos de
absorbancia a 334 nm, se añadían 100 μl de
actividad enzimática, sobre los sustratos
oxalacetato potásico 14 mM, se mezclaba por
adecuados, en amplio rango de temperaturas
inversión y se hacía un seguimiento del
en intervalos de 5 ó 10 ºC.
decremento de absorbancia a 334 nm durante
6 min a temperatura ambiente.
3.6. Cuantificación de la actividad Además se hacía un control de oxidación del

malato deshidrogenasa NADH, sin muestra.

La malato deshidrogenasa (MDH) es una Las unidades de actividad MDH (mol/min) se


enzima intracelular del ciclo de Krebs, que por calculaban a partir de la pendiente de la recta
tanto sólo se detecta en sobrenadantes de resultante y en función del coeficiente de
cultivos bacterianos si existe lisis celular, de extinción molar del NADH a 334 nm
manera que puede utilizarse como marcador (6,11·103 M-1cm-1) según la siguiente fórmula:
para cuantificar el porcentaje de lisis celular en    D.O.334nm Muestra− D.O.334nm Control ×Volumen

U= Coeficiente extinción molar ×1cm 

Bacillus subtilis. tiempo


44

El grado de lisis se expresó como el porcentaje midiendo la absorbancia a 340 nm (midiendo


de actividad malato deshidrogenasa pues el incremento de NADPH + H+).
extracelular (en sobrenadantes) respecto a la
actividad malato deshidrogenasa total (en A partir de cultivos líquidos se obtenían los
extractos celulares más sobrenadantes). sobrenadantes de cultivo y los extractos
celulares libres de restos celulares y
Soluciones: membranas.
Tampón K2HPO4 200 mM + KH2PO4 La reacción enzimática se realizaba en una
fosfato 200 mM hasta pH 7,8 cubeta espectrofotométrica de cuarzo, en la
potásico
200 mM que se mezclaban 500 μl de tampón fosfato
pH 7,8: potásico 100 mM pH 8, 20 μl de MgCl2
Oxalacetato Oxalacético 28 mM 25 ml 250 mM, 50 μl de NADP 8 mM, la muestra
potásico KOH 28 mM 25 ml
14 mM: (máximo 420 μl) y agua bidestilada
(50 ml) esterilizada hasta 990 μl.
NADH 6 mM A continuación se hacía el blanco de
absorbancia a 340 nm, se añadían 10 μl de
isocitrato 100 mM, se mezclaba por inversión
3.7. Cuantificación de la actividad
y se hacía un seguimiento del incremento de
isocitrato deshidrogenasa
absorbancia a 340 nm durante 6 min a
La isocitrato deshidrogenasa (ICDH) es una temperatura ambiente.
enzima intracelular del ciclo de Krebs, Además se hacía un control de reducción del
relativamente resistente a los exoenzimas de NADP, sin muestra.
Bacillus subtilis. Sólo se detecta en
sobrenadantes de cultivos bacterianos si existe Las unidades de actividad ICDH (mol/min) se
lisis celular, de manera que puede utilizarse calculaban a partir de la pendiente de la recta
como marcador para cuantificar el porcentaje resultante y en función del coeficiente de
de lisis celular (Harwood et al., 1990). extinción molar del NADPH a 340 nm
(6,22·102 M-1cm-1) según la siguiente fórmula:
La ICDH, en presencia de Mn2+ o Mg2+,    D.O.340nm Muestra− D.O.340nm Control ×Volumen

U=
Coeficiente extinción molar ×1cm 

cataliza la siguiente reacción enzimática: tiempo

threo-Ds isocitrato + NADP+ ↔ 2-oxoglutarato El grado de lisis se expresó como el porcentaje

+ NADPH + H+ + CO2 de actividad isocitrato deshidrogenasa


extracelular (en sobrenadantes) respecto a la
actividad malato deshidrogenasa total (en
En nuestros experimentos, se cuantificó la
extractos celulares más sobrenadantes).
conversión de NADP a NADPH + H+
45

Soluciones: pET3b: este plásmido forma parte de la serie


Tampón fosfato K2HPO4 100 mM + de vectores pET (Studier y Moffatt, 1986;
potásico 100 mM KH2PO4 100 mM hasta Novagen) para la expresión inducible por
pH 8: pH 8
IPTG en cepas de E. coli que contengan el
Isocitrato 100 mM
lisógeno λDE3. El plásmido pET3b permite
NADP 8 mM
clonar genes bajo el control del promotor
fuerte e inducible del fago T7, entre las dianas
4. VECTORES PLASMÍDICOS UTILIZADOS NdeI y BamHI. Además posee un gen
marcador para la selección de transformantes
pUC19: el plásmido pUC19 (Yanisch-Perron
en ampicilina.
et al., 1985) es un vector de clonación en
pN5: el plásmido pN5 (Pastor et al., 1999) es
E. coli de alto número de copia, que permite la
un vector lanzadera E. coli - Bacillus subtilis,
selección blanco-azul de recombinantes
resultado de la ligación de pUC19 con pC194
gracias a que el polylinker (sitio de clonación
(vector de clonación en Bacillus subtilis)
múltiple) se encuentra interrumpiendo el gen
(Alonso y Tailor, 1987). Permite la selección
5'-lacZ. Las colonias transformantes pueden
de transformantes por resistencia a ampicilina
seleccionarse por su resistencia a ampicilina
(E. coli) y cloramfenicol (B. subtilis).
(gracias al gen bla del plásmido, que codifica
pRB473: el plásmido pRB473 (Obst et al.,
para una β-lactamasa).
1995) es un vector lanzadera
pGEM®-T y pGEM®-T easy: vectores
E. coli - Bacillus subtilis derivado de pBR322
comerciales de la empresa Promega
(vector de clonación en E. coli de bajo número
Corporation (Robles y Doers, 1994) basados
de copia) (Bolivar et al., 1977) y pUB110
en el plásmido pGEM®-5Zf(+) de clonación
(vector de clonación en B. subtilis) (Maciag et
en E. coli (Yanisch-Perron et al., 1985),
al., 1988). Permite la selección de
digerido con EcoRV (en posición 51 en el caso
transformantes por resistencia a ampicilina
de pGEM®-T, y 60 en el caso de
(E. coli) y cloramfenicol (B. subtilis).
pGEM®-T easy), al que se ha añadido una
pRBSPO2: el vector pRBSPO2 contiene el
timina (T) en cada extremo 3' libre, para
promotor SPO2, promotor fuerte en B. subtilis
aumentar la eficacia de clonación de
(Williams et al., 1981b; Bolhius et al., 1999),
fragmentos de ADN provenientes de
insertado en el polylinker de pRB473.
amplificación con polimerasas que añaden una
pMSR8: el plásmido pMSR8 (Soriano, 2004)
adenina en 3', como la Taq polimerasa.
es un vector lanzadera
Permiten la selección de transformantes por
E. coli - Bacillus subtilis derivado de pUC19 y
resistencia a ampicilina.
pUB110. Permite la selección de
46

transformantes por resistencia a ampicilina 15 min, se le añadían 500 µl de isopropanol, y


(E. coli) y kanamicina (B. subtilis). se dejaba 5 min a temperatura ambiente. Tras
pMSR8amy y pMSR8SPO2: son vectores este tiempo, se centrifugaba 5 min y se
derivados del vector pMSR8, que contienen decantaba el isopropanol. El pellet (que
los promotores de la α-amilasa (Palva et al., contenía el ADN) se secaba al vacío y se
1981) y SPO2, respectivamente, promotores resuspendía en 200 µl de TE.
fuertes en B. subtilis. A continuación se añadían 200 µl de LiCl 5 M
YEplac195: vector lanzadera y se mantenía la preparación 5 min a -20 ºC.
E. coli-S. cerevisiae (Gietz y Sugino, 1988). Se centrifugaba 5 min, y se recuperaba el
sobrenadante.
Para precipitar el ADN, se añadían 40 µl de
5. ANÁLISIS Y MANIPULACIÓN DEL solución III y 2 volúmenes de etanol absoluto
ADN RECOMBINANTE frío, y se dejaba 1 h a -20 ºC. Después el ADN
se recogía por centrifugación (15 min), se
5.1. Extracción de ADN lavaba 2 veces con etanol al 70% frío
(1 volumen de etanol), se secaba al vacío y se
plasmídico
resuspendía en el volumen adecuado de agua
5.1.1. Minipreparación de ADN bidestilada esterilizada.
plasmídico por lisis alcalina
Soluciones:
A partir de 5 - 10 ml de cultivos en fase
estacionaria, las células se recogían por Solución I: Glucosa 50 mM.
Tris-HCl 25 mM pH 8.
centrifugación y se resuspendían en 200 µl de EDTA 10 mM.
solución I agitando vigorosamente. En caso de Solución II: NaOH 0,2 N.
extraer ADN plasmídico de Bacillus subtilis, SDS 1%.
se añadían también 20 µl de lisozima Solución III: Acetato sódico 3 M.
Ajustada a pH 4,8 con ácido
20 mg/ml (concentración final de 2 mg/ml), acético glacial.
para degradar su gruesa pared celular de TE: Tris-HCl 10 mM pH 8.
peptidoglicano. Se incubaba con la solución I EDTA 1 mM.
durante 5 min en hielo.
Se añadían a continuación 400 µl de
5.1.2. Midipreparación de ADN
solución II y se mantenía 5 min en hielo.
plasmídico
Después se añadían 300 µl de solución III y se
Se utilizó el kit comercial QIAGEN-tip 100
mantenía otros 5 min en hielo.
MidiPrep.
El sobrenadante se recuperaba tras centrifugar
en una microcentrífuga eppendorf durante
47

En este kit, el ADN plasmídico se aislaba Este tratamiento solo se aplicó a las muestras
mediante cromatografía de intercambio de ADN plasmídico cuando el ARN podía
aniónico en columna, partiendo de 25 ml de enmascarar la presencia de algunos fragmentos
cultivo para plásmidos de alto número de de ADN en los geles. Por el contrario, no se
copia (como pUC19), y de 100 ml de cultivo aplicó a las muestras obtenidas usando el kit
para plásmidos de bajo número de copia comercial QIAGEN-tip 100 MidiPrep, ya que
(como pRB473). en su protocolo se incluye un tratamiento con
RNAsa A.

5.2. Digestión con enzimas de


restricción y tratamiento con 5.3. Ligación de moléculas de
RNAsa ADN
Las ligaciones entre insertos y vectores de
5.2.1. Digestión con enzimas de ADN se realizaron usando la ligasa del
restricción bacteriófago T4 (Biolabs) siguiendo las
Las digestiones con enzimas de restricción se instrucciones de la casa comercial.
hicieron siguiendo las instrucciones del Generalmente, las proporciones molares entre
suministrador (Boehringer Mannheim, ADN vector y ADN inserto fueron 1:3 cuando
Promega o Biolabs). se trabajaba con plásmidos de clonación en
Los tampones utilizados fueron los E. coli y 1:6 cuando se trabajaba con vectores
suministrados con cada enzima (los óptimos lanzadera E. coli - Bacillus subtilis.
según la casa comercial). En las digestiones
dobles se escogió el tampón más adecuado
para la actividad de ambas enzimas. 5.4. Amplificación por PCR

5.4.1. Amplificación de alta fidelidad


5.2.1. Tratamiento con RNAsa Las amplificaciones preparativas, en las que
La eliminación de ARN de las preparaciones interesaba que no se introdujeran cambios
de ADN se realizó justo antes de cargar las aleatorios en la secuencia de nucleótidos, se
muestras en geles de agarosa mediante la llevaron a cabo utilizando una ADN
adición de RNAsa A (Biolabs) en una polimerasa de alta fidelidad (Stratagene cloned
concentración final de 10 µg/ml (a partir de un Pfu ADN Polymerase) para la reacción de
stock de 5 mg/ml) e incubando a temperatura amplificación, siguiendo las instrucciones de
ambiente durante 5 - 10 min. la casa comercial:
48

Tampón 10X: 1X Tampón 10X: 1X


Deoxinucleótidos Deoxinucleótidos
200 μM cada dNTP 200 μM cada dNTP
trifosfato (dNTPs): trifosfato (dNTPs):
ADN molde: 50 - 200 ng/100 μl Dideoxinucleótido
200 μM extra
Cebadores: 0,2 μM cada uno trifosfato en exceso:
Polimerasa Pfu: 5,0 U/100 μl ADN molde: 50 - 200 ng/100 μl
Cebadores: 0,4 μM cada uno
Polimerasa Taq: 2,5 U/100 μl
Generalmente los volúmenes de reacción eran
de 50 μl, aunque en algunas ocasiones se
Generalmente los volúmenes de reacción eran
usaron volúmenes de 100 μl para obtener
de 50 μl; y tras la amplificación se mezclaba el
mayor cantidad de ADN amplificado.
contenido de los 4 tubos utilizados.

El termociclador utilizado fue un Perkin Elmer


El termociclador utilizado fue un Perkin Elmer
GeneAmp PCR System 2400.
GeneAmp PCR System 2400.

El ADN amplificado se purificó usando el kit


Wizard® de Promega para la eliminación de 5.5. Gene Shuffling
sales, cebadores, dNTPs y otros (recombinación in vitro por PCR)
contaminantes.
Se utilizó un método muy similar al de
Stemmer (1994), consistente básicamente en
5.4.2. PCR mutagénica fragmentar las diferentes copias de un gen o

Permite realizar mutagénesis aleatoria fragmento de ADN de manera aleatoria con

aprovechando la falta de actividad correctora DNAsa I, para después volver a recomponer el

de polimerasas como la Taq. gen mediante una primera PCR sin cebadores

Además, para aumentar la tasa de error de esta (PCR I), que permite la mezcla aleatoria pero

ADN polimerasa (2x10-5 mutaciones por ordenada de los diferentes fragmentos (con o

nucleótido por ciclo), se realizaron 4 PCRs de sin mutaciones), y una segunda PCR de

amplificación diferentes del mismo gen, en amplificación utilizando 2 cebadores (PCR II),

cada una de las cuales uno de los cuatro que permite obtener la gran variedad de copias

dNTPs estaba en exceso. del gen generadas durante el proceso.

Para la reacción de PCR se siguieron las Se partía de amplificados obtenidos bien

instrucciones de la casa comercial mediante una PCR mutagénica bien mediante

suministradora de la Taq polimerasa: una PCR no mutagénica, pero utilizando en


ambos casos una ADN polimerasa sin
actividad correctora. Los amplificados eran
49

analizados en geles de agarosa de bajo punto QIAGEN, y se comprobaba su tamaño por


de fusión (0,7% de agarosa en TAE), y la electroforesis en geles de agarosa 0,7% en
banda correspondiente al gen de interés se TBE.
eluía utilizando el kit Wizard® de Promega.
Una vez comprobado el tamaño de los
A continuación las muestras de ADN se fragmentos A y B de ADN, se realizaba con
sometían a una digestión parcial con DNAsa I ellos una PCR sin cebadores (PCR I), en la que
en presencia de Mg2+, para obtener fragmentos los mismos fragmentos de ADN actuaban
cohesivos de tamaño aleatorio. La mezcla de simultáneamente como molde y como
reacción contenía: cebadores, de manera que por
ADN muestra: 80 μl complementariedad de bases y amplificación,
Tampón Tris-HCl 1 M pH 7,4: 5 μl el gen se iba reensamblando de nuevo.
MgCl2 2,5 M: 4 μl
DNAsa I 1 U/μl: 1 μl Para encontrar las condiciones adecuadas de
Agua destilada: Hasta 100 μl PCR I para cada experimento de gene
shuffling, se realizaban varias PCR de prueba
Se incubaba a 25 ºC hasta obtener fragmentos
en 25 μl de reacción conteniendo diferentes
de ADN entre 150 y 500 bp. Para comprobar
cantidades (entre 10 y 17 μl) de fragmentos de
el tamaño de los fragmentos de digestión, cada
ADN de tipo A, de tipo B o una mezcla de
3 min se analizaban 3 μl de la mezcla de
ambos:
reacción mediante electroforesis en geles de
Tampón 10X: 1X
agarosa. Deoxinucleótidos
200 μM cada dNTP
Una vez los fragmentos de ADN alcanzaban el trifosfato (dNTPs):
ADN molde: 10 - 17 μl
rango de tamaño deseado, se paraba la Cebadores: -
reacción añadiendo 10 μl de EDTA 0,5 M y Polimerasa Taq: 2,5 U/100 μl
calentando a 80 ºC durante 10 min para
El programa de PCR utilizado se dividía en 2
inactivar la DNAsa I.
secciones para favorecer el aumento de tamaño
A continuación, las muestra de ADN digerido
de los fragmentos de ADN y permitir tomar
eran separadas en geles de agarosa de bajo
muestra a medio programa (tras los 20
punto de fusión (1,5% de agarosa en TAE), de
primeros ciclos) y monitorizar el aumento de
los que se recortaba por un lado la zona del gel
tamaño:
que contenía fragmentos de ADN de 200 a
400 bp (fragmentos de tipo A) y por otro la
que contenía fragmentos de 80 a 200 bp
(fragmentos de tipo B). Estos fragmentos de
ADN se eluían utilizando el kit QIAquick de
50

Hold Incial: 94 ºC 5 min Hold Inicial: 94 ºC 5 min


Desnaturalización: 94 ºC 30 s Desnaturalización: 94 ºC 30 s
x10-15
Hibridación: 50 ºC 30 s x20 ciclos Hibridación: 55 ºC 25 s
ciclos
Síntesis: 72 ºC 40 s Síntesis: 72 ºC 2 min
Hold Intermedio: 94 ºC 5 min Hold de síntesis: 72 ºC 10 min
Desnaturalización: 94 ºC 30 s Parada: 4 ºC -
Hibridación: 60 ºC 25 s x25 ciclos
Síntesis: 72 ºC 1 min Una vez concluido el programa de
Hold de síntesis: 72 ºC 10 min
Parada: 4 ºC - amplificación, los productos de PCR II se
analizaban electroforéticamente para
Una vez concluido el programa de comprobar el tamaño de los fragmentos
amplificación, los productos de cada PCR I amplificados y la obtención de un amplificado
eran analizados electroforéticamente para con el tamaño del fragmento original,
comprobar si había habido aumento de tamaño indicativo de que se había reconstruido dicho
de los fragmentos de ADN. fragmento.
Si era así, se usaban éstos como molde para la Si era así, se repetía la PCR II tantas veces
PCR II. como fuera necesario, y usando mayores
volúmenes de reacción, para obtener suficiente
En la PCR II se amplificaba el resultado de cantidad de ADN mutagenizado.
PCR I utilizando cebadores externos (los
mismos que se utilizaban en la amplificación La banda de ADN correspondiente al tamaño
previa al gene shuffling), con el objetivo de del gen mutagenizado se eluía utilizando el kit
obtener múltiples copias de las diferentes Wizard® de Promega tras su separación en
variantes mutagenizadas del gen original que geles de agarosa de bajo punto de fusión (0,7%
se hubieran generado durante el proceso: de agarosa en TAE).
Tampón 10X: 1X
Deoxinucleótidos Tampones:
200 μM cada dNTP
trifosfato (dNTPs):
Producto de PCR I: 1 μl TAE (10X): Tris 0,9 M
Cebadores: 0,4 μM cada uno Ácido acético 0,9 M
Polimerasa Taq: 2,5 U/100 μl EDTA 0,02 M
pH 8,3
El volumen utilizado era de 25 μl, y el
programa presentaba un número reducido de
ciclos para evitar la aparición de amplificados
inespecíficos:
51

5.6. Transformación Después se añadía 1 ml de medio LB (sin


antibióticos) y se incubaba a 37 ºC durante 1 h
5.6.1. Transformación de Escherichia en agitación, para permitir la expresión de los
coli genes marcadores de resistencia a antibióticos
Se utilizó un método basado en el descrito por presentes en el ADN introducido.
Cohen et al. (1972).
Por último, las células transformadas se
A partir de un cultivo nocturno de la cepa de sembraban en placas de Agar LB
E. coli a transformar, se inoculaban 20 ml de suplementado con los antibióticos necesarios
LB fresco (con los antibióticos necesarios) y para la selección de transformantes y se
se incubaba a 37 ºC en agitación hasta una incubaban a 37 ºC durante 16 - 24 h.
D.O.600nm de 0,3 - 0,5 (correspondiente a la fase
exponencial de crecimiento).
5.6.2. Transformación de Bacillus
Una vez alcanzada esta densidad óptica, se
subtilis
separaban 10 ml del cultivo (volumen inicial)
Se utilizó el método descrito por Cohen y
y se mantenían a 0 ºC durante 10 min. A
Chang (1979).
continuación, se recogían las células por
centrifugación en una centrífuga de sobremesa
A partir de un cultivo nocturno en caldo
(5 min a 4 ºC), se resuspendían en 5 ml (1/2
Penassay de la cepa de B. subtilis a
del volumen inicial) de CaCl2 50 mM enfriado
transformar, se inoculaban 65 ml de caldo
en hielo, y se mantenían durante 20 min en
Penassay fresco (con los antibióticos
hielo.
necesarios) y se incubaba a 37 ºC en agitación
Transcurrido este tiempo se recogían las
hasta una D.O.600nm de 0,5 - 0,6
células por centrifugación (3 min a 4 ºC), se
(correspondiente a la fase exponencial de
resuspendían en 665 µl (1/15 del volumen
crecimiento).
inicial) de CaCl2 50 mM enfriado en hielo y se
Se separaban entonces 50 ml de cultivo
mantenían en hielo durante 1 - 1,5 h, para
(volumen inicial) y se centrifugaban para
obtener así células competentes.
recoger las células, que eran después
resuspendidas en 5 ml (1/10 del volumen
A continuación, 100 µl de células competentes
inicial) de SMMP con lisozima 2 mg/ml. Esta
se mezclaban con el ADN a introducir por
suspensión se incubaba a 37 ºC durante 3 h, en
transformación y se mantenían en hielo
agitación muy suave, hasta que al microscopio
durante 1 h. Tras este tiempo las células eran
se observaba la formación de protoplastos.
sometidas a un choque térmico de 42 ºC
durante 2 min, y se volvían a poner en hielo.
52

A continuación, se recogían los protoplastos (2600xg 15 min).


por centrifugación (2600xg 15 min) y se Después de este lavado, los protoplastos se
resuspendían en 5 ml de SMMP para resuspendían suavemente en 5 ml (1/10 del
recogerlos de nuevo por centrifugación volumen original) de SMMP.

Tabla MM.5.5: Medios y tampones para la transformación de protoplastos de Bacillus subtilis.

Composición Preparación
Caldo Penassay 1X Extracto de levadura 1,5 g Tras disolver se esterilizaba en
(1 l): Extracto de carne 1,5 g autoclave.
Peptona 5g
Glucosa 1g
NaCl 3,5 g
K2HPO4 3,68 g
KH2PO4 1,32 g
Agua destilada
Caldo Penassay 4X Extracto de levadura 1,5 g Tras diolver se esterilizaba en
(250 ml): Extracto de carne 1,5 g autoclave.
Peptona 5g
Glucosa 1g
NaCl 3,5 g
K2HPO4 3,68 g
KH2PO4 1,32 g
Agua destilada
SMM 2X Sacarosa 171,15 g Tras disolución de sus
(500 ml): Maleato 2,32 g componentes, se ajustaba a pH 6,5
MgCl2 4,06 g con NaOH, se enrasaba a 500 ml
Agua bidestilada con agua bidestilada y se
autoclavaba.
SMMP: Volúmenes iguales de caldo Penassay 4X Se hacía la mezcla en condiciones
y SMM 2X. estériles.
PEG6000 al 40% PEG6000 (Polietilenglicol 6000) 50 ml Se disolvía el PEG en SMM 2X
en SMM: caliente. Tras autoclavar, se
enrasaba a 100 ml con agua
destilada estéril.
Agar DM3 Agar 8g Se esterilizaban por filtración la
(1 l): Extracto de levadura 10% 5g BSA y los casaminoácidos. El
K2HPO4 3,5 g MgCl2 y el succinato sódico se
KH2PO4 1,5 g autoclavaban por separado. El
Glucosa 5g resto de productos se autoclavaban
Agua destilada 375 ml juntos.
Antes de plaquear, se calentaban
las diferentes soluciones; se
Succinato sódico 1 M pH 7,3 500 ml mezclaban el succinato sódico, el
MgCl2 1 M 20 ml cloruro de magnesio, los
Casaminoácidos 5% 100 ml casaminoácidos y la BSA, y se
Seroalbúmina bovina (BSA) 2% 5 ml añadían a la botella que contenía
el resto de productos con el agar.
Stock de lisozima: 20 mg/ml de lisozima en agua bidestilada Se esterilizaba por filtración.
53

Se mezclaban 0,5 ml de protoplastos en 6. SECUENCIACIÓN Y ANÁLISIS DE


SMMP con 1,5 ml de Polietilenglicol 6000
SECUENCIA
(PEG6000) al 40% en SMM, 50 µl de TE,
50 µl de SMM 2X y el ADN a introducir por
6.1. Secuenciación
transformación (de 1 pg a 5 μg). Esta mezcla
se incubaba 5 min a temperatura ambiente, y a Se utilizó la secuenciación automática

continuación se añadían 5 ml de SMMP y se fluorescente por PCR, empleando para ello los

centrifugaba para recuperar los protoplastos kits de secuenciación comerciales de

(2600xg 10 min). Amershan y Perkin Elmer y los secuenciadores

Una vez recuperados los protoplastos, se ABI PRISM 377 ADN Sequencer y ABI

resuspendían en 1 ml de SMMP y se PRISM 3700 ADN Analyzer (Perkin Elmer)

incubaban a 30 ºC durante 1,5 h en agitación de los Serveis Cientificotècnics de la

suave, para permitir la expresión de los genes Universitat de Barcelona (UB).

marcadores de resistencia a antibióticos


presentes en el ADN introducido.
6.2. Análisis informático de
secuencias
Por último, los protoplastos transformados se
sembraban en placas de Agar DM3 Se realizaron búsquedas de homología tanto de
suplementado con los antibióticos necesarios secuencias de nucleótidos como de
para la selección de transformantes, y se aminoácidos usando los programas Blast del
incubaba a 30 ºC durante 2 - 3 días para NCBI (Altschul et al., 1997), Fasta3 del EBI
permitir que los protoplastos regeneraran la (Pearson, 1990) y Blast del SubtiList Web
pared y así como el crecimiento de los clones Server (http://genolist.pasteur.fr/SubtiList/ ;
transformantes correspondientes. Moszer et al., 1995). Se utilizaron los servicios
Pfam (http://pfam.sanger.ac.uk/ ; Finn et al.,
Los medios de cultivo y los tampones 2006) y ProDom (http://prodom.prabi.fr/ ; Bru
utilizados para esta técnica de transformación et al., 2005) para la búsqueda de homologías
se describen en la Tabla MM.5.5. de secuencia con dominios de proteínas ya
conocidas.

Asimismo se realizaron alineamientos


múltiples de secuencias de proteínas usando
los programas ClustalX (Thompson et al.,
1997) y ClustalW
(http://www.ebi.ac.uk/Tools/clustalw/ ;
54

Thompson et al., 1994) en su versión 1.8. Los 7. DICROISMO CIRCULAR


árboles filogenéticos a partir de estos
El dicroismo circular (CD) es una técnica
alineamientos se generaron usando el
espectrofotométrica basada en la absorción
programa ClustalX y se visualizaron con el
diferencial de la luz polarizada circularmente a
programa TreeView (Page, 1996).
la derecha y a la izquierda. Todas las
macromoléculas presentan esta característica,
En la predicción de péptido señal se utilizaron
que puede ser utilizada para la caracterización
los programas SignalP v1.1
estructural de proteínas (Beychok, 1966;
(http://www.cbs.dtu.dk/services/SignalP/ ;
Bulheller et al., 2007).
Nielsen et al., 1997, 1999) y PSort v6.4
(http://psort.nibb.ac.jp/ ; Nakai y Kanehisa,
Para medir el CD de las proteínas purificadas,
1991, 1992).
se utilizó un espectropolarímetro Jasco J-810
(JASCO Inc.) de los Serveis Cientificotècnics
Para la predicción de estructura secundaria se
de la Universitat de Barcelona (UB).
utilizaron los servicios on-line Jpred
(http://www.compbio.dundee.ac.uk/~www-
jpred/ ; Cuff y Barton, 2000) y SCRATCH 8. ANÁLISIS ELECTROFORÉTICO
(http://www.igb.uci.edu/tools/scratch/ ; Cheng
et al., 2005), ambos basados en el 8.1. Electroforesis en geles de
procesamiento de alineamientos múltiples
poliacrilamida desnaturalizantes
mediante redes neuronales.
Generalmente, las muestras proteicas se
analizaron mediante electroforesis en geles
Para la predicción de modelos de estructura
desnaturalizantes de poliacrilamida con
terciaria por homología se utilizó el servicio
dodecil sulfato sódico (SDS-PAGE) según
automatizado on-line SWISS-MODEL
Laemmli (1970), lo que permite separar las
(http://swissmodel.expasy.org/ ; Schwede et
proteínas en función de su peso molecular.
al., 2003)

El montaje y la electroforesis se realizaron


También se usaron las herramientas del
usando un aparato Mini-Protean-II (Bio-Rad).
ExPASy Molecular Biology Server
(http://expasy.org/ ; Gasteiger et al., 2003)
Los geles utilizados fueron geles de 2 fases, un
para la predicción de diferentes parámetros
gel de empaquetamiento al 5% de
físico-químicos de las proteínas secuenciadas.
poliacrilamida y un gel separador al 10% o al
12%, preparados de la siguiente manera:
55

Separador Empaquetador Tampones y soluciones:


10% 12% 5% Solución de Acrilamida 30%
Solución de acrilamida: Bisacrilamida 0,8%
2 ml 2,4 ml 0,42 ml
acrilamida Tampón de Tris-HCl 1,5 M pH 8,8
Tampón 1,56 ml 1,56 ml 0,625 ml separación: SDS 0,4%
Agua Tampón de Tris-HCl 0,5 M pH 6,8
2,4 ml 2 ml 1,4 ml empaquetamiento: SDS 0,4%
bidestilada
Persulfato Tampón de Tris-HCl 0,25 M pH 8,3
30 μl 30 μl 17,5 μl electroforesis Glicina 1,92 M
amónico 10%
(10X): SDS 1%
TEMED 5 μl 5 μl 5 μl
Tampón de Glicerol 10%
muestra 3X: β-mercaptoetanol 5%
Cuando se preparaban geles para la detección SDS 2,3%
Tris-HCl 0,0625 M pH 6,8
de actividades mediante zimograma, se Azul de bromofenol 0,02%
sustituía parte del agua por una solución en
agua del sustrato cuya degradación se quería
estudiar, en nuestro caso xilano de madera de 8.2. Electroforesis en geles de
abedul al 0,2% final. poliacrilamida en condiciones
nativas
Las muestras, antes de ser cargadas en los
Cuando había que analizar la actividad en gel
geles, se mezclaban con tampón de muestra
de enzimas que se desnaturalizaban
3X y se trataban a 100 ºC durante 5 min para
irreversiblemente (como es el caso de XynB
desnaturalizarlas. Además de las muestras, en
de Paenibacillus barcinonensis), se recurrió a
uno de los carriles se cargaba también un
la utilización de geles de poliacrilamida
marcador comercial de pesos moleculares.
nativos (no desnaturalizantes) según Hames y
Las electroforesis se desarrollaban
Rickwood (1981).
generalmente a 75 V a través del gel de
Estos geles son similares a los de SDS-PAGE,
empaquetamiento y a 100 V a través del gel
pero los reactivos utilizados no contienen
separador.
elementos desnaturalizantes, de manera que las
proteínas migran en función de su carga
Una vez desarrollada la electroforesis, los
eléctrica y de su volumen molecular.
geles podían revelarse para la detección de
proteínas (tinción de Coomassie) o de actividad
Como en el caso del SDS-PAGE, los geles
enzimática (revelado zimográfico).
utilizados fueron geles de 2 fases, un gel de
empaquetamiento al 5% de poliacrilamida y un
gel separador generalmente al 8% o al 10%,
preparados del siguiente modo:
56

Separador Empaquetador Tampones y soluciones:


8% 10% 5% Solución de Acrilamida 30%
Solución de acrilamida: Bisacrilamida 0,8%
1,33 ml 1,66 ml 0,5 ml
acrilamida Tampón de Tris-HCl 3 M pH 8,8
Tampón 0,62 ml 0,62 ml 1 ml separación:
Agua Tampón de Tris-HCl 0,5 M pH 6,8
2,79 ml 2,46 ml 2 ml empaquetamiento:
bidestilada
Persulfato Tampón de Tris-HCl 0,25 M pH 8,3
250 μl 250 μl 300 μl electroforesis Glicina 1,92 M
amónico 1,5%
(10X):
TEMED 8 μl 8 μl 5 μl
Tampón de Glicerol 30%
muestra 3X: β-mercaptoetanol 5%
Para la detección de actividades mediante Tris-HCl 0,19 M pH 6,8
Azul de bromofenol 0,08%
zimograma, se sustituía parte del agua por una
solución en agua del sustrato cuya degradación
se quería estudiar, en nuestro caso xilano de 8.3. Tinción de proteínas con azul
madera de abedul al 0,2% final. de Coomassie
Una vez desarrollada una electroforesis de
Las muestras, antes de ser cargadas en los
proteínas en geles de poliacrilamida, para
geles, se mezclaban con tampón de muestra
visualizar las bandas de proteínas se teñían los
nativo 3X y no se trataban térmicamente.
geles durante 1 h con una solución de azul
Tampoco se utilizaba ningún tipo de marcador
brillante de Coomassie, y después se desteñían
de pesos moleculares, ya que las proteínas en
con ácido acético al 10% hasta observar la
estos geles no se separan en base a su peso
aparición de bandas.
molecular.

Solución para la Azul de Coomassie


Las electroforesis se desarrollaban tinción de R-250 0,05%
generalmente a 75 V a través del gel de Coomassie: Ácido acético 10%
Isopropanol 25%
empaquetamiento y a 125 V a través del gel
separador.
8.4. Revelado zimográfico
Una vez desarrollada la electroforesis, los (zimograma)
geles podían revelarse para la detección de
Se utilizaba para revelar la actividad
proteínas (tinción de Coomassie) o de actividad
enzimática de las bandas de proteínas en geles
enzimática (revelado zimográfico).
de poliacrilamida suplementados con el
sustrato de la enzima a detectar (xilano en
nuestro caso).
57

Si los geles de poliacrilamina eran Se utilizaban geles de isoelectroenfoque


desnaturalizantes (SDS-PAGE), primero se comerciales (PhastGel® de Pharmacia) con un
lavaban con Tritón X-100 2,5% durante rango de pH de 3,0 a 9,0. Las electroforesis se
30 min, para eliminar el SDS y que las desarrollaban en un PhastSystem (Amersham
proteínas pudieran renaturalizarse. Pharmacia Biotech) según las instrucciones de
la casa comercial.
Se lavaban varias veces durante 30 min con el El marcador de pI utilizado era el Broad pI Kit
tampón adecuado para la actividad enzimática, Marker (Amersham Pharmacia Biotech), cuyo
y a continuación se incubaban los geles en el rango de pI era de 3,5 a 9,3.
mismo tampón a la temperatura adecuada
durante el tiempo necesario para que se Una vez desarrollada la electroforesis, para
pudiera dar la hidrólisis del sustrato incluido detectar la actividad xilanasa de las enzimas,
en dichos geles. los geles se lavaban con agua destilada
Los geles se teñían durante 15 min con Rojo (30 min), para después aplicarles una
Congo 0,1%, el cual se une a los sustratos sobrecapa (overlay) de agarosa 1% con xilano
polisacarídicos. A continuación, se desteñían de madera de abedul al 0,5%, e incubarlos a
con NaCl 1 M hasta que aparecían bandas de 37 ºC durante 30 - 45 min.
degradación del sustrato. Por último, se Las sobrecapas se revelaban con Rojo Congo
sumergían en ácido acético al 5% para bajar el para la detección de actividad enzimática
pH y hacer virar el rojo claro de las zonas de (zimograma). Mientras los geles de
sustrato no degradado a azul oscuro, isoelectroenfoque se revelaban para la
aumentando así el contraste con las bandas detección de proteínas (tinción de Coomassie).
claras de degradación.

8.6. Electroforesis y transferencia


8.5. Isoelectroenfoque de proteínas para su
Se utilizaba para la determinación del punto secuenciación N-terminal
isoeléctrico (pI) de las proteínas. Consiste en
El método utilizado para la secuenciación del
la aplicación de una diferencia de potencial
extremo N-terminal de proteínas por
para hacer migra las proteínas nativas a través
degradación de Edman fue el descrito por
de un gel en el que se ha formado un gradiente
Packman (1993).
de pH, de manera que estas dejaran de migrar
cuando lleguen al pH correspondiente a su pI.
Se realizaba una electroforesis en geles
desnaturalizantes de poliacrilamida
(SDS-PAGE), para los que la poliacrilamida
58

había sido previamente desionizada durante Tampones y soluciones:


2 h con un 5% de Analytical Grade Mixed Bed Tampón de Tris 48 mM
Resin (Bio-Rad) y después filtrada. Además, el transferencia: Glicina 39 mM
Metanol 20%
tampón de electroforesis contenía 2 mM de SDS 0,02%
ácido tioglicólico, y, antes de cargar las pH 8,3
muestras, se eliminaban los iones Solución para la Azul de Coomassie
tinción con R-250 0,01%
contaminantes que contuviera el gel aplicando Coomassie: Metanol 50%
130 V durante 20 min. Solución de Ácido acético 10%
Una vez desarrollada la electroforesis, los desteñido: Metanol 50%

geles se trataban con metanol (5 min) y se


incubaban en tampón de transferencia (5 min) 8.7. Electroforesis en geles de
antes de realizar la transferencia de las
agarosa
proteínas a una membrana de PVDF (Roche)
Las preparaciones de ADN se analizaron
utilizando un Trans-Blot Semi-Dry (Bio-Rad)
mediante electroforesis en geles de agarosa de
a 15 V durante 1 h.
baja electroendósmosis (EEO) al 0,8 - 1,3%
A continuación, las membranas se lavaban 3
(en función del tamaño de los fragmentos de
veces con agua bidestilada, se teñían las
ADN a analizar) en TBE.
proteínas transferidas con Azul de Coomassie,
El montaje y la electroforesis se realizaron en
se desteñían las membranas con una solución
cubetas horizontales Bio-Rad.
de ácido acético, y se dejaban secar.
Finalmente se recortaban las bandas de las
Las muestras se mezclaban con tampón de
proteínas de interés y se congelaba a -20 ºC.
carga 5X antes de ser cargadas en los geles.
Las electroforesis se desarrollaron
La secuenciación automática de Edman (Niall,
generalmente a 100 - 125 V.
1973) era realizada a partir de la banda
proteica por el Servei de Seqüenciació de
Una vez desarrollada la electroforesis, los
Proteïnes de l'Institut de Biologia Fonamental
geles se teñían sumergiéndolos en una solución
de la Universitat Autònoma de Barcelona
de bromuro de etidio en agua destilada
(UAB) utilizando un secuenciador Procise 492
(0,75 μg/ml) durante 15 min.
(Applied Biosystems).
59

Tampones: 6 ºC para recuperar los sobrenadantes, libres


TBE (10X): Tris 0,9 M de ácidos nucleicos.
Ácido bórico 0,9 M
EDTA 0,02 M
pH 8,3 Para limpiar los extractos celulares
Tampón de carga Azul de bromofenol 0,25% concentrados del mayor número posible de
5X: Xilencianol 0,25% proteínas no deseadas, se procedía a una doble
Glicerol 60%
precipitación con sulfato amónico (salting
out).
9. PURIFICACIÓN DE PROTEÍNAS Primero se hacía un pequeño ensayo en que se
añadían concentraciones crecientes de sulfato
9.1. Preparación de las muestras amónico a pequeños volúmenes (0,5 ml) de

Se partía de 2 l de cultivos en fase estacionaria extractos concentrados y se ensayaba la

de la cepa que expresaba la proteína a actividad sobre pNPX de los sobrenadantes

purificar. resultantes tras centrifugar para separar las

A partir de estos cultivos se obtenían extractos proteínas precipitadas de las solubles. Este

celulares en 50 ml utilizando el método de ensayo permitía determinar la concentración

fraccionamiento por French Press descrito máxima de sulfato amónico a que la proteína

anteriormente, empleando tampón fosfato de interés se mantenía mayoritariamente

50 mM pH 7 para lavar y resuspender. soluble, y la concentración mínima a utilizar

Antes de continuar con la preparación de las para hacerla precipitar.

muestras, se comprobaba que efectivamente A continuación, a los extractos celulares

contenían la proteína de interés. En nuestro concentrados se añadía poco a poco el sulfato

caso, para comprobar la presencia de XynB o amónico necesario para llegar a la

alguna de sus variantes mutagenizadas, se concentración máxima a que la proteína de

realizaban ensayos de actividad enzimática interés se mantenía aún soluble, de manera que

sobre pNPX. tras centrifugar a 10000 r.p.m. durante 1 h a


4 ºC en una centrífuga Beckman high-speed

A continuación, se procedía a la eliminación sólo se recuperaba el sobrenadante.

de los ácidos nucleicos de las muestras. Para A este sobrenadante se le continuaba

ello, se añadía a los extractos celulares, en añadiendo poco a poco el sulfato amónico

agitación suave y poco a poco, 2,5 mg de necesario para llegar a la concentración

sulfato de estreptomicina por cada ml de mínima que hacía precipitar nuestra proteína

extracto, y se dejaba reposar a 0 ºC varias h. de interés. Así, en este segundo paso del

Después, se centrifugaba a 40000 r.p.m. en salting out, tras centrifugar a 10000 r.p.m. 1 h

una ultracentrífuga Beckman durante 50 min a


60

a 4 ºC en una centrífuga Beckman high-speed, columna se utilizó en algunas


se recuperaba el pellet. purificaciones como un tercer paso
extra (o de polishing) después del paso
Por último se resuspendía este pellet en 5 ml de intercambio iónico, con el fin de
de tampón fosfato 50 mM pH 7 (concentración eliminar totalmente algunas proteínas
final 400X), y se ensayaba la actividad de bajo peso molecular que coeluían
enzimática sobre pNPX para evaluar la con XynB.
proteína a purificar. – TricornTM Mono QTM 5/50 GL: es una
columna de intercambio aniónico de alta
resolución que permite la separación de
9.2. Cromatografía en columna proteínas en función de su carga eléctrica.
Se utilizó un purificador ÄKTATM FPLCTM Esta columna se utilizó en el segundo paso
(Fast Protein Liquid Chromatography) de de purificación para obtener las proteínas
Amersham Biosciences para llevar a cabo las con un alto grado de pureza.
cromatografías en columna con el fin de
purificar la proteína XynB y sus variantes
9.2.1. Cromatografía de gel filtración
mutagenizadas.
Las columnas utilizadas, todas ellas de El primer paso de purificación era pues un
Amersham Biosciences, fueron: paso de gel filtración, en el cual se cargaban
– Columnas de gel filtración (exclusión 2 ml de los extractos concentrados con sulfato
molecular): permiten la separación de amónico en la columna HiLoadTM 16/60
proteínas en función de su tamaño. Se SuperdexTM 75 pg. Como eluyente se utilizaba
utilizaron 2 columnas diferentes: tampón fosfato 50 mM pH 7 con un 0,02% de
– HiLoadTM 16/60 SuperdexTM 75 prep azida sódica (para evitar el crecimiento de
grade: permite volúmenes de carga microorganismos), que se hacía pasar por la
relativamente elevados, manteniendo columna a un flujo de 1 ml/min con una
una alta resolución. Se utilizó en el presión máxima de 0,5 MPa.
primer paso de purificación para Las fracciones se recogían de forma continua a
eliminar la mayoría de proteínas razón de 2 ml por fracción.
diferentes a la proteína de interés,
especialmente aquellas de peso A continuación se seleccionaban aquellas
molecular muy elevado o muy bajo. fracciones en que se encontraba de forma
– Tricorn™ SuperdexTM 200 10/300 GL: mayoritaria la proteína a purificar. Para ello se
de mayor resolución que la anterior y observaban los picos de absorbancia a 280 nm
menor capacidad de carga. Esta en el cromatograma resultante, y se analizaban
61

las fracciones que contenían dichos picos Las fracciones se recogían de forma continua a
mediante ensayos de actividad sobre pNPX y razón de 0,5 ml por fracción, pero cuando el
SDS-PAGE. FPLCTM detectaba un pico de absorbancia a
Este primer paso además de permitir separar la 280 nm, las fracciones se reducían a 0,3 ml por
proteína de interés de la mayoría de proteínas fracción, con el objetivo de obtener una mayor
del extracto, también permitía la eliminación resolución.
del sulfato amónico (el cual eluía hacia el
final), ya que podría interferir en el siguiente A continuación se volvían a seleccionar
paso de purificación. aquellas fracciones en que se encontraba
solamente (o en una proporción especialmente
Las fracciones seleccionadas (normalmente 3 elevada) la proteína a purificar. Para ello se
ó 4 fracciones) se mezclaban y se observaban los picos de absorbancia a 280 nm
concentraban en 1 ml por ultrafiltración con en el cromatograma resultante, y se analizaban
unidades de filtración Centricon Ultracel las fracciones que recogían dichos picos
YM-10. mediante ensayos de actividad sobre pNPX y
en especial mediante SDS-PAGE.

9.2.2. Cromatografía de intercambio Las fracciones seleccionadas (normalmente 3


iónico ó 4 fracciones) se mezclaban en un sólo tubo.
Constituía el segundo paso de purificación. En
este paso las muestras concentradas obtenidas
en el proceso anterior se cargaban en una 9.2.3. Tercer paso opcional de

columna de intercambio aniónico TricornTM cromatografía

Mono QTM 5/50 GL. Como eluyentes se En algunas purificaciones, tras el paso de
utilizaban dos tampones con diferente intercambio iónico, aún se observaron
concentración de NaCl: tampón fosfato 50 mM proteínas de bajo peso molecular que coeluían
pH 7, 0,02% azida sódica, sin NaCl; y tampón con XynB. En estos casos, se procedió a un
fosfato 50 mM pH 7, 0,02% azida sódica, con tercer paso extra de purificación (polishing),
1 M NaCl. Estos tampones eran mezclados de en el cual las muestras resultantes del
manera automática por el ÄKTATM FPLCTM intercambio aniónico se cargaban en una
para generar un gradiente creciente de fuerza columna de gel filtración TricornTM
iónica dentro de la columna a lo largo del SuperdexTM 200 10/300 GL. Como eluyente se
tiempo. La mezcla de tampones se hacía pasar utilizaba también tampón fosfato 50 mM pH 7
por la columna a un flujo de 2 ml/min con una con un 0,02% de azida sódica, que se hacía
presión máxima de 4 MPa.
62

pasar por la columna a un flujo de 1 ml/min filtración y volviendo a centrifugar a


con una presión máxima de 1,5 MPa. 3000 r.p.m. durante 15 min, de manera que se
Las fracciones se recogían de forma continua a recogía en un tubo el volumen no filtrado
razón de 0,5 ml por fracción, pero cuando el concentrado.
FPLCTM detectaba un pico de absorbancia a
280 nm, las fracciones pasaban a ser de 0,3 ml
por fracción, para obtener una mayor
resolución.

Por último se seleccionaban de nuevo aquellas


fracciones en las que se encontraba solamente
la proteína a purificar mediante ensayos de
actividad enzimática sobre pNPX y mediante
SDS-PAGE.

Las fracciones seleccionadas se mezclaban en


un solo tubo.

9.3. Concentración de proteínas


por ultrafiltración
Se utilizaban unidades de filtración Centricon
de Millipore, que contenían filtros de celulosa
regenerada de baja adherencia y con exclusión
de pesos moleculares de 10 ó 30 kDa (modelos
Ultracel YM-10 y YM-30, respectivamente).

Se centrifugaba a 3000 r.p.m. en una


centrifuga Beckman high-speed hasta que
pasaba por el filtro la mayor parte del volumen
de la muestra a concentrar y sólo quedaba sin
filtrar el volumen deseado.

Por último se recuperaban las proteínas


concentradas invirtiendo la unidad de
CAPÍTULO I.
LA XILANASA XYNA DE BACILLUS SP. BP-7
65

- Expresión de las enzimas caracterizadas en


1. - INTRODUCCIÓN Y OBJETIVOS forma de proteínas de fusión en estudios de
La biodegradación del xilano es un proceso secreción fúngica.
complejo que requiere la acción coordinada de
diferentes enzimas, entre las cuales las
xilanasas juegan un papel fundamental al 2. - RESULTADOS
degradar los enlaces β(1→4) del esqueleto de
xilosas del xilano. 2.1. Clonación e identificación de
xilanasas de Bacillus sp. BP-7
La cepa Bacillus sp. BP-7 (López et al. 1998)
había sido previamente aislada por el grupo de 2.1.1. Construcción y escrutinio de la
investigación a partir de suelo de arrozal del genoteca de Bacillus sp. BP-7
Delta de L'Ebre (lugar rico en materia vegetal Con el objetivo de clonar e identificar los
en descomposición y por tanto adecuado para genes codificantes de enzimas degradadores de
aislar degradadores de celulosa y xilano), polisacáridos y lípidos (xilanasas, celulasas,
mediante cultivos de enriquecimiento en paja lipasas, esterasas y pectinasas) de la cepa
de arroz. Esta cepa fue seleccionada por su Bacillus sp. BP-7, se construyó una genoteca
elevada actividad degradadora de xilano, de la misma en colaboración con el resto de
además de presentar actividad hidrolítica sobre miembros del grupo de investigación.
celulosa, pectina y lípidos.
Para la construcción de la genoteca, el ADN
Con el fin de encontrar y caracterizar nuevas total de Bacillus sp. BP-7 fue digerido a
xilanasas para su análisis, tanto molecular tiempo parcial con el enzima de restricción
como de aplicación industrial, los objetivos de Sau3A. El ADN resultante fue sometido a
este capítulo fueron: electroforesis en geles preparativos, a partir de
- Construcción de una genoteca en los cuales se aislaron fragmentos de tamaño
Escherichia coli de la cepa Bacillus sp. medio aproximado entre 6 y 8 kb. Estos
BP-7, selección de los clones fragmentos fueron ligados al plásmido pUC19
recombinantes portadores de genes de linearizado con BamHI, y el resultado de la
xilanasas, e identificación y caracterización ligación fue introducido por transformación en
genética de los mismos. E. coli XL1-Blue. Se sembró a continuación

- Caracterización bioquímica de la xilanasa en placas de agar LB suplementado con

mayoritaria de la cepa Bacillus sp. BP-7. tetraciclina, ampicilina, IPTG y X-gal, que se
incubaron 24 h a 37 ºC. A partir de las
colonias que crecieron en estas placas se
66

seleccionaron alrededor de 4500 clones colonias con actividad xilanasa presentaban a


recombinantes (colonias blancas y AmpR) para su alrededor un halo claro resultante de la
su posterior análisis. degradación del xilano. Sin embargo, la
sensibilidad de estas placas para identificar
Para el escrutinio de la genoteca, los clones clones con actividad xilanasa es relativamente
recombinantes seleccionados se sembraron en baja. Por ello en ocasiones se usaron también
placas de agar LB suplementado con distintos placas de agar LB suplementadas con
sustratos para revelar la producción de las xilano-RBB (0,1%), con mayor sensibilidad, y
enzimas de interés. Estos sustratos fueron: que por tanto permiten detectar clones con
CMC para identificar clones productores de niveles bajos de actividad xilanasa. En las
celulasas, ácido poligalacturónico para placas de agar LB xilano-RBB las colonias
detectar clones con actividad pectinasa, productoras de xilanasas se detectan por la
tributirina para detectar clones positivos para formación de halos claros que destacan sobre
esterasas, y aceite de oliva para detectar clones el fondo azul oscuro del medio (Figura I.2.1).
con actividad lipasa. Para identificar clones
positivos para actividad xilanasa, se usaron Tras el escrutinio de más de 4500 clones
placas de agar LB suplementadas con xilano recombinantes se identificaron 3 clones
de espelta de avena (0,4%). Estas placas eran productores de lipasa, 1 clon productor de
turbias debido al xilano, de manera que las pectinasa y 6 clones productores de xilanasa.

Bacillus sp.  pXA1   pXA2  pXA5


BP­7 pXA3   pXA7  pXA6 Selección de 
Extracción  clones con 
de DNA
actividad 
xilanasa
DNA 
(con halo de 
Cromosómico Vector degradación del 
Digestión (pUC19) xilano del medio)
parcial con 
Sau3A Selección de 
DNA 
Digestión  clones 
digerido
con BamH1 recombinantes
Vector  (colonias  blancas 
DNA 
digerido AmpR)
(tamaños deseados)
Ligación

Transformación 
en E. coli XL1­Blue

Figura I.2.1: Construcción y escrutinio de la genoteca de Bacillus sp. BP-7.


67

Los 6 clones recombinantes con actividad Se observó que los plásmidos recombinantes
xilanasa se clasificaron en 2 grupos: pXA1, pXA2, pXA3 y pXA7 presentaban
- Clones XA1, XA2, XA3, y XA7. muchas bandas de restricción comunes, lo cual
Presentaban actividad en placas de agar LB indicaba que una gran parte del inserto que
suplementadas con xilano de espelta de contenían era común a todos ellos.
avena o con xilano-RBB. Por otra parte, se constató que los plásmidos

- Clones XA5 y XA6. Mostraban actividad pXA5 y pXA6 presentaban un patrón de

detectable únicamente en placas de agar restricción idéntico, hecho que indicaba que

LB con xilano-RBB. los clones XA5 y XA6 contenían el mismo

Los clones fueron congelados en glicerol a plásmido. Dicho patrón de restricción era

-80 ºC para su conservación. además totalmente distinto al de los otros


plásmidos recombinantes.
Así pues, los 6 clones productores de xilanasa
2.1.2. Análisis de los clones con
correspondían únicamente a 2 fragmentos
actividad xilanasa
distintos del ADN de Bacillus sp. BP-7.

2.1.2.1. - Análisis de los plásmidos Sobre la base de estos resultados, para

recombinantes posteriores estudios se seleccionaron 2 clones.


Del grupo de clones XA1, XA2, XA3 y XA7
El ADN plasmídico (obtenido por
se escogió al XA3 por ser el que presentaba un
minipreparación) de los clones productores de
inserto de menor tamaño; y del grupo de
xilanasa fue analizado mediante digestiones
clones XA5 y XA6 (ambos idénticos) se
simples y dobles con enzimas de restricción.
escogió XA5.
A partir de estos análisis de restricción se
obtuvo el tamaño de los insertos de los
diferentes clones, tal como aparece en la Tabla 2.1.2.2. - Subclonaje del inserto de pXA3
I.2.1.
Para delimitar el gen de xilanasa y eliminar el
ADN no necesario para la expresión del
Tabla I.2.1: Tamaño del inserto de los plásmidos enzima, se procedió a subclonar el inserto de
recombinantes.
pXA3, contenido en el clon recombinante
Plásmido Tamaño XA3.
Clon Recombinante del inserto (kb)
Para ello se digirió el inserto del plásmido
XA1 pXA1 7,2
XA2 pXA2 8,9 pXA3 con diferentes enzimas de restricción, se
XA3 pXA3 6,0 clonaron los fragmentos digeridos en pUC19 y
XA5 pXA5 8,7
se transformó en células competentes de
XA6 pXA6 8,7
XA7 pXA7 6,8 E. coli XL1 Blue.
68

A partir del clon XA3 se obtuvo el subclón 2.1.3. Secuenciación e identificación


XA30, que presentaba actividad xilanasa y del gen xynA
contenía el plásmido pXA30, el cual consistía Se secuenció el inserto de pXA30, usando para
en el fragmento HindIII de 1,4 kb del inserto ello cebadores que flanqueaban el sitio de
de pXA3 clonado en pUC19 (Figura I.2.2). clonación múltiple de pUC19. La secuencia
obtenida (Figura I.2.3) mostró una pauta
HindIII
LacZ abierta de lectura de 639 bp, que codificaba
una proteína de 213 aminoácidos, con un peso
xynA molecular teórico de 23474,7 Da y un pI
Amp R
teórico de 9,28, a la que se denominó XynA
pXA30 (xilanasa A de Bacillus sp. BP-7).
4,09 kb
Inserto
(1,4 kb) La secuencia deducida de aminoácidos se
HindIII comparó con secuencias de glicosil hidrolasas
ORI LacI conocidas contenidas en las bases de datos
(Swissprot, NCBI, EMBL y SubtiList). Se
Figura I.2.2: Plásmido pXA30. encontró una elevada homología (92% de
identidad) con la xilanasa A de Bacillus
La cuantificación de actividad xilanasa en subtilis (Paice et al., 1986), la xilanasa A de
extractos celulares del subclón obtenido, en Bacillus circulans (Yang et al., 1988) y la
comparación con la del clon original y del xilanasa S de Bacillus sp. YA-14 (Yu et al.,
control negativo, se muestra en la Tabla I.2.2. 1993); y una menor homología con XynA de
B. stearothermophilus (78% de identidad)
(Cho y Choi, 1995), XynN de B. halodurans
Tabla I.2.2: Actividad xilanasa en placa y en
ensayos de actividad de los clones y subclones (75% de identidad) (EMBL accession number
obtenidos. AY170624), XynA de B. pumilus (46% de
identidad) (Fukusaki et al., 1984) y con XynA
Clones Actividad U/ml
recombinantes en placa de cultivo de B. agaradhaerens (45% de identidad)
E. coli/pXA3 (EMBL accession number A68006), todas
+ 0,03
(XA3)
E. coli/pXA30 ellas xilanasas de la familia 11 (G) de glicosil
+ 0,03
(XA30) hidrolasas (Gilkes et al., 1991; Henrissat y
E. coli/pXA5
+ 0,01 Bairoch, 1996).
(XA5)
E. coli/pUC19
- 0,00
(C –)
69

47   GCT ACC TCA TGT CAA AGT CAG AAA AAA TAT TAT AGG AGG TAA CAT  91

92   ATG TTT AAG TTT ACA AAG AAA TTC TTA GTT GGG TTA ACG GCA GCT  136
1    Met Phe Lys Phe Thr Lys Lys Phe Leu Val Gly Leu Thr Ala Ala  15

137  TTG ATG AGT ATT AGC TTG TTT TCG GCA AAC GCC TCT GCA GCT AAC  181
16   Leu Met Ser Ile Ser Leu Phe Ser Ala Asn Ala Ser Ala Ala Asn  30

182  ACA GAC TAC TGG CAA AAT TGG ACT GAT GGG GGC GGA ACA GTA AAC  226
31   Thr Asp Tyr Trp Gln Asn Trp Thr Asp Gly Gly Gly Thr Val Asn  45

227  GCT GTC AAT GGG TCT GGC GGG AAT TAC AGT GTG AAT TGG TCT AAT  271
46   Ala Val Asn Gly Ser Gly Gly Asn Tyr Ser Val Asn Trp Ser Asn  60

272  ACC GGG AAT TTC GTT GTT GGT AAA GGT TGG ACT ACA GGT TCG CCA  316
61   Thr Gly Asn Phe Val Val Gly Lys Gly Trp Thr Thr Gly Ser Pro  75

317  TTT AGG ACG ATA AAC TAT AAT GCC GGA GTT TGG GCG CCG AAT GGC  361
76   Phe Arg Thr Ile Asn Tyr Asn Ala Gly Val Trp Ala Pro Asn Gly  90

362  AAT GCA TAT TTG ACT TTA TAT GGT TGG ACG CGA TCA CCT CTC ATA  406
91   Asn Ala Tyr Leu Thr Leu Tyr Gly Trp Thr Arg Ser Pro Leu Ile  105

407  GAA TAT TAT GTA GTG GAT TCA TGG GGT ACT TAT AGA CCT ACT GGA  451
106  Glu Tyr Tyr Val Val Asp Ser Trp Gly Thr Tyr Arg Pro Thr Gly  120

452  ACG TAT AAA GGT ACG GTT TAC AGT GAT GGG GGT ACA TAT GAC GTG  496
121  Thr Tyr Lys Gly Thr Val Tyr Ser Asp Gly Gly Thr Tyr Asp Val  135

497  TAC ACA ACT ACA CGT TAT GAT GCA CCT TCC ATT GAT GGC GAT AAA  541
136  Tyr Thr Thr Thr Arg Tyr Asp Ala Pro Ser Ile Asp Gly Asp Lys  150

542  ACT ACT TTT ACG CAG TAC TGG AGT GTT CGC CAG TCG AAG AGA CCA  586
151  Thr Thr Phe Thr Gln Tyr Trp Ser Val Arg Gln Ser Lys Arg Pro  165

587  ACT GGA AGC AAC GCT ACA ATC ACT TTC AGC AAT CAC GTT AAC GCA  631
166  Thr Gly Ser Asn Ala Thr Ile Thr Phe Ser Asn His Val Asn Ala  180

632  TGG AAG AGA TAT GGG ATG AAT CTG GGT AGT AAT TGG TCT TAC CAA  676
181  Trp Lys Arg Tyr Gly Met Asn Leu Gly Ser Asn Trp Ser Tyr Gln  195

677  GTC TTA GCG ACA GAG GGA TAT CAA AGT AGT GGA AGT TCT AAC GTC  721
196  Val Leu Ala Thr Glu Gly Tyr Gln Ser Ser Gly Ser Ser Asn Val  210

722  ACA GTG TGG TAA CAG ATT ATC TTT AAT CAG GGG TAG CTA ACG GGC  766
211  Thr Val Trp Stop                       

767  TGC TGA TCG TTC CTT GAG AAA TTT TAT AAT CGT TGT TAT TGT GAG  811

Figura I.2.3: Secuencia de nucleótidos y secuencia deducida de aminoácidos del gen xynA
de Bacillus sp. BP-7.

Tal como se observa en el alineamiento glutámicos en posiciones 106 y 200.


múltiple (Figura I.2.4), la homología con las
Según se observó en estos análisis de
xilanasas mencionadas en primer lugar es muy
secuencia, la xilanasa XynA de Bacillus sp.
elevada, conservándose en todas ellas los dos
BP-7 es una enzima de dominio único, de la
residuos catalíticos del centro activo del
familia 11 (G) de glicosil hidrolasas, y dentro
enzima, correspondientes a los ácidos
70

Figura I.2.4: Alineamiento múltiple de XynA de Bacillus sp. BP-7 (XynA_BP-7), XynA de Bacillus
subtilis (XynA_B.sub), XynA de Bacillus circulans (XynA_B.cir) y XynS de Bacillus sp. YA-14
(XynS_B.sp.) (Yu et al., 1993).

de ella pertenece al subgrupo de xilanasas (E. coli/pUC19). Los geles de electroforesis


alcalinas de bajo peso molecular, el cual resultantes fueron revelados para proteínas por
parece ser ubicuo entre las especies del género tinción con azul de Coomassie y para actividad
Bacillus y ha sido propuesto como el principal xilanasa mediante técnicas zimográficas
subgrupo de la familia 11 de glicosil (Figura I.2.5).
hidrolasas.
En los geles teñidos con azul de Coomassie no
se observaron diferencias significativas en el
2.2. Caracterización bioquímica patrón de bandas proteicas del extracto celular
de la xilanasa XynA de de E. coli/pXA30 respecto al del control
Bacillus sp. BP-7 negativo. Sin embargo, en los geles
desarrollados zimográficamente se observó
2.2.1. Determinación del peso una banda intensa de actividad xilanasa en el
molecular y del punto isoeléctrico extracto celular de E. coli/pXA30, que no se
Para analizar el producto génico de xynA observó en el control negativo. Esta banda de
expresado en la cepa recombinante actividad xilanasa presentaba un peso
E. coli/pXA30 se obtuvieron extractos molecular aparente de unos 23 - 24 kDa, que
celulares concentrados de dicha cepa concuerda con el peso molecular teórico
recombinante y se analizaron mediante deducido a partir de su secuencia aminoacídica
electroforesis en geles de poliacrilamida con (23474,7 Da).
SDS (SDS-PAGE), junto a los extractos
celulares concentrados de un control negativo
71

Figura I.2.6: Análisis


zimográfico a partir de
geles de
isoelectroenfoque de la
xilanasa A (extractos de
E. coli/pXA30).

Figura I.2.5: Análisis electroforético mediante crudos del subclón E. coli/pXA30 sobre
SDS-PAGE de la xilanasa A. diferentes xilanos (xilanos de maderas duras y
(A) Tinción con azul de Coomassie.
(B) Zimograma para actividad xilanasa. xilanos de cereales), celulosas (Avicel y
(1) Extractos de E. coli/pUC19 (C−).
carboximetil celulosa), otros polisacáridos
(2) Extractos de E. coli/pXA30.
(laminarina, liquenano, poligalacturonato,
Los extractos celulares de E. coli/pXA30, pectina y almidón), además de sobre
fueron también analizados en geles de aril-xilósidos (pNPX y oNPX) y otros
isoelectroenfoque que se revelaron aril-glicósidos (pNAp, pNAf y pNPG)
zimográficamente para actividad xilanasa. (Tabla I.2.3).
Se observó una única banda de actividad en el
límite de pH superior de los geles, lo que La xilanasa A presentó elevada actividad sobre
indica que XynA posee un pI de 9 o superior los distintos xilanos de maderas duras y
(Figura I.2.6), tal como era de esperar en cereales ensayados, obteniéndose los valores
función de su pI teórico (9,28). más altos sobre xilano de madera de haya
(0,207 U/mg de proteína). Por el contrario, la
actividad sobre celulosas, otros polisacáridos,
2.2.2. Propiedades enzimáticas
aril-xilósidos y aril-glicósidos evaluados, fue
2.2.2.1. - Especificidad de sustrato muy baja o indetectable.

Se hicieron estudios de especificidad de


sustrato ensayando la actividad de extractos
72

Tabla I.2.3: Especificidad de sustrato de la xilanasa A de Bacillus sp. BP-7.

Actividad
específica % respecto a la
Sustrato (U/mg) a actividad máxima
Xilano de madera de abedul 0,182 87,92
Xilano de madera de haya 0,207 100,00
Metil glucuronoxilano 0,139 67,15
Xilano de espelta de avena 0,145 70,05
Arabinoxilano de trigo 0,164 79,23
Arabinoxilano de centeno 0,054 26,09
Carboximetil celulosa ND 0
Avicel ND 0
Laminarina ND 0
Liquenano 0,003 1,45
Poligalacturonato ND 0
Pectina 0,003 1,45
Almidón 0,003 1,45
pNPX 0,001 0,48
oNPX 0,001 0,48
pNPG 0,001 0,48
pNPAp 0,001 0,48
pNPAf 0,002 0,97

a
ND: No Detectable

La especificidad de sustrato mostrada por Se ensayó la actividad de extractos crudos de


XynA indica que se trata de una endoxilanasa E. coli/pXA30 sobre xilano de madera de
(1,4-β-D-xylan xylanohydrolase; EC 3.2.1.8). abedul en el rango de pH de 3 a 12 en
intervalos de 0,5 unidades de pH, a una
temperatura de 60 ºC (Figura I.2.7).
2.2.2.2. - pH óptimo y Temperatura óptima
A partir de estos ensayos se observó que el pH
A continuación se determinaron el pH óptimo óptimo de XynA en extractos crudos es de 6,0,
(pH al que el enzima tiene máxima actividad) manteniendo más de un 50% de actividad en el
y la temperatura óptima (temperatura a la que rango de pH entre 4,5 y 8,5.
el enzima presenta máxima actividad) de la
enzima, con el fin de determinar las Para determinar la temperatura óptima, se
condiciones de aplicación de la misma en analizó la actividad de los extractos crudos de
posibles usos industriales. E. coli/pXA30 sobre xilano de madera de
73

100
100
Actividad relativa (%)

90
80

Actividad Relativa (%)


80
60

70
40

20 60

0 50
3 4 5 6 7 8 9 10 11 12 50 55 60 65 70
pH Temperatura (ºC)

Figura I.2.7: Efecto del pH sobre la actividad de Figura I.2.8: Efecto de la temperatura sobre la
XynA. actividad de XynA.

abedul, a pH 6, en el rango de temperaturas de que a 60 ºC la enzima se inactivó rápidamente,


50 a 70 ºC, en intervalos de 5 ºC (Figura I.2.8). no mostrando actividad significativa tras 1 h
Los resultados mostraron que la temperatura de incubación en estas condiciones.
óptima de XynA en extractos crudos es de
60 ºC, presentando más de un 50% de 100 50 ºC
actividad a temperaturas entre 50 y 70 ºC.
Actividad relativa (%)

80
55 ºC
60

2.2.2.3. - Termorresistencia 40

Para analizar la termorresistencia (o 20 60 ºC


termoestabilidad) de la enzima, muestras de
0
extractos crudos de E. coli/pXA30 se 30 60 90 120 150 180
Tiempo de preincubación (min.)
incubaron a 50, 55 ó 60 ºC durante diferentes
intervalos de tiempo (hasta un máximo de 3 h) Figura I.2.9: Termorresistencia de XynA a pH 7.
a pH 7, y posteriormente se ensayó la
actividad xilanasa residual sobre xilano de
madera de abedul (Figura I.2.9). 2.2.2.4. - Influencia de iones metálicos sobre
la actividad
La xilanasa cruda se mostró altamente estable
Por último, se comprobó la influencia de
a 50 ºC, manteniendo el 100% de su actividad
diferentes cationes metálicos sobre la actividad
tras las 3 h de incubación ensayadas.
de la xilanasa A cruda.
Por el contrario, tras 3 h de incubación a 55 ºC
Para ello, se realizó el ensayo de actividad
la actividad disminuyó hasta el 50%; mientras
xilanasa en presencia de diferentes cationes
74

1 mM 10 mM
120
110
100
Actividad Relativa (%)

90
80
70
60
50
40
30
20
10
0

EDTA
Mg2+
NH4+
Mn2+

C+
Cu2+

Pb2+

Ag2+

Hg2+
Co2+
Ni2+

Zn2+
Ca2+
Fe3+

Ba2+

Figura I.2.10: Influencia de diferentes iones y EDTA a 1 y 10 mM sobre la actividad de XynA.

metálicos a una concentración final de 1 mM o a 10 mM, aumentando la actividad hasta un


10 mM. Con el fin de observar el efecto de la 112% y un 110% de la actividad del control +.
falta de iones sobre la actividad, también se
realizaron ensayos añadiendo EDTA (1 o
10 mM). 2.3. Expresión de la xilanasa
XynA en levadura
Tal como se observa en la Figura I.2.10, la
xilanasa A fue inhibida en mayor o menor 2.3.1. Antecedentes
grado por casi todos los cationes ensayados a El bajo peso molecular (24 kDa), la alta
concentraciones de 10 mM. actividad sobre arabinoxilanos de trigo (79%
Es de destacar el efecto inhibidor de los iones de la actividad máxima), el amplio rango de
2+ 3+ 2+ 2+
Mn , Fe , Pb y Hg , que a concentraciones pH (4,5 - 8,5) y la termoestabilidad (3 h a
de 10 mM redujeron la actividad por debajo 50 ºC) son características bioquímicas de la
del 25 % respecto al control + (sin iones). De xilanasa A de Bacillus sp. BP-7 que la
2+
estos 4 iones, sólo el Hg no mostraba efecto convierten en una buena candidata para su uso
inhibidor a concentraciones de 1 mM. Por el en la industria panadera, con el fin de mejorar
2+
contrario, el Ba presentaba un ligero efecto las propiedades reológicas del pan. Es por ello
activador sobre la xilanasa tanto a 1 mM como que se decidió ensayar su expresión en
Saccharomyces cerevisiae.
75

Como estrategia para conseguir la secreción de secretada parcialmente al medio de cultivo;


la xilanasa A en esta levadura se decidió su Moukadiri et al., 1999), tal como se describe
fusión génica a proteínas de pared celular, que en la Figura I.2.11.
trasportaran la xilanasa al exterior de la
Las 5 construcciones realizadas (C1 - C5),
superficie celular de la levadura.
basadas en el plásmido de expresión en
levaduras YEplac112, fueron transformadas en
En colaboración con el grupo del Dr. Jesús
las cepas de S. cerevisiae BY4741 (cepa
Zueco de la Universitat de València, se
salvaje) y S. cerevisiae mnn9 (cepa deficiente
construyeron 5 proteínas de fusión diferentes.
en glicosilación; Hernández et al., 1989).
En ellas, la pauta abierta de lectura de XynA,
sin la región que codifica el péptido señal, se
fusionó en distintos puntos con el gen
codificante de la proteína Pir4 (proteína de
pared de S. cerevisiae, que además es

NcoI BglII SalI


Pir4 XynA
PS SI MP S II PS Xilanasa

Amplificación de la región codificante, sin


Digestión con enzimas de restricción incluir el PS, usando cebadores que
incorporan dianas de restricción

NcoI NcoI
C1

BglII BglII
C2

SalI SalI

C3

NcoI BglII SalI

C4
NcoI SalI
C5

Figura I.2.11: Construcciones XynA-Pir4. PS: región codificante para el péptido señal; S I: región
codificante para la subunidad I de Pir4 (pro-péptido procesado en el aparato de Golgi); MP: región
codificante para el motivo Pir (repeticiones internas); S II: región codificante para la subunidad II de Pir4
(la región C-terminal de esta subunidad posiblemente permite el anclaje a la pared).
76

2.3.2. Análisis de actividad de los S. cerevisiae BY4741, siendo especialmente


clones recombinantes notables los halos de los clones que contenían
Para proceder al estudio de la actividad la construcción C4, cuyos halos resultaron más
xilanasa de los 10 clones obtenidos (5 en intensos que los del control +. En el caso de la
S. cerevisiae BY4741 y 5 en S. cerevisiae construcción C1 también se observaron halos
mnn9), éstos fueron sembrados en placas de de degradación del xilano en ambas cepas
Agar SD (his, leu, met) suplementado con huéspedes, sin embargo estos eran muy tenues
Xilano-RBB al 0,1%. También se sembró la en comparación con los de las otras
cepa E. coli/pXA30 como control +, y las construcciones.
cepas parentales S. cerevisiae BY4741 y Por el contrario, la construcción C5 no mostró
S. cerevisiae mnn9 como controles –. halos de degradación en ninguna de las 2 cepas
Las placas se incubaron a 30 ºC durante 48 h, huéspedes.
al cabo de las cuales se analizó la aparición de
halos de degradación del xilano alrededor de Con este ensayo en placa comprobamos que
las estrías de crecimiento microbiano. las proteínas de fusión expresadas por algunos
de los clones recombinantes eran funcionales,
Tal como se observa en la Figura I.2.12, los quedando pues por determinar la localización
clones con las construcciones C2, C3 y C4 celular de estas proteínas de fusión en los
presentaron halos de degradación del xilano diferentes clones.
alrededor de las estrías de crecimiento, tanto
los derivados de la cepa S. cerevisiae mnn9
como los derivados de la cepa salvaje

A B
C2 C1 C2 C1

C5 C4 C3 C5 C4 C3

C+ C- C+ C-

Figura I.2.12: Ensayo de actividad en placa de las 5 construcciones obtenidas (clones del 1 al 5) en
S. cerevisiae mnn9 (placa A) y S. cerevisiae BY4741 (placa B).
77

2.3.3. - Localización celular sobrenadantes fueron concentrados 40 veces


Aquellos clones positivos para actividad (40X) mediante varios pasos de ultrafiltración.
xilanasa que resultaban más activos A continuación se ensayó la actividad xilanasa
(construcciones C2, C3 y C4), fueron de los sobrenadantes concentrados en las
cultivados en medio líquido SD (his, leu, met) condiciones óptimas de pH y temperatura
para poder obtener sobrenadantes de cultivo y previamente establecidas.
fracciones de pared celular sobre los que Las paredes celulares fueron procesadas y
realizar análisis cuantitativos de actividad analizadas paralelamente por Isabel Andrés,
xilanasa. Las cepas huéspedes también fueron del grupo del Dr. Jesús Zueco.
cultivadas en medio YPD para utilizarlas como
controles −. Tal como se observa en la Tabla I.2.4, todos
los clones analizados presentaron actividad
Los sobrenadantes de cultivo fueron dializados xilanasa significativa asociada a pared celular,
y concentrados antes de realizar los ensayos de aunque en el caso de la construcción C4, ésta
actividad. La diálisis se realizó frente a tampón fue muy inferior a la mostrada por las
Tris-HCl 200 mM pH 7, para eliminar los construcciones C2 y C3 en las mismas cepas.
azúcares presentes en los medios de cultivo En cuanto a la actividad liberada a los
utilizados (ya que ambos contenían, entre sobrenadantes de cultivo, en el caso de los
otros, un 2% de glucosa) y evitar así la clones en la cepa S. cerevisiae BY4741 sólo la
interferencia de estos azúcares reductores con construcción C4 presentaó valores
el método de detección de actividad xilanasa significativos de actividad xilanasa; mientras
(Nelson-Somogyi). Una vez dializados, los que en los clones derivados de la cepa
S. cerevisiae mnn9 todos los sobrenadantes de

Tabla I.2.4: Actividad xilanasa asociada a pared y en sobrenadantes de cultivo de las construcciones C2, C3
y C4 en las cepas S. cerevisiae BY4741 y S. cerevisiae mnn9.
Actividad asociada a pared celular Actividad en sobrenadantes de cultivo
Cepa U/g pared U/l cultivo % U/l cultivo %
BY4741 0,00 0,00 0 0,00 0
C2-BY4741 1,80 5,76 100 0,00 0
C3-BY4741 1,50 4,80 96 0,19 4
C4-BY4741 0,45 1,10 11 8,43 89
mnn9 0,00 0,00 0 0,00 0
C2-mnn9 0,93 5,95 76 1,83 24
C3-mnn9 1,17 7,50 43 9,85 57
C4-mnn9 0,35 2,20 13 14,33 87
78

los clones recombinantes analizados, aunque


especialmente los del que contenía la
construcción C4, presentaron actividad
xilanasa significativa.
Así pues, destacaba especialmente la elevada
actividad xilanasa presente en los
sobrenadantes de los dos clones que contenían
la construcción C4, en los que el 87 - 89% de
la actividad xilanasa total fue secretada al
medio de cultivo.
CAPÍTULO II.
LAS XILANASAS YNFF Y XYND DE
BACILLUS SP. BP-7
81

1. - INTRODUCCIÓN Y OBJETIVOS 2. - RESULTADOS


Tal como se ha descrito en el capítulo anterior,
el escrutinio de la genoteca de la cepa 2.1. Aislamiento de las xilanasas
Bacillus sp. BP-7 en Escherichia coli dio lugar del clon Escherichia coli/pXA5
al aislamiento de 2 tipos de clones productores Tras analizar el ADN plasmídico de los clones
de xilanasa: los clones del primer tipo (XA1, XA5 y XA6, se observó que los plásmidos
XA2, XA3, y XA7) contenían todos ellos el pXA5 y pXA6 presentaban el mismo tamaño
gen xynA, caracterizado en el capítulo anterior, (8,7 kb) y un patrón de restricción idéntico, y a
mientras que el segundo tipo de clones, su vez distinto al de los plásmidos
formado por XA5 y XA6, sólo mostraba recombinantes que codificaban para la
actividad detectable en placas de agar LB con xilanasa A, descrita en el capítulo anterior.
xilano-RBB, lo que indicaba la presencia de,
como mínimo, una xilanasa con características Sobre la base de estos resultados, se seleccionó
diferentes a XynA. el clon XA5 (E. coli/pXA5) para continuar con
su estudio.
El objetivo del presente capítulo fue la
caracterización genética y bioquímica de las
2.1.1. Subclonaje del inserto del
xilanasas de la cepa Bacillus sp. BP-7 clonadas
plásmido pXA5
en XA5 y XA6.
Con el objetivo de delimitar los posibles genes
de xilanasa y eliminar el ADN no necesario
para la expresión de las mismas, se procedió a
subclonar el inserto de pXA5. Para ello se
digirió el inserto del plásmido pXA5 con
diferentes enzimas de restricción, se clonaron
los fragmentos digeridos en pUC19 y se
transformó en células competentes de E. coli
XL1-Blue.
La poca cantidad de dianas de restricción
útiles en el inserto dificultó la subclonación.
Finalmente, tras varios intentos, se obtuvieron
2 subclones, conteniendo los plásmidos
pXA50 y pXA51, consistentes
respectivamente en los fragmentos EcoRI de
82

1,9 kb y 2,2 kb del inserto de pXA5 clonados los subclones), usando para ello cebadores que
en pUC19. Pero ninguno de estos 2 subclones flanqueaban el sitio de clonación múltiple de
presentó actividad xilanasa (Tabla II.2.1). pUC19. La secuenciación reveló que el inserto
de pXA5 era homólogo a la región del genoma
Tabla II.2.1: Actividad xilanasa de los clones y de Bacillus subtilis entre 1940 kb y 1949 kb
subclones obtenidos.
(Kunst et al., 1997). Esta región de Bacillus
Clones Actividad U/ml subtilis (Figura II.2.1) contenía, entre otros, los
recombinantes en placa de cultivo
genes bglC (anotado como endoglucanasa),
E. coli/pXA5 (XA5) + 0,01
E. coli/pXA50 (XA50) - 0,00 ynfF (gen de función desconocida homólogo a
E. coli/pXA51 (XA51) - 0,00
genes de xilanasas) y xynD (anotado como
E. coli/pUC19 (C -) - 0,00
xilanasa).

2.1.2. Secuenciación e identificación de


La nueva información permitió diseñar
los genes de pXA5
cebadores para avanzar en la secuenciación de
Puesto que no se obtuvieron subclones activos,
zonas concretas del inserto de pXA5,
se secuenciaron los extremos de los insertos de
comprobándose que el plásmido contenía 2
pXA5 y de pXA50 y pXA51 (contenidos en

pXA5

Subclonación

pXA50 pXA51

Secuenciación y
Búsquedas de homología

ynfF xynD

Figura II.2.1: Región del genoma de Bacillus subtilis con homología al inserto de pXA5,
conteniendo los genes bglC, ynfF y xynD.
83

pautas abiertas de lectura homólogas a los algunas de las proteínas homólogas a la


genes ynfF y xynD de Bacillus subtilis. nuestra (entre ellas XynD de Paenibacillus
polymyxa) han sido caracterizadas
bioquímicamente presentando actividad
2.1.2.1.- Secuencia y homología de xynD de
arabinofuranosidasa, además de actividad
Bacillus sp. BP-7
xilanasa.
La pauta abierta de lectura contenida en pXA5
que presentaba muy alta homología con el gen
xynD de Bacillus subtilis, pasó a denominarse 2.1.2.1.- Secuencia y homología de ynfF de
xynD de Bacillus sp. BP-7 (Figura II.2.2). Bacillus sp. BP-7
La proteína deducida de esta pauta abierta de Por otro lado, la pauta abierta de lectura del
lectura, XynD de BP-7, contiene 512 inserto de pXA5 que presentaba homología
aminoácidos, y muestra un peso molecular con el gen ynfF de Bacillus subtilis, pasó a
teórico de 54243,9 Da y un pI teórico de 8,17. denominarse ynfF de Bacillus sp. BP-7
(Figura II.2.3).
Las búsquedas de homología en bases de datos Esta pauta abierta de lectura codifica una
(NCBI y SubtiList) mostraron que la proteína proteína de 423 aminoácidos, con un peso
XynD de Bacillus sp. BP-7 presentaba alta molecular teórico de 47608,6 Da y un pI
homología con XynD de Bacillus subtilis 168 teórico de 8,80, a la que se denominó YnfF.
(84% de identidad) (Kunst et al., 1997), tal
como se esperaba, con XynD de Paenibacillus Los estudios de homología de secuencia que se
polymyxa (64% de identidad) (Gosalbes et al., realizaron (NCBI y SubtiList) mostraron alta
1991), XynA de Caldicellulosiruptor sp. homología entre YnfF de Bacillus sp. BP-7 e
Tok7B.1 (49% de identidad) (Gibbs et al., YnfF de Bacillus subtilis 168 (92% de
2000), una xilanasa de Caldicellulosiruptor sp. identidad) (Kunst et al., 1997). Asimismo, se
Rt69B.1 (48% de identidad) (NCBI halló alta homología con una endoxilanasa de
AAB95326) y XynF de Caldicellulosiruptor Aeromonas punctata W-61 (79% de identidad)
saccharolyticus (48% de identidad) (Luthi et (NCBI BAA13641), la xilanasa D de
al., 1990). Aeromonas caviae ME-1 (77% de identidad)
Muchas de estas enzimas pertenecen a la (Suzuki et al., 1997) y la xilanasa A de
familia 43 de glicosil hidrolasas en lugar de a Pectobacterium chrysanthemi D1 (39% de
las familias 10 y 11, típicas de xilanasas. identidad) (Keen et al., 1996).
Resulta de interés señalar en este punto que la Todas estas enzimas presentan homología a
familia 43 contiene mayoritariamente enzimas glicosil hidrolasas de la familia 5, en lugar de a
con actividad arabinofuranosidasa, y que xilanasas de las familias 10 u 11.
84
496   CCC CAT TTT TAG AAA AAA GGA GGA TGT TAA GTC ATG AGT AAA AAG   540
                                                  Met Ser Lys Lys   4

541   TGT AGC GTA TGT TTA TGG GTT CTT GCT TTA TTA TTG AGT TGC TTA   585
5     Cys Ser Val Cys Leu Trp Val Leu Ala Leu Leu Leu Ser Cys Leu   19

586   TTT GGG GAG TCT GCG TAT GCA GCC AGT ACT ACA ATT GCA AAA CAT   630
20    Phe Gly Glu Ser Ala Tyr Ala Ala Ser Thr Thr Ile Ala Lys His   34

631   GCA GGG AAT TCA AAC CCC CTT ATA GAC CAT CAT TTG GGA GCA GAT   675
35    Ala Gly Asn Ser Asn Pro Leu Ile Asp His His Leu Gly Ala Asp   49

676   CCG TTT GCG CTG ACC TAT AAC GGA AGA GTC TAC ATC TAT ATG TCA   720
50    Pro Phe Ala Leu Thr Tyr Asn Gly Arg Val Tyr Ile Tyr Met Ser   64

721   AGT GAT GAC TAT GAA TAT AAT AGC AAC GGA ACG ATT AAG GAT AAC   765
65    Ser Asp Asp Tyr Glu Tyr Asn Ser Asn Gly Thr Ile Lys Asp Asn   79

766   TCA TTT GCC AAT TTG AAT AGA GTA TTC GTC ATC TCT TCA GCG GAT   810
80    Ser Phe Ala Asn Leu Asn Arg Val Phe Val Ile Ser Ser Ala Asp   94

811   ATG GTG AAC TGG ACA GAC CAC GGA GCC ATT CCG GTA GCA GGT GCC   855
95    Met Val Asn Trp Thr Asp His Gly Ala Ile Pro Val Ala Gly Ala   109

856   AAC GGG GCT AAT GGC GGC CGG GGG ATT GCG AAA TGG GCA GGT GCG   900
110   Asn Gly Ala Asn Gly Gly Arg Gly Ile Ala Lys Trp Ala Gly Ala   124

901   TCC TGG GCC CCG TCA GTC GCA GTT AAA AAG ATA AAT GGT AAG GAT   945
125   Ser Trp Ala Pro Ser Val Ala Val Lys Lys Ile Asn Gly Lys Asp   139

946   AAA TTC TTC CTT TAT TTC GCA AAC AGC GGC GGA GGT ATC GGG GTT   990
140   Lys Phe Phe Leu Tyr Phe Ala Asn Ser Gly Gly Gly Ile Gly Val   154

991   CTC ACC GCA GAC AGC CCG ATT GGC CCA TGG ACC GAC CCA ATC GGA   1035
155   Leu Thr Ala Asp Ser Pro Ile Gly Pro Trp Thr Asp Pro Ile Gly   169

1036  AAA GCG CTC GTA ACG CCA AGT ACG CCA GGA ATG TCC GGT GTT GTA   1080
170   Lys Ala Leu Val Thr Pro Ser Thr Pro Gly Met Ser Gly Val Val   184

1081  TGG CTT TTT GAT CCG GCA GTA TTT GTA GAT GAT GAC GGC ACC GGT   1125
185   Trp Leu Phe Asp Pro Ala Val Phe Val Asp Asp Asp Gly Thr Gly   199

1126  TAC CTG TAT GCC GGG GGA GGC GTT CCT GGC GGT TCA AAT CCA ACG   1170
200   Tyr Leu Tyr Ala Gly Gly Gly Val Pro Gly Gly Ser Asn Pro Thr   214

1171  CAG GGA CAA TGG GCC AAT CCT AAA ACA GCA AGA GTC ATG AAA TTG   1215
215   Gln Gly Gln Trp Ala Asn Pro Lys Thr Ala Arg Val Met Lys Leu   229

1216  GGG CCT GAT ATG ACC AGT GTT GTT GGA AGT GCA GCT ACA ATT GAT   1260
230   Gly Pro Asp Met Thr Ser Val Val Gly Ser Ala Ala Thr Ile Asp   244

1261  GCG CCT TTT ATG TTT GAA GAT TCG GGA ATG CAT AAG CAT AAC GGA   1305
245   Ala Pro Phe Met Phe Glu Asp Ser Gly Met His Lys His Asn Gly   259

1306  AAA TAT TAC TAT TCC TAT TGC ATC AAT TTC GGG GGC ACG CAC CCG   1350
260   Lys Tyr Tyr Tyr Ser Tyr Cys Ile Asn Phe Gly Gly Thr His Pro   274

1351  GCC GAT AAA CCC CCA GGT GAG ATC GGC TAT ATG ACC AGC TCA AGT   1395
275   Ala Asp Lys Pro Pro Gly Glu Ile Gly Tyr Met Thr Ser Ser Ser   289

1396  CCC ATG GGT CCC TTT ACA TAT AGA GGG CAC TTC CTG AAA AAT CCG   1440
290   Pro Met Gly Pro Phe Thr Tyr Arg Gly His Phe Leu Lys Asn Pro   304

1441  GGA GCA TTT TTC GGA GGT GGC GGA AAC AAC CAC CAT GCT GTT TTC   1485
305   Gly Ala Phe Phe Gly Gly Gly Gly Asn Asn His His Ala Val Phe   319

1486  AAT TTA AAA AAT GAG TGG TAT GTG GTG TAC CAT GCT CAA ACT GTC   1530
320   Asn Leu Lys Asn Glu Trp Tyr Val Val Tyr His Ala Gln Thr Val   334
85

1531  AGT TCC GCT CTG TTC GGA GCC GGC AAA GGA TAC CGT TCT CCC CAT   1575
335   Ser Ser Ala Leu Phe Gly Ala Gly Lys Gly Tyr Arg Ser Pro His   349

1576  ATT AAT AAG CTG GTG CAT AAT GCA GAT GGA TCC ATT CAA GAG GTT   1620
350   Ile Asn Lys Leu Val His Asn Ala Asp Gly Ser Ile Gln Glu Val   364

1621  GCG GCA AAT TAT GCA GGC GTA ACA CAG CTT TCC AAT TTG AAT CCA   1665
365   Ala Ala Asn Tyr Ala Gly Val Thr Gln Leu Ser Asn Leu Asn Pro   379

1666  TTT AAC CGG GTA GAA GCT GAA ACG TTT GCC TGG AAT GGA CGC ATA   1710
380   Phe Asn Arg Val Glu Ala Glu Thr Phe Ala Trp Asn Gly Arg Ile   394

1711  TTG ACC GAG AAA TCT TCA GCA ACC GGC GGG CCG GTA AAT AAT CAA   1755
395   Leu Thr Glu Lys Ser Ser Ala Thr Gly Gly Pro Val Asn Asn Gln   409

1756  AAT GTA ACA AGC ATT CAT AAC GGA GAC TGG ATT GCT GTA GGA AAT   1800
410   Asn Val Thr Ser Ile His Asn Gly Asp Trp Ile Ala Val Gly Asn   424

1801  GCA GAC TTC GGG GCG GGC GGT GCC AGA ACG TTT AAA GCA AAT GTA   1845
425   Ala Asp Phe Gly Ala Gly Gly Ala Arg Thr Phe Lys Ala Asn Val   439

1846  GCA TCC ACT ATA GGC GGG AAA ATA GAA GTG CGT CTA GAC AGT GCA   1890
440   Ala Ser Thr Ile Gly Gly Lys Ile Glu Val Arg Leu Asp Ser Ala   454

1891  AAC GGT AAG CTT GCA GGA ACC CTG AAT GTA CCT TCC ACA GGC GGA   1935
455   Asn Gly Lys Leu Ala Gly Thr Leu Asn Val Pro Ser Thr Gly Gly   469

1936  GCG CAA ACC TGG AGA GAA ATA GAA ACT GCG GTA AGC GGT GCA ACC   1980
470   Ala Gln Thr Trp Arg Glu Ile Glu Thr Ala Val Ser Gly Ala Thr   484

1981  GGT GTA CAC AAA GTT TTC TTT GTA TTT ACC GGA ACA GGT ACA GGA   2025
485   Gly Val His Lys Val Phe Phe Val Phe Thr Gly Thr Gly Thr Gly   499

2026  AAC TTG TTT AAT TTT GAT TAC TGG CAG TTT ACG CAA AGA TAG CAG   2070
500   Asn Leu Phe Asn Phe Asp Tyr Trp Gln Phe Thr Gln Arg Stop        

2071  ATG AGA AAA CCT TTT GTT TGC AAT ATA AAA GGA GAC AGA TCA GAT   2115

Figura II.2.2: Secuencia de nucleótidos y secuencia deducida de aminoácidos del gen xynD
de Bacillus sp. BP-7.

93    AAA AGA CAA GGA GAG GAA AAA ATG ATT TCA AGC GTA AAA AAA CCA   137
                                  Met Ile Ser Ser Val Lys Lys Pro   7

138   ATT TGT GTA TTA TTG GTA TGT TTC ACT ATG CTG TCA GTC ATG TTA   182
8     Ile Cys Val Leu Leu Val Cys Phe Thr Met Leu Ser Val Met Leu   22

183   GCC GGG CCA GGT GCT ACT GAA GTT TTA GCA GCA AGT GAT GTA ACA   227
23    Ala Gly Pro Gly Ala Thr Glu Val Leu Ala Ala Ser Asp Val Thr   37

228   ATT AAT TTA TCT GCA GAA AAA CAA GTG ATC CGC GGT TTT GGA GGC   272
38    Ile Asn Leu Ser Ala Glu Lys Gln Val Ile Arg Gly Phe Gly Gly   52

273   ATG AAC CAC CCG GCT TGG ATT GGA GAT TTG ACA GCA GCT CAA AGA   317
53    Met Asn His Pro Ala Trp Ile Gly Asp Leu Thr Ala Ala Gln Arg   67

318   GAA ACC GCT TTT GGC AAT GGA CAG AAT CAG TTA GGT TTT TCA ATC   362
68    Glu Thr Ala Phe Gly Asn Gly Gln Asn Gln Leu Gly Phe Ser Ile   82

363   TTA AGA ATT CAT GTG GAT GAA AAT AGA AAT AAT TGG TAT AGA GAA   407
83    Leu Arg Ile His Val Asp Glu Asn Arg Asn Asn Trp Tyr Arg Glu   97

408   GTG GAG ACT GCA AAG AAT GCG ATC AAA CAT GGA GCA ATC GTT TTT   452
98    Val Glu Thr Ala Lys Asn Ala Ile Lys His Gly Ala Ile Val Phe   112
86
453   GCT TCT CCC TGG AAT CCT CCA AGC GAT ATG GTT GAG ACC TTC AAT   497
113   Ala Ser Pro Trp Asn Pro Pro Ser Asp Met Val Glu Thr Phe Asn   127

498   CGT AAT GGT GAC ACA TCA GCT AAA CGG CTA AGA TAC GAT AAG TAC   542
128   Arg Asn Gly Asp Thr Ser Ala Lys Arg Leu Arg Tyr Asp Lys Tyr   142

543   GCC GCA TAC GCG CAG CAT CTT AAC GAT TTT GTT ACC TAC ATG AAG   587
143   Ala Ala Tyr Ala Gln His Leu Asn Asp Phe Val Thr Tyr Met Lys   157

588   AAT AAT GGC GTG AAT CTT TAT GCG ATT TCT GTT CAA AAC GAG CCT   632
158   Asn Asn Gly Val Asn Leu Tyr Ala Ile Ser Val Gln Asn Glu Pro   172

633   GAT TAT GCA CAC GAA TGG ACG TGG TGG ACT CCG CAA GAA ATA CTT   677
173   Asp Tyr Ala His Glu Trp Thr Trp Trp Thr Pro Gln Glu Ile Leu   187

678   CGT TTC ATG AGA GAA AAT GCC GGT TCC ATT AAT GCA CGT GTC ATT   722
188   Arg Phe Met Arg Glu Asn Ala Gly Ser Ile Asn Ala Arg Val Ile   202

723   GCA CCA GAA TCT TTT CAG TAC TTT AAA AAT ATA TCG GAC CCC ATT   767
203   Ala Pro Glu Ser Phe Gln Tyr Phe Lys Asn Ile Ser Asp Pro Ile   217

768   TTG AAC GAT CCA CAG GCG CTT AGG AAT ATG GAT ATT CTC GGA ACT   812
218   Leu Asn Asp Pro Gln Ala Leu Arg Asn Met Asp Ile Leu Gly Thr   232

813   CAC CTG TAC GGT ACT CAG GTC AGT CAG TTT CCT TAT CCT CTA TTC   857
233   His Leu Tyr Gly Thr Gln Val Ser Gln Phe Pro Tyr Pro Leu Phe   247

858   AAA CAA AAA GGA GCA GGG AAA GAG CTA TGG ATG ACG GAA GTA TAC   902
248   Lys Gln Lys Gly Ala Gly Lys Glu Leu Trp Met Thr Glu Val Tyr   262

903   TAT CCA AAC AGT GAC AAC AAT TCA GCG GAT CGC TGG CCC GAG GCA   947
263   Tyr Pro Asn Ser Asp Asn Asn Ser Ala Asp Arg Trp Pro Glu Ala   277

948   TTA GGC GTT TCA GAG CAT ATT CAC CAT TCA ATG GTG GAG GGA GAT   992
278   Leu Gly Val Ser Glu His Ile His His Ser Met Val Glu Gly Asp   292

993   TTT CAA TCT TAT GTT TGG TGG TAC ATC CGC AGA TCT TAC GGT CCT   1037
293   Phe Gln Ser Tyr Val Trp Trp Tyr Ile Arg Arg Ser Tyr Gly Pro   307

1038  ATG AAA GAA GAC GGT ACG ATC AGC AAA CGC GGT TAC AAT ATG GCT   1082
308   Met Lys Glu Asp Gly Thr Ile Ser Lys Arg Gly Tyr Asn Met Ala   322

1083  CAT TTC TCG AAG TTT GTG CGT CCC GGC TAT GTA AGG GTT GAT GCA   1127
323   His Phe Ser Lys Phe Val Arg Pro Gly Tyr Val Arg Val Asp Ala   337

1128  ACG AAA AAT CCT AAT GCG AAC GTT TAC GTG TCA GCC TAT AAA GGT   1172
338   Thr Lys Asn Pro Asn Ala Asn Val Tyr Val Ser Ala Tyr Lys Gly   352

1173  GAC AAC AAG GTC GTT ATT GTT GCC ATT AAC AAA AGC AAT ACA GGG   1217
353   Asp Asn Lys Val Val Ile Val Ala Ile Asn Lys Ser Asn Thr Gly   367

1218  GTC AAC CAA AAC TTT GTG TTG CAG AAT GGA TCT GCT TCT CAG GTA   1262
368   Val Asn Gln Asn Phe Val Leu Gln Asn Gly Ser Ala Ser Gln Val   382

1263  TCT AGG TGG ATA ACA AGC GGA AGC AGC AAT CTT CAA CCT GGA ACG   1307
383   Ser Arg Trp Ile Thr Ser Gly Ser Ser Asn Leu Gln Pro Gly Thr   397

1308  AAT CTC AAT GTA ACG GGC AAT CAT TTT TGG GCC CAT CTT CCA GCT   1352
398   Asn Leu Asn Val Thr Gly Asn His Phe Trp Ala His Leu Pro Ala   412

1353  CAA AGC GTG ACA ACA TTT GTC GCA AAT CGT TAA GGG GAC CTC AGG   1397
413   Gln Ser Val Thr Thr Phe Val Ala Asn Arg Stop                

1398  CAA GCG GGC CCG CGG ACA TGT TTT GCC AAA AAT CCA TAT AGC AAA   1442

Figura II.2.3: Secuencia de nucleótidos y secuencia deducida de aminoácidos del gen ynfF
de Bacillus sp. BP-7.
87

También se encontró homología entre YnfF En primer lugar, los resultados de


(posiciones 103 a 365) y el dominio amplificación de ambos genes se clonaron de
conservado de las glicosil hidrolasas de la manera independiente en pUC19 usando la
familia 30 (GH 30) (65% de identidad), y con diana EcoRV (extremos romos), y se
módulos de unión a carbohidratos de la familia transformaron en E. coli 5K.
6 (CBM6) de Clostridium (70% de identidad). Tras la selección de transformantes
recombinantes (colonias blancas ampicilina
resistentes), el análisis por restricción de los
2.1.2. Aislamiento de los genes xynD e
plásmidos contenidos en ellos permitió la
ynfF de Bacillus sp. BP-7
selección de los plásmidos pUC19-xynD y
Con el fin de estudiar independientemente pUC19-ynfF, que contenían los genes xynD e
estos dos genes y caracterizar las enzimas ynfF respectivamente.
correspondientes, se procedió a amplificarlos y A continuación los plásmidos obtenidos se
clonarlos por separado. digirieron con SmaI y SacI para clonar de
Se diseñaron para ello cebadores que manera direccional los genes xynD e ynfF en
contenían las dianas SmaI y SacI, necesarias los vectores pMSR8amy y pMSR8SPO2,
para clonar cada uno de los genes en la bajo el control de los promotores contenidos
dirección adecuada dentro del polylinker de los en ellos.
vectores lanzadera E. coli - Bacillus subtilis Los nuevos plásmidos construidos se
pMSR8amy y pMSR8SPO2 (Figura II.2.4). transformaron en varias cepas huéspedes de
Estos vectores lanzadera se eligieron con el fin Escherichia coli (5K, HB101 y DH5α).
de poder sobreexpresar estas xilanasas en
cepas huéspedes de Bacillus subtilis, de En el caso de ynfF, entre los clones
manera que se facilitara su obtención en alta recombinantes obtenidos, se seleccionaron los
cantidad para su purificación así como para siguientes para poder realizar los estudios
ensayos papeleros. bioquímicos:

Cebador Secuencia Región de hibridación


SmaI Cadena - antes de la región de unión
FWXYND TGACCCGGGTGATCACCCCCC al ribosoma de xynD.
SacI Cadena + después del codón stop de
BKXYND TTGAGCTCTCTGATCTGTCTCC xynD.
SmaI Cadena - antes de la región de unión
FWYNFF TACCCGGGAAGACAAGGAGAGG al ribosoma de ynfF.
SacI Cadena + después del codón stop de
BKYNFF CTGAGCTCCCCTTAACGATTTG ynfF.

Figura II.2.4: Cebadores diseñados para la amplificación de la región estructural de los genes
xynD (FWXYND + BKYND) e ynfF (FWYNFF + BKYNFF).
88

– E. coli HB101/pMSR8amy-ynfF 9. Los geles revelados con tinción de Coomassie


– E. coli 5K/pMSR8SPO2-ynfF 1A. no mostraron diferencias significativas en el
– E. coli DH5α/pMSR8amy-ynfF 4. patrón de bandas proteicas del extracto celular
– E. coli DH5α/pMSR8SPO2-ynfF 50. del clon recombinante respecto al del control
Todos estos clones presentaron niveles negativo. Mientras que en los geles paralelos
similares de actividad sobre xilano de madera desarrollados como zimograma se observó una
de abedul (unas 0,004 U/ml de cultivo). banda intensa de actividad xilanasa
únicamente en el carril del extracto celular de
También se escogieron varios clones que E. coli DH5α/pMSR8amy-ynfF 4. Esta banda
contenían el gen xynD, aunque ninguno de los de actividad xilanasa mostró un peso
clones analizados mostró actividad xilanasa molecular aparente de unos 47 - 48 kDa, en
sobre xilano de madera de abedul. Este hecho concordancia con el peso molecular teórico
sugería que, tal como mostraban los estudios deducido previamente a partir de la secuencia.
de homología, el gen xynD codificaba una
arabinofuranosidasa en lugar de una xilanasa.

A B
kDa
2.2. Caracterización bioquímica
de la enzima YnfF de Bacillus sp. 150 -
100 -
BP-7
75 -
2.2.1. Determinación del peso
50 -
molecular.
Para confirmar de manera experimental el peso
molecular teórico de 47608,6 Da de YnfF, se 37 -

obtuvieron extractos celulares concentrados de


la cepa recombinante E. coli
DH5α/pMSR8amy-ynfF 4 y se analizaron 25 -
mediante electroforesis en geles de 15 -
poliacrilamida con SDS (SDS-PAGE), junto a 1 2 1 2
los extractos celulares de un control negativo
Figura II.2.5: Análisis electroforético de la
(E. coli DH5α/pMSR8amy). Los geles de xilanasa YnfF mediante SDS-PAGE.
(A) Gel revelado con azul de Coomassie.
electroforesis resultantes fueron revelados con
(B) Zimograma de actividad xilanasa.
azul de Coomassie y mediante técnicas (1) Control –.
(2) Extractos concentrados de E. coli
zimográficas (Figura II.2.5). DH5α/pMSR8amy-ynfF 4.
89

2.2.2. Propiedades enzimáticas más altos sobre xilano de madera de abedul


(0,581 U/g). Por el contrario, la enzima no
2.2.2.1. - Especificidad de sustrato presentó actividad detectable sobre xilanos de
Se hicieron estudios de especificidad de gramíneas (arabinoxilanos), y su actividad
sustrato ensayando la actividad de extractos tampoco fue detectable o significativa sobre
crudos de los clones recombinantes de E. coli los aril-glicósidos ensayados.
conteniendo el gen ynfF sobre diferentes
xilanos, celulosas y otros polisacáridos,
2.2.2.2. - pH óptimo y Temperatura óptima
además de sobre aril-xilósidos y otros
aril-glicósidos. Se determinaron las condiciones óptimas en
Los resultados obtenidos (Tabla II.2.2) cuanto a pH y temperatura para la actividad de
mostraron que la xilanasa YnfF tenía actividad YnfF sobre xilano de madera de abedul.
sobre xilanos de maderas duras (tales como
xilano de madera de abedul, de haya y metil Para ello se ensayó la actividad xilanasa de
glucuronoxilano), obteniéndose los valores extractos crudos de los clones recombinantes

Tabla II.2.2: Especificidad de sustrato de la xilanasa YnfF.

Actividad % respecto a la
específica actividad específica
Sustrato (U/g) a máxima
Xilano de madera de abedul 0,581 100,0
Xilano de madera de haya 0,464 79,9
Metil glucuronoxilano 0,573 98,7
Xilano de espelta de avena ND 0
Arabinoxilano de trigo ND 0
Arabinoxilano de centeno ND 0
Carboximetil celulosa ND 0
Avicel ND 0
Laminarina ND 0
Liquenano ND 0
Poligalacturonato ND 0
Pectina ND 0
Almidón ND 0
pNPX 0,001 0,2
oNPX ND 0
pNPG ND 0
pNPAp ND 0
pNPAf ND 0

a
ND: No Detectable
90

de E. coli conteniendo el gen ynfF sobre xilano 100


de madera de abedul en el rango de pH de 3 a

Actividad relativa (%)


80
12 en intervalos de 0,5 unidades de pH, a una
temperatura de 65 ºC. 60
A partir de estos ensayos se observó que el pH
40
óptimo de XynA en extractos crudos es de 6,5,
presentando más de un 50% de actividad en el 20

rango de pH entre 4,5 y 10 (Figura II.2.6).


30 35 40 45 50 55 60 65 70 75 80
Temperatura (ºC)
100

Figura II.2.7: Efecto de la temperatura sobre la


Actividad relativa (%)

80
actividad de YnfF.
60

aplicación en procesos industriales, los


40
extractos crudos de de los clones
20
recombinantes de E. coli conteniendo el gen
0 ynfF se incubaron a 50, 55 ó 60 ºC durante
3 4 5 6 7 8 9 10 11 12
diferentes intervalos de tiempo hasta un
pH
máximo de 3 h, a pH 7. A continuación se
Figura II.2.6: Efecto del pH sobre la actividad de ensayó la actividad xilanasa residual sobre
YnfF.
xilano de madera de abedul (Figura II.2.8).

150
Se midió también la actividad de estos 50 ºC

extractos, a pH 7 y 6,5, en el rango de 125 55 ºC


Actividad relativa (%)

temperaturas de 30 a 75 ºC, en intervalos de 100


60 ºC
5 ºC. 75
Los ensayos permitieron determinar que la
50
temperatura óptima de YnfF en extractos
25
crudos es de 65 ºC, presentando más de un
0
60% de actividad en el rango de temperaturas 30 60 90 120 150 180
comprendido entre 30 y 70 ºC (Figura II.2.7). Tiempo de preincubación (min.)

Figura II.2.8: Termorresistencia de YnfF a


pH 7.
2.2.2.3. - Termorresistencia
Para analizar la termoestabilidad de la enzima
YnfF, factor importante para una posible
91

La xilanasa cruda se mostró altamente estable Se realizaron también ensayos de actividad


a las 3 temperaturas ensayadas, alcanzando xilanasa añadiendo EDTA (1 y 10 mM), y una
incluso valores superiores al 100% de su muestra sin adicionar ningún catión
actividad tras las 3 h de incubación ensayadas, (Control +).
lo que hace suponer un proceso de activación
por temperatura.
Tal como se observa en la Figura II.2.9, en
Los valores de actividad relativa fueron
general la xilanasa YnfF mostró únicamente
significativamente superiores en el caso de las
una ligera inhibición por casi todos los
incubaciones a 50 ºC.
cationes a concentraciones de 1 mM.
Sin embargo, a concentraciones de 10 mM, el

2.2.2.4. - Influencia de iones metálicos sobre grado de inhibición por algunos cationes tales

la actividad como Fe3+, Hg2+, Cu2+, Zn2+ y Mn2+ fue


importante (7 - 29% de la actividad residual);
Por último, se comprobó la influencia de
mientras que para el resto de cationes la
diferentes cationes metálicos sobre la actividad
actividad residual se mantuvo superior al 80%.
de la xilanasa YnfF.
Por otro lado, la adición de EDTA no modificó
Para ello, se realizaron ensayos de actividad
de forma significativa la actividad de la
xilanasa en presencia de diferentes cationes
enzima.
metálicos a concentraciones finales de 1 mM y
10 mM.

1 mM 10 mM
100
Actividad Relativa (%)

90
80
70
60
50
40
30
20
10
0
EDTA
Mg2+
Mn2+

Cu2+

Pb2+

Hg2+
NH4+

Co2+

C+
Ni2+

Zn2+

Ag2+
Ca2+
Fe3+

Ba2+

Figura II.2.9: Influencia de diferentes iones y EDTA a 1 y 10 mM sobre la actividad de YnfF.


CAPÍTULO III.
ESTUDIO DE LA XILANASA XYNB DE

PAENIBACILLUS BARCINONENSIS
95

1. - INTRODUCCIÓN Y OBJETIVOS 2. - RESULTADOS


La xilanasa B (también denominada X20 o
XynB) de Paenibacillus barcinonensis 2.1. Especificidad de sustrato de
(previamente descrito como Bacillus sp. XynB de Paenibacillus
BP-23) había sido clonada en Escherichia coli barcinonensis
y caracterizada previamente por el grupo de Tal como se ha comentado, la xilanasa XynB
investigación. Esta xilanasa presenta una de Paenibacillus barcinonensis, además de
inusual actividad sobre aril-xilósidos, así como actividad xilanasa, presenta una elevada
actividad transxilosidasa (Blanco et al., 1996), actividad sobre aril-xilósidos.
lo cual la convierte en una enzima de interés Con el fin de dilucidar mejor la especificidad
tanto a nivel de ciencia básica como a nivel de sustrato de esta enzima, se obtuvieron
biotecnológico. extractos celulares concentrados del clon
E. coli 5K/pX60, derivado del clon original
Un factor importante a la hora de facilitar la E. coli 5K/pX20 (Blanco et al., 1996), y se
aplicación de enzimas es la obtención de cepas ensayó su actividad enzimática sobre
productoras que expresen y secreten las diferentes xilanos, otros polisacáridos,
enzimas en cantidades elevadas. Estas cepas aril-xilósidos y otros aril-glicósidos, todos
también resultan de interés para obtener ellos al 0,5%, a excepción de los
cantidades suficientes de enzimas para su aril-glicósidos, que se ensayaron al 0,1%.
adecuado estudio bioquímico y estructural.
De esta manera, los objetivos de este capítulo Los resultados (Tabla III.2.1) mostraron que
fueron: XynB presenta similar actividad específica
- El análisis detallado de la especificidad de sobre los diferentes xilanos ensayados,
sustrato de la xilanasa B de Paenibacillus independientemente de su grado y tipo de
barcinonensis. sustituciones. De entre éstos, la máxima
- La clonación de la xilanasa B de actividad se obtuvo sobre arabinoxilano de
Paenibacillus barcinonensis en vectores trigo (265,4 U/g). La enzima también presentó
lanzadera E. coli - Bacillus subtilis para su actividad sobre todos los aril-glicósidos
posterior transformación en cepas ensayados, resultando destacable su actividad
huéspedes de Bacillus subtilis. sobre aril-xilósidos, siendo ésta igual o incluso
- El estudio de la sobreexpresión en los superior a su actividad sobre xilanos. En
clones recombinantes de Bacillus subtilis concreto, la actividad específica sobre oNPX
obtenidos. (550,3 U/g) fue aproximadamente el doble que
la obtenida sobre arabinoxilano de trigo.
96

Tabla III.2.1: Especificidad de sustrato de XynB en extractos crudos de E. coli 5K/pX60.

Actividad % respecto a la
específica actividad específica
Sustrato (U/g) a máxima
Xilano de madera de abedul 215,0 39,07
Xilano de madera de haya 248,7 45,18
Meti glucuronoxilano 169,6 30,82
Xilano de espelta de avena 213,1 38,72
Arabinoxilano de trigo 265,4 48,23
Arabinoxilano de centeno 224,4 40,77
Carboximetil celulosa 3,1 0,56
Avicel 3,5 0,63
Laminarina ND 0
Liquenano ND 0
Almidón ND 0
pNPX 286,1 51,98
oNPX 550,3 100,00
pNPG 0,6 0,11
pNPG2 41,5 7,53
pNPG3 42,5 7,72
pNPG4 42,1 7,66
pNPG5 31,4 5,70
pNAp 26,4 4,80
pNAf 0,8 0,14

a
ND: No Detectable

Los resultados obtenidos corroboran los 2.2. Producción de XynB de


previamente publicados (Blanco et al., 1996) y
Paenibacillus barcinonensis en
podrían indicar que XynB es una β-xilosidasa
huéspedes homólogos
(β-1,4-xylosidases, EC 3.2.1.37) en lugar de
una xilanasa. Sin embargo, su incapacidad
2.2.1. Clonación en vectores lanzadera
para hidrolizar la xilobiosa tal como se había
E. coli-Bacillus subtilis
demostrado en trabajos previos (Blanco et al.,
1996) descartan esta interpretación. 2.2.1.1. - Amplificación de xynB para su
clonación en Escherichia coli
La xilanasa B es una enzima de dominio único
de 332 aminoácidos, con un peso molecular
teórico de 38561 Da. Está codificada por una
pauta abierta de lectura (ORF) de 999 bp
97

contenida en la secuencia depositada en el Los 3 cebadores que se diseñaron a tal efecto


EMBL-Bank con número de acceso pueden verse en la Figura III.2.1.
AJ006646.
Para clonar el gen xynB de Paenibacillus El resultado de amplificación con los
barcinonensis en E. coli, en primer lugar se cebadores FWX20A y BKX20 fue, tal como se
amplificó el gen xynB a partir del ADN esperaba, un fragmento de 1,3 kb
plasmídico de pX60. Se diseñaron para ello correspondiente a la hipotética región
cebadores que contenían las dianas SacI y promotora (de 121 bp) más la región
SmaI, necesarias para clonar el gen en la estructural de xynB. Este fragmento se clonó
dirección adecuada dentro del polylinker de los en el vector lanzadera pN5, entre las dianas
plásmidos pN5 y pRBSPO2; vectores SacI y SmaI, dando lugar al vector pN5X20.
lanzadera E. coli - Bacillus subtilis De la amplificación con los cebadores
previamente construidos en el grupo de FWX20B y BKX20 resultó un fragmento de
investigación. 1,1 kb (tamaño esperado) correspondiente a la
Además, puesto que se quería evaluar la región de unión al ribosoma más la región
expresión de xynB tanto bajo el control de su estructural de xynB. Este fragmento se clonó
propio promotor como bajo el control del en el vector lanzadera pRBSPO2, entre las
promotor fuerte SPO2, contenido en el vector dianas SacI y SmaI, bajo el control del
pRBSPO2, se amplificó el gen promotor SPO2, dando lugar al plásmido
alternativamente con y sin su promotor. pBRSPO2X20.

EcoRI (314)
EcoRI (100) PstI (303) PstI (1020)

ORF

pX60

FWX20A FWX20B BKX20

Cebador Secuencia
Región de hibridación
SacI Cadena - después de la pauta
BKX20 ACGAGCTCTCCCTTAATCAAGGGC abierta de lectura de xynB.
SmaI Cadena + antes de la hipotética
FWX20A CGCCCGGGTTTTCCCAGTCAC región promotora de xynB.
Cadena + después de la
SmaI
FWX20B AACCCGGGAGGAGGAACCAGG hipotética región promotora de
xynB.
Figura III.2.1: Cebadores diseñados para la amplificación de xynB con su posible promotor
(FWX20A + BKX20) y sin él (FWX20B + BKX20).
98

Los plásmidos construidos fueron 2.2.1.2. - Transformación en las cepas de


transformados en diferentes cepas de E. coli y Bacillus subtilis MB216 y MW15
de entre todos los clones obtenidos se Las cepas huéspedes Bacillus subtilis MB216
escogieron aquellos que presentaban actividad y Bacillus subtilis MW15, esta última
xilanasa en placas de agar LB suplementado deficiente en xilanasas, celulasas y proteasas,
con xilano-RBB. se transformaron con los plásmidos
Se obtuvo ADN plasmídico de los clones pRBSPO2X20 y pN5X20.
seleccionados y se realizaron análisis de Los transformantes obtenidos se seleccionaron
restricción y secuenciación para verificar las en placas de agar DM3 suplementadas con
construcciones genéticas que contenían. cloramfenicol 20 µg/ml, para los
transformantes de la cepa MB216, o
A partir de estos análisis se escogió un clon de
cloramfenicol 50 µg/ml, para los de la cepa
E. coli HB101/pRBSPO2X20 y un clon de
MW15.
E. coli XL1-Blue/pN5X20, por presentar el
De entre todos los clones obtenidos se
primero de ellos xynB sin promotor propio en
seleccionaron aquellos que presentaban
pRBSPO2 (pRBSPO2X20), y xynB con su
actividad xilanasa en placas de agar LB con
promotor en pN5 (pN5X20) el segundo de
xilano-RBB. El análisis de restricción del
ellos.
ADN plasmídico de los clones seleccionados
reveló que contenían las construcciones
Se hizo a continuación una cuantificación de
correctas (pN5X20 y pRBSPO2X20).
actividad xilanasa en los extractos celulares de
los clones elegidos. Los resultados se muestran
Como resultado de la transformación de las 2
en la Tabla III.2.2.
construcciones en cada una de las 2 cepas de

Tabla III.2.2: Actividad xilanasa de los clones Bacillus subtilis se obtuvieron 4 cepas
recombinantes elegidos. recombinantes:
Actividad Actividad – B. subtilis MW15/pN5X20
xilanasa xilanasa
Clones en placa (U/ml cultivo) – B. subtilis MW15/pRBSPO2X20
E. coli HB101/ – B. subtilis MB216/pN5X20
+ 0,04
pRBSPO2X20 – B. subtilis MB216/pRBSPO2X20
E. coli XL1-Blue/
+ 0,08
pN5X20
E. coli 5K/
+ 0,08
pX60 (C +)
E.coli/
- 0,00
pUC19 (C -)
99

2.2.2. Expresión en Bacillus subtilis En vista de estos resultados se decidió


proseguir los estudios de producción con la
2.2.2.1. - Análisis de expresión de la xilanasa cepa B. subtilis MW15/pRBSPO2X20, por ser
en las cepas recombinantes de Bacillus la que presentaba los valores más elevados de
subtilis actividad xilanasa.
Las cepas recombinantes de B. subtilis se
cultivaron en caldo nutritivo a 30 ºC durante Para comprobar la correcta expresión de XynB
varios días, se tomaron muestras a distintos en la cepa seleccionada, se hicieron análisis
días de cultivo, y se determinó la actividad electroforéticos en geles de poliacrilamida con
xilanasa en los sobrenadantes de los cultivos. SDS de las proteínas de sobrenadantes de
Los resultados se resumen en la Tabla III.2.3 y cultivo de dicha cepa.
en la Figura III.2.2.

Tabla III.2.3: Actividad xilanasa en los sobrenadantes de cultivos de los clones recombinantes de Bacillus
subtilis.
Actividad (U/ml de sobrenadante)
Cepa 1 día 2 días 3 días 4 días 8 días
MB216/pN5X20 0,01 0,01 0,01 0,01 0,01
MB216/pRBSPO2X20 0,01 0,03 0,03 0,02 0,02
MB216 0,01 0,01 0,01 0,01 0,01
MW15/pN5X20 0,00 0,00 0,00 0,00 0,00
MW15/pRBSPO2X20 0,00 0,02 0,05 0,05 0,04
MW15 0,00 0,00 0,00 0,00 0,00

0,06
Actividad xilanasa (U/ml)

0,05
MB216/pN5X20
0,04
MB216/pRBSPO2X20
MB216
0,03
MW15/pN5X20
MW15/pRBSPO2X20
0,02 MW15

0,01

0,00
1 2 3 4 5 6 7 8 9
Días
Figura III.2.2: Actividad xilanasa en los sobrenadantes de cultivos de los clones recombinantes de Bacillus
subtilis.
100

En estos sobrenadantes de B. subtilis eficacia en producción y secreción de la


MW15/pRBSPO2X20 se observó una banda misma.
de proteína que no aparecía en el sobrenadante
del control – (B. subtilis MW15/pRBSPO2) y
2.2.2.2. - Expresión en diferentes medios de
que mostraba la misma movilidad
cultivo
electroforética que una banda proteica de los
extractos del clon original E. coli 5K/pX20 Para ensayar la influencia de la composición

utilizado como control + (Figura III.2.3). Esta del medio de cultivo sobre la producción de

banda mostraba un tamaño de unos 38 kDa, xilanasa por parte de B. subtilis

que concuerda con el tamaño descrito para la MW15/pRBSPO2X20, se realizaron cultivos

xilanasa B de Paenibacillus barcinonensis de dicha cepa durante 8 días a 30 ºC en 4

(Blanco et al., 1996), correspondiendo por medios distintos (caldo nutritivo, MG, MG2 y

tanto a la misma. BREC1), sin suplementar o suplementados con


diferentes sustancias, y se determinó la
kDa
actividad xilanasa en los sobrenadantes de
116 -
97 - dichos cultivos a diferentes tiempos durante el
periodo de incubación.
66 - Debido a la gran cantidad de sustancias
reductoras del medio, la actividad xilanasa de
45 -
31 - los sobrenadantes de los medios MG y BREC1
y de algunas muestras en medios MG2 no
21 - pudo cuantificarse por el método de
Nelson-Somogyi, y hubo que evaluarla por el
método cromogénico basado en xilano-RBB.
1 2 3 4
Esto hace que los resultados obtenidos no sean
Figura III.2.3: Análisis por SDS-PAGE en geles
del 12%. del todo comparables, ya que los valores de
(1) Extracto de E. coli 5K/pBR322 (C -). actividad obtenidos por dicho método
(2) Extracto de E. coli 5K/pX20.
(3) Sobrenadante de cultivos de 4 días en caldo presentan mayor variabilidad y acostumbran a
nutritivo de B. subtilis MW15/pRBSPO2X20.
(4) Sobrenadante de cultivos de 4 días en caldo
ser algo mayores que los obtenidos por el
nutritivo de B. subtilis MW15/pRBSPO2 (C -). método de Nelson-Somogyi.

Los resultados más significativos obtenidos


Es de destacar también que la xilanasa B
con los medios utilizados se resumen en la
constituía la proteína mayoritaria de los
Tabla III.2.4.
sobrenadantes de la nueva cepa B. subtilis
MW15/pRBSPO2X20, hecho que evidencia la
101

Tabla III.2.4: Producción de xilanasa por B. subtilis MW15/pRBSPO2X20 en distintos medios de cultivo.

Día de máxima Máxima actividad


Medio base Sustancia añadida actividad (U/ml sobrenadante)
- 4 0,06
Caldo Xilano de espelta de avena 1% 3 0,09
nutritivo Paja de arroz 1% 4 0,20
Xilano de madera de abedul 0,2% 3 0,23
- 8 0,12 (a)
MG Xilano de espelta de avena 1% 8 0,16 (a)
Paja de arroz 1% 8 0,16 (a)
- 0,00
MG2 Xilano de espelta de avena 1% 3 0,09 (a)
Paja de arroz 1% 8 0,13 (a)
- 0,00 (a)
BREC1 Xilano de espelta de avena 1% 8 0,15 (a)
Paja de arroz 1% 4 0,07 (a)
(a)
: Valores obtenidos por el método cromogénico basado en xilano-RBB.

Se observó que la máxima producción tuvo MW15/pRBSPO2X20 correspondientes a los


lugar en caldo nutritivo suplementado con sobrenadantes de los cultivos en los diferentes
xilano de madera de abedul a los 3 días de medios ensayados, y se hicieron
cultivo. determinaciones de actividad xilanasa para
medir la proporción de xilanasa existente
Se hicieron también análisis de proteínas de dentro de la célula.
los sobrenadantes de los cultivos anteriores Al comparar la actividad en los extractos
mediante electroforesis en geles de celulares (intracelular) con la actividad en los
poliacrilamida con SDS, observándose en sobrenadantes de cultivo (extracelular) se
todos los casos la banda proteica de 38 kDa observó que sorprendentemente la actividad
correspondiente a XynB, muy intensa y intracelular suponía más del 35% del total,
ausente en los controles negativos (datos no valor muy superior a lo esperado inicialmente
mostrados). (Tabla III.2.5).

A continuación, se hicieron análisis


2.3. Localización celular de XynB electroforéticos de las proteínas de los
extractos celulares y sobrenadantes de cultivos
2.3.1. Localización de XynB en Bacillus
de 3 y 4 días de B. subtilis
subtilis MW15/pRBSPO2X20
MW15/pRBSPO2X20 en caldo nutritivo.
Se obtuvieron los extractos celulares de las
Tanto en los extractos celulares como en los
muestras de Bacillus subtilis
sobrenadantes se observó la banda proteica de
102

Tabla III.2.5: Actividad xilanasa en sobrenadantes y extractos celulares de cultivos de Bacillus


subtilis MW15/pRBSPO2X20.

B. subtilis MW15/pRBSPO2X20 Actividad Proporción


(4º día de incubación) (U/ml de cultivo) (%)
Extracto celular 0,03 37,5
Caldo nutritivo
Sobrenadante 0,05 62,5
Caldo nutritivo con Extracto celular 0,11 35,5
paja de arroz 1% Sobrenadante 0,20 64,5

38 kDa correspondiente a XynB planteáramos como nuevo objetivo el estudio


(Figura III.2.4). Además, la intensidad de de la localización celular de XynB en la cepa
dicha banda proteica era aproximadamente la original Paenibacillus barcinonensis.
misma tanto en extractos celulares como en
muestras de sobrenadantes.
2.3.2. Localización de XynB en
Paenibacillus barcinonensis
La proporción tan elevada de xilanasa B
intracelular, cuando la enzima se expresaba en Para determinar la localización celular de la

cepas secretoras de Bacillus subtilis, fue un xilanasa B en la cepa original Paenibacillus

resultado inesperado que hizo que nos barcinonensis, se hicieron nuevos cultivos en
caldo nutritivo suplementado con xilano de

kDa

116 -
97 -

66 -

45 -
31 -

21 -

1 2 1 2 1 2 1 2
Sobrenadantes Extractos Sobrenadantes Extractos

3er día de cultivo 4º día de cultivo

Figura III.2.4: Análisis mediante SDS-PAGE en geles del 12% de los sobrenadantes y extractos celulares
de cultivos de (1) B. subtilis MW15/pRBSPO2 (C-) y (2) B. subtilis MW15/pRBSPO2X20.
103

madera de abedul 0,2%, de Paenibacillus mayoritaria en los sobrenadantes (Tabla III.2.6


barcinonensis y de la cepa recombinante y Figura III.2.5).
B. subtilis MW15/pRBSPO2X20. En los
extractos celulares y sobrenadantes de estos Los resultados obtenidos hasta este punto
cultivos se determinaron tanto la actividad parecían indicar que la xilanasa B era una
xilanasa (sobre xilano) como la actividad enzima de localización preferentemente
xilosidasa (sobre pNPX), por ser XynB activa intracelular. Para determinar si la existencia de
sobre ambos sustratos (Blanco et al., 1996). lisis celular en los cultivos realizados daba
lugar a la liberación inespecífica de XynB a
En el caso de B. subtilis MW15/pRBSPO2X20 los sobrenadantes de cultivo, y por tanto era
no se detectaron valores significativos de responsable de la actividad xilanasa detectada
actividad xilanasa ni xilosidasa en los extracelularmente, se realizaron ensayos que
sobrenadantes hasta las 24 h de cultivo, evaluaban el grado de lisis celular en los
mientras que en los extractos celulares se cultivos y su relación con los niveles de XynB
detectaron ambas actividades a las 17 h de en los sobrenadantes.
cultivo. Las actividades enzimáticas en los Una de las enzimas usada comúnmente como
extractos celulares fueron muy superiores a las marcador intracelular en Bacillus subtilis es la
encontradas en los sobrenadantes hasta las isocitrato deshidrogenasa (ICDH). Sin
48 h de cultivo, momento en que embargo en los ensayos realizados únicamente
aproximadamente ambas actividades se se pudo detectar actividad ICDH, aunque a
igualaron. Únicamente en cultivos de 72 h las unos niveles muy bajos, en algunas muestras
actividades extracelulares xilanasa y xilosidasa de los extractos celulares de B. subtilis
superaron ligeramente a las intracelulares MW15/pRBSPO2X20, pero no en los
(Tabla III.2.6 y Figura III.2.5). sobrenadantes de cultivo.

En el caso de Paenibacillus barcinonensis, Se realizaron entonces ensayos para


cepa que posee un sistema xilanolítico determinar la presencia de otro marcador
complejo con varios enzimas con actividad intracelular, la malato deshidrogenasa (MDH),
xilanasa y xilosidasa, se observó que los que a pesar de no estar descrito como tal en
valores de actividad xilanasa fueron siempre Bacillus subtilis es muy usado como marcador
mucho mayores en los sobrenadantes. Sin intracelular en E. coli.
embargo, la actividad xilosidasa, asociada En estos ensayos, se detecto actividad MDH
principalmente a XynB, era mayoritariamente tanto en extractos como en sobrenadantes de
intracelular en cultivos jóvenes (14 h), y sólo a cultivos de 1 a 3 días de B. subtilis
las 48 h pasaba a localizarse de forma MW15/pRBSPO2X20. Los valores de
104

Tabla III.2.6: Actividad xilanasa y xilosidasa total en sobrenadantes y extractos celulares de cultivos de
Paenibacillus barcinonensis y Bacillus subtilis MW15/pRBSPO2X20.

Actividad xilanasa Actividad (U/ml cultivo) Porcentajes (% actividad)


14 17 24 48 72 14 17 24 48 72
Paenibacillus Extracto 0,040 - 0,035 0,051 0,052 26,2 - 6,3 5,7 6,0
barcinonensis Sobrenadante 0,113 - 0,514 0,850 0,821 73,8 - 93,7 94,3 94,0
B. subtilis MW15/ Extracto - 0,005 0,084 0,172 0,215 - 100,0 93,9 55,3 48,4
pRBSPO2X20 Sobrenadante - 0,000 0,005 0,139 0,229 - 0,0 6,1 44,7 51,6

Actividad xilosidasa Actividad (U/ml cultivo) Porcentajes (% actividad)


14 17 24 48 72 14 17 24 48 72
Paenibacillus Extracto 0,017 - 0,013 0,011 0,010 100,0 - 48,3 28,5 31,8
barcinonensis Sobrenadante 0,000 - 0,013 0,027 0,021 0,0 - 51,7 71,5 68,2
B. subtilis MW15/ Extracto - 0,005 0,058 0,353 0,283 - 100,0 69,9 56,7 43,6
pRBSPO2X20 Sobrenadante - 0,000 0,025 0,270 0,366 - 0,0 30,1 43,3 56,4

Actividad Xilanasa:
Paenibacillus
Paenibacillus sp. BP23
barcinonensis B. subtilis MW15/pRBSPO2X20
0,90 1,20 0,25 1,00
0,80 0,90
1,00
0,70 0,20 0,80
0,60 0,80 0,70
U/ml cultivo

U/ml cultivo
D.O.600nm

D.O.600nm
0,15 0,60
0,50
0,60 0,50
0,40
0,10 0,40
0,30 0,40 0,30
0,20 0,05 0,20
0,20
0,10 0,10
0,00 0,00 0,00 0,00
0 24 48 72 0 24 48 72
Horas Horas
Extractos Sobrenadantes D.O.600nm Extractos Sobrenadantes D.O.600nm

Actividad Xilosidasa:
Paenibacillus
Paenibacillus sp. BP23
barcinonensis B. subtilis MW15/pRBSPO2X20
0,03 1,20 0,40 1,00
0,35 0,90
0,03 1,00
0,80
0,30
0,02 0,80 0,70
U/ml cultivo

U/ml cultivo

0,25
D.O.600nm
D.O.600nm

0,60
0,02 0,60 0,20 0,50
0,15 0,40
0,01 0,40 0,30
0,10
0,01 0,20 0,20
0,05 0,10
0,00 0,00 0,00 0,00
0 24 48 72 0 24 48 72
Horas Horas
Extractos Sobrenadantes D.O.600nm Extractos Sobrenadantes D.O.600nm

Figura III.2.5: Actividad xilanasa y xilosidasa en extractos celulares y sobrenadantes de cultivos de


Paenibacillus barcinonensis y Bacillus subtilis MW15/pRBSPO2X20.
105

actividad de este marcador de lisis celular xilanasa de secreción previamente clonada y


obtenidos presentaron bastante correlación con caracterizada (Blanco et al., 1999): extractos
los valores de actividad xilanasa detectados en de E. coli 5K/pX20 como control + de XynB,
los compartimentos intracelular y extracelular y extractos de E. coli 5K/pX31 como
de la cepa recombinante (Tabla III.2.7). control + de XynC. (Figura III.2.6).
Por el contrario, no pudo detectarse actividad
MDH ni en extractos ni en sobrenadantes de
cultivos de Paenibacillus barcinonensis.

Ante la falta de resultados concluyentes


utilizando los marcadores intracelulares para
Paenibacillus barcinonensis, con el fin de
comprobar la localización intracelular de
XynB en dicha cepa, se realizaron análisis
zimográficos de extractos y sobrenadantes
1 2 3 4 5 6
concentrados tanto de cultivos jóvenes (17 h)
como de cultivos en fase estacionaria (72 h). Figura III.2.6: Análisis zimográfico de
sobrenadantes y extractos celulares de cultivos de
Puesto que la xilanasa B de Paenibacillus Paenibacillus barcinonensis en caldo nutritivo.
barcinonensis se inactiva de manera (1) Sobrenadante de cultivos de 17 h.
(2) Extractos celulares de cultivos de 17 h.
irreversible en geles desnaturalizantes (3) Sobrenadante de cultivos de 72 h.
(4) Extractos celulares de cultivos de 72 h.
(SDS-PAGE), se tuvieron que usar geles (5) Extractos celulares de E. coli 5K/pX20 (C + de
nativos para su posterior revelado zimográfico. XynB).
(6) Extractos celulares de E. coli 5K/pX31 (C + de
Además, se usaron 2 controles para identificar XynC).
tanto la xilanasa B, en estudio, como la
xilanasa C de Paenibacillus barcinonensis,

Tabla III.2.7: Actividad MDH y xilanasa en fracciones celulares de B. subtilis MW15/pRBSPO2X20.

Actividad MDH Actividad MDH Actividad xilanasa


(U/ml cultivo) extracelular (%) extracelular (%)
1 día de Extractos 0,039
4,88 30,1
cultivo Sobrenadantes 0,002
2 días de Extractos 0,084
72,10 43,3
cultivo Sobrenadantes 0,218
3 días de Extractos 0,013
83,33 56,4
cultivo Sobrenadantes 0,065
Control - 0,000
106

En los carriles correspondientes a los membranas. Los extractos celulares se


sobrenadantes concentrados de Paenibacillus centrifugaron a 38000xg durante 1 h a 4 ºC y
barcinonensis, tanto a 17 como a 72 h, se se recuperaron los sobrenadantes (citoplasma),
observó una banda de actividad muy mientras que los sedimentos (pellet, restos de
prominente correspondiente a la xilanasa C, pared y membranas celulares) se lavaron con
juntamente con otras bandas difusas y menos tampón acetato y se resuspendieron en 1
intensas. Todas estas bandas correspondían al volumen del mismo tampón.
complejo de xilanasas secretadas de Tras este fraccionamiento, se ensayó la
Paenibacillus barcinonensis, previamente actividad xilanasa tanto en la fracción soluble
descrito (Blanco et al. 1993, 1995). Sin como en la fracción particulada del extracto
embargo, en estos sobrenadantes, no se celular de Paenibacillus barcinonensis.
observó ninguna banda de actividad con la Tal como puede observarse en los resultados
movilidad electroforética de la xilanasa B. de la Tabla III.2.8, sólo se detectó actividad
Por el contrario, en los carriles xilanasa en el citoplasma (sobrenadante),
correspondientes a los extractos celulares se mientras que no se detecto actividad en la
observaba claramente una banda de actividad fracción particulada.
correspondiente a la la xilanasa B, tanto en los Tabla III.2.8: Actividad xilanasa en fracciones
cultivos jóvenes de 17 h como en los de fase celulares de Paenibacillus barcinonensis.

estacionaria de 72 h. Actividad xilanasa


En zimogramas de otras muestras de cultivos Fracción (U/ml cultivo) a
Citoplasma 0,080
de Paenibacillus barcinonensis
Pared y membranas
correspondientes a 17 y 72 h, se observaron ND
celulares
a
ocasionalmente bandas de actividad ND: No Detectable

correspondientes a XynB en algunos


sobrenadantes, aunque siempre mucho más 2.3.3. Análisis de péptido señal
tenues que las correspondientes bandas de Los resultados observados indicaban que
actividad de XynB observadas en todos los XynB de Paenibacillus barcinonensis era una
extractos celulares. xilanasa intracelular en lugar de una enzima de
secreción. Por ello, se realizó un análisis del
Para evaluar la posibilidad de que XynB fuera gen codificante para determinar la existencia o
una enzima de secreción pero asociada a la no de señales de secreción en él.
pared bacteriana, se realizó un fraccionamiento
fino de extractos celulares de cultivos de 14 h El estudio de la secuencia de la región
de Paenibacillus barcinonensis para separar el N-terminal de XynB no reveló la presencia de
citoplasma de los restos de pared y secuencias de aminoácidos compatibles con la
107

estructura típica de un péptido señal que celulares como de sobrenadantes de cultivo de


pudiera ser reconocido por los sistemas de B. subtilis MW15/pRBSPOX20. También se
secreción de Bacillus subtilis y otros Gram +. secuenció el extremo N-terminal de la proteína
La ausencia de péptido señal en XynB fue aislada a partir de extractos celulares del clon
confirmada por los análisis realizados con los original E. coli/pX20.
programas SignalP y PSort, en contraposición En los 3 casos, la secuencia N-terminal que se
con los de la xilanasa A de Bacillus sp. BP-7, obtuvo fue la misma, STEIPSLSAS, y
utilizada como control + por contener un coincidía con la secuencia N-terminal
péptido señal típico (Figura III.2.7). deducida a partir de la secuencia de
nucleótidos. Este resultado confirma la
Para confirmar la ausencia de péptido señal, se ausencia de péptido señal en XynB y
secuenció el extremo N-terminal de la corrobora que la presencia de XynB en el
xilanasa B aislada a partir de geles de medio de cultivo sería debida a una liberación
poliacrilamida de muestras tanto de extractos inespecífica, posiblemente por lisis celular.

XynA de Bacillus sp. BP-7 (C+) XynB de Paenibacillus barcinonensis

MFKFTKKFLVGLTAALMSI SLFSANASAANTDYWQNWT MSTEI PSLSASYANSFKI GAAVHTRMLQTEGEFI AKHY

DGGGTVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPF NSVTAENQMKFEEVHPREHEYTFEAADEI VDFAVARGI

RTI N GVRG

Análisis con SignalP

Figura III.2.7: Análisis de la región N-terminal de XynB de Paenibacillus barcinonensis en


comparación con la región N-terminal de XynA de Bacillus sp. BP-7 (control +).
En el análisis informático con SignalP, los valores de S score elevados indican secuencias de péptido
señal, los valores de C score superiores a 0,5 indentifican posibles lugares de corte para peptidasas señal,
y el Y score combina en un único estadístico el S score y el C score para una mejor predicción del lugar
de corte de las peptidasas señal.
108

2.4. Estudio de las homologías de 21 (55% de identidad) (Baba et al., 1994),

XynB XynA de Thermobacillus xylanilyticus (54%


de identidad) (Debeche et al., 2000) y XynA
2.4.1. Homologías de XynB de Caldicellulosiruptor saccharolyticus (52%

La secuencia de aminoácidos de XynB fue de identidad) (Luthi et al., 1990). Estas 6

comparada con secuencias de proteínas xilanasas pertenecen a la familia 10 de glicosil

conocidas contenidas en las bases de datos hidrolasas (familia F de xilanasas).

(NCBI y EMBL).
La máxima homología se encontró con XynX El análisis de potenciales secuencias de

de Aeromonas punctata (85% de identidad) péptido señal en estas 6 proteínas homólogas a

(Usui et al., 1999), XynA2 de Bacillus XynB, usando para ello los programas SignalP

stearothermophilus T-6 (57% de identidad) y PSort, no halló evidencia de que estas

(Shulami et al., 1999), XyaA de Bacillus sp. proteínas presentaran péptidos señal, tal como

N137 (55% de identidad) (Tabernero et al., ya había sucedido con XynB de Paenibacillus

1995), Xyn2 de Bacillus stearothermophilus barcinonensis. Por el contrario, se

680 10 690 20 700 30 710 40 720 50 730 60 740 70


....|....|....|....|....|....|....|....|....|....|....|....|....|....|....
XynA_C.sp. KSLKEKGVPIHGIGLQSHINLDWP-SISEIENTIRLFSSIPGLEIHITELDMS-FYQWGSSTSYSTPPRDLLIK
XynA_D.the KKLKDKGVPIHGIGIQGHWTLAWP-TPKMLEDSIKRFAEL-GVEVQVTEFDISIYYDRNENNNFKVPPEDRLER
XynC_C.sp. KSLKEKGVPIHGIGLQCHINLDWP-SISEIENTIKLFSSIPGLEIHITELDMS-FYQWGSSTSYSTPPRDLLIK
XynE_C.sac KNMKSKGIPIHGVGLQCHINVDSP-SVEEIEETIKLFSTIPGLEIQITELDMS-FYQWGSSVYYVEPSREMLLR
XynA_A.the KSLREKGIPIHGVGLQCHISVSWP-SVEEVEKTIKLFSSIPGIKIHVTEIDISVAKEYGEDIDEET-KRYLLIQ
XynA_C.cel QRLKSKGIPVHGVGHQTHINITWP-SISEIENSLVKFSNL-GVVQEITELDMSIYNNSSQKYDTLP--SDLAQQ
XynB_C.sp. KALHDRGL-IDGVGLQGHINVDSP-AVKEIEDTINLFSTIPGLQIQITELDISVYTSSTQQYDTLP--QDIMIK
XynX_A.pun RSLLDKGAPVHGIGLQGHWNIHGP-SIEEIRMAIERYASL-DVQLHVTELDMSVFRHEDRRTDLTAPTSEMAEL
XynB_BP23 RSLLDQGAPVHGIGMQGHWNIHGP-SMDEIRQAIERYASL-DVQLHVTELDLSVFRHEDQRTDLTEPTAEMAEL
XynA2_B.ste KSLRDKGIPIHGIGMQAHWSLTRP-SLDEIRAAIERYASL-GVVLHITELDVSMFEFHDRRTDLAAPTSEMIER
Xyn2_B.ste KSLRDKGIPIHGIGMQAHWSLNRP-TLDEIRAAIERYASL-GVILHITELDISMFEFDDHRKDLAAPTNEMVER
XynA_T.xyl KWLKEQGAPIHGIGMQGHYNLASP-SIAEVREAIEKYAEL-GLVIHVTELDMSVYAWDDRRTDLLEPTAEMVER
XyaA_B.sp. KSLLDKDVPIHGVGLQAHWNVHDP-SLDDIRAAIERYASL-GIQLQITEMDVSMFSWDNRRADLTQPTEKMLNL
XynA_C.sac KELLERGTPIDGIGIQAHWNIWDKNLVSNLKKAIEVYASL-GLEIHITELDISVFEFEDKRTDLFEPTPEMLEL

Región V Región VI
Región A Región B

Figura III.2.8: Regiones A y B sobre el alineamiento múltiple de las secuencias de proteínas XynA de
Caldicellulosiruptor sp. Tok7B.1 (XynA_C.sp.) (Gibbs et al., 2000), XynA de Dictyoglomus
thermophilum (XynA_D.the) (Gibbs et al., 1995), XynC de Caldicellulosiruptor sp. (XynC_C.sp.) (Morris
et al., 1999), XynE de Caldicellulosiruptor saccharolyticus (XynE_C.sac) (PIR T30910), XynA de
Anaerocellum thermophilum (XynA_A.the) (NCBI CAA93627), XynA de Caldibacillus cellulovorans
(XynA_C.cel) (Sunna et al., 2000), XynB de Caldicellulosiruptor sp. (XynB_C.sp.) (Morris et al., 1999),
XynA de Aeromonas punctata (XynX_A.pun), XynB de Paenibacillus barcinonensis (XynB_BP23),
XynA2 de Bacillus stearothermophilus T-6 (XynA2_B.ste), Xyn2 de Bacillus stearothermophilus 21
(Xyn2_B.ste), XynA de Thermobacillus xylanilyticus (XynA_T.xyl), XyaA de Bacillus sp. N137
(XyaA_B.sp.) y XynA de Caldicellulosiruptor saccharolyticus (XynA_C.sac). Se muestrtan también las
regiones V y VI, conservadas en las xilanasas de la familia 10.
109

identificaron secuencias típicas de péptido homólogas a XynB de Paenibacillus


señal en las otras xilanasas de la familia F barcinonensis ya mencionadas, juntamente
analizadas, todas ellas con un menor nivel de con otras xilanasas de la familia F
homología a XynB de Paenibacillus (Figura III.2.8).
barcinonensis.
Se observó que tanto XynB como las 6
Se realizaron alineamientos múltiples de las xilanasas más homólogas a ella, todas sin
secuencias proteicas de las 6 xilanasas más péptido señal, presentaban 2 regiones

Xyn Cryptococcus albidus


Cex Cellulomonas fimi
XynZ Clostridium thermocellum
XlnA Streptomyces lividans
Xyn Thermoascus aurantiacus
XynA Aspergillus awamori var. kawachii
XynA Pseudomonas fluorescens
XynB Pseudomonas fluorescens
ORF4 Caldocellum saccharolyticum
XynB Butyrivibrio fibrisolvens
XynA Ruminococcus flavefaciens
XynA Butyrivibrio fibrisolvens
XynA Caldibacillus cellulovorans
XynA Bacillus sp. C125
XynB Clostridium stercorarium F-9
XynA Dictyoglomus thermophilum
CelB Caldocellum saccharolyticum
XynE Caldicellulosiruptor saccharolyticus
XynA Caldicellulosiruptor sp. Tok7B.1
XynC Caldicellulosiruptor sp.
XynA Caldicellulosiruptor saccharolyticus
XynX Aeromonas punctata
XynB Paenibacillus barcinonensis BP-23
Xyn Bacillus sp. N137
XynA Thermobacillus xylanilyticus
XynA2 Bacillus stearothermophilus T-6
Xyn2 Bacillus stearothermophilus 21
XynA Anaerocellum thermophilum
XynB Caldicellulosiruptor sp.

Figura III.2.9: Dendrograma de XynB de Paenibacillus barcinonensis con 28 xilanasas de la familia F


(Gilkes et al., 1991; Henrissat y Bairoch 1996). Está señalada la rama a la que pertenecen XynB de
Paenibacillus barcinonensis y las 6 xilanasas más homólogas a esta.
110

altamente conservadas no presentes en el resto


de xilanasas de la familia F. Estas regiones
estaban situadas alrededor de la región VI,
conservada en las xilanasas de la familia F
(Baba et al., 1994; Fukumura et al., 1995); y
se denominaron provisionalmente como región
A, cuya secuencia conservada es AIE_YASL,
y región B, cuya secuencia conservada es
RTDL__PT.

A partir de nuevos alineamientos múltiples


conteniendo más secuencias de xilanasas de la
familia F (Gilkes et al., 1991; Henrissat y
Bairoch 1996) se obtuvo el árbol filogenético
para estas xilanasas que se muestra en la
Figura III.2.9.

En este árbol, XynB de Paenibacillus


barcinonensis junto con las 6 xilanasas
homólogas que no contienen péptido señal
quedaron segregadas, formando un cluster o
agrupamiento separado del resto de xilanasas
de la familia 10.
CAPÍTULO IV.
INGENIERÍA DE PROTEÍNAS CON LA XILANASA
XYNB DE PAENIBACILLUS BARCINONENSIS
113

1. - INTRODUCCIÓN Y OBJETIVOS 2. - RESULTADOS


Las peculiares características de la xilanasa B
(XynB) de Paenibacillus barcinonensis la 2.1. Análisis estructural y
convierten en una enzima de interés tanto funcional de XynB de
desde el punto de vista básico como aplicado. Paenibacillus barcinonensis

Para profundizar en el conocimiento de esta 2.1.1 Análisis de la estructura primaria


enzima así como para mejorar sus cualidades Para averiguar los posibles dominios
para una posible aplicación en la industria, se funcionales y estructurales de XynB, se usaron
decidió realizar estudios de estructura-función los servicios on-line Pfam y ProDom, que se
y experimentos de ingeniería de proteínas. basan en la búsqueda de homologías de
En base a esto, los objetivos de este capítulo secuencia con dominios de proteínas ya
fueron: conocidas.
- El análisis estructural de la xilanasa B de
Paenibacillus barcinonensis. La búsqueda en Pfam dio como resultado la

- Estudio de la relación estructura-función en identificación, entre los aminoácidos 44 y 244

la xilanasa B mediante mutagénesis de XynB, de una región altamente homóloga a

dirigida. un dominio típico de glicosil hidrolasas de la


familia 10 (número de acceso PF0033). Este
- La purificación y la cristalización de la
dominio, anteriormente denominado
xilanasa B de Paenibacillus barcinonensis.
glycosyl_hydro3 y cuya denominación actual
- Ensayos de mutagénesis aleatoria (PCR
en Pfam es Glyco_hydro_10, engloba el centro
mutagénica y shuffling) para aumentar la
activo de esta familia de enzimas, así como el
termoestabilidad de la xilanasa B.
núcleo de la estructura en forma de
- Estudio de la relación estructura-función en
TIM-barrel o barril (α/β)8 de dichas enzimas.
la xilanasa B a partir del análisis de las
Las diferentes familias de glicosil hidrolasas
enzimas mutantes obtenidas.
con este plegamiento terciario se agrupan
dentro de un clan o superfamilia, denominado
Tim barrel glycosyl hydrolase superfamily
(denominación en Pfam) o clan GH-A. Las
familias de este clan presentarían un origen
evolutivo común.
114

Por su parte, los resultados obtenidos de la otras xilanasas y que contenía además la
búsqueda en ProDom (Figura IV.2.1) región B (RTDL__PT) identificada
indicaban que la proteína XynB contenía previamente en este grupo de xilanasas
regiones homólogas a 3 dominios presentes en (Figura III.2.8 del capítulo III) confería un
su base de datos (versión 2001.3): interés adicional al estudio de XynB.
– Al dominio 809, hacia la región N-terminal Actualmente, según la versión 2005.1 de la
y central de XynB. Este dominio es típico base de datos de ProDom, la enzima XynB
de glicosil hidrolasas de la familia 10 y presenta regiones homologas a 5 dominios,
engloba las regiones conservadas I a VI de dos de los cuales, PD000809 y PD005864,
dicha familia (Baba et al., 1994; Fukumura corresponden a los anteriores 809 y 5864, y los
et al., 1995). otros tres, situados a N-terminal, son dominios
– Al dominio 5864, hacia la región típicos de glicosil hidrolasas de la familia 10;
C-terminal de XynB. Este dominio desapareciendo cualquier referencia al antiguo
también es típico de glicosil hidrolasas de dominio 277407.
la familia 10 y engloba las regiones
conservadas VII a VIII típicas de esta
2.1.2. Predicción de estructura
familia (Fukumura et al., 1995).
secundaria y terciaria
– A un dominio localizado entre los 2
dominios anteriores, que recibía el número Se realizó un análisis informático de la

de identificación 277407 y que solamente estructura secundaria de la proteína utilizando

se encontraba presente en XynB y las otras para ello los servicios on-line Jpred y

6 xilanasas sin péptido señal homólogas a SCRATCH. Ambos servicios usan programas

ella, mencionadas en el capítulo anterior. de predicción 2D basados en alineamientos


múltiples (generados con PSI-BLAST) de la
Prodom Release 2001.3
secuencia introducida y en el posterior
0 100 200 300 400 procesamiento de estos alineamientos
mediante redes neuronales.

809 277407 5864 XynB


Los resultados obtenidos sugerían que XynB
Figura IV.2.1: Predicción de dominios para la
xilanasa B de Paenibacillus barcinonensis según presentaba 8 regiones de hélice α y 8 regiones
ProDom (2001.3). de conformación β, intercaladas por varias
regiones no estructuradas (Figura IV.2.2).
El hecho de que tanto en XynB de
Tal como hemos indicado anteriormente, en
Paenibacillus barcinonensis como en las otras
las enzimas de la familia 10 de glicosil
6 xilanasas homólogas a ella y sin péptido
hidrolasas estas estructuras secundarias
señal, aparecía un dominio no presente en
115

1---------11--------21--------31--------41--------51--------61--------71--------81--------91-------100
XynB : MSTEIPSLSASYANSFKIGAAVHTRMLQTEGEFIAKHYNSVTAENQMKFEEVHPREHEYTFEAADEIVDFAVARGIGVRGHTLVWHNQTPAWMFEDASGGTA
jalign : -----HHHHHHH-------EE--------HHHHHHH---------------------------HHHHHHHHHH---EE--EEEEEE------EEE-------
jfreq : --HHHHHHHHHH--------EE-HHHHHHHHHHHHHH-------------------------HHHHHHHHHHH---EEE-EEEEEE-----EEEE-------
jhmm : ---HHHHHHHHH-----EEEEE-------HHHHHHHH---EE------------------HH-HHHHHHHHHH----EE-EEEE------------------
jnet : --HHHHHHHHHH-----EEEEE---HHHHHHHHHHHH---EEE-------------------HHHHHHHHHHH---EEEEEEEEEE-----EEEE-------
jpssm : -----HHHHHHH-----EEEE------H--HHHHHH----EEE-------------------HHHHHHHHHHH---EEE-EEEEE------EEEE-------
jpred : ---HHHHHHHHH-----EEEEE-------HHHHHHHH---EE--------------------HHHHHHHHHHH---EEE-EEEEEE-----EEEE-------

101-----111-------121-------131-------141-------151-------161-------171-------181-------191--------202
XynB : SREMMLSRLKQHIDTVVGRYKDQIYAWDVVNEAIEDKTDLIMRDTKWLRLLGEDYLVQAFNMAHEADPNALLFYNDYNETDPVKREKIYNLVRSLLDQGAPV
jalign : HHHHHHHHHHH-HHHHEEE----EEEEEEEEEE------------EEEE----HHHHHHHHHHHH-----EEEE---------HHHHHHHHHHHHH------
jfreq : -HHHHHHHHHH-EEEEEEE---EEEEEEEE-EEE-----------EEE-----HHHHHHHHHHHH-----HHHH---------HHHHHHHHHHHHHH-----
jhmm : -HHHHHHHHHHHHHHHHHH----EEEEEEEEEE-------------HHE---HHHHHHHHHHHHHH----EEEE---------HHHHHHHHHHHHHH-----
jnet : -HHHHHHHHHHHHHHHHH-----EEEEEEEEEEE-------------EE---HHHHHHHHHHHHHH----EEEE---------HHHHHHHHHHHHHH-----
jpssm : -HHHHHHHHHHHHHHHH-----EEEEEEEEEEEE-------------E----HHHHHHHHHHHHHH----EEEEE--------HHHHHHHHHHHHH------
jpred : -HHHHHHHHHHHHHHHHH-----EEEEEEEEEEE-------------EE---HHHHHHHHHHHHHH----EEEE---------HHHHHHHHHHHHHH-----

203---211-------221-------231-------241-------251-------261-------271-------281-------291----------304
XynB : HGIGMQGHWNIHGPSMDEIRQAIERYASLDVQLHVTELDLSVFRHEDQRTDLTEPTAEMAELQQKRYEDIFGLFREYRSNITSVTFWGVADNYTWLDNFPVR
jalign : ---------------HHHHHHHHHHHHH----EEEEEE------------------HHHHHHHHHHHHHHHHHHHH-----EEEEEEEE-------------
jfreq : -----EEE--------HHHHHHHHHHHH----EEEEEEE----------------HHHHHHHHHHHHHHHHHHHHH-----EEEEEEEE-------------
jhmm : --EEEEEE-------HHHHHHHHHHHHH----EEEEEE------------------HHHHHHHHHHHHHHHHHHHH-----EEEEEEEE-------------
jnet : --EEEEEE-------HHHHHHHHHHHHH----EEEEEEE----------------HHHHHHHHHHHHHHHHHHHHH-----EEEEEEEE-------------
jpssm : --EEEE----------HHHHHHHHHHHH----EEEEEEE-----------------HHHHHHHHHHHHHHHHHHHH-----EEEEEEEE-------------
jpred : --EEEEEE-------HHHHHHHHHHHHH----EEEEEEE-----------------HHHHHHHHHHHHHHHHHHHH-----EEEEEEEE-------------

jalign - Predicción de Jnet según el alineamiento múltiple


305-311-------321------330
XynB : GRKNWPFVFDTELQPKDSFWRIIGQD
jfreq - Predicción de Jnet según la frecuencia de perfiles de PSI-BLAST
jalign : --------------------EE---- jhmm - Predicción de Jnet basada en “hidden Markov models” (HMM)
jfreq : ------------------EEEE---- jnet - Predicción de Jnet con parámetros estándar
jhmm : ----------------HHHHHH---- jpssm - Predicción de Jnet según la “position-specific scoring matrix” (PSSM)
jnet : -----------------HHHHH----
jpssm : ------------------HH------
de PSI-BLAST
jpred : ------------------HHHH---- jpred - Predicción consenso

Figura IV.2.2: Predicción de la estructura secundaria de XynB de Paenibacillus barcinonensis usando el


servicio Jpred. Las H en rojo indican la predicción de regiones de hélice α y las E en naranja indican la
predicción de regiones de hebras β. En azul se indican los glutámicos catalíticos, y en violeta la región B.

conforman un plegamiento tridimensional Para comprobar esta hipotética estructura


conocido como TIM-barrel o barril (α/β)8. secundaria, y continuar con el estudio de
XynB, se obtuvo un modelo por homología de

A C

Figura IV.2.3: Imágenes del modelo de la estructura terciaria de XynB de Paenibacillus barcinonensis,
generado por el servicio SWISS-MODEL. Las hélices α están coloreadas en rojo, las hebras β en amarillo y
los bucles o loops en verde claro. Los 2 aminoácidos catalíticos están coloreados en azul. Puede observarse
tanto la representación de lazos (A y B), como de la superficie (C).
116

la estructura terciaria de la enzima, usando visto, formaría parte del dominio 277407
para ello el servicio SWISS-MODEL según ProDom versión 2001.3.
(Figura IV.2.3).
Tal como se puede observar en el modelo, la Se realizaron 3 delecciones distintas
estructura de la xilanasa B sería la típica de (Figura IV.2.4):
barril (α/β)8 con elementos adicionales de – Una delección que englobaba sólo los
estructura secundaria (Figura IV.2.3.A). Los aminoácidos 253 a 256 de XynB
aminoácidos catalíticos de esta enzima (Δ253-256), y que correspondía a la
quedarían muy próximos hacia el interior del secuencia RTDL de la región B.
barril en una hendidura de la superficie de la – Una segunda delección más amplia
proteína (Figura IV.2.3.C). La región B correspondiente a los aminoácidos 253 a
(RTDL__PT), previamente identificada en el 260 (Δ253-260), y que incluía toda la
grupo de xilanasas sin péptido señal, aparecía región B de XynB.
localizada en uno de los bucles (loops) – La delección de todo el dominio 277407,
exteriores de la estructura terciaria de la comprendiendo los aminoácidos 249 a 261
proteína. (Δ249-261).

Estas delecciones se introdujeron en el gen


2.1.3. Mutagénesis dirigida
xynB contenido en el plásmido pX60
Para estudiar la posible funcionalidad de la (pUC19-X20) mediante amplificación por
región B presente en XynB, se decidió obtener PCR divergente en un sólo paso con la pareja
proteínas mutantes derivadas de XynB en las de cebadores adecuada (Figura IV.2.4) y
que dicha región estuviera deleccionada total o posterior religación de los amplificados.
parcialmente. La región B, como ya hemos

240 250 260 270 Cebador Secuencia Delección


277407 Δ253-256
XynB TELDLSVFRHEDQRTDLTEPTAEMAELQQKR BKDEL_AB CTGATCCTCGTGACGAAAC
XynB Δ253-256 TELDLSVFRHEDQ----TEPTAEMAELQQKR Δ253-260
XynB Δ253-260 TELDLSVFRHEDQ--------AEMAELQQKR
TELDLSVFR-------------EMAELQQKR FWDEL_A ACCGAGCCAACGGCAGAG Δ253-256
XynB Δ249-261
FWDEL_B GCAGAGATGGCAGAGCTG Δ253-260
240 250 260 270
BKDEL_C ACGAAACACAGACAGATCC Δ249-261
FWDEL_A
BKDEL_AB FWDEL_C GAGATGGCAGAGCTGCAGC Δ249-261
FWDEL_B

BKDEL_C FWDEL_C

Figura IV.2.4: Delecciones de XynB y cebadores diseñados para la amplificación de xynB sin los
fragmentos a deleccionar.
117

Los plásmidos obtenidos fueron clonados en 2.2.1. Obtención de clones


E. coli DH5α, se seleccionaron los clones sobreproductores de XynB
recombinantes, y se comprobó por Con el fin de obtener elevada cantidad de
secuenciación la correcta introducción de las XynB, que facilitara su purificación y
delecciones en el gen xynB. posterior cristalización, se decidió su
clonación en vectores de expresión bajo el
Para analizar la actividad de las xilanasas control de un promotor inducible.
deleccionadas construidas, se obtuvieron Se eligió para ello el sistema pET, en concreto
extractos celulares de los clones el plásmido pET3b, que permite clonar genes
recombinantes correspondientes y se ensayó su bajo el control del promotor fuerte e inducible
actividad enzimática sobre xilano de madera del fago T7.
de abedul y pNPX, a temperatura ambiente y
pH 5,5 y 7. Para ello, se amplificó el gen xynB a partir de
En ninguno de los ensayos se obtuvieron ADN plasmídico de pX60 mediante cebadores
valores detectables de actividad, hecho que que contenían las dianas NdeI y BamHI,
indicaba que estas xilanasas deleccionadas necesarias para clonar el gen en la dirección
construidas no eran funcionales. adecuada (Figura IV.2.5).
A continuación el fragmento amplificado se
clonó en el vector pET3b, entre las dianas de
2.2. Purificación y cristalización
restricción para las mencionadas enzimas,
de XynB obteniéndose así el plásmido pET3b-X20
Para aumentar los conocimientos estructurales (Figura IV.2.6).
sobre XynB se decidió llevar a cabo la
resolución de su estructura terciaria mediante Este plásmido se transformó en la cepa E. coli
cristalografía y difracción de rayos X. BL21(DE3), que al contener el lisógeno λDE3
en su cromosoma es capaz de expresar la ARN
polimerasa de T7 al añadir IPTG al medio de
cultivo.

Cebador Secuencia Región de hibridación


FWX20pET1 NdeI Cadena + después del RBS de
ACCCATATGTCTACCGAAATTCCG xynB.
BamHI Cadena - después de la pauta
BKX20pET1 CTTATAGGATCCTAGTCTTGCCCG abierta de lectura de xynB.

Figura IV.2.5: Cebadores diseñados para la amplificación de xynB y posterior clonación en


pET3b.
118

A pesar de estos problemas, el clon E. coli


T7Ter BamHI BL21(DE3)/pET3b-X20 2b fue utilizado con
éxito para la purificación de la xilanasa B
xynB
mediante cromatografía de alta resolución
(1 kb)
Amp R (FPLC). Dicha purificación fue realizada por
pET3b-X20 NdeI el grupo de Estructura y Función de Enzimas
T7Pro del Dr. Julio Polaina, del Departamento de
5,6 kb
Biotecnología de los Alimentos, en el Instituto
de Agroquímica y Tecnología de Alimentos
(IATA-CSIC, Valencia).
ORI

La proteína purificada fue cristalizada a


Figura IV.2.6: Plásmido pET3b-X20, resultante continuación por Pablo Isorna del grupo de
de clonar el gen xynB en pET3b.
Cristalografía Macromolecular y Biología
Los clones recombinantes obtenidos se Estructural de la Dra. Julia Sanz-Aparicio, en
seleccionaron por su actividad enzimática en el Instituto de Química-Física Rocasolano
placas de agar LB suplementado con (CSIC, Madrid).
xilano-RBB e IPTG.
Tabla IV.2.1: Actividad sobre pNPX de los clones
recombinantes con pET3b-X20 seleccionados.
Al ensayar la actividad sobre pNPX de
extractos de cultivos inducidos con IPTG de Actividad % Actividad
sobre pNPX respecto al
los diferentes clones seleccionados, todos ellos
(U/mg de clon con
conteniendo el plásmido pET3b-X20, se Clones proteína) pX60
observaron importantes diferencias entre ellos, E. coli
BL21(DE3)/ 0,504 4367,8
aunque en todos los casos la actividad fue pET3b-X20 2b
superior a la del clon original E. coli 5K/pX60 E. coli
(Tabla IV.2.1). BL21(DE3)/ 0,078 679,6
pET3b-X20 3b
Asimismo, se observó una reducción de la E. coli
actividad a lo largo de diferentes resiembras de BL21(DE3)/ 0,026 225,6
pET3b-X20 5b
los clones, lo que, juntamente con los
E. coli 5K/
resultados anteriores, parece indicar problemas 0,012 100,0
pX60
de estabilidad de la construcción pET3b-X20 E. coli
en la cepa E. coli BL21(DE3). BL21(DE3)/ 0,000 0,0
pET3b (C -)
119

B C
Figura IV.2.7: Imágenes de la estructura terciaria de XynB de Paenibacillus barcinonensis, obtenidas a
partir del análisis de difracción de rayos X de sus cristales (esquina superior izquierda). Las hélices α están
coloreadas en rojo, las hebras β en amarillo y los bucles en verde. Los 2 aminoácidos catalíticos están
coloreados en azul. Puede observarse tanto la representación de lazos (A y B), como la de superficie (C).

2.2.2. Resultados de cristalografía máximas diferencias se observan en el bucle


Tras la obtención de cristales de la proteína L7 (Figura IV.2.8), que une la lámina β7 con
XynB, se recogió el espectro de difracción de la hélice α7 del barril (aminoácidos S245-
rayos X y se resolvió la estructura T260). Este bucle es esencial en la
tridimensional de la enzima a una resolución
de 2 Å (Figura IV.2.7).
Esta estructura tridimensional resultó ser la
típica de xilanasas de la familia 10, el barril
(α/β)8, tal como se había observado
previamente en el modelo teórico obtenido por
homología (Figura IV.2.3). Las principales
diferencias entre dicho modelo teórico y la
estructura real de XynB se encontraban en los
bucles que conectan los extremos N-terminal
de las láminas β con las hélices α
(Figura IV.2.8), cosa coherente con el hecho Figura IV.2.8: Comparación entre la estructura
de que estas regiones son las más difíciles de tridimensional de XynB obtenida mediante
modelado por homología (en azul) y la obtenida a
modelar por homología, ya que son las que partir de los análisis de difracción de rayos X (en
amarillo). El bucle L7, que une β7 con α7 del
presentan mayor variabilidad secuencial. Las barril, está representado en negro en la estructura
experimental.
120

conformación del centro activo, siendo el en la hidrólisis del sustrato (E241 y E134), así
máximo responsable de la forma y como la de otros residuos aromáticos (W299,
especificidad del centro activo en los subsitios Y179 y F303) que ayudarían a posicionar
de la parte positiva. correctamente los anillos de xilosa del sustrato
en los diferentes subsitios para permitir la
Según la estructura tridimensional obtenida, hidrólisis del enlace glicosídico.
los dos aminoácidos catalíticos de la enzima También es importante señalar la presencia de
quedarían muy próximos entre ellos hacia el una cavidad a nivel del subsitio +2, que
interior del barril (α/β)8 (Figura IV.2.7.B) en permitiría acomodar sustituyentes laterales en
una hendidura de la superficie de la enzima la cadena de xilosas del sustrato (como por
(Figura IV.2.7.C). ejemplo metil glucurónico).
Esta cavidad viene determinada
Al observar con más detalle este surco o estructuralmente por el bucle L7, que contiene
hendidura catalítica, se distinguen claramente la secuencia consenso RTDL__PT presente en
los subsitios -2, -1, +1 y +2 de unión a las el grupo de xilanasas sin péptido señal
xilosas del sustrato, aunque también es homólogas a XynB. Los residuos R248, H249
probable la existencia de los subsitios -3, +3 y y E250 de este bucle son además los
+4 (Figura IV.2.9). principales responsables de la especificidad de
Destaca la presencia a nivel del subsitio -1 de los subsitios +2 y +3.
los 2 residuos de ácido glutámico implicados

Figura IV.2.9: Surco catalítico de XynB de Paenibacillus


A barcinonensis, en el que se ha modelado una cadena de xilosas,
hidrolizada a nivel del subsitio -1, y un posible anillo de
metil glucurónico en el O2 de la xilosa del subsitio +2. También se
han representado los residuos R248, H249 y E250 del bucle L7,
altamente variables y máximos responsables de la especificidad de
los subsitios +2 y +3 (A).
Ampliación de los subsitios -2, -1 y +1, y aminoácidos implicados
en el posicionamiento de las xilosas del sustrato para que los
residuos catalíticos E241 y E134 del subsitio -1 puedan llevar a
cabo la hidrólisis (abajo).

Subsitio -2 Subsitio -1 Subsitio +1


121

mutagénica que permitió obtener diferentes


2.3. Aumento de la variantes mutantes de dicho gen.
termorresistencia de XynB de
Paenibacillus barcinonensis A continuación, se mezclaron los diferentes

Con el fin de mejorar las características de la amplificados mutagenizados y se sometieron a

enzima XynB para facilitar su utilización en un proceso de DNA shuffling (recombinación

procesos biotecnológicos, y asimismo in vitro por PCR).

aumentar el conocimiento sobre la relación Este proceso consiste en fragmentar las

entre estructura y función de esta xilanasa, nos diferentes copias mutagenizadas de forma

planteamos aumentar su termorresistencia. aleatoria con DNAsa I y después volver a


recomponer el gen mediante una primera PCR
sin cebadores (PCR I), que permite la mezcla
2.3.1 Mutagénesis aleatoria aleatoria pero ordenada de los diferentes
Dados los problemas para obtener resultados fragmentos (con o sin mutaciones), y una
mediante mutagénesis dirigida, descritos en el segunda PCR (PCR II) utilizando los mismos
apartado 2.1.3 y los pocos conocimientos que cebadores utilizados en la PCR mutagénica
disponíamos sobre la relación estructura- inicial, que permite obtener la gran variedad de
función para XynB, se decidió recurrir a la copias mutantes del gen generadas durante el
mutagénesis aleatoria para generar una gran proceso.
variabilidad de copias mutantes del gen xynB
entre las que poder seleccionar después El ADN amplificado resultante se ligó al
aquellas que diesen lugar a enzimas con una vector pGEM-T (Promega), consistente en el
mayor termoestabilidad (estrategia conocida plásmido pGEM digerido con EcoRV
como evolución dirigida) (Kaur y Sharma, (extremos romos) al que se ha añadido una
2006). timina (T) en cada extremo 3' libre para
aumentar la eficacia de clonación de
Primeramente, a partir del plásmido pX60 y fragmentos de ADN provenientes de
utilizando los cebadores CL1 y CL3 amplificación con polimerasas que añaden una
(Figura IV.2.10), se realizó una PCR adenina en 3', como es el caso de la Taq
polimerasa que se utilizó en estos
Cebador Secuencia
experimentos.
CL1 AGCGGATAACAATTTCACACAGGA
El resultado de ligación se transformó en
CL3 CGCCAGGGTTTTCCCAGTCACGAC E. coli DH5α, y de entre los transformantes
Figura IV.2.10: Cebadores que flanquean el obtenidos se seleccionaron aquellos que
polylinker de pUC19, utilizados en la PCR para
expresaban una xilanasa funcional (aquellos
amplificar xynB y en la PCR II del DNA shuffling.
122

donde las mutaciones introducidas durante el continuación se realizó el proceso de


proceso mutagénico no habían inactivado la shuffling, clonación, transformación y
enzima). selección tal como se ha descrito previamente.
Para ello se hicieron réplicas de las placas que De esta manera, tras 3 ciclos de shuffling y
contenían los transformantes y, tras el selección, se obtuvieron un total de 48 nuevos
crecimiento de las colonias y la lisis mediante clones que contenían una xilanasa B funcional
cloroformo, se les aplicó una sobrecapa potencialmente mutada.
(overlay) de agarosa sólida que contenía
pNPX, seleccionándose aquellas colonias que Entre las dos aproximaciones de mutagénesis
daban lugar a un halo amarillo al cabo de aleatoria utilizadas se obtuvo un total de 83
pocos minutos, hecho que implicaba la posibles mutantes para xynB. Los clones
degradación del pNPX por la xilanasa provenientes de la primera aproximación
expresada. La actividad sobre pNPX de los mutagénica fueron numerados del 1 al 35, y
clones positivos era reevaluada nuevamente del 36 al 83 los clones provenientes de la
mediante la técnica del overlay, comparando segunda aproximación.
con un control + (E. coli DH5α/pX60) y un
control – (E. coli DH5α).
2.3.2 Selección de mutantes
termorresistentes
Al final del proceso, se obtuvieron muy pocos
clones que expresaran una xilanasa funcional, Para seleccionar aquellos clones que poseían

lo que obligó a realizar múltiples ciclos de variantes mutagenizadas del gen xynB que

shuffling y selección a partir de los dieran lugar a una xilanasa más

amplificados de la PCR mutagénica. termorresistente que la salvaje, se realizó en

De esta manera se obtuvieron un total de 35 primer lugar un escrutinio cualitativo.

clones que contenían una xilanasa B funcional,


y posiblemente mutada. En este primer paso de selección, varias
réplicas de las placas que contenían los 83

Para aumentar la cantidad de mutantes activos, clones obtenidos fueron sometidas a choques

se repitió el proceso mutagénico, pero esta vez térmicos de 45, 50, 60, 70 y 80 ºC, durante 15

se optó por sustituir la PCR mutagénica inicial y 30 min.

por una PCR de amplificación estándar Tras cada choque térmico, utilizando la técnica

utilizando una polimerasa Taq, hecho que del overlay con pNPX se comparaba la

reducía la tasa de mutación en este paso a la intensidad de color amarillo que se apreciaba

tasa de error típica de la polimerasa Taq para cada clon (relacionada con el grado de

(2x10-5 mutaciones por nucleótido y ciclo). A actividad residual de la xilanasa expresada)


123

Tabla IV.2.2: Intensidad relativa de coloración amarilla de los clones obtenidos por mutagénesis aleatoria,
tras choque térmico a diferentes temperaturas y revelado de la actividad usando overlays con pNPX.
45 ºC 50 ºC 60 ºC 70 ºC 80 ºC 45 ºC 50 ºC 60 ºC 70 ºC 80 ºC
Clon 15' 30' 15' 30' 15' 30' 15' 30' 15' 30' Media Clon 15' 30' 15' 30' 15' 30' 15' 30' 15' 30' Media
C+ 100 100 100 100 100 13 13 0 0 0 53 36 100 50 0 50 0 0 0 0 0 22
1 100 100 0 50 0 0 0 0 0 28 37 100 50 0 25 0 0 0 0 0 19
2 100 100 0 50 0 0 0 0 0 28 38 100 100 100 150 0 0 0 0 0 50
3 200 200 200 200 100 50 0 0 0 106 39 100 100 100 150 0 0 0 0 0 50
4 200 100 100 50 0 0 0 0 0 50 40 50 100 100 50 0 0 0 0 0 33
5 100 100 50 75 0 0 0 0 0 36 41 100 100 100 100 50 0 25 0 0 0 48
6 100 100 50 100 0 0 0 0 0 39 42 100 200 100 100 150 0 25 0 0 0 68
7 100 100 100 100 50 50 0 0 0 56 43 100 100 100 100 75 0 25 0 0 0 50
8 100 100 100 75 25 25 0 0 0 47 44 100 0 100 100 75 0 25 0 0 0 40
9 0 0 0 0 0 0 0 0 0 0 45 50 100 50 100 100 0 0 0 0 0 40
10 100 200 200 50 100 25 0 0 0 75 46 100 100 100 0 25 0 25 0 0 0 35
11 100 100 100 75 100 0 0 0 0 53 47 100 100 100 100 100 0 25 0 0 0 53
12 100 100 0 25 0 0 0 0 0 25 48 100 100 100 100 50 0 25 0 0 0 48
13 100 100 200 100 50 50 0 0 0 67 49 100 100 100 100 75 0 25 0 0 0 50
14 0 0 0 0 0 0 50 100 100 100 100 150 0 25 0 0 0 58
15 100 200 200 100 50 0 0 0 0 72 51 100 100 100 100 100 0 25 0 0 0 53
16 100 100 100 100 0 50 0 0 0 50 52 100 100 100 100 150 0 25 0 0 0 58
17 100 100 50 100 0 0 0 0 0 39 53 100 100 100 200 100 0 50 0 25 0 68
18 100 100 100 75 25 0 0 0 0 44 54 100 100 100 100 150 0 0 0 0 0 55
19 100 100 100 50 0 0 0 0 0 39 55 100 100 100 100 100 0 50 0 50 0 60
20 100 100 100 100 50 50 0 0 0 56 56 100 100 100 100 100 25 100 0 50 0 68
21 100 100 100 100 50 50 0 0 0 56 57 100 50 100 50 50 0 25 0 0 0 38
22 50 100 100 125 0 0 0 0 0 42 58 50 100 50 100 50 0 0 0 0 0 35
23 100 100 0 0 0 0 0 0 0 22 59 100 200 100 200 75 0 100 0 25 0 80
24 75 0 0 0 0 0 13 60 200 100 200 100 125 0 25 0 0 0 75
25 100 100 0 100 0 0 0 0 0 33 61 100 100 100 200 150 0 50 0 25 0 73
26 100 100 50 100 0 0 0 0 0 39 62 100 100 100 100 100 25 50 0 50 0 63
27 100 100 0 150 0 0 0 0 0 39 63 100 100 100 100 100 100 100 0 50 0 75
28 100 100 100 100 50 25 0 0 0 53 64 100 100 100 100 150 100 100 0 50 0 80
29 100 100 100 100 50 25 0 0 0 53 65 100 50 100 50 100 0 0 0 0 0 40
30 200 200 100 150 0 0 0 0 0 72 66 100 50 100 50 50 0 0 0 0 0 35
31 100 50 0 0 0 0 0 0 0 17 67 100 100 100 100 100 0 25 0 0 0 53
32 100 100 100 75 0 0 0 0 0 42 68 0 0 0 0 50 0 0 0 0 0 5
33 100 100 50 75 25 0 0 0 0 39 69 100 100 100 100 100 0 50 0 50 0 60
34 50 50 100 125 0 0 0 0 0 36 70 100 0 100 0 0 0 0 0 0 0 20
35 100 100 100 200 50 0 0 0 0 61 71 100 100 100 100 100 0 50 0 0 0 55
72 100 100 100 50 75 0 0 0 0 0 43
73 200 100 200 200 150 0 50 0 0 0 90
74 100 100 100 100 100 0 25 0 0 0 53
75 100 100 100 100 100 0 25 0 0 0 53
76 100 0 25 0 0 0 21
77 100 200 100 100 100 0 50 0 50 0 70
78 100 100 100 50 150 0 25 0 0 0 53
79 100 200 100 50 75 0 25 0 0 0 55
80 100 100 100 100 150 50 50 0 50 0 70
81 100 100 100 50 75 0 0 0 0 0 43
82 100 100 100 0 100 0 0 0 0 0 40
83 100 100 100 0 100 0 0 0 0 0 40
124

con la intensidad que se apreciaba en un incluyó una PCR mutagénica inicial


control + (E. coli DH5α/pX60) que no había (Tabla IV.2.2).
sido sometido a ningún choque térmico.
En función de la relación de intensidades de Una vez realizado el escrutinio cualitativo, se
coloración amarilla de cada clon, a cada procedió a verificar de manera cuantitativa la
temperatura y a los 2 tiempos de incubación termorresistencia de los clones seleccionados,
ensayados (Tabla IV.2.2), se seleccionaron los mediante ensayos de la actividad residual
siguientes clones para proseguir con su sobre pNPX de los extractos celulares crudos
estudio: de estos clones y de un control + (E. coli
– Por elevada termorresistencia: clones 53, DH5α/pX60), tras preincubaciones de dichos
55, 56, 59, 61, 62, 63, 64, 69, 77 y 80. extractos a 45 ºC durante 0, 10, 20 y 30 min.
– Por elevada actividad y termorresistencia: Las gráficas obtenidas al representar el
clones 3, 60 y 73. logaritmo neperiano del porcentaje de
– Por elevada actividad y moderada actividad residual en relación al tiempo de
termorresistencia: clon 30. preincubación (Figura IV.2.11) permitieron
– Por elevada actividad, aunque baja calcular las pendientes de las rectas de
termorresistencia: clones 4 y 15. inactivación o termorresistencia, las cuales se
utilizaron para seleccionar los clones mutantes
Tal como se puede observar, la mayoría de los que presentaban una variante de la xilanasa B
clones preseleccionados (13 de 17) provenían más termoestable que la xilanasa salvaje
del proceso de mutagénesis en el que no se (control +).

Control + Mutante 80

100 5,00
Ln(%Actividad máxima)

y = -0,0552x + 4,4345
%Actividad máxima

80 4,00

60 3,00
y = -0,0852x + 4,4968
40 2,00

20 1,00

0 0,00
0 10 20 30 0 10 20 30
Tiempo de incubación a 45ºC (min) Tiempo de incubación a 45ºC (min)

Figura IV.2.11: Ejemplo de la comparación entre la termoestabilidad de la xilanasa B de extractos crudos


de uno de los mutantes seleccionados (el 80) respecto a la del control +. Se muestran las rectas de regresión
obtenidas en cada gráfica para calcular la pendiente.
125

En estas gráficas, cuanto más cercano a 0 es el – Por su elevada termorresistencia: clones


valor de la pendiente mayor es la 55, 62, 63 y 64.
termoestabilidad de la enzima (Tabla IV.2.3). – Por su elevada termorresistencia y
actividad específica: clon 80.
Para comprobar también la elevada actividad
aparente de algunos de los clones
2.3.3 Secuenciación de los mutantes
seleccionados, se determinó la actividad
seleccionados y aislamiento de las
específica sobre pNPX de los extractos
mutaciones
celulares crudos de todos ellos (Tabla IV.2.3).
Con el fin de localizar aquellas mutaciones
Tabla IV.2.3: Pendientes de las rectas de que producían cambios en la secuencia
termorresistencia y actividad específica sobre aminoacídica de XynB que pudieran ser
pNPX de los clones seleccionados.
responsables del aumento de la
Actividad específica termoestabilidad o de la actividad específica
Clones Pendiente (U/mg)
de la enzima, se secuenció el gen xynB
3 -0,12 0,08
4 - - contenido en los plásmidos recombinantes de
15 -0,07 0,13 los diferentes clones mutantes.
30 -0,08 0,34
53 -0,09 0,64
55 -0,06 0,03 Para ello se diseñó una serie de 5 nuevos
56 -0,09 0,15
59 -0,10 0,27 cebadores solapantes que permitieran cubrir
60 -0,15 0,02 toda la pauta abierta de lectura de xynB así
61 -0,08 0,86
como la parte de la región 5' no codificante
62 -0,04 0,09
63 -0,04 0,05 (upstream) clonada en los plásmidos
64 -0,06 0,10 (Figura IV.2.12).
69 -0,11 0,02
73 -0,10 1,73
77 -0,08 0,04 Cebador Secuencia
80 -0,06 1,38 CL3 CGCCAGGGTTTTCCCAGTCACGAC
Control + -0,09 0,13
OG376 (FWXB1) CACACTCTGGTATGGC
OG377 (FWXB2) CACGGTCCTTCTATGG
OG378 (BKXB1) TCAAGGGCTGCATGC
En base a los resultados obtenidos respecto al OG379 (BKXB2) CATGAAGCTGTACATCC
OG380 (BKXB3) TCTCTCTGGAAGCCG
control +, se seleccionaron los siguientes 9
CL3 OG376 (FWXB1) OG377 (FWXB2)
clones mutantes:
xynB ORF

– Por su elevada actividad específica: clones 1 100 200 300 400 500 600 700 800 900 1000 1100 1200

OG380 (BKXB3) OG379 (BKXB2) OG378 (BKXB1)


30, 53, 61 y 73.
Figura IV.2.12: Cebadores utilizados en la
secuenciación de xynB y sus variantes mutantes.
126

Una vez obtenidas las secuencias completas de mutante 80, termoestable y de elevada
los genes xynB de los mutantes 30, 55, 61, 62, actividad.
63, 64 y 80 (los correspondientes a los
mutantes 53 y 73 no se pudieron secuenciar), El siguiente paso fue el aislamiento de estas
éstas fueron comparadas con la secuencia del mutaciones de otras posibles mutaciones
gen xynB salvaje en busca de mutaciones en la presentes en regiones reguladoras o en el
región codificante del gen. Los resultados se vector de los mutantes obtenidos, para poder
resumen en la Tabla IV.2.4. así estudiar el efecto independiente de cada
una de ellas sobre la termoestabilidad de la
Tabla IV.2.4: Mutaciones en la secuencia de xynB
de los clones mutantes seleccionados. xilanasa B.

Cambio Cambio Primero, a partir del plásmido pX60 se


Mutante nucleotídico aminoacídico
30 2 mutaciones no codificantes amplificó el gen xynB salvaje usando los
A411T E137D cebadores CL1 y CL3 (Figura IV.2.10) y la
C618T G206
polimerasa Pfu, para evitar introducir nuevas
C681A I227
C909T F303 mutaciones.
G967A D323N
A continuación, el resultado de amplificación
53 -
55 T592C L198 fue purificado y adenilado en sus extremos 3'
61 1 mutación no codificante para simular una amplificación con Taq
62 T36C Y12
63 2 mutaciones no codificantes polimerasa y así poder clonarlo en el plásmido
C44T S15L pGEM-T easy (pGEM-Te), obteniéndose, tras
64 2 mutaciones no codificantes
C44T S15L su transformación en E. coli, la cepa
73 - recombinante E. coli DH5α/pGEM-Te-X20.
80 A277G M93V
Esta cepa fue verificada en cuanto a su
actividad, mediante ensayos enzimáticos, y el
Tal como se puede observar, el conjunto de
gen xynB fue secuenciado, para asegurar que
mutantes secuenciados contenía únicamente 4
no existía ninguna diferencia respecto a la
mutaciones que producían sustituciones
xilanasa B original.
aminoacídicas, que fueron seleccionadas para
su estudio: E137D y D323N presentes en el
Las 4 mutaciones seleccionadas fueron
mutante 30, de elevada actividad; S15L
introducidas en el plásmido pGEM-Te-X20
presente en los mutantes termoestables 63 y 64
mediante mutagénesis dirigida, utilizando la
(que resultaron ser idénticos a nivel de
técnica de amplificación por PCR divergente
secuencia de xynB); y M93V presente en el
en un solo paso y 4 parejas de cebadores que
127

permitían la introducción de las mutaciones pGEM-Te-X20S15L y pGEM-Te-X20M93V)


(Figura IV.2.13). fueron transformados en E. coli DH5α,
obteniéndose así 4 clones que presentaban,
Cebador Secuencia Mut.
cada uno, una de las 4 mutaciones
FWE137D ATCTGATTATGCGTGATACAAAATG -
anteriormente seleccionadas. La introducción
BKE137D CCGTCTTGTCATCAATCGCC T → A
FWD323N CTTCTGGCGTATTATCGGGC - correcta de dichas mutaciones fue comprobada
BKD323N GAATTCTTGGGCTGAAGCTCTG C → T por secuenciación.
FWS15L AAAATAGGTGCGGCAGTGC -

BKS15L GAACAAATTGGCATAAGATGCAG G → A
FWM93V AAGATGCTTCCGGGGGAACG -
2.3.4 Purificación de las xilanasas
BKM93V CAAACACCCAAGCCGGCGTC T → C
mutantes
Figura IV.2.13: Cebadores utilizados para la
mutagénesis dirigida de xynB. A partir de los cuatro clones con las
mutaciones simples introducidas en xynB y del
Los plásmidos mutagenizados obtenidos tras
clon con el gen xynB salvaje (E. coli
amplificación y religación (pGEM-Te-
DH5α/pGEM-Te-X20), se hicieron cultivos en
X20E137D, pGEM-Te-X20D323N,
2 litros de medio LB con ampicilina

(1) Gel Filtración


mAU mS/cm

2500
30.0
SDS-PAGE
2000
25.0
kDa
1500
20.0
200 -

1000
116 -
15.0 97 -
500 66 -
10.0

0
0 50 100 150 ml
45 -

(2) Intercambio Iónico


mAU mS/cm
31 -

80.0
2000

70.0
21 -
1500 60.0

50.0

1000 40.0

30.0 0 1 2
500
20.0

10.0
0
0.0 5.0 10.0 15.0 20.0 25.0 30.0 35.0 ml

Figura IV.2.14: Cromatogramas (izquierda) y SDS-PAGE (derecha) de los resultados de purificación de la


xilanasa XynB salvaje mediante gel filtración (1) e intercambio iónico (2), a partir de extractos celulares
concentrados precipitados con sulfato amónico (0). En los cromatogramas, se muestra la absorbancia a
280 nm en azul y la conductividad en marrón.
128

100 μg/ml, de los que se obtuvieron los (Tabla IV.2.5) y se analizaron las distintas
extractos celulares correspondientes por fracciones mediante SDS-PAGE
French Press. (Figura IV.2.15) para comprobar el grado de
Los extractos celulares fueron clarificados, purificación obtenido para las diferentes
precipitados con sulfato amónico y enzimas.
concentrados para someterlos a continuación a
kDa
un proceso de purificación mediante
116 -
cromatografía en columna de 2 etapas 97 -
66 -
(Figura IV.2.14):
45 -
– Una primera etapa de gel filtración que
permitía eliminar la mayoría de proteínas 31 -

diferentes a XynB, especialmente aquellas


21 -
de peso molecular elevado.
– Una segunda etapa de intercambio 0 1 2 3 4 5

aniónico que permitía obtener la proteína Figura IV.2.15: Análisis por SDS-PAGE de las
XynB con un alto grado de pureza. xilanasas purificadas: (1) XynB salvaje, (2) XynB
E137D, (3) XynB D323N, (4) XynB S15L, (5)
XynB M93V. (0) Extractos celulares precipitados
con sulfato amónico de E. coli DH5α/pGEM-Te-
En algunos casos, para eliminar totalmente X20.
algunas proteínas de bajo peso molecular que
coeluían con XynB en el segundo paso de
intercambio aniónico, fue necesario recurrir a 2.3.5 Termoestabilidad de las xilanasas
una última etapa de purificación, en la que se mutantes
utilizaba una segunda columna de gel Para analizar la termoestabilidad de las
filtración de menor diámetro de poro y mayor xilanasas purificadas, se ensayó la actividad
resolución que la usada en la primera etapa. enzimática residual sobre pNPX tanto de las
variantes mutantes de XynB como de la
Durante todos las etapas de purificación se xilanasa salvaje, tras diferentes tiempos de
determinó la actividad específica preincubación a 45 ºC y a 50 ºC.

Tabla IV.2.5: Actividad específica (U/mg de proteína) de XynB salvaje y las variantes mutantes a lo largo
de las diferentes etapas del proceso de purificación.

XynB salvaje XynB E137D XynB D323N XynB S15L XynB M93V
Extracto precipitado 0,089 0,002 0,142 0,134 0,298
Gel filtración 1 0,660 0,101 2,007 0,520 1,204
Intercambio aniónico 0,687 0,292 2,395 1,090 1,476
Gel filtración 2 2,776 1,314
129

En los ensayos a 45 ºC, la gráfica obtenida al 50 ºC de la enzima con la mutación M93V fue
representar el logaritmo neperiano del más de 3 veces superior a la de la xilanasa
porcentaje de actividad residual en relación al salvaje, mientras que la xilanasa mutante S15L
tiempo de preincubación, mostró como las presentó a 50 ºC una vida media 5 veces
xilanasas mutantes presentaban una mayor superior a la de la enzima salvaje.
termorresistencia que la enzima salvaje,
destacando especialmente las variantes que
2.3.6 Obtención de dobles mutantes
presentaban las mutaciones M93V y S15L
(Figura IV.2.16). Tras los resultados obtenidos, se propuso
incrementar la termorresistencia de la
5,00
xilanasa B combinando las diferentes
4,00 mutaciones entre sí. Para ello se crearon 2
ln (% Actividad)

3,00
xilanasas dobles mutantes:
XynB (wt)
– Una que contenía simultáneamente las
2,00 M93V
S15L mutaciones E137D y D323N, provenientes
1,00 E137D
D323N
0,00
0 5 10 15 20 25 30 5,00

Tiempo de incubación a 45 ºC (min)


4,00
ln (% Actividad)

Figura IV.2.16: Gráfica de termoestabilidad a 3,00


45 ºC de la xilanasa B salvaje y 4 de sus variantes
mutantes. 2,00
XynB (wt)
1,00
M93V
Al repetir el ensayo de termoestabilidad con S15L
estas dos últimas xilanasas, esta vez 0,00
0 4 8 12 16
preincubando a 50 ºC, se observó como las
Tiempo de incubación a 50 ºC (min)
diferencias de termoestabilidad respecto a la
enzima salvaje se hacían aún más apreciables Figura IV.2.17: Gráfica de termoestabilidad a
50 ºC de la xilanasa B salvaje y las xilanasas
(Figura IV.2.17). mutantes XynB M93V y XynB S15L.
Estos resultados se observan mejor al calcular Tabla IV.2.6: Vida media, en minutos, de XynB y
la vida media, en minutos, de estas enzimas las xilanasas mutantes.

(Tabla IV.2.6). 45 ºC 50 ºC
XynB (wt) 9,1 1,8
Se observó así que a 45 ºC todas las xilanasas XynB E137D 14,1 -
mutantes presentaban una vida media superior XynB D323N 11,2 -
a la xilanasa salvaje, hecho que se hizo más XynB S15L 17,6 9,1

patente a 50 ºC. En concreto, la vida media a XynB M93V 35,8 7,1


130

las dos del mismo clon mutante original y otro de 1723 bp sin mutaciones; mientras
(clon 30). que a partir de pGEM-Te-X20M93V el
– Una segunda xilanasa doble mutante con fragmento resultante de 3082 bp no contenía
las 2 mutaciones que conferían mutaciones y era el fragmento de 1723 bp el
individualmente mayor termorresistencia, que contenía la mutación M93V.
M93V y S15L. La ligación de los 2 fragmentos que contenían
las mutaciones (el de 3082 bp con la mutación
Para obtener la doble mutante E137D/D323N, S15L y el de 1723 bp con la mutación M93V),
se partió del plásmido pGEM-Te-X20D323N, dio lugar al plásmido pGEM-Te-
sobre el cual se introdujo la mutación E137D X20S15L+M93V (Figura IV.2.18).
mediante mutagénesis dirigida, utilizando la NaeI lacZ NaeI lacZ

técnica de amplificación por PCR divergente f1 ORI xynBS15L f1 ORI xynBM93V

M93V
en un sólo paso y los cebadores FWE137D y pGEM-Te-X20S15L
NaeI
pGEM-Te-X20M93V
4,8 Kb 4,8 Kb NaeI
S15L
BKE137D ya utilizados previamente para AmpR AmpR
SpeI SpeI

introducir las mutaciones simples


(Figura IV.2.13).
NaeI NaeI lacZ

f1 ORI

Para obtener la doble mutante S15L/M93V se 3,1 Kb


M93V

NaeI 1,7 Kb NaeI


aplicó la metodología anterior (mutagénesis AmpR
S15L

SpeI
dirigida por PCR divergente en un sólo paso),
tanto para introducir la mutación S15L en el
plásmido pGEM-Te-X20M93V, como a la lacZ
NaeI

inversa, para introducir la mutación M93V en f1 ORI xynBS15L+M93V

pGEM-Te-X20S15L; pero no se obtuvieron 4,8 Kb


M93V

NaeI

resultados positivos. Amp R


S15L

SpeI

pGEM-Te-X20S15L+M93V
La alternativa que se utilizó finalmente fue
dividir en dos fragmentos tanto el plásmido Figura IV.2.18: Obtención del plásmido
pGEM-Te-X20S15L+M93V por restricción y
pGEM-Te-X20S15L como el pGEM-Te- ligación.
X20M93V utilizando la enzima de restricción
Los dos nuevos plásmidos construidos,
NaeI, que posee una diana en el gen xynB
pGEM-Te-X20E137D+D323N y pGEM-Te-
localizada entre las mutaciones S15L y M93V,
X20S15L+M93V, fueron transformados en
y otra diana en el vector pGEM-Te. En el caso
E. coli, dando lugar a los clones E. coli
de pGEM-Te-X20S15L se generó un
fragmento de 3082 bp, con la mutación S15L,
131

DH5α/pGEM-Te-X20E137D+D323N y evidenciaron el grado de pureza de las enzimas


E. coli DH5α/pGEM-Te-X20S15L+M93V. obtenidas.
La correcta introducción de las 2 mutaciones
en cada uno de los clones construidos fue Para determinar la termoestabilidad de estas
comprobada mediante secuenciación. nuevas xilanasas purificadas, se ensayó su
actividad enzimática residual sobre pNPX tras
diferentes tiempos de preincubación a 50 ºC.
2.3.7 Purificación y ensayos de
Los resultados de termoestabilidad obtenidos
termoestabilidad de las xilanasas
mostraron claramente como la xilanasa doble
dobles mutantes
mutante S15L/M93V presentaba una
A partir de los clones E. coli DH5α/pGEM-Te- termorresistencia muy superior a la de la
X20E137D+D323N y E. coli enzima salvaje, mientras que la doble mutante
DH5α/pGEM-Te-X20S15L+M93V se E137D/D323N no mostró grandes diferencias
procedió a purificar las xilanasas dobles respecto a la termoestabilidad de la xilanasa
mutantes utilizando la misma metodología salvaje (Figura IV.2.20).
descrita en el apartado 2.3.4.
5,00
La determinación de la actividad específica a
lo largo de las etapas de purificación y el 4,00
ln (% Actividad)

análisis por SDS-PAGE (Figura IV.2.19), 3,00


XynB (wt)
2,00 M93V
S15L
1,00 S15L/M93V
kDa
E137D/D323N
0,00
116 -
97 - 0 4 8 12 16

66 - Tiempo de incubación a 50 ºC (min)

45 - Figura IV.2.20: Gráfica de termoestabilidad a


50 ºC de la xilanasa B salvaje, las dobles mutantes
S15L/M93V y E137D/D323N, y las mutantes
simples M93V y S15L.
31 -

La comparación de la termoestabilidad de la
21 - doble mutante S15L/M93V con la de las
xilanasas mutantes simples de las que deriva,
0 1 2 3
mostró que la doble mutante presentaba una
Figura IV.2.19: Análisis por SDS-PAGE de las termorresistencia notablemente aumentada
xilanasas dobles mutantes purificadas. (1) XynB
salvaje, (2) XynB E137D+ D323N, (3) XynB (Figura IV.2.20).
S15L+M93V, (0) extractos celulares precipitados
con sulfato amónico de E. coli DH5α/pGEM-Te-
X20.
132

La vida media de la doble mutante 2.3.8 Efectos de las mutaciones sobre


S15L/M93V resultó muy superior a la vida la estructura de XynB
media de las mutantes simples S15L y M93V Con el fin de averiguar si las diferentes
originales (Tabla IV.2.7), observándose un mutaciones encontradas podían producir
efecto sinérgico de estas dos mutaciones, lo cambios en la estructura tridimensional de la
cual confería a la doble mutante S15L/M93V enzima, se localizó la situación dichas
una vida media a 50 ºC aproximadamente 20 mutaciones en la estructura tridimensional de
veces superior a la de la xilanasa salvaje. la xilanasa salvaje.
Tal como se puede observar en la
Tabla IV.2.7: Vida media en minutos de XynB y
las mutantes simples y dobles analizadas. Figura IV.2.21, todas las mutaciones se
encontraban en regiones superficiales del
plegamiento, relativamente alejadas del centro
50 ºC
XynB (wt) 1,8 activo. Esta localización periférica hacía
XynB E137D/D323N 2,2 suponer la ausencia de cambios importantes en
XynB S15L 9,1
la estructura tridimensional y en la función.
XynB M93V 7,1
XynB S15L/M93V 37,7
Para comprobar si estas mutaciones producían
o no cambios significativos en la estructura
secundaria de la enzima que permitieran

E137D

E134

M 93V

E241

S15L
D323N

Figura IV.2.21: Localización de las mutaciones (en azul) y los residuos catalíticos (en rojo) en la estructura
tridimensional de la xilanasa B.
133

XynB (wt) 30 ºC
0 XynB (wt) 40 ºC
XynB (wt) 50 ºC
CD (mgrados)

XynB (wt) 60 ºC

XynB S15L/M93V 30 ºC
XynB S15L/M93V 40 ºC
-5 XynB S15L/M93V 50 ºC
XynB S15L/M93V 60 ºC

-8
200 220 240 260
Longitud de onda (nm)

Figura IV.2.22: Gráfica de dicroísmo circular de XynB salvaje y la doble mutante S15L/M93V a 30, 40, 50
y 60 ºC de temperatura.

explicar el aumento de termorresistencia, se xilanasa B salvaje, de las dos mutantes simples


hicieron análisis por dicroísmo circular a más termoestables (mutaciones S15L y M93V)
diferentes temperaturas de la xilanasa B y de las dos dobles mutantes, sobre
salvaje y de la doble mutante S15L/M93V, por concentraciones crecientes de pNPX
ser esta la más termoestable de entre las (Figura IV.2.23).
mutantes.

3,2
Los resultados obtenidos (Figura IV.2.22), no
Velocidad (U/ml)

2,6
mostraron variaciones significativas alrededor
de los 220 nm que permitieran inferir posibles 2,0

diferencias en la estructura secundaria. Se 1,4

observaron, sin embargo, ligeras diferencias en


0,8
la desviación de la luz entre los 228 y los
0,2
240 nm. 0 2 4 6 8 10
Concentración pNPX (mM)

XynB (wt) E137D/D323N


2.3.9 Estudio de las constantes M93V M93V/S15L
S15L
cinéticas de XynB y de las xilanasas
Figura IV.2.23: Gráfica de las cinéticas
mutantes enzimáticas de la xilanasa B salvaje y las xilanasas
mutantes.
Se determinaron a continuación los valores de
las constantes cinéticas VMáx y KM sobre
pNPX, evaluando para ello la actividad de la
134

Tabla IV.2.8: Parámetros cinéticos de XynB y las xilanasas mutantes.


VMáx KM [E]Total KCAT KCAT/KM
(U/ml) (mM) (μmol/ml) (ms-1) (ms-1mM-1)
XynB (wt) 1,451 2,384 186,193 0,130 0,054
XynB S15L 0,877 1,820 12,652 1,155 0,635
XynB M93V 3,395 1,712 48,077 1,177 0,688
XynB E137D/D323N 2,938 2,495 30,491 1,606 0,644
XynB S15L/M93V 3,260 1,497 59,464 0,914 0,610

El cálculo de las constantes cinéticas a partir


de las gráficas (Tabla IV.2.8), no mostró
grandes diferencias respecto a la xilanasa
salvaje en cuanto a la afinidad (1/KM) aunque
sí que se apreciaba un ligero aumento de ésta
en el caso de las mutantes más
termorresistentes.
Por el contrario los valores de velocidad
máxima (VMáx) mostraban una alta
variabilidad, pero al corregir por la
concentración total de enzima ([E]Total), la
constante catalítica (KCAT) resultante fue muy
similar entre todas las xilanasas mutantes, que
presentaron valores muy superiores a los de la
xilanasa B salvaje.

Resultados similares se obtuvieron al calcular


la eficacia catalítica (KCAT/KM). Todas las
xilanasas mutantes presentaron valores
similares de eficiencia catalítica, que fueron a
su vez muy superiores a la eficiencia catalítica
de la xilanasa B salvaje.
ANEXO I.
APLICACIÓN DE LAS XILANASAS ESTUDIADAS

EN EL BLANQUEO DE LA PASTA DE PAPEL


137

ensayos papeleros posteriores, y su


1. - INTRODUCCIÓN Y OBJETIVOS suministro al grupo de Ingeniería Papelera
Tal como se ha comentado con anterioridad en de la UPC para su evaluación en el
este trabajo, una de las principales blanqueo de pastas kraft de Eucalyptus
aplicaciones industriales de las xilanasas hoy globulus.
día se da en la industria papelera. El
tratamiento con xilanasas de la pasta de papel,
previo al blanqueo químico, hace mucho más
2. - RESULTADOS Y DISCUSIÓN
eficiente el proceso de blanqueo, lo que reduce
las necesidades de blanqueantes clorados para 2.1. Producción en fermentador
obtener el mismo grado de blancura y calidad de las xilanasas a evaluar
en la pasta de papel, generándose como A partir de las cepas E. coli/pXA30 (ver
consecuencia una menor cantidad de residuos capítulo I de Resultados), E. coli DH5α/
organoclorados, de elevada toxicidad pMSR8SPO2-ynfF (ver capítulo II de
ambiental (Bajpai, 2004). Resultados) y E. coli 5K/pX20 (Blanco et al.,
Por este motivo se decidió probar la idoneidad 1996) se prepararon cultivos de 500 ml, en
o no de los enzimas estudiados en este trabajo medio LB suplementado con ampicilina
para potenciar el blanqueo de la pasta de 100 μg/ml, que se incubaron a 37 ºC toda la
papel. noche.
Los ensayos papeleros fueron realizados por 10 ml de cada uno de estos cultivos fue
Cristina Valls, del grupo de Ingeniería utilizado para verificar la actividad xilanasa,
Papelera de la Universitat Politècnica de mediante el ensayo enzimático sobre xilano de
Catalunya (UPC), bajo la dirección de la madera de abedul. Una vez comprobada esta
Doctora Mª Blanca Roncero. actividad, el resto de los cultivos iniciales
(490 ml) se utilizó como inóculo de cultivos en
En base a esto, los objetivos de este apartado 50 l de medio LB preparado y esterilizado en
fueron: el fermentador B. Braun Biotech - Sartorius
- La producción de las xilanasas XynA del servicio de fermentación de la Universitat
(familia 11) e YnfF (familia 5) de de Barcelona; medio que se suplementó con
Bacillus sp. BP-7, y XynB (familia 10) de ampicilina 100 μg/ml esterilizada por filtración
Paenibacillus barcinonensis, en cantidad antes de ser inoculado.
suficiente para su ensayo en laboratorio Tras incubaciones de 15 h a 37 ºC, se
papelero. recogieron las células por centrifugación en
- La cuantificación de la actividad xilanasa una centrífuga clarificadora Westfalia CSA
producida, en las condiciones de los 1-06-475 (con tambor de platos y esterilizable
138

por vapor) del servicio de fermentación. Las La actividad xilanasa obtenida para cada
células obtenidas fueron concentradas enzima, junto a las condiciones de ensayo, se
adicionalmente por centrifugación en una detallan en la Tabla AN1.2.1.
centrífuga Beckman high-speed, se
resuspendieron en 100 ml de tampón Tris-HCl Las muestras de xilanasas fueron alicuotadas
100 mM pH 7, se sometieron a lisis mediante en tubos de 10 ml, se congelaron a -20 ºC y se
French Press, y a continuación se enviaron en frío al grupo de Ingeniería
centrifugaron los lisados obtenidos para Papelera de la UPC, donde se realizaron los
recuperar los sobrenadantes, que contenían las ensayos papeleros.
enzimas.

2.3. Ensayos papeleros


2.2. Determinaciones de actividad
2.3.1. Características de las pastas
enzimática
papeleras
Una vez obtenidos los extractos celulares
La materia prima que se utilizó para los
concentrados, se ensayó la actividad xilanasa
ensayos fue pasta kraft de Eucalyptus globulus
de los mismos mediante ensayo enzimático
(pasta de maderas duras, ricas en xilano),
sobre xilano de madera de abedul en las
previamente deslignificada con oxígeno.
condiciones de pH y temperatura adecuadas en
Se emplearon dos tipos de pastas de eucalipto,
cada caso para su aplicación en las pastas
ambas de procedencia industrial y producidas
papeleras.
por la empresa Torraspapel S.A.:
Generalmente estas condiciones no eran las
– Pasta 1: pasta tal cual era proporcionada
óptimas para las xilanasas, pero sí eran
por Torraspapel S.A., sin lavar
aquellas que permitían que las enzimas
posteriormente en el laboratorio. Esta pasta
mantuvieran un alto porcentaje de actividad
contenía gran cantidad de xilooligómeros,
durante las 2 h de duración de los tratamientos
hecho que suele dificultar el análisis del
enzimáticos de las pastas, manteniendo bajos
efecto de las xilanasas sobre ellas.
los niveles de inactivación.

Tabla AN1.2.1: Condiciones de ensayo y actividad de las xilanasas obtenidas por fermentación.

Actividad
Xilanasa Clon Temperatura pH (U/ml extracto)
XynA de Bacillus sp. BP-7 E. coli/PXA30 50 ºC 7 46,5
E. coli DH5α/
YnfF de Bacillus sp. BP-7 60 ºC 7 91,8
pMSR8SPO2-ynfF
XynB de Paenibacillus barcinonensis E. coli 5K/pX20 40 ºC 8 30,2
139

– Pasta 2: pasta lavada en el laboratorio con – Fase D: blanqueo con dióxido de cloro
tampón Tris-HCl pH 7 durante 30 min a (equivalente a 3% de Cl2 activo).
temperatura ambiente. Este lavado – Fase P: blanqueo con peróxido de
permitía eliminar los xilooligómeros. hidrógeno (1,5% de NaOH, 3% de H2O2).

Tabla AN1.2.3: Condiciones de aplicación de las


Las características iniciales de estas pastas se xilanasas en la fase X de la secuencia XDP.
resumen en la Tabla AN1.2.2:
Dosis Temp. Tiempo
Tabla AN1.2.2: Características iniciales de las Enzima (U/gps) (ºC) pH Tampón (h)
pastas papeleras utilizadas. C- 0 40 - 60
YnfF 60 7 Tris-HCl
2
Pasta 1 Pasta 2 XynA 2 50 50 mM
Índice kappa 9,2 8,0 XynB 40 8
Blancura (%ISO) 50,2 51,1
Viscosidad (ml/g) 958±24 972±20
Las xilanasas XynA e YnfF de Bacillus sp.
El índice kappa es una medida de la cantidad
BP-7 se evaluaron sobre pasta 1, y la xilanasa
de lignina, responsable del color marrón de la
XynB de Paenibacillus barcinonensis sobre
pasta de papel. Se determinó según la norma
pasta 2.
ISO 302.
El porcentaje de blancura ISO es una medida
Los resultados obtenidos en el índice kappa
del grado de blanco de un papel, expresado
(Ik) y el porcentaje de blancura ISO
como porcentaje respecto a un blanco
(Bl % ISO), determinados al final de la
normalizado (el del óxido de magnesio =
secuencia de blanqueo, se resumen en la
100%). Se determinó según la norma
Tabla AN1.2.4:
ISO 5351/1.
Tabla AN1.2.4: Resultados finales de la secuencia
de blanqueo XDP.

2.3.2. Secuencia de blanqueo XDP


Pasta Ik Bl (% ISO)
Para la evaluación del efecto de las xilanasas C- 2,6 89,2
sobre las pastas papeleras se utilizó en primer YnfF 1 2,2 90,6
lugar una secuencia parcial de blanqueo ECF XynA 2,0 90,2
C- 2,5 89,4
(elemental chlorine free). 2
XynB 2,4 89,4
En concreto se utilizó una secuencia XDP, que
consta de 3 etapas: Tal como se puede observar los tratamientos
– Fase X: pretratamiento enzimático con con XynA e YnfF permitieron obtener un
xilanasa (Tabla AN1.2.3). aumento de 1 - 1,4% en la blancura final
140

respecto al control –, y una reducción de Las dos enzimas seleccionadas y el control se


0,4 - 0,6 puntos en el índice kappa evaluaron sobre pasta 2.
(relacionado con la cantidad de lignina Los resultados que se obtuvieron para el índice
residual). Por el contrario, la aplicación de la kappa y el porcentaje de blancura ISO tras el
xilanasa XynB no produjo mejoras apreciables tratamiento enzimático y al final de la
en las propiedades del papel. secuencia de blanqueo se resumen en la
Tabla AN1.2.6:

2.3.3. Secuencia de blanqueo XDEOPD1 Tabla AN1.2.6: Resultados tras el tratamiento


enzimático (fase X) y al final de la secuencia
A partir de los resultados con la secuencia completa de blanqueo XDEOPD1.
XDP se seleccionaron las xilanasas XynA e
X XDEOPD1
YnfF de Bacillus sp. BP-7 para proceder a la
Ik Bl(% ISO) Ik Bl(% ISO)
realización de una secuencia completa de
C - 7,9 51,8 0,8 89,3
blanqueo ECF. Se utilizó la secuencia YnfF 7,8 52,3 0,7 89,4
XDEOPD1, que consta de 4 etapas: XynA 7,9 54,5 0,5 90,4
– Fase X: pretratamiento enzimático con
Se observó que, por un lado, a pesar de que el
xilanasa (Tabla AN1.2.5). Se aumentaron
índice kappa es inferior al del control en
las dosis de enzimas respecto a la
ambos tratamientos enzimáticos, las
secuencia XDP para acentuar los efectos
diferencias son en general pequeñas (menores
de éstas.
o iguales a 0,3 puntos).
– Fase D: blanqueo con dióxido de cloro
En cuanto a la blancura final de las pastas,
(equivalente a 3% de Cl2 activo).
mientras la xilanasa A causó un incremento de
– Fase EOP: extracción alcalina con oxígeno
ésta en 1,1%, YnfF causó un aumento de
y peróxido de hidrógeno (1,1% de NaOH,
blancura del 0,1%, muy discreto respecto al
0,3% de H2O2).
control sin enzima.
– Fase D1: nueva fase de blanqueo con
Sin embargo, la determinación de la blancura
dióxido de cloro, pero en menor cantidad
tras las distintas etapas de blanqueo mostraba
(equivalente a 1,25% de Cl2 activo).
que a medida que se avanzaba en la secuencia
Tabla AN1.2.5: Condiciones de aplicación de las de blanqueo, las diferencias de blancura
xilanasas en la fase X de la secuencia XDEOPD1.
respecto al control se reducían (datos no

Dosis Temp. Tiempo mostrados). Esto podía ser debido a que las
Enzima (U/gps) (ºC) pH Tampón (h) elevadas dosis de blanqueantes químicos
C- 0
YnfF 50 7
Tris-HCl
2
empleadas permiten por sí solas que se
3 50 mM
XynA
141

alcancen valores de blancura muy elevados, y estudiadas en nuevas secuencias ECF y en


por tanto muy difíciles de mejorar. secuencias TCF (total chlorine free), así como
Estos resultados indican que la aplicación de su contribución a la disminución de la dosis de
estas enzimas, al menos en el caso de la blanqueantes (especialmente derivados
xilanasa A, permitirían reducir los niveles de clorados) y la consecuente reducción en la
blanqueantes químicos a utilizar generación de AOX (Compuestos Orgánicos
(especialmente el dióxido de cloro) para Halogenados), altamente contaminantes.
obtener una blancura determinada;
consiguiéndose así una reducción de los
residuos tóxicos generados durante el proceso.

También se hicieron ensayos de la cantidad de


ácidos hexenurónicos (HexA) presentes en las
pastas tratadas con xilanasas. Estos HexA se
generan durante el proceso de cocción kraft a
partir de los grupos de ácido
4-O-metil-α-D-glucurónico presentes en los
xilanos y son responsables en gran medida del
envejecimiento o amarilleamiento del papel
(Buchert et al., 1997).
Los resultados obtenidos hasta el momento
indican que la aplicación tanto de YnfF como
de XynA de Bacillus sp. BP-7 reducen las
cantidades de HexA en las pastas.

El conjunto de resultados papeleros obtenidos


muestran, por una parte la diferente
efectividad de las xilanasas bacterianas para su
aplicación en el blanqueo de pastas de papel, y
por otra parte han permitido identificar dos
nuevas xilanasas potenciadoras del blanqueo
de pastas kraft de eucalipto.
En el momento actual se están llevando a cabo
nuevos ensayos para cuantificar la efectividad
potenciadora del blanqueo de las enzimas
DISCUSIÓN
145

máxima actividad sobre xilano de madera de


1. XILANASAS DE BACILLUS SP. haya, además de presentar actividad sobre
BP-7 otros glucuronoxilanos y arabinoxilanos,
observándose una actividad decreciente a
Con el objetivo de clonar e identificar nuevos
medida que aumenta el grado de sustitución de
genes de xilanasas se construyó una genoteca
los xilanos. No se detectó actividad de XynA
de Bacillus sp. BP-7. Esta cepa había sido
sobre celulosas (CMC o Avicel), y su
aislada y caracterizada bioquímicamente en el
actividad sobre polisacáridos diferentes del
grupo de investigación (López et al., 1998), y
xilano y sobre los aril-glicósidos ensayados
fue escogida por presentar una elevada
fue muy baja.
actividad xilanasa.
A partir de la genoteca construida se aislaron
El peso molecular teórico de la xilanasa A de
seis clones capaces de degradar xilano. Cuatro
Bacillus sp. BP-7 es de 23,5 kDa, lo cual
de estos clones poseían alta actividad y
concuerda con el peso molecular aparente en
codificaban la misma xilanasa, que se
los zimogramas de extractos de la cepa
denominó xilanasa A (XynA). Los otros dos
recombinante E. coli/pXA30 (23-24 kDa).
clones eran idénticos y poseían menor
Esta enzima debe corresponder a la xilanasa
actividad. El inserto de los mismos incluía 2
mayoritaria de Bacillus sp. BP-7, previamente
pautas abiertas de lectura que codificaban
identificada en los análisis electroforéticos de
proteínas homólogas a xilanasas, las cuales se
sobrenadantes de esta cepa (López et al.,
denominaron XynD e YnfF, respectivamente.
1998). Dichos análisis, sin embargo, indicaban
Las 3 xilanasas de Bacillus sp. BP-7 fueron
un peso molecular de 22 kDa para esta enzima.
clonadas de manera independiente, fueron
La diferencia en cuanto al peso molecular se
secuenciadas, y dos de ellas, XynA e YnfF,
debería a que la proteína deducida a partir de
fueron caracterizadas bioquímicamente
xynA presenta un péptido señal de 28
(capítulos I y II de Resultados).
aminoácidos (comprobado mediante los
programas SignalP y PSort), el cual no sería
1.1.- Identificación y procesado en el clon recombinante
Escherichia coli/pXA30, mientras que en la
caracterización de XynA
enzima detectada en sobrenadantes de la cepa
Los resultados de especificidad de sustrato
parental Bacillus sp. BP-7 este péptido señal
obtenidos para XynA (Tabla I.2.3) indican
sería eliminado durante la secreción al medio.
claramente que esta enzima es una
El punto isoeléctrico (pI) teórico de 9,28
endoxilanasa (1,4-β-D-xylan
deducido para esta xilanasa se vio corroborado
xylanohydrolase; EC 3.2.1.8) que presenta
146

también por los resultados experimentales en XynA de Bacillus sp. BP-7 son similares a las
geles de isoelectroenfoque (pI de 9 o superior). de las xilanasas mencionadas, las cuales están
Las condiciones óptimas de actuación de exhaustivamente caracterizadas (Paice et al.,
XynA fueron determinadas, siendo estas 60 ºC 1986; Yang et al., 1989; Wakarchuk et al.,
de temperatura y pH 6, aunque mantiene un 1994; Wolf et al., 1995).
porcentaje elevado de actividad en márgenes También se ha observado que la composición
amplios alrededor de estos valores (de 40 a G+C en la primera y segunda posición de
70 ºC y pH de 4,5 a 8,5). codón de xynA de Bacillus sp. BP-7 es del
En cuanto a la termoestabilidad de la enzima, a 38,2% y del 52,1% respectivamente.
50 ºC es de como mínimo 3 h, inactivándose Porcentajes similares se obtienen para xynA de
rápidamente a 60 ºC. En base a ésto, la enzima B. circulans y para xynA de B. subtilis (38,3%
no plantearía problemas a la hora de su en G+C para la primera posición y 52,8% para
mantenimiento y almacenamiento, sin la segunda), mientras que los porcentajes
embargo no soportaría las altas temperaturas promedio para estas posiciones de codón en
de algunos procesos industriales, de manera los genes de glicosil hidrolasas de B. subtilis
que para su utilización en este tipo de procesos son de 51,7% y 37,7%. Este hecho, sugiere
biotecnológicos podría ser interesante que la xilanasa A de Bacillus sp. BP-7
someterla a ensayos de evolución dirigida para corresponde a una enzima altamente
incrementar su termoestabilidad. conservada en este género y adquirida por
transferencia horizontal de genes, mediada
Los análisis de secuencia revelaron que XynA en este caso por el profago 6, tal como
de Bacillus sp. BP-7 es una enzima de dominio sugieren García-Vallvé y colaboradores
único con una alta homología con el subgrupo (1999).
de xilanasas, dentro de la familia 11 de
glicosil hidrolasas, de pI alcalino y bajo peso
molecular (92% de identidad con la xilanasa A 1.2.- Identificación y
de Bacillus subtilis y con la xilanasa A de caracterización de YnfF
Bacillus circulans; Figura I.2.4). Este tipo de YnfF de Bacillus sp. BP-7 presenta alta
xilanasas parece ser ubicuo entre las especies homología con la proteína deducida del gen
del género Bacillus y ha sido propuesto como ynfF de Bacillus subtilis ssp. subtilis cepa 168,
el principal subgrupo de enzimas de la familia identificada en el Proyecto Genoma de
11 de glicosil hidrolasas (Wong et al., 1988). Bacillus subtilis (Kunst et al., 1997) y anotada
De esta manera, tal como era de esperar, las originalmente como una proteína de función
características bioquímicas (pH y temperaturas desconocida homóloga a endoxilanasas; pero
óptimos, especificidad de sustrato, etc.) de que recientemente ha sido caracterizada y
147

renombrada como XynC (St. John et al., EC 3.2.1.8) que hidroliza xilanos de maderas
2006b). duras (tales como xilano de madera de abedul,
En cuanto a la función de ynfF de Bacillus sp. de haya y metil glucuronoxilano),
BP-7, hemos comprobado que codifica una obteniéndose los valores más altos de
endoxilanasa. Sin embargo, YnfF es una actividad sobre xilano de madera de abedul.
xilanasa atípica en el sentido de que no Por el contrario, la enzima no presenta
pertenece ni a la familia 10 ni a la familia 11, a actividad detectable sobre xilanos de
las que pertenecen la mayoría de gramíneas (xilano de espelta de avena,
endoxilanasas, ya que no presenta homología arabinoxilano de trigo, arabinoxilano de
con estas familias. YnfF presenta homología centeno), y su actividad tampoco es detectable
con enzimas con actividad xilanasa que a su o significativa sobre los aril-glicósidos
vez son homólogas a enzimas de la familia 5 ensayados.
de glicosil hidrolasas (Keen et al., 1996; Estos resultados indican que la xilanasa YnfF
Suzuki et al., 1997). Asimismo, YnfF presenta tiene actividad sobre xilanos con
homología a nivel de secuencia con un ramificaciones de ácido metil glucurónico
dominio conservado de glicosil hidrolasas de (glucuronoxilanos) pero es inactiva sobre
la familia 30, hecho descrito también para xilanos con ramificaciones de arabinosa
otras enzimas de la familia 5 (Collins et al., (arabinoxilanos); lo cual es coherente con el
2005). A pesar de que su estructura modo de acción descrito para xilanasas de la
tridimensional es el típico barril (α/β)8 de las familia 5 de glicosil hidrolasas.
enzimas de la familia 5, las xilanasas de esta Recientes estudios han demostrado que estas
familia son muy similares en secuencia de xilanasas de la familia 5 sólo cortan la cadena
aminoácidos a glicosil hidrolasas de la de xilosas del xilano en aquellos puntos
familia 30, cuya estructura, inferida a partir de cercanos a una ramificación lateral de ácido
la β-glucosidasa ácida 1 de Homo sapiens, 4-O-metil-α-D-glucurónico, la cual quedaría
sería también de barril (α/β)8 (Lieberman et acomodada en el subsitio -2 del centro activo.
al., 2007). Los productos resultantes de este modo de
YnfF de Bacillus sp. BP-7 es por tanto una de acción son fragmentos de xilano que,
las pocas xilanasas descritas dentro de la independientemente de su longitud, contienen
familia 5 de glicosil hidrolasas. esta ramificación lateral de ácido
metil glucurónico en el segundo residuo de
Tal como se ha comentado, los resultados de xilopiranosa contando desde el extremo
especificidad de sustrato obtenidos para YnfF reductor (St. John et al., 2006b; Vršanská et
(Tabla II.2.2) indican que esta enzima es una al., 2007) (Figura D.1.1).
endoxilanasa (1,4-β-D-xylan xylanohydrolase;
148

Figura D.1.1: Esquema del modo de actuación de las xilanasas de la familia 5.

La falta de actividad de estas xilanasas sobre de identidad a nivel de secuencia


arabinoxilanos sugeriría la imposibilidad aminoacídica).
estérica de acomodar residuos de
α-L-arabinofuranosa en los subsitios del centro La termoestabilidad de YnfF fue muy elevada
activo de la enzima. (>3 h) a las temperaturas ensayadas de 60 y
50 ºC. Así, esta enzima no plantearía
La xilanasa YnfF de Bacillus sp. BP-7 tiene un problemas a la hora de su mantenimiento y
peso molecular teórico de 47,6 kDa, que almacenamiento.
concuerda con el peso molecular determinado
zimográficamente, 47 - 48 kDa, a partir de
extractos obtenidos de cepas recombinantes de 1.3.- Identificación de XynD
E. coli. Se ha comprobado además, mediante Hasta el momento, XynD de Bacillus sp. BP-7
los programas SignalP y PSort, que la sólo ha sido clonada y secuenciada, no
secuencia proteica deducida de ynfF presenta habiéndose caracterizado aún su actividad
péptido señal, hecho que indica que se trata enzimática.
de una enzima de secreción en la cepa original A nivel de secuencia de aminoácidos, presenta
de Bacillus sp. BP-7. alta homología con la xilanasa D (XynD) de
Bacillus subtilis (Kunst et al., 1997), la cual a
Las condiciones óptimas de actuación de YnfF pesar de haber sido secuenciada durante el
son 65 ºC de temperatura y pH 6,5, Proyecto Genoma de Bacillus subtilis no ha
presentando un porcentaje elevado de sido caracterizada bioquímicamente. También
actividad (>50%) en margenes amplios presenta homología elevada con XynD de
alrededor de estos valores (de 30 a 70 ºC y pH Paenibacillus polymyxa (Gosalbes et al.,
de 4,5 a 10). 1991) y otras enzimas que, además de
Estos valores además son muy similares a los actividad xilanasa, muestran actividad
de XynC de Bacillus subtilis 168 (St. John et arabinofuranosidasa, y que se encuentran
al., 2006b), lo cual era de esperar dado el alto clasificadas en la familia 43 de glicosil
grado de identidad entre ambas proteínas (92% hidrolasas, la cual engloba enzimas con
diferentes actividades hidrolíticas.
149

Así, en este caso sería necesario caracterizar la de las otras xilanasas caracterizadas en este
actividad enzimática de XynD de Bacillus sp. trabajo, así como productos de procesamiento
BP-7, comprobando si realmente la proteína de las mismas. Dado que taxonómicamente
clonada tiene actividad xilanasa, o si por el Bacillus sp. BP-7 se encuentra muy cercano a
contrario presenta alguna otra de las Bacillus subtilis (López, 2000) y que la
actividades hidrolíticas relacionadas con la homología de los genes de ambos hasta ahora
degradación del xilano, xilosidasa o comparados es bastante elevada, cabría esperar
arabinofuranosidasa, exhibidas por enzimas de que Bacillus sp. BP-7 tuviera un número de
la familia 43. xilanasas similar al de Bacillus subtilis.
A partir de consultas en la base de datos del
genoma de Bacillus subtilis (SubtiList) se
1.4.- Sistema xilanolítico de deduce que éste posee sólo 2 genes conocidos
Bacillus sp. BP-7 que codifiquen para xilanasas, xynA e ynfF
Se han clonado e identificado entre 2 y 3 (recientemente renombrado como xynC),
xilanasas de la cepa Bacillus sp. BP-7, cuyos homólogos en Bacillus sp. BP-7 se han
dependiendo de si consideramos sólo los genes identificado en este trabajo. Bacillus subtilis
xynA e ynfF, o si finalmente se confirma XynD posee también otros 2 genes clasificados como
como una auténtica xilanasa (Tabla D.1.1). homólogos a endoxilanasas, pero aún no
confirmados experimentalmente, xynD e yheN,
Sin embargo, en los zimogramas realizados a de los cuales en Bacillus sp. BP-7 se ha
partir de sobrenadantes de la cepa analizada identificado y subclonado el homólogo a
aparecen una gran variedad de bandas con xynD.
actividad xilanasa (López et al., 1998). Así, De esta manera, a parte de la caracterización
podría ser que Bacillus sp. BP-7 presentara bioquímica de este último enzima, que se está
más genes de xilanasas, aunque también realizando actualmente en el grupo de
podría suceder que las bandas de actividad investigación, quedaría por analizar la
detectadas en los zimogramas fueran existencia en Bacillus sp. BP-7 del gen
agregados de la xilanasa mayoritaria (XynA) o homólogo a yheN de Bacillus subtilis y por

Tabla D.1.1: Xilanasas de Bacillus sp. BP-7.

Peso Temperatura pH Vida media a


Gen Familia molecular pI óptima óptimo 50 ºC
xynA 11 23 - 24 kDa 9,28* 60 ºC 6,0 >3h
ynfF 5 47 - 48 kDa 8,80* 65 ºC 6,5 >3h
xynD 43 54,3 kDa* 7,73* - - -
*
Valores teóricos
150

caracterizar la presunta proteína codificada por Kex2 (Moukadiri et al., 1999), quedando
él. separada la subunidad I (con el péptido señal)
del resto de la proteína. A continuación, la
subunidad I es secretada al medio de cultivo;
1.5.- Expresión de xilanasas en mientras que el resto de Pir4 (MP + S II)
levaduras queda anclado a la pared celular gracias a que
En colaboración con el grupo del Dr. Jesús contiene 4 cisteínas (1 a nivel del MP y 3 a
Zueco de la Universitat de València, se ha nivel de la S II) que permiten la formación de
conseguido ensayar con éxito la expresión y puentes disulfuro para la unión a la pared
secreción de la xilanasa XynA de Bacillus sp. celular de la levadura.
BP-7 en Saccharomyces cerevisiae, como
primer paso para su posible utilización Las distintas construcciones re1alizadas
biotecnológica en la industria alimentaria. (C1 - C5) contenían la secuencia codificante
S. cerevisiae es un buen candidato para estos de XynA desprovista de péptido señal
ensayos ya que de forma natural no produce (aa 28 - aa 245) fusionada a posiciones
xilanasas autóctonas (Jeffries, 1983), es un distintas de la secuencia codificante de Pir4
organismo considerado seguro por la FDA (Figura I.2.11):
americana (GRAS: Generally Recognized as – En la construcción C1 la secuencia
Safe), y se posee una amplia experiencia en su codificante de XynA fue insertada en la
cultivo a escala industrial en fermentadores. región N-terminal de la subunidad I.
– En C2, XynA se insertó en la región
En los experimentos realizados, se N-terminal de la subunidad II.
construyeron cinco fusiones génicas entre el – En C3, XynA se insertó en la región
gen de la xilanasa A de Bacillus sp. BP-7 y el C-terminal de la subunidad II.
gen de la proteína de pared Pir4 de – En C4, la secuencia codificante de XynA
S. cerevisiae. sustituyó gran parte de la secuencia
Pir4 es una proteína formada por dos codificante de la subunidad II.
subunidades, S I hacia N-terminal y S II en – En C5, la secuencia codificante de XynA
C-terminal, unidas entre sí a través del motivo sustituyó prácticamente toda la secuencia
Pir (MP). Pir4 posee además en N-terminal un codificante de Pir4, excepto el péptido
péptido señal para su secreción en señal.
S. cerevisiae. Estas construcciones fueron expresadas con
Tras su síntesis en el retículo endoplasmático éxito en S. cerevisiae BY4741 (cepa salvaje) y
de la levadura, la proteína Pir4 es procesada, a S. cerevisiae mnn9 (cepa deficiente en
nivel del aparato de Golgi, por la proteasa glicosilación); y se analizó su localización
151

celular mediante ensayos de actividad formación de puentes disulfuro para la unión a


xilanasa. la pared celular.
En los clones de la cepa S. cerevisiae BY4741
De las 5 construcciones (C1 - C5), cuatro de con estas construcciones, C2 y C3, la mayoría
ellas mostraron actividad xilanasa en placas de la actividad xilanasa (100% y 96%
suplementadas con xilano-RBB, C1 - C4, lo respectivamente) se detectó a nivel de pared;
que indica el correcto plegamiento de la mientras que en el caso de la cepa
xilanasa bacteriana en el huésped eucariota. S. cerevisiae mnn9, los clones con estas
En el caso de la construcción C5, la falta de construcciones, presentaron actividad xilanasa
actividad podría deberse a un incorrecto tanto a nivel de pared celular como en los
plegamiento de la proteína a nivel del retículo sobrenadantes de cultivo, debido a que las
endoplasmático, tal como sucede con otras deficiencias en glicosilación de esta cepa
proteínas de fusión con proteínas de pared de (Hernández et al., 1989) afectarían la unión de
la familia Pir en las que no se incluye la Pir4 a la pared celular (Moukadiri et al.,
subunidad II de la proteína Pir (Simonen et al., 1999), y por tanto parte de la proteína de
1994). fusión Pir4-XynA sufriría cierta secreción al
En el caso de la construcción C1, ésta dio sobrenadante en lugar de quedar retenida en la
lugar a tenues halos de degradación en placas pared celular. Esta secreción parcial de
suplementadas con xilano-RBB. Este hecho Pir4-XynA al medio de cultivo también
podría deberse a que el procesamiento de la explicaría porque la actividad a nivel de pared
proteína de fusión en el aparato de Golgi en la cepa mnn9 era menor que en la cepa
separaría la subunidad I, con la actividad BY4741.
xilanasa, de la subunidad II; lo cual podría Por último, se observó que la proteína de
afectar al correcto plegamiento de la enzima, fusión Pir4-XynA resultante de la construcción
tal como se ha mencionado anteriormente. El C4 era secretada de manera mayoritaria al
fragmento procesado conteniendo la enzima medio de cultivo (87 - 89% de la actividad
XynA y la subunidad I muy probablemente xilanasa total), tanto en los clones de la cepa
sería secretado al medio de cultivo, en lugar de BY4741 como en los de la cepa mnn9. Esto
quedar retenido en la pared celular. sería debido a que en esta construcción se
Los productos génicos de las construcciones había eliminado la región de la subunidad II de
C2 y C3, se detectaron mediante ensayos de Pir4 que contiene 3 de las 4 cisteínas
actividad xilanasa a nivel de la pared celular conservadas, y por tanto la proteína resultante
de S. cerevisiae. Esto sería debido a que ambas no podría ser retenida en la pared celular. El
construcciones conservaban las 4 cisteínas hecho de que esta proteína fuera secretada
típicas de la familia Pir que permitirían la también explicaría que los clones que
152

contenían la construcción C4 dieran mayores


halos de degradación del xilano-RBB en los 2. XYNB DE PAENIBACILLUS
ensayos de actividad en placa, al poder BARCINONENSIS
difundirse por el medio sólido.
2.1. Expresión en huéspedes
Los resultados de actividad y localización de
homólogos
las proteínas de fusión se vieron respaldadas
La xilanasa B (XynB) de Paenibacillus
por los resultados de western blot con
barcinonensis presenta unas propiedades, entre
anticuerpos anti-Pir4 obtenidos por el grupo
las que se encuentra su actividad
del Dr. Jesús Zueco en Valencia (Andrés et al.,
transxilosidasa (Blanco et al., 1996; Gallardo
2005).
et al., 2003), que confieren a esta enzima
especial interés por su potencial aplicación en
Se ha conseguido un sistema basado en la
la síntesis de nuevos xilósidos, de utilidad en
proteína Pir4 que permite direccionar xilanasas
la industria alimentaria o farmacéutica (Jiang
hacia la pared celular de levaduras o hacia el
et al., 2004). Con el fin de producir xilanasa B
medio de cultivo, para obtener enzimas
en elevadas cantidades, se decidió clonarla y
activas, bien inmovilizadas en la pared celular
sobreexpresarla en huéspedes homólogos. Se
o bien secretadas.
eligió para ello Bacillus subtilis, debido a que
Estos ensayos con S. cerevisiae facilitan el uso
es un sistema de expresión homólogo a
de XynA y otras xilanasas en la industria
Paenibacillus barcinonensis (del antiguo
panadera para obtener los efectos beneficiosos
género Bacillus). Bacillus subtilis es además
que se derivan de la aplicación de estas
un microorganismo GRAS, bien conocido,
enzimas en panificación (aumento del
fácilmente cultivable, y previamente utilizado
volumen y de la calidad de la miga, además de
con éxito para la producción industrial de
un efecto de antienranciamiento) (Linko et al.,
enzimas y otras proteínas (Harwood, 1992;
1997); con la ventaja añadida que conlleva el
Ferrari et al., 1993; Tremblay y Archibald,
hecho que sea la propia levadura utilizada para
1993; Wong, 1995). Además, presenta la
el esponjado de la masa panaria la que
ventaja añadida de tener la capacidad de
produzca xilanasas que queden expuestas al
secretar un gran número de proteínas al medio
medio y, por tanto, en contacto con las
extracelular, con lo que era de esperar que la
hemicelulosas sobre las que han de actuar.
xilanasa podría ser secretada al medio de
cultivo en lugar de permanecer dentro de las
células (como sucede en E. coli),
153

simplificándose así su purificación a escala barcinonensis, y que falta alguna secuencia


industrial (downstream-processing). importante en posición 5' necesaria para la
Concretamente, se eligieron las cepas Bacillus transcripción del gen xynB.
subtilis MB216, por ser fácilmente Por otra parte, los buenos niveles de expresión
transformable (Lampen et al., 1986), y obtenidos con el plásmido pRBSPO2X20 se
Bacillus subtilis MW15, por ser una cepa deberían al buen funcionamiento del promotor
deficiente en proteasas, celulasas, lichenasas y SPO2 utilizado, tal como era de esperar en
xilanasas (Wolf et al., 1995). base a publicaciones de otros autores (Schoner
et al., 1983; Overbeeke et al., 1990; Bolhuis et
Se realizaron construcciones que contenían el al., 1999). Es probable que se puedan
gen xynB en los vectores lanzadera conseguir niveles de expresión iguales e
E. coli-Bacillus subtilis pBRSPO2 y pN5. Los incluso superiores a los obtenidos con el
clones con la construcción pBRSPO2X20 promotor SPO2 utilizando otros promotores
(donde xynB está bajo el control del promotor fuertes en Bacillus subtilis, como por ejemplo
fuerte SPO2) mostraron una elevada el promotor de la α−amilasa de Bacillus
producción de actividad xilanasa; mientras que amyloliquefaciens (Palva et al., 1981;
los clones con la construcción pN5X20 (xynB Yamamoto et al., 2005) o el promotor SPO1
con su propio promotor) no presentaron (Osburne y Craig, 1986).
diferencias de actividad xilanasa con las
correspondientes cepas huésped. De entre los clones con la misma construcción
La falta de expresión apreciable de XynB en pBRSPO2X20, el clon en la cepa B. subtilis
los clones con la construcción pN5X20 podría MW15 mostró más actividad que el clon
deberse a que la potencial región promotora correspondiente en B. subtilis MB216, debido
del gen xynB (121 bp) clonada en pN5X20 no seguramente a que la cepa B. subtilis MW15
era funcional en las cepas huéspedes es deficiente en 2 proteasas (la proteasa neutra
utilizadas, a pesar de su similitud con y la proteasa alcalina), mientras que la cepa
A
secuencias reconocidas por la subunidad σ de B. subtilis MB216 no lo es, de manera que en
la ARN polimerasa de Bacillus subtilis y a el clon B. subtilis MW15/pRBSPO2X20 debe
pesar también de que, por regla general, los haber menor proteólisis de la enzima
promotores de Bacillus y géneros afines dan producida. La actividad xilanasa de este clon
lugar a altos niveles de expresión en B. subtilis proviene además exclusivamente de la
(Sumitomo et al., 1995). Este hecho parece xilanasa recombinante, ya que la cepa huésped
indicar que dicha región de 121 bp en posición Bacillus subtilis MW15 no presenta actividad
5' del gen estructural xynB no es tampoco una xilanasa basal detectable al tener
región promotora funcional en Paenibacillus disrupcionado el gen xynA, que codifica la
154

xilanasa mayoritaria de la cepa. Por el concretamente el medio BREC1 ha sido


contrario, en el clon B. subtilis descrito como un medio muy adecuado para la
MB216/pRBSPO2X20 parte de la actividad sobreexpresión en Bacillus subtilis DB104,
xilanasa producida es actividad basal debida a cepa de la cual deriva la cepa MW15
las xilanasas propias de la cepa huésped. (Overbeeke et al., 1990).

Continuando con el estudio de la expresión en


Bacillus subtilis MW15/pRBSPO2X20, se 2.2. Localización celular
observó que los niveles máximos de actividad Cuando se comparó la actividad xilanasa en
xilanasa se obtenían en fase estacionaria los extractos celulares (intracelular) con la
avanzada, a los 3 - 4 días de cultivo, lo cual actividad en los sobrenadantes (extracelular)
concuerda con datos de producción de otras de cultivos de Bacillus subtilis
enzimas en cepas de Bacillus (Blanco y Pastor, MW15/pRBSPO2X20 en fase estacionaria, se
1993; Kim y Pack, 1996). Estudios por observó que sorprendentemente la actividad
SDS-PAGE de los sobrenadantes de estos intracelular era más elevada de lo que se
cultivos mostraron que la xilanasa B esperaría si la xilanasa B fuera secretada al
representaba la banda proteica mayoritaria de medio. Asimismo, estudios por SDS-PAGE
los mismos, hecho que confirma la confirmaron que la xilanasa B recombinante se
sobreproducción de XynB en la cepa encontraba en alta proporción tanto en los
recombinante construida. sobrenadantes como en los extractos celulares
Los medios de cultivo que dieron lugar a de cultivos en fase estacionaria.
mayor producción de xilanasa fueron el caldo Se comprobó que en cultivos jóvenes (hasta
nutritivo suplementado con paja de arroz o con 24 h) la actividad xilanasa era
xilano de madera de abedul. En este último mayoritariamente intracelular, a medida que
medio se obtuvieron niveles de actividad en los cultivos progresaban en la fase estacionaria
los sobrenadantes unas 3 veces superiores a los (1 - 2 días) la actividad empezaba a detectarse
niveles de actividad intracelular del clon en el medio extracelular; y sólo en cultivos en
original E. coli 5K/pX60. fase estacionaria muy avanzada (3 - 4 días) los
El resto de medios de cultivo ensayados no niveles extracelulares de actividad xilanasa
dieron lugar a estos niveles de producción, superaban ligeramente a los intracelulares.
siendo sorprendente la baja producción en los Puesto que la mayoría de enzimas
medios MG, MG2 y, sobre todo, en el medio extracelulares de Bacillus son secretadas al
BREC1, si se tiene en cuenta que contienen medio desde las primeras etapas de los
altas concentraciones de amonio para cultivos (Jeong et al., 1998; Leloup et al.,
minimizar la expresión de proteasas, y que 1999; Qureshy et al., 2000; Schallmey et al.,
155

2004); los resultados indicaban que la una prueba empírica sólida del carácter
xilanasa B de Paenibacillus barcinonensis era intracelular de XynB de Paenibacillus
una enzima intracelular, que no se secretaba al barcinonensis. En este tipo de geles la banda
medio, y que, posiblemente, debido a lisis de actividad correspondiente a XynB se puede
celular se encontraría también en el diferenciar fácilmente del resto de xilanasas de
sobrenadante de cultivos viejos. la cepa debido a su diferente movilidad
electroforética (Blanco et al., 1996). Esta
En base a estos datos, planteamos la hipótesis banda aparecía claramente en todas las
según la cual la xilanasa B sería una enzima muestras analizadas de extractos celulares de
intracelular cuya liberación al medio de cultivo Paenibacillus barcinonensis, mientras que
se podría producir de manera inespecífica por sólo ocasionalmente se observaron bandas de
lisis celular en determinadas condiciones. Ésto actividad correspondientes a XynB en algunos
se pudo constatar en la cepa recombinante sobrenadantes de Paenibacillus barcinonensis,
B. subtilis MW15/pRBSPO2X20, en la cual y siempre varios ordenes de magnitud más
los valores de lisis, medidos en función de la tenues que las bandas de XynB observadas en
actividad malato deshidrogenasa extracelular los correspondientes extractos celulares.
respecto a la intracelular, presentaron La posibilidad de que XynB fuera una enzima
correlación con los valores de actividad de la secretada pero asociada a la pared bacteriana
xilanasa B detectados en el compartimento fue descartada al comprobarse que sólo se
extracelular (Tabla III.2.7). detectaba actividad xilanasa en el citoplasma,
no detectándose ésta en los restos de pared y
La realización de estudios de localización membranas celulares, tras analizar las
celular en la cepa original Paenibacillus fracciones soluble y particulada de extractos
barcinonensis resultó más compleja debido a celulares de Paenibacillus barcinonensis.
que dicha cepa, a diferencia del clon
B. subtilis MW15/pRBSPO2X20, posee un El análisis de la secuencia de aminoácidos
sistema xilanolítico complejo con varias deducida del gen xynB de Paenibacillus
enzimas con actividad xilanasa y xilosidasa barcinonensis mostró la ausencia en la región
(Blanco y Pastor, 1993), de manera que no se N-terminal de un péptido señal típico para
puede asociar directamente la actividad secreción en Bacillus y otros Gram + mediante
xilanasa o xilosidasa de una fracción celular a el sistema Sec (Sec pathway) o por el sistema
XynB. Tat (twin-arginine pathway). Un péptido señal
Sin embargo, los análisis zimográficos en de este tipo debería de consistir en varios
geles nativos de los extractos celulares y los aminoácidos con cargas positivas en el
sobrenadantes de cultivo permitieron obtener extremo más N-terminal (dominio N), con la
156

presencia o no de secuencias KR o RR empíricamente mediante secuenciación del


(twin-arginine motif), seguidos de una zona de extremo N-terminal de la xilanasa B presente
aminoácidos hidrófobos (dominio H), y de tanto en citoplasma como en sobrenadantes de
aminoácidos polares o cargados a continuación cultivo. En todos los casos se observó una
y antes del lugar de corte por la peptidasa secuencia aminoacídica idéntica a la
señal (dominio C). Tampoco se identificó en N-terminal deducida a partir del gen xynB. Si
XynB la presencia de otros péptidos señales la xilanasa B fuera una proteína que se
menos frecuentes, como los utilizados por los secretara por cualquiera de los 4 sistemas de
sistemas de secreción Com (dominio N + secreción descritos en Bacillus y otros Gram +
dominio C + dominio H) o ABC (dominio N + (sistema Sec, sistema Tat, sistema Com y
dominio C) (Tjalsma et al., 2004) sistema de transportadores ABC; Tjalsma et
(Figura D.2.2). al., 2004), deberían haberse observado
La ausencia de péptido señal fue evidenciada diferencias, debidas al procesamiento por parte
mediante análisis informáticos de la secuencia de cualquiera de los tipos de peptidasa señal
proteica deducida mediante los programas involucrados en secreción en este tipo de
SignalP y PSort. También se verificó bacterias.

Sistema de Peptidasas
secreción señal

Péptido señal de tipo Tw in-arginine


Tat N H C
++ K/RR ## AXA
+1
Tipo I
(SipS, SipT, SipU,
Péptido señal de tipo Sec SipV o SipW)
N H C
+++ G P AXA
+1
Sec
Péptido señal de lipoproteínas
N H C Tipo II
++ LXX C (LspA)
+1

Péptido señal de Pseudopilinas


Peptidasas de
Com N C H Pseudopilinas
KG F E (ComC)
+1

Péptido señal de Bacteriocinas y Feromonas


Transportadores
N C
ABC ABC
(SunT, AlbE/F)
+1

Figura D.2.2: Péptidos señal válidos en Bacillus y otros Gram +. Se representan los dominios N (con cargas
positivas, en rojo), C (con aminoácidos polares o cargados, en azul) y H (con aminoácidos hidrófobos, en
amarillo). (Tjalsma et al., 2004).
157

La ausencia de péptido señal impediría la Cabe mencionar en este punto que, tal como se
secreción de la xilanasa B al medio, ya que comentó en la introducción, han sido descritas
todas las enzimas de Bacillus y géneros afines xilanasas localizadas en el espacio
(como Paenibacillus) descritas hasta la fecha periplásmico de bacterias Gram negativas,
necesitan péptido señal para ser secretadas como es el caso de la bacteria del rumen
(Nagarajan, 1993; Fu et al., 2007). Prevotella bryantii, en la que
aproximadamente un 80% de la actividad
Estos hechos indicarían, en concordancia con xilanasa se localiza en el periplasma (Miyazaki
el resto de experimentos de localización, que et al., 1997); o de Cellvibrio mixtus, en la que
la xilanasa B de Paenibacillus barcinonensis la xilanasa XylC presenta un péptido señal que
es una enzima intracelular. dirige su secreción al periplasma (Fontes et al.,
2000). Tal como sugieren estos autores, la
La localización intracelular de la xilanasa B función de estas xilanasas periplásmicas no
resulta sorprendente ya que las xilanasas, sería tampoco la degradación del xilano, sino
como enzimas degradadoras de polímeros, que, muy posiblemente, sería la degradación
deben ser secretadas al medio para que puedan de aquellos xilooligosacáridos de menor
actuar sobre el xilano (de elevado tamaño), tamaño que pudieran atravesar la membrana
liberando xilooligómeros más pequeños que sí externa, al mismo tiempo que quedarían
pueden ser transportados al interior de la protegidas en el periplasma de la acción de las
célula para su completa degradación. Dado proteasas extracelulares.
que, tal como hemos demostrado, XynB no es
secretada al medio, su función natural no Por último, los estudios de homología de
puede ser la degradación del xilano, ya que en XynB mostraron que pertenecía a la familia 10
condiciones normales no entraría en contacto de glicosil hidrolasas, observándose un
con él. Su función podría ser pues la elevado grado de homología con otras 6
degradación de xilooligómeros cortos, de 3 o xilanasas de esta familia. Nuestros estudios
más residuos de xilosa, resultantes de la han revelado que estas 6 xilanasas tienen una
degradación extracelular del xilano por otras serie de características comunes entre ellas y
xilanasas, una vez transportados al interior de con XynB, que las diferencian respecto al resto
la célula. Esta posibilidad se vería respaldada de xilanasas de la familia. En concreto, estas
tanto por estudios previos que indican que xilanasas no presentan evidencias de poseer
XynB presenta elevada actividad sobre estos péptido señal (comprobado mediante análisis
xilooligosacáridos (Blanco et al., 1996), como informáticos de secuencia), y todas ellas
por los datos de especificidad de sustrato poseen 2 regiones de aminoácidos conservadas
mostrados en el presente trabajo. no presentes en el resto de xilanasas de la
158

familia 10 (regiones A, AIE_YASL, y B, homólogas a XynB, que agrupan junto a ella


RTDL__PT, flanqueando la región VI en los árboles filogenéticos.
conservada en las xilanasas de esta familia).
Además, XynB y estas 6 xilanasas homólogas Sería necesaria también una caracterización
sin péptido señal son xilanasas de dominio bioquímica exhaustiva de XynB, evaluando su
único, sin dominios extra de unión a sustratos actividad sobre un amplio rango de
insolubles; y, en algunos casos, sus autores las xilooligómeros y sustancias afines, con el fin
clasifican como xilanasas intracelulares o de dilucidar cuál es el sustrato natural de esta
como exoxilanasas (Usui et al., 1999; Shulami enzima e identificar su función biológica.
et al., 1999), aunque en ningún caso se ha Asimismo, el estudio detallado de la actividad
mostrado evidencia experimental de la transglicosidasa de la xilanasa B, evidenciada
localización intracelular de las mismas. por la aparición de productos de mayor grado
Al realizar estudios de agrupamiento en de polimerización que los sustratos (Blanco et
dendrogramas, XynB y las 6 xilanasas al., 1996), podría ser de utilidad para
homólogas quedan agrupadas juntas, formando identificar la función biológica de XynB, ya
un cluster, separadas del resto de miembros de que muy posiblemente sea éste el mecanismo
la familia 10 (Figura III.2.9). responsable de que esta xilanasa presente la
Así, estaríamos ante un nuevo tipo de inusualmente elevada actividad sobre
xilanasas, dentro de la familia 10, con función aril-xilósidos que se ha descrito en el trabajo.
intracelular, posiblemente la degradación de
xilooligómeros pequeños, pero con actividad La existencia de xilanasas intracelulares tanto
claramente distinta a la de las xilosidasas al no citosólicas como periplásmicas permitirían a
ser activas sobre xilobiosa. Este grupo de las bacterias que las poseen un rápido y eficaz
enzimas constituirían pues un tipo intermedio aprovechamiento de los productos resultantes
entre las xilanasas auténticas y las xilosidasas, de la degradación del xilano extracelular,
cuya función biológica en la degradación del llevada a cabo por xilanasas extracelulares
xilano todavía está por dilucidar propias o de otras bacterias.
experimentalmente.

Para confirmar que realmente estas enzimas 2.3. Relación estructura-función


forman un grupo aparte dentro de las xilanasas Para profundizar en el conocimiento de la
de la familia 10, sería necesario un estudio xilanasa B de Paenibacillus barcinonensis, se
más amplio y detenido de las características decidió realizar estudios de estructura-función.
bioquímicas y estructurales de las xilanasas
159

A partir de los modelos de estructura distinguen 4 subsitios de unión al sustrato


secundaria y terciaria de XynB, y claramente definidos (subsitios -2, -1, +1 y
posteriormente de la estructura tridimensional +2), y sugiere la existencia de 3 subsitios
determinada por cristalografía, se comprobó adicionales (-3, +3 y +4) (Figura IV.2.9). La
que la estructura de la xilanasa era la típica presencia del elevado número de subsitios de
estructura de barril (α/β)8 o TIM-barrel de las unión al sustrato es coherente con la capacidad
xilanasa de la familia 10. En esta estructura, de la xilanasa B de hidrolizar oligosacáridos
los aminoácidos catalíticos de la enzima (E241 de 3, 4 o más residuos de xilosa, y con su
y E134) quedarían muy próximos y hacia el ausencia de actividad frente a xilobiosa.
interior del barril en una hendidura de la Además de los dos residuos de glutámico
superficie de la proteína. Cabe recordar aquí catalíticos a nivel del subsitio -1, es importante
que en las xilanasas de la familia 10 el lugar de la presencia de otros residuos aromáticos
unión al sustrato está en una hendidura poco (W299, Y179 y F303) que ayudarían a
profunda (mientras que en las de la familia 11 posicionar correctamente el sustrato en la
el lugar de unión al sustrato está en un surco orientación correcta para la hidrólisis del
más profundo), hecho que permite a las enlace glucosídico (Leggio et al., 2000);
xilanasas de esta familia ser menos estrictas en asimismo estos residuos aromáticos, y en
cuanto al sustrato, mostrando una mayor especial el triptófano 299 en el subsitio -1,
versatilidad catalítica que las xilanasas de la actuarían como impedimento estérico para el
familia 11 (Biely et al., 1997). En el caso de correcto posicionamiento de un anillo de
XynB esta mayor laxitud respecto al sustrato glucosa (con un CH2OH en lugar de un H
puede observarse en el análisis de su respecto a la xilosa) a nivel del subsitio -1, lo
especificidad de sustrato del capítulo III de cual explicaría la baja actividad (<1% de la
Resultados (Tabla III.2.1), ya que además de actividad máxima) de esta enzima sobre las
actividad sobre diferentes xilanos (tanto de celulosas ensayadas (carboximetil celulosa y
maderas duras como de gramíneas) y la Avicel).
elevada actividad sobre aril-xilósidos, la También es importante resaltar la presencia de
xilanasa B presenta actividad significativa una cavidad a nivel del subsitio +2, la cual
sobre aril-glucósidos (pNPCel2 - pNPCel5), permitiría acomodar sustituyentes laterales en
característica particular de las xilanasas de la el O2 de la xilosa posicionada en este subsitio,
familia 10 que sirve para diferenciarlas de las como por ejemplo metil glucurónico (Pell et
de la familia 11 (Biely et al., 1997). al., 2004), lo que se ve corroborado por la
actividad de la xilanasa B sobre sustratos
La estructura obtenida por cristalografía reveló como el glucuronoxilano.
con detalle la hendidura catalítica, en la que se
160

Con el fin de profundizar en los estudios de la de puentes de hidrógeno que mantienen la


relación estructura-función, se decidió recurrir estructura necesaria para que las enzimas
a la ingeniería de proteínas, ya que se ha realicen su función concreta, obteniéndose
demostrado como una tecnología útil para como resultado enzimas inactivas (Hwang y
resolver cuestiones relativas a la estructura y la Warshel, 1988; Yano et al., 1998).
función de las proteínas, además de para Sin embargo, cuando se obtuvieron
obtener nuevas estructuras proteicas que estén posteriormente los resultados de cristalografía,
mejor preparadas para una utilización se observó que el bucle L7 (aminoácidos
industrial específica (Arrizubieta y Polaina, S245 - T260), que contiene la región
2000). conservada B y está afectado por las
En concreto, para estudiar la posible delecciones introducidas mediante
funcionalidad de la región conservada B mutagénesis dirigida, es esencial para
(RTDL__PT), distintiva del grupo de xilanasas determinar la conformación del centro activo
sin péptido señal y situada en uno de los de la xilanasa B, ya que los residuos R248,
bucles (o loops) exteriores de la estructura de H249 y E250 situados en dicho bucle son los
XynB, se decidió recurrir a una estrategia de principales responsables de la especificidad de
mutagénesis dirigida para obtener proteínas los subsitios +2 y +3 (Figura IV.2.9). Así, las
mutantes derivadas de ésta en las que dicha alteraciones debidas a las delecciones
región estuviera deleccionada total o introducidas no sólo podían afectar a la
parcialmente. estructura básica de la enzima, como se creyó
A pesar de que se consiguieron diferentes en un primer momento, sino que además
clones con delecciones de 4, 8 y 13 alteraban de manera importante el centro
aminoácidos en esta región, ninguno de ellos activo de la enzima al acortar y desestructurar
mostró actividad xilanasa o sobre pNPX, el bucle L7.
hecho que indica que estas xilanasas truncadas
no son funcionales. En cualquier caso, la falta de mutantes
En un principio se creyó que ésto funcionales no permite dilucidar si la región B
probablemente era debido a que se había juega alguna función o no, más allá de su
alterado la estructura básica de la enzima, al aparente papel en el mantenimiento de la
reducirse la distancia entre la séptima hebra β estructura del bucle L7, para el correcto
y la séptima hélice α del barril (α/β)8. Este tipo plegamiento del centro activo de la enzima.
de resultado negativo es bastante frecuente a la
hora de intentar rediseñar enzimas, ya que, por
ejemplo, es muy fácil desbaratar con las
modificaciones introducidas la intrincada red
161

2.4. Termoestabilidad S15L y M93V, fueron aisladas mediante PCR


divergente en un sólo paso y expresadas de
Para conocer mejor la xilanasa B de
manera individual, obteniéndose de esta
Paenibacillus barcinonensis así como para
manera 4 xilanasas mutantes que fueron
mejorar sus cualidades para una posible
purificadas y caracterizadas en cuanto a
aplicación en la industria, se realizaron
termoestabilidad. Todas las xilanasas mutantes
experimentos de ingeniería de proteínas
presentaron una termoestabilidad superior a la
enfocados a modificar su termorresistencia.
xilanasa salvaje, tanto a 45 como a 50 ºC;
Debido a los problemas encontrados en la
destacando entre ellas las mutantes M93V y
obtención de resultados mediante mutagénesis
S15L, que presentaron a 50 ºC una vida media
dirigida y a los pocos conocimientos que
entre 3 y 4 veces superior a la de la enzima
disponíamos sobre la relación entre la
salvaje.
estructura y la función de XynB, se decidió
recurrir a la denominada “evolución dirigida”
Con el fin de mejorar el incremento de
(Hancock et al., 2006). Esta tecnología se basa
termoestabilidad que producían las mutaciones
en la generación aleatoria de una gran
de manera individual, se decidió combinarlas
variabilidad de copias mutantes del gen entre
creando 2 xilanasas dobles mutantes: una que
las que seleccionar a continuación aquellas que
contenía las 2 mejores mutaciones, M93V y
dan lugar a enzimas con las características
S15L, y otra que contenía las mutaciones
deseadas (López-Camacho y Polaina, 1993;
E137D y D323N.
Yano et al., 1998); en nuestro caso xilanasas
La xilanasa doble mutante E137D/D323N no
con una mayor termorresistencia.
mostró grandes diferencias de termoestabilidad
Un paso crítico en la estrategia de evolución
respecto a la enzima salvaje; mientras que la
dirigida es el procedimiento para generar las
xilanasa doble mutante S15L/M93V presentó
copias mutagenizadas. Se decidió utilizar la
un incremento notable en la termoestabilidad,
técnica de DNA shuffling, con o sin una etapa
siendo su vida media a 50 ºC 20 veces superior
previa de PCR mutagénica, ya que es una
a la de la xilanasa B salvaje y 2 veces superior
técnica que ha dado muy buenos resultados en
a la suma de las vidas medias de las mutantes
aproximaciones de este tipo (Stemmer, 1994;
simples S15L y M93V. Se constató pues un
López-Camacho et al., 1996; Sanz-Aparicio et
efecto sinérgico de estas 2 mutaciones sobre la
al., 1998; Arrizubieta y Polaina, 2000).
termoestabilidad de la xilanasa B. Diferentes
Mediante esta metodología se consiguió
estudios previos muestran también como la
obtener 3 clones mutantes termoestables, que
combinación de mutaciones puntuales que
contenían un total de 4 mutaciones en la
afectan positivamente la misma propiedad de
secuencia aminoacídica de XynB. Las 4
una proteína produce una enorme mejora de
mutaciones identificadas, E137D, D323N,
162

dicha propiedad, bien debido a un efecto


aditivo o a un efecto sinérgico (cooperativo,
como es nuestro caso) de las mutaciones
(Zhang et al., 1995; Kawamura et al., 1998;
Akanuma et al., 1999; Arrizubieta y Polaina,
2000).

Para inferir las posibles modificaciones


Figura D.2.3: Localización sobre la superficie
estructurales que determinaban los residuos tridimensional de XynB de los aminoácidos
mutagenizados y como éstas podrían afectar catalíticos E241 y E134 (azul) en el surco
catalítico, y del glutámico mutagenizado E137D
positivamente a la termoestabilidad de la (púrpura). Se aprecia claramente como este
aminoácido no forma parte del surco catalítico.
enzima XynB, se localizó la posición de las
mutaciones estudiadas sobre la estructura E137D) o en la frontera entre estructuras en
tridimensional obtenida por cristalografía de la hélice α y bucles (M93V y D323N), lo cual es
xilanasa B. consistente con el hecho de que los bucles son
Se observó que todas las mutaciones las regiones de los barriles (α/β)8 con una
caracterizadas quedaban en regiones de mayor variabilidad en secuencia y donde más
plegamiento superficial, bastante alejadas del cambios aminoacídicos pueden darse sin que
centro activo (Figura IV.2.21). La única de las se produzca un cambio deletéreo en la enzima
mutaciones que presentaba cierta proximidad (Sanz-Aparicio et al., 1998).
al centro activo era la mutación E137D,
cercana a nivel de estructura primaria al Al estudiar con más detalle las regiones (el
aminoácido catalítico E134. Sin embargo, en entorno) en que se encuentran las dos mejores
la representación de la superficie de la mutaciones, S15L y M93V, se observa como,
proteína, se puede constatar como el en el caso de la mutación S15L, la serina en
aminoácido en esta posición no interviene en posición 15 de la proteína salvaje está
el surco catalítico de la enzima (Figura D.2.3); estabilizada por 3 puentes de hidrógeno con
además del hecho de que se trata de un cambio otros residuos polares de su entorno (Y12, N14
conservativo (glutámico por aspártico, ambos y R282). Su sustitución por leucina en las
aminoácidos ácidos) y por tanto suponemos mutantes imposibilita dos de estos puentes de
que no son de esperar grandes alteraciones de hidrógeno: los que se establecían con Y12 y
cargas o en los enlaces salinos de esta región con R282 (Figura D.2.4).
cercana al centro activo. Sin embargo, la leucina en las xilanasas
También cabe remarcar que todas las mutantes puede establecer interacciones
mutaciones se sitúan en bucles (S15L y hidrofóbicas con los anillos aromáticos de
163

temperaturas cuando está situada en regiones


superficiales, hecho que llevaría a la
R282 N14
inactivación irreversible de la enzima (Estell
S15 et al., 1985; Glazer y Nikaido, 1995;
Arrizubieta y Polaina, 2000; Koc y Gladyshev
Y12
2007). Por el contrario estas modificaciones
F16
químicas no podrían darse sobre la valina de
las mutantes M93V, de manera que la

S15L
15L

R282
N14

L15 M93
F94

Y12
P90
F16
W92

Figura D.2.4: Entorno del residuo en posición 15


de XynB. Se muestra tanto la enzima original
M93V
93V
donde es una serina la que ocupa esta posición
(arriba, modelo obtenido por cristalografía), como
el resultado de sustituir dicha serina por leucina
(abajo, modelo obtenido por manipulación
informática). En ambos casos se marcan los
puentes de hidrógeno en línea discontinua de color
verde.

aminoácidos de su entorno, Y12 y F16,


V93
F94
permitiendo un plegamiento más compacto en
P90
esta zona (Akanuma et al., 1999).
W92

En el caso de la mutación M93V, la situación


es diferente. Aquí no se pierden puentes de
hidrógeno al cambiar la metionina en posición
93 por valina (Figura D.2.5). Figura D.2.5: Entorno de la metionina en posición
Sin embargo, se ha descrito para otras enzimas 93 en la proteína salvaje (arriba, modelo obtenido
por cristalografía), y entorno resultante al sustituir
que la metionina es químicamente lábil y dicha metionina por valina (abajo, modelo
obtenido por manipulación informática). En ambos
propensa a la oxidación o desaminación a altas casos se muestra el único puente de hidrógeno de
la región en línea discontinua de color verde.
164

sustitución de metionina por valina permitiría A partir de los resultados de los estudios
una mayor estabilidad de la xilanasa frente a la cinéticos que se realizaron con las xilanasas
temperatura. Además, esta sustitución podría mutantes, se observa que a pesar de las
mejorar el empaquetamiento de esta región importantes diferencias en cuanto a
debido a las mejores interacciones termoestabilidad de estas proteínas, la
hidrofóbicas con los aminoácidos del entorno, constante de Michaelis (KM) de éstas no
W92 y F99, que puede establecer la valina al presenta grandes diferencias respecto a la KM
presentar ésta una cadena lateral ramificada de la xilanasa B salvaje; aunque sí que se
(Arrizubieta y Polaina, 2000; Wu et al., 2007). aprecia una ligera reducción de esta constante
en el caso de las enzimas mutantes más
Para comprobar si estas modificaciones termorresistentes, especialmente en la doble
aminoacídicas producían algún tipo de cambio mutante S15L/M93V, lo que indicaría un
en la estructura secundaria respecto a la de la pequeño aumento de la afinidad (1/KM) de
xilanasa B salvaje, se hicieron análisis de estas mutantes por el sustrato.
dicroísmo circular. Sin embargo, la constante catalítica (KCAT) aun
En los resultados obtenidos no se observaron siendo muy similar entre todas las xilanasas
variaciones significativas alrededor de los mutantes, resulta ser muy superior (alrededor
220 nm que permitieran inferir posibles de un orden de magnitud) a la KCAT de la
diferencias en la estructura secundaria (en el xilanasa B salvaje. Esto significa que a pesar
grado de α-helipticidad o de contenido en de que no se ha modificado de manera
conformación hélice α) (Hurlbert y Preston, apreciable la afinidad en las mutantes, sí que
2001). Asimismo, las ligeras diferencias en la ha aumentado la cantidad de moléculas de
desviación de la luz encontradas en la zona de sustrato que una molécula de enzima mutante
230 nm entre la xilanasa B salvaje y la doble puede convertir en producto por unidad de
mutante (Figura IV.2.22), serían debidas a tiempo.
cambios puntuales causados por la Cabe destacar el caso de la doble mutante
reorganización de los residuos aromáticos en XynB E137D/D323N, cuya termoestabilidad
el entorno de los aminoácidos mutados. es muy similar a la de la xilanasa B salvaje,
En cualquier caso, tal como ha sido descrito pero que, a pesar de tener la KM más parecida a
previamente (Akanuma et al., 1999), son la de la enzima salvaje, presenta los valores de
posibles aumentos en la termorresistencia KCAT más elevados. Esto es debido a su alta
mediante pequeños cambios aminoacídicos sin VMáx en relación a la baja concentración de
que ello conlleve cambios aparentes en la enzima utilizada.
estructura básica de las proteínas. Resultados en el mismo sentido que para la
KCAT se obtuvieron al calcular la eficacia
165

catalítica (KCAT/KM): todas las xilanasas 3. APLICACIÓN DE LAS XILANASAS


mutantes presentan valores similares de
ESTUDIADAS EN EL BLANQUEO DE LA
eficiencia catalítica, que son a su vez muy
superiores a la eficiencia catalítica de la PASTA DE PAPEL

xilanasa B salvaje. En el anexo I del presente trabajo se recogen


los resultados obtenidos de la aplicación de las
Se han conseguido pues no sólo aumentos en xilanasas YnfF y XynA de Bacillus sp. BP-7, y
la termoestabilidad de algunas de las xilanasas XynB de Paenibacillus barcinonensis, en
mutantes, sino también aumentos en la estudios de blanqueo de pasta de papel.
eficiencia catalítica. Los resultados papeleros mostrados ponen de
Cambios aminoacídicos similares, que no manifiesto la diferente efectividad de las
afectan a residuos de la hendidura catalítica xilanasas microbianas en el blanqueo de pastas
pero que sin embargo producen cambios en la de papel (Elegir et al., 1995; Vicuña et al.,
capacidad catalítica de una enzima, han sido 1995; Clarke et al., 1997). Así, mientras XynB
previamente descritos (Oue et al., 1999; no produjo mejoras apreciables, la aplicación
Shimotohno et al., 2001); y pueden resultar de de YnfF y sobre todo de XynA permitieron
gran utilidad para el diseño de estrategias de obtener mejoras notables en la blancura del
mutagénesis dirigida orientadas a modificar la papel.
funcionalidad de la enzimas, debido a la
demostrada importancia funcional que tienen Es de destacar que la xilanasa más eficiente,
también los residuos que no forman parte del XynA, pertenece a la familia 11, a la cual
centro activo. también pertenecen la mayoría de las xilanasas
utilizadas a nivel industrial para el blanqueo
Actualmente se está llevando a cabo la del papel.
cristalización de la doble mutante S15L/M93V Es también importante mencionar los buenos
para comprobar las hipótesis de mejora de resultados de la xilanasa YnfF en la
plegamiento propuestas. Asimismo, con la potenciación del blanqueo. Esta enzima
estructura de la doble mutante obtendremos un pertenece a la familia 5 de glicosil hidrolasas,
mayor conocimiento de XynB, que podría ser de la que no se han descrito ensayos papeleros
utilizado para mejorar su potencial hasta el momento. Sin embargo, tal como se ha
biotecnológico. descrito en este trabajo, se trata de una
xilanasa que únicamente presenta actividad
sobre xilanos desprovistos de arabinosa, lo que
puede resultar de importancia para el blanqueo
de pastas de maderas duras, como la de
166

eucalipto, que es la materia prima más


importante en la industria papelera española.

Actualmente se están llevando a cabo nuevos


ensayos para cuantificar la efectividad
potenciadora del blanqueo de XynA e YnfF en
nuevas secuencias ECF (elemental chlorine
free) y en secuencias TCF (total chlorine free).
Estos ensayos también pretenden determinar la
contribución de estas enzimas a la disminución
de la dosis de blanqueantes químicos
necesarios (especialmente derivados clorados)
y evaluar así la reducción en la generación de
AOX, altamente contaminantes.
En este sentido, sería también de interés la
utilización de la xilanasa doble mutante
XynB S15L/M93V en ensayos papeleros, para
comprobar si su aplicación a las pastas
papeleras a temperaturas más altas y durante
más tiempo, gracias a su aumentada
termoestabilidad, permite mejorar los
resultados obtenidos hasta el momento con la
xilanasa B salvaje.
CONCLUSIONES
169

1.- Se han clonado e identificado 3 enzimas que se encuentran clasificadas en la


degradadoras de xilano de la cepa familia 43 de glicosil hidrolasas.
Bacillus sp. BP-7: XynA, YnfF y XynD. 7.- La enzima XynB de Paenibacillus
2.- La xilanasa XynA de Bacillus sp. BP-7 barcinonensis es una xilanasa de la
presenta máxima actividad sobre xilano de familia 10 con elevada actividad sobre
madera de haya. Es una enzima homóloga xilanos y sobre aril-xilósidos.
a las xilanasas del subgrupo de pI alcalino 8.- Se ha clonado y expresado la xilanasa
y bajo peso molecular de la familia 11. XynB de Paenibacillus barcinonensis en
3.- Los resultados del análisis de uso de cepas de Bacillus subtilis. La máxima
codón en XynA de Bacillus sp. BP-7 producción se ha obtenido con la cepa
sugieren que la enzima, altamente recombinante B. subtilis
conservada en especies del género MW15/pRBSPO2X20, que contiene el
Bacillus, posiblemente ha sido adquirida gen xynB bajo el control del promotor
por transferencia horizontal de genes entre SPO2.
especies relacionadas de dicho género. 9.- Los estudios de localización celular
4.- Se ha conseguido diseñar un sistema indican que XynB de Paenibacillus
basado en la proteína Pir4 de barcinonensis es un xilanasa intracelular.
Saccharomyces cerevisiae para la Su detección en sobrenadantes de cultivos
expresión y direccionamiento de la viejos es debida a lisis celular y no a
xilanasa XynA de Bacillus sp. BP-7 a la auténtica secreción.
pared celular de levaduras o al medio de 10.- La xilanasa XynB de Paenibacillus
extracelular, como primer paso hacia su barcinonensis junto con otras 6 xilanasas
posible utilización biotecnológica en la altamente homólogas de la familia 10
industria alimentaria. forman un nuevo subgrupo de xilanasas
5.- La xilanasa YnfF de Bacillus sp. BP-7 es dentro de dicha familia. Las características
una de las pocas xilanasas descritas hasta comunes de estas xilanasas son la
el momento en la familia 5 de glicosil ausencia de péptido señal, y la presencia
hidrolasas. YnfF presenta actividad sobre de 2 secuencias conservadas, regiones A y
xilanos con ramificaciones de ácido B, no presentes en el resto de xilanasas de
metil glucurónico pero es inactiva sobre la familia 10.
xilanos con ramificaciones de arabinosa. 11.- La estructura tridimensional de la
6.- La enzima XynD de Bacillus sp. BP-7 xilanasa B de Paenibacillus
presenta alta homología con enzimas con barcinonensis, determinada por métodos
actividad xilanasa y arabinofuranosidasa cristalográficos, es un barril (α/β)8, como
170

en el resto de las xilanasas de la familia 15.- La aplicación en el blanqueo de pastas de


10. La hendidura catalítica muestra 4 papel de las xilanasas YnfF y XynA de
subsitios de unión al sustrato claramente Bacillus sp. BP-7 permite obtener mejoras
definidos, y sugiere la existencia de 3 notables en la blancura del papel.
subsitios adicionales. Es importante la
presencia de una cavidad a nivel del
subsitio +2, que permitiría acomodar
sustituyentes laterales como ácido
metil glucurónico. También es de gran
importancia el bucle L7, que contiene la
región conservada B, para determinar la
conformación del centro activo de la
xilanasa.

12.- Mediante evolución dirigida se han


obtenido 4 mutantes termoestables de
XynB de Paenibacillus barcinonensis,
cada una de ellas con una de las siguientes
sustituciones: E137D, D323N, S15L y
M93V. Las variantes con las mutaciones
S15L y M93V presentan una vida media
claramente superior a la xilanasa salvaje.

13.- La combinación de las 2 mutaciones más


efectivas (S15L y M93V) en un doble
mutante S15L/M93V origina una xilanasa
con una vida media a 50 ºC incrementada
más de 20 veces respecto a la enzima
salvaje; hacho que se debería a un efecto
sinérgico de las mutaciones introducidas.

14.- Además de los aumentos en la


termoestabilidad de las xilanasas mutantes
se han conseguido también aumentos en la
eficiencia catalítica (KCAT/KM) de estas
enzimas.
BIBLIOGRAFÍA
173

A Andrés, I., Gallardo, O., Parascandola, P.,


Javier Pastor, F.I. y Zueco, J. (2005) Use of
the cell wall protein Pir4 as a fusion partner
Ahuja, S.K., Ferreira, G.M. y Moreira, A.R.
for the expression of Bacillus sp. BP-7
(2004) Utilization of enzymes for
xylanase A in Saccharomyces cerevisiae.
environmental applications. Critical Reviews
Biotechnology and Bioengineering 89 (6):
in Biotechnology 24 (2-3): 125-154.
690-697.

Akanuma, S., Yamagishi, A., Tanaka, N. y


Arias, M.E., Arenas, M., Rodriguez, J.,
Oshima, T. (1999) Further improvement of the
Soliveri, J., Ball, A.S. y Hernandez, M. (2003)
thermal stability of a partially stabilized
Kraft Pulp Biobleaching and Mediated
Bacillus subtilis 3-isopropylmalate
Oxidation of a Nonphenolic Substrate by
dehydrogenase variant by random and site-
Laccase from Streptomyces cyaneus CECT
directed mutagenesis. European Journal of
3335. Applied and Environmental
Biochemistry / FEBS 260 (2): 499-504.
Microbiology 69 (4): 1953-1958.

Alonso, J.C. y Tailor, R.H. (1987) Initiation of


Arrizubieta, M.J. y Polaina, J. (2000)
plasmid pC194 replication and its control in
Increased thermal resistance and modification
Bacillus subtilis. Molecular and General
of the catalytic properties of a beta-
Genetics 210 (3):476-484.
glucosidase by random mutagenesis and in
vitro recombination. The Journal of Biological
Altschul, S.F., Madden, T.L., Schäffer, A.A.,
Chemistry 275 (37): 28843-28848.
Zhang, J., Zhang, Z., Miller W. y Lipman, D.J.
(1997), Gapped BLAST and PSI-BLAST: a
new generation of protein database B
searchprograms. Nucleic Acids Research
25:3389-3402. Baba, T., Shinke, R. y Nanmori, T. (1994)
Identification and characterization of
Andrés, I. (2003) Inmovilización de ligandos, clustered genes for thermostable xylan-
enzimas y antígenos recombinantes en la degrading enzymes, β-xylosidase and
pared celular de Saccharomyces cerevisiae xylanase, of Bacillus stearothermophilus 21.
mediante técnicas de ingeniería genética. Applied and Enviromental Microbiology 60
Tesis Doctoral. Director Zueco, J. (7): 2252-2258.
Departamento de Microbiología y Ecologia,
Facultad de Farmacia, Universidad de Bairoch, A. y Apweiler, R. (2000) The SWISS-
Valencia. PROT protein sequence database and its
174

supplement TrEMBL in 2000. Nucleic Acids Applied Microbiology and Biotechnology 56


Research 28: 45-48. (3-4): 326-338.

Bajpai, P. (2004) Biological bleaching of Beychok, S. (1966) Circular dichroism of


chemical pulps. Critical Reviews in biological macromolecules. Science 154
Biotechnology 24 (1): 1-58. (754): 1288-1299.

Bayer, E.A., Shoham, Y. y Lamed, R. (2000) Biely, P. (1985). Microbial xylanolytic


Cellulose-decomposing prokaryotes and their systems. Trends in Biotechnology 3: 286-290.
enzyme system. En The Prokaryotes: An
Evolving Electronic Resource for the Biely, P., Vrsanska, M., Tenkanen, M. y
Microbiological Comunity, 3rd edn. Dworkin, Kluepfel, D. (1997) Endo-β-1,4-xylanase
M., Falcow, S., Rosenberg, E., Schleifer, K.H., families: differences in catalytic properties.
y Stackbrandt, E., eds. Springer, New York. Journal of Biotechnology 57 (1-3): 151-166.

Bayer, E.A., Belaich, J., Shoham, Y., y Biely, P., Mislovičová, D., Toman, R. (1998)
Lamed, R. (2004) The cellulosomes: Remazol Brilliant Blue-Xylan: a soluble
multienzyme machines for degradation of chromogenic substrate for xylanase. Methods
plant cell wall polysaccharides. Annual in Enzymology 160: 536-541.
Review of Microbiology 58: 521-54.
Bhat, M.K. (2000) Cellulases and related
Bedford, M.R. y Classen, H.L. (1992) enzymes in biotechnology. Biotechnology
Reduction of intestinal viscosity through Advances 18 (5): 355-383.
manipulation of dietary rye and pentosanase
concentration is effected through changes in Black, G.W., Hazlewood, G.P., Millward-
the carbohydrate composition of the intestinal Sadler, S.J., Laurie, J.I. y Gilbert, H.J. (1995)
aqueous phase and results in improved growth A modular xylanase containing a novel non-
rate and food conversion efficiency of broiler catalytic xylan-specific binding domain. The
chicks. The Journal of Nutrition 122 (3): 560- Biochemical Journal 307: 191-195.
569.
Blanco, A. y Pastor, F.I.J. (1993)
Beg, Q.K., Kapoor, M., Mahajan, L. y Characterization of cellulase-free xylanases
Hoondal, G.S. (2001) Microbial xylanases and from the newly isolated Bacillus sp. Strain
their industrial applications: a review. BP-23. Canadian Journal of Microbiology 39:
1162-1166.
175

Blanco, A., Vidal, T., Colom, J.F. y Pastor, Boraston, A.B., Bolam, D.N., Gilbert, H.J. y
F.I.J. (1995) Purification and Properties of Davies, G.J. (2004) Carbohydrate-binding
Xylanase A from Alkali-Tolerant Bacillus sp. modules: fine-tuning polysaccharide
Strain BP-23. Applied and Environmental recognition. The Biochemical Journal 382:
Microbiology 61 (12): 4468-4470. 769-781.

Blanco, A., Diaz, P., Martínez, J., López, O., Bourbonnais, R., Paice, M.G., Freiermuth, B.,
Soler, C. y Pastor, F.I.J. (1996) Cloning of a Bodie, E. y Borneman, S. (1997) Reactivities
Bacillus sp. BP-23 gene encoding a xylanase of Various Mediators and Laccases with Kraft
with high activity against aryl xylosides. Pulp and Lignin Model Compounds. Applied
FEMS Microbiology Letters 137: 285-290. and Environmental Microbiology 63 (12):
4627-4632.
Blanco, A., Díaz, P., Zueco, J., Parascandola,
P. y Javier Pastor, F.I. (1999) A multidomain Bru, C., Courcelle, E., Carrere, S., Beausse,
xylanase from a Bacillus sp. with a region Y., Dalmar, S. y Kahn, D. (2005) The ProDom
homologous to thermostabilizing domains of database of protein domain families: more
thermophilic enzymes. Microbiology 145 (8): emphasis on 3D. Nucleic Acids Research 33
2163-2170. (suppl_1): D212-215.

Bolhuis, A., Tjalsma, H., Smith, H.E., De Buchert, J., Bergnor, E., Lindblad, G., Viikari,
Jong, A. Meima, R., Venema, G., Bron, S. y L. y Ek, M. (1997) Significance of xylan and
Van Dijl, J.M. (1999) Evaluation of glucomannan in the brightness reversion of
bottlenecks in the late stages of protein kraft pulps. TAPPI Journal 80 (6): 165–171.
secretion in Bacillus subtilis. Applied and
Environmental Microbiology 65: 2934-2941. Bulheller, B.M., Rodger, A. y Hirst, J.D.
(2007) Circular and linear dichroism of
Bolivar, F., Rodriguez, R.L., Greene, P.J., proteins. Physical Chemistry Chemical
Betlach, M.C., Heyneker, H.L. y Boyer, H.W. Physics 9 (17): 2020-2035.
(1977) Construction and characterization of
new cloning vehicles. II. A multipurpose Bullock, W.O., Fernández, J.M. y Short, J.M.
cloning system. Gene 2 (2): 95-113. (1987) XL1-Blue: A high efficiency plasmid
transforming recA Escherichia coli strain with
Bolivar, F. y Backman, K. (1979) Plasmids of beta-galactosidase selection. Biotechniques 5:
Escherichia coli as cloning vectors. Methods 376-377.
in Enzymology 68: 245-67.
176

C Cho, S.G. y Choi, Y.J. (1999) Catabolite


repression of the xylanase gene (xynA)
expression in Bacillus stearothermophilus no.
Clarke, J.H., Davidson, K., Gilbert, H.J.,
236 and B. subtilis. Bioscience,
Fontes, C.M.G.A. y Hazlewood, G.P. (1996) A
Biotechnology, and Biochemistry 63 (12):
modular xylanase from mesophilic
2053-2058.
Cellulomonas fimi contains the same
cellulose-binding and thermostabilizing
Chothia, C. y Lesk, A.M. (1986) The relation
domains as xylanases from thermophilic
between the divergence of sequence and
bacteria. FEMS Microbiology Letters 139 (1):
structure in proteins. The EMBO Journal 5
27-35.
(4): 823-826.

Clarke, J.H., Rixon, J.E., Ciruela, A., Gilbert,


Christov, L., Biely, P., Kalogeris, E.,
H.J. y Hazlewood, G.P. (1997) Family-10 and
Christakopoulos, P., Prior, B.A. y Bhat, M.K.
Family-11 xylanases differ in their capacity to
(2000) Effects of purified endo-[beta]-1,4-
enhance the bleachability of hardwood and
xylanases of family 10 and 11 and acetyl xylan
softwood paper pulps. Applied Microbiology
esterases on eucalypt sulfite dissolving pulp.
and Biotechnology 48(2): 177-183.
Journal of Biotechnology, 83 (3): 231-244.

Chanda, S.K., Hirst, E.L., Jones, J.K.N. y


Cohen, S.N. y Chang, S. (1979) High
Percival, E.G.V. (1950) The constitution of
frequency transformation of Bacillus subtilis
xylan from esparto grass (Stipa tenacissima,
protoplasts by plasmid DNA. Molecular and
L.). Journal of the Chemical Society: 1289-
General Genetics 168: 111-115.
1297.

Cohen, S.N., Chang, A.C.Y. y L. Hsu. (1972)


Cheng, J., Randall, A.Z., Sweredoski, M.J. y
Nonchromosomal antibiotic resistance in
Baldi, P. (2005) SCRATCH: a protein
bacteria: Genetic transformation in
structure and structural feature prediction
Escherichia coli by R-factor DNA. Biochemica
server. Nucleic Acids Research 33 (suppl_2):
et Biophysica Acta 69: 2110.
W72-76.

Collins, T., Gerday, C. y Feller, G. (2005)


Cho, S. y Choi, Y. (1995) Nucleotide sequence
Xylanases, xylanase families and
analysis of an endo- xylanase gene (xynA)
extremophilic xylanases. FEMS Microbiology
from Bacillus stearothermophilus. Journal of
Reviews 29 (1): 3-23.
Microbiology and Biotechnology 5:117-124.
177

Coughlan, M.P. y Hazlewood, G.P. (1993). Debeche, T., Cummings, N., Connerton, I.,
β− 1,4-D-xylan-degrading enzyme systems: Debeire, P. y O'Donohue, M.J. (2000) Genetic
biochemistry, molecular biology and and biochemical characterization of a highly
applications. Biotechnology and Applied thermostable alpha-L-arabinofuranosidase
Biochemistry 17: 259-289. from Thermobacillus xylanilyticus. Applied
and Enviromental Microbiology 66 (4): 1734-
Coughlan, M.P., Tuohy, M.G., Filho, E.X.F., 1736.
Puls, J., Claeyssens, M., Vrsanská, M. y
Hughes, M.M. (1993) Enzymological aspects Dekker, R.F.H. (1989) Biodegradation of the
of microbial hemicellulases with emphasis on hetero-1,4-linked xylans. En Plant Cell Wall
fungal systems. En Hemicelluloses and Polymers. pp. 619-629. Lewis, N.G. y M.G.
hemicellulases. pp. 53-84. Coughlan M.P y Paice, eds. American Chemical Society,
Hazlewood G.P, eds. Portland Press, London Washington.
and Chapel Hill.
Delmer D.P. y Amor Y. (1995) Cellulose
Coutinho, P.M. y Henrissat, B. (1999) byosinthesis. Plant Cell 7 (7): 987-1000.
Carbohydrate-active enzymes: an integrated
database approach. En Recent Advances in De Vries, R.P., Visser, J. y De Graaff, L.H.
Carbohydrate Bioengineering. pp. 3-12. (1999) CreA modulates the XlnR-induced
Gilbert, H.J., Davies, G.S., Henrissat, B., y expression on xylose of Aspergillus niger
Svensson. B., eds. The Royal Society of genes involved in xylan degradation. Research
Chemistry, Cambridge. in Microbiology 150 (4): 281-285.

Cuff, J.A. y Barton, G.J. (2000) Application of De Vries, R.P., Kester, H.C.M., Poulsen, C.H.,
multiple sequence alignment profiles to Benen, J.A.E. y Visser, J. (2000) Synergy
improve protein secondary structure between enzymes from Aspergillus involved in
prediction. Proteins 40 (3): 502-511. the degradation of plant cell wall
polysaccharides. Carbohydrates Research 327:

D 401-410.

De Vries, R.P. y Visser, J. (2001) Aspergillus


Davies, G. y Henrissat, B. (1995) Structures
enzymes involved in degradation of plant cell
and mechanisms of glycosyl hydrolases.
wall polysaccharides. Microbiology and
Structure 3 (9): 853-859.
Molecular Biology Reviews 65: 497-522.
178

E Bateman, A. (2006) Pfam: clans, web tools


and services. Nucleic Acids Research 34
(suppl_1): D247-D251
Eda, S., Ohnishi, A. y Katõ, K. (1976) Xylan
isolaed from the stalk of Nicotiana tabacum.
Fontes, C.M., Gilbert, H.J., Hazlewood, G.P.,
Agricultural and Biological Chemistry 40:
Clarke, J.H., Prates, J.A., McKie, V.A., Nagy
359-364.
T., Fernandes, T.H. y Ferreira, L.M. (2000) A
novel Cellvibrio mixtus family 10 xylanase
Elegir, G., Sykes, M. y Jeffries, T.W. (1995)
that is both intracellular and expressed under
Differential and synergistic action of
non-inducing conditions. Microbiology 146:
Streptomyces endoxylanases in prebleaching
1959-1967.
of kraft pulps. Enzyme and Microbial
Technology 17 (10): 954-959.
Fry, S.C. (2001) The Growing Plant Cell
Wall: Chemical and Metabolic Analysis. The
Estell, D., Graycar, T. y Wells, J. (1985)
Blackburn Press.
Engineering an enzyme by site-directed
mutagenesis to be resistant to chemical
Fu, L.L., Xu, Z.R., Li, W.F., Shuai, J.B., Lu,
oxidation. The Journal of Biological
P. y Hu, C.X. (2007). Protein secretion
Chemistry, 260 (11): 6518-6521.
pathways in Bacillus subtilis: Implication for
optimization of heterologous protein secretion.
F
Biotechnology Advances 25 (1): 1-12.

Ferrari, E., Jarnagin, A.S. y Schmidt, B.F.


Fujimoto, Z., Kuno, A., Kaneko, S., Yoshida,
(1993) Commercial production of
S., Kobayashi, H., Kusakabe, I. y Mizuno, H.
extracellular enzymes. En Bacillus subtilis and
(2000) Crystal structure of Streptomyces
other Gram-positive bacteria. Biochemistry,
olivaceoviridis E-86 β-xylanase containing
physiology and molecular genetics. pp. 917-
xylan-binding domain. Journal of Molecular
937. Sonenshein, A.L., Hoch, J.A. y Losick,
Biology 300(3): 575-585.
R., eds. American Society for Microbiology,
Washington.
Fukumura, M., Sakka, K., Shimada, K. y
Ohmiya, K. (1995) Nucleotide sequence of the
Finn, R.D., Mistry, J., Schuster-Bockler, B.,
Clostridium stercorarium xynB gene encoding
Griffiths-Jones, S., Hollich, V., Lassmann, T.,
an extremely thermostable xylanase, and
Moxon, S., Marshall, M., Khanna, A., Durbin,
characterization of the translated product.
R., Eddy, S.R., Sonnhammer, E.L.L. y Alex
179

Bioscience, Biotechnology and Biochemistry substrate. Applied and Environmental


59 (1): 40-46. Microbiology 61 (12): 4403-4408.

Fukusaki, E., Panbangred, W., Shinmyo, A. y Gibbs, M.D., Reeves, R.A., Farrington, G.K.,
Okada, H. (1984) The complete nucleotide Anderson, P., Williams, D.P. y Bergquist, P.L.
sequence of the xylanase gene (xynA) of (2000) Multidomain and multifunctional
Bacillus pumilus. FEBS Letters 171:197-201 glycosyl hydrolases from the extreme
thermophile Caldicellulosiruptor isolate
G Tok7B.1. Current Microbiology 40 (5): 333-
340.

Ganga, M.A., Pinaga, F., Valles, S., Ramon,


Gilkes, N.R., Henrissat, B., Kilburn, D.G.,
D. y Querol, A. (1999) Aroma improving in
Miller Jr., R.C y. Warren, R.A.J. (1991)
microvinification processes by the use of a
recombinant wine yeast strain expressing the Domains in microbial β-1,4-glicanases:
Aspergillus nidulans xlnA gene. International sequence conservation, function and enzyme

Journal of Food Microbiology 47 (3): 171-178. families. Microbiological Reviews 55: 303-
315.

Garcia-Vallvé, S., Palau, J. y Romeu, A.


(1999) Horizontal gene transfer in glycosyl Glazer, A. y Nikaido, H. (1995) Genetic

hydrolases inferred from codon usage in Engineering of Subtilisin. En Microbial

Escherichia coli and Bacillus subtilis. Biotechnology: Fundamentals of Applied

Molecular Biology and Evolution 16 (9): Microbiology. pp 257-259. W.H. Freeman

1125-1134. And Company, New York.

Gasteiger, E., Gattiker, A., Hoogland, C., Godessart, N., Muñoa, F. J., Regue, M. y

Ivanyi, I., Appel, R.D. y Bairoch, A. (2003) Juárez, A. (1988) Chromosomal mutations

ExPASy: the proteomics server for in-depth that increase the production of a plasmid-

protein knowledge and analysis. Nucleic Acids encoded haemolysin in Escherichia coli.

Research 31 (13): 3784-3788. Journal of General Microbiology 134 (10):


2779-87.

Gibbs, M.D., Reeves, R.A. y Bergquist, P.L.


(1995) Cloning, sequencing, and expression of González Arzola, K., Polvillo, O., Arias, M.E.,

a xylanase gene from the extreme thermophile Perestelo, F., Carnicero, A., González-Vila,

Dictyoglomus thermophilum Rt46B.1 and F.J., y Falcón, M.A. (2006) Early attack and

activity of the enzyme on fiber-bound subsequent changes produced in an industrial


180

lignin by a fungal laccase and a laccase- Harwood, C.R., Coxon R.D. y Hancock, I.C.
mediator system: an analytical approach. (1990). The Bacillus cell envelope and
Applied Microbiology and Biotechnology 73 secretion. Molecular biological methods for
(1), 141-150. Bacillus. pp. 327-390. Harwood, C.R. y
Cutting, S.M., ed. John & Sons Ltd, England.
Goodwin, T.W. y Mercer, E.I. (1990) The
plant cell wall. En Introduction to Plant Harwood, C.R. (1992) Bacillus subtilis and its
Biochemistry. pp. 55-91. Goodwin, T.W. y relatives: molecular biological and industrial
Mercer, E.I., eds. Pergamon Press, Oxford. workhorses. Trends in Biotechnology 10 (7):
247-256.
Gosalbes, M.J., Perez-Gonzalez, J.A.,
Gonzalez, R. y Navarro, A. (1991) Two beta- Hatti-Kaul, R., Mattiasson, B., Martinez, A.,
glycanase genes are clustered in Bacillus Delgado, O. y Mamo, G. (2006) Cloning,
polymyxa: molecular cloning, expression, and Sequence Analysis, and Expression of a Gene
sequence analysis of genes encoding a Encoding an Endoxylanase From Bacillus
xylanase and an endo-beta-(1,3)-(1,4)- halodurans S7. Molecular Biotechnology 33
glucanase. Journal of Bacteriology 173 (23): (2): 149-160.
7705-7710.
Henrissat, B. (1991). A classification of
H glycosyl hydrolases based on amino acid
sequence similarities. The Biochemical
Journal 280: 309-316.
Hanahan, D. (1983) Studies on transformation
of Escherichia coli with plasmids. Journal of
Henrissat, B. y Bairoch, A. (1996) Updating
Molecular Biology 166 (4): 557-580.
the sequence-based classification of glycosyl
hydrolases. The Biochemical Journal 316:
Hames, B.D. y Rickwood, D. (1981) Gel
695-696.
electrophoresis of proteins. A practical
approach. IRL Press Ltd, Oxford.
Heredia, A., Jiménez, A. y Guillén, R. (1995).
Composition of plant cell wall. Zeitschrift für
Hancock, S.M., Vaughan, M.D. y Withers,
Lebensmittel-untersuchung und-Forschung
S.G. (2006). Engineering of glycosidases and
200: 24-31.
glycosyltransferases. Current Opinion in
Chemical Biology 10 (5): 509-519.
Hernández, L.M., Ballou, L., Alvarado, E.,
Gillece-Castro, B., Burlingame, A.L. y Ballou,
181

C.E. (1989) A new Saccharomyces cerevisiae and Environmental Microbiology 60 (3): 763-
mnn mutant N-linked oligosaccharide 770.
structure. The Journal of Biological Chemistry
264 (20): 11849-11856. Irwin, D., Shin, D., Zhang, S., Barr, B.K.,
Sakon, J., Karplus, P.A. y Willson, D.B.
Hoch, J.A. (1991) Genetic analysis in Bacillus (1998) Roles of the Catalytic Domain and Two
subtilis. Methods in Enzymology 204: 305-320 Cellulose Binding Domains of
Thermomonospora fusca E4 in Cellulose
Honda, Y. y Kitaoka, M. (2004) A Family 8 Hydrolysis. Journal of Bacteriology 180 (7):
Glycoside Hydrolase from Bacillus halodurans 1709-1714.
C-125 (BH2105) Is a Reducing End Xylose-
releasing Exo-oligoxylanase. The Journal of J
Biological Chemistry 279 (53): 55097-55103.

Jiang, Z., Zhu, Y., Li, L., Yu, X., Kusakabe, I.,
Hoondal, G.S., Tiwari, R.P., Tewari, R.,
Kitaoka, M. y Hayashi, K. (2004)
Dahiya, N. y Beg, Q.K. (2002) Microbial
Transglycosylation reaction of xylanase B
alkaline pectinases and their industrial
from the hyperthermophilic Thermotoga
applications: a review. Applied Microbiology
maritima with the ability of synthesis of
and Biotechnology 59 (4): 409-418.
tertiary alkyl β-xylobiosides and xylosides.
Journal of Biotechnology 114 (1-2): 125-134.
Hurlbert, J.C. y Preston, J.F. (2001)
Functional characterization of a novel
Jiang, Z., Dang, W., Yan, Q., Zhai, Q., Li, L. y
xylanase from a corn strain of Erwinia
Kusakabe, I. (2006) Subunit composition of a
chrysanthemi. Journal of Bacteriology 183 (6):
large xylanolytic complex (xylanosome) from
2093-2100.
Streptomyces olivaceoviridis E-86. Journal of
Biotechnology 126 (3): 304-312.
Hwang, J. y Warshel, A. (1988) Why ion pair
reversal by protein engineering is unlikely to
Jeffries, T.W. (1983) Utilization of xylose by
succeed. Nature 334 (6179): 270-272.
bacteria, yeasts, and fungi. En Pentoses and
Lignin. pp 1-32 Advances in biochemical
I Engineering/Biotechnology 27. Springer,
Berlin.
Irwin, D., Jung, E.D. y Wilson, D.B. (1994)
Characterization and sequence of a Jeong, K.J., Park, I.Y., Kim, M.S. y Kim, S.C.
Thermomonospora fusca xylanase. Applied (1998) High-level expression of an
182

endoxylanase gene from Bacillus sp. in Kawamura, S., Abe, Y., Ueda, T., Masumoto,
Bacillus subtilis DB104 for the production of K., Imoto, T., Yamasaki, N. y Kimura, M.
xylobiose from xylan. Applied Microbiology (1998) Investigation of the Structural Basis for
and Biotechnology 50 (1): 113-118. Thermostability of DNA-binding Protein HU
from Bacillus stearothermophilus. The Journal
Joseleau, J.P., Comtat, J. y Ruel, K. (1992). of Biological Chemistry 273 (32): 19982-
Chemical structure of xylans and their 19987.
interaction in the plant cell wall. En Xylans
and xylanases. pp. 1-15. Visser, J., Beldman, Khandke, K.M., Vithayathil, P.J. y Murthy,
G., Kusters-van Someren, M.A. y A.G.J. S.K. (1989) Purification and characterization
Voragen, eds. Elsevier Science Publishers, of an α-D-glucuronidase from a thermophilic
Amsterdam. fungus, Thermoascus aurantiacus. Archives of
Biochemistry and Biophysics 274: 511-517.
Ju-Hyun, Y., Park, Y.S., Yum, D.Y., Kim,
J.M., Kong, I.S. y Bai, D.H. (1993) Nucleotide Keen, N.T., Boyd, C. y Henrissat, B. (1996)
sequence and analysis of a xylanase gene Cloning and characterization of a xylanase
(xynS) from alkali-tolerant Bacillus sp. YA-14 gene from corn strains of Erwinia
and comparison with other xylanases. Journal chrysanthemi. Molecular Plant Microbe
of Microbiology and Biotechnology 3: 139- Interactions 9 (7): 651-657.
145.
Kim, J.H. y Pack, M.Y. (1993)
K Overproduction of extracellular
endoglucanase by genetically engingeered
Bacillus subtilis. Biotechnology Letters 15 (2):
Kaji, A. (1984) L-arabinosidases. Advances in
133-138.
Carbohydrate Chemistry and Biochemistry 42:
383-394.
Koc, A. y Gladyshev, V.N. (2007) Methionine
sulfoxide reduction and the aging process.
Kataeva, I.A., Seidel, R.D., Shah, A., West,
Annals of the New York Academy of
L.T., Li, X. y Ljungdahl, L.G. (2002) The
Sciences, 1100, 383-386.
fibronectin type 3-like repeat from the
Clostridium thermocellum cellobiohydrolase
Kolek, J. y Kozinka, V. (1992) Physiology of
CbhA promotes hydrolysis of cellulose by
the Plant Root System. Kolek, J. y Kozinka,
modifying its surface. Applied and
V., eds. Springer.
Environmental Microbiology 68(9): 4292-
4300.
183

Kolenova, K., Vrsanska, M. y Biely, P. (2005) American Society for Microbiology,


Purification and characterization of two minor Washington, D.C.
endo-[beta]-1,4-xylanases of Schizophyllum
commune. Enzyme and Microbial Technology Larson, S., Day, J., BarbadelaRosa, A., Keen,
36 (7): 903-910. N. y McPherson, A. (2003) First
Crystallographic Structure of a Xylanase from
Kubata, B.K., Takamizawa, K., Kawai, K., Glycoside Hydrolase Family 5: Implications
Suzuki, T. y Horitsu, H.. (1995). Xylanase IV, for Catalysis. Biochemistry 42 (28): 8411-
an Exoxylanase of Aeromonas caviae ME-1 8422.
Wich Produces Xylotetraose as the Only Low-
Molecular-Weight. Applied and Lee, J. (1997) Biological conversion of
Environmental Microbiology 61: 1666-1668. lignocellulosic biomass to ethanol. Journal of
Biotechnology 56 (1): 1-24.
Kulkarni, N., Shendye, A. y Rao, M. (1999)
Molecular and biotechnological aspects of Lee, Y.E. y Zeikus, J.G. (1993) Genetics
xylanases. FEMS Microbiology Reviews 23 organization, sequence and biochemical
(4): 411-456. characterization of recombinant β-xylosidase
from Thermoanaerobacterium saccharolyticum
Kunst, F., Ogasawara, N., Moszer, I., <146 strain B6A-RI. Journal of General
autores más>, Yoshikawa, H. y Danchin, A. Microbiology 139: 1235-1243.
(1997) The complete genome sequence of the
Gram-positive bacterium Bacillus subtilis. Leggio, L.L., Jenkins, J., Harris, G.W. y
Nature 390: 249-256. Pickersgill, R.W. (2000) X-ray
crystallographic study of xylopentaose binding
L to Pseudomonas fluorescens xylanase A.
Proteins 41 (3): 362-373.

Laemmli, U.K. (1970) Cleavage of structural


proteins during the assembly of the head of Leloup, L., Le Saux, J., Petit-Glatron, M.F. y

bacteriophage T4. Nature 227: 680-685. Chambert, R. (1999) Kinetics of the secretion
of Bacillus subtilis levanase overproduced

Lampen, J.O., Pastor, F.I.J. y Hussain, M. during the exponential phase of growth.

(1986) Processing of secreted proteins and the Microbiology 145: 613-619.

signal peptidases of Bacilli. En Microbiology.


pp. 279-282. Leive, L., Bon-ventre, P.F., Lerouxel, O., Cavalier, D.M., Liepman, A.H. y

Morello, J.A., Silver, S.D. y Wu, H.C., eds. Keegstra, K. (2006) Biosynthesis of plant cell
184

wall polysaccharides - a complex process. Lopez-Camacho, C., Salgado, J., Lequerica,


Current Opinion in Plant Biology 9 (6): 621- J.L., Madarro, A., Ballestar, E., Franco, L. y
630. Polaina, J. (1996) Amino acid substitutions
enhancing thermostability of Bacillus
Lieberman, R.L., Wustman, B.A., Huertas, P., polymyxa beta-glucosidase A. Biochemical
Powe, A.C., Pine, C.W., Khanna, R., Journal 314 (Pt 3): 833-838.
Schlossmacher, M.G., Ringe, D. y Petsko,
G.A. (2007) Structure of acid β-glucosidase Luthi, E., Love, D.R., McAnulty, J., Wallace,
with pharmacological chaperone provides C., Caughey, P.A., Saul, D. y Bergquist, P.L.
insight into Gaucher disease. Nature Chemical (1990) Cloning, sequence analysis, and
Biology 3 (2): 101-107. expression of genes encoding xylan-degrading
enzymes from the thermophile Caldocellum
Linder, M. y Teeri, T.T. (1997) The roles and saccharolyticum. Applied and Environmental
function of cellulose-binding domains. Journal Microbiology 56: 1017-1024.
of Biotechnology 57 (1-3): 15-28.
M
Lindner, C., Stülke, J. y Hecker, M. (1994)
Regulation of xylanolytic enzymes in Bacillus
Maciag, I.E., Viret, J.F. y Alonso, J.C. (1988)
subtilis. Microbiology 140: 753-757.
Replication and incompatibility properties of
plasmid pUB110 in Bacillus subtilis.
Linko, Y.Y., Javanainen, P. y Linko, S. (1997)
Molecular and General Genetics 212 (2): 232-
Biotechnology of bread baking. Trends in
240.
Food Science and Technology 8: 339-344.

MaCkenzie, C.R., Bilous, D., Schneider, H. y


López, C., Blanco, A. y Javier, F.I.J. (1998)
Johnson, K.G. (1987). Induction of cellulolytic
Xylanase production by a new alkali-tolerant
and xylanolytic enzyme systems in
isolate of Bacillus. Biotechnology Letters 20
Streptomyces spp. Applied and Environmental
(3): 243-246.
Microbiology 53: 2835-2839.

López-Camacho, C., y Polaina, J. (1993)


Markwalder, H.U. y Neukom, H. (1976)
Random mutagenesis of a plasmid-borne
Diferulic acid as a possible crosslink in
glycosidase gene and phenotypic selection of
hemicelluloses from wheat germ.
mutants in Escherichia coli. Mutation
Phytochemistry 15: 836-837.
Research 301 (2): 73-77.
185

Martínez, A.T., Speranza, M., Ruiz-Dueñas, Moszer, I., Glaser, P. y Danchin, A. (1995)
F.J., Ferreira, P., Camarero, S., Guillén, F., SubtiList: a relational database for the
Martínez, M.J., Gutiérrez, A. y del Río, J.C. Bacillus subtilis genome. Microbiology
(2005) Biodegradation of lignocellulosics: (Reading, England) 141 ( Pt 2): 261-268.
microbial, chemical, and enzymatic aspects of
the fungal attack of lignin. International Moszer, I. (1998) The complete genome of
Microbiology 8 (3): 195-204. Bacillus subtilis: From sequence annotation to
data management and analysis. FEBS Letters
Miyazaki, K., Martin, J.C., Marinsek-Logar, 430: 28-36.
R. y Flint, H.J. (1997) Degradation and
Utilization of Xylans by the Rumen Anaerobe Moukadiri, I., Jaafar, L. y Zueco, J. (1999)
Prevotella bryantii (formerly P. ruminicola Identification of Two Mannoproteins Released
subsp. brevis) B14. Anaerobe 3 (6): 373-381. from Cell Walls of a Saccharomyces cerevisiae
mnn1 mnn9 Double Mutant by Reducing
Monfort, A., Blasco, A., Prieto, J. y Sanz, P. Agents. Journal of Bacteriology 181 (16):
(1996) Combined Expression of Aspergillus 4741-4745.
nidulans Endoxylanase X24 and Aspergillus
oryzae (alpha)-Amylase in Industrial Baker's N
Yeasts and Their Use in Bread Making.
Applied and Environmental Microbiology 62
Nagarajan, V. (1993) Protein secretion. En
(10): 3712-3715.
Bacillus subtilis and other Gram-Positive
bacteria. Biochemistry, physiology and
Montiel, M.D., Hernández, M., Rodríguez, J. y
molecular genetics. pp. 713-726. Hoch, J.A. y
Arias, M.E. (2002) Evaluation of an endo-
Losick R., eds. American Society for
beta-mannanase produced by Streptomyces
Microbiology, Washington, D.C.
ipomoea CECT 3341 for the biobleaching of
pine kraft pulps. Applied Microbiology and
Nakai, K. y Kanehisa, M. (1991) Expert
Biotechnology 58 (1): 67-72.
system for predicting protein localization sites
in gram-negative bacteria. Proteins 11 (2): 95-
Morris, D.D., Gibbs, M.D., Ford, M., Thomas,
110.
J. y Bergquist, P.L. (1999) Family 10 and 11
xylanase genes from Caldicellulosiruptor sp.
Nakai, K. y Kanehisa, M. (1992) A knowledge
strain Rt69B.1. Extremophiles 1999 3 (2):103-
base for predicting protein localization sites in
111.
eukaryotic cells. Genomics 1992 14 (4): 897-
911.
186

Niall, H.D. (1973) Automated Edman Oue, S., Okamoto, A., Yano, T. y
degradation: the protein sequenator. Methods Kagamiyama, H. (1999) Redesigning the
in Enzymology 27: 942-1010. Substrate Specificity of an Enzyme by
Cumulative Effects of the Mutations of Non-
Nielsen, H., Engelbrecht, J., Brunak, S. y von active Site Residues. The Journal of Biological
Heijne, G. (1997) Identification of prokaryotic Chemistry 274 (4): 2344-2349.
and eukaryotic signal peptides and prediction
of their cleavage sites. Protein Engineering 10 Overbeeke, N., Termorshuizen, G.H.M.,
(1): 1-6. Giuseppin, M.L.F., Underwood, D.R. y
Verrips C.T. (1990) Secretion of the α-
Nielsen, H., Brunak, S. Y Heijne, G. (1999) Glactosidase from Cyamopsis tetragonoloba
Machine learning approaches to the (Guar) by Bacillus subtilis. Applied and
prediction of signal peptides and other protein Environmental Microbiology 56 (5): 1429-
sorting signals. Protein Engineering 12: 3-9. 1434.

O P

Oakley, A.J., Heinrich, T., Thompson, C.A. y Packman, L.C. (1993) Protein chemical
Wilce, M.C.J. (2003) Characterization of a methods for molecular biologists. Methods in
family 11 xylanase from Bacillus subtillis Molecular and Cellular Biology 4: 189-198.
B230 used for paper bleaching. Acta
Crystallographica. Section D, Biological Paice, M.G., Bourbonnais, R., Desrochers, M.,
Crystallography 59 (4): 627-636. Jurasek, L. Y Yaguchi, M. (1986) A xylanase
gene from Bacillus subtilis: nucleotide
Obst, M., Meding, E.R., Vogel, R.F. y sequence and comparation with B. pumilus
Hammes, W.P. (1995) Two genes encoding gene. Archives of Microbiology 144: 201-206.
the beta-galactosidase of Lactobacillus sake.
Microbiology 141: 3059-3066. Palva, I., Petterson, R.F., Kalkkinen, N.,
Lehtovaara, P., Sarvas, M., Södelund, H.,
Osburne, M.S. y Craig R.J. (1986) Activity of Takkinen, K. y Kääriäinen L. (1981)
two strong promoters cloned into Bacillus Nucleotide sequence of the promoter and the
subtilis. Journal of General Microbiology 132: NH2-terminal signal peptide region of the alfa-
565-568. amilase gene from Bacillus amyloliquefaciens.
Gene 15: 43-51.
187

Page, R.D.M. (1996) TREEVIEW: An Pell, G., Szabo, L., Charnock, S.J., Xie, H.,
application to display phylogenetic trees on Gloster, T.M., Davies, G.J. y Gilbert, H.J.
personal computers. Computer Applications in (2004a) Structural and biochemical analysis
the Biosciences 12: 357-358. of Cellvibrio japonicus xylanase 10C: how
variation in substrate-binding cleft influences
Parajo, J.C., Dominguez, H. y Dominguez, J. the catalytic profile of family GH-10
(1998) Biotechnological production of xylitol. xylanases. The Journal of Biological
Part 1: Interest of xylitol and fundamentals of Chemistry 279 (12): 11777-11788.
its biosynthesis. Bioresource Technology 65
(3): 191-201. Pell, G., Taylor, E.J., Gloster, T.M.,
Turkenburg, J.P., Fontes, C.M.G.A., Ferreira,
Parajo, J.C., Dominguez, H. y Dominguez, J. L.M.A., Nagy, T., Clark, S.J., Davies, G.J. y
(1998) Biotechnological production of xylitol. Gilbert, H.J. (2004) The Mechanisms by
Part 2: Operation in culture media made with Which Family 10 Glycoside Hydrolases Bind
commercial sugars. Bioresource Technology Decorated Substrates. The Journal of
65 (3): 203-212. Biological Chemistry 279 (10): 9597-9605.

Pason, P., Kyu, K.L., y Ratanakhanokchai, K. Petit-Breuilh, X., Zaror, C. y Melo, R. (2004)
(2006). Paenibacillus curdlanolyticus Strain Hexenuronic acid removal from unbleached
B-6 Xylanolytic-Cellulolytic Enzyme System krat eucalyptus pulp by peroxymonosulfuric.
That Degrades Insoluble Polysaccharides. Journal of the Chilean Chemical Society 49
Applied and Environmental Microbiology 72 (4): 355-360.
(4): 2483-2490.
Polizeli, M.L.T.M., Rizzatti, A.C.S., Monti,
Pastor, F.I.J., López, J.L., Díaz, P. y Blanco, R., Terenzi, H.F., Jorge, J.A. y Amorim, D.S.
A. (1999) Expresión de la celulasa A de (2005) Xylanases from fungi: properties and
Bacillus sp. BP-23 en cepas de Bacillus sin industrial applications. Applied Microbiology
fondo celulolítico. Congreso de la Sociedad and Biotechnology 67 (5): 577-591.
Española de Microbiología, Granada, 17-21 de
Septiembre, Resúmenes Volumen II: C 10-45. Proctor, M.R., Taylor, E.J., Nurizzo, D.,
Turkenburg, J.P., Lloyd, R.M., Vardakou, M.,
Pearson, W.R. (1990) Rapid and sensitive Davis, G.J. y Gilbert, H.J. (2005) Tailored
sequence comparison with FASTP and catalysts for plant cell-wall degradation:
FASTA. Methods in Enzymology 183: 63- 98. Redesigning the exo/endo preference of
Cellvibrio japonicus arabinanase 43A.
188

Proceedings of the National Academy of Rye, C.S. y Withers, S.G. (2000) Glycosidase
Sciences of the United States of America 102 mechanisms. Current Opinion in Chemical
(8): 2697-2702. Biology 4(5): 573-580.

Puls, J., Schmidt, O. y Granzow, C. (1987) S


α− Glucuronidase in two microbial xylanolytic
systems. Enzyme and Microbial Technology 9: Sánchez, M.M., Pastor, F.I.J. y Diaz, P. (2003)
83-88. Exo-mode of action of cellobiohydrolase
Cel48C from Paenibacillus sp. BP-23. A
Q unique type of cellulase among Bacillales.
European Journal of Biochemistry 270 (13):
Qureshy, A.F., Khan, L.A. y Khanna, S. 2913-2919.
(2000) Expression of Bacillus circulans Teri-
42 xylanase gene in Bacillus subtilis. Enzyme Sánchez, M.M., Fritze, D., Blanco, A., Spröer,
and Microbial Technology 27: 227-233. C., Tindall, B.J., Schumann, P., Kroppenstedt,
R.M., Diaz, P. y Pastor, F.I.J. (2005)

R Paenibacillus barcinonensis sp. nov., a


xylanase-producing bacterium isolated from a
rice field in the Ebro River delta. International
Reilly, P.J. (1981). Xylanases structure and
Journal of Systematic and Evolutionary
function. Trends in the biology of fermentation
Microbiology 55: 935-939.
for fuels and chemicals. pp. 111-126.
Hollander, A., ed. Plenum Press, New York
Sabini, E., Wilson, K.S., Danielsen, S.,
and London.
Schülein, M. y Davies, G.J. (2001)
Oligosaccharide binding to family 11
Robles, J. y Doers, M. (1994) pGEM®-T
xylanases: both covalent intermediate and
Vector Systems troubleshooting guide.
mutant product complexes display (2,5)B
Promega Notes 45: 19-20.
conformations at the active centre. Acta
Crystallographica. Section D, Biological
Roncero, M.B., Torres, A.L., Colom, J.F. y
Crystallography 57 (9): 1344-1347.
Vidal, T. (2003) Effect of xylanase on ozone
bleaching kinetics and properties of
Saha, B.C. (2000). α-L-Arabinofuranosidases:
Eucalyptus kraft pulp. Journal of Chemical
biochemistry, molecular biology and
Technology & Biotechnology 78 (10): 1023-
application in biotechnology. Biotechnology
1031.
Advances 18: 403-423.
189

Sanz-Aparicio, J., Hermoso, J.A., Martínez- insoluble polysaccharides. Trends in


Ripoll, M., González, B., López-Camacho, C. Microbiology 7 (7): 275-281.
y Polaina, J. (1998). Structural basis of
increased resistance to thermal denaturation Shulami, S., Gat, O., Sonenshein, A.L. y
induced by single amino acid substitution in Shoham, Y. (1999) The glucuronic acid
the sequence of beta-glucosidase A from utilization gene cluster from Bacillus
Bacillus polymyxa. Proteins 33 (4): 567-676. stearothermophilus T-6. Journal of
Bacteriology 181 (12): 3695-3704.
Saxena, I.M. y Brown, R.M. (2005) Cellulose
biosynthesis: current views and evolving Schwede, T., Kopp, J., Guex, N. y Peitsch,
concepts. Annals of Botany 96: 9-21 M.C. (2003) SWISS-MODEL: an automated
protein homology-modeling server. Nucleic
Schäfer, T., Borchert, T.W., Nielsen, V.S., Acids Research 31 (13): 3381-3385.
Skagerlind, P., Gibson, K., Wenger, K.,
Hatzack, F., Nilsson, L.D., Salmon, S., Simonen, M., Jämsä, E. y Makarow, M. (1994)
Pedersen, S., Heldt-Hansen, H.P., Poulsen, The role of the carrier protein and disulfide
P.B., Lund, H., Oxenbøll, K.M., Wu, G.F., formation in the folding of beta-lactamase
Pedersen, H.H., Xu, H. (2007) Industrial fusion proteins in the endoplasmic reticulum
enzymes. En White Biotechnology. pp. 59-131. of yeast. The Journal of Biological Chemistry
Springer, Berlin / Heidelberg. 269 (19): 13887-13892.

Schallmey, M., Singh, A. y Ward, O.P. (2004). Sigoillot, C., Camarero, S., Vidal, T., Record,
Developments in the use of Bacillus species E., Asther, M., Perez-Boada, M., Martínez,
for industrial production. Canadian Journal of M.J., Sigoillot, J., Asther, M., Colom, J.F. y
Microbiology 50 (1): 1-17. Martínez, A.T. (2005) Comparison of different
fungal enzymes for bleaching high-quality
Schoner, R.G., Williams, D.M. y Lovett, P.S. paper pulps. Journal of Biotechnology 115 (4):
(1983) Enhaced expression of mouse 333-343.
dihydrofolate reductase in Bacillus subtilis.
Gene 22: 47-57. Shimotohno, A., Oue, S., Yano, T., Kuramitsu,
S. y Kagamiyama, H. (2001) Demonstration of
Shoham, Y., Lamed, R., y Bayer, E.A. (1999) the Importance and Usefulness of
The cellulosome concept as an efficient Manipulating Non-Active-Site Residues in
microbial strategy for the degradation of Protein Design. Journal of Biochemistry
(Tokyo) 129 (6): 943-948.
190

Smith, C.J. (1993) Carbohydrate chemistry. methylglucuronoxylan utilization. Applied and


En Plant Biochemistry and Molecular Environmental Microbiology 72 (2): 1496-
Biology. pp. 74-111. Lea, P.J. y Leegood, 1506.
R.C., eds. John Wiley and Sons, Ltd,
Inglaterra. St. John, F.J., Rice, J.D. y Preston, J.F.
(2006b) Characterization of XynC from
Smith , H.L., Bron, S., van Hee, J. Y Venema, Bacillus subtilis subsp. subtilis Strain 168 and
G. (1987) Construction and use of signal Analysis of Its Role in Depolymerization of
sequence selection vectors in Escherichia coli Glucuronoxylan. Journal of Bacteriology 188
and Bacillus subtilis. Journal of Bacteriology (24): 8617-8626.
169: 3321-3328.
Stemmer, W.P.C. (1994) Rapid evolution of a
Spiro R.G. (1966) The Nelson-Somogyi protein in vitro by DNA shuffling. Nature 370
copper reduction method. Analysis of sugar (6488): 389-391.
found in glycoporteins. Methods in
Enzymology 8: 3-26. Studier, F. W. y Moffatt, B. A. (1986). Use of
bacteriophage T7 RNA polymerase to direct
Somerville, C., Bauer, S., Brininstool, G., selective high-level expression of cloned
Facette, M., Hamann, T., Milne, J., Osborne, genes. Journal of Molecular Biology 189 (1):
E., Paredez, A., Persson, S., Raab, T., 113-130.
Vorwerk, S. y Youngs, H. (2004) Toward a
Systems Approach to Understanding Plant Stülke, J. y Hillen, W. (2000) Regulation of
Cell Walls. Science 306: 2206-2211. carbon catabolism in bacillus species. Annual
Review of Microbiology 54 (1): 849-880.
Soriano, M. (2004) Análisis de sistemas
pectinolíticos bacterianos. Aislamiento y Sulzenbacher, G., Schülein, M. y Davies, G.J.
caracterización de las pectinasas PelA de (1997) Structure of the endoglucanase I from
Paenibacillus sp. BP-23 e YvpA de Bacillus Fusarium oxysporum: native, cellobiose, and
subtilis. Tesis Doctoral. Director Pastor, F.I.J. 3,4-epoxybutyl β-D-cellobioside-inhibited
Departamento de Microbiología, Facultad de forms, at 2.3 Å resolution. Biochemistry 36
Biología, Universitat de Barcelona. (19): 5902-5911.

St. John, F.J., Rice, J.D. y Preston, J.F. Sumitomo, N., Ozaki, K., Hitomi, J.,
(2006a) Paenibacillus sp. strain JDR-2 and Kawaminami, S., Kobayashi, T., Kawai, S. y
XynA1: a novel system for Ito, S. (1995) Application of the upstream
191

region of a Bacillus endoglucanase gene to beta-1,4-xylanase from an alkalophilic


high-level expression of foreign genes in Bacillus strain (N137). Applied and
Bacillus subtilis. Bioscience, Biotechnology, Environmental Microbiology 61 (6): 2420-
and Biochemistry 59 (11): 2172-2175. 2424.

Sun, Y., y Cheng, J. (2002) Hydrolysis of Tajana, E., Fiechter, A. y Zimmermann, W.


lignocellulosic materials for ethanol (1992) Purification and characterization of
production: a review. Bioresource Technology two α-L-arabinofuranosidases from
83 (1): 1-11. Streptomyces diastaticus. Applied and
Environmental Microbiology 58 (5): 1447-
Sunna, A., Gibbs, M.D. y Bergquist, P.L. 1450.
(2000) A novel thermostable multidomain 1,4-
beta-xylanase from Caldibacillus Tenkanen, M. y Poutanen, K. (1992).
cellulovorans and effect of its xylan-binding Significance of esterases in the degradation of
domain on enzyme activity. Microbiology xylans. En Xylans and xylanases. pp. 203-212.
146: 2947-2955. Visser, J., Beldman, G., Kusters-van Someren,
M.A. y A.G.J. Voragen, eds. Elsevier Science
Suurnäkki, A., Clark, T.A., Allison, R.W., Publishers, Amsterdam.
Viikari, L. y Buchert, J. (1996) Xylanase- and
mannanase-aided ecf and tcf bleaching. Thompson, J.D., Higgins, D.G. y Gibson, T.J.
TAPPI Journal 79 (7): 111-117. (1994) CLUSTAL W: improving the sensitivity
of progressive multiple sequence alignment
Suzuki, T., Ibata, K., Hatsu, M., Takamizawa, through sequence weighting, positions-specific
K. y Kawai, K.(1997) Cloning and expression gap penalties and weight matrix choice.
of a 58-kDa xylanase VI gene (xynD) of Nucleic Acids Research 22: 4673-4680.
Aeromonas caviae ME-1 in Escherichia coli
which is not categorized as a family F or Thompson, J.D., Gibson, T.J., Plewniak, F.,
family G xylanase. Journal of Fermentation Jeanmougin, F. y Higgins, D.G. (1997) The
and Bioengineering 84: 86-89. ClustalX windows interface: flexible strategies
for multiple sequence alignment aided by
T quality analysis tools. Nucleic Acids Research
24: 4876-4882.

Tabernero, C., Sánchez-Torres, J., Perez, P. y


Santamaria, R.I. (1995) Cloning and DNA
sequencing of xyaA, a gene encoding an endo-
192

Thomson, J.A. (1993) Molecular biology of Aeromonas caviae ME-1 that produces
xylan degradation. FEMS Microbiology exclusively xylobiose and xylotetraose from
Reviews 104: 65-82. xylan. Bioscience, Biotechnology and
Biochemistry 63 (8): 1346-1352.
Timell, T.E. (1967) Recent progress in the
chemistry of wood hemicelluloses. Wood V
Science and Technology 1: 45-70.

Van Petegem, F., Collins, T., Meuwis, M.,


Tjalsma, H., Antelmann, H., Jongbloed, J.D.,
Gerday, C., Feller, G. y Van Beeumen, J.
Braun, P.G., Darmon, E., Dorenbos, R.,
(2003) The structure of a cold-adapted family
Dubois, J.Y., Westers, H., Zanen, G., Quax,
8 xylanase at 1.3 A resolution. Structural
W.J., Kuipers, O.P., Bron, S., Hecker, M. y
adaptations to cold and investgation of the
van Dijl, J.M. (2004) Proteomics of Protein
active site. The Journal of Biological
Secretion by Bacillus subtilis: Separating the
Chemistry 278 (9): 7531-7539.
"Secrets" of the Secretome. Microbiology and
Molecular Biology Reviews 68 (2): 207-233.
Vardakou, M., Flint, J., Christakopoulos, P.,
Lewis, R.J., Gilbert, H.J. y Murray, J.W.
Tomme, P., Boraston, A., McLean, B.,
(2005) A Family 10 Thermoascus aurantiacus
Kormos, J., Creagh, A.L., Sturch, K., Gilkes,
Xylanase Utilizes Arabinose Decorations of
N.R., Haynes, C.A., Warren, R.A. y Kilburn,
Xylan as Significant Substrate Specificity
D.G. (1998) Characterization and affinity
Determinants. Journal of Molecular Biology
applications of cellulose-binding domains.
352 (5): 1060-1067.
Journal of Chromatography. B, Biomedical
Sciences and Applications 715 (1): 283-296.
Vicuña, R., Oyarzún, E. y Osses, M. (1995)
Assessment of various commercial enzymes in
Tremblay, L. y Archibald, F. (1993)
the bleaching of radiata pine kraft pulps.
Production of a cloned xylanase in Bacillus
Journal of Biotechnology 40 (3): 163-168.
cereus and its performance in kraft pulp
prebleaching. Canadian Journal of
Viikari, L., Kantelinen, A., Sundquist, J. y
Microbiology 39 (9): 853-860.
Linko, M. (1994) Xylanases in bleaching:
from an idea to the industry. FEMS
U Microbiology Reviews 13: 335-350.

Usui, K., Ibata, K., Suzuki, T. y Kawai, K. Viikari, L., Tenkanen, M. y Suurnäkki, A.
(1999) XynX, a posible exo-xylanase of (2001) Biotechnology in the pulp and paper
193

industry. REHM, H. J. (ed.) Biotechnology. microorganisms: Funtions and applications.


Weinheim: Wiley-VCH, 10: 523-546. Microbiological Reviews 52: 305-317.

Vrsanska, M., Kolenova, K., Puchart, V. y Wong, S. (1995) Advances in the use of
Biely, P. (2007) Mode of action of glycoside Bacillus subtilis for the expression and
hydrolase family 5 glucuronoxylan secretion of heterologous proteins. Current
xylanohydrolase from Erwinia chrysanthemi. Opinion in Biotechnology 6 (5): 517-522.
FEBS Journal 274 (7): 1666-1677.
Wu, Y., Vadrevu, R., Kathuria, S., Yang, X. y
W Matthews, C.R. (2007) A Tightly Packed
Hydrophobic Cluster Directs the Formation of
an Off-pathway Sub-millisecond Folding
Wakarchuk, W.W., Campbell, R.L., Sung,
Intermediate in the α Subunit of Tryptophan
W.L., Davoodi, J. y Yaguchi, M. (1994)
Synthase, a TIM Barrel Protein. Journal of
Mutational and crystallographic analyses of
Molecular Biology 366 (5): 1624-1638.
the active site residues of the Bacillus
circulans xylanase. Protein Science 3 (3): 467-
475. Y

Williams, D.M., Schoner, R.G., Duvall, E.J., Yamamoto, T., Mukai, K., Maruta, K.,
Preis, L.H. y Lovett, P.S. (1981b) Expression Watanabe, H., Yamashita, H., Nishimoto, T.,
of E. coli trp genes and the mouse Kubota, M., Chaen, H. y Fukuda, S. (2005)
dihydrofolate reductase gene cloned in Hyper expression of kojibiose phosphorylase
Bacillus subtilis. Gene 16: 199-206. gene and trehalose phosphorylase gene from
Thermoanaerobacter brockii ATCC35047 in
Wolf, M., Geczi, A., Simon, O. y Borriss, R. Bacillus subtilis and selaginose synthesis
(1995) Genes encoding xylan and β-glucan utilizing two phosphorylases. Journal of
hydrolysin enzymes in Bacillus subtilis: Bioscience and Bioengineering 100 (3): 343-
characterization, mapping and construction of 346.
strains deficient in lichenase, cellulase an
xylanase. Microbiology 141: 281-290. Yang, R.C., MacKenzie, C.R. y Narang, S.A.
(1988) Nucleotide sequence of a Bacillus
Wong, K.K.Y., Tan, L.U.L. y Saddler, J.N. circulans xylanase gene. Nucleic Acids

(1988) Multiplicity of β-1,4-xylanase in Research 16 (14B): 7187.


194

Yang, R.C., MacKenzie, C.R., Bilous, D. y


Narang, S.A. (1989) Identification of two
distinct Bacillus circulans xylanases by
molecular cloning of the genes and expression
in Escherichia coli. Applied and
Environmental Microbiology 55 (3): 568-572.

Yanisch-Perron, C., Vieira, J. y Messing, J.


(1985) Improved M13 phage cloning vectors
and host strains: nucleotide sequences of the
M13mp18 and pUC19 vectors. Gene 33 (1):
103-119.

Yano, T., Oue, S. y Kagamiyama, H. (1998)


Directed evolution of an aspartate
aminotransferase with new substrate
specificities. Proceedings of the National
Academy of Sciences of the United States of
America 95 (10): 5511-5515.

Yip, V.L.Y. y Withers, S.G. (2004) Nature's


many mechanisms for the degradation of
oligosaccharides. Organic and Biomolecular
Chemistry 2(19): 2707-2713.

Yu, J.H., Park, Y.S., Yum, D.Y., Kim, J.M. y


Kong, I.S. (1993) Nucleotide Sequence and
Analysis of a Xylanase gene (xynS) from
Alkali-tolerant Bacillus sp. YA-14 and
Comparison with Other Xylanases. Journal of
Microbiology and Biotechnology 3 (3): 139-
145.
PUBLICACIONES
Los artículos publicados derivados del presente trabajo de investigación son:

Gallardo, O., Diaz, P. y Pastor, F.I. (2003) Characterization of a Paenibacillus


cell-associated xylanase with high activity on aryl-xylosides: a new subclass of family
10 xylanases. Applied Microbiology and Biotechnology 61 (3): 226-233.

Gallardo, O., Diaz, P. y Pastor, F.I. (2004) Cloning and characterization of xylanase A
from the strain Bacillus sp. BP-7: comparison with alkaline pI-low molecular weight
xylanases of family 11. Current Microbiology 48 (4): 276-279.

Andrés, I., Gallardo, O., Parascandola, P., Javier Pastor, F.I. y Zueco, J. (2005) Use of
the cell wall protein Pir4 as a fusion partner for the expression of Bacillus sp. BP-7
xylanase A in Saccharomyces cerevisiae. Biotechnology and Bioengineering 89 (6):
690-697.

Gallardo, O., Diaz, P. y Pastor, F.I.J. (2007) Cloning and production of Xylanase B
from Paenibacillus barcinonensis in Bacillus subtilis hosts. Biocatalysis and
Biotransformation 25 (2): 157-162.
Appl Microbiol Biotechnol (2003) 61:226–233
DOI 10.1007/s00253-003-1239-1

ORIGINAL PAPER

O. Gallardo · P. Diaz · F. I. J. Pastor

Characterization of a Paenibacillus cell-associated xylanase


with high activity on aryl-xylosides: a new subclass
of family 10 xylanases
Received: 8 October 2002 / Revised: 13 December 2002 / Accepted: 16 December 2002 / Published online: 27 February 2003
 Springer-Verlag 2003

Abstract The sequence of gene xynB encoding xylanase Introduction


B from Paenibacillus sp. BP-23 was determined. It
revealed an open reading frame of 999 nucleotides Biodegradation of xylan, an abundant plant polysaccha-
encoding a protein of 38,561 Da. The deduced amino ride, is a complex process that requires the coordinated
acid sequence of xylanase B shows that the N-terminal action of several enzymes, among which xylanases (1,4-
region of the enzyme lacks the features of a signal b-d-xylan xylanohydrolase; EC 3.2.1.8), cleaving internal
peptide. When the xylan-degrading system of Paenibacil- linkages on the b-1,4-xylose backbone, play a key role.
lus sp. BP-23 was analysed in zymograms, it revealed that The complex chemical nature and heterogeneity of xylan
xylanase B was not secreted to the extracellular medium can account for the multiplicity of xylanases produced by
but instead remained cell-associated, even in late station- microoorganisms (Kulkarni et al. 1999). The activity of
ary-phase cultures. When xynB was expressed in a different xylanases with subtle differences in substrate
Bacillus subtilis secreting host, it also remained associ- specificity and mode of action should improve degrada-
ated with the cells. Sequence homology analysis showed tion of plant xylan in natural habitats. Based on amino
that xylanase B from Paenibacillus sp. BP-23 belongs to acid sequence homologies and hydrophobic cluster anal-
family 10 glycosyl hydrolases, exhibiting a distinctive ysis, xylanases have been classified in two groups, family
high homology to six xylanases of this family. The 10 and family 11 (Gilkes et al. 1991; Henrissat and
homologous enzymes were also found to be devoid of a Bairoch 1996). However, xylanases homologous to family
signal peptide and seem to constitute, together with 5 b-glycanases have also been found (Keen et al. 1996).
xylanase B, a separate group of enzymes. They all have Although xylanases show remarkable differences in
two conserved amino acid regions not found in the other sequence, only minor differences in catalytic activity
family 10 xylanases, and cluster in a separate group after between xylanases of the different families have been
dendrogram analysis. We propose that these enzymes reported (Biely et al. 1997). These differences have been
constitute a new subclass of family 10 xylanases, that are proposed to result from differences in the three-dimen-
cell-associated, and that hydrolyse the xylooligosaccha- sional structure of their catalytic domains, which show
rides resulting from extracellular xylan hydrolysis. greater conformational flexibility in family 10 enzymes
Xylanase B shows similar specific activity on aryl- (Davies and Henrissat 1995). Several xylanases are
xylosides and xylans. This can be correlated to some, not single-domain enzymes, while other xylanases have a
yet identified, trait of catalytic activity of the enzyme on modular structure that, in addition to a catalytic domain,
plant xylan. contains one or more cellulose-binding domains (Tomme
et al. 1998). Recent identification of domains that
promote specific binding to xylan or other carbohydrates
has prompted the term "carbohydrate-binding module" to
group domains that mediate substrate binding (Charnock
et al. 2000).
Xylanases are secreted enzymes, released to the
O. Gallardo · P. Diaz · F. I. J. Pastor ()) extracellular medium to enable contact with and cleavage
Department of Microbiology, Faculty of Biology, of highly polymerized xylans. However, an intracellular
University of Barcelona, xylanase has recently been described in Cellvibrio mixtus
Avinguda Diagonal 645, 08028 Barcelona, Spain (Fontes et al. 2000). The enzyme is located in the
e-mail: fpastor@bio.ub.es periplasm, where it is probably involved in the breakdown
Tel.: +34-93-4034626 of large xylooligosaccharides and protected from extra-
Fax: +34-93-4034629
227

cellular proteases. A similar location of xylanase activity study the activity on aryl-glycosides, the enzyme was incubated
has been reported in the rumen bacterium Prevotella with substrate for 5 min at 40C in a final volume of 0.25 ml of
100 mM acetate buffer pH 5.5. Substrate concentration was 0.5%
ruminicola (Miyazaki et al. 1997). for p-nitrophenyl-b-d-xylopyranoside or o-nitrophenyl-b-d-xylopy-
The strain Paenibacillus sp. BP-23, previously termed ranoside; and 0.1% for p-nitrophenyl-b-d-glucopyranoside, p-
Bacillus sp. BP-23, secretes into the extracellular media a nitrophenyl-b-cellobioside, p-nitrophenyl-b-cellotrioside, p-nitro-
set of xylanases, several of which have been characterized phenyl-b-cellotetraoside, p-nitrophenyl-b-cellopentaoside, p-nitro-
phenyl-a-l-arabinofuranoside or p-nitrophenyl-a-l-arabinopy-
(Blanco and Pastor 1993; Blanco et al. 1995, 1999). In ranoside (Sigma Chemical). The reaction was stopped by the
this article we describe the characterization of xylanase B addition of 1 ml of 1 M Na2CO3 and colour development was
from this strain, which has been cloned in Escherichia measured at 400 nm. One unit of enzymatic activity was defined as
coli (Blanco et al. 1996). Xylanase B does not exhibit a the amount of enzyme that released 1 mol of reducing sugar
signal peptide for its secretion outside the cytoplasm and equivalent, p-nitrophenol or o-nitrophenol per minute under the
assay conditions described.
shows activity on both xylans and aryl-xylosides. The role
of the enzyme in plant xylan biodegradation is discussed.
Gel electrophoresis and zymograms

Sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS-


Materials and methods PAGE) was performed in 12% gels, essentially as described by
Laemmli (1970). Native gel electrophoresis was performed in 8%
Bacterial strains and plasmids polyacrylamide gels according to Hames and Rickwood (1981). For
the detection of xylanase activity, 0.2% birchwood xylan was
Paenibacillus sp. strain BP-23 was grown as described previously included in native gels before polymerization. Samples were heated
(Blanco and Pastor 1993). E. coli-pX20 and E. coli-pX60, for 10 min at 50C in sample buffer before being applied to gels.
described previously (Blanco et al. 1996), are recombinant strains After electrophoresis, gels were washed in 50 mM phosphate
containing xynB. Bacillus subtilis MW15 has been described buffer, pH 7.0, for 30 min, and incubated at 37C for 30 min in the
elsewhere (Wolf et al. 1995). Plasmid pRB473 is a shuttle vector same buffer. Gels were then stained with 0.1% Congo Red for
for E. coli and B. subtilis (Brckner 1992). The SPO2 promoter was 15 min and washed with 1 M NaCl until xylanase bands became
amplified by PCR from plasmid pPL608 (Schoner et al. 1983) and visible. Gels were then immersed in 5% (v/v) acetic acid and
inserted between XbaI and BamHI sites of plasmid pRB473 photographed.
polylinker. The resultant plasmid was named pRBSPO. The
structural part of xynB was amplified by PCR from pX60, and
inserted between SacI and SmaI sites of pRBSPO, downstream of N-terminal sequencing of xylanase B
the SPO2 promoter. The resultant plasmid was named pRB-
SPOX20. Xylanase protein bands were separated in SDS-PAGE gels and
transferred to polyvinylidene difluoride (PVDF) membranes as
described (Packman 1993). N-terminal sequencing was determined
Nucleic acid manipulations by automated Sanger degradation in a Beckman LF3000 sequencer.
Plasmid DNA was purified by the alkaline lysis procedure
(Sambrook et al. 1989) or by chromatography (QIAGEN-tip 100 Nucleotide sequence accession number
MidiPrep, Promega). PCR amplification was performed with Pfu
DNA polymerase (Stratagene). Restriction nucleases and ligase The DNA sequence of the xynB gene was deposited at the EMBL
were purchased from Boehringer Mannheim. E. coli was trans- database under accession number AJ006646.
formed as described by Sambrook et al. (1989). Protoplasts from B.
subtilis were transformed as described by Cohen and Chang (1979).
The sequence of both strands of xynB and SPO2 promoter was
determined by automated fluorescence sequencing with an ABI Results
PRISM dye terminator cycle sequencing ready reaction mix (Perkin
Elmer) in a 377 Perkin Elmer DNA sequencer. Substrate specificity of xylanase B
from Paenibacillus sp. BP-23
Enzyme assays
Recombinant E. coli-pX60, harbouring the xylanase B
Cultures from Paenibacillus sp. BP-23, B. subtilis MW15/pRB- encoding gene, was isolated previously from a gene
SPOX20, E. coli-pX20 or E. coli-pX60 were centrifuged and library made from Paenibacillus sp. BP-23 (Blanco et al.
supernatants and pellets separated. Cells were disrupted by
sonication and enzyme activity of cell extracts and supernatants 1996). The enzymatic activity of cell extracts from E.
was evaluated. To isolate the cytoplasmic fraction, cell extracts coli-pX60 on xylans having a different extent of arabinose
were centrifuged at 8,000 g for 10 min and supernatants were and methylglucuronic substitution, and on nitrophenol
collected and centrifuged at 38,000 g for 60 min. Supernatants from derivatives of xylose, arabinose, glucose and cel-
the last centrifugation were kept as cytoplasmic fraction while
pellets were resuspended in buffer and kept as membrane fraction. looligosaccharides, was evaluated (Table 1). Xylanase B
Xylanase activity was assayed by measuring the amount of showed similar specific activity on all tested xylans,
reducing sugars released from xylans using the method of Nelson irrespective of the extent of substitution. The enzyme also
and Somogyi (Spiro 1966). The xylans tested as substrates were showed activity on most aryl-glycosides tested. Interest-
birchwood, oat spelt and beechwood xylan, methylglucuronoxylan ingly, the specific activity on pNP-b-xyloside and oNP-b-
(Sigma Chemical), and rye or wheat arabinoxylan (Megazyme).
The assay mixture contained 0.5% xylan in a final volume of 0.1 ml xyloside was similar to that found on xylans. The high
of 50 mM acetate buffer pH 5.5. The mixture was incubated at activity on aryl-xylosides could indicate that the enzyme
40C for 15 min. Colour development was measured at 520 nm. To was a b-xylosidase. However, previous results had shown
228
Table 1 Substrate specificity of xylanase B
Substrate Specific activity
(U/mg)·103
Birchwood xylan 232.8
Oat spelt xylan 213.1
Beechwood xylan 248.7
Methylglucuronoxylan 192.8
Rye arabinoxylan 224.4
Wheat arabinoxylan 265.4
p-Nitrophenyl b-xylopyranoside 286.1
o-Nitrophenyl b-xylopyranoside 550.3
p-Nitrophenyl b-glucopyranoside 0.6
p-Nitrophenyl b-cellobioside 41.5
p-Nitrophenyl b-cellotrioside 42.5
p-Nitrophenyl b-cellotetraoside 42.1
p-Nitrophenyl b-cellopentaoside 31.4
p-Nitrophenyl a-arabinopyranoside 26.4 Fig. 1 SDS-PAGE analysis of cell-associated and extracellular
p-Nitrophenyl a-arabinofuranoside 0.8 fractions from Bacillus subtilis MW15/pRBSPOX20. Bacillus
subtilis MW15/pRBSPOX20, carrying xynB, and control B. subtilis
MW15/pRBSPO were grown on nutrient broth supplemented with
0.2% birchwood xylan. Samples were taken after 3 days of
that although the enzyme was active on xylotetraose and incubation, fractionated into cell extracts and supernatants and
xylotriose, it did not hydrolyse xylobiose (Blanco et al. analysed by SDS-PAGE. Lane 1, cell extracts from Escherichia
coli-pBR322. Lane 2, cell extracts from E. coli-pX20, carrying
1996), clearly indicating that XynB is a xylanase. The xynB. Lane 3, concentrated supernatants from B. subtilis MW15/
high activity found on aryl xylosides could be the result of pRBSPOX20. Lane 4, concentrated supernatants from B. subtilis
transferase activity of xylanase B, as shown from the MW15/pRBSPO. Lane 5, cell extracts from B. subtilis MW15/
analysis of XynB hydrolysis products from xylotetraose pRBSPOX20. Lane 6, cell extracts from B. subtilis MW15/
(Blanco et al. 1996). pRBSPO. The positions of molecular weight markers are indicated

Genetic characterization of xynB

The sequence of the 1,219-bp DNA fragment from


Paenibacillus sp. BP-23 contained in pX60 was deter-
mined and submitted to the EMBL nucleotide sequence
database under accession number AJ006646. It contains
an open reading frame of 999 nucleotides that encodes a
protein of 332 amino acids with a predicted molecular Fig. 2 N-Terminal sequence of xylanase B. The sequence of the 50
mass of 38,561 Da. This size is in agreement with that of amino acids from the N-terminus of xylanase B, and the
recombinant xylanase B produced in E. coli (40 kDa), as corresponding DNA encoding sequence is shown. The nucleotide
sequence resembling a ribosome binding site is underlined
determined from SDS-PAGE gels (Fig. 1). Seven nucle-
otides upstream of the ATG start codon there is an
AGGAGG sequence, resembling that of a ribosome- activity was detected in culture supernatants from the
binding site (Shine-Dalgarno). beginning of the stationary phase, reaching a maximum
Analysis of the deduced amino acid sequence of XynB after 2 days of culture. This activity corresponds to the set
shows that the enzyme has an N-terminal region that lacks of secreted xylanases previously described in the strain
the features of a signal peptide (Nagarajan 1993) (Fig. 2). (Blanco and Pastor 1993; Blanco et al. 1995, 1999).
A stretch of 25–30 amino acids, containing a hydrophobic Activity was also found in cell extracts, although it
core preceded by a few positively charged residues and represented only a small percentage of total activity (6%
followed by a sequence recognized by bacterial signal in samples from late stationary-phase cultures).
peptidases (Tjalsma et al. 1997) is not found in Paeni- To analyse the location of xylanase B, cell extracts and
bacillus sp. BP-23 XynB. The absence of a signal peptide extracellular fractions from early or late stationary-phase
in XynB was confirmed by SignalP and PSORT computer cultures from Paenibacillus sp. BP-23 were analysed by
analysis programs for the identification of signal peptides gel electrophoresis and zymograms. As XynB was
(Nakai and Kanehisa 1992; Nielsen et al. 1999). irreversibly inactivated by SDS, native gels were used
for the zymographic analysis. Paenibacillus sp. BP-23
culture supernatants showed several xylanase activity
Cellular location of XynB from Paenibacillus sp. BP-23 bands: a well defined prominent band, corresponding to
the previously characterized xylanase C (Blanco et al.
Paenibacillus sp. BP-23 was cultured in nutrient broth 1999), and a broad and diffuse band that extended up to
supplemented with birchwood xylan. High xylanase the upper limit of the gel, probably the result of
229

for the cell-associated xylanases. Cell extracts from


Paenibacillus sp. BP-23 showed a single xylanase band
with identical mobility to that of recombinant xylanase B,
while no other significant activity bands were detected.
The results indicate that xylanase B is not secreted to the
medium, but instead, remains cell-associated, even in late
stationary-phase cultures. Cell extracts were centrifuged
to separate membranes from the soluble fraction and
xylanase activity was evaluated. The soluble fraction
showed 97% of the activity associated to cells, indicating
that xylanase B is located in the cytoplasm of Paeni-
bacillus sp. BP-23.

Cloning of xylanase B in B. subtilis


Fig. 3 Zymographic analysis of cell-associated and secreted xy-
lanases from Paenibacillus sp. BP-23. Paenibacillus sp. BP-23 was
cultivated on 0.2% birchwood xylan-supplemented nutrient broth. Xylanase B was cloned and expressed in B. subtilis
Samples were taken after 17 h of incubation (early stationary phase) MW15 (Wolf et al. 1995), which is devoid of background
or after 72 h (late stationary phase), fractionated in cell extracts and xylanase activity. Cultures of recombinant B. subtilis
supernatants, and analysed by native gel electrophoresis and MW15/pRBSPOX20, harbouring xynB, produced xy-
zymograms. Lanes: 1, concentrated supernatants from 17 h lanase that initially remained cell-associated. However,
cultures; 2, cell extracts from 17 h cultures; 3, concentrated
supernatants from 72 h cultures; 4, cell extracts from 72 h cultures. in late stationary-phase cultures (3 days), around 40% of
Lane 5, control cell extracts from E coli-pX20 carrying xynB. Lane total activity was found at the supernatants, probably as a
6, control cell extracts from E- coli-pX31 carrying xynC. Arrows result of cell lysis.
indicate the activity bands corresponding to XynB and XynC The cellular location of xylanase B in B. subtilis
MW15/pRBSPOX20 was also examined by SDS-PAGE.
coalescence of less well defined bands (Fig. 3). The Cell extracts and supernatants from 3-day-old cultures
activity bands detected showed different mobility to that showed a 40 kDa protein band, corresponding to xylanase
of xylanase B from recombinant E. coli-pX20 cells, used B, not found in control B. subtilis MW15/pRBSPO
as a control. The extracellular xylanase profile was cultures (Fig. 1). It is noteworthy that the enzyme
completely different from the zymographic pattern found detected in the two locations showed identical mobility,

Fig. 4 Amino acid alignment of family 10 xylanases. Alignment of (PspXynB), Bacillus stearothermophilus T-6 XynA2 (BstXynA),
the amino acid sequences flanking the conserved regions V and VI Bacillus stearothermophilus 21 Xyn2 (BstXyn2), Thermobacillus
of family 10 xylanases was performed using the ClustalW program. xylanilyticus XynA (TxyXynA), Bacillus sp. N137 XyaA
The xylanases aligned are the 14 enzymes having the highest (BspXyaA) and Caldicellulosiruptor saccharolyticus XynA
homology to xylanase B from Paenibacillus sp. BP-23, according (CsaXynA); accession numbers: AF078737, Q12603, T31085,
to Blast analysis of sequences from the Swissprot and EMBL T30910, Z69782, AF200304, T31082, AB015980, AJ006646,
databases. The sequences shown are: Caldicellulosiruptor sp. AF098273, P45703, Y16849, I40356 and P23556, respectively.
Tok7B.1 XynA (CspXynA), Dictyoglomus thermophilum XynA Numbering of the amino acids starts at the N-termini of the
(DthXynA), Caldicellulosiruptor sp XynC (CspXynC), Caldicel- proteins. Gaps are indicated by dashes. Amino acids identical in at
lulosiruptor saccharolyticus XynE (CsaXynE), Anaerocellum ther- least seven of the sequences aligned are shown in shadowed boxes.
mophilum XynA (AthXynA), Caldibacillus cellulovorans XynA Regions a and b, of conserved amino acids in xylanases from the
(CceXynA), Caldicellulosiruptor sp. XynB (CspXynB), Aeromo- signal peptide-less group, are underlined
nas punctata XynA (ApuXynX), Paenibacillus sp. BP-23 XynB
230

Fig. 5 Dendrogram of xylanases of family 10 based on amino acid Blast analysis, and those enzymes quoted by Baba et al. (1994) and
sequence homology. The dendrogram was generated with ClustalX. Fukumura et al. (1995) in the identification of conserved regions in
The xylanases compared are the 14 enzymes with the highest family 10 xylanases. The arrow indicates the group of seven
homology to XynB from Paenibacillus sp. BP-23, according to xylanases from the signal peptide-less group

suggesting the lack of processing of the xylanase found in stearothermophilus 21 (Baba et al. 1994), XynA from
extracellular media. To confirm this, the N-terminal Thermobacillus xylanilyticus (Connerton et al. 1999), and
sequence of xylanase B from supernatants and cell XynA from Caldicellulosiruptor saccharolyticus (Lthi et
extracts from B. subtilis MW15/pRBSPOX20, and also al. 1990), which showed 85, 57, 55, 55, 54 and 52%
from cell extracts from E coli-pX20, was determined. identity to XynB from Paenibacillus sp. BP-23, respec-
Each of the three samples had the N-terminal sequence tively (Fig. 4). Analysis of the deduced amino acid
STEIPSLSAS, deduced from xynB (Fig. 2). sequences of these enzymes showed that, like xylanase B,
they do not show an N-terminal region with the features
of a signal peptide. This was verified by SignalP and
Homology of xylanase B to enzymes from family 10 PSORT programs analysis for the identification of leader
peptides. Xylanases of family 10 show eight conserved
The deduced amino acid sequence of XynB was com- regions (Baba et al. 1994; Fukumura et al. 1995),
pared to enzyme sequences contained in the Swissprot including the conserved sequences WDVVNE (region
and EMBL databases. Alignment by BLASTP (Altschul III) and TELD (region VI) containing the two Glu
et al. 1997) showed that xylanase B is a single-domain residues, Glu-134 and Glu-241 in the case of XynB,
enzyme with homology to xylanases of family 10 proposed to be the catalytic acid-base and nucleophile
glycosyl hydrolases. The highest homology was found residues in family 10 xylanases (Harris et al. 1994;
to six of these enzymes: XynX from Aeromonas punctata Dominguez et al. 1995). Alignment of XynB from
(Usui et al. 1999), XynA2 from Bacillus stearother- Paenibacillus sp. BP-23 with the six signal peptide-less
mophilus T-6 (Shulami et al. 1999), XyaA from Bacillus xylanases allowed the identification of two additional
sp. N137 (Tabernero et al. 1995), Xyn2 from B. conserved regions, flanking region VI. The regions show
231

the amino acid sequences AIE_YASL (region a) and 1996). However, the significance of this region for
RTDL__PT_EM (region b), and are not found in other secretion of proteins in B. subtilis remains to be
xylanases from family 10. Our results indicate that XynB established.
from Paenibacillus sp. BP-23 and six family 10 xylanases Analysis of sequence homology shows that xylanase B
constitute a distinctive group of highly homologous from Paenibacillus sp. BP-23 belongs to family 10
enzymes that do not exhibit a signal peptide sequence. glycosyl hydrolases and exhibits a distinctive higher
A dendrogram of 28 xylanases of family 10 was generated homology to six xylanases of this family: the three
with the ClustalX program (Thompson et al. 1997) xylanases without a signal peptide mentioned above and
(Fig. 5). This showed that xylanase B, together with the Xyn2 from Bacillus stearothermophilus 21 (Baba et al.
xylanases from the signal peptide-less group, cluster 1994), XynA from Thermobacillus xylanilyticus (Con-
separately from the rest of the enzymes of family 10. The nerton et al. 1999), and XynA from Caldicellulosiruptor
identified group probably constitutes a new type of saccharolyticus (Lthi et al. 1990). These three latter
xylanase with some specific action in the degradation of enzymes have also been shown after computer analysis to
plant xylan. be devoid of signal peptides. Xylanase B from Paeni-
bacillus sp. BP-23 and the six signal peptide-less
xylanases cluster separately from the rest of the family
Discussion 10 xylanases and seem to constitute a separate group of
enzymes. Additionally, they show as a distinctive feature
Paenibacillus sp. BP-23 has a complex xylanolytic the conserved amino acid stretches AIE_YASL and
system with multiple xylanases (Blanco and Pastor RTDL__PT_EM, flanking region VI of family 10
1993), three of which (xylanases A, B and C) have been xylanases. The 3-D structure of xylanase B, predicted
characterized (see Blanco et al. 1995, 1999; this article). by the Swiss pdbViewer program (Guex and Peitsch
This multiplicity of xylanases is similar to that found in 1997), is an (a/b)8 barrel, similar to family 10 enzymes.
other microorganisms (Wong and Saddler 1992; Kulkarni Interestingly, the conserved stretch RTDL__PT_EM folds
et al. 1999), where the cooperation of different xylanases as a random loop located in close proximity to the
with distinctive action on xylan is assumed to favour substrate-binding cleft. This suggests that the residues in
degradation of the polymer. Xylanase B from Paeni- this region can play a role in the catalytic properties of
bacillus sp. BP-23 shows similar activity on xylans of xylanase B. Analysis of domains by the ProDom program
different rate of arabinose or methylglucuronic substitu- (Corpet et al. 2000) showed that xylanase B contains a
tion. Similarly to other xylanases from family 10 (Biely et domain of 41 amino acids (ID: 277407) found exclusively
al. 1997), the characterized enzyme does not require a in the seven xylanases of the signal peptide-less group.
long stretch of unsubstituted xylose residues for the This domain contains the conserved stretch
cleavage of xylan. RTDL__PT_EM and is located between regions VI and
Xylanase B from Paenibacillus sp. BP-23 seems to be VII of family 10 xylanases. This makes the spacing
an intracellular enzyme. Several pieces of evidence between these conserved regions in xylanase B unusually
support this assumption. First, the enzyme does not show long.
a signal peptide. In accord with this, xylanase B was not Our data suggest that xylanase B, together with the six
secreted to the extracellular media by Paenibacillus sp. signal peptide-less xylanases, form a new subclass of
BP-23, but remained cell-associated, in the soluble family 10 xylanases of intracellular location. A cytoplas-
fraction. Additionally, when xynB was overexpressed in mic location would be in agreement with the fact that all
B. subtilis, the enzyme was mainly cell-associated. these xylanases are single-domain enzymes without
Xylanases are usually secreted to the extracellular modules that mediate binding to insoluble substrates.
medium and accordingly, have a signal peptide. However, These xylanases probably hydrolyse short xylooligosac-
XynB from Paenibacillus sp. BP-23 is a cell-associated charides, resulting from extracellular xylan hydrolysis,
enzyme without a signal peptide. To our knowledge this is once they have been transported inside cells. Recently, a
the first example of a xylanase with these traits. Three periplasmic xylanase (XylC) has been characterized in
other xylanases without signal peptide have been reported Cellvibrio mixtus (Fontes et al. 2000). The xylanase
up to date, although no experimental evidence of their shows a typical signal peptide (Fontes et al. 2000) and
location has been provided. These enzymes are: XynX does not show homology or clustering with the group of
from Aeromonas punctata, XynA2 from Bacillus signal peptide-less xylanases described in this paper.
stearothermophilus T6 and XyaA from Bacillus sp. strain The group of xylanases proposed here may differ from
N137 (Usui et al. 1999; Shulami et al. 1999; Tabernero et extracellular xylanases in substrate specificity by some
al. 1995). These enzymes have been proposed to be subtle, not yet identified, traits. One of these could be
intracellular or, alternatively, secreted to the extracellular high activity on pNP-b-xyloside, which can suggest an
medium by a signal peptide-independent mechanism, exo-type of catalytic activity. Although the occurrence of
similar to ABC exporter systems described in Gram- true exoxylanases remains to be elucidated, this type of
negative bacteria (Binet et al. 1997). A region of the B. mechanism has been proposed for xylanases from
subtilis chromosome has been found to contain sequences Prevotella ruminicola and Aeromonas caviae (Gasparic
homologous to ABC transporter genes (Yamamoto et al. et al. 1995; Kubata et al. 1994). Our results indicate that
232

xylanase B belongs to a new group of xylanases, bearing Corpet F, Servant F, Gouzy J, Kahn D (2000) ProDom and
unusual features probably related to some specific, not yet ProDom-CG: tools for protein domain analysis and whole
genome comparisons. Nucleic Acids Res 28:267–269
identified, function in degradation of plant xylan. The Davies G, Henrissat B (1995) Structure and mechanism of glycosyl
biotechnological applications of this new subclass of hydrolases. Structure 3:853–859
xylanases have not yet been evaluated, but their distinc- Dominguez R, Souchon H, Spinelli S, Dauter Z, Wilson KS,
tive properties make them good candidates for the Chauvaux S, Bguin P, Alzari PM (1995) A common protein
fold and similar active site in two distinct families of b-
specific modification of xylan-containing substrates. glycanases. Nat Struct Biol 2:569–576
Fontes CMGA, Gilbert HJ, Hazlewood GP, Clarke JH, Prates JAM,
Acknowledgements We thank Monika Wolf for her gift of McKie VA, Nagy T, Fernandes TH, Ferreira LMA (2000) A
bacterial strain Bacillus subtilis MW15 and Gaspar Prez-Gonzlez novel Cellvibrio mixtus family 10 xylanase that is both
for his gift of plasmid pRB473. We also thank Serveis Cientfico- intracellular and expressed under non-inducing conditions.
T cnics of the University of Barcelona for their support in Microbiology 146:1959–1967
nucleotide sequencing, Servei de Prote
mica i Bioinform tica of Fukumura M, Sakka K, Shimada K, Ohmiya K (1995) Nucleotide
Universitat Aut
noma de Barcelona for the N-terminal sequencing sequence of the Clostridium stercorarium xynB gene encoding
of XynB and Margarita Soriano for technical aid in the construction an extremely thermostable xylanase, and characterization of the
of pRBSPO. This work was partially supported by the Spanish translated product. Biosci Biotechnol Biochem 59:40–46
Ministry of Science and Technology (CICYT), project ref. Gasparic A, Martin J, Daniel AS, Flint HJ (1995) A xylan hydrolase
PPQ2000-0091-P4-04, and the Generalitat de Catalunya (III Pla gene cluster in Prevotella ruminicola B14: sequence relation-
de Recerca, project. ref. 2001SGR 00143) and Centre de Refer ncia ships, synergistic interactions, and oxigen sensitivity of a novel
en Biotecnologia (CerBa). Oscar Gallardo held a FI grant from enzyme with exoxylanase and b-(1,4)-xylosidase activity. Appl
Generalitat de Catalunya. Environ Microbiol 61:2958–2964
Gilkes NR, Henrissat B, Kilburn DG, Miller RC Jr, Warren RAJ
(1991) Domains in microbial b-1,4-glycanases: sequence
conservation, function, and enzyme families. Microbiol Rev
References 55:303–315
Guex N, Peitsch MC (1997) SWISS-MODEL and the Swiss-
Altschul SF, Madden TL, Sch ffer AA, Zhang J, Zhang Z, Miller PdbViewer: an environment for comparative protein modeling.
W, Lipman DJ (1997) Gapped BLAST and PSI-BLAST: a new Electrophoresis 18:2714–2723
generation of protein database search programs. Nucleic Acids Hames BD, Rickwood D (1981) Gel electrophoresis of proteins: a
Res 25:3389–3402 practical approach. IRL, Oxford University Press, Oxford
Baba T, Shinke R, Nanmori T (1994) Identification and character- Harris GW, Jenkins JA, Connerton I, Cummings N, Lo Leggio L,
ization of clustered genes for thermostable xylan-degrading Scott M, Hazlewood GP, Laurie JI, Gilbert HJ, Pickersgill RW
enzymes, b-xylosidase and xylanase, of Bacillus stearother- (1994) Structure of the catalytic core of the family F xylanase
mophilus 21. Appl Environ Microbiol 60:2252–2258 from Pseudomonas fluorescens and identification of the
Biely P, VrÐansk M, Tenkanen M, Kluepfel D (1997) Endo-b-1,4- xylopentaose-binding sites. Structure 2:1107–1116
xylanase families: differences in catalytic properties. J Biotech- Henrissat B, Bairoch A (1996) Updating the sequence-based
nol 57:151–166 classification of glycosyl hydrolases. Biochem J 316:695–696
Binet R, Ltoff S, Ghigo JM, Delepelaire P, Wandersman C Keen NT, Boyd C, Henrissat B (1996) Cloning and characterization
(1997) Protein secretion by Gram-negative bacterial ABC of a xylanase gene from corn strains of Erwinia chrysanthemi.
exporters: a review. Gene 192:7-11 Mol Plant Microb Interact 9:651–657
Blanco A, Pastor FIJ (1993) Characterization of cellulase-free Kubata BK, Suzuki T, Horitsu H, Kawai K, Takamizawa K (1994)
xylanases from the newly isolated Bacillus sp. strain BP-23. Purification and characterization of Aeromonas caviae ME-1
Can J Microbiol 39:1162–1166 xylanase V, which produces exclusively xylobiose from xylan.
Blanco A, Vidal T, Colom JF, Pastor FIJ (1995) Purification and Appl Environ Microbiol 60:531–535
properties of xylanase A from alkali-tolerant Bacillus sp. strain Kulkarni N, Shendye A, Rao M (1999) Molecular and biotechno-
BP-23. Appl Environ Microbiol 61:4468–4470 logical aspects of xylanases. FEMS Microbiol Rev 23:411–456
Blanco A, Daz P, Martnez J, L pez O, Soler C, Pastor FIJ (1996) Laemmli UK (1970) Cleavage of structural proteins during the
Cloning of a Bacillus sp. BP-23 gene encoding a xylanase with assembly of the head of bacteriophage T4. Nature 227:680–685
high activity against aryl-xylosides. FEMS Microbiol Lett Lthi E, Love DR, McAnulty J, Wallace C, Caughey PA, Saul D,
137:285–290 Bergquist PL (1990) Cloning, sequence analysis, and expres-
Blanco A, Daz P, Zueco J, Parascandola P, Pastor FIJ (1999) A sion of genes encoding xylan-degrading enzymes from the
multidomain xylanase from a Bacillus sp. with a region thermophile Caldocellum saccharolyticum. Appl Environ Mi-
homologous to thermostabilizing domains of thermophilic crobiol 56:1017–1024
enzymes. Microbiology 145:2163–2170 Miyazaki K, Martin JC, Marinsek-Logar R, Flint HJ (1997)
Brckner R (1992) A series of shuttle vectors for B. subtilis and E. Degradation and utilization of xylans by the rumen anaerobe
coli. Gene 122:187–192 Prevotella bryantii (formerly P. ruminicola subsp. brevis) B14.
Charnock SJ, Bolam DN, Turkenburg JP, Gilbert HJ, Ferreira Anaerobe 3:373–381
LMA, Davies GJ, Fontes CMGA (2000) The X6 "thermosta- Nagarajan, V (1993) Protein secretion. In: Sonenshein AL, Hoch
bilizing" domains of xylanases are carbohydrate-binding mod- JA, Losick R (eds) Bacillus subtilis and other Gram-positive
ules: structure and biochemistry of the Clostridium bacteria. (Biochemistry, physiology, and molecular genetics)
thermocellum X6b domain. Biochemistry 39:5013–5021 American Society for Microbiology, Washington, D.C., pp.
Cohen SN, Chang S (1979) High frequency transformation of 713–726
Bacillus subtilis protoplasts by plasmid DNA. Mol Gen Genet Nakai K, Kanehisa M (1992) A knowledge base for predicting
168:111–115 protein localization sites in eukaryotic cells. Genomics 14:879–
Connerton I, Cummings N, Harris GW, Debeire P, Breton C (1999) 911
A single domain thermophilic xylanase can bind insoluble Nielsen H, Brunak SY, Heijne G (1999) Machine learning
xylan: evidence for surface aromatic clusters. Biochim Biophys approaches to the prediction of signal peptides and other
Acta 1433:110–121 protein sorting signals. Protein Eng 12:3-9
Packman LC (1993) Protein chemical methods for molecular
biologists. Methods Mol Cell Biol 4:189–198
233
Sambrook J, Fritsch EF, Maniatis T (1989) Molecular cloning: a signal peptidases with overlapping substrate specificities. J Biol
laboratory manual, 2nd edn. Cold Spring Harbor Laboratory, Chem 272:25983–25992
Cold Spring Harbor, N.Y. Tomme P, Boraston A, McLean B, Kormos J, Creagh AL, Sturch
Schoner RG, Williams DM, Lovett PS (1983) Enhanced expression K, Gilkes NR, Haynes CA, Warren RAJ, Kilburn DG (1998)
of mouse dihydrofolate reductase in Bacillus subtilis. Gene Characterization and affinity applications of cellulose-binding
22:47–57 domains. J Chromatogr B 715:283–296
Shulami S, Gat O, Sonenshein A, Shoham Y (1999) The glucuronic Usui K, Ibata K, Suzuki T, Kawai K (1999) XynX, a possible exo-
acid utilization gene cluster from Bacillus stearothermophilus xylanase of Aeromonas caviae ME-1 that produces exclusively
T-6. J Bacteriol 181:3695–3704 xylobiose and xylotetraose from xylan. Biosci Biotechnol
Spiro RG (1966) The Nelson-Somogyi copper reduction method: Biochem 63:1346–1352
analysis of sugars found in glycoprotein. Methods Enzymol Wolf M, Geczi A, Simon O, Borriss R (1995) Genes encoding
8:3-26 xylan and b-glucan hydrolysing enzymes in Bacillus subtilis:
Tabernero C, Snchez-Torres J, Prez P, Santamara RI (1995) characterization, mapping and construction of strains deficient
Cloning and DNA sequencing of xyaA, a gene encoding an in lichenase, cellulase and xylanase. Microbiology 141:281–
endo-b-1,4-xylanase from an alkalophilic Bacillus strain 290
(N137). Appl Environ Microbiol 61:2420–2424 Wong KKY, Saddler JN (1992) Trichoderma xylanases, their
Thompson JD, Gibson TJ, Plewniak F, Jeanmougin F, Higgins DG properties and application. Crit Rev Biotechnol 12:413–435
(1997) The ClustalX windows interface: flexible strategies for Yamamoto H, Uchiyama S, Sekiguchi J (1996) The Bacillus
multiple sequence alignment aided by quality analysis tools. subtilis chromosome region near 78 contains the genes
Nucleic Acids Res 24:4876–4882 encoding a new two-component system, three ABC transporters
Tjalsma H, Noback MA, Bron S, Venema G, Yamane K, Dijl, JM and a lipase. Gene 181:147–151
van (1997) Bacillus subtilis contains four closely related type I
CURRENT MICROBIOLOGY Vol. 48 (2004), pp. 276 –279
DOI: 10.1007/s00284-003-4196-0 Current
Microbiology
An International Journal
© Springer-Verlag New York LLC 2004

Cloning and Characterization of Xylanase A from the Strain Bacillus


sp. BP-7: Comparison with Alkaline pI-Low Molecular Weight
Xylanases of Family 11
Óscar Gallardo, Pilar Diaz, F.I. Javier Pastor
Departament de Microbiologia, Facultat de Biologia, Universitat de Barcelona, Avinguda Diagonal 645, 08028 Barcelona, Spain

Received: 16 July 2003 / Accepted: 15 August 2003

Abstract. The xynA gene encoding a xylanase from the recently isolated Bacillus sp. strain BP-7 has been
cloned and expressed in Escherichia coli. Recombinant xylanase A showed high activity on xylans from
hardwoods and cereals, and exhibited maximum activity at pH 6 and 60°C. The enzyme remained stable
after incubation at 50°C and pH 7 for 3 h, and it was strongly inhibited by Mn2⫹, Fe3⫹, Pb2⫹, and Hg2⫹.
Analysis of xylanase A in zymograms showed an apparent molecular size of 24 kDa and a pI of above
9. The amino acid sequence of xylanase A, as deduced from xynA gene, shows homology to alkaline
pI-low molecular weight xylanases of family 11 such as XynA from Bacillus subtilis. Analysis of codon
usage in xynA from Bacillus sp. BP-7 shows that the G⫹C content at the first and second codon positions
is notably different from the mean values found for glycosyl hydrolase genes from Bacillus subtilis.

Biodegradation of xylan, a major component of plant cell gene encoding xylanase A from Bacillus sp. BP-7, and
walls, is a complex process that requires the coordinate the characterization of the enzyme.
action of several enzymes, among which xylanases (1,4-
␤-D-xylan xylanohydrolase; EC 3.2.1.8), cleaving inter- Materials and Methods
nal linkages on the ␤-1,4-xylose backbone, play a key Nucleic acids manipulation. Plasmid DNA was purified by the alka-
role. Based on amino acid sequence homologies and line lysis procedure [16] or by chromatography (QIAGEN-tip 100
hydrophobic cluster analysis, xylanases have been clas- MidiPrep, Promega). Restriction nucleases and ligase were purchased
from Boehringer Mannheim. Escherichia coli XL1-Blue was trans-
sified in two groups, family 10 and family 11 [7, 9]. formed as described [16]. The sequences of both strands of xynA,
However, xylanases homologous to family 5 ␤-gly- contained in plasmid pXA30, were determined by automated fluores-
canases have also been found [10]. The complex chem- cence sequencing with an ABI PRISM dye terminator cycle sequencing
ical nature and heterogeneity of xylan can account for the ready reaction mix (Perkin Elmer) in a 377 Perkin Elmer DNA se-
quencer. Sequence homology was analyzed through BLAST [1].
multiplicity of xylanases produced by microorganisms
[11]. Members of the genus Bacillus produce many dif- Enzyme assays. Escherichia coli/pXA30 was grown on ampicillin
supplemented LB broth at 37°C for 16 h, and cells were collected and
ferent xylanases, several of which have been cloned and disrupted by sonication. Xylanase activity on cell extracts was assayed
characterized [2, 8, 14]. The activity of different xyla- as described [5]. The assay mixture contained 0.5% (wt/vol) xylan,
nases with subtle differences in substrate specificity and pNP-␤-xyloside, oNP-␤-xyloside, pNP-␤-glucopyranoside, pNP-␣-ar-
mode of action should improve degradation of plant abinofuranoside or pNP-␣-arabinopyranoside (Sigma Chemical Co.) in
a final volume of 0.1– 0.25 mL of 50 mM Tris-HCl buffer pH 6. The
xylan in natural habitats. mixture was incubated at 60°C for 15 min. Color development was
The alkali-tolerant strain Bacillus sp. BP-7 secretes measured at 520 nm for xylans and 400 nm for oNP and pNP deriva-
high xylanase activity in media supplemented with xy- tives. One unit of enzymatic activity was defined as the amount of
lose and shows a complex xylanolytic system [13]. In enzyme that releases 1 ␮mol of reducing sugar equivalent, p-nitrophe-
nol or o-nitrophenol per minute under the assay conditions described.
this article we describe the cloning and sequencing of the
Gel electrophoresis and zymograms. Sodium dodecyl sulfate poly-
acrylamide gel electrophoresis (SDS-PAGE) was performed in 12%
Correspondence to: F.I.J. Pastor; email: fpastor@bio.ub.es gels essentially as described by Laemmli [12]. For detection of xyla-
Ó. Gallardo et al.: Xylanase A from Bacillus sp. BP-7 277

nase activity, 0.2% (wt/vol) birchwood xylan was included in the gels Table 1. Substrate specificity of crude xylanase A
before polymerization. Samples were heated for 10 min at 45°C in
sample buffer before being applied to gels. After electrophoresis, gels Specific activity
were soaked in 2.5% (wt/vol) Triton X-100 for 30 min, washed in 50 Substrate (U/mg)a
mM phosphate buffer pH 7 for 30 min, and incubated at 37°C for 15
min in the same buffer. Gels were stained with 0.1% (wt/vol) Congo Birchwood xylan 0.182
red for 15 min and washed with 1 M NaCl until xylanase bands became Beechwood xylan 0.207
visible. Gels were then immersed in 5% (wt/vol) acetic acid, in which Methylglucuronoxylan 0.139
the background turned dark blue, and photographed. Oat spelt xylan 0.145
Isoelectric focusing (IEF) was performed with a Pharmacia Phast- Wheat arabinoxylan 0.164
System unit. Gels with a pH range from 3.0 to 9.0 (Amersham Phar- Rye arabinoxylan 0.054
macia Biotech AB) were used. After electrophoresis, gels were overlaid Carboxymethyl cellulose ND
with 1% agarose gels containing 0.5% (wt/vol) birchwood xylan, Avicel ND
incubated for 45 min at 37°C, stained with Congo red, and washed with Laminarin ND
NaCl. Lichenan 0.003
Polygalacturonate ND
Nucleotide sequence accession number. The DNA sequence of xynA
Pectin 0.003
gene was submitted to the EMBL database under accession number
Starch 0.003
AJ536759.
pNPX 0.001
oNPX 0.001
pNPG 0.001
Results and Discussion pNPAp 0.001
Cloning of xylanase A encoding gene. A gene library pNPAf 0.002
from Bacillus sp. BP-7, previously constructed in Es- a
ND, not detected.
cherichia coli [15], was screened for xylanase activity on
agar LB plates containing 0.1% (wt/vol) Remazol Bril-
liant Blue R-D-Xylan. Six clones out of the 4500 tested enzyme remained stable at 50°C and pH 7 for at least 3 h
showed clear halos around the bacterial growth and were (Fig. 1). However, at 60°C, the enzyme lost 78% of its
selected. Four of these clones carried recombinant plas- activity after 15 min incubation. The effect of different
mids with different inserts that contained a common metal ions at a concentration of 10 mM on xylanase A
DNA segment of 3.8 kb. The smallest of these plasmids activity was also determined. The enzyme was com-
was digested with HindIII, and fragments were inserted pletely inhibited by Mn2⫹, while strong inhibition was
in pUC19. After transformation in Escherichia coli, a caused by Fe3⫹, Pb2⫹, and Hg2⫹ (3.0, 12.9, and 22.4%
clone harboring plasmid pXA30, containing a 1.6 kb residual activity, respectively). Little inhibition was
DNA insert and expressing xylanase activity, was chosen caused by Cu2⫹, Zn2⫹, Ni2⫹, Ag2⫹, Co2⫹, and Ca2⫹.
for further experiments. Mg2⫹ did not affect enzyme activity, while Ba2⫹ pro-
duced a small stimulating effect.
Properties of the enzyme. The activity of the enzyme
The gene product contained in pXA30 was charac-
produced by the recombinant clone was tested on several
terized by SDS-PAGE and zymographic analysis. An
polysaccharides. Cells from E. coli/pXA30 cultures were
intense and well-defined xylanase activity band, showing
disrupted by sonication, and the lysates obtained were
an apparent molecular weight of 24 kDa, was found in
assayed for activity. High hydrolytic activity was found
zymograms from E. coli/pXA30 (Fig. 2). The xylanase
on most xylans tested, showing the maximum value on
band was not detected in extracts from control cells from
beechwood xylan, while activity on highly arabinose-
E. coli/pUC19. Analysis of the recombinant enzyme in
substituted xylan from rye was considerably lower (Ta-
isoelectric focusing gels and zymograms showed a
ble 1). Cloned enzyme showed very low activity on
unique and prominent activity band in the upper pH limit
pNP-xyloside and other aryl-glycosides tested. Activity
of the gel, indicating xylanase A has a pI of 9.0 or higher
was not detected on carboxymethyl cellulose or Avicel,
(Fig. 2).
and no significant activity was found on other polysac-
charides. The results obtained indicate the cloned en- Analysis of xylanase coding sequence. The nucleotide
zyme is an endoxylanase. We call the enzyme XynA. sequence of the 1394 bp DNA insert of pXA30 was
The effects of pH and temperature on the activity of determined. It contained an open reading frame of 639 bp
xylanase A were determined. Optimum conditions for encoding a protein of 213 amino acids with deduced
activity were 60°C and pH 6. The enzyme was highly molecular weight and isoelectric point of 23,475 Da and
active in a wide range of pH, showing more than 50% of 9.28, respectively, in agreement with results from zymo-
maximum xylanase activity in the pH range from 4.5 to graphic analysis. Alignment of the deduced amino acid
8.5 (Fig. 1). Thermostability assays indicated that the sequence of xynA to ␤-glycanase sequences contained in
278 CURRENT MICROBIOLOGY Vol. 48 (2004)

Fig. 1. Effect of pH and temperature on xylanase A


activity. (A) Effect of pH on activity of XynA. (B)
Thermal stability of XynA at pH 7 and 50°C (F),
55°C (E), or 60°C (}).

XynA from B. agaradhaerens [EMBL accession number


A68006] was only 78, 75, 46, and 45%, respectively.
A recent report on codon usage in glycosyl hydro-
lases shows that the G⫹C content at the first and second
codon positions of xynA from B. subtilis (38.3 and
52.8%, respectively) differs widely from the average
G⫹C content at the same codon positions of glycosyl
hydrolase genes of this microorganism (51.7 and 37.7%,
respectively) [6]. Similar results have been found for
xynA from B. circulans, suggesting that these genes have
been acquired by horizontal gene transfer, through trans-
duction mediated by prophage 6, probably from an ac-
tynomycetes-related organism. Interestingly, the G⫹C
content values at the first and second codon positions of
xynA from Bacillus BP-7 (38.2 and 52.1%, respectively),
are similar to those found in B. subtilis xynA. The results
found suggest that the cloned xylanase corresponds to a
highly conserved enzyme that has probably been ac-
Fig. 2. Electrophoretic analysis of xylanase A. (A) Coomassie Blue- quired by Bacillus sp. BP-7 by horizontal gene transfer
stained SDS polyacrylamide gel. (B) Zymogram of an SDS polyacryl-
amide gel. (C) Zymogram of an isoelectric focusing gel. Lanes 1:
from a related Bacillus strain.
Control cell extracts from Escherichia coli/pUC19; lanes 2: cell ex-
tracts from Escherichia coli/pXA30. The positions of molecular weight ACKNOWLEDGMENTS
standards and of pI markers are indicated.
We thank Serveis Cientı́fico-Tècnics of the University of Barcelona for
their support in nucleotide sequencing. This work was partially sup-
ported by the Spanish Ministery of Science and Technology (CICYT),
Swissprot and EMBL databases showed that xylanase A project ref. PPQ2000-0091-P4-04; the Generalitat de Catalunya (III Pla
from Bacillus sp. BP-7 is a single domain enzyme with de Recerca, project. ref. 2001SGR 00143); and Centre de Referència en
Biotecnologia (CeRBa). Óscar Gallardo held an FI grant from the
homology to xylanases of family 11. The cloned enzyme
Generalitat de Catalunya.
seems to belong to the type of “alkaline pI-low molecular
weight xylanases”, that was proposed to constitute the
core group of family 11 glycanases, and that seems to be Literature Cited
1. Altschul SF, Madden TL, Schäffer AA, Zhang J, Zhang Z, Miller
ubiquitous among Bacillus species [17]. However, this
W, Lipman DJ (1997) Gapped BLAST and PSI-BLAST: A new
type of xylanase is differently conserved among the generation of protein database search programs. Nucleic Acids Res
different isolates and species of the genus. In this way, 25:3389 –3402
xylanase A from Bacillus sp. BP-7 shows 92% identity 2. Blanco A, Dı́az P, Zueco J, Parascandola P, Pastor FIJ (1999) A
with the low-molecular-weight xylanases from B. subtilis multidomain xylanase from a Bacillus sp. with a region homolo-
gous to thermostabilizing domains of thermophilic enzymes. Mi-
[14], B. circulans [18], and Bacillus sp. YA-14 [19],
crobiology 145:2163–2170
while the identity found with XynA from B. stearother- 3. Cho S, Choi Y (1995) Nucleotide sequence analysis of an endo-
mophilus [3], XynN from B. halodurans [EMBL acces- xylanase gene (xynA) from Bacillus stearothermophilus. J Micro-
sion number AY170624], XynA from B. pumilus [4], and biol Biotechnol 5:117–124
Ó. Gallardo et al.: Xylanase A from Bacillus sp. BP-7 279

4. Fukusaki E, Panbangred W, Shinmyo A, Okada H (1984) The 12. Laemmli UK (1970) Cleavage of structural proteins during the
complete nucleotide sequence of the xylanase gene (xynA) of assembly of the head of bacteriophage T4. Nature 227:680 – 685
Bacillus pumilus. FEBS Lett 171:197–201 13. López C, Blanco A, Pastor FIJ (1998) Xylanase production by a
5. Gallardo Ó, Diaz P, Pastor FIJ (2003) Characterization of a Paeni- new alkali-tolerant isolate of Bacillus. Biotechnol Lett 20:243–246
bacillus cell-associated xylanase with high activity on aryl-xylo- 14. Paice MG, Bourbonnais R, Desrochers M, Jurasek L, Yaguchi M
sides: A new subclass of family 10 xylanases. Appl Microbiol (1986) A xylanase gene from Bacillus subtilis: nucleotide se-
Biotechnol 61:226 –233 quence and comparison with B. pumilus gene. Arch Microbiol
6. Garcia-Vallvé S, Palau J, Romea A (1999) Horizontal gene transfer 144:201–206
in glycosyl hydrolases inferred from codon usage in Escherichia 15. Prim N, Pastor FIJ, Diaz P (2001) Cloning and characterization of
coli and Bacillus subtilis. Mol Biol Evol 16:1125–1134 a bacterial cell-bound type B carboxylesterase from Bacillus sp.
BP-7. Curr Microbiol 42:237–240
7. Gilkes NR, Henrissat B, Kilburn DG, Miller RC Jr, Warren RAJ
16. Sambrook J, Fritsch EF, Maniatis T (1989) Molecular cloning: A
(1991) Domains in microbial ␤-1,4-glycanases: Sequence conser-
laboratory manual, 2nd ed. Cold Spring Harbor, NY: Cold Spring
vation, function, and enzyme families. Microbiol Rev 55:303–315
Harbor Laboratory Press
8. Gupta N, Reddy VS, Maiti S, Ghosh A (2000) Cloning, expression
17. Wong KKY, Tan LUL, Saddler JN (1988) Multiplicity of ␤-1,4-
and sequence analysis of the gene encoding the alkali-stable, xylanase in microorganisms: Functions and applications. Micro-
thermostable endoxylanase from alkalophilic, mesophilic Bacillus biol Rev 52:305–317
sp. strain NG-27. Appl Environ Microbiol 66:2631–2635 18. Yang RCA, MacKenzie R, Bilous D, Narang SA (1989) Hyper-
9. Henrissat B, Bairoch A (1996) Updating the sequence-based clas- expression of a Bacillus circulans xylanase gene in Escherichia
sification of glycosyl hydrolases. Biochem J 316:695– 696 coli and characterization of the gene product. Appl Environ Mi-
10. Keen NT, Boyd C, Henrissat B (1996) Cloning and characteriza- crobiol 55:1192–1195
tion of a xylanase gene from corn strains of Erwinia chrysanthemi. 19. Yu JH, Park YS, Yum DY, Kim JM, Kong IS, Bai DH (1993)
Mol Plant-Microbe Interact 9:651– 657 Nucleotide sequence and analysis of a xylanase gene (xynS) from
11. Kulkarni N, Shendye A, Rao M (1999) Molecular and biotechno- alkali-tolerant Bacillus sp. YA-14 and comparison with other xy-
logical aspects of xylanases. FEMS Microbiol Rev 23:411– 456 lanases. J Microbiol Biotechnol 3:139 –145
Use of the Cell Wall Protein Pir4
as a Fusion Partner for the Expression
of Bacillus sp. BP-7 Xylanase A in
Saccharomyces cerevisiae

Isabel Andrés,1 Oscar Gallardo,2 Palma Parascandola,3


F.I. Javier Pastor,2 Jesús Zueco1
1
Unidad de Microbiologı́a, Facultad de Farmacia, Univ. De Valencia,
Avda. Vicente Andrés Estelles s/n. 46100-Burjassot (Valencia), Spain;
telephone: 34-963543605; fax: 34-963544299;
e-mail: jesus.zueco@ uv.es
2
Dep. Microbiologia, Fac. Biologı́a, Univ. Barcelona, Avinguda Diagonal 645,
08028-Barcelona, Spain
3
Dip. di Ingegneria Chimica e Alimentare, Università degli Studi di Salerno,
Via Ponte Don Melillo 1, I-84084 Fisciano, SA, Italy
Received 7 July 2004; accepted 14 October 2004

Published online 31 January 2005 in Wiley InterScience (www.interscience.wiley.com). DOI: 10.1002/bit.20375

Abstract: Xylanase A from Bacillus sp. BP7, an enzyme INTRODUCTION


with potential applications in biotechnology, was used to
test Pir4, a disulfide bound cell wall protein, as a fusion The cell wall of the yeast Saccharomyces cerevisiae is
partner for the expression of recombinant proteins in made of three main components: h-1,6 and h-1,3-glucans,
standard or glycosylation-deficient mnn9 strains of Sac- chitin, and mannoproteins. Glucans and chitin are localized
charomyces cerevisiae. Five different constructions were to the inner part of the cell wall and are responsible for the
carried out, inserting in-frame the coding sequence of
xynA gene in that of PIR4, with or without the loss of structural strength and the shape of the cell wall, while
specific regions of PIR4. Targeting of the xylanase fusion mannoproteins are localized to the surface of the cells and
protein to the cell wall was achieved in two of the five their main role seems to be structural and that of mediating
constructions, while secretion to the growth medium was with the environment (Klis, 1994; Klis et al., 2002). A
the fate of the gene product of one of the constructions. In biotechnologically interesting feature of S. cerevisiae, first
all three cases localization of the xylanase fusion proteins
was confirmed both by Western blot and detection with demonstrated by Schreuder et al. (1993), is the possibility
Pir-specific antibodies and by xylanase activity determi- to immobilize heterologous enzymes on the cell surface by
nation. The cell wall-targeted fusion proteins could be fusing them to a cell wall protein, creating in this way an
extracted by reducing agents, showing that the inclusion easy-to-separate reusable biocatalyst (Schreuder et al.,
of a recombinant protein of moderate size does not af- 1996). Different groups of cell wall mannoproteins (CWPs)
fect the way Pir4 is attached to the cell wall. Also, the
construction that leads to the secretion of the fusion have been used as partners for the targeting of recombinant
protein permitted us to identify a region of Pir4 responsible fusion proteins to the yeast cell wall: that of the glucanase-
for cell wall retention. In summary, we have developed a extractable GPI-CWPs, which are linked to h-1,6-glucan
Pir4-based system that allows selective targeting of an through the remnant of a glycosylphosphatidylinositol
active recombinant enzyme to the cell wall or the growth group, the Pir-CWP group, supposedly linked to h-1,3-
medium. This system may be of general application for the
expression of heterologous proteins in S. cerevisiae for glucan through alkali-sensitive linkages, and that of the
surface display and secretion. B 2005 Wiley Periodicals, Inc. disulphide-bound cell wall proteins. GPI-CWPs have been
Keywords: Saccharomyces cerevisiae; Pir cell wall pro- used as fusion partners for the targeting of a reporter
teins; recombinant protein expression; cell wall targeting; enzyme to the cell wall (Schreuder et al., 1993; Van der
secretion; xylanase Vaart et al., 1997), for the immobilization of glucolytic
enzymes on the cell surface to create a starch-utilizing yeast
(Murai et al., 1997a,b, 1998, 1999; Sato et al., 2002), for
the expression of lipases (Schreuder et al., 1996; Washida
Correspondence to: Jesús Zueco et al., 2001; Matsumoto et al., 2002), or for the surface
Contract grant sponsors: Ministerio de Ciencia y Tecnologı́a (Spain);
Generalitat Valenciana
display of the staphylococcal protein A (Andrés et al.,
Contract grant numbers: BMC2001-2761; Grupos 03/106, and a 2003), while Pir1 and Pir2, two Pir-CWPs, have been used
predoctoral grant (to I.A.) for the cell wall targeting of different glycosyltransferases

B 2005 Wiley Periodicals, Inc.


so as to create single-cell biocatalysts (Abe et al., 2003, Reagents
2004). Finally, Aga2p, a disulphide-bound CWP, has been
Agar, yeast extract, peptone, and yeast nitrogen base were
used as a carrier to present a library of antibody fragments
purchased from Difco Laboratories (Detroit, MI); phenyl-
on the cell surface (Boder and Wittrup, 1997; Kieke at al.,
methylsulphonylfluoride (PMSF) was from Roche (Nutley,
1997, Wittrup, 2001).
NJ); DNA restriction and modification enzymes were from
Pir4 belongs to the so-called Pir (proteins with internal
Roche, New England Biolabs (Beverly, MA), and Amer-
repeats) family of S. cerevisiae cell wall proteins (Toh-e
sham-Pharmacia (Amersham, UK). Tris-base, HCl, and
et al., 1993; Mrsa et al., 1997; Klis et al., 2002), which
other buffer reagents were purchased from Sigma Chemical
are supposed to be directly attached to h-1,3-glucan.
(St. Louis MO) and from Panreac (Barcelona, Spain).
However, two of the four PIR-CWPs described, Pir4 and
Electrophoresis reagents were from Bio-Rad Laboratories
Pir2/Hsp150, are secreted to the medium to a variable
(Hercules, CA). Nitrocellulose membranes and the chemi-
degree (Russo et al., 1992; Moukadiri and Zueco, 2001)
luminescence ECL reagents for developing Western
and can be specifically extracted from isolated cell walls
immunoblots were from Amersham. Goat antirabbit IgG-
by reducing agents (Moukadiri et al., 1999; Moukadiri and
peroxidase was from Bio-Rad.
Zueco, 2001) and, accordingly, they can be included
among the disulphide-bound cell wall proteins. In this
work, we describe the use of Pir4 for the targeting of
xylanase A from Bacillus sp. BP-7 to the yeast cell wall Transformation of Strains, DNA Isolation,
or to the culture medium. Xylan is a complex polymer and Sequencing
of plant cell walls that is second only to cellulose in Basic DNA manipulation and transformation in E. coli was
abundance in nature. The xylanases, which are the en- performed as described by Sambrook et al. (1989). Yeast
zymes responsible for the depolymerization of the xylan transformation was carried out by the lithium acetate
backbone, have attracted interest because of their poten- method (Ito et al., 1983; Gietz and Sugino, 1988). Plasmid
tial biotechnological application in pulp bleaching and DNA from E. coli was prepared using the Flexi-Prep kit
in the food and animal feed industries (Maat et al., (Amersham-Pharmacia) and DNA fragments were purified
1992; Beauchemin et al., 1995; Luonteri et al., 1996). from agarose gels using the Sephaglass Band-Prep kit, also
S. cerevisiae does not naturally secrete xylanases and from Amersham-Pharmacia. Sequencing was performed
cannot degrade xylan (Jeffries, 1983); however, it is an using Amplytaq polymerase with a Dye Terminator kit
attractive host for the expression and production of (Perkin Elmer, Norwalk, CT) in an Applied Biosystems
recombinant xylanases (Li and Ljungdahl, 1996; Peréz- (Foster City, CA) 373A automatic sequencer.
Gonzaléz et al., 1996; Ganga et al., 1999; La Grange
et al., 2001). It provides for posttranslational processing
such as proteolytic cleavage and glycosylation and, since
it normally secretes few proteins and in low abundance, Construction of the Different Gene Fusions
Between PIR4 and XYNA
a secreted heterologous protein is easily separated from
most other yeast proteins. Furthermore, it is a GRAS The first step consisted of subcloning the complete
(generally regarded as safe) organism, which allows sequence of the PIR4 gene into vector YEplac195 (Gietz
for its use in the food and pharmaceutical industries, and Sugino, 1988), whose SalI restriction site had been
and there is ample experience in its growth in indus- previously destroyed. For this, YEplac195 was digested
trial fermentors. with PstI and XbaI and the resulting protruding ends were
filled in with Klenow and ligated with the loss of the PstI,
HincII, SalI, and XbaI sites from the polylinker of
MATERIALS AND METHODS YEplac195. The complete sequence of PIR4, including
its regulatory sequences, was amplified by PCR using
oligonucleotides PIR5V and PIR3V (Table I) and Expand High
Strains and Media
Fidelity Polymerase from Roche. The resulting 1.2-Kbp
Escherichia coli DH5a was used for the propagation of fragment was subcloned in the SmaI site of YEplac195,
plasmids; it was grown in Luria broth supplemented with previously modified as described above, to give construc-
100 Ag of ampicillin per ml when necessary. The tion pIA1.
S. cerevisiae strains BY4741 (MATa, ura30, leu20, Constructions C1 to C3 consisted of the insertion of the
met150, his31) and mnn9 (MATa, ura30, leu20, coding sequence of Bacillus sp. BP7 xynA gene (Gallardo
met150, his31, ypl050c::kanMX4) used in this study et al., 2004), minus the 5V region coding the leader peptide,
were obtained from the EUROSCARF collection (Heidel- in the NcoI, BglII, and SalI sites of PIR4. For this, a 569-bp
berg, Germany). Yeast strains were grown in YPD (1% fragment of xynA was amplified using the oligonucleo-
yeast extract, 2% bacto peptone, 2% glucose) or synthetic tides XNCO5-XNCO3, XBGL5-XBGL3, XSAL5-XSAL3
minimal medium SD (0.7% yeast nitrogen base without (Table I), and plasmid pXA3V1 (Gallardo et al., 2004)
amino acids, 2% glucose, and amino acids as required). as template. The oligonucleotides included the restriction

ANDRÉS ET AL.: PIR-4 BASED EXPRESSION OF A XYLANASE 691


Table I. Oligonucleotides used to amplify the coding sequence of the many). Breakage was confirmed by phase contrast micro-
xynA gene minus the region coding for the leader peptide. scopy and the walls were washed six to eight times in buffer
Oligonucleotide Sequence A. Removal of noncovalently bound proteins was achieved
by boiling the walls in buffer A containing 2% SDS (10 ml
PIR5V TGCATTCCATACGATTTCCACGGG
per gram of walls, wet weight) for 10 min, followed by six
PIR3V GTGTATATTAAAGGCTGCATGTGG
XNCO5 AATTAACCATGGGCTAACACAGACTACTGGC to eight washes in buffer A. The purified cell walls were
XNCO3 AAAAATCCATGGCCACACTGTGACGTTAGAAC finally resuspended in 10 mM ammonium acetate buffer,
XSAL5 AATTAACTCGAGGCTAACACAGACTACTGGC pH 6.3, containing 2% (v/v) h-mercaptoethanol (5 ml per
XSAL3 TATATACTCGAGCCACACTGTGACGTTAGAAC gram of walls, wet weight) and incubated for 3 h at 30jC in
XBGL5 AATTAAGGATCCTAGCTAACACAGACTACTGGC
an orbital incubator at 200 rpm. The extract was separated
XBGL3 TATATAGGATCCACACTGTGACGTTAGAAC
from the cell walls by centrifugation and concentrated by
lyophilization. Cell walls to be used in the xylanase activity
determinations were washed six to eight times in buffer A
and used directly.
sites for the enzymes NcoI, BamHI, which leaves overhangs
compatible with those left by BglII, and XhoI, which leaves
overhangs compatible with the overhangs left by SalI, and
SDS-Polyacrylamide Gels and Western Blot Analysis
had been designed so that the xynA fragment was inserted
in-frame in PIR4 in construction pIA1. The PCR fragments Proteins were separated by SDS-polyacrylamide gel elec-
amplified using Expand High Fidelity DNA polymerase trophoresis (SDS-PAGE) according to the method of
(Roche) were subcloned in the HincII site of pUC19; Laemmli (1970) in 10% polyacrylamide gels. The proteins
digested out with NcoI, BamHI, or XhoI, and inserted in separated by SDS-PAGE were transferred onto Hybond-C
pIA1 previously digested by NcoI, BglII, or SalI. The nitrocellulose membranes as described by Towbin et al.
correct orientation of the inserts was monitored by PCR (1979) and Burnette (1981). Membranes were blocked
performed directly on the colonies of transformants using overnight in Tris-buffered saline containing 0.05% Tween-
oligonucleotides PIR5V and the corresponding 3V oligonu- 20 (TBST) and 5% nonfat milk. The blocked membranes
cleotides used in the amplification of xynA (Table I). were washed three times in TBST and incubated for 1 h
Constructions C4 and C5 involved the substitution of in TBST containing an antibody that reacts with Pir cell
fragments of PIR4 by the coding sequence of xynA. In C4, wall proteins (Moukadiri et al., 1999) at a dilution of
the 567-bp fragment of xynA was amplified using 1:5,000. After three washes in TBST, the membranes were
oligonucleotides XBGL5 and XSAL3 (Table I) and incubated for 20 min in TBST containing goat antirabbit
plasmid pXA3V1 as template, subcloned in the HincII site IgG-peroxidase at a dilution of 1:12,000 and washed in
of pUC19; digested out with BamHI and XhoI and TBST. Finally, antibody binding was visualized on X-ray
subcloned in pIA1 previously digested with enzymes BglII film by using the ECL method (Amersham).
and SalI with the loss of 365 bp of the 5V region of the
PIR4 ORF. Finally, to create construction C5, the 567-bp
fragment of xynA was amplified using oligonucleotides
Determination of Xylanase Activity
XNCO5 and XSAL3 (Table I) and plasmid pXA3V1 as tem-
plate, subcloned in the HincII site of pUC19; digested out Plates for the xylanase plate assay contained 0.1% of xylan
with NcoI and XhoI and subcloned in pIA1 previously Remazol Brilliant Blue (Sigma) in SD minimal medium to
digested with enzymes NcoI and SalI with the loss of 588 bp which the required amino acids had been added. Strains
of the PIR4 ORF. Constructions C4 and C5 were moni- containing the different constructions were inoculated on
tored by PCR using oligonucleotides PIR3V and either the plates, grown for 48 h at 28jC, and the xylanase activity
XBGL5 or XNCO5 (Table I). was detected by the presence of a transparent halo around
the growth. The quantification of the xylanase activity was
done by measuring the amount of reducing sugars, xylose
equivalents, released from birch wood xylan (Sigma), by the
Isolation of Cell Wall Mannoproteins
method of Somogyi-Nelson (Spiro, 1966). Samples of
Cell walls were purified and extracted with h-mercaptoeth- growth medium or cell walls were incubated for 10 min at
anol as follows: cells in the early logarithmic phase were 50jC in 50 mM Tris-HCl buffer pH 7containing 0.5% of
harvested and washed twice in Tris-HCl 10 mM, pH 7.4, birch wood xylan. The reaction was stopped by cooling on
1 mM in PMSF (buffer A). The harvested biomass was ice for 5 min and the determination of reducing sugars was
resuspended in buffer A in a proportion of 2 ml per gram carried out by the method of Somogyi-Nelson, measuring
(wet weight), glass beads (0.45 mm in diameter) were added the resulting color at 520 nm. One unit of xylanase activity
up to 50% of the final volume, and the cells were broken by is defined as the amount of enzyme that releases 1 Amol of
shaking four times for 30 sec, with 1-min intervals, in a CO2 reducing sugar equivalent in 1 min under the assay
refrigerated MSK homogenizer (Braun Melsungen, Ger- conditions described.

692 BIOTECHNOLOGY AND BIOENGINEERING, VOL. 89, NO. 6, MARCH 20, 2005
RESULTS PIR4, with the loss of the carboxy-terminal fragment of
Subunit II of PIR4 that contains three of the four very
conserved cysteine residues that are expected to be
PIR4/xynA Gene Fusion Strategies and Expression
in S. cerevisiae responsible for cell wall retention. Finally, in C5 the xynA
coding sequence was inserted between the NcoI–SalI
A total of five different gene fusion strategies were at- restriction sites of PIR4, to give a construction consisting
tempted with the aim of testing the viability of using Pir4 in the signal peptide of PIR4 followed by the xynA coding
as a fusion partner for the targeting of xylanase A to the sequence, with the loss of almost the complete coding
cell wall, and also to determine the different regions in sequence of Subunits I and II of PIR4 (Fig. 1).
Pir4 that are important for its linkage to the cell wall The five different constructions, based in YEplac112,
structure. All four PIR-CWPs share the presence of a sig- were then transformed in the wildtype BY4741 and the
nal peptide and that of a propeptide (Subunit I) that is glycosylation-deficient strain mnn9 (Hernandez et al.,
processed at the Golgi by the Kex2p protease. The mature 1989) of S. cerevisiae and the resulting recombinant strains
protein (Subunit II) includes a 19 amino acid repetitive do- were tested for xylanase activity in plate assays using
main and a very conserved carboxy-terminus that contains Remazol Brilliant Blue xylan as substrate. The results of
four cysteine residues at fixed positions, which, considering this assay are shown in Figure 2. As can be deduced from
the extractability of some PIR-CWPs by reducing agents, the halos around the different strains, constructions C1–C4
should be responsible for cell wall retention. confer xylanase activity to the strains harboring them, in
The structure of the PIR4, as outlined above, and that of some cases (C4), as intense as that of the positive control,
the xynA genes is shown in Figure 1, together with a consisting of a recombinant E. coli strain harboring pXA3V1
schematic representation of the five different fusion (Gallardo et al., 2004).
strategies used. The first three (C1–C3) consisted of
inserting all the coding sequence of the xynA gene, minus
the 5V fragment coding the leader peptide, in different Study of the Localization of the Recombinant
naturally occurring restriction sites of the coding sequence Pir4-XynA Fusion Proteins by Western Immunoblot
of PIR4. For this, the xynA sequence was amplified using To find out if the Pir4-XynA fusion proteins were being
plasmid pXA3V1 (Gallardo et al., 2004) as template and correctly targeted to the cell wall, and if, as is the case with
oligonucleotides which included in their 5V ends restriction Pir4, they could be extracted by reducing agents, h-
sites compatible with the NcoI, BglII, or SalI sites in PIR4, mercaptoethanol extracts from purified cell walls of the
and which had been designed to fit in-frame in the different strains and concentrated samples of growth me-
corresponding sites in the ORF of PIR4. dium were probed by Western immunoblot using an anti-
Constructions C4 and C5 (Fig. 1) involved the substi- body that reacts with Pir-CWPs of S. cerevisiae (Moukadiri
tution of fragments of PIR4 by the coding sequence of the et al., 1999). The results (Fig. 3A) show that, at least in
xynA gene. In the case of the C4 construction, the xynA the h-mercaptoethanol extracts from purified cell walls of
coding sequence was subcloned in the BglII–SalI sites of the strains transformed with constructions C2 and C3, it
was possible to detect specific bands reactive with the anti-
body and with sizes compatible with those of the ex-
pected fusion proteins. In the case of the wildtype BY4741
strain harboring the C3 construction, the size of the spe-
cific reactive polypeptide is of 58 kDa, which matches the
expected size of 36 kDa for Pir4 plus f20 kDa of the
xylanase portion. In the same strain transformed with C2,
two main polypeptides of 52 and f100 kDa could be de-
tected. A possible interpretation of this 100 kDa polypep-
tide would be that it corresponds to a dimer of the 52 kDa
one, still attached through disulfide bridges despite the
SDS-PAGE procedure. No specific polypeptides could
be detected in the extracts of strains transformed with C1,
C4, and C5. In C1 and C5 this could be explained by the fact
that the resulting fusions may not be recognized by the
antibody, C5 because there is almost nothing of Pir4 itself
left, and C1 because it involves subunit I, which is not rec-
ognized by the antibody. Moreover, in C4 and C5 the four
cysteine region of Pir4, probably responsible for cell wall
Figure 1. Schematic representation of the xynA and PIR4 genes together
retention, is not present and, accordingly, the fusions
with the different PIR4-xynA gene fusions. SP, signal peptide; SI, subunit I; resulting from these constructions were not expected to be
PM, Pir motive; SII, subunit II; LP, leader peptide. targeted to the cell wall.

ANDRÉS ET AL.: PIR-4 BASED EXPRESSION OF A XYLANASE 693


Figure 2. Xylanase plate assay of the different strains harboring constructions C1–C5; halos around the streaks represent degradation of the substrate
(Remazol Brilliant Blue Xylan). Strains based on BY4741 (A), and mnn9 (B). Numbers 1–5 represent the strains harboring constructions C1–C5. Number 6
corresponds to a positive control consisting in an E. coli strain harboring plasmid pXA3V1. Number 7 corresponds to the parental strains BY4741 (A) or
mnn9 (B).

To complete the above results, the presence of Pir4- antibody is not included in the resulting fusion protein;
XynA fusions was also probed in the growth medium of the however, it is also important to note that the strain
strains harboring the different constructions. Only in the harboring C5 was the only one that did not exhibit
case of the strain transformed with C4 was it possible to xylanase activity in the plate assay.
detect the presence of a series of polypeptides that were The results obtained with the mnn9-based strains
specific to this strain using the Pir antibody. A total of three (Fig. 4A,B) were basically similar to those of the
bands were detected, of 50, 45, and 40 kDa, the 50 kDa one BY4741-based strains. Specific Pir4-xynA bands of the
probably representing the full size fusion protein, and the expected size were detected in the h-mercaptoethanol
other two, partial degradation products (Fig. 3B). As extracts of the mnn9 strains transformed with constructions
mentioned before, the presence of the fusion protein C2 and C3 (Fig. 4A). Two Pir4-XynA bands were detected
derived from C4 in the growth medium correlates with in each of these strains, probably corresponding to the
the absence from the resulting fusion protein of the region Kex2-processed and unprocessed forms of the fusion
of Pir4 that is responsible for cell wall retention. Finally, protein, as is the case with the native Pir4 in the mnn9
no trace of the fusion protein derived from C5 could be strain (Moukadiri et al., 1999). Finally, the results obtained
detected. This could be explained by the fact that, as is with the growth medium showed the presence of specific
the case in C1, the region of Pir4 that is recognized by the Pir4-XynA bands in the mnn9 strain transformed with

Figure 3. Immunoblot localization of the different recombinant fusion-proteins derived from constructions C1–C5 (lanes 2–6) in the wildtype strain
BY4741 of S. cerevisiae using an antibody that reacts with the Pir4 protein. A: h-Mercaptoethanol extracts from purified cell walls. B: Growth medium.
Lane 1 corresponds to the untransformed BY4741 strain of S. cerevisiae.

694 BIOTECHNOLOGY AND BIOENGINEERING, VOL. 89, NO. 6, MARCH 20, 2005
Figure 4. Immunoblot localization of the different recombinant fusion-proteins derived from constructions C1–C5 (lanes 2–6) in the mnn9 glycosylation-
deficient strain of S. cerevisiae using an antibody that reacts with the Pir4 protein. A: h-Mercaptoethanol extracts from purified cell walls. B: Growth
medium. Lane 1 corresponds to the untransformed mnn9 strain of S. cerevisiae.

construction C4 only (Fig. 4B), with sizes very similar to wall-associated xylanase activity was lower than in the
those found in the wildtype BY4741 strain transformed strains harboring constructions C2 and C3, and most of the
with the same construction. total xylanase activity was detected in the growth medium
(88% of the culture’s total), while no xylanase activity
could be detected in the growth medium of strain BY4741
Detection of Xylanase Activity Associated With Cell transformed with either construction C2 or C3. The results
Wall or Secreted to the Growth Medium
for the transformed strains based on mnn9 confirm that
To confirm the above results and, at the same time, to test most of the activity expressed by the strain harboring
and quantify functionality of the fusion proteins expressed construction C4 is secreted to the growth medium;
in the strains transformed with constructions C2, C3, and however, unlike the strains based on BY4741, the mnn9
C4, xylanase activity was determined in purified cell walls strains harboring constructions C2 and C3 leak xylanase
and cell-free spent culture medium of 24-h cultures of these activity to the growth medium (Table II). This could be
strains. The results are shown in Table II. Xylanase activity accounted for by the fact that Pir4 is partly secreted to the
associated with the cell walls was detected for both the growth medium in the mnn9 strain (Moukadiri and Zueco,
wildtype BY4741 and mnn9 strains transformed with 2001), a fate that could presumably be followed by the
constructions C2, C3, and C4, but not in the cell walls of Pir4-xylanase fusion proteins derived from constructions
the untransformed strains. The detection of xylanase C2 and C4. As a whole, the distribution of the enzymatic
activity associated with the cell walls in the strains activities matches that of the fusion proteins as determined
transformed with construction C4 shows that some fusion by Western blot and specific antibody detection; however,
protein was retained at the cell wall, although it could not in some cases no fusion protein could be detected in
be detected by Western blot. However, the level of cell samples containing detectable enzymatic activity levels.

Table II. Xylanase activity as determined in cell walls and growth medium of strains BY4741 and
mnn9 of S. cerevisiae, untransformed or harboring constructions C2, C3, or C4.

Cell wall associated activity Activity in growth medium

(Units/l % of culture (Units/l % of culture


(Units/g of culture activity of culture in acitivity in growth
Strain cell walls) in cell walls) in cell walls growth medium) medium

BY4741 0 0 0 0 0
C2-BY4741 1.8 5.76 100 0 0
C3-BY4741 1.5 4.8 100 0 0
C4-BY4741 0.45 1.1 12 8 88
mnn9 0 0 0 0 0
C2-mnn9 0.93 5.95 75 2 25
C3-mnn9 1.17 7.5 45 10 55
C4-mnn9 0.35 2.2 14 14 86

The mean of three experiments is presented.

ANDRÉS ET AL.: PIR-4 BASED EXPRESSION OF A XYLANASE 695


DISCUSSION cell wall. Also, the fact that the fusion protein is secreted
would explain the larger halo around the strains harboring
In a previous report (Moukadiri et al., 1999), we have construction C4 in the xylanase activity plate assay. Two
shown the use of Pir4, a disulphide bound cell wall protein conclusions can be drawn from this result: first, that Pir4
of S. cerevisiae, for the targeting of the IgG binding domain can be used as a carrier for the secretion of heterologous
of staphylococcal protein A to the cell wall. Our aim in the proteins, in a similar fashion to the a-factor leader
present work was to explore the viability of using Pir4 as a (Romanos et al., 1992) or to Pir2/Hsp150 (Simonen et al.,
partner for the targeting of functional enzymes to the yeast 1994; Simonen et al., 1996), just by removing the cell wall
cell wall. For this, xylanase A of Bacillus sp. BP-7 was retention domain; and second, that the very conserved
used (Gallardo et al., 2004). Of the five different PIR4/ carboxy-terminal domain in Pir4, including four cysteine
xynA gene fusion constructions tested (C1–C5), four residues, is indeed responsible for the disulphide cell wall
exhibited xylanase activity in plate assays, and in three of attachment of Pir4, notwithstanding the fact that Pir4 may
these the fusion protein could be detected using an antibody also, to some extent, be linked to the h-1,3-glucan of the
that recognizes the Pir4 moiety. C2 involves the insertion cell wall through an alkali-sensitive linkage that involves
of the xynA fragment in the region of PIR4 that codes the Pir repetitive domain. Furthermore, Simonen et al.
subunit II, between the 19 amino acids repetitive domain (1996) suggested that the repetitive domain in Pir2/Hsp150
and the carboxy-terminal region that contains the four may allow productive folding of the heterologous protein
conserved cysteine residues, while in C3, the insertion of fused after it. Since this 19 amino acids domain is present
xynA is made just two amino acids before the carboxy- 11 times in Pir2/Hsp150, and only once in Pir4, we can
terminal end of Pir4. In both cases the resulting fusion conclude that the single copy of this domain is enough to
proteins are correctly targeted to the cell wall, from where perform this role, at least for the case studied.
they can be extracted by reducing agents, and confer The results from the quantification of the xylanase
xylanase activity to the cells. However, the sizes of the activity associated with cell walls or secreted to the growth
respective fusion proteins, as detected by immunoblot medium shows that activity is mainly associated with the
analysis, are slightly different. In the case of C3, the band cell walls in the strains harboring constructions C2 and C3,
detected is relatively well defined and has a size close to and that xylanase activity of BY4741-based strains is
the expected, while in C2, two bands are detected, not very higher than that of those based in the mnn9 strain, probably
well defined, and with average sizes of 50 and 100 kDa. A because, in this strain, part of Pir4 is released to the growth
possible interpretation for this difference could be that in medium (Moukadiri and Zueco, 2001). This is confirmed
C3 the insertion would not affect the disulphide formation by the presence of xylanase activity in the growth medium
in the folding of Pir4, while in C2, because of the insertion of the mnn9 strain harboring constructions C2 and C3.
being in the central part of Pir4, it would affect it and even Finally, no fusion protein derived from C5 could be
induce stronger dimer formation, the 100 kDa form being detected. This could be easily explained by the fact that the
representative of this. Accordingly, insertions in the SalI fusion protein does not include subunit II of Pir4, and it is
restriction site of PIR4 (C3), which are equivalent to a not recognized by the antibody used, as is the case with the
carboxy-terminal fusion, are most likely to be correctly fusion protein derived from C1. However, contrary to the
folded and to retain activity, besides being correctly case of C1, no xylanase activity was detected in the plate
targeted to the cell wall. assay of the strain harboring C5. This result matches that of
In the case of the mnn9 strain transformed with Simonen et al. (1994) in Pir2/Hsp150, which found that a
construction C2, no dimer form was detected; however, Pir2/h-lactamase fusion protein was retained at the
both in C2 and C3 a double band of the approximate endoplasmic reticulum and lacked activity when Subunit
expected size was detected. Since Pir4 also appears as a II of Pir2/Hsp150 was not part of the fusion.
double band in the mnn9 strain, corresponding to the In summary, we have developed a Pir4-based system that
unprocessed and Kex2-processed forms (Moukadiri et al., allows selective targeting of heterologous proteins to the
1999), it is reasonable to assume that the double bands cell wall or the growth medium. This system may be of
derived from the C2 and C3 constructions in this strain general application and, at least in the example studied,
correspond also to the unprocessed and Kex2-processed leads to cell wall immobilization or to secretion to the
forms of the fusion proteins. growth medium of an active enzyme.
Different from C2 and C3, the fusion protein derived
from C4 could only be detected in the growth medium, both
in the BY4741 and mnn9 strains, in the form of three References
polypeptides of 50, 45, and 40 kDa, probably correspond-
ing to the full-size fusion protein and partial degradation Abe H, Shimma Y, Jigami Y. 2003. In vitro oligosaccharide synthesis
products. In this case, the construction involved the using intact cells that display glycosyltransferases at the cell surface
through cell wall anchored protein Pir. Gycobiology 13:87–95.
substitution of the region containing three of the four Abe H, Ohba M, Shimma Y, Jigami Y. 2004. Yeast cells harboring human
conserved cysteine residues of Pir4 by XynA and, as could alpha-1,3-fucosyltransferase at cell surface engineered using Pir, a cell
be expected, the fusion protein is no longer retained in the wall anchored protein. FEMS Yeast Res 4:417–425.

696 BIOTECHNOLOGY AND BIOENGINEERING, VOL. 89, NO. 6, MARCH 20, 2005
Andrés I, Zueco J, Parascandola P. 2003. Immobilization of Saccha- Mrsa V, Seidl T, Gentzsch M, Tanner W. 1997. Specific labelling of cell
romyces cerevisiae cells to protein G-Sepharose by cell wall wall proteins by biotinylation. Identification of four covalently linked
engineering. J Mol Microbiol Biotechnol 5:161–166. O-mannosylated proteins of Saccharomyces cerevisiae. YEAST 13:
Beauchemin KA, Rode LM, Sewalt VJH. 1995. Fibrolytic enzymes 1145–1154.
increase fiber digestibility and growth rate of steers fed dry forages. Murai T, Ueda M, Yamamura M, Atomi H, Shibasaki Y, Kamasawa N,
Can J Anim Sci 75:641–644. Osumi M, Amachi T, Tanaka A. 1997a. Construction of a starch-
Boder ET, Wittrup KD. 1997. Yeast surface display for screening utilizing yeast by cell surface engineering. Appl Environ Microbiol
combinatorial polypeptide libraries. Nat Biotechnol 15:553–557. 63:1362–1366.
Burnette WN. 1981. Western blotting: electrophoretic transfer of proteins Murai T, Ueda M, Atomi H, Shibasaki Y, Kamasawa N, Osumi M,
from sodium dodecyl-sulfate-polyacrylamide gels to unmodified Kawaguchi T, Arai M, Tanaka A. 1997b. Genetic immobilization of
nitrocellulose and radiographic detection with antibody and radio- cellulase on the cell surface of Saccharomyces cerevisiae. Appl
iodinated protein A. Anal Biochem 112:195–203. Microbiol Biotechnol 48:499–503.
Gallardo O, Diaz P, Pastor FIJ. 2004. Cloning and characterization of Murai T, Ueda M, Kawaguchi T, Arai M, Tanaka A. 1998. Assimilation of
Xylanase A from the strain Bacillus sp. BP-7. Comparison to alka- cellooligosaccharides by a cell surface-engineered yeast expressing h-
line pI-low molecular weight xylanases of family 11. Curr Microbiol glucosidase and carboxymethylcellulase from Aspergillus aculeatus.
48:276–279. Appl Microbiol Biotechnol 64:4857–4861.
Ganga MA, Piñaga F, Vallés S, Ramón D, Querol A. 1999. Aroma im- Murai T, Ueda M, Shibasaki Y, Kamasawa N, Osumi M, Imanaka T,
proving in microvinification processes by the use of a recombinant Tanaka A. 1999. Development of an arming yeast strain for efficient
wine yeast strain expressing the Aspergillus nidulans xlnA gene. Int utilization of starch by co-display of sequential amylolytic enzymes on
J Food Microbiol 47:171–178. the cell surface. Appl Microbiol Biotechnol 51:65–70.
Gietz RD, Sugino A. 1988. New yeast-Escherichia coli shuttle vector Pérez-Gonzaléz JA, De Graaf LH, Visser J, Ramón D. 1996. Molecular
constructed with in vitro mutagenized yeast genes lacking six-base cloning and expression in Saccharomyces cerevisiae of two
pair restriction sites. Gene 74:527–534. Aspergillus nidulans Xylanase genes. Appl Environ Microbiol 62:
Hernandez LM, Ballou L, Alvarado E, Gillece-Castro BL, Burlingame AL, 2179–2182.
Ballou CE. 1989. A new Saccharomyces cerevisiae mnn mutant N- Romanos MA, Scorer CA, Clare JJ. 1992. Foreign gene expression in
linked oligosaccharide structure. J Biol Chem 246:11846–11856. yeast: a review. YEAST 8:423–488.
Ito H, Fukuda Y, Murata K, Kimura A. 1983. Transformation of intact Russo P, Kalkkinen N, Sareneva H, Paakkola J, Makarow M. 1992. A heat
yeast cells treated with alkali cations. J Bacteriol 153:163–168. shock gene from Saccharomyces cerevisiae encoding a secretory
Jeffries TW. 1983. Utilization of xylose by bacteria, yeast and fungi. Adv glycoprotein. Proc Natl Acad Sci U S A 89:3671–3675.
Biochem Eng 27:1–32. Sambrook J, Fritsch EF, Maniatis T. 1989. Molecular cloning: a laboratory
Kieke MC, Cho BK, Boder ET, Kranz DM, Wittrup KD. 1997. Isolation of manual, 2nd ed. Cold Spring Harbor NY: Cold Spring Harbor
anti-T cell receptor scFv mutants by yeast surface display. Prot Eng Laboratory Press.
10:1303–1310. Sato N, Matsumoto T, Ueda M, Tanaka A, Fukuda H, Kondo A. 2002.
Klis FM. 1994. Review: cell wall assembly in yeast. YEAST 10:851–869. Long anchor using Flo1 protein enhances reactivity of cell surface-
Klis FM, Mol P, Hellingwerf K, Brul S. 2002. Dynamics of cell wall displayed glucoamylase to polymer substrates. Appl Microbiol
structure in Saccharomyces cerevisiae. FEMS Micobiol Rev 738: Biotechnol 60:469–474.
1–18. Schreuder MP, Brekelmans S, Van den Ende H, Klis FM. 1993. Targeting
La Grange DC, Pretorius IS, Claeyssens M, Van Zyl WH. 2001. Degradation of a heterologous protein to the cell wall of Saccharomyces cerevisiae.
of xylan to d-xylose by recombinant Saccharomyces cerevisiae YEAST 9:399–409.
coexpressing the Aspergillus niger h-xylosidase (xlnD) and the Schreuder MP, Mooren ATA, Toschka HY, Verrips CT, Klis FM. 1996.
Trichoderma reesei xylanase II (xyn2) genes. Appl Environ Microbiol Immobilizing enzymes on the surface of yeast cells. Trends Bio-
67:5512–5519. technol 14:115–120.
Laemmli UK. 1970. Cleavage of structural proteins during the head Simonen M, Jämsä E, Makarow M. 1994. The role of the carrier protein
assembly of bacteriophage T4. Nature 227:680–685. and disulfide formation in the folding of h-lactamase fusion
Li XL, Ljungdahl LG. 1996. Expression of Aureobasidium pullulans xynA proteins in the endoplasmic reticulum of yeast. J Biol Chem 269:
in, and secretion of the xylanase from, Saccharomyces cerevisiae. 13887–13892.
Appl Environ Microbiol 62:209–213. Simonen M, Vihinen H, Jämsä E, Arumäe U, Kalkkinen N, Makarow M.
Luonteri E, Tenkanen M, Siika-Aho M, Buchert J, Viikari L. 1996. a- 1996. The hsp150-carrier confers secretion competence to the rat
Arabinosidases of Aspergillus terreus and their potentials in pulp and nerve growth factor receptor ectodomain in Saccharomyces cerevi-
paper application. In: Srebotnik E, Messner K, editors. Biotechnology siae. YEAST 12:457–466.
in the pulp and paper industry. Vienna: Facultas-Universitätsverlag. Spiro RG. 1966. The Nelson-Somogyi copper reduction method. Analysis
p 119–122. of sugars found in glycoprotein. Methods Enzymol 8:3–26.
Maat J, Roza M, Verbakel J, Stam H, Santos da Silva MJ, Bosse M, Toh-e A, Yasunaga S, Nisogi H, Tanaka K, Oguchi T, Matsui Y. 1993.
Egmond MR, Hagemans MLD, Gorcom RFMV, Hessing JGM, Van Three yeast genes, PIR1, PIR2 and PIR3, containing internal tandem
der Hondel CAMJJ, Rotterdam CV. 1992. Xylanases and their appli- repeats are related to each other, and PIR1 and PIR2 are required for
cation in bakery. In: Visser J, Beldman G, Kusters-Van Someren MA, tolerance to heat shock. YEAST 9:481–494.
Voragen AGJ, editors. Xylan and xylanases. Amsterdam: Elsevier Towbin H, Staehelin T, Gordon J. 1979. Electrophoretic transfer of
Science. p 349–360. proteins from polyacrylamide gels to nitrocellulose sheets: procedure
Matsumoto T, Fukuda H, Ueda M, Tanaka A, Kondo A. 2002. Con- and some applications. Proc Natl Acad Sci U S A 76:4350–4354.
struction of yeast strains with high cell surface lipase activity by using Van der Vaart JM, te Biesebeke R, Chapman JW, Toschka HY, Klis FM,
novel display system based on the Flo1p flocculation functional Verrips T. 1997. Comparison of cell wall proteins of Saccharomyces
domain. Appl Environ Microbiol 68:4517–4522. cerevisiae as anchors for cell surface expression of heterologous
Moukadiri I, Zueco J. 2001. Evidence for the attachment of Hsp150/Pir2 to proteins. Appl Environ Microbiol 63:615–620.
the cell wall of Saccharomyces cerevisiae through disulfide bridges. Washida M, Takahashi S, Ueda M, Tanaka A. 2001. Spacer-mediated
FEMS Yeast Res 1:241–245. display of active lipase on the yeast cell surface. Appl Microbiol
Moukadiri I, Jaafar L, Zueco J. 1999. Identification of two mannoproteins Biotechnol 56:681–686.
released from cell walls of a Saccharomyces cerevisiae mnn1 mnn9 Wittrup KD. 2001. Protein engineering by cell-surface display. Curr Opin
double mutant by reducing agents. J Bacteriol 181:4741–4745. Biotechnol 12:395–399.

ANDRÉS ET AL.: PIR-4 BASED EXPRESSION OF A XYLANASE 697


Biocatalysis and Biotransformation, March August 2007; 25(2 4): 157 162
Downloaded By: [Uab-02/Science Lib] At: 13:35 16 October 2007

ORIGINAL ARTICLE

Cloning and production of Xylanase B from Paenibacillus


barcinonensis in Bacillus subtilis hosts

OSCAR GALLARDO, PILAR DIAZ, & F. I. JAVIER PASTOR

Department of Microbiology, Faculty of Biology, University of Barcelona, Spain

Abstract
Xylanase B from Paenibacillus barcinonensis was cloned in shuttle vectors for Escherichia coli and Bacillus subtilis ,
and expressed in Bacillus hosts. Several recombinant strains were constructed, among which B. subtilis MW15/pRBSPOX20
showed the highest production. This recombinant strain consists of a protease double mutant host containing
P. barcinonensis xynB gene under the control of a phage SPO2 strong promoter. Maximum production was found
when the strain was cultured in nutrient broth supplemented with xylans. Analysis of xylanase B location in B. subtilis
MW15/pRBSPOX20 showed that the enzyme remained cell-associated in young cultures, consistent with its intracellular
location in its original host, P. barcinonensis, and the lack of a signal peptide. However, when cultures reached the stationary
phase, xylanase B was released to the external medium as a result of cell lysis. The amount of enzyme located in the
supernatants of old cultures could account for 50% of total xylanase activity. Analysis by SDS PAGE showed that xylanase
B is an abundant protein found in the culture medium in late stationary phase cultures.

Keywords: Xylanase, production, expression, Bacillus

Introduction feed industries (Bedford & Classen 1992; Monfort


et al. 1996). The synthesis of new xylosides is a
Xylan is a major structural component of plant cell
promising application, where xylanases with trans-
walls and, after cellulose, is the second most abun-
glycosidase activity can be of special interest (Jiang
dant renewable polysaccharide in nature (Collins
et al. 2004).
et al. 2005). Biodegradation of xylan is a complex
Paenibacillus barcinonensis is a recently identified
process that requires the co-ordinate action of several new species that produces a complex set of enzymes
enzymes, among which xylanases (1,4-b-D-xylan for xylan degradation (Blanco et al. 1995, 1999;
xylanohydrolase; EC 3.2.1.8), cleaving internal lin- Sánchez et al. 2005). One of these enzymes, xylanase
kages on the b-1,4-xylose backbone, play a key role B, has previously been cloned and characterized
(Gilkes et al. 1991; Henrissat & Bairoch 1996). The (Blanco et al. 1996). In contrast with known
complex chemical nature and heterogeneity of xylan xylanases, which are secreted to the extracellular
can account for the multiplicity of xylanases pro- medium to allow contact and cleavage of highly
duced by micro-organisms (Kulkarni et al. 1999). polymerized xylans, xylanase B is a cytoplasmic
Xylanases have important applications in industry enzyme that may represent a new type of enzyme
due to their enormous potential to modify and involved in xylan degradation (Gallardo et al. 2003).
transform plant-derived biomass, which is used in Xylanase B shows transglycosidase activity on oligo-
a wide variety of industrial processes. One of the saccharides, suggesting that it has a potential for the
most successful biotechnological applications of synthesis of new compounds (Blanco et al. 1996). In
these enzymes is in pulp bleaching, where xylanase this article, we describe the expression of xylanase B
pretreatment results in important economic and in different microbial hosts as a first step in
environmental advantages over the non-enzymatic constructing recombinant strains able to produce
process (Viikari et al. 1994; Bajpai 2004). Xylanases high amounts of enzyme to be evaluated in biotech-
have also important applications in food and animal nological applications.

Correspondence: F. I. J. Pastor, Department de Microbiologia, Facultat de Biologia, Universitat de Barcelona, Avinguda Diagonal 645,
08028 Barcelona, Spain. Tel: 34 93 4034626. Fax: 34 93 4034629. E-mail: fpastor@ub.edu
158 O. Gallardo et al.

Materials and methods evaluated. Xylanase activity was assayed by measur-


ing the amount of reducing sugars released from
Downloaded By: [Uab-02/Science Lib] At: 13:35 16 October 2007

Bacterial strains and plasmids


birchwood xylan using the method of Nelson and
Escherichia coli /pX60 is a recombinant strain con- Somogyi (Spiro 1966). The assay mixture contained
taining xynB described previously (Blanco et al. 0.5% xylan in a final volume of 0.1 mL of 50 mM
1996). Bacillus subtilis MB216 (trpC2 thr-5) and acetate buffer pH 5.5. After 15 min incubation at
B. subtilis MW15 (his nprR2 nprE18 DaprA3 408C, color development was measured at 520 nm.
DeglS102 DbglT bglSRV DxynA CmR) have been One unit of enzymatic activity was defined as the
described elsewhere (Lampen et al. 1986; Wolf et al. amount of enzyme that released 1 mmol of reducing
1995). Plasmid pN5 is a shuttle vector for E. coli and sugar equivalent per minute under the assay condi-
B. subtilis that was constructed in this work by tions described. Xylanase activity in supernatants
ligation of partially Sau 3A-digested pUC19 and from cultures containing glucose or other substances
pC194 plasmids (Horinouchi & Weisblum 1982). that could interfere in the determination of reducing
A 1.3 Kb DNA segment of P. barcinonensis, contain- sugars was determined by evaluating the release of
ing xynB preceded by a region with partial homology soluble color from Remazol Brilliant Blue xylan
to Bacillus spp promoters, was amplified by PCR (Sigma Chemical Co.). The assay mixture contained
from pX60 and inserted at the Sma I site of pN5. 6 mg mL1 of Remazol Brilliant Blue xylan in a final
The resulting plasmid was named pN5X20. Plasmid volume of 0.5 mL of 50 mM acetate buffer pH 5.5.
pRBSPOX20 contains the xynB structural gene The mixture was incubated at 408C for 15 min and 1
cloned downstream of the SPO2 promoter of vector mL of absolute ethanol was added. After further
pRBSPO (Gallardo et al. 2003). Strains were incubation for 30 min at room temperature, samples
cultured at 308C in nutrient broth, BREC1 (Over- were centrifuged at 2 000 g for 3 min and the color
beeke et al. 1990), MG and MG2 (Hoch 1991). released to the supernatant measured at 595 nm. To
When necessary, media were supplemented with 1% quantify the activity assayed by the Remazol Brilliant
oat spelt xylan (Sigma Chemical Co.), 0.2% birch- Blue xylan system, xylanase activity of control
wood xylan (Sigma Chemical Co.), or 1% rice straw. samples was determined by the two assay methods
described and a standard plot was obtained.
Nucleic acid manipulations
Gel electrophoresis
Plasmid DNA was purified by the alkaline lysis
procedure (Sambrook et al. 1989) or through chro- Sodium dodecyl sulphate polyacrylamide gel elec-
matography (QIAGen-tip 100 MidiPrep, QIAGen). trophoresis (SDS PAGE) was performed in 12%
PCR amplification was performed using Pfu DNA gels essentially as described by Laemmli (1970).
Polymerase (Stratagene). Restriction nucleases and
ligase were purchased from Boehringer Mannheim Results
and used according to the manufacturer’s instruc-
tions. E. coli was transformed as described (Sam- Cloning of xylanase B in selected strains of Bacillus
brook et al. 1989). Protoplasts from B. subtilis were subtilis
obtained by lysozyme treatment of cells from mid-log Xylanase B from P. barcinonensis was previously
phase cultures and transformed as described (Chang identified and characterized from E. coli /pX60, a
& Cohen 1979). The sequence of both strands of recombinant clone containing xynB (Blanco et al.
xynB was determined by automated fluorescence 1996). The enzyme shows high specific activity on
TM
sequencing with an ABI PRISM dye terminator aryl-xylosides, probably as a result of transglycosi-
cycle sequencing ready reaction mix (Perkin-Elmer) dase activity, as revealed from the study of its mode
in a 377 Perkin-Elmer DNA sequencer. of action on xylooligosaccharides (Blanco et al.
1996). This makes the enzyme a good candidate
for biotechnological applications.
Enzyme assays
The choice of an appropriate host is usually an
Cultures from B. subtilis MB216/pN5X20, B. subtilis important factor in obtaining high levels of expres-
MW15/pN5X20, B. subtilis MB216/pRBSPOX20 sion and production of recombinant enzymes.
and B. subtilis MW15/pRBSPOX20 were centri- B. subtilis can be successfully used for the production
fuged and supernatants and pellets separated. To of heterologous proteins of other endosporulating
obtain cell extracts, pelleted cells were washed in Gram-positive bacteria. To obtain a high level of
water, resuspended in 100 mM Tris/HCl and dis- production of xylanase B, we cloned xynB in shuttle
rupted by sonication (four pulses of 2 min). Enz- vectors for E. coli and B. subtilis. The two shuttle
yme activity of cell extracts and supernatants was vectors used, pN5 and pRBSPO, were derived from
Cloning and production of Xylanase B 159

E. coli plasmids pUC19 or pBR322, respectively, and activity after 3 to 8 days of incubation, and in all
from plasmids pC194 or pUB110, respectively, for cases xylanase production was increased in media
Downloaded By: [Uab-02/Science Lib] At: 13:35 16 October 2007

cloning in B. subtilis (see Materials and methods). In with xylans or rice straw (Table I). Cultures supple-
the case of pN5, xynB was placed under the control mented with these substrates showed a notable
of its own putative promoter, while in the case of increase in xylanase production when compared to
pRBSPO, the xynB structural gene was cloned the non-supplemented cultures, which in some cases
downstream of the SPO2 phage promoter contained (MG2 and BREC) did not show detectable xylanase
in this vector. activity. In most cultures, birchwood xylan and rice
The plasmids constructed, pN5X20 and straw showed a similar stimulating effect in the
pRBSPOX20, were selected from E. coli transfor- production of xylanase, while cultures supplemented
mants that showed xylanase activity on plate assays. with oat spelt usually displayed lower xylanase
These plasmids were subsequently isolated and activity. Maximum xylanase production was ob-
introduced in B. subtilis by protoplast transforma- tained when strain B. subtilis MW15/pRBSPOX20
tion. Two different strains were used as recipient was grown on birchwood xylan supplemented nu-
host: B. subtilis MB216 (with background xylanase trient broth. In this medium, 0.23 xylanase activity
activity) and B. subtilis MW15 (devoid of xylanase units mL1 were detected in supernatants of 3-day-
activity). The recombinant strains obtained were old cultures.
grown in nutrient broth supplemented with the
corresponding antibiotics and xylanase activity in Cellular location of xylanase B in Bacillus subtilis
the culture supernatants was determined (Figure 1).
Recombinant strains containing plasmid pN5X20 Previous analysis of xylanase B showed that it does
did not show a significant increase of xylanase not have a signal peptide for secretion outside the
activity over the non-recombinant parental strains. cells, and, accordingly, it is a cytoplasmic enzyme in
However, recombinant strains carrying plasmid its original host, P. barcinonensis (Gallardo et al.
pRBSPOX20 showed notable xylanase activity. 2003). The physiological role of intracellular xylanase
Maximum production was obtained with B. subtilis B in xylan degradation is unclear, but it is probably in
MW15/pRBSPOX20, which was selected for further the hydrolysis of the oligosaccharides resulting
studies. from xylan degradation by extracellular xylanases,
once they have been transported inside the cells.
In the results shown up to this point, xylanase
Influence of culture media on xylanase production activity determinations were performed in culture
supernatants of the recombinant strains constructed.
B. subtilis MW15/pRBSPOX20 was grown in differ-
Detection of activity in these samples indicated that at
ent culture media that were supplemented with
least a percentage of the xylanase produced by the
birchwood xylan, oat spelt xylan or rice straw.
recombinant strains was released to the extracellular
Samples were taken at different intervals and xyla-
nase activity in culture supernatants was deter- Table I. Production of xylanase by Bacillus subtilis MW15/
mined. All cultures showed maximum xylanase pRBSPOX20 cultured in media supplemented with different
polysaccharides.
0.06
Polysaccharide Days of Activity
Culture media added culture (U mL 1)
Xylanase activity (U/ml)

0.05

0.04 Nutrient brotha  4 0.06


Oat spelt xylan 3 0.09
0.03 Rice straw 4 0.20
Birchwood xylan 3 0.23
0.02 MGb  8 0.02
Oat spelt xylan 8 0.16
0.01 Rice straw 8 0.16
MG2b  0.00
0.00 Oat spelt xylan 3 0.09
0 1 2 3 4 5 6 7 8 Rice straw 8 0.13
Days BREC1b  0.00
Oat spelt xylan 8 0.15
Figure 1. Production of xylanase activity by recombinant strains Rice straw 4 0.07
of Bacillus subtilis carrying xynB . B. subtilis MB216 ('), B. subtilis
a
MW15 (^), B. subtilis MB216/pRBSPOX20 (m), and B. subtilis Xylanase activity was determined by the method of Nelson and
MW15/pRBSPOX20 (k) were grown at 308C in nutrient broth. Somogyi.
b
Samples were collected at different intervals and xylanase activity Activity was determined by the Remazol Brilliant Blue Xylan
in supernatants of cultures was determined. assay.
160 O. Gallardo et al.

medium. To analyze the location of xylanase B in kDa


B. subtilis MW15/pRBSPOX20, the strain was cul-
Downloaded By: [Uab-02/Science Lib] At: 13:35 16 October 2007

tured in nutrient broth supplemented with birchwood


xylan, samples were taken at different intervals, and
xylanase activity determined in both cell extracts and
culture supernatants (Figure 2). Xylanase activity
116 -
remained cell associated in young cultures, through 97 -
the exponential phase of growth. However, when
cultures reached the stationary phase, a significant
amount of xylanase activity was released to the 66 -
external medium, and in 3-day-old cultures around
50% of total activity was found in the supernatants.
The cellular location of xylanase B in B. subtilis
MW15/pRBSPOX20 was also examined by SDS- 45 -
PAGE. Supernatants from 3-day cultures showed a
prominent 40 kDa protein band, corresponding to
31 -
xylanase B, not found in supernatants from control
B. subtilis cultures (Figure 3). Cell extracts from
B. subtilis MW15/pRBSPOX20 also showed a pro- 21 -
minent band (not shown) with identical mobility to
that found in the supernatants of old cultures,
suggesting the lack of processing of the enzyme found
extracellularly, which was probably released as a
result of cell lysis. 1 2
Figure 3. SDS PAGE analysis of extracellular fractions from
Discussion Bacillus subtilis MW15/pRBSPOX20. B. subtilis MW15/
pRBSPOX20 and control B. subtilis MW15/pRBSPO were
Xylanase B from P. barcinonensis has several proper- cultured at 308C. Samples were taken after 3 days of incubation,
ties that make it an unusual enzyme among xylanases centrifuged and supernatants were analyzed by SDS PAGE.
(Blanco et al. 1996; Gallardo et al. 2003). One of the Lane 1, concentrated supernatants from B. subtilis MW15/
properties is transglycosidase activity, which makes pRBSPOX20. Lane 2, concentrated supernatants from B. subtilis
MW15/pRBSPO. The positions of molecular weight markers are
the enzyme a good candidate for biotechnological indicated.
application in the synthesis of new xylosides
with potential use in food, pharmaceutical and xylanase B, we constructed several recombinant
detergency industries (Jiang et al. 2004). Biotechno- strains in which xynB was cloned in different
logical evaluation of enzymes usually requires the
plasmid vectors and expressed under the control of
availability of high amounts of purified or enriched
different promoters in several host strains. B. subtilis
samples. As a first stage in the production of
is a well known micro-organism successfully used
0.25 1.0
for industrial production of enzymes and proteins
(Harwood 1992; Ferrari et al. 1993; Wong 1995).
Xylanase activity (U/ml)

0.20 0.8 We selected it as a host for the heterologous


O.D. 600nm

production of xylanase B from P. barcinonensis. One


0.15 0.6
of the strains used, B. subtilis MB216, was selected
0.10 0.4 because of its efficiency in producing heterologous
proteins from other bacilli (Lampen et al. 1986),
0.05 0.2
whereas the second strain, B. subtilis MW15, is a
double mutant deficient in neutral and alkaline
0 24 48 72 protease activity, which additionally is devoid of
Hours background xylanase activity (Wolf et al. 1995). In
Figure 2. Cellular location of xylanase activity in Bacillus subtilis the experiments performed in this work, the strain
MW15/pRBSPOX20. B. subtilis MW15/pRBSPOX20 was grown B. subtilis MW15 showed the highest production of
at 308C in nutrient broth supplemented with birchwood xylan, recombinant xylanase B, in agreement with previous
samples were taken at different intervals of incubation, fraction-
ated into cell extracts and supernatants, and xylanase activity
results showing the effectiveness of protease-
determined. Culture O.D.600nm ('), xylanase activity in cell deficient mutants of B. subtilis for the expression of
extracts (m), xylanase activity in supernatants (I). enzymes and proteins (Wu et al. 1991).
Cloning and production of Xylanase B 161

Regarding the plasmids constructed, plasmid gressed into the stationary phase, a significant
pN5X20 did not give rise to the production of amount of xylanase B was released to the media.
Downloaded By: [Uab-02/Science Lib] At: 13:35 16 October 2007

detectable xylanase activity by the B. subtilis strains Most probably this is non-specific release, resulting
that contained it. This may be due to the absence of from cell lysis of old cultures, as the activity of the
Bacillus promoters in the shuttle vector used, pN5. cytoplasmic enzyme malate dehydrogenase, assayed
However, the DNA insert of pN5X20 contained in parallel, was also released to the medium in these
both the structural gene xynB plus a 121 bp DNA cultures (data not shown). We have obtained a high
upstream fragment that included a region with level of expression and production of recombinant
partial sequence similar to those recognized by the xylanase B in B. subtilis. At present, new construc-
sA factor of Bacillus RNA polymerase. This putative tions using alternative promoters and Bacillus host
promoter sequence included in pN5X20 seems not strains are being prepared to obtain higher levels of
to be functional in the B. subtilis hosts used in this production of the enzyme. This should facilitate
work, although promoters from Bacillus and related biotechnological evaluation of xylanase B, an en-
genera are usually active in B. subtilis hosts, and can zyme of unique and distinctive properties among
give rise to high levels of production (Sumitomo xylanases.
et al. 1995). The results obtained here suggest that
the 121 bp region upstream xynB structural gene
Acknowledgements
may not be a functional promoter in its natural host
P. barcinonensis. Plasmid pRBSPOX20, however, We thank Monika Wolf for her gift of bacterial strain
expressed high xylanase activity in the two host Bacillus subtilis MW15. We also thank the Serveis
strains assayed, probably as a result of the good Cientı́fico-Tècnics of the University of Barcelona for
performance of the SPO2 promoter located up- their support in nucleotide sequencing, and Margar-
stream of xynB. Several studies have shown that ita Soriano for technical aid in the construction of
the SPO2 promoter can give rise to high expression pRBSPOX20. This work was partially supported by
of heterologous enzymes (Schoner et al. 1983; the Spanish Ministry of Education and Science,
Bolhius et al. 1999). High levels of production of project ref. CTQ2004-07560-CO2-02.
recombinant proteins in B. subtilis have also been
reported using promoters, such as SPO1 phage References
(Osbourne & Craig 1986) and the a-amylase pro-
Bajpai P. 2004. Biological bleaching of chemical pulps. Crit Rev
moter from B. amyloliquefaciens (Palva et al. 1981; Biotechnol 24:1 58.
Inoue et al. 2002, Yamamoto et al. 2005). Bedford MR, Classen HL. 1992. The influence of dietary
Among the several culture media assayed, max- xylanase on intestinal viscosity and molecular weight distribu-
imum xylanase production was found when B. tion of carbohydrates in rye-fed broiler chicks. In: Visser J,
Beldman G, Kusters-van Someren MA, Voragen AGJ, editors.
subtilis MW15/pRBSPOX20 was grown in nutrient
Xylans and xylanases. Amsterdam: Elsevier. pp 361 370.
broth. The reported increase of production in media Binet R, Létoffé S, Ghigo JM, Delepelaire P, Wandersman C.
with high ammonium concentration (MG, MG2 and 1997. Protein secretion by Gram-negative bacterial ABC
BRECI), that suppress expression of residual pro- exporters  a review. Gene 192:7 11.
tease in protease deficient strains (Overbeeke et al. Blanco A, Vidal T, Colom JF, Pastor FIJ. 1995. Purification and
properties of xylanase A from alkali-tolerant Bacillus sp. strain
1990) seems not to apply in our experiments. In all
BP-23. Appl Environ Microbiol 61:4468 4470.
media tested, xylan supplementation enhanced xyla- Blanco A, Dı́az P, Martı́nez J, López O, Soler C, Pastor FIJ. 1996.
nase production, probably as a result of a higher Cloning of a Bacillus sp. BP-23 gene encoding a xylanase with
growth of the strains in these media, as confirmed by high activity against aryl-xylosides. FEMS Microbiol Lett
the determination of cell protein contents of samples. 137:285 290.
Blanco A, Dı́az P, Zueco J, Parascandola P, Pastor FIJ. 1999. A
Xylanase B was mostly located in the cytoplasm of multidomain xylanase from a Bacillus sp. with a region
B. subtilis hosts in accordance with the intracellular homologous to thermostabilizing domains of thermophilic
location of the enzyme in its original host enzymes. Microbiology 145:2163 2170.
P. barcinonensis , and the lack of a signal peptide Bolhuis A, Tjalsma H, Smith HE, De Jong A, Meima R, Venema
(Gallardo et al. 2003). This is in agreement with the G, Bron S, Van Dijl JM. 1999. Evaluation of bottlenecks in the
late stages of protein secretion in Bacillus subtilis . Appl Environ
need for a signal peptide for enzyme export to the Microbiol 65:2934 2941.
extracellular medium in B. subtilis (Nagarajan Chang S, Cohen SN. 1979. High frequency transformation of
1993). Although alternative, signal peptide-indepen- Bacillus subtilis protoplasts by plasmid DNA. Mol Gen Genet
dent, secretion pathways have been described in 168:111 115.
Gram-negative bacteria (Binet et al. 1997), similar Collins T, Gerday C, Feller G. 2005. Xylanases, xylanase families
and extremophilic xylanases. FEMS Microbiol Rev 29:3 23.
pathways for protein secretion in B. subtilis have not Ferrari E, Jarnagin AS, Schmidt BF. 1993. Commercial produc-
been reported to date. Our results show that when tion of extracellular enzymes. In: Sonenshein AL, Hoch JA,
cultures of B. subtilis MW15/pRBSPOX20 pro- Losick R, editors. Bacillus subtilis and other Gram-positive
162 O. Gallardo et al.
bacteria. Biochemistry, physiology and molecular genetics. Washington, DC: American Society for Microbiology. p 713 
Washington, DC: American Society for Microbiology. pp 917  726.
Downloaded By: [Uab-02/Science Lib] At: 13:35 16 October 2007

937. Osbourne MS, Craig RJ. 1986. Activity of two strong promoters
Gallardo O, Diaz P, Pastor FIJ. 2003. Characterization of a cloned into Bacillus subtilis . J Gen Microbiol 132:565 568.
Paenibacillus cell-associated xylanase with high activity on aryl- Overbeeke N, Termorshuizen GHM, Giuseppin MLF, Under-
xylosides: A new subclass of family 10 xylanases. Appl wood DR, Verrips CT. 1990. Secretion of the a-galactosidase
Microbiol Biotechnol 61:226 233. from Cyamopsis tetragonoloba (Guar) by Bacillus subtilis . Appl
Gilkes NR, Henrissat B, Kilburn DG, Miller RC Jr, Warren RAJ. Environ Microbiol 56:1429 1434.
1991. Domains in microbial b-1,4-glycanases: Sequence con- Palva I, Petterson RF, Kalkkinen N, Lehtovaara P, Sarvas M,
servation, function, and enzyme families. Microbiol Rev Södelund H, Takkinen K, Kääriäinen L. 1981. Nucleotide
55:303 315. sequence of the promoter and the NH2-terminal signal peptide
Harwood CR. 1992. Bacillus subtilis and its relatives: Molecular, region of the a-amylase gene from Bacillus amyloliquefaciens .
biological and industrial workhorses. Trends Biotechnol Gene 15:43 51.
10:247 256. Sánchez MM, Fritze D, Blanco A, Spröer C, Tindall BJ,
Henrissat B, Bairoch A. 1996. Updating the sequence-based Schumann P, Kroppenstedt RM, Diaz P, Pastor FIJ. 2005.
classification of glycosyl hydrolases. Biochem J 316:695 696. Paenibacillus barcinonensis sp. nov., a xylanase-producing bac-
Hoch JA. 1991. Genetic analysis in Bacillus subtilis . Method terium isolated from a rice field in the Ebro River delta. Int J
Enzymol 204:305 320. Syst Evol Microbiol 55:935 939.
Horinouchi S, Weisblum B. 1982. Nucleotide sequence and Sambrook J, Fritsch EF, Maniatis T. 1989. Molecular cloning: A
functional map of pC194, a plasmid that specifies inducible laboratory manual. 2nd edn. Cold Spring Harbor, NY: Cold
chloramphenicol resistance. J Bacteriol 150:815 825. Spring Harbor Laboratory.
Inoue Y, Yasutake N, Oshima Y, Yamamoto Y, Tomita T, Miyoshi Schoner RG, Williams DM, Lovett PS. 1983. Enhanced expres-
sion of mouse dihydrofolate reductase in Bacillus subtilis . Gene
S, Yatake T. 2002. Cloning of the maltose phosphorylase gene
22:47 57.
from Bacillus sp strain RK-1 and efficient production of the
Spiro RG. 1966. The Nelson-Somogyi copper reduction method.
cloned gene and the trehalose phosphorylase gene from Bacillus
Analysis of sugars found in glycoprotein. Methods Enzymol
stearothermophilus SK-1 in Bacillus subtilis . Biosci Biotechnol
8:3 26.
Biochem 66:2594 2599.
Sumitomo N, Ozaki K, Hitomi J, Kawaminami S, Kobayashi T,
Jiang Z, Zhu Y, Li L, Yu X, Kusakabe I, Kitaoka M, Hayashi K.
Kawai S, Ito S. 1995. Application of the upstream region of a
2004. Transglycolysation reaction of xylanase B from the
Bacillus endoglucanase gene to high-level expression of foreign
hyperthermophilic Thermotoga maritima with the ability of
genes in Bacillus subtilis . Biosci Biotech Biochem 59:2172 
synthesis of tertiary alkyl b-D-lobiosides and xylosides. J
2175.
Biotechnol 114:125 134. Viikari L, Kantelinen A, Sundquist J, Linko M. 1994. Xylanases
Kulkarni N, Shendye A, Rao M. 1999. Molecular and biotech- in bleaching: From an idea to the industry. FEMS Microbiol
nological aspects of xylanases. FEMS Microbiol Rev 23:411  Rev 13:335 350.
456. Wolf M, Geczi A, Simon O, Borriss R. 1995. Genes encoding
Laemmli UK. 1970. Cleavage of structural proteins during the xylan and b-glucan hydrolysing enzymes in Bacillus subtilis :
assembly of the head of bacteriophage T4. Nature 227:680  Characterization, mapping and construction of strains deficient
685. in lichenase, cellulase and xylanase. Microbiology 141:281 
Lampen JO, Pastor FIJ, Hussain M. 1986. Processing of secreted 290.
proteins and the signal peptidases of bacilli. In: Leive L, Wu XC, Lee W, Tran L, Wong SL. 1991. Engineering a Bacillus
Bonventre PF, Morello JA, Silver SD, Wu HC, editors. subtilis expression secretion system with a strain deficient in six
Microbiology 86. Washington, DC: American Society for extracellular proteases. J Bacteriol 173:4952 4958.
Microbiology. p 279 282. Wong SL. 1995. Advances in the use of Bacillus subtilis for the
Monfort A, Blasco A, Prieto JA, Sanz P. 1996. Combined expression and secretion of heterologous proteins. Curr Opin
expression of Aspergillus nidulans endoxylanase X24 and Biotech 6:517 522.
Aspergillus oryzae a-amylase in industrial bakers’s yeasts and Yamamoto T, Mukai K, Maruta K, Watanabe H, Yamashita H,
their use in bread making. Appl Environ Microbiol 62:3712  Nishimoto T, Kubota M, Chaen H, Fukuda S. 2005. Hyper
3715. expression of kojibiose phosphorylase gene and trehalose
Nagarajan V. 1993. Protein secretion. In: Sonenshein AL, Hoch phosphorylase gene from Thermoanaerobacter brocki
JA, Losick R, editors. Bacillus subtilis and other Gram-positive ATCC35047 in Bacillus subtilis and selaginose synthesis utiliz-
bacteria (Biochemistry, physiology, and molecular genetics). ing two phosphorylases. J Biosci Bioeng 100:343 346.
LICENCIA
Reconocimiento-No comercial-Compartir
bajo la misma licencia 2.5 España

Usted es libre de:

• copiar, distribuir y comunicar públicamente la obra

• hacer obras derivadas

Bajo las condiciones siguientes:


• Reconocimiento. Debe reconocer los créditos de la obra de la manera
especificada por el autor o el licenciador (pero no de una manera que
sugiera que tiene su apoyo o apoyan el uso que hace de su obra).

• No comercial. No puede utilizar esta obra para fines comerciales.

• Compartir bajo la misma licencia. Si altera o transforma esta obra, o


genera una obra derivada, sólo puede distribuir la obra generada bajo
una licencia idéntica a ésta.

• Al reutilizar o distribuir la obra, tiene que dejar bien claro los términos de la
licencia de esta obra.
• Alguna de estas condiciones puede no aplicarse si se obtiene el permiso del
titular de los derechos de autor
• Nada en esta licencia menoscaba o restringe los derechos morales del autor.
Los derechos derivados de usos legítimos u otras limitaciones reconocidas por ley
no se ven afectados por lo anterior.

Esta obra está bajo una licencia Reconocimiento-No comercial-Compartir bajo la misma
licencia 2.5 España de Creative Commons. Para ver una copia de esta licencia, visite
http://creativecommons.org/licenses/by-nc-sa/2.5/es/ o envie una carta a Creative
Commons, 171 Second Street, Suite 300, San Francisco, California 94105, USA.
Tesis Doctoral
Óscar Gallardo Román
Barcelona, 2007