You are on page 1of 88

:$7(5*$5'(1,1*

5HWDLO&DWDORJ

321'6833/,(6
:H6KLS(YHU\WKLQJ%XW7KH:DWHU
7$%/(2)&217(176 321'/,1(5&20
(GXFDWLRQ 6NLPPHUV $TXDWLF3ODQW3URGXFWV
3RQG/LQHUV $LU3XPSV )LVK)RRG
3RQG/LQHU$FFHVVRULHV )RXQWDLQV 'LVSOD\$HUDWRUV :DWHU7HVW.LWV
3RQG.LWV /LJKWLQJ 3RQG&RQVWUXFWLRQ
'LVDSSHDULQJ:DWHUIDOO.LWV 3RQG9DFXXPV 'LVFKDUJH.LWV
3RQGOHVV:DWHUIDOO&RPSRQHQWV 3RQG0DLQWHQDQFH :DWHU&XW2II6ZLWFKHVDQG$XWR)LOO.LWV
:DWHUIDOO:HLUV 3RQG'H,FHUV 9DOYHVDQG&RQQHFWRUV
:DWHU)HDWXUH%DVLQV 3RQG1HWWLQJ 7XELQJ )LWWLQJV
)LOWHUV $OJDH7UHDWPHQWV )LWWLQJV
)LOWHU0HGLD :DWHU&RQGLWLRQHUV 6\QWKHWLF*ROI*UHHQV
3XPS)LOWHU&RPERV 3XPSV &OHDQ8S%DFWHULD 6KLSSLQJDQG3D\PHQW7HUPV
3XPSV )ORFFXODQWV %DUOH\
89&ODUL¿HUV6WHULOL]HUV )LVK0HGLFDWLRQV

5(78516
5(785132/,&<

8QLW/LQHU&RPSDQ\ZLOORQO\DFFHSWDXWKRUL]HGUHWXUQV
$Q50$QXPEHUPXVWEHREWDLQHGIURPRXUFXVWRPHUVHUYLFHGHSDUWPHQW
DQGEHFOHDUO\PDUNHGRQWKHRXWHUER[EHLQJUHWXUQHG
'HIHFWLYHSURGXFWV
‡8QLW/LQHUZLOOUHSODFHGHIHFWLYHLWHPVXQGHUZDUUDQW\DWQRFRVWWRWKHFXVWRPHU
‡ 'HIHFWLYHSURGXFWVDUHVXEMHFWWRLQVSHFWLRQ:KROHVDOHFXVWRPHUVZLOOEHFKDUJHGIRUSXPSVWKDWDUHQRWZDUUDQWDEOHIRULQVWDQFH
ZLWKSRZHUFRUGVWKDWKDYHEHHQDOWHUHG
‡ :HZLOOVKLSDUHSODFHPHQWSXPSDQGDUHWXUQODEHOVRWKDWWKHGHIHFWLYHSXPSFDQEHUHWXUQHGWRXV8QLW/LQHU&RPSDQ\ZLOO
SD\VKLSSLQJRQERWKWKHUHWXUQDQGUHSODFHPHQW$//27+(5,7(061(('72%(5(7851('7281,7/,1(5)25
,163(&7,21,IWKHLWHPLVGHIHFWLYHZHZLOOVHQGDUHSODFHPHQWDWQRFKDUJH,IWKHLWHPLVQRWGHIHFWLYHLWZLOOEHUHWXUQHGWR
WKHFXVWRPHU
‡ :KROHVDOHFXVWRPHUVZLOOEHFKDUJHGLIWKHGHIHFWLYHSXPSVDUHQRWUHWXUQHGZLWKLQGD\VRIUHSODFHPHQW

1HZ3URGXFWV
‡8QLW/LQHU&RPSDQ\ZLOODFFHSWQHZXQXVHGSURGXFWVZLWKLQGD\VRIGDWHRISXUFKDVH3OHDVHVKLSWKHLWHPEDFNZLWKWKH
RULJLQDOSDFNDJLQJHQFORVHGZLWKLQDVHSDUDWHER[WRPLQLPL]HSDFNDJHGDPDJH
‡ 5HWXUQHGSURGXFWVDUHVXEMHFWWRLQVSHFWLRQ3URGXFWVUHWXUQHGDVQHZEXWKDYHEHHQLQVHUYLFHZLOOEHFRQVLGHUHGXVHGDQG
UHVWRFNLQJIHHVZLOODSSO\
‡ )UHLJKWFRVWVDQGDUUDQJHPHQWVDUHWKHUHVSRQVLELOLW\RIWKHZKROHVDOHFXVWRPHU2ULJLQDOIUHLJKWFRVWVDUHQRQUHIXQGDEOH
‡ 3URGXFWVVROGDUHQRWDJXDUDQWHHGVDOH8QGHUQRFLUFXPVWDQFHVZLOO8QLW/LQHUEX\EDFNLQYHQWRU\DWWKHHQGRIWKHVHDVRQ
‡ $OOSURGXFWVDUHXQGHUZDUUDQW\IURPRULJLQDOSXUFKDVHGDWHRQO\DQG'R1RWUHQHZZLWKUHSODFHPHQWV

8VHG3URGXFWV
‡8QLW/LQHU&RPSDQ\ZLOODFFHSWXVHGSURGXFWVZLWKLQGD\VRIGDWHRISXUFKDVH
‡ 5HWXUQHGSURGXFWVDUHVXEMHFWWRLQVSHFWLRQ3URGXFWVUHWXUQHGDVXVHGPXVWEHIXOO\DVVHPEOHGFOHDQDQGEHLQJRRGZRUNLQJ
RUGHUDQGZLOOEHVXEMHFWWRDUHVWRFNLQJIHH3URGXFWV0867EHUHWXUQHGZLWKDOOFRPSRQHQWV
‡ )UHLJKWFRVWVDQGDUUDQJHPHQWVDUHWKHUHVSRQVLELOLW\RIWKHZKROHVDOHFXVWRPHU2ULJLQDOIUHLJKWFRVWVDUHQRQUHIXQGDEOH
‡ 2SHQHGFRQVXPDEOHV ZDWHUWUHDWPHQWV¿VKIRRGHWF RUH[FHVVEXONLWHPV OLQHUXQGHUOD\WXELQJ¿OWHUPHGLDHWF PD\QRWEH
UHWXUQHG
‡ 3RQG)LOWHUVDUHVXEMHFWWRDUHVWRFNLQJIHH
‡ 2WKHUXVHGSURGXFWVDUHVXEMHFWWRDUHVWRFNLQJIHH
‡ %DUJDLQ%DVHPHQWLWHPVPXVWEHUHWXUQHGLQFOHDQZRUNLQJRUGHUDQGDVVROGZLWKQRIXUWKHUGDPDJHRUPLVVLQJSDUWVWRREWDLQD
UHIXQG7KHVHKDYHRQO\DGD\ZDUUDQW\IURPWKHGDWHRISXUFKDVH


 ('8&$7,21
8QLW/LQHUEHJDQLQSURYLGLQJOLQHUVIRUWKHRLO¿HOGLQGXVWU\
7KHFRPSDQ\XQGHUWRRNPDQ\OLQLQJSURMHFWVUDQJLQJIURP¿YHPLO
OLRQJDOORQVWRUDJHWDQNVWR¿YHDFUHSRQGV$VWKHFRPSDQ\JUHZ
DQGH[SDQGHGRWKHUSURGXFWOLQHVZHUHDGGHGDQGQHZGLYLVLRQV
ZHUHFUHDWHG2QHRIWKHVHGLYLVLRQV3RQGOLQHUFRPFDPHDERXWE\
FXVWRPHUGHPDQG

7KHUHWDLOVWRUH3RQG3UR6KRSLVDGLYLVLRQRIWKHFRPSDQ\ZKLFK
EHJDQLQLQDVPDOOFRUQHURIRXURI¿FHVSDFHDQGVWHDGLO\
H[SDQGHGDVRXUORFDOFXVWRPHUVEHFDPHPRUHDQGPRUHLQWHUHVWHGLQ
WKHDFTXLVLWLRQRI¿UVWTXDOLW\SRQGSURGXFWVDQGLQVWDOODWLRQRIZDWHU
IHDWXUHVLQWKHLUKRPHVDQGEXVLQHVVHV

,QZHEHJDQFRQGXFWLQJLQGHSWKVHPLQDUVIRURXUZKROHVDOH
FOLHQWVDQGZDWHUJDUGHQGHPRQVWUDWLRQVIRURXUORFDOFXVWRPHUV
2IFRXUVHDVZRUGVSUHDGWKURXJKRXWWKHLQGXVWU\PRUHDQGPRUH
SHRSOHIURPVXUURXQGLQJVWDWHVDWWHQGHGDQGWKHGHPDQGIRUFODVVHV
VWHDGLO\LQFUHDVHG

,QZHKDGWKHRSSRUWXQLW\WRDFTXLUHVTXDUHIHHWRQ
WZHQW\DFUHVDFURVVWKHVWUHHWIURPRXURULJLQDOORFDWLRQDQGEH
JDQWKHSURFHVVRIUHORFDWLQJDOOWKHGLYLVLRQVRI8QLW/LQHUXQGHU
RQHURRI7KHPRYHDOORZHGXVWRH[SDQGRXUZDUHKRXVHIDFLOLW\
WKHUHWDLOVWRUHDQGWREXLOGDQLQGRRUWUDLQLQJIDFLOLW\WKH¿UVWRI
LW¶VNLQGLQWKHQDWLRQ

7KH,QGRRU3RQG7UDLQLQJ)DFLOLW\LQFOXGHVDVTXDUHIRRW
FODVVURRPDVTXDUHIRRWSRQGEXLOGLQJDUHDDQGD
VTXDUHIRRWGDUNURRPIRUQLJKWOLJKWLQJGLVSOD\V(DFKSDUWRI
RXUIDFLOLW\DGGVWRWKHOHDUQLQJHQYLURQPHQW

2XU6WDIILVGHGLFDWHGWRJURZLQJWKHZDWHUJDUGHQLQJLQGXVWU\
WKURXJKTXDOLW\SURGXFWVWUDLQLQJDQGVHUYLFH7HFKQLFDODVVLVW
DQFHLVDYDLODEOH0RQGD\WKURXJK)ULGD\GXULQJQRUPDOEXVLQHVV
KRXUVE\FDOOLQJRXUWROOIUHHQXPEHU

‡:HDUHRQHRIWKH¿YHODUJHVWZKROHVDOHZDWHUJDUGHQGLVWULEXWRUVLQWKH86
‡ZDWHUJDUGHQLQYHQWRU\DWRXUIDFLOLW\
‡7KHQDWLRQ¶VRQO\LQGRRUZDWHUJDUGHQWUDLQLQJIDFLOLW\
‡VTXDUHIRRWZDUHKRXVHWRKRXVHRXULQYHQWRU\
‡5HWDLOVWRUHRSHQ\HDUURXQGZLWKGLVSOD\SRQGVSRQGHTXLSPHQWDQGVXSSOLHVDTXDWLFSODQWV¿VKVWDWXDU\DQGPXFKPRUH


321'/,1(56 321'/,1(5&20
)LUHVWRQH3RQG*DUGSRQGOLQHULVWKHLQGXVWU\VWDQGDUGIRUZDWHUIHDWXUHV1R
RWKHUPDWHULDOPDWFKHVLWVHDVHRILQVWDOODWLRQDQGORQJHYLW\*XDUDQWHHGILVKVDIH
:LWKVWDQGVGLUHFWVXQOLJKWDQGWHPSHUDWXUHVWRž)\HDUZDUUDQW\
/LQHUVPDUNHGZLWKDQ ZLOOVKLS)HG([2WKHUVZLOOVKLS&RQZD\)UHLJKWRU
RWKHUIUHLJKWVKLSSLQJFRPSDQ\

0LO 4„VTIW&XW2„VTIW)XOO5ROO

IW:LGH IW:LGH IW:LGH


 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ UROO
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶ UROO  ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ UROO
 ( ¶[¶ UROO  ( ¶[¶ 
 ( ¶[¶ UROO
IW:LGH IW:LGH
 ,WHP 6L]H 3ULFH
IW:LGH  ,WHP 6L]H 3ULFH
 ( ¶[¶   ,WHP 6L]H 3ULFH  ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ UROO
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶ UROO  ( ¶[¶ UROO  ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶ UROO
 ( ¶[¶   ( ¶[¶ 
 ( ¶[¶ UROO  ( ¶[¶ UROO

IW:LGH IW:LGH IW:LGH IW:LGH


 ,WHP 6L]H 3ULFH ,WHP 6L]H 3ULFH ,WHP 6L]H 3ULFH ,WHP 6L]H 3ULFH
 ( ¶[¶   ( ¶[¶   ( ¶[¶   ( ¶[¶ UROO
 ( ¶[¶   ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶ UROO  ( ¶[¶   ( ¶[¶ 
 ( ¶[¶ UROO  ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶   ( ¶[¶ 
 ( ¶[¶   ( ¶[¶   ( ¶[¶   ( ¶[¶ UROO
 ( ¶[¶   ( ¶[¶   ( ¶[¶ UROO
 ( ¶[¶   ( ¶[¶ UROO
 ( ¶[¶ UROO 7KLVVL]HOLQHUZLOOVKLS)HG([


 321'/,1(56

3RO\HWK\OHQH3RQG/LQHU
PLO#„SHUVTIW PLO#„SHUVTIW &XVWRPVL]HGPHGLXPGHQVLW\
SRO\HWK\OHQHSRQGOLQHUVDUHLGHDOIRU
 6L]H 6T)W 3ULFH  6L]H 6T)W 3ULFH ODUJHSRQGVDQGODNHV3RO\HWK\OHQHSRQG
 ¶[¶    ¶[¶   OLQHUVDUHFRPSOHWHO\VDIHIRUDOOSODQW
DQGDQLPDOOLIH3RO\HWK\OHQHH[KLELWV
 ¶[¶    ¶[¶  
VXSHUE89UHVLVWDQFHHYHQZKHQH[SRVHG
 ¶[¶    ¶[¶  
WRGLUHFWVXQOLJKW,WLVOHVVH[SHQVLYHDQG
 ¶[¶    ¶[¶   OLJKWHUWKDQRWKHUPDWHULDOVZKLFKPDNHV
 ¶[¶    ¶[¶   LQVWDOODWLRQRIODUJHUOLQHUVHDVLHU0HGLXP
 ¶[¶    ¶[¶   GHQVLW\SRO\HWK\OHQHLVDVLQJOHSO\WRXJKPDWHULDO
 ¶[¶    ¶[¶   WKDWLVGLIILFXOWWRSXQFWXUH7KLVPDWHULDOLVOHVVSOLDEOH
 ¶[¶    ¶[¶   WKDQRWKHUPDWHULDOVDQGLVGLIILFXOWWRLQVWDOOLQVPDOOSRQGV
 ¶[¶    ¶[¶  
 ¶[¶    ¶[¶   ‡0HGLXPGHQVLW\SRO\HWK\OHQHLVDYDLODEOHLQDQGPLO
 ¶[¶    ¶[¶   ‡(DFKOLQHULVFXVWRPEXLOWWR\RXUVSHFLILFDWLRQV
 ¶[¶    ¶[¶   ‡0HDVXUHGLQ¶LQFUHPHQWV ZLGWKPXVWEHGLYLVLEOHE\¶
 ¶[¶    ¶[¶   ‡%DFNHGE\DWZHQW\\HDUZDUUDQW\
 ¶[¶    ¶[¶  
)XOOLQVWDOODWLRQVHUYLFHVDUHDYDLODEOHQDWLRQZLGHIRUOLQHUVWRRODUJHWRVKLS
 ¶[¶    ¶[¶  
 ¶[¶    ¶[¶   /DUJHVWVL]HWKDWFDQEHVKLSSHG)HG([
 ¶[¶    ¶[¶  
 ¶[¶    ¶[¶  
 3(/LQHU 0D[LPXPRQHSLHFHVL]H 3ULFH
 ¶[¶    ¶[¶  
 PLO VTIW „SHUVTIW
 ¶[¶    ¶[¶  
 PLO VTIW „SHUVTIW

321'/,1(5$&&(6625,(6

+RZWRFDOFXODWHZKDWVL]HOLQHU\RX
7,3 ZLOOQHHGIRU\RXUZDWHUIHDWXUH
8QLYHUVDO5HSDLU7DSH
5HSDLUV3RO\HWK\OHQHOLQHUV6LPSO\FOHDQDQGGU\
7KHEDVLFIRUPXODIRUGHWHUPLQLQJOLQHUVL]HLV WKHGDPDJHGDUHDDQGDSSO\WKHSDWFK1RFKHPLFDO
/HQJWK 'HSWK[  2YHUODS[  /HQJWKRI/LQHU RUDFWLYDWRUVQHFHVVDU\1RWUHFRPPHQGHGIRU
VSOLFLQJOLQHUWRJHWKHU
:LGWK 'HSWK[  2YHUODS[  :LGWKRI/LQHU
‡0HDVXUHV´
:HUHFRPPHQGD¶RYHUODSRQDOOVLGHVRIZDWHUIHDWXUH
 ,WHP 6L]H 3ULFH
%HVXUHWRPHDVXUHWKHORQJHVWZLGHVW GHHSHVWSRLQWVRI
 0 ¶5ROO 
\RXUZDWHUIHDWXUHWRXVHLQWKHIRUPXODLQRUGHUWRHQVXUH
WKHDFFXUDWHVL]H  0/) /LQHDU)RRW 

3RQG/LQHU8QGHUOD\
,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH 8QGHUOD\LQFUHDVHVSRQGOLQHUOLIHDQG
 8 ¶[¶   8 ¶[¶  PDNHVOLQHUVPRUHSXQFWXUHUHVLVWDQW
E\SURWHFWLQJWKHPIURPVKDUSREMHFWV
 8 ¶[¶   8 ¶[¶  LQWKHVRLO8QGHUOD\VWDELOL]HVJURXQG
 8 ¶[¶   8 ¶[¶  XQGHUWKHOLQHUWRNHHS(3'0DQGRWKHU
 8 ¶[¶   8 ¶[¶  SRQGOLQHUVIRUPRYHUVWUHWFKLQJ4XLFN
 8 ¶[¶   8 ¶[¶  DQGHDV\WRLQVWDOOXQGHUOD\UHVLVWSRQG
VHWWOLQJGHFRPSRVLWLRQDQGVKLIWLQJXQOLNH
 8 ¶[¶   8 ¶[¶  QHZVSDSHURUVDQG7KLFNQHVVLVR]
 8 ¶[¶   8 ¶[¶ 
$YDLODEOHLQ¶ ¶UROOZLGWKV
 8 ¶[¶   8 ¶[¶ 
3ULFHSHUVTIW „
 8 ¶[¶   8 ¶[¶ 
¶UROOVSHUVTIW „
 8 ¶[¶ 


321'/,1(5$&&(6625,(6 321'/,1(5&20
)HGH[+D]0DW)HHRU&RQZD\)UHLJKW+D]0DW)HH

)LUHVWRQH )LUHVWRQH )LUHVWRQH)RUP


´6HDP7DSH ´&RYHU7DSH )ODVK´[¶
 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH  ,WHP 3ULFH
:5$& ¶  :5$& ¶   :5$& 
:5$& ¶  :5$& ¶   :5$&/) /)


)LUHVWRQH
(3'05HSDLU.LW
)LUHVWRQH3UHIRUPHG
3LSH)ODVKLQJ%RRW
)LUHVWRQH
6LOLFRQH5ROOHU
 ,WHP 3ULFH  ,WHP 3ULFH  ,WHP 3ULFH
 :5$&   :   : 

)LUHVWRQH )LUHVWRQH¶ )LUHVWRQH


&RUQHU)ODVKLQJ 7HUPLQDWLRQ%DU 4XLFN6FUXEEHU.LW
,QFOXGHVKDQGOHV 3DGV
 ,WHP 3ULFH  ,WHP 3ULFH  ,WHP 3ULFH
 :5$&   :5$&   : 

)LUHVWRQH *HQHULF )LUHVWRQH4XLFN6FUXEEHU


4XLFN5ROOHU ´&RYHU7DSH 3ULPHU$SSOLFDWLRQ.LW
,QFOXGHVKDQGOHV 3DGV
 ,WHP 3ULFH  ,WHP 6L]H 3ULFH  ,WHP 3ULFH
 :   (3'0&9573/) /LQHDU)W   : 
 (3'0&973 ¶ 

)LUHVWRQH:DWHU%ORFN

)LUHVWRQH
4XLFN3ULPH3OXV
*HQHULF  ,WHP 6L]H 3ULFH
´6SOLFH7DSH  : R] 
 ,WHP 6L]H 3ULFH
:5$& 4UW 
 ,WHP 6L]H 3ULFH
 (3'06073 ¶ 
)LUHVWRQH%RQGLQJ$GKHVLYH
 : *DO   ,WHP 6L]H 3ULFH
(3'06073 ¶ 
 : *DO   : *DO 

/,1(5
7,3
(GXFDWLRQDO9LGHRVRQ
)LUHVWRQH3URGXFWVFDQEH 
)LUHVWRQH/DS6HDODQW+6
,WHP 6L]H 3ULFH
)LUHVWRQH6SOLFH$GKHVLYH
 ,WHP 6L]H 3ULFH
IRXQGDWZZZILUHVWRQHVSFRP
 : R]   : *DO 


 321'321'.,76

6DYLR*DOORQ3RQG3DFNDJH Š
7KHSHUIHFWVL]HIRUDVPDOOSDWLRSRQG
‡6DYLR&RPSDFW6NLPPHUILOWHUŠ ‡6DYLR:DWHU0DVWHUŒ6ROLGV ‡&RQVWUXFWLRQ*XLGH
Z´)DFHSODWH 3XPS ‡3OXPELQJ.LW
‡6DYLR´:DWHUIDOO:HLU ‡¶[´.LQN)UHH3LSH ‡%HQHILFLDO%DFWHULD%DUOH\([WUDFW

 ,WHP 3RQG.LW6L]H /LQHU8QGHUOD\6L]H 3ULFH


 33 ¶[¶[¶ ¶[¶ 

6DYLR*DOORQ3RQG3DFNDJH Š
7KHSHUIHFWVL]HIRUDVPDOOSDWLRSRQG
‡6NLPPHUILOWHUŠZ´)DFHSODWH ‡¶[´.LQN)UHH3LSH ‡%HQHILFLDO%DFWHULD%DUOH\([WUDFW
‡´:DWHUIDOO:HLU ‡&RQVWUXFWLRQ*XLGH ‡%ODFN)RDP
‡:DWHU0DVWHUŒ6ROLGV3XPS ‡3OXPELQJ.LW ‡+RZWREXLOGD/LYLQJSRQGŠ9LGHR

 ,WHP 3RQG.LW6L]H /LQHU8QGHUOD\6L]H 3ULFH


 33 ¶[¶[¶ ¶[¶ 

6DYLR*DOORQ3RQG3DFNDJH Š
$ODUJHUSRQGZLWKHYHQPRUHELRILOWUDWLRQFDSDFLW\

‡6NLPPHUILOWHUŠZ´)DFHSODWH ‡6SULQJIOR%LR)LOWHU0HGLD ‡%ODFN)RDP


‡/LYLQJSRQGVŠ:DWHUIDOO)LOWHU ‡3OXPELQJ.LW ‡&RQVWUXFWLRQ*XLGH
‡:DWHU0DVWHUŒ6ROLGV3XPS ‡%HQHILFLDO%DFWHULD%DUOH\([WUDFW ‡+RZWREXLOGD/LYLQJSRQGŠ
‡¶[´.LQN)UHH3LSH ‡)LOWHU%RWWRP'UDLQ$VVHPEO\ 9LGHR

 ,WHP 3RQG.LW6L]H /LQHU8QGHUOD\6L]H 3ULFH


 33 ¶[¶[¶ ¶[¶ 

6DYLR*DOORQ3RQG3DFNDJH Š
$ODUJHUSRQGZLWKHYHQPRUHELRILOWUDWLRQFDSDFLW\

‡6NLPPHUILOWHUŠZ´)DFHSODWH ‡6SULQJIOR%LR)LOWHU0HGLD ‡%ODFN)RDP


‡/LYLQJSRQGVŠ:DWHUIDOO)LOWHU ‡3OXPELQJ.LW ‡&RQVWUXFWLRQ*XLGH
‡:DWHU0DVWHUŒ6ROLGV3XPS ‡%HQHILFLDO%DFWHULD%DUOH\([WUDFW ‡+RZWREXLOGD/LYLQJSRQGŠ9LGHR
‡¶[´.LQN)UHH3LSH ‡)LOWHU%RWWRP'UDLQ$VVHPEO\

 ,WHP 3RQG.LW6L]H /LQHU8QGHUOD\6L]H 3ULFH


 33 ¶[¶[¶ ¶[¶¶[¶ 


321'.,76 321'/,1(5&20

3RQG.LWVZLWK6DYLR&RPSRQHQWV
‡6DYLR6NLPPHUILOWHUŠ ‡3OXPELQJFRQQHFWLRQV
‡6DYLR/LYLQJSRQGV:DWHUIDOO)LOWHU ‡%ODFNZDWHUIDOOIRDP
‡)LUHVWRQH3RQG*DUGPLO(3'0OLQHU ‡'HFKORULQDWRU
‡3RQG/LQHU8QGHUOD\ ‡%DFWHULD
‡&KRLFHRID6KLQ0D\ZDRU6DYLR:DWHU0DVWHU ‡,QVWUXFWLRQ0DQXDO
6ROLGV+DQGOLQJSRQGSXPS
‡´39&+RVH
‡3XPS'LVFKDUJHNLW
‡)LOWHUERWWRPGUDLQNLW
‡¶[´39&KRVHIRUGUDLQ

.LWVL]HVFDOFXODWHGXVLQJ¶PD[LPXPSRQGGHSWK([WUDOLQHUPD\EHUHTXLUHGIRUZDWHUIDOORUVWUHDP

.LWFRQWDLQVVNLPPHUILOWHUVZDWHUIDOOILOWHUVZDWHUIDOOSXPSVDQGSXPSGLVFKDUJHNLWV
‚
.LWV0XVW6KLS)UHLJKW7UXFN

 ,WHP 3RQG.LW6L]H +RVH/HQJWK /LQHU8QGHUOD\6L]H 3XPS 3ULFH


 6.6 ¶[¶ ¶ ¶[¶ 6KLQ0D\ZD&56JSK 
 6. ¶[¶ ¶ ¶[¶ 6DYLR:DWHU0DVWHU6ROLGVJSK 
 6.6 ¶[¶ ¶ ¶[¶ 6KLQ0D\ZD&56JSK 
 6. ¶[¶ ¶ ¶[¶ 6DYLR:DWHU0DVWHU6ROLGVJSK 
 6.6 ¶[¶ ¶ ¶[¶ 6KLQ0D\ZD&56JSK 
 6. ¶[¶ ¶ ¶[¶ 6DYLR:DWHU0DVWHU6ROLGVJSK 
‚
 6.6 ¶[¶ ¶ ¶[¶ 6KLQ0D\ZD&56JSK 
‚
 6. ¶[¶ ¶ ¶[¶ 6DYLR:DWHU0DVWHU6ROLGVJSK 
‚
 6.6 ¶[¶ ¶ ¶[¶ 6KLQ0D\ZD&56JSK 
‚
 6. ¶[¶ ¶ ¶[¶ 6DYLR:DWHU0DVWHU6ROLGVJSK 
‚
 6.6 ¶[¶ ¶ ¶[¶ 6KLQ0D\ZD&56JSK 
‚
 6. ¶[¶ ¶ ¶[¶ 6DYLR:DWHU0DVWHU6ROLGVJSK 
‚
 6.6 ¶[¶ ¶ ¶[¶ 6KLQ0D\ZD&56JSK 
‚
 6. ¶[¶ ¶ ¶[¶ 6DYLR:DWHU0DVWHU6ROLGVJSK 
‚
 6.6 ¶[¶ ¶ ¶[¶ 6KLQ0D\ZD&56JSK 
‚
 6. ¶[¶ ¶ ¶[¶ 6DYLR:DWHU0DVWHU6ROLGVJSK 

3URIHVVLRQDO  3URIHVVLRQDO 
6PDOO3RQG.LWV 0HGLXP3RQG.LWV
3URIHVVLRQDOJUDGHNLWVIHDWXULQJ$WODQWLF:DWHU 3URIHVVLRQDOJUDGHNLWVIHDWXULQJ$WODQWLF:DWHU
*DUGHQV%LJ%DKDPDVHULHVSRQGVNLPPHUV *DUGHQV%LJ%DKDPDVHULHVSRQGVNLPPHUV
ILOWHUIDOOVDQGD6KLQ0D\ZD3XPS6KLSV)H[([ ILOWHUIDOOVDQGD6KLQ0D\ZD3XPS6KLSV)HG([

‡%DKDPD6HULHV36 DQG&OHDQXS%DFWHULD ‡%DKDPD6HULHV36 DQG&OHDQXS%DFWHULD


3RQG6NLPPHU ‡:DWHUIDOO)RDP 3RQG6NLPPHU ‡:DWHUIDOO)RDP
‡%DKDPD6HULHV%))LOWHU)DOOV ‡:ULWWHQ,QVWUXFWLRQV ‡%DKDPD6HULHV%))LOWHU)DOOV ‡:ULWWHQ,QVWUXFWLRQV
‡6KLQ0D\ZD*3+3XPS ‡6KLQ0D\ZD*3+3XPS
‡)LUHVWRQHPLO(3'0 ‡)LUHVWRQHPLO(3'0
3RQG/LQHU 3RQG/LQHU
‡3RQG/LQHU8QGHUOD\ ‡3RQG/LQHU8QGHUOD\
‡¶[´39&)OH[3LSH ‡¶[´39&)OH[3LSH
‡&KHFN9DOYH3OXPELQJ&RQQHFWLRQV ‡&KHFN9DOYH3OXPELQJ&RQQHFWLRQV
‡:DWHU&RQGLWLRQHU6WDUWXS ‡:DWHU&RQGLWLRQHU6WDUWXS

 ,WHP 3RQG.LW6L]H /LQHU6L]H 3ULFH  ,WHP 3RQG.LW6L]H /LQHU6L]H 3ULFH


 $. ¶[¶ ¶[¶   $. ¶[¶ ¶[¶ 
 $. ¶[¶ ¶[¶   $. ¶[¶ ¶[¶ 
 $. ¶[¶ ¶[¶ 


 352)(66,21$/321'.,76

3URIHVVLRQDO/DUJH3RQG.LWV
‡%DKDPD6HULHV36 ‡&KHFN9DOYH3OXPELQJ 3URIHVVLRQDOJUDGHNLWVIHDWXULQJ$WODQWLF:DWHU*DUGHQV%LJ
3RQG6NLPPHU &RQQHFWLRQV %DKDPDVHULHVSRQGVNLPPHUVILOWHUIDOOVDQG6KLQ0D\ZD3XPSV
‡%DKDPD6HULHV%))LOWHU)DOOV ‡:DWHUIDOO)RDP FDQV  ,WHP 3RQG.LW6L]H /LQHU6L]H 3ULFH
‡6KLQ0D\ZD*3+3XPS ‡:DWHU&RQGLWLRQHU6WDUWXS  $. ¶[¶ ¶[¶ 
‡3RQG/LQHU8QGHUOD\ DQG&OHDQXS%DFWHULD
 $. ¶[¶ ¶[¶ 
‡)LUHVWRQHPLO(3'0 ‡:ULWWHQ,QVWUXFWLRQV
 $. ¶[¶ ¶[¶ 
3RQG/LQHU ‡6KLSV)UHLJKW7UXFN
 $. ¶[¶ ¶[¶ 
‡¶[´39&)OH[3LSH

0LQL+DSS\.RL3RQG.LW
‡$WODQWLF:DWHU*DUGHQV ‡)LUHVWRQHPLO3RQG*DUG
%))LOWHUIDOOV (3'03RQG/LQHU
‡$WODQWLF:DWHU*DUGHQV ‡&KHFN9DOYH)LWWLQJV 
+$33<.2,321'.,76 366NLPPHU +RVH&ODPSV
‡$OSLQH+XUULFDQH*3+3XPS ‡:DWHU&RQGLWLRQHU6WDUWXS
‡¶[´6SLUDO7XELQJ DQG&OHDQXS%DFWHULD
+DSS\ .RL 3RQG .LWV DUH ‡:DWHUIDOO)RDP ‡:ULWWHQ,QVWUXFWLRQV
H[FHOOHQWSRQGNLWVIRUWKHGRLW
‡3RQG/LQHU8QGHUOD\
\RXUVHOI SRQG HQWKXVLDVW (DFK
NLW FRQWDLQV D SRQG VNLPPHU  ,WHP 3RQG.LW6L]H /LQHU6L]H 3ULFH
ZDWHUIDOO ILOWHU PDJQHWLFGULYH  +. ¶[¶ ¶[¶ 
SXPS(3'0 SRQGOLQHUSRQG
 +. ¶[¶ ¶[¶ 
OLQHU XQGHUOD\ VSLUDO WXELQJ
FKHFNYDOYHGLVFKDUJHNLWZDWHU  +. ¶[¶ ¶[¶ 
FRQGLWLRQHU EDFWHULD ZDWHUIDOO
IRDP DQG ZULWWHQ LQVWDOODWLRQ
LQVWUXFWLRQV

+DSS\ .RL 3RQG .LWV DUH HDV\


6PDOO+DSS\.RL3RQG.LW
WRLQVWDOODQGEXLOWWRODVW
‡$WODQWLF:DWHU*DUGHQV ‡)LUHVWRQHPLO3RQG*DUG
.LWVL]HVDUHFDOFXODWHGXVLQJD %))LOWHUIDOOV (3'03RQG/LQHU
´SRQGGHSWK ‡$WODQWLF:DWHU*DUGHQV ‡&KHFN9DOYH)LWWLQJV 
366NLPPHU +RVH&ODPSV
&RPSRQHQWZDUUDQWLHV ‡$OSLQH+XUULFDQH*3+3XPS ‡:DWHU&RQGLWLRQHU6WDUWXS
:DWHUIDOO)LOWHU/LIHWLPH ‡¶[´6SLUDO7XELQJ DQG&OHDQXS%DFWHULD
3RQG6NLPPHU/LIHWLPH ‡:ULWWHQ,QVWUXFWLRQV
3RQG/LQHU\HDU ‡:DWHUIDOO)RDP
0DJ'ULYH3XPS \HDUV ‡3RQG/LQHU8QGHUOD\
 ,WHP 3RQG.LW6L]H /LQHU6L]H 3ULFH
 +. ¶[¶ ¶[¶ 
 +. ¶[¶ ¶[¶ 
 +. ¶[¶ ¶[¶ 

0HGLXP+DSS\.RL3RQG.LW
‡$WODQWLF:DWHU*DUGHQV ‡¶[´6SLUDO7XELQJ ‡&KHFN9DOYH)LWWLQJV 
%))LOWHUIDOOV ‡:DWHUIDOO)RDP +RVH&ODPSV
‡$WODQWLF:DWHU*DUGHQV ‡3RQG/LQHU8QGHUOD\ ‡:DWHU&RQGLWLRQHU6WDUWXS
366NLPPHU DQG&OHDQXS%DFWHULD
‡)LUHVWRQHPLO3RQG*DUG
‡$OSLQH+XUULFDQH*3+3XPS (3'03RQG/LQHU ‡:ULWWHQ,QVWUXFWLRQV

 ,WHP 3RQG.LW6L]H /LQHU6L]H 3ULFH


 +. ¶[¶ ¶[¶ 
 +. ¶[¶ ¶[¶ 
 +. ¶[¶ ¶[¶ 


',6$33($5,1*:$7(5)$//.,76 321'/,1(5&20

¶6DYLR3RQG)UHH:DWHUIDOOSDFNDJH
¶[¶0D[LPXP6L]H¶:[¶/[¶'%DVLQ

6DYLR3RQG)UHHV\VWHPVSURYLGHHYHU\WKLQJQHFHVVDU\WREXLOGDG\QDPLFZDWHUIDOORUVWUHDPVFDSHHQYLURQPHQWVLPSO\
DGGURFNVDQGSODQWV
‡:DWHUIDOO:HOO ‡¶[¶PLO(3'0OLQHU ‡%ODFN)RDP
‡´)LOWHU:HLU ‡¶[¶8QGHUOD\ ‡6WHSE\6WHS,QVWUXFWLRQV
‡6DYLR:0&JSKSXPS ‡¶[´.LQN)UHH3LSH ‡+RZWR%XLOGD3RQG)UHH:DWHUIDOO9LGHR

 ,WHP 3ULFH
 3) 

¶6DYLR3RQG)UHH:DWHUIDOOSDFNDJH
¶[¶0D[LPXP6L]H¶:[¶/[¶'%DVLQ

6DYLR¶3RQG)UHHV\VWHPSURYLGHVHYHU\WKLQJQHFHVVDU\WREXLOGELJJHUG\QDPLFZDWHUIDOOVRUORQJHUVWUHDPEHGV
VLPSO\DGGURFNVDQGSODQWV
‡:DWHUIDOO:HOO ‡¶[¶PLO(3'0OLQHU ‡%ODFN)RDP
‡´)LOWHU:HLU ‡¶[¶8QGHUOD\ ‡6WHSE\6WHS,QVWUXFWLRQV
‡6DYLR:0&JSKSXPS ‡¶[´.LQN)UHH3LSH ‡+RZWR%XLOGD3RQG)UHH:DWHUIDOO9LGHR

 ,WHP 3ULFH
 3) 

6PDOO'LVDSSHDULQJ 0HGLXP'LVDSSHDULQJ
:DWHUIDOOSDFNDJH :DWHUIDOOSDFNDJH
¶[´0D[LPXP6L]H¶:[¶/[¶'%DVLQ ¶[´0D[LPXP6L]H¶:[¶/[¶'%DVLQ

.LW,QFOXGHV .LW,QFOXGHV
‡/LWWOH*LDQW6LPSO\)DOOV3XPS ‡¶[¶)LUHVWRQHPLO ‡/LWWOH*LDQW6LPSO\)DOOV3XPS ‡¶[¶)LUHVWRQHPLO
9DXOW (3'0OLQHU 9DXOW (3'0OLQHU
‡$WODQWLF:DWHU*DUGHQV63 ‡¶[¶8QGHUOD\ ‡$WODQWLF:DWHU*DUGHQV63 ‡¶[¶8QGHUOD\
)DVW)DOOV ‡%ODFN:DWHUIDOO)RDP FDQV )DVW)DOOV ‡%ODFN:DWHUIDOO)RDP FDQV
‡&DO3XPSJSK0DJ'ULYH ‡3OXPELQJ&RQQHFWLRQV ‡&DO3XPSJSK0DJ'ULYH ‡3OXPELQJ&RQQHFWLRQV
:DWHUIDOO3XPS ‡6WHSE\6WHS,QVWUXFWLRQV :DWHUIDOO3XPS ‡6WHSE\6WHS,QVWUXFWLRQV
‡¶[´6SLUDO7XELQJ ‡¶[´6SLUDO7XELQJ
 ,WHP 3ULFH  ,WHP 3ULFH
 ':.   ':. 

/DUJH'LVDSSHDULQJ:DWHUIDOOSDFNDJH
¶[´0D[LPXP6L]H¶:[¶/[¶'%DVLQ
.LW,QFOXGHV
‡/LWWOH*LDQW6LPSO\)DOOV3XPS9DXOW ‡¶[¶8QGHUOD\
‡$WODQWLF:DWHU*DUGHQV63)DVW)DOOV ‡%ODFN:DWHUIDOO)RDP FDQV
‡¶[´6SLUDO7XELQJ ‡3OXPELQJ&RQQHFWLRQV
‡&DO3XPSJSK0DJ'ULYH:DWHUIDOO3XPS ‡6WHSE\6WHS,QVWUXFWLRQV
‡¶[¶)LUHVWRQHPLO(3'0OLQHU

 ,WHP 3ULFH
 ':. 


 321'/(66:$7(5)$//&20321(176

/LWWOH*LDQW6LPSO\)DOOV3XPS9DXOW
‡9DXOWLVURWDWLRQDOPROGHGSRO\HWK\OHQHIRUGXUDELOLW\ ‡:DOOULGJHVSURYLGHDGGHGVWUHQJWK
‡6WXUG\YDXOWOLGDOORZV\RXWRFRQFHDOWKHXQLWZLWK ‡0XOWLSOHLQOHWYHQWVDOORZVXQLWWRFROOHFWZDWHUDWD
URFNVJUDYHOSODQWVHWF UDSLGSDFH
‡3UHGULOOHG´GLVFKDUJHSRUWWDNHVWKHKDVVOHRXWRI ‡<HDU:DUUDQW\
LQVWDOODWLRQ

 ,WHP 'LPHQVLRQV 0D[)ORZ 3ULFH


  ´'LD[´+ JSK 

/LWWOH*LDQW$XWR)LOO.LW /LWWOH*LDQW'LVFKDUJH.LW
‡´037$XWR)LOO9DOYH ‡´)HPDOH$GDSWRU 7KHVHNLWVLQFOXGHDOOWKHFRPSRQHQWV\RXQHHG
‡´%DUE$GDSWRU ‡´*DUGHQ+RVH$GDSWRU LQFOXGLQJUXEEHUFRXSOLQJVFKHFNYDOYHVDQGDGDSWRUV
 ,WHP 'HVFULSWLRQ 3ULFH
 ,WHP 3ULFH   '.$´'LVFKDUJH.LW 
     '.%´ ´'LVFKDUJH.LW 
  '.&´'LVFKDUJH.LW 

6DYLR:DWHUIDOO:HOO 6DYLR
&UHDWH%HDXWLIXO'LVDSSHDULQJ:DWHUIDOOV 6WUHDPV:LWKRXW :DWHUIDOO:HOO([WHQVLRQ
WKH1HHGIRUD3RQG
,QFUHDVHWKHGHSWKDQGKROGLQJFDSDFLW\RI
‡3URWHFWV\RXUSXPSIURPWKHFUXVKLQJIRUFHVRI
3RQG)UHH6\VWHPV7KHPRUHZDWHU\RXUEDVLQ
URFNDQGZDWHU
KROGVWKHOHVVRIWHQ\RXZLOOKDYHWRUHILOOLW%\
‡)HDWXUHVZLGHPRXWKIRUWKHODUJHVWRISXPSVZLWKHDV\DFFHVVWR
DGGLQJWKH´:DWHUIDOO:HOO([WHQVLRQRQWR
ERWKSXPS SOXPELQJ
\RXU6DYLR:DWHUIDOO:HOO\RXZLOOFXWGRZQWKH :DWHUIDOO:HOO
‡6QDSILWHQFORVXUHLVHDV\WRDVVHPEOH FRQWDLQVQRPRYLQJSDUWV
QXPEHURIWLPHVLWZLOOQHHGWREHUHILOOHG Z([WHQVLRQ
‡(DV\SXQFKPXOWLSOHRXWOHWVL]HV
‡+DQGOHVPD[LPXPSXPSIORZRI*3+
‡\HDUZDUUDQW\  ,WHP 'LPHQVLRQV 3ULFH
 . ´+ 
 ,WHP 'LPHQVLRQV 0D[)ORZ 3ULFH
 :: ´'LD[´+ JSK 

6DYLR$XWR)LOO.LW 'LVFKDUJH.LWIRU6DYLR
0DLQWDLQRSWLPDOZDWHUOHYHOZLWKDUHJXODWHGIORZRIZDWHU 'HVLJQHGIRU6DYLR:DWHU0DVWHU&OHDU3XPSV0DNHLWHDV\WR
6HOIWDSSLQJYDOYHFRQQHFWVWRFRSSHUSODVWLFRULURQZDWHU UHPRYHSXPSVIRUVHUYLFLQJRUZLQWHUVWRUDJH
VXSSO\OLQHVXSWR´LQFKGLDPHWHU,QFOXGHV¶RI´OLQH
 ,WHP 'HVFULSWLRQ 3ULFH
 ,WHP 3ULFH  . .LWIRU:DWHUIDOO:HOO 
 .   . .LWIRU:DWHUIDOO:HOO([WHQVLRQ 

$WODQWLF:DWHU*DUGHQV $WODQWLF:DWHU*DUGHQV
3XPS9DXOW 3XPS9DXOW([WHQVLRQ
7KHYLUWXDOO\LQGHVWUXFWLEOHGHVLJQRIWKH$WODQWLF:DWHU*DUGHQ 7KH$WODQWLF:DWHU*DUGHQV3XPS9DXOW([WHQVLRQDOORZV\RX
3XPS9DXOWFDQDFFRPPRGDWHODUJHSXPSVDQGIORZUDWHVXSWR WRFUHDWHSRQGOHVVZDWHUIDOOVLQWLJKWHUDUHDVE\DOORZLQJWKH
JSK)HDWXUHVLQFOXGHKHDY\GXW\OLG´RSHQLQJFXW EDVLQVL]HWREH´GHHSHUZKLFKDOORZVIRUDVPDOOHUZLGWKDQG
OLQHVIRUSXPSGLVFKDUJHDQGSLSHH[WHQVLRQDQGIODWSDQHOVIRU OHQJWK7KH$WODQWLF:DWHU*DUGHQV3XPS9DXOW([WHQVLRQILWVWKH
FXVWRPSOXPELQJDSSOLFDWLRQV $WODQWLF:DWHU*DUGHQV393XPS9DXOW

 ,WHP 'LPHQVLRQV 0D[)ORZ 3ULFH  ,WHP 'LPHQVLRQV 3ULFH


 39 ´'LD[´+ JSK   39(;7 ´'LD[´+ 
 39 ´'LD[´+ JSK 


:$7(5)$//&20321(176 321'/,1(5&20

´6DYLR)LOWHU:HLUV
7KHH[WUHPHO\SRSXODU´6DYLR)LOWHU:HLUŒFUHDWHVDEUHDWKWDNLQJ´FXUWDLQRIIDOOLQJZDWHUZKLOHRIIHULQJ
VXSSOHPHQWDOELRPHFKDQLFDOILOWUDWLRQWKDWVXSSRUWVWKHJURZWKRIEHQHILFLDOEDFWHULD:DWHUILOWHUVWKHQIDOOV8VHWZR´
XQLWVVLGHE\VLGHIRUODUJHUZDWHUIDOOVRUFUHDWHDZDWHUIDOOFDVFDGHE\LQVWDOOLQJWZRRUPRUHZHLUVLQDVWDLUVWHSSDWWHUQ

0DQXIDFWXUHGZLWKDVXSHUVWURQJLQMHFWLRQPROGHGKRXVLQJXQLWWKLVH[FHSWLRQDOZDWHUIDOOZHLUFUHDWHVDSURIHVVLRQDO
ZDWHUIDOOHIIRUWOHVVO\DQGLVHDV\WRUHWURILWWRH[LVWLQJSRQGV,QOHWFRQQHFWVWR´,'39&ILWWLQJ´)LOWHU:HLUŒLVUDWHG
IRUSXPSIORZVIURPJSK)LOWHU:HLULQFOXGHZLWKPHGLDDQGDILYH\HDUZDUUDQW\&RPELQHPXOWLSOHXQLWVIRU
ZLGHUIDOOV

 ,WHP :LHU 0D[)ORZ 2XWOHW 3ULFH


 ) ´ JSK ´6OLS,Q5HDU 

´6DYLR)LOWHU:HLUV
7KLVHDVLO\LQVWDOODEOHZHLUSURYLGHVWKHWUDQTXLOVRXQGVDQGYLVXDOVSOHQGRURIDFDVFDGLQJZDWHUIDOO±RQDODUJHVFDOH7KLVLV
WKHZD\IRUGRLW\RXUVHOIHUVDQGSRQGSURVDOLNHWRFUHDWHDQLPSUHVVLYHGUDPDWLFGLVSOD\RIIDOOLQJZDWHUZLWKSURIHVVLRQDO
UHVXOWV3OXVLW¶VHDV\WRUHWURILWWRH[LVWLQJSRQGVDQGSRQGIUHHV\VWHPVZLWKIORZUDWHVXSWRJDOORQVSHUKRXU
,QFOXGHVLQFKIDFHSODWHVSLOOZD\DQGDVWXUG\PHGLDJUDWHIRUVWRQHVRUSRWWHGSODQWV)LOWHU:HLULQFOXGHZLWKPHGLDWRS
JUDWHDQGDILYH\HDUZDUUDQW\&RPELQHPXOWLSOHXQLWVIRUZLGHUIDOOV
 ,WHP :LHU 0D[)ORZ 2XWOHW 3ULFH
 ) ´ JSK ´6OLS2Q%RWK6LGHV 

6DYLR)LOWHU:HLUV$FFHVVRULHV
 ,WHP 1DPH 3ULFH
 5) 5HSODFHPHQW)LOWHU0DWIRU6DYLR)LOWHU:HLU 
 5) 5HSODFHPHQW)LOWHU0DWIRU6DYLR)LOWHU:HLU 
 . 6WRQH.LWIRU6DYLR)LOWHU:HLU 

/LWWOH*LDQW:DWHUIDOO:HLU
&UHDWHGWRPLPLFDQDWXUDOZDWHUIDOO6WXUG\GHVLJQSURYLGHVWKHDELOLW\WRFUHDWHDQDWXUDOGLVJXLVHZLWKURFNRURWKHU
GHFRUDWLYHHOHPHQWV5XQWZRRUWKUHHRIWKHVHWRJHWKHUXVLQJRQHSXPSWRFUHDWHDWUXO\XQLTXHH[SHULHQFH

‡0XOWLSOHSOXPELQJSRUWVYHUVDWLOHLQVWDOODWLRQ ‡,QFOXGHVIOH[LEOHSLSHJURPPHWVHDVLHULQVWDOODWLRQ
‡%XLOGLQGULSHGJHGLUHFWVZDWHUIORZDQGKHOSSUHYHQW ‡´RU´6OLS&RQQHFWLRQ
EDFNIORZ ‡'LPHQVLRQV´[´[´
‡&LUFXODUULGJHGZDOOGHVLJQSURYLGHVH[WUDVWUHQJWKDQG ‡\HDUZDUUDQW\
LQJURXQGDQFKRULQJ

 ,WHP :HLU 0D[)ORZ 3ULFH


  ´ JSK 

&DO3XPS6SLOOZD\
&UHDWHDTXLFNDQGHDV\ZDWHUIDOOHIIHFWZLWK&DO3XPSV6SLOOZD\7KH\FDQEHLQVWDOOHGLQQHZV\VWHPVRUFDQHDVLO\
UHWURILWLQWRH[LVWLQJZDWHUIHDWXUHV2XU6SLOOZD\VDUHDYDLODEOHLQWKUHHGLIIHUHQWVL]HV´´DQG´$OORIWKH
6SLOOZD\VLQFOXGHILOWHUPHGLDWRFRQGLWLRQWKHZDWHUIRUDVPRRWKZDWHUIDOOHIIHFW7KH´VSLOOZD\KDVD´LQOHW
ZLWKILWWLQJDQGWKH´DQG´KDYHERWK´DQG´ILWWLQJVIRUHDV\LQVWDOODWLRQ

 ,WHP :LHU 0D[)ORZ 'LPHQVLRQV 3ULFH


 63: ´ JSK ´[´[´ 
 63: ´ JSK ´[´[´ 
 63: ´ JSK ´[´[´ 


 :$7(5)$//&20321(176

$WODQWLF:DWHU*DUGHQV3URIHVVLRQDO)DVW)DOOV
7KHVHLQFUHGLEO\VWURQJRQHSLHFHXQLWV
IHDWXUHDQLQWHUQDOEDIIOLQJV\VWHPVXSSRUW
FRQHVDQGUHHQIRUFHGVSLOOZD\7KH
LQQRYDWLYHµLQVLGHWKHOLQHU¶GHVLJQDQGUHDU
OLQHUDWWDFKPHQWVLPSOLILHVLQVWDOODWLRQ
7KHWRSRIWKH3UR)DVW)DOOVFDQEHFRYHUHG
ZLWKURFNJUDYHOVRLORUPXOFKWREOHQG 63 63 63
VHDPOHVVO\ZLWKWKHVXUURXQGLQJODQGVFDSH

 ,WHP 0D[3XPS)OR :LHU %XONKHDG 'LPHQVLRQV 3ULFH


 63 JSK ´ ´ ´[´[´ 
 63 JSK ´ ´ ´[´[´ 
 63 JSK ´ ´ ´[´[´ 

$WODQWLF:DWHU*DUGHQV)DVW)DOOV

63 63 63

(DVLO\DGGDZDWHUIDOORUVWUHDPWRDQHZRUH[LVWLQJZDWHUIHDWXUH6SLOOZD\VUDQJLQJIURP´WR´DOOFRPHLQUHWDLO
UHDG\ER[ZLWKEXONKHDGOLQHUDWWDFKPHQWIODQJHVSODVKUHGXFWLRQIRDPDQGWRSJUDWHIRUHDV\FDPRXIODJLQJ
63
 ,WHP 0D[3XPS)OR :LHU %XONKHDG 'LPHQVLRQV 3ULFH
 63 JSK ´ ´ ´[´[´ 
 63 JSK ´ ´ ´[´[´ 
 63 JSK ´ ´ ´[´[´ 
 63 JSK ´ 7ZR´%XONKHDGV ´[´[´ 

$WODQWLF:DWHU*DUGHQV&RORU)DOOV
7KHILUVWOLJKWHGZHLUVSHFLILFDOO\GHVLJQHGIRUZDWHUIHDWXUHV$SHUIHFWILWIRUIRUPDOUHWDLQLQJZDOOVDQGSRQGOHVV
DSSOLFDWLRQV&RORUIDOOVDGGVDEUHDWKWDNLQJQHZGLPHQVLRQWRDZDWHUIHDWXUHZDWHUIDOOVZLWKVKLPPHULQJGHWDLOVLQ
ZKLWHUHGRUEOXHKXHV ‡´/LS([WHQVLRQ ‡´)37,QOHW ‡¶&RUG

´&RORUIDOOV ´&RORUIDOOV ´&RORUIDOOV

 ,WHP 'HVFULSWLRQ 0D[)ORZ 9ROWV:DWWV 'LPHQVLRQV 3ULFH


 &)% ´&RORUIDOOV%OXH/(' JSK  ´[´[´ 
 &): ´&RORUIDOOV&U\VWDO:KLWH/(' JSK  ´[´[´ 
 &)6: ´&RORUIDOOV6ROLG:KLWH/(' JSK  ´[´[´ 
 &)5 ´&RORUIDOOV5HG/(' JSK  ´[´[´ 
 &)% ´&RORUIDOOV%OXH/(' JSK  ´[´[´ 
 &): ´&RORUIDOOV&U\VWDO:KLWH/(' JSK  ´[´[´ 
 &)6: ´&RORUIDOOV6ROLG:KLWH/(' JSK  ´[´[´ 
 &)5 ´&RORUIDOOV5HG/(' JSK  ´[´[´ 
 &)% ´&RORUIDOOV%OXH/(' JSK  ´[´[´ 
 &): ´&RORUIDOOV&U\VWDO:KLWH/(' JSK  ´[´[´ 
 &)6: ´&RORUIDOOV6ROLG:KLWH/(' JSK  ´[´[´ 
 &)5 ´&RORUIDOOV5HG/(' JSK  ´[´[´ 
 &)%586+ &RORUIDOOV&OHDQLQJ%UXVK ± ± ´/[´: 


:$7(5)$//&20321(176 321'/,1(5&20

$WODQWLF:DWHU*DUGHQV $WODQWLF:DWHU*DUGHQV
(FR%OR[ (FKR&KDPEHU
(FR%OR[ZDWHUPDWUL[DOORZVIRUJDOORQV 1RWRQO\DVDFROOHFWLRQEDVLQIRUSXPSLQJ
RIZDWHUVWRUDJHIRUSRQGIUHHDSSOLFDWLRQV EXWDOVRDPSOLI\QDWXUDOZDWHUVRXQGVWR
ERJILOWHUVDQGZDWHUKDUYHVWLQJ HQKDQFHWKHDXUDOEHDXW\RI\RXUZDWHU
IHDWXUH
‡+ROGV[PRUHZDWHUWKDQWUDGLWLRQDOJUDYHOEDVLQV ‡*UDWHLVFRQVWUXFWHGIURP5XJJHG39&
‡SDQHOFRQVWUXFWLRQIRUH[FHSWLRQDOVWUHQJWK ZLWKKHDY\GXW\VXSSRUWEDUV
‡ò´[ô´KROHVL]HFDQEHXVHGZLWKVPDOOHUJUDYHO ‡0D[SXPSIORZJSK
‡1HZVOLGHORFNFRQQHFWLRQV\VWHP
 ,WHP &DSDFLW\ 'LPHQVLRQV 3ULFH
 (&7 *DOORQV ´[´[´ 
 ,WHP &DSDFLW\ 'LPHQVLRQV 3ULFH
 (&2%/2; *DOORQV ´[´[´ 
$WODQWLF:DWHU*DUGHQV
)RXQWDLQ%DVLQV
$WODQWLF¶VLQQRYDWLYHGHVLJQLQFOXGHVDIODW
$WODQWLF:DWHU*DUGHQV VXSSRUWHGWRSGHFNZLWKUHFHVVHGSOXPELQJ
FKDQQHOVDQGSRFNHWIRUWKH1HZ7ULWRQ
&RORU)DOOV%DVLQV ZD\PDQLIROG:KHWKHULQVWDOOLQJD
$WODQWLF¶V&RORUIDOOV%DVLQVDUHSHUIHFWIRU EXEEOLQJXUQURFNFROXPQVRUDGLVDSSHDULQJ
KDUGVFDSHLQVWDOODWLRQVRUVPDOOSRQGIUHH IRXQWDLQWKHYHUVDWLOLW\RI$WODQWLF¶V
ZDWHUIDOOV7KHEDVLQVFRPHLQWZRGLIIHUHQW )RXQWDLQ%DVLQVPDNHVWKHPWKHULJKW
VL]HVDQGKDYHEXLOWLQSOXPELQJFKDQQHOV SURGXFWIRUHYHU\MRE
WRDFFRPPRGDWHZKDWHYHUWKHSURMHFW)RU
DEHDXWLIXOQDWXUDOORRNFRYHUWKHEDVLQPDW
 ,WHP &DSDFLW\ 'LPHQVLRQV 3ULFH
ZLWKJUDYHO  )% *DOORQV ´'LD[´+ 
 )% *DOORQV ´'LD[´+ 
‡3UHILOWHUHGSXPSFKDPEHU ‡%XLOWLQSOXPELQJFKDQQHOV
‡2QHSLHFHFRQVWUXFWLRQ ‡&DQEHLQVWDOOHGDERYHRUEHORZJURXQG
$WODQWLF:DWHU*DUGHQV
 ,WHP &DSDFLW\ 'LPHQVLRQV 3ULFH
 &)%$6,1 *DOORQV ´[´[´ 
)RXQWDLQ%DVLQ.LW
 &)%$6,1 *DOORQV ´[´[´  ,QFOXGHV´SXPSGLVFKDUJHILWWLQJV7ULWRQZD\
PDQLIROG¶RI´NLQNIUHHKRVHSLHFHVDQGSLSH
VHDODQWWKUHH´LQVHUW[´VRFNHWILWWLQJVDQGWZR
´FRUGVWRSSHUVIRUFRQGXLWVOHHYHV
$WODQWLF:DWHU*DUGHQV  ,WHP 1DPH 3ULFH
 )%.,7 )RXQWDLQ%DVLQ.LW 
&RORUIDOOV%DVLQ$FFHVVRULHV
 ,WHP 1DPH 3ULFH $WODQWLF:DWHU*DUGHQV
 &)0$ 5HSODFHPHQW0DWDOD3DG  7ULWRQ:D\'LYHUWHU
 &)630$ ´$QWL6SODVK0DW 
 &)630$ ´$QWL6SODVK0DW  7ULWRQZD\GLYHUWHULVWKHRQO\PDQLIROGGHVLJQHG
H[FOXVLYHO\IRUSRQGIUHHIRXQWDLQLQVWDOODWLRQV7UXHµEDOO¶
VW\OHYDOYHVZLWKUHPRYDEOHKDQGOHVHQDEOHVPDOOIORZ
DGMXVWPHQWVWREHPDGHWRHDFKRXWOHWLQGHSHQGHQWO\
/LWWOH*LDQW'LVDSSHDULQJ  ,WHP ,QOHW 2XWOHW 'LPHQVLRQV 3ULFH
:DWHU)HDWXUH%DVLQV  75:$< ´),37 ´,QVHUW ´[´[´ 

‡5XJJHGGHVLJQ+ROGVXSLQDGYHUVH
ZHDWKHUFRQGLWLRQV /DJXQD'LVDSSHDULQJ
‡(DV\LQVWDOODWLRQDQGPDLQWHQDQFH1R :DWHU)HDWXUH%DVLQ
JUDWHVWRFXW
‡+ROGVDZLGHYDULHW\RIIRXQWDLQWRSVHJ 7KHLGHDOLQJURXQGZDWHUFROOHFWLRQUHVHUYRLU
VWRQHFRQFUHWHSRWWHU\EURQ]HDQGPRUH IRUIRXQWDLQVRUQDPHQWVDQGVPDOOSUHIRUPHG
‡')%KROGVOEVDQGWKH')% ZDWHUIDOOV\VWHPV
KROGVOEV ‡6ROLGKHDY\GXW\FRQVWUXFWLRQVXSSRUWV
‡\HDUZDUUDQW\ RUQDPHQWDOIRXQWDLQV
,WHP 'HVFULSWLRQ 'LPHQVLRQV &DSDFLW\ 3ULFH ‡5HPRYDEOHOLGDQGDFFHVVSRLQWVPDNH
  ')%5RXQG ´'LD[´+ *DOORQV  LQVWDOODWLRQDQGPDLQWHQDQFHHDV\
  ')%6TXDUH ´:[´/[´+ *DOORQV   ,WHP &DSDFLW\ 'LPHQVLRQV 3ULFH
 37 *DOORQV ô´/[ò´:[ô´+ 


 ),/7(56

6DYLR/LYLQJSRQGV:DWHUIDOO)LOWHU
,QVWDQWO\FUHDWHVDVWXQQLQJ´ZDWHUIDOO,WUXQVDWSHDNHIILFLHQF\HYHQZKHQWKHILOWHUPHGLDLVGLUW\2WKHUILOWHUV
UHTXLUHFRQVWDQWXSNHHSWRSHUIRUP7KLVILOWHUSURYLGHVFRPSOHWHILOWUDWLRQIRUSRQGVXSWRJDOORQVZLWKOHVV
PDLQWHQDQFH$GYDQFHGELRORJLFDOILOWUDWLRQXVLQJURXQGVKDSHGERWWRPWRUHPRYHKHDY\GHEULVEHIRUHLWUHDFKHVWKH
ILOWHUPHGLD8WLOL]HVFORJUHVLVWDQW6SULQJIORPHGLDWKDWSHUIRUPVHYHQZKHQGLUW\
‡&RQQHFWILOWHUVWRJHWKHUIRUPRUHILOWUDWLRQ
‡&RPHVZLWKRQH6SULQJIORPHGLD
‡´)37,QOHW 'UDLQ2XWOHW
‡\HDUZDUUDQW\

 ,WHP :HLU 0D[)ORZ 'LPHQVLRQV 3ULFH


 ) ´ JSK ´:[´/[´+ 

6SULQJÀR
)LOWHU0HGLD 6WRQH&RYHU
 ,WHP 3ULFH
 6)   ,WHP 3ULFH
 . 

5HSODFHPHQW )LOWHU%RWWRP
0DW 'UDLQ.LW
 ,WHP 3ULFH  ,WHP 3ULFH
 5)   . 

6DYLR/LYLQJSRQGV9HUVDWLOH)LOWHU
6KDUHVDOOWKHIHDWXUHVRI6DYLR/LYLQJSRQGV:DWHUIDOO)LOWHUVEXWLQVWHDGRID´ZHLUWKH\KDYHD´GLVFKDUJH
8QOLNHILOWHUVWKDWKDYHWREHSODFHGDWWKHWRSRIWKHZDWHUIDOOWKH9HUVDWLOH)LOWHUFDQEHORFDWHGHLWKHUDWWKHWRSRI
WKHZDWHUIDOORUXSWR¶DZD\7KHILOWHULVHDVLO\KLGGHQEHKLQGIHQFHVVKUXEVRUVXUURXQGLQJODQGVFDSH7KLVILOWHU
SURYLGHGFRPSOHWHILOWUDWLRQIRUSRQGVXSWRJDOORQVZLWKOHVVPDLQWHQDQFH

$GYDQFHGELRORJLFDOILOWUDWLRQXVLQJURXQGVKDSHGERWWRPWRUHPRYHKHDY\GHEULVEHIRUHLWUHDFKHVWKHILOWHUPHGLD
8WLOL]HVFORJUHVLVWDQW6SULQJIORPHGLDWKDWSHUIRUPVHYHQZKHQGLUW\

‡&RQQHFWILOWHUVWRJHWKHUIRUPRUHILOWUDWLRQ ‡´)37,QOHW 'UDLQ2XWOHW


‡&RPHVZLWKRQH6SULQJIORPHGLD ‡\HDUZDUUDQW\

 ,WHP 2XWOHW 0D[)ORZ 'LPHQVLRQV 3ULFH


 ) ´ JSK ´:[´/[´+ 

6DYLR/LYLQJSRQGV:DWHUIDOO)LOWHU)
7KHVPDOOILOWHUWRFRPSOHPHQWD6NLPPHUILOWHUIRUSRQGVXSWR
)$FFHVVRULHV JDOORQV.HHSV\RXUZDWHUFOHDUZKLOHFUHDWLQJD´ZDWHUIDOO,QFOXGHV
WZRILOWHUSDGVDQGFHUDPLFPHGLD,QFOXGHV´UHGXFHUEXVKLQJ´
LQVHUWDGDSWHU´SOXJDQGD\HDUZDUUDQW\
 ,WHP 1DPH 3ULFH
 5) 5HSODFHPHQW0HGLD3DG  ‡)RUIORZUDWHVXSWR*3+ ‡0HGLD3DGVVXSSRUWWKH
‡%LR0HGLDVTIWRIPLFURELDO JURZWKRIEHQHILFLDOEDFWHULD
 5) 5HSODFHPHQW&HUDPLF0HGLD 
VXUIDFHDUHD ‡0HFKDQLFDOVHDOQRJOXH
 . 6WRQH.LW  ‡6XSHUVWURQJLQMHFWLRQPROGLQJ UHTXLUHGWRDWWDFKOLQHU
‡´VOLSLQOHWV

 ,WHP 0D[)ORZ :HLU 0D[3RQG6L]H 'LPHQVLRQV 3ULFH


 ) JSK ´ JSK ´:[´/[´ 


),/7(56 321'/,1(5&20

$WODQWLF:DWHU*DUGHQV)LOWHUIDOOV

%) %) %)

‡([WUDZLGHVSLOOZD\HQKDQFHVWKHZDWHUIDOO DHUDWHV ‡'HVLJQHGWREHFDPRXIODJHGZLWKQDWXUDOPDWHULDOV


WKHZDWHU DQGSODQWV
‡2SHQVZLUOFKDPEHUOHWVZDWHUIORZHYHQO\  ‡([WUDODUJHFRQWDLQHUKROGVPRUHEDFWHULDIRUD
HIILFLHQWO\WKURXJKILOWHUPHGLD FOHDQHUSRQG
‡7KUHHVHSDUDWHILOWHULQJDFWLRQVIRUFOHDQZDWHU ‡,QFOXGHVWRSDQGERWWRPJUDWH
‡,QFOXGHVILOWHUPHGLD ‡/LIHWLPH:DUUDQW\
‡%ODFNSRO\HWK\OHQHFRQWDLQHULVZDUUDQWHGIRUOLIH ‡7RS*UDWHIRU%)LVQRWDYDLODEOH

 ,WHP :HLU %XONKHDG 0D[)ORZ 'LPHQVLRQV 3ULFH


 %) ´ ´)37 JSK ´:[´/[´+ 
 %) ´ ´)37 JSK ´:[´/[´+ 
 %) ´ ´)37 JSK ´:[´/[´+ 

$WODQWLF:DWHU*DUGHQV%LJ%DKDPD)LOWHUIDOOV

%) %)
%)

‡7KHLQFOXGHGKHDY\GXW\UHPRYDEOHWRSJUDWHDOORZVQDWXUDO ‡5ROOHGXSSHUULPSURYLGHVFOHDQOLQHVDQGLQFUHGLEOH
URFNFDPRXIODJH VWUHQJWK
‡6XSSRUWEDUVDGGVWDELOLW\DQGUHLQIRUFHWRSJUDWH ‡%RWWRPFKDPEHUZLOODFFHSWEXONKHDGRQDOOVLGHVZKLOH
%) ‡0HGLDEDJDQG%LR7HFKPHGLDSURYLGHPD[VXUIDFHDUHDIRU ERWWRPFRQHVUHGXFHVXUIDFHDUHDIRUPRUHHIILFLHQWEDFN
GHYHORSPHQWRIEHQHILFLDOEDFWHULD PHGLDVROGVHSDUDWHO\  IOXVKLQJ
‡'XDO%LR7HFKILOWHUPDWVIRUH[FHSWLRQDOELRORJLFDOILOWUDWLRQ ‡2QHSLHFHOLQHUIODQJHDOORZVHDV\OHDNIUHHDWWDFKPHQWVRI
‡6WXUG\ERWWRPJUDWHVXSSRUWVILOWHUPHGLD )LOWHU)DOOVWRSRQGOLQHU
‡´RU´KHDY\GXW\)37EXONKHDGIRUKLJKIORZUDWHV ‡/LIHWLPH:DUUDQW\
 ,WHP :HLU %XONKHDG 0D[)ORZ 'LPHQVLRQV 3ULFH
 %) ´ ´)37 JSK ´:[´'[´+ 
 %) ´ ´)37 JSK ´:[´'[´+ 
 %) ´ ´)37 JSK ´:[´'[´+ 
 %) ´ ´)37 JSK ´:[´'[´+ 

)LOWHU)DOOV$FFHVVRULHV
 ,WHP 1DPH 3ULFH  ,WHP 1DPH 3ULFH  ,WHP 1DPH 3ULFH
 %* %ODFN0HGLD%DJ´[´   7* 7RS*UDWHIRU%)   07 )LOWHU0DWIRU%) 
 %% 0HGLXP0HGLD%DJZ)LOWHU0HGLD   7* 7RS*UDWHIRU%)   07 )LOWHU0DWIRU%) 
 *7 %RWWRP*UDWHIRU%)   7* 7RS*UDWHIRU%)   07 )LOWHU0DWIRU%) 
 *7 %RWWRP*UDWHIRU%)   7* 7RS*UDWHIRU%)   07 )LOWHU0DWIRU%) 
 *7 %RWWRP*UDWHIRU%)   7* 7RS*UDWHIRU%)   0$ 6WDJH0DWDOD)LOWHUIRU%) 
 *7 %RWWRP*UDWHIRU%)   7* 7RS*UDWHIRU%)   0$ 6WDJH0DWDOD)LOWHUIRU%) 
 *7 %RWWRP*UDWHIRU%)   07 )LOWHU0DWIRU%)   0$ 6WDJH0DWDOD)LOWHUIRU%) 
 *7 %RWWRP*UDWHIRU%)   07 )LOWHU0DWIRU%)   %). %DFNÀXVK 'UDLQ.LW 
 *7 %RWWRP*UDWHIRU%)   07 )LOWHU0DWIRU%) 


 ),/7(56
/LG6ROG6HSDUDWHO\
/LWWOH*LDQW:DWHUIDOO)LOWHUV
%LR9RUWWHFKQRORJ\LVGHVLJQHGWRHYHQO\GLVSHUVHGHEULVDQGVHWWOHVROLGELRORDGVIRUOHVVPDLQWHQDQFHDQGVXSHULRU
ILOWUDWLRQ$OOSOXPELQJLVKLGGHQDQGSODQWEDVNHWVFDQEHSODFHGRQWRSWRFUHDWHERWKDQDWXUDOGLVJXLVHDQGDGGLWLRQDO
ILOWUDWLRQ\HDUZDUUDQW\
2SWLRQDOOLGFDQEHSXUFKDVHGVHSDUDWHO\
%LRORJLFDOPHGLDDQGPHVKEDJLQFOXGHG

 0DWDODILOWHUSDGVODVWORQJHUDQGFUHDWHLGHDOEDFWHULDFRXQWV
9RUWH[DFWLRQKHOSVVHWWOHRXWGHEULVDQGGLVWULEXWHZDWHUHYHQO\RYHU
ILOWHUSDGV
'ULSHGJHSUHYHQWVZDWHUIURPIORZLQJEHKLQGOLQHUDQGZDWHUIDOOXQLW
 &LUFXODUULGJHGGHVLJQIRUPD[LPXPVWUHQJWK
6WURQJOLJKWZHLJKWDUWLILFLDOURFNOHGJHHQKDQFHVIORZDQGDSSHDUDQFH
RIFDVFDGLQJZDWHU
3OXPEIURPHLWKHUVLGH)OH[LEOHSLSHJURPPHWHOLPLQDWHVEXONKHDG
ILWWLQJV
 %DFNIOXVKRSWLRQVLPSOLILHVPDLQWHQDQFH
5XVWUHVLVWDQWVWDLQOHVVVWHHOOLQHUDWWDFKPHQWULQJUHTXLUHVQRVFUHZLQJ
RUVLOLFRQH
3XPSV3HRSOH3DUWQHUVKLSV

  ,WHP 1DPH :HLU 0D[)ORZ ,QOHW 'LPHQVLRQV 3ULFH


  :) ´ JSK ´ ´+[´' 
  :) ´ JSK ´ ´+[´' 

 
/LWWOH*LDQW)LOWHU$FFHVVRULHV
 ,WHP 1DPH 3ULFH
   %).0%DFNÀXVK.LW 
  )/LG 
    )/LG 
  0DWDOD) 
  0DWDOD) 

  0HGLD%DJ 
  %LRPHGLDFW 
%).0%DFNIOXVK.LWLQFOXGHVRQH´39&JDWHYDOYHRQH´IOH[LEOHSLSHJURPPHWDQGRQH´
OHQJWKRI39&SLSH

3UR(FR%LR)ORZ%LRORJLFDO)LOWHUV
7KH3UR(FR%LR)ORZ%LRORJLFDO)LOWHUVDUHJUDYLW\IORZSRQGILOWHUVWKDW
HIIHFWLYHO\FOHDQWKHSRQGZLWKORZHUSXPSIORZUHTXLUHPHQWV

:DWHULVDHUDWHGZKHQILUVWSXPSHGLQWRWKHILOWHU7KHILOWHUPDWHULDOWUDSV
GLUWDQGVXVSHQGHGSDUWLFOHVLQWKHSRQGZDWHUDQGKRXVHVEHQHILFLDOEDFWHULD
FRORQLHVWKDWEUHDNGRZQDQGUHPRYHDPPRQLDDQGQLWULWHV$QRSWLRQDO
XOWUDYLROHWFODULILHUDLGVLQIORFFXODWLQJVXVSHQGHGDOJDHSDUWLFOHVVRWKDWWKHILOWHU
FDQUHPRYHWKHPIURPWKHSRQG

‡ 0HFKDQLFDO%LRORJLFDOPXOWLFKDPEHUJUDYLW\IORZILOWHU
‡ 'HVLJQHGWREHXVHGRXWVLGHSRQGIRUHDV\PDLQWHQDQFH
‡\HDUZDUUDQW\ 89&ODULILHU1RW,QFOXGHG
89&ODULILHU1RW,QFOXGHG

 ,WHP 0D[)ORZ 89 3RQGZR)LVK 3RQGZ¿VK ,QOHW 2XWOHW 'LPHQVLRQV 3ULFH


 (%) JSK : JDOORQV JDOORQV ´´ ´ ´[´[´ 
 (%) JSK : JDOORQV JDOORQV ´´ ´ ´[´[´ 


),/7(56 321'/,1(5&20

/DJXQD3RZHU)OR)LOWHU)DOOV
/DJXQD3RZHU)OR)LOWHU)DOOVLVDKLJKSHUIRUPDQFHZDWHUIDOOILOWHUWKDWSURYLGHVWKHXOWLPDWHZDWHUPDQDJHPHQW
VROXWLRQIRUODUJHSRQGVXSWRJDOORQV

7KHILOWHULVGHVLJQHGWRPDNH\RXUZDWHUJDUGHQLQJH[SHULHQFHVLPSOHDQGHQMR\DEOH7DQJLEOHEHQHILWVLQFOXGH
FOHDUDQGKHDOWK\SRQGZDWHUORZPDLQWHQDQFHDQGDSOHDVDQWZDWHUJDUGHQHQYLURQPHQW

7KHXQLWIHDWXUHVWKUHHODUJHFDSDFLW\ILOWHUFKDPEHUVWKDWFDQDFFRPPRGDWHVSHFLDOILOWHUSDGVDVZHOODV
ELRORJLFDODQGFKHPLFDOPHGLD$OOFKDPEHUVLQFOXGHDKDQGOHIRUHDV\UHPRYDODQGFOHDQLQJ$VZDWHUIORZV
WKURXJKWKHPHGLDFKDPEHUVLWLVWKRURXJKO\FOHDQVHGDQGILOWHUHG7KHUHVXOWLVFOHDQDQGKHDOWK\SRQGZDWHU
IRUILVKDQGSODQWVWRWKULYHLQ

$VZDWHUIORZVWKURXJKWKHFKDPEHUVLWLVFRPSOHWHO\ILOWHUHG&OHDQDQGKHDOWK\ZDWHUWKHQUHWXUQVWRWKHSRQG
YLDD´ZLGHVSLOOZD\FUHDWLQJDVWXQQLQJZDWHUIDOO7KHEXONKHDGVFDQEHXVHGLQSODFHRIWKHVSLOOZD\IRU
LQLWLDWLQJLQGLYLGXDOVWUHDPVZKLFKIHHGLQWRWKHSRQG

2WKHUIHDWXUHVLQFOXGHDZDWHUR[\JHQDWLQJVSUD\EDUDYHQWXULYDOYHIRUPL[LQJDLUDQGZDWHUDZLQWHUL]LQJDQG
ZDWHUGUDLQDQGKHDY\GXW\FRQVWUXFWLRQZLWKUHLQIRUFHGOLG

7KUHHILOWHUEUXVKHVRQHPHFKDQLFDOILOWHUSDG/DJXQD%LRVSKHUHVELRORJLFDOILOWHUPHGLD´KRVHFRQQHFWRU
´KRVHFODPSDQGWHIORQWDSHDUHDOVRLQFOXGHG

7KHILOWHUFDQEHFRQQHFWHGWR/DJXQD¶V3RZHU)OR6NLPPHU)LOWHUIRUH[WUDILOWHULQJFDSDFLW\IRUSRQGVXS
WRJDO
‡ODUJHPHGLDFKDPEHUV ‡9HQWXULYDOYHIRUPL[LQJDLUDQGZDWHU
‡+DQGOHVRQDOOFKDPEHUVIRUHDV\UHPRYDODQGFOHDQLQJ ‡$ZLQWHUL]LQJDQGZDWHUGUDLQ
‡$ZLGHLQFKVSLOOZD\FUHDWHVDFDSWLYDWLQJZDWHUIDOO ‡+HDY\GXW\FRQVWUXFWLRQZLWKUHLQIRUFHGOLG
‡7KUHDGHGEXONKHDGVRQWKHVSLOOZD\DOORZVZDWHUWREH ‡)RUODUJHSRQGVXSWR86JDOORQV
GLYHUWHGWRVPDOOZDWHUIDOOVVWUHDPVRURWKHUILOWHUV ‡5HSODFHPHQWSDUWVDYDLODEOH
‡:DWHUR[\JHQDWLQJVSUD\EDU ‡<HDU:DUUDQW\

 ,WHP :HLU 0D[)ORZ 'LPHQVLRQV 3ULFH


 37 ´ JSK ´:[´/[´+ 

/DJXQD3RZHU)OR)LOWHU)DOOVDQG6NLPPHU$FFHVVRULHV
 ,WHP 1DPH 'LPHQVLRQV 3ULFH
 37 &RDUVH0HFKDQLFDO%LRORJLFDO)LOWHU3DG ´[´[´[´ 
 37 0HGLXP0HFKDQLFDO%LRORJLFDO)LOWHU3DG ´[´[´[´ 
 37 )LQH0HFKDQLFDO%LRORJLFDO)LOWHU3DG ´[´[´[´ 

/DJXQD3RZHU)OR%LRORJLFDO)LOWHU
/DJXQD3RZHU)OR([WHUQDO%LRORJLFDO)LOWHULVLGHDOIRUODUJHUSRQGVXSWRJDOORQV7KHILOWHUIHDWXUHVDQ
HIILFLHQWWLHUHGILOWHULQJV\VWHPWKDWSURYLGHVFRPSOHWHPHFKDQLFDODQGELRORJLFDOILOWUDWLRQ7KHWRSWUD\KRXVHV
SXPLFHILOWHUPDWHULDO LQFOXGHG ZKLFKSURYLGHVPHFKDQLFDODQGELRORJLFDOILOWUDWLRQ%HORZWKHWRSWUD\DIRDP
SDG DOVRLQFOXGHG SHUIRUPVPHFKDQLFDOILOWUDWLRQ7KHERWWRPWUD\LVGHVLJQHGWRKROGWKHELRORJLFDOPHGLDRI\RXU
FKRLFHVXFKDV/DJXQD%LR0D[ QRWLQFOXGHG 7KHWUD\VKDYHFRQYHQLHQWKDQGOHVZKLFKDOORZ\RXWRUHPRYHWKHP
HDVLO\2WKHUIHDWXUHVLQFOXGHDEXLOWLQGUDLQSOXJDQGWZRRXWOHWVIRUFUHDWLQJZDWHUIDOOVRUFRQQHFWLQJWRRWKHUSRQG
HTXLSPHQWVXFKDVD896WHULOL]HU7KHILOWHULVGHVLJQHGWREHLQVWDOOHGRXWVLGHWKHSRQGZKLFKDOORZVHDV\DFFHVVIRU
PDLQWHQDQFH$8QLYHUVDO&OLFN)LWFRXSOLQJIRU´´DQG´LQOHWWXELQJLVDOVRLQFOXGHG5HSODFHPHQWSDUWV
DYDLODEOHXSRQUHTXHVW
,QFOXGHV
‡3XPLFHILOWHUPDWHULDODQGDIRDPSDGERWK $FFHVVRULHV
SURYLGLQJPHFKDQLFDODQGELRORJLFDOILOWUDWLRQ
‡8QLYHUVDO&OLFN)LWFRXSOLQJIRU´´DQGó´  ,WHP 1DPH 3ULFH
LQOHWKRVLQJ  37 5HSODFHPHQW)RDP3DG 
‡\HDUZDUUDQW\

 ,WHP 0D[)ORZ 'LPHQVLRQV 3ULFH


 37 JSK ´:[´/[´+ 


866-766-3548 FILTERS

Laguna Powerfalls Filter Spillway


The Laguna PowerFalls Filter Spillway is a simple, easy-to-use filter that can be used as a beginning to a waterfall.
It provides the ultimate water management solution for small to medium sized ponds (up to 1000 Gal.) and comes
complete with mechanical and biological filter media. With its solid, professional grade construction, the PowerFalls
Filter Spillway produces a 14 ½” wide waterfall. Includes a 1 year warranty.
• For ponds up to 1000 gal. Includes:
• Solid, professional grade fiberglass construction. • 1½” threaded bulkhead fitting.
• Produces 14½” wide waterfall. • Filter foam and biomedia, both providing
• Can be installed in or above ground. mechanical and biological filtration.
• Faceplate allows for easy liner attachment. • Faceplate.
• Replacement parts available. • 6 stainless steel screws.
Item # Weir Max Flow Dimensions Price
PT490 14 1/2” 500 gph 15” W x 22” L x 16.25” H $129.00

Laguna Powerfalls Filter Spillway Accessory


Item # Name Dimensions Price
PT494 Coarse Mechanical/Biological Filter Pad 17” x 14” x 14.5” x 1 3/16” $14.99
PT492 Biological Bio-Max Filter Media - $15.99

EasyPro AquaFalls
AquaFalls Accessories
Item # Name Price
ATM Mini Replacement Pad $12.99
ASM Small Replacement Pad $15.99
Mini Small
AMM Med Replacement Pad $26.99 Medium
ALM Large Replacement Pad $49.00 EasyPro AquaFalls biological filters not only help keep your
ASGR Small Rock Grate $35.00 pond sparkling clean they also serve as a great start to your
stream or waterfall. Designed for use with the EasyPro pond
AMGR Medium Rock Grate $95.00
skimmers for a truly professional looking pond. Includes a 5
ALGR Large Rock Grate $139.00 year warranty. Large w/rock grate

Item # Size Weir Fittings Max Flow Pond Size Dimensions Price
AT Mini 14” 1 1/2” FPT Inlet 1,200 gph 1,200 gal 18” x 24” x 18” $215.00
AS Small 18” 2 - 2” Bulkheads 4,200 gph 2,500 gal 26” x 26” x 26” $349.00
AM Medium 26” 2 - 2” Bulkheads 7,200 gph 6,000 gal 35” x 36” x 28” $439.00
AL Large 50” 2 - 3” Bulkheads 15,000 gph 15,000 gal 36” x 65” x 36” $779.00

ProEco Pressurized Pond Filters


ProEco Pressurized Pond Filters provide incredible mechanical and biological filtration
at a great price. The filter incorporates both fine and coarse filter foam media for
optimal beneficial bacteria growth. The filter is easily cleaned by switching the control
valve to backwash and slowly pulling the cleaning handle to compress the filter pads.
Simply switch the control valve back to normal pond filtering when the filter is clean.
• Pressure filters provide highly effective mechanical and biological filtration.
• Built-in UV Clarifier in the lid to keep the pond water crystal clear.
• Designed to operate in combination with magnetic drive circulating pumps.
• May be installed in ground to base of lid.
• Convenient cleaning mechanism enables the owner to maintain the filter by
using a manual flushing control at the top of the unit.
• 3 year warranty on filter & 1 year warranty on the UV lamp.
• 20’ Cord.
Item # Max Flow UV Pond w/o Fish Pond w/fish Outlet/Inlet Dimensions Price
CPF-180 2400 13 W 1600 gallons 800 gallons 3/4”,1”,1.25”,1.5” 14.97” Dia. x 15.75” H $209.00
CPF-250 3200 13 W 2000 gallons 1000 gallons 3/4”,1”,1.25”,1.5” 14.97” Dia. x 19.75” H $249.00

19
),/7(56 321'/,1(5&20

/DJXQD3UHVVXUH)OR3UHVVXUL]HG3RQG)LOWHUV
+LJK3HUIRUPDQFHSUHVVXUL]HGSRQGILOWHUVZLWKLQWHJUDWHG89VWHULOL]HU
FODULILHU/DJXQD3UHVVXUH)OR)LOWHUVDUHKLJKSHUIRUPDQFHZDWHUILOWHULQJ
V\VWHPVWKDWNHHSSRQGZDWHUFOHDQDQGKHDOWK\7KHVHDOOLQRQHILOWHUV
SURYLGHPHFKDQLFDOELRORJLFDO DQG89VWHULOL]DWLRQDQGDUHGHVLJQHGWR
37 ZRUNLQWDQGHPZLWKDVROLGVKDQGOLQJSXPSVVXFKDV/DJXQD¶V0D[)OR
7KH\DOVRIHDWXUHDUHYROXWLRQDU\%DFNZDVK&OHDQLQJ6\VWHPWKDWHDVLO\
FOHDQVWKHHQWLUHVXUIDFHRIWKHIRDPILOWHUVZLWKRXWRSHQLQJWKHILOWHU7KLV
SDWHQWSHQGLQJV\VWHPLVRQHRIDNLQG%DFNZDVKFOHDQLQJFDQEHGRQH
HDVLO\DQGFRPIRUWDEO\LQDIHZPLQXWHVZLWKRXWRSHQLQJWKHOLG$QHDV\
37 YLHZFOHDQLQJLQGLFDWRUVLJQDOVZKHQLW¶VWLPHWRSHUIRUPEDFNZDVKFOHDQLQJ
37
7KHXQLWVFDQEHLQVWDOOHGLQRUDERYHJURXQG
1XPEHURI5HSODFHPHQW3DGV5HTXLUHG
5HSODFHPHQWSDUWVDYDLODEOHXSRQUHTXHVW
‡37SDGV
‡37 37SDGV ‡¶&RUG ‡´&RQQHFWRU,QOHW ‡<HDU:DUUDWQ\
‡37SDGV
 ,WHP 1DPH 89 0D[)ORZZR)LVK 0D[)ORZZ¿VK 5HF3XPS 'LPHQVLRQV 3ULFH
 37 3UHVVXUH)OR : JSK JSK 0D[)OR ´'LD[´+ 
 37 3UHVVXUH)OR : JSK JSK 0D[)OR ´'LD[´+ 
 37 3UHVVXUH)OR : JSK JSK 0D[)OR ´'LD[´+ 
 37 3UHVVXUH)OR : JSK JSK 0D[)OR ´'LD[´+ 

/DJXQD3UHVVXUH)OR3UHVVXUL]HG)LOWHU$FFHVVRULHV
,WHP 1DPH )LOWHU 3ULFH ,WHP 1DPH )LOWHU 3ULFH ,WHP 1DPH )LOWHU 3ULFH
37 :89%XOE   37 5HSODFHPHQW)LOWHU)RDP   37 3UHVVXUH)OR6HUYLFH.LW   
37 :89%XOE   37 5HSODFHPHQW)LOWHU)RDP   373UHVVXUH)OR6HUYLFH.LW   
37 :89%XOE   37 5HSODFHPHQW)LOWHU)RDP   373UHVVXUH)OR6HUYLFH.LW   
37 5HSODFHPHQW)LOWHU)RDP   37 %LRVSKHUH)LOWHU0HGLD   373UHVVXUH)OR6HUYLFH.LW   
3UHVVXUH)ORGRHVQRWKDYHDELRORJLFDOILOWUDWLRQFKDPEHU 3UHVVXUH)OR6HUYLFH.LWLQFOXGHV)RDPV89EXOERULQJV
FOHDQLQJEUXVKHVDQGVLOLFRQHOXEULFDQW

3RQGPDVWHU6XEPHUVLEOH)LOWHUV
30
&UHDWHDKHDOWK\SRQGEDODQFHZLWKPLQLPXPERWKHUXVLQJ3RQGPDVWHU
VXEPHUVLEOHILOWHUV)RUODUJHUSRQGVPXOWLSOHXQLWVFDQEHFRPELQHG
ZLWK7ILWWLQJVDQGH[WUDWXELQJ

‡&RQQHFWWRLQWDNHVLGHRISXPS ‡)RULQSRQGXVH
‡0XOWLSOHXQLWVFDQEHFRQQHFWHG ‡5HFRPPHQGHGIRUVPDOO
WRRQHSXPS SRQGVRQO\
30 ‡7XELQJDQGILWWLQJVLQFOXGHG ‡\HDUZDUUDQW\

,WHP 1DPH &RPSDWLEOH3XPSV 3RQG6L]H 2XWOHW )LOWHU0HGLD 'LPHQVLRQV 3ULFH


  30 3RQG0DJ 6PDOOWR0HGLXP ´,' &DUERQ &RDUVH3RO\HVWHU ´[´ 
  30 3RQG0DJ 0HGLXPWR/DUJH ´,' &RDUVH3RO\HVWHU )RDP ´[´ 

3RQGPDVWHU6XEPHUVLEOH)LOWHU$FFHVVRULHV
 ,WHP 1DPH 3ULFH  ,WHP 1DPH 3ULFH
  3RO\3DG5HSODFHPHQW SN     &RXUVH5HSODFHPHQW3DG VLQJOHSN  
  &DUERQ &RDUVH5HSODFHPHQW3DGV    )RDP5HSODFHPHQW3DG 
  &DUERQ5HSODFHPHQW3DG VLQJOHSN     %LRIRDP5HSODFHPHQW%ORFNVIRU30 

6HH3RQGPDVWHU3XPS)LOWHU&RPERVRQSDJH


 ),/7(56

/DJXQD3RZHU)OR0HFKDQLFDO8QGHUZDWHU)LOWHU
7KH/DJXQD3RZHU)OR8QGHUZDWHU)LOWHUSURYLGHVWKRURXJKPHFKDQLFDOILOWUDWLRQ±ILOWHULQJRXWGLUWDQGIORDWLQJ
GHEULV±WRLPSURYHZDWHUTXDOLW\DQGFODULW\ZKLOHSURWHFWLQJWKHSXPSIURPFORJJLQJWKHUHE\UHGXFLQJ
PDLQWHQDQFH,WFDQEHSRVLWLRQHGQHDUWKHSRQG¶VHGJHIRUTXLFNDFFHVVDQGHDV\PDLQWHQDQFH
‡6XLWDEOHIRUSRQGVXSWRJDOORQV ,QFOXGHV
‡&RPSOHWHPHFKDQLFDOILOWUDWLRQ ‡8QLYHUVDO&OLFN)LWFRXSOLQJZKLFKDOORZV
‡,QWHJUDWHVHDVLO\ZLWKH[LVWLQJSXPSV FRQQHFWLRQVWRRULQFKKRVLQJ
‡(DVLO\H[SDQGLEOH ‡7ZRIRDPILOWHUSDGV
‡5HSODFHPHQWSDUWVDYDLODEOHXSRQUHTXHVW ‡\HDUZDUUDQW\

 ,WHP 1DPH 2XWOHW 0D[)ORZ 3ULFH


 37 3RZHU)OR0HFKDQLFDO)LOWHU 8QLYHUVDO&OLFN)LW&RXSOLQJ JSK 
 37 5HSODFHPHQW)RDP0HGLD ± ± 

/DJXQD3RZHU)OR0D[%LRORJLFDO8QGHUZDWHU)LOWHU
7KH/DJXQD3RZHU)OR0D[%LRORJLFDO8QGHUZDWHU)LOWHULVLGHDOIRUXVHLQSRQGVWKDWFRQWDLQILVK7KHILOWHUSURYLGHV
WKHVDPHSRZHUIXOPHFKDQLFDOILOWUDWLRQDVWKH3RZHU)ORSOXVLWIHDWXUHVELRORJLFDOILOWUDWLRQZLWK/DJXQD¶VSDWHQWHG
%LR0D[ILOWHUPDWHULDO7KHHIILFLHQWFHUDPLFPHGLDSURYLGHVDKXJHVXUIDFHDUHDIRUEHQHILFLDOEDFWHULDWRWKULYH
7KLVPHGLDZLOOVXSSRUWWKHGHFRPSRVLWLRQRIDPPRQLDDQGQLWULWHWROHVVKDUPIXOQLWUDWHWKDWFDQEHFRQWUROOHGE\
DTXDWLFSODQWVDQGZDWHUFKDQJHV7KHHQGUHVXOWLVWKDWWKHILOWHUSURWHFWVWKHSXPSIURPFORJJLQJDQGNHHSVZDWHU
FOHDQDQGFOHDU7KHILOWHUFDQEHLQVWDOOHGQHDUWKHHGJHRIWKHSRQGIRUTXLFNDQGHDV\DFFHVVDQGPDLQWHQDQFH
‡6XLWDEOHIRUSRQGVXSWRJDOORQV ,QFOXGHV
‡&RPSOHWHELRORJLFDOPHFKDQLFDOILOWUDWLRQ ‡8QLYHUVDO&OLFN)LWFRXSOLQJZKLFKDOORZV
‡5HGXFHVSXPSPDLQWHQDQFH FRQQHFWLRQVWRRULQFKKRVLQJ
‡$OORZVIRUHDV\DFFHVVDQGFOHDQLQJ ‡7ZRIRDPILOWHUSDGV
‡,QWHJUDWHVHDVLO\ZLWKH[LVWLQJSXPSV ‡/DJXQD%LR0D[ILOWHUPHGLD
‡5HSODFHPHQWSDUWVDYDLODEOHXSRQUHTXHVW ‡\HDUZDUUDQW\
 ,WHP 1DPH 2XWOHW 0D[)ORZ 3ULFH
 37 3RZHU)OR%LRORJLFDO)LOWHU 8QLYHUVDO&OLFN)LW&RXSOLQJ JSK 
 37 5HSODFHPHQW)LOWHU0HGLD ± ± 

),/7(50(',$

/DJXQD%LRVSKHUHV
‡3URYLGHVODUJHOLYLQJDUHDIRUEHQHILFLDOEDFWHULDWRWKULYH ‡(IILFLHQWO\UHGXFHVDPPRQLDDQGQLWULWH
‡+HOSVPDLQWDLQKHDOWK\SRQGZDWHUFRQGLWLRQVDQGRYHUDOO ‡&DOFLXPLVDGGHGWRWKH%LRVSKHUHVSURYLGLQJZHLJKWDQG
ZHOOEHLQJRISRQGILVKDQGSODQWV WH[WXUHWRPDNHWKHPVLQNDVZHOODVDGGYDOXDEOHVXUIDFHDUHD

 ,WHP 6L]H 3ULFH


 37 6SKHUHV 
 37 6SKHUHV 

/DJXQD)LOWHU:RRO /DJXQD%LRORJLFDO)LOWHU
0HGLD /DYD5RFN
‡)RUXQGHUZDWHUDQGH[WHUQDOILOWHUV
‡(IIHFWLYHPHFKDQLFDOILOWHUPHGLDUHPRYHV ‡/DUJHSRURXVVXUIDFHDUHD
ILQHSDUWLFOHVIURPSRQGZDWHU ‡$QLGHDOKRVWIRUODUJHSRSXODWLRQVRIEHQHILFLDO
‡3UHYHQWVSRQGILOWHUVDQGRWKHUILOWHUPHGLD EDFWHULD
IURPFORJJLQJ ‡&UHDWHFRQGLWLRQVIRUFOHDQDQGFOHDUSRQGZDWHU
‡+HOSVSURGXFHXOWUDFOHDUZDWHUFRQGLWLRQV ‡6XLWDEOHIRUPRVWXQGHUZDWHUSRQGILOWHUV
‡1RQWR[LFDQGFKHPLFDOO\LQHUW

 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH


 37 OEV 
 37 R] 

),/7(50(',$ 321'/,1(5&20

3RO\)OR 3RO\)OR
%LRORJLFDO)LOWHU0HGLD 0HFKDQLFDO)LOWHU0HGLD
2QHRI3RO\)OR¶VPRVWSRSXODUPHFKDQLFDO
ILOWUDWLRQPHGLD,W¶VUHODWLYHPHGLXPGHQVLW\DOORZV
IRURSWLPXPSDUWLFXODWHUHPRYDOZKLOHPDLQWDLQLQJ
DQDGHTXDWHZDWHUIORZ7KLVWUDQVODWHVLQWRKLJK
%OXH )XVLRQ %ODFN &UHDP HIILFLHQF\ILOWUDWLRQZLWKRXWKDYLQJWRFOHDQWKHSDG
WRRRIWHQ
3RO\)OR¶VPRVWSRSXODUELRORJLFDOILOWUDWLRQPHGLD,WLVDYDLODEOHLQó´DQG´
WKLFNQHVVHV7KH´PDWHULDOLVXVHGH[FOXVLYHO\LQYLUWXDOO\DOO86PDQXIDFWXUHGSRQG ,WHP &RORU 7KLFNQHVV 'LPHQVLRQV 3ULFH
VNLPPHUVDQGZDWHUIDOOXQLWV7KHRSHQFKDUDFWHURIWKLVILOWHUPHGLDDOORZVIRUKLJK   /LPH*UHHQ0LQL5ROO ´ ¶[´ 
YROXPHVRIZDWHUWRSDVVWKURXJKZLWKRXWFORJJLQJZKLOHSURYLGLQJRSWLPDOVXUIDFHDUHD
WRIDFLOLWDWHEDFWHULDOFRORQL]DWLRQ   /LPH*UHHQ-XPER5ROO ´ ¶[´ 

 ,WHP &RORU 7KLFNQHVV 'LPHQVLRQV 3ULFH


  &UHDP0LQL5ROO ´ ¶[´ 
  &UHDP0LQL5ROO ´ ¶[´  3RO\)OR
  &UHDP-XPER5ROO ´ ¶[´ 
  &UHDP-XPER5ROO ´ ¶[´ 
5DLQERZ%LR%OR[
  %ODFN0LQL5ROO ´ ¶[´  ‡0RUHWKDQVTIWRIVXUIDFHDUHDSHURQH
  %ODFN0LQL5ROO ´ ¶[´  FXELFIRRWER[
‡/HVVH[SHQVLYHDOWHUQDWLYHWRRWKHUW\SHVRI
  %ODFN-XPER5ROO ´ ¶[´ 
ILOWHUPHGLD
  %ODFN-XPER5ROO ´ ¶[´  ‡&DQEHXVHGLQYLUWXDOO\DQ\ELRORJLFDOILOWHU
  %OXH0LQL5ROO ´ ¶[´  ‡2QHER[ZLOOILOORIWKH)%EDJV
  )XVLRQ0LQL5ROO ´ ¶[´  ‡2QHER[ZLOOORRVHO\ILOOWKH%*
  )XVLRQ-XPER5ROO ´ ¶[´   ,WHP 'HVFULSWLRQ 3ULFH
 %% 5DLQERZ%LR%OR[ &XELF)RRW  
3XPS6RFN
3URWHFWVDOOVL]HVRIVXEPHUVLEOHSXPSVIURP
ODUJHGHEULVDQGDOORZVIRUEHWWHUZDWHUIORZ &U\VWDO&OHDU3ROLVK$&
DQGFRROLQJRISXPS:LOODGDSWWRKRUL]RQWDO
RUYHUWLFDOGLVFKDUJHV5HTXLUHVPLQLPDO ‡6XSHUKHDWHGWR ‡5HPRYHVQLWUDWHV
FOHDQLQJ ³DFWLYDWH´WKHFDUERQ ‡5HPRYHVFKORULQH
 ,WHP 'LPHQVLRQV 3ULFH DQGSURYLGHDKLJKOHYHO ‡(OLPLQDWHVQLWULWHV
 36 ´+[´'LD  RISRURXVVXUIDFHDUHD ‡5HPRYHVIRXORGRUV
IRULQFUHDVHGHIILFLHQF\ ‡+HOSVFOHDUWDQQLQ
‡5HSODFHDIWHUPRQWKV VWDLQHGZDWHU
‡3ROLVKHVZDWHU ‡\HDUVKHOIOLIH
)LOWHU0HGLD%DJV ‡5HSDLUVVWDLQHGZDWHU
([FHOOHQWIRUUHWDLQLQJ%LR%OR[%LR%DOOV6SULQJIOR  ,WHP 6L]H 7UHDWV 3ULFH
%LRILOWHUPHGLD]HROLWHRURWKHUW\SHRIEXONILOWHU
 && OEV JDO 
PHGLD+ROHVDUHVPDOOHUWKDQDSHQFLOHUDVHU
 && OEV JDO 
 ,WHP 'HVFULSWLRQ 3ULFH
 )% ´[´0HGLD%DJ 
 %* ´[´0HGLD%DJ 
 )% ´[´0HGLD%DJ 
6DYLR
6SULQJÀR%LR¿OWHU0HGLD
3RQG&DUH$PPR5RFNV
5LEERQHQFRXUDJHVEHWWHUDGKHVLRQDQGSUROLIHUDWLRQRI
1HZSRQGV PDWXUHSRQGVDWWKHVWDUWRIWKHVHDVRQ EDFWHULDXVLQJDVSHFLDOIRUPXODWLRQRISRO\SURS\OHQH
GRQRWKDYHHQRXJKQLWULI\LQJEDFWHULDWRFRQWURO DQGFDOFLXPFDUERQDWH7KHWH[WXUHGVXUIDFHLV
DPPRQLD QLWULWHOHYHOV,WFDQWDNHXSWRZHHNVIRU HPERVVHGZLWKPLOOLRQVRIGLPSOHVWRUDSLGO\VHFXUH
WKHELRORJLFDOILOWHUWRIXOO\GHYHORS,WLVGXULQJWKLV DQGGHYHORSEHQHILFLDOPLFURRUJDQLVPV,WGRHVQRW
EUHDNLQSHULRGWKDWPRVWILVKDUHNLOOHGE\DPPRQLD FORJDQGUHVLVWVFKDQQHOOLQJDQGFRPSDFWLRQLQXS
$PPR5RFNVUHPRYHWR[LFDPPRQLDIURP\RXUSRQG IORZDQGKRUL]RQWDOIORZSUHVVXUHILOWHUFKDPEHUV
‡)DVWHUELRORJLFDOGHYHORSPHQW 1HJDWLYHEXR\DQF\NHHSVLWLQSODFH2YHUVTIW
‡5HPRYHVWR[LFDPPRQLDIURP\RXUSRQG SHUUROO
‡QDWXUDO]HROLWH
 ,WHP 'HVFULSWLRQ 3ULFH
 ,WHP 6L]H 3ULFH  6) 6SULQJÀR0HGLD 
 % OE   . )LOWHU0HGLD%DJ 


 3803),/7(5&20%26

3RQGPDVWHU 3RQGPDVWHU
3XPS)LOWHU&RPER 3XPS)LOWHU&RPER
,QFOXGHVSXPS30ILOWHUEHOO DGMXVWDEOH ,QFOXGHVSXPS30ILOWHUEHOO DGMXVWDEOH
IRXQWDLQKHDGVWXELQJ ILWWLQJV IRXQWDLQKHDGVWXELQJILWWLQJVDQGGLYHUWHUYDOYH

 ,WHP 1DPH 3RQG6L]H 3XPS 3ULFH  ,WHP 1DPH 3RQG6L]H 3XPS 3ULFH
  30. *DO 3RQG0DJ    30. *DO 3RQG0DJ 
  30. *DO 3RQG0DJ 
  30. *DO 3RQG0DJ 

/DJXQD&OHDU)OR3RQG3XPS)LOWHU&RPER
)RUWKHXOWLPDWHFRPELQDWLRQLQSRZHUDQGSHUIRUPDQFHZHKDYHFRPELQHGRXULQGXVWU\OHDGLQJ0D[)ORVROLGVKDQGOLQJ
SXPSZLWKWKH3UHVVXUH)OR89)LOWHU7KLVSHUIHFWSDUWQHUVKLSHQVXUHVVXVWDLQHGSHUIRUPDQFHDQGVWXQQLQJZDWHUFODULW\
‡,QFOXGHVD8QLYHUVDO³&OLFNILW´KRVHFRXSOLQJ´´ ´ ‡<HDU:DUUDQW\
0$;)/23RQG3XPS)HDWXUHV 35(6685()/23RQG)LOWHU)HDWXUHV
‡3RZHUHGE\D(XURSHDQHQJLQHHUHGPDJQHWLFGULYHQ ‡&OHDQLQJLQGLFDWRUWDNHVWKHJXHVVZRUNRXWRI
PRWRU PDLQWHQDQFHLQWHUYDOV
‡(QHUJ\HIILFLHQWSXPSVWKHHQHUJ\VDYLQJVRIWHQ ‡)LOWHUEDFNZDVKV\VWHPHQDEOHVURXWLQHFOHDQLQJLQ
SD\VIRUWKHFRVWRIWKHSXPSZLWKLQWZR\HDUV VHFRQGV
‡9HU\IHZPRYLQJSDUWVUHVXOWVLQPLQLPDO ‡0HFKDQLFDOELRORJLFDODQGLQWHJUDWHG89ILOWUDWLRQ
PDLQWHQDQFH ZRUNLQXQLVRQSURYLGLQJFOHDQDQGFOHDUSRQGZDWHU
‡7KHXQLTXHVWUDLQHUFDJHSURWHFWVWKHLPSHOOHUDQG JXDUDQWHHG
PDLQWDLQVDFRQVWDQWZDWHUIORZ ‡(DV\WRLQVWDOODQGPDLQWDLQ
 ,WHP 1DPH 3RQG6L]H 3XPS )LOWHU 3ULFH
 37 &OHDU)OR *DO 0D[)OR 3UHVVXUH)OR 
 37 &OHDU)OR *DO 0D[)OR 3UHVVXUH)OR 
 37 &OHDU)OR *DO 0D[)OR 3UHVVXUH)OR 
 37 &OHDU)OR *DO 0D[)OR 3UHVVXUH)OR 

38036

6KLQ0D\ZD1RUXV:DWHUIDOO3XPSV
7KH6KLQ0D\ZD 3URQRXQFHG6KLQ0D\:DK 1RUXV:DWHUIDOO3XPS
LVRQHRIWKHPRVWUHOLDEOHDQGGXUDEOHSXPSVVROGLQWRGD\¶VZDWHU
 ,WHP ¶ ¶ ¶ ¶ ¶ JDUGHQPDUNHW
&56     ± ‡&RQWLQXRXV'XW\
&56      ‡+LJK(IILFLHQF\ORQJOLIHDQGORZRSHUDWLQJFRVW
&56      ‡&RUURVLRQ5HVLVWDQWVWDLQOHVVVWHHODQG3RO\$PLGHILEHU
&56      UHLQIRUFHGUHVLQSURYLGHVVXSHULRUFRUURVLRQUHVLVWDQFHHYHQLQ
KDUGDSSOLFDWLRQV
‡7KHUPDO2YHUORDGSUHYHQWVPRWRUIURPRYHUKHDWLQJGXHWRORFNHG
URWRURUXQGHUYROWDJH
‡9RUWH[,PSHOOHU'HVLJQVXSHULRUVROLGVKDQGOLQJFKDUDFWHULVWLFV
HVSHFLDOO\ZLWKILEURXVDQGVWULQJ\PDWHULDOV
‡39&WXELQJDQGWKHXVHRIDEDOOYDOYHLVUHFRPPHQGHGIRUKLJK
SUHVVXUHSXPSV
6HH3DJHIRU 6HH3DJHIRU
9HUWLFDOPDVWHU3XPS6ZLWFK 6KLQ0D\ZD'LVFKDUJH.LW ‡\HDUZDUUDQW\

 ,WHP 0D[+HDG $PSV:DWWV 2XWOHW 'LPHQVLRQV &RUG/HQJWK +3 3ULFH


 &56 ¶  ´)37 ´[´[´ ¶  
 &56 ¶  ´)37 ´[´[´ ¶  
 &56 ¶  ´)37 ´[´[´ ¶  
 &56 ¶  ´)37 ´[´[´ ¶  


38036 321'/,1(5&20

6KLQ0D\ZD&9&6HULHV3XPSV
‡9RUWH[LPSHOOHUIRUVXSHULRUVROLGVKDQGOLQJFDSDELOLW\
‡$LUILOOHG&ODVV(LQVXODWHGKHDY\GXW\PRWRURSHUDWHV
FRROHUZLWKKLJKHUHIILFLHQFLHV
‡'RXEOHPHFKDQLFDOVHDOVPDGHRIVLOLFRQFDUELGHRSHUDWH
LQDQRLOEDWKSURYLGLQJORQJHUVHUYLFHOLIHDQGORZHU
PDLQWHQDQFH
‡&DSDFLWRUDQGSRZHUFRUGFRQQHFWLRQVDUHLVRODWHG
IURPPRWRUKRXVLQJDQGHDVLO\DFFHVVLEOHIRUILHOG
PDLQWHQDQFHV  ,WHP ¶ ¶ ¶ ¶ ¶ ¶
‡6WDLQOHVV6WHHOQRQFRUURVLYHKDUGZDUH &9&
‡$XWRFXWWKHUPDORYHUORDGSURWHFWVWKHSXPSIURPRYHU
FXUUHQWDQGRYHUWHPSHUDWXUH
‡<HDU:DUUDQW\

 ,WHP 0D[+HDG $PSV9ROWV 2XWOHW 6ROLGV 3KDVH &RUG/HQJWK +3 3ULFH


 &9& ¶  ´)37 ´  ¶  

6KLQ0D\ZD&1/6HULHV3XPSV
‡9DQHQRQFORJKLJKHIILFLHQF\LPSHOOHU ‡/DUJHVROLGVKDQGOLQJFDSDELOLWLHV±SUHYHQWVWURXEOHVRPH
‡$LUILOOHG&ODVV(LQVXODWHGKHDY\GXW\PRWRURSHUDWHV FORJJLQJ
FRROHUZLWKKLJKHUHIILFLHQFLHV ‡'RXEOHPHFKDQLFDOVHDOV±RSHUDWHLQDQRLOEDWKSURYLGLQJ
‡%XLOWLQPRWRUSURWHFWLRQ±3URWHFWVDJDLQVWRYHUKHDWRXW ORQJHUVHUYLFHOLIHDQGORZHUPDLQWHQDQFH
RISKDVHDQGVLQJOHSKDVLQJ ‡<HDU:DUUDQW\

 ,WHP ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶
 &1/        

&1/ ±        

 ,WHP 0D[+HDG $PSV9ROWV 2XWOHW 6ROLGV 3KDVH &RUG/HQJWK +3 3ULFH


 &1/ ¶  ´)37 ´  ¶  
 &1/ ¶  ´)37 ´  ¶  

6KLQ0D\ZD9DULDEOH6SHHG3XPS&RQWURO3DQHOV
$GYDQWDJHVRI9DULDEOH6SHHG3DQHOV 9DULDEOHVSHHGSDQHOVRIIHUWKHDELOLW\WRXVHWKUHHSKDVH
‡1ROLJKWGLPPLQJLQUXVKFXUUHQW LQGXVWULDOGXW\PRWRUVLQVLQJOHSKDVHUHVLGHQWLDODSSOLFDWLRQV
‡3XPS³VRIWVWDUWV´DQG³6RIWVWRSV´UHGXFLQJZDWHU 7KHVHSDQHOVDOORZWKHKRPHRZQHUPRUHFRQWURORYHUWKHIORZ
KDPPHUDQGH[WHQGLQJWKHOLIHRI\RXUSXPS DQGIHHORIWKHLUZDWHUIHDWXUH,WLVDOVRDZHOONQRZQIDFWWKDW
‡6XSHULRUPRWRURYHUORDGSURWHFWLRQDVZHOODVYROWDJHDQG WKUHHSKDVHPRWRUVDUHIDUVXSHULRUWRVLQJOHSKDVHUHVLGHQWLDO
SRZHUORVVSURWHFWLRQ PRWRUVEHFDXVHWKH\DUHPRUHHIILFLHQWWKDQVLQJOHSKDVH
‡6HQVHVIDXOWVDQGVKRUWVFLUFXLWVDQGVKXWVGRZQWKHSXPS WKH\ODVWORQJHUWKDQVLQJOHSKDVHPRWRUVWKH\KDYHRQO\RQH
LQPLFURVHFRQGVWRSUHYHQWLUUHSDUDEOHPRWRUGDPDJH PRYLQJSDUWZKLFKUHGXFHVZHDUDQGLQFUHDVHVORQJHYLW\
‡6HQVHVSXPSFORJDQGZLOOVKXWWKHPRWRUGRZQWRSUHYHQW ,QFOXGHVD\HDUZDUUDQW\
GDPDJH
‡$ELOLW\WRVORZGRZQPRWRUDWQLJKWUHDOL]LQJVXEVWDQWLDO $GYDQWDJHVRI9DULDEOH6SHHG3DQHOV
SRZHUVDYLQJZKLOHPDLQWDLQLQJFULWLFDOFLUFXODWLRQ ‡1HPD;ZHDWKHUSURRIHQFORVXUH
‡0XFKODUJHUPRWRUVFDQEHXVHGLQUHVLGHQWLDODSSOLFDWLRQV ‡KRXUWLPHUWRFRQWURORQRIIRUKLJKORZVSHHGIXQFWLRQV
‡*LYHVRZQHUWKHDELOLW\WRYDU\WKHVSHHGRIWKHSXPS ‡'HDGIURQWFRYHUWRSURWHFWIURPLQDGYHUWHQWVKRFN
DFKLHYLQJGLIIHUHQWORRNDQGQRLVHOHYHOVLQDIHDWXUH ‡6SHHGNQREIRUYDULDEOHVSHHGFRQWURO
‡7DNHVWKHSODFHRIPXOWLVSHHGPRWRUVDQGRUYDOYHVZKHQ ‡7HUPLQDOVIRULQFRPLQJSRZHUDQGSXPSFRQQHFWLRQV
XVHGIRUZDWHUHIIHFW ‡2QRIIDXWRVZLWFKIRUPDQXDOFRQWURORUWLPHURSHUDWLRQ

 ,WHP $PSV 'LPHQVLRQV 3ULFH


 )3  ´[´[´ 
 )3  ´[´[´ 


 38036

/LWWOH*LDQW:DWHU)HDWXUH3XPSV
&RQVWUXFWHGZLWKVWDLQOHVVVWHHOFDVWLURQDQGGXUDEOHWKHUPRSODVWLFWKHQHZ
VROLGVKDQGOLQJ/LWWOH*LDQWVXEPHUVLEOHZDWHUIHDWXUHSXPSVPHHWWKHULJRURXV
 ,WHP ¶ ¶ ¶ ¶ :*)3
GHPDQGVRIWKHPRVWLPSUHVVLYHZDWHUIHDWXUHV6LQJOHPHFKDQLFDO VLQJOH
 :*)3     UDGLDOOLSVKDIWVHDOVRQPRGHOV:*)3  :*)3
 :*)3    
‡F&6$XV&HUWLILHG
 :*)3    
‡/LPLWHG\HDUZDUUDQW\
 :*)3     ‡9ROW
:*)3     ‡¶&RUG

:*)3 :*)3
:*)3
3XPSV3HRSOH3DUWQHUVKLSV
 ,WHP 1DPH 0D[+HDG $PSV:DWWV 2XWOHW 'LPHQVLRQV 6ROLGV+DQGOLQJ +3 3ULFH
  :*)3 ¶  ´)37 ´[´[´ ´  
  :*)3 ¶  ´)37 ´[´[´ ´  
  :*)3 ¶  ´)37 ´[´[´ ´  
  :*)3 ¶  ´)37 ´[´[´ ´  
  :*)3 ¶  ´)37 ´[´[´ ´  

/LWWOH*LDQW'LUHFW'ULYH'XDO'LVFKDUJH3XPSV
(IILFLHQWRLOOHVVGLUHFWGULYHGXDOGLVFKDUJHSXPSVSURGXFH
JUHDWHUIORZSUHVVXUHVRHDFKFDQVHUYHWZRZDWHUIHDWXUHV
 ,WHP ¶ ¶ ¶ ¶ ¶ ¶ VLPXOWDQHRXVO\
:*33:    ± ± ‡F&6$XV&HUWLILHG ‡´)73'LVFKDUJH
:*33:      ‡/LPLWHG\HDUZDUUDQW\ ‡´037'LVFKDUJH&DS
‡8QLTXH'XDO'LVFKDUJH ‡9HUVDWLOH8VH9HUWLFDOO\RU
:*33:      ± 'HVLJQ RSHUDWHVZDWHU +RUL]RQWDOO\
IHDWXUHVVLPXOWDQHRXVO\ ‡¶&RUG

 ,WHP 1DPH 0D[+HDG $PSV:DWWV 'LPHQVLRQV ,QFOXGHV 3ULFH


  :*33: ¶  ´[´[´ ´%DUE 
  :*33: ¶  ´[´[´ ´%DUE 
  :*33: ¶  ´[´[´ ´%DUE 

/LWWOH*LDQW/DUJH9ROXPH6XEPHUVLEOH3XPSV
7KHVHFRQWLQXRXVGXW\SXPSVIHDWXUHHSR[\FRDWHGFDVW
LURQKRXVLQJWKDWUHVLVWVUXVWDQGFRUURVLRQ3RZHUHG
 ,WHP ¶ ¶ ¶ ¶ ¶ ¶ E\FRPPHUFLDOJUDGHWKHUPDOO\SURWHFWHGPRWRUVWKHVH 6+&,0
6+&,0      ± VXEPHUVLEOHVROLGVKDQGOLQJSXPSVGHOLYHUVXSHULRU
 6&,0      ± SHUIRUPDQFH
 6&,0      ‡/LPLWHG\HDUZDUUDQW\
 6&,0 ±    ‡6+&,0¶&RUG
‡$OO2WKHUV¶&RUG

6&,0
6&,0 6&,0

3XPSV3HRSOH3DUWQHUVKLSV 6HH/LWWOH*LDQW'LVFKDUJH.LWVRQSDJH

 ,WHP 1DPH 0D[+HDG :DWWV$PSV9ROWV 2XWOHW 'LPHQVLRQV 6ROLGV+DQGOLQJ +3 3ULFH


  6+&,0 ¶  ´)37 ´[´[´ ´  
  6&,0 ¶  ´)37 ´[´[´ ´  
  6&,0 ¶  ´)37 ´[´[´ ´  
  6&,0 ¶  ´)37 ´[´[´ ´  


38036 321'/,1(5&20

/LWWOH*LDQW)OH[3XPS
35

1HZZDWHUIHDWXUHSXPSVDUHHQHUJ\HIILFLHQWDQGLGHDOIRUSRZHULQJ 30

ZDWHUIHDWXUHVDQGSRQGILOWUDWLRQV\VWHPVZLWKIORZUHTXLUHPHQWVIURP 25
*3+WR*3+7KHVHSXPSVDUHUDWHGIRUFRQWLQXRXVGXW\WR

HEAD (FT )
20
RSHUDWHLQWKHPRVWULJRURXVDSSOLFDWLRQV,QFOXGHV\HDUZDUUDQW\
15

FP-6 FP-9
10
FP-3
FP-2
5
FP-1
0

3XPSV3HRSOH3DUWQHUVKLSV 0 1000 2000 3000 4000 5000 6000 7000 8000 9000 10000

FLOW (GPH)

 ,WHP 1DPH 0D[)ORZ 0D[+HDG :DWWV 2XWOHW &RUG 6ROLGV 3ULFH


  )3 JSK ¶  ´)37 ¶ ´ 
  )3 JSK ¶  ´)37 ¶ ´ 
  )3 JSK ¶  ´)37 ¶ ´ 
  )3 JSK ¶  ´)37 ¶ ´ 
  )3 JSK ¶  ´)37 ¶ ´ 

&DO3XPS'LUHFW'ULYH:DWHUIDOO3XPSV
 ,WHP ¶ ¶ ¶ ¶ ¶ ¶
 3:    ± ± ±
 3:    ± ± ±
 3:     ± ±
 3:     ± ±
 3:      
3: 2SWLRQDO´ ‡,GHDOLQKLJKKHDGDSSOLFDWLRQVZKHUHPDJQHWLFGULYH
6XFWLRQ6WUDLQHU SXPSVFDQQRWSURYLGHHQRXJKIORZ
&DO3XPS'LUHFW'ULYH:DWHUIDOO3XPSVDUHLGHDOIRUZDWHUIDOOV ‡1RWIRUXVHLQORZHUKHDGDSSOLFDWLRQV
VWUHDPVRUSRZHULQJSRQGILOWHUV\VWHPV7KHVHSRQGSXPSV ‡)LWWLQJV,QFOXGHG´0WR´0(OERZ
DUHEHVWVXLWHGWREHXVHGLQDSRQGVNLPPHUEXWPD\EHXVHG ´)WR´7KHDGHG%DUE´0[´0
GLUHFWO\LQWKHSRQGZLWKVHYHUDOLQWDNHVFUHHQVDYDLODEOH ‡\HDUZDUUDQW\
 ,WHP 0D[)ORZ $PSV PLQPD[  :DWWV PLQPD[  2XWOHW 'LPHQVLRQV &RUG/HQJWK 3ULFH
 3: JSK   ´037 ´[´ ¶ 
 3: JSK   ´037 ´[´ ¶ 
 3: JSK   ´037 ´[´ ¶ 
 3: JSK   ´037 ´[´ ¶ 
 3: JSK   ´037 ´[´ ¶ 

&DO3XPS0DJQHWLFDOO\&RXSOHG:DWHUIDOO3XPS
,GHDOIRUZDWHUIDOOVVWUHDPVDQGSRQGV
‡'HVLJQHGHVSHFLDOO\IRUZDWHUJDUGHQDSSOLFDWLRQV  ,WHP ¶ ¶ ¶ ¶ ¶
‡/RZHUHQHUJ\XVDJH ORQJHUOLIHWKDQ3:6HULHVSXPSV
3:0    ± ±
‡1RVHDOV1RRLO
‡&DQEHLQVWDOOHGLQOLQHE\UHPRYLQJERWWRPVFUHHQ 3:0     ±
‡¶&RUG 3:0     
‡\HDUZDUUDQW\
 ,WHP 0D[)ORZ $PSV PLQPD[  :DWWV PLQPD[  ,QOHW'LVFKDUJH 'LPHQVLRQV 3ULFH
 3:0 JSK   ´037´)37 ´/[´' 
 3:0 JSK   ´037´)37 ´/[´' 
 3:0 JSK   ´037´)37 ´/[´' 


 38036

&DO3XPS7RUSHGR3XPSV
 ,WHP ¶ ¶ ¶ ¶ ¶ 7KH&DO7RUSHGR3XPSVDUHWKHILUVWSXPSVGHVLJQHGIRUWKH
SRQGHQWKXVLDVWWKDWDUHOLJKWZHLJKWZDWHUFRROHGXVHQRRLODQG
 7     ±
FDQEHXVHGLQRURXWRIZDWHU&DO3XPS7RUSHGR3XPSV¶KLJK
 7     ± YROXPHZDWHUIORZDQGORZHQHUJ\FRQVXPSWLRQPDNHVWKHPWKH
 7      PRVWXQLTXHSRQGSXPSVDYDLODEOH
 7     

‡,GHDOLQKLJKKHDGDSSOLFDWLRQVZKHUHPDJQHWLFGULYHSXPSV ‡6XEPHUVLEOHRULQOLQH
FDQQRWSURYLGHHQRXJKIORZ ‡&DQVLWXSULJKWLQVNLPPHUXVLQJILOWHUEDVNHW
‡1RWIRUXVHLQORZHUKHDGDSSOLFDWLRQV ‡\HDUZDUUDQW\

 ,WHP 0D[)ORZ $PSV PLQPD[  :DWWV PLQPD[  2XWOHW 'LPHQVLRQV &RUG/HQJWK 3ULFH
 7 JSK   ´037 ´[´[´ ¶ 
 7 JSK   ´037 ´[´[´ ¶ 
 7 JSK   ´037 ´[´[´ ¶ 
 7 JSK   ´037 ´[´[´ ¶ 
 7 JSK   ´037 ´[´[´ ¶ 

)RDPIRU´%DUUHO)LOWHU %DUUHO)LOWHUV
 ,WHP 3ULFH  ,WHP 6L]H /[' 3ULFH
 &)6   &)67 ´ ´[´ 
 &)67 ´ ´[´ 

6WHHO6XFWLRQ6WUDLQHU)37 %DVNHW6XFWLRQ6WUDLQHU)73
 ,WHP 6L]H /[' 3ULFH  ,WHP 6L]H /[' 3ULFH
 6563 ´ ´[´   653 ´ ´[´ 
 6563 ´ ´[´   653 ´ ´[´ 
 653 ´ ´[´ 

&DO3XPS6WDLQOHVV6WHHODQG%URQ]H3XPSV
&DO3XPS6WDLQOHVV6WHHODQG%URQ]HSXPSVFRPHLQILYHGLIIHUHQW
PRGHOVZLWKIORZUDWHVIURPJSKWRJSKWRFRYHUDZLGH
 ,WHP ¶ ¶ ¶ ¶ ¶ YDULHW\RIXVHV6WDLQOHVV6WHHODQG%URQ]HSXPSVDUHZLGHO\XVHG
 6   ± ± ± LQNRLSRQGVZDWHUJDUGHQLQJDQGDSSOLFDWLRQVZKHUHGHSHQGDELOLW\
 6    ± ± DQGORQJHYLW\DUHDPXVW
 6     ± ‡$OOPRGHOVIHDWXUHDIORZDGMXVWHU ‡8VHVXEPHUJHGRULQRSHQ
 6     ± OLVWHGIRUFRQVXPHUFRQILGHQFH DLUEHORZZDWHUOHYHO
‡([WUHPHO\TXLHWRSHUDWLRQ ‡7ZR\HDUZDUUDQW\
 6     
‡5HSDLUNLWDYDLODEOH

 ,WHP 0D[)ORZ 0D[+HDG :DWWV ,QOHW2XWOHW &RUG 'LPHQVLRQV 3ULFH


 67 JSK ¶  ´037´037 ¶ ´[´ 
 67 JSK ¶  ´037´037 ¶ ´[´ 
 67 JSK ¶  ´037´037 ¶ ´[´ 
 67 JSK ¶  ´037´037 ¶ ´[´ 
 67 JSK ¶  ´037´037 ¶ ´[´ 
 67 JSK ¶  ´037´037 ¶ ´[´ 
 67 JSK ¶  ´037´037 ¶ ´[´ 
 67 JSK ¶  ´037´037 ¶ ´[´ 


38036 321'/,1(5&20

&DO3XPS$OXPLQLXP6WDWXDU\3XPSV
$ ‡([WUHPHO\TXLHWRSHUDWLRQ
‡,QFOXGHVIORZFRQWURO
‡ò´LQWDNHPSWó´GLVFKDUJHPSW ,WHP ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶
‡&DQEHXVHGVXEPHUJHGRULQOLQH  $    ± ± ± ± ±
EHORZZDWHUOHYHO  $       ± ±
‡\HDUZDUUDQW\  $        

 ,WHP &RUG 0D[)ORZ $PSV :DWWV 'LPHQVLRQV 3ULFH


 $ ¶ JSK   ´[´[´ 
$$  $ ¶ JSK   ´[´[´ 
 $ ¶ JSK   ´[´[´ 
 $ ¶ JSK   ´[´[´ 
 $ ¶ JSK   ´[´[´ 
 $ ¶ JSK   ´[´[´ 

6DYLR:DWHU0DVWHU6ROLGV3XPS
6DYLR:DWHU0DVWHU6ROLGV+DQGOLQJ3XPSVFDQKDQGOHVXVSHQGHG
:06 GHEULVDQGVSKHULFDOVROLGVXSWRó´LQGLDPHWHU2LOOHVVGHVLJQ
:06 PDNHVWKHPVDIHIRUXVHLQHQYLURQPHQWVZLWKILVKSODQWVDQGRWKHU
:06 DTXDWLFOLIH3HUIHFWIRUFRQWLQXRXVGXW\XVHLQ6NLPPHUILOWHUVDQG
SRQGILOWUDWLRQV\VWHPV
‡:06FDQKDQGOHVROLGVXSWRó´GLD
‡:06DQGFDQKDQGOHVROLGVXSWRò´GLD
:06 ‡2LOOHVVGHVLJQLVILVKSODQWVDIH²7KHRQO\RLOOHVVVROLGV
:06 KDQGOLQJSXPSRQWKHPDUNHW
‡&6$DSSURYHGIRUXVHLQWKH86$DQG&DQDGD
‡\HDUZDUUDQW\
6HHSDJHIRU
6DYLR'LVFKDUJH.LWV
 ,WHP 0D[)ORZ 0D[+HDG $PSV:DWWV 2XWOHW 'LPHQVLRQV &RUG/HQJWK 3ULFH
 :06 JSK ¶  ´)37 ´'[´+ ¶ 
 :06 JSK ¶  ´)37 ´'[´+ ¶ 
 :06 JSK ¶  ´)37 ´'[´+ ¶ 
 :06 JSK ¶  ´)37 ´'[´+ ¶ 
 :06 JSK ¶  ´)37 ´'[´+ ¶ 

6DYLR:DWHU0DVWHU&OHDU3XPS
6DYLR:DWHU0DVWHU&OHDU3XPSVFUHDWHGUDPDWLFZDWHUIDOOVDQGZDWHU
IHDWXUHV7KHVHSXPSVSURYLGHGXUDELOLW\DQGUHOLDELOLW\DWDQDIIRUGDEOH
SULFHSRLQW:DWHU0DVWHUVHULHVSXPSVXWLOL]HDZHDUUHVLVWDQWFHUDPLF
FRDWHGVKDIWKHDY\GXW\VHDOHGEHDULQJVDQGIHDWXUHVWKUHHUHGXQGDQWOLS
VHDOVIRULQFUHDVHGOLIHVSDQDQGGHSHQGDELOLW\\RXFDQFRXQWRQ+RXVLQJV
DQGLQWHUQDOFRPSRQHQWVDUHFRPSOHWHO\QRQFRUURVLYH$OO:DWHU0DVWHU
VHULHVSXPSVDUHRLOOHVVIRUILVKDQGSODQWVDIHW\(DFK:DWHU0DVWHU&OHDU
3XPSLVIDFWRU\WHVWHGSULRUWRVKLSPHQW
‡&6$DSSURYHGIRUXVHLQWKH86$DQG&DQDGD
‡,QFOXGHV´HOERZISWILWWLQJ
‡\HDUZDUUDQW\
6HHSDJHIRU
6DYLR'LVFKDUJH.LWV

 ,WHP 0D[)ORZ 0D[+HDG $PSV:DWWV 2XWOHW 'LPHQVLRQV &RUG/HQJWK 3ULFH


 :0& JSK ¶  ´)37 ´'[´+ ¶ 
 :0& JSK ¶  ´)37 ´'[´+ ¶ 
 :0& JSK ¶  ´)37 ´'[´+ ¶ 
 :0& JSK ¶  ´)37 ´'[´+ ¶ 


 38036

$WODQWLF:DWHU*DUGHQV7LGDO:DYH3XPSV

 ,WHP ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶
 $         ± ± ±
 $           

‡6XEPHUVLEOHVROLGVKDQGOLQJSXPSV ‡7KHUPDORYHUORDGSURWHFWLRQ ‡¶KHDY\GXW\SRZHUFRUG


DUHHQHUJ\HIILFLHQWDQGQHYHUQHHG ‡'RXEOHVHDOVZLWKVLOLFRQHFDUELGHIDFLQJ ‡\HDU:DUUDQW\
OXEULFDWLRQ ‡39&WXELQJDQGWKHXVHRIDEDOOYDOYHLV
6HH$WODQWLF:DWHU*DUGHQV&KHFN
‡5XJJHGKRXVLQJFDVWLURQYRUWH[LPSHOOHU UHFRPPHQGHGIRUKLJKSUHVVXUHSXPSV
9DOYH$VVHPEOLHVRQSDJH

 ,WHP $PSV9ROWV +3 2XWOHW 5HF0LQLPXP+HDG 'LPHQVLRQV 3ULFH


 $   ´)37 ¶PLQLPXPKHDGSUHVVXUH ´[´[´ 
 $   ´)37 ¶PLQLPXPKHDGSUHVVXUH ´[´[´ 

3RQGPDVWHU+<'ULYH3XPSV
7KH3RQGPDVWHU+<'ULYH3XPSVDUHXQLTXHKLJKFDSDFLW\SXPSV
GHVLJQHGVSHFLILFDOO\IRUXVHLQODUJHUSRQGLQVWDOODWLRQV+\'ULYH
SXPSVFDQEHSRVLWLRQHGYHUWLFDOO\RUKRUL]RQWDOO\DQGDUHHTXDOO\
DWKRPHXQGHUZDWHUDVDVXEPHUVLEOHSXPSRUDVDQLQOLQHH[WHUQDO
SXPSLQJVRXUFH

‡3RZHUIXO(IILFLHQW+\EULG ‡)37WR)37&RXSOHU
0DJQHWLF'LUHFW'ULYH0RWRU ‡,QOLQHDQG6XEPHUVLEOH
‡)LVK6DIH%HFDXVH1R2LOLV8VHG 2SHUDWLRQ
‡([WUD/RQJ¶3RZHU&RUGZLWK ‡&DQZRUNXSULJKWRURQLWVVLGH
*URXQGHG3OXJ ‡<HDU:DUUDQW\

 ,WHP 1DPH 0D[)ORZ 0D[+HDG $PSV:DWWV 2XWOHW 3ULFH


  +<'ULYH JSK ¶  ´037 
  +<'ULYH JSK ¶´  ´037 
  +<'ULYH JSK ¶´  ´037 
  +<'ULYH JSK ¶  ´037 
  +<'ULYH JSK ¶  ´037 
  +<'ULYH JSK ¶´  ´037 
  +<'ULYH JSK ¶´  ´037 

3RQGPDVWHU3RQG0DJ0DJQHWLF'ULYH3XPSV
‡5DWHGIRUFRQWLQXRXVXVDJHQRVHDOVWRZHDURXW ‡¶&RUG
‡9HU\HQHUJ\HIILFLHQWXVHVKDOIWKHHOHFWULFLW\RIVLPLODUSXPSV ‡8//LVWHGWR$PHULFDQ &DQDGLDQ6WDQGDUGV
‡2LOIUHH ‡\HDUZDUUDQW\RQSXPSPRWRUDQGFRYHU
‡\HDUZDUUDQW\RQPDJQHWLFLPSHOOHU

 ,WHP ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶
 3RQG0DJ        ± ± ± ± ± ±
 3RQG0DJ            ± ±
 3RQG0DJ            ± ±
 3RQG0DJ             

 ,WHP 1DPH 0D[+HDG 0D[)ORZ :DWWV 2XWOHW 'LPHQVLRQV 3ULFH


  3RQG0DJ ¶ JSK  ´037 ´[´[´ 
  3RQG0DJ ¶´ JSK  ´037 ´[´[´ 
  3RQG0DJ ¶´ JSK  ´037 ´[´[´ 
  3RQG0DJ ¶´ JSK  ´037 ´[´[´ 


38036 321'/,1(5&20

3RQGPDVWHU3RQG0DJ0DJQHWLF'ULYH3XPSV
‡5DWHGIRUFRQWLQXRXVXVDJHQRVHDOVWRZHDURXW ‡8//LVWHGWR$PHULFDQ &DQDGLDQ6WDQGDUGV
‡9HU\HQHUJ\HIILFLHQWXVHVKDOIWKHHOHFWULFLW\RIVLPLODUSXPSV ‡\HDUZDUUDQW\RQSXPSPRWRUDQGFRYHU
‡2LOIUHH ‡\HDUZDUUDQW\RQPDJQHWLFLPSHOOHU
‡¶&RUG
 ,WHP ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶ ¶    
 RQG0DJ         
3    
3RQG0DJ              
3RQG0DJ              
3RQG0DJ              

 ,WHP 1DPH 0D[+HDG 0D[)ORZ :DWWV 2XWOHW 'LPHQVLRQV 3ULFH


  3RQG0DJ ¶´ JSK  ´037 ´[´[´ 
  3RQG0DJ ¶´ JSK  ´037 ´[´[´ 
  3RQG0DJ ¶´ JSK  ´037 ´[´[´ 
  3RQG0DJ ¶ JSK  ´037 ´[´[´ 

)RDP3UH)LOWHU ,PSHOOHU
 ,WHP 6L]H 3XPS 3ULFH  ,WHP 3XPS 3ULFH
  6PDOO      
  /DUJH       
  /DUJH      
  E 
  E 
  E 
3XPS&RYHU9ROXWH    
   
 ,WHP 6L]H 3XPS 3ULFH
  7UHDGHG   
 3 %DUEHG    3ODVWLF3UH)LOWHU
  7UHDGHG     
  %DUEHG   
 ,WHP 3ULFH
  

3XPS&RYHU9ROXWH
 ,WHP 3XPS 3ULFH
    'LYHUWHU9DOYH
      ,WHP 6L]H )RU 3ULFH
    
  ´  
   
  ´  
   ´   ´  

3RQGPDVWHU)RXQWDLQ+HDGV
)+)RXQWDLQKHDG )+)RXQWDLQKHDG )+)RXQWDLQKHDG
7KUHHGLVWLQFWDGMXVWDEOHSDWWHUQV ‡/DUJHDGMXVWDEOH%HOO ‡/DUJHDGMXVWDEOHEXEEOLQJ
‡+LJKDQG/RZ)OHXUGHOLV PXVKURRP SDWWHUQ IRDPLQJIRXQWDLQKHDG
DQG/RWXV'HVLJQV ‡,QFOXGHVWZR´H[WHQVLRQV ‡,QFOXGHVWZR39&H[WHQVLRQ
‡,QFOXGHVWZR´H[WHQVLRQV DQGSXPSDGDSWHU VWHPVZLWKô´SLSHWKUHDGV
DQGSXPSDGDSWHU ‡6XLWDEOHIRU3RQGPDVWHU ‡6XLWDEOHIRU3RQGPDVWHU
‡6XLWDEOHIRU3RQGPDVWHU JSKSXPSV JSKSXPSV
JSKSXPSV
 ,WHP 1DPH 3ULFH
  )+)RXQWDLQKHDG 
  )+)RXQWDLQKHDG 
  )+)RXQWDLQKHDG 
  ´([WHQWLRQ7XEHIRU)+ 


 38036

/DJXQD3RZHU-HW)RXQWDLQ:DWHUIDOO3XPSV
‡/DUJHVXUIDFHFDSDFLW\VWUDLQHUFDJHIRUPD[LPXPSXPS
SURWHFWLRQ
 ,WHP ¶ ¶ ¶ ¶ ¶ ¶ ‡3LYRWLQJULVHUVWHPDOORZVVXUIDFHOHYHOLQJRIIRXQWDLQKHDG
 37   ± ± ± ± ‡³7LHU´DQG³:DWHUEHOO´IRXQWDLQKHDGLQFOXGHG
 37   ± ± ± ± ‡([WHQGDEOHULVHUVWHPFDQDOVREHDGMXVWHGKRUL]RQWDOO\
‡7ZRVHSDUDWHIORZFRQWUROVHDFKRQHLQGHSHQGHQWO\DGMXVWV
 37    ± ± ±
WKHZDWHUIORZLQJWRWKHIRXQWDLQKHDGDQGZDWHUIDOO
 37    ± ± ± ‡(DV\WRXVH&OLFN)LWFRQQHFWRUVIRUIDVWDQGHDV\KRVH
 37      ± FRQQHFWLRQV
 37      ± ‡3XPSFDJHFDQEHHDVLO\DWWDFKHGWRDIL[HGVXUIDFH
ODUJHEULFNRUIODWSLHFHRIURFN XVLQJWKHFRQYHQLHQW
 37      ±
NH\KROHFXWRXWVORFDWHGRQWKHERWWRPRIWKHSXPSFDJH
 37       6FUHZVDQGVFUHZSOXJVDUHDOVRLQFOXGHG
‡(UJRQRPLFSXPSKDQGOHIRUHDV\WUDQVSRUWDWLRQ
)RXQWDLQ:DWHUIDOO3XPS.LWVKDYHHYHU\WKLQJQHHGHGWR
‡,QOHWIRUFRQQHFWLQJWRHLWKHUDJDUGHQKRVHIRUEDFNZDVKLQJ
JHQHUDWHEHDXWLIXOZDWHUIHDWXUHV7KHSXPSVLWVLQVLGHD
RUWRD3RZHU)OR8QGHUZDWHU)LOWHU
VWUDLQHUFDJHWKDWSURWHFWVWKHLPSHOOHUIURPFORJJLQJ
‡<HDU:DUUDQW\
UHGXFLQJPDLQWHQDQFH7KH\DUHFRPSOHWHO\VXEPHUVLEOHDQG ,QFOXGHV
GHVLJQHGWRUXQFRQWLQXRXVO\ :DWHUEHOO 7LHU
)RXQWDLQKHDG )RXQWDLQKHDG
 ,WHP 1DPH 0D[)ORZ &RUG :DWWV 0D[+HDG ,QOHW2XWOHW 3ULFH
 37 3RZHU-HW JSK ¶ : ¶´ ´´´ 
 37 3RZHU-HW JSK ¶ : ¶´ ´´´ 
 37 3RZHU-HW JSK ¶ : ¶´ ´´´ 
 37 3RZHU-HW JSK ¶ : ¶´ ´´´ 
 37 3RZHU-HW JSK ¶ : ¶´ ´´´ 
5HSODFHPHQWSDUWV
 37 3RZHU-HW JSK ¶ : ¶´ ´´´ 
DYDLODEOHXSRQUHTXHVW
 37 3RZHU-HW JSK ¶ : ¶´ ´´´ 
 37 3RZHU-HW JSK ¶ : ¶´ ´´´ 

/DJXQD0D[)OR6ROLGV+DQGOLQJ3XPSV
0D[)ORSXPSVDUHGHVLJQHGWRSURYLGHFRQWLQXRXVDQG
UHOLDEOHZDWHUFLUFXODWLRQ7KH\DUHLGHDOO\VXLWHGIRUD
 ,WHP ¶ ¶ ¶ ¶ ¶ ¶ YDULHW\RISRQGDSSOLFDWLRQVVXFKDVSURYLGLQJZDWHUIORZ
 37   ± ± ± ± WRILOWUDWLRQV\VWHPVDQGFUHDWLQJVSHFWDFXODUZDWHUIDOOV
 37    ± ± ± 0DGHLQ,WDO\WKHSXPSVDUHSRZHUHGE\DPDJQHWLFGULYHQ
 37      ± PRWRUWKDW¶VXQULYDOOHGLQWKHPDUNHWIRUJHQHUDWLQJODUJH
DPRXQWVRIZDWHUIORZDWH[WUHPHO\ORZHQHUJ\FRVWV7KLV
 37      ±
LVJUHDWQHZVIRUSHRSOHZKRDUHZDU\RIFRVWO\HOHFWULFLW\
 37      ± ELOOV,QIDFWVZLWFKLQJWRD/DJXQDSXPSZLOORIWHQSD\IRU
 37       LWVHOILQRQHVHDVRQ
 37      
0D[)ORSXPSVDUHGHVLJQHGWRSURFHVVZDWHUORDGHGZLWK
PRGHUDWHDPRXQWVRIVXVSHQGHGVROLGVDQGWUDQVSRUWWKHPWR
0D[)ORSXPSVDUHSRZHUHGE\D(XURSHDQHQJLQHHUHG VXLWDEOHH[WHUQDOILOWHUV\VWHPVZKLFKWKHQWUDSDQ\GHEULVWKDW
PDJQHWLFDOO\GULYHQPRWRUWKDWFRPELQHVKLJKSHUIRUPDQFHZLWK FRXOGSRWHQWLDOO\SROOXWHSRQGZDWHUHIIHFWLYHO\ILOWHULQJWKH
ORZHQHUJ\DQGPLQLPDOPDLQWHQDQFHFRVW7KHVHSXPSVDUH SRQG7KH\DUHFRPSOHWHO\VXEPHUVLEOHDQGGHVLJQHGWRUXQ
VXLWDEOHIRUDZLGHYDULHW\RISRQGDSSOLFDWLRQVLQFOXGLQJ FRQWLQXRXVO\LQIUHVKZDWHUIRU\HDUVRIWURXEOHIUHHRSHUDWLRQ
SUHVVXUL]HGILOWHUVVXUIDFHVNLPPHUVDQGRWKHUILOWUDWLRQV\VWHPV ,QFOXGHVD\HDUZDUUDQW\DQG8QLYHUVDO³&OLFNILW´KRVH
FRXSOLQJ´´ ´

 ,WHP 1DPH 0D[)ORZ &RUG :DWWV 0D[+HDG 6ROLGV 3ULFH 5HSODFHPHQWSDUWV


 37 0D[)OR JSK ¶ : ¶´ ´  DYDLODEOHXSRQUHTXHVW
 37 0D[)OR JSK ¶ : ¶´ ´ 
 37 0D[)OR JSK ¶ : ¶´ ´ 
 37 0D[)OR JSK ¶ : ¶´ ´ 
 37 0D[)OR JSK ¶ : ¶´ ´ 
 37 0D[)OR JSK ¶ : ¶´ ´ 
 37 0D[)OR JSK ¶ : ¶´ ´ 


38036 321'/,1(5&20

$OSLQH7RUQDGR3XPSV
$OSLQH7RUQDGR3RQG3XPSVDUHLGHDOIRUJHQHUDOSRQGDQGZDWHUIDOOXVH7KH\DUHGHVLJQHGIRUIOH[LELOLW\HVSHFLDOO\ZKHQJUHDWHU
IORZOHYHOVDUHQHHGHG7RUQDGR3RQG3XPSVFDQEHXVHGLQZDWHUIDOOVIRXQWDLQVILOWUDWLRQV\VWHPVDQGVSHFLDODSSOLFDWLRQV

‡2LO)UHHPDJQHWLFGULYH ‡ô´ó´WXELQJDGDSWHUVLQFOXGHG ‡¶&RUG ‡\HDUZDUUDQW\

 ,WHP 0D[)ORZ 0D[+HDG :DWWV 2XWOHW ,QOHW 'LPHQVLRQV 3ULFH


 3$& JSK ¶  ´037 ´ ´[´[´ 
 3$& JSK ¶  ´037 ´ ´[´[´ 
 3$& JSK ¶  ´037 ´ ´[´[´ 
 3$& JSK ¶  ´037 ´ ´[´[´ 

$OSLQH+XUULFDQH3XPSV
2XU+XUULFDQH3XPSVŒDUHLGHDOIRUKHDY\GXW\ZDWHUIDOORUILOWHUV\VWHPVDVLWKDVWKHQHHGHGSRZHUWRIRUFHODUJHTXDQWLWLHV
RIZDWHUWKURXJKORQJRUKLJKSLSHUXQVRUWKURXJKUHVWULFWLYH89&¶VDQGILOWHUV7KH\DUHGHVLJQHGIRUFRQWLQXRXVRSHUDWLRQ
HYHQLQWKHKDUVKHVWSRQGHQYLURQPHQW
‡2LOIUHHPDJQHWLFGULYHQHSR[\ ‡)W3RZHU&RUGV
SURWHFWHGFHUDPLFVKDIW ‡+HDY\GXW\ZDWHUIDOODSSOLFDWLRQV
‡&RVWVDYLQJHQHUJ\HIILFLHQWRSHUDWLRQ ‡<HDU:DUUDQW\
‡&HUDPLFLPSHOOHUIRUORQJOLIH          

 ,WHP 0D[)ORZ 0D[+HDG :DWWV 2XWOHW &RUG 3ULFH


 3$% JSK ¶´¶  ´WR´ ¶ 
 3$% JSK ¶´  ´WR´ ¶ 
 3$% JSK ¶´  ´WR´ ¶ 

3
$OSLQH3RZHU+HDG6WDWXDU\3XPSV
33 3/ ‡$GMXVWDEOHZDWHUIORZFRQWURO
‡5HOLDEOHTXLHWVXEPHUVLEOHZDWHUSXPSV
‡2LOIUHHPDJQHWLFDOO\GULYHQ
‡&RUG/HQJWKLV¶
‡3/FRPHVZLWKDOLJKW
‡\HDUOLPLWHGZDUUDQW\

 ,WHP 0D[)ORZ 0D[KHDG :DWWV 2XWOHW 'LPHQVLRQV 3ULFH


 3 JSK ¶´  ´ ´%DUEHG ´[´[´ 
 3 JSK ¶´  ´ ´%DUEHG ´[´[´ 
 3 JSK ¶´  ´%DUEHG ´[´[´ 
 3/ JSK ¶´  ´%DUEHG ´[´[´ 
 3 JSK ¶´  ´%DUEHG ´[´[´ 

         

7,3 +RZWRFDOFXODWHKHDGSUHVVXUH
+HDG3UHVVXUHLVWKHIRUFHWKDWDSXPS 9HUWLFDO/LIW ¶KHDGSUHVVXUH ƒ)LWWLQJ ¶KHDG
¶RI+RVH ¶KHDGSUHVVXUH 2WKHU)LWWLQJV ¶KHDG
PXVWRYHUFRPHWRSXVKZDWHURXWWKH
HQGRIDWXELQJUXQ7RFDOFXODWHKHDG ([DPSOH,I\RXUZDWHUIDOOLV¶KLJKDQG\RXKDYHRQHƒILWWLQJ¶RIWXELQJDQG
RWKHUILWWLQJVZRXOGEHWKHHTXLYDOHQWRIOLIWLQJWKHZDWHU¶KLJK
SUHVVXUH\RXPXVWWDNHLQWRDFFRXQW
UHVLVWDQFH RI YHUWLFDO OLIW OHQJWK RI 7KHEDVLFIRUPXODIRUGHWHUPLQLQJKHDGSUHVVXUHLV
SLSHILWWLQJVHWF 9HUWLFDO/LIW /HQJWKRIWXELQJ±  ƒ)LWWLQJV  2WKHU)LWWLQJV 7RWDO+HDG


866-766-3548 PUMPS

Sequence Titan Series External Pumps


As large water features and high turnover requirements continue
to gain popularity, the cost of energy does not! The highest
efficiency pumps available for water garden applications -
where you need them most, in high flow! With flow rates
between 12,000 gph and 32,000 gph and head capabilities
between 21 and 180 feet, the Sequence Titan series is sure to
cover most large scale water feature requirements.
• Made in the USA • Supplied with 230 volt, 8’ cord
• 115V or 230V Motor • 3 year warranty.

Item # Inlet/Outlet Max Flow Max Head Watts Amps Price


12000SEQ21-K 3” FPT / 2” FPT 12,500 gph 21’ 845 6.0 $824.00
18000SEQ45-K 3” FPT / 2” FPT 18,000 gph 45’ 2315 12.0 $2,396.00
31500SEQ180-K 3” FPT / 2” FPT 32,000 gph 180’ 13000 36.0 $3,009.00

Sequence Titan Flange Kit


Item # Size Pressure Rating Gasket Material Price
MP-FK-20.30 2” & 3” 150 psi Neoprene $120.00

7.5” 7”
Sequence Sequence
Strainer Basket - 500 ci Strainer Basket - 90 ci
19” 9”
Item # Size Price Item # Size Price
24166728 3” $279.00 1000.771-1 1 1/2” $89.00
24157724 1 1/2” - 2” $279.00 1000.771-7 2” $89.00 11”
11”

Sequence 750 Series External Pumps


The 750 Series External Pumps provide tremendous flow rates,
with enough head pressure to handle the requirements of most
systems with biological filters and moderate height waterfalls.
They are also used extensively for the transfer and re-circulation
requirements of filtration systems, water features, streams,
fountains and aquaculture.
• For small and simple ponds (3,000 gallons or less)
• Motor has totally enclosed fan for durability
• 115V Motor
• Includes 8’ cord
• 3 year warranty

Item # Inlet Outlet Max Flow Max Head Watts/Amps Price


3600SEQ12 2” 1.5” FPT 3600 gph 12’ 139/1.4 $340.00
4200SEQ12 2” 1.5” FPT 4200 gph 12’ 160/1.56 $352.00

33
38036 321'/,1(5&20

3RZHU6HULHV([WHUQDO3XPSV
)RUWKHDSSOLFDWLRQWKDWGHPDQGVKLJKSHUIRUPDQFH6HTXHQFH ‡0DGHLQWKH86$ ‡¶&RUG
RIIHUVWKH3RZHU6HULHVZLWKDEXQGDQWIORZDQGSUHVVXUH ‡9RU9 ‡\HDUOLPLWHGZDUUDQW\
7KH3RZHUSXWVWKHKRUVHSRZHUDQGHIILFLHQF\LQWRWKH
SUHVVXUHVLGHRIWKHSHUIRUPDQFHUHTXLUHPHQWEXWPDLQWDLQV
IORZUDWHVWKDWZLOOPHHWWKHPRVWFKDOOHQJLQJRIVFHQDULRV
0RWRULVWRWDOO\HQFORVHGIDQFRROHGIRUGXUDELOLW\  ,WHP ¶ ¶ ¶ ¶ ¶
3:5     
 3:5     
 3:5     

 ,WHP 0D[)ORZ 0D[+HDG :DWWV $PSV ,QOHW2XWOHW 9ROWV 3ULFH


 3:5 JSK ¶   ´)37 RU 
 3:5 JSK ¶   ´)37 RU 
 3:5 JSK ¶   ´)37 RU 

6HTXHQFH6HULHV([WHUQDO3XPSV
,QWURGXFLQJWKH1(:6HTXHQFH7KHQHZH[SDQVLYH
GHVLJQZLOOPHHWWRGD\¶VLQFUHDVHGPDUNHWGHPDQGIRU
SHUIRUPDQFHRQDOOOHYHOV3HDNSHUIRUPDQFHRIJSKZKLOH
RQO\UHTXLULQJ:DWWV(YHU\6HTXHQFH0RGHOLV
VXSSOLHGZLWK´)137DQG%XWWUHVVWKUHDGSRUWVDQGXQLRQVIRU
HDVHRIXVH
‡0DGHLQWKH86$ ‡6XSSOLHGZLWK¶FRUG
‡9 ‡\HDUOLPLWHGZDUUDQW\

 ,WHP ,QOHW2XWOHW 0D[)ORZ 0D[+HDG :DWWV $PSV 3ULFH


 6(4 ´)37´037 JSK ¶   
 6(4 ´)37´037 JSK ¶   
 6(4 ´)37´037 JSK ¶   
 6(4 ´)37´037 JSK ¶   
 6(4 ´)37´037 JSK ¶   

6HTXHQFH3ULPHU$OSKD3XPSV
7KH3ULPHU$OSKDVHULHVLQWHJUDWHVDEDVNHWW\SHSUHILOWHUDQG ‡0DGHLQWKH86$
VHOISULPLQJFDSDELOLWLHVLQWRRQHHIILFLHQWSDFNDJHIRUWURXEOHIUHH ‡¶&RUG
RSHUDWLRQ6LQFHDQLQWHUQDOGLIIXVHUDOORZVIRUGLVSODFHPHQWRI ‡9RU9
WUDSSHGDLUWKLVW\SHRISXPSZLOOFRQWLQXHWRPRYHZDWHUHYHQ ‡\HDUOLPLWHGZDUUDQW\
ZKHQWKHUHLVVRPHDLULQWKHOLQH7KHLQWHJUDWHGVWUDLQHUEDVNHW
RQDOOWKHSULPHUXQLWVKHOSVSURWHFWWKHLQWHUQDOURWDWLQJSDUWVRI
WKHSXPSIURPGDPDJHGXHWRH[WHUQDOGHEULVEHLQJSXOOHGLQWRWKH
SXPS7KHVLPSOHFRYHUDOORZVIRUTXLFNFOHDQLQJDQGUHSODFHPHQW  ,WHP ¶ ¶ ¶ ¶ ¶
%HFDXVHWKHXQLWFDQRSHUDWHIRUVKRUWSHULRGVRIWLPHZLWKRXWIXOO 350     
ZDWHUIORZLWSURYLGHVDVPDOOFXVKLRQRIFRPIRUWWRWKHRZQHUVRI 350     
WKRVHV\VWHPVZKHUHWKHZDWHUOHYHOGURSVEHORZWKHLQWDNHSRLQW
0RWRULVWRWDOO\HQFORVHGIDQFRROHGIRUGXUDELOLW\
 ,WHP 0D[)ORZ 0D[+HDG :DWWV $PSV 9ROWV ,QOHW2XWOHW 3ULFH
 350 JSK ¶   RU ´)37 
 350 JSK ¶   RU ´)37 


 38036

9DOX)OR6HULHV([WHUQDO3XPSV
7KHFRPSDFWVHULHVGHOLYHUVELJIORZIRUOLWWOHSRZHU*UHDWIRUVPDOOHUDQGVLPSOHSRQGV JDOVRUOHVV 7KH
PRWRULVWRWDOO\HQFORVHGDQGIDQFRROHGIRUGXUDELOLW\6XSSOLHGZLWKDQ¶FRUGVHW

‡0DGHLQWKH86$ ‡¶&RUG/HQJWK
‡9RU9 ‡PRQWKOLPLWHGZDUUDQW\

 ,WHP ¶ ¶ ¶ ¶ ¶


9$)     

 ,WHP 0D[)ORZ 0D[+HDG :DWWV $PSV ,QOHW2XWOHW 9ROWV 3ULFH


 9$) JSK ¶   ´´  

9DOX)OR6HULHV([WHUQDO3XPSV
7KHVHULHVKDVVHWWKHVWDQGDUGE\ZKLFKDOORWKHUVDUHPHDVXUHG3HUIHFWEOHQGRIPHGLXPSUHVVXUHDQGDPSOHIORZ
IRUWKHPDMRULW\RISRQGV0RWRULVWRWDOO\HQFORVHGDQGIDQFRROHGIRUGXUDELOLW\

‡0DGHLQWKH86$ ‡¶&RUG/HQJWK
‡9RU9 ‡PRQWKOLPLWHGZDUUDQW\
 ,WHP ¶ ¶ ¶ ¶ ¶
9$)     
9$)     
9$)     
9$)     

 ,WHP 0D[)ORZ 0D[+HDG :DWWV $PSV ,QOHW2XWOHW 9ROWV 3ULFH


 9$) JSK ¶   ´´ RU 
 9$) JSK ¶   ´´ RU 
 9$) JSK ¶   ´´ RU 
 9$) JSK ¶   ´´ RU 

7KLQJV<RX6KRXOG.QRZ$ERXW([WHUQDO3XPSV 7,3
([WHUQDO SRQG SXPSV ZRUN EHVW IRU PHGLXP WR ODUJHU VL]HG SRQGV ZLWK  JDOORQV RI ZDWHU RU PRUH 7KH\ DOVR
ZRUNJUHDWIRUPHGLXPWRODUJHGLVDSSHDULQJZDWHUIDOOV7KHH[WHUQDOSXPSLVRIWHQWKHEHVWFKRLFHEHFDXVHWKH\DUH
W\SLFDOO\PRUHHQHUJ\HIILFLHQWDQGFDQKDQGOHODUJHUZDWHUIORZVZLWKKLJKHUKHDGSUHVVXUH7KHVHSXPSVXVXDOO\
FRPHZLWKDSULPLQJSRWDQGOHDIVWUDLQHUZKLFKLVHDVLO\DFFHVVLEOH

‡.HHSSXPSDVFORVHWRWKHSRQGDVSRVVLEOH,WQHHGV
WREHZLWKLQIWRIWKHHGJHRIWKHSRQGRUOHVV
‡,GHDOO\WKHSXPSQHHGVWREHSODFHGRQJURXQGOHYHORU
EHORZWRZRUNWKHEHVW
‡$SULPLQJSRWRQWKHLQWDNHLVUHFRPPHQGHGLQRUGHUWR
KHOSWKHSXPSVWD\SULPHG
‡,IDSULPLQJSRWLVQRWXVHGDFKHFNYDOYHRQWKHLQWDNH
OLQHFDQZRUNDVZHOOWRKHOSWKHSXPSNHHSLWVSULPH


89&/$5,),(56 321'/,1(5&20

6HQWU\89&ODULILHUV6WHULOL]HUV
$FFHVVRULHV
 ,WHP 1DPH 3ULFH
‡,QGLFDWRUVVKRZLIEDOODVWRUEXOELVQRWZRUNLQJSURSHUO\
‡,QVWDQWVWDUWEDOODVWILUHVLPPHGLDWHO\DQGGRHVQ¶WGHFUHDVH  / :DWW89/DPS 
ODPSOLIH  / :DWW89/DPS 
‡6SHFLDOO\FRDWHGODPSVODVWORQJHUWKDQRWKHUEXOEV  / :DWW89/DPS 
H[WHQGLQJODPSOLIHWRKRXUV/DPSVFDQODVWXSWRVHDVRQV  46 94XDUW]6OHHYH 
‡2SWLRQDOVWDLQOHVVVWHHOOLQLQJLQFUHDVHVNLOOLQJSRZHUE\
‡&RPHVZLWKD¶&RUG  46 94XDUW]6OHHYH 
‡/LIHWLPHZDUUDQW\RQ39&KRXVLQJDQG\HDUZDUUDQW\RQEDOODVW  46 94XDUW]6OHHYH 
 %/3 :%DOODVW 
 %/3 :%DOODVW 
 %/3 :%DOODVW 
   &ODUL¿HV 6WHULOL]HV 
 ,WHP 1DPH 3RQG6L]H)ORZ5DWH 3RQG6L]H)ORZ5DWH ,QOHW2XWOHW 3ULFH
 39&8 :DWW JDOJSK JDOJSK ´6OLS 
 39&/ :DWWZ66LQVHUW JDOJSK JDOJSK ´6OLS 
 39&8 :DWW JDOJSK JDOJSK ´6OLS 
 39&/ :DWWZ66LQVHUW JDOJSK JDOJSK ´6OLS 
 39&8 :DWW JDOJSK JDOJSK ´6OLS 
 39&/ :DWWZ66LQVHUW JDOJSK JDOJSK ´6OLS 

/LWWOH*LDQW89&ODULIHUV
$FFHVVRULHV
/LWWOH*LDQW89OLJKWVHOLPLQDWHJUHHQZDWHUIDVWDQGGHVWUR\  ,WHP 1DPH 3ULFH
KDUPIXOEDFWHULDGLVHDVHFDXVLQJSDWKRJHQVDQGRWKHU
FRQWDPLQDWHVWKDWFRPSURPLVHSRQGKHDOWKDQGEHDXW\  :DWW89/DPS 
 :DWW89/DPS 
%XLOWWRODVWIURPLQGXVWULDOJUDGHPDWHULDOVWKHVHXQLWVKDYH  :DWW89/DPS 
DVDIHW\IHDWXUHWRSUHYHQW89&UDGLDWLRQH[SRVXUH:LWK  :4XDUW]6OHHYH 
DURWDWDEOHFRQQHFWRUWKDWPDNHVWKHPHDV\WRLQVWDOOWKHVH
LQQRYDWLYHOLJKWGULYHILOWUDWLRQV\VWHPVDUHGRXEOHVHDOHGDQG  :4XDUW]6OHHYH 
SOXPEHGLQOLQHIRUHDV\PDLQWHQDQFH(DFKFRPHVZLWKPRXQWLQJ  :4XDUW]6OHHYH 
EUDFNHWVSOXPELQJDGDSWRUVDQGD¶FRUG  :25LQJ IRUVOHHYH  
 :25LQJ IRUVOHHYH  
 25LQJ(OHFWULFDO+RXVLQJ 
 ,WHP 1DPH 3RQG6L]H ,QOHW2XWOHW 'LPHQVLRQV 3ULFH  :DWW)LWWLQJV 
  893 JSK ´´)LWWLQJV ´[´[´ 
 :DWW)LWWLQJV 
  893 JSK ´´´)LWWLQJV ´[´[´ 
  893 JSK ´´´)LWWLQJV ´[´[´ 

3RQGPDVWHU89&ODULILHU
$FFHVVRULHV
‡&DQEHXVHGLQRURXWRIWKHZDWHU  ,WHP 1DPH 3ULFH
‡)XOO\VXEPHUVLEOHXQLW¶VYRUWH[IORZGHVLJQH[SRVHVZDWHU
  :DWW89/DPS 
ORQJHUWRXOWUDYLROHWOLJKW
‡*ORZLQJPRQLWRUKDORULQJYLVLEOHIURPDQ\DQJOH   :DWW89/DPS 
LPPHGLDWHO\VKRZVLWLVZRUNLQJ   :DWW89/DPS 
‡&RPHVFRPSOHWHZLWKKRXUORQJOLIHODPSDQGZDWHU   94XDUW]6OHHYH 
WLJKWTXDUW]VOHHYH
  94XDUW]6OHHYH 
‡,QFOXGHVWUDQVIRUPHUDQG¶JURXQGHGSRZHUFRUG
‡%ODFNFRORULVXQREWUXVLYHZKHWKHUXVHGLQRURXWRIWKH   94XDUW]6OHHYH 
ZDWHU   :DWW89%DOODVW 
‡\HDUZDUUDQW\   :DWW89%DOODVW 
  :DWW89%DOODVW 
 ,WHP :DWWV 5HF3RQG6L]H 5HF3XPS)ORZ ,QOHW2XWOHW 'LPHQVLRQV 3ULFH
  : JSK JSK ´%DUEHG ´/ 
  : JSK JSK ´%DUEHG ´/ 
  : JSK JSK ´7KUHDGHGZ´%DUEHG(OERZ ´/ 


 6.,00(56

6DYLR&RPSDFW6NLPPHUILOWHU
6WXUG\PXOWLIXQFWLRQDOILOWUDWLRQUHGXFHVPDLQWHQDQFHFROOHFWVGHEULVDQGKLGHVXQVLJKWO\SXPSVDQGSOXPELQJ

‡7UDSVODUJHGHEULVIRUHDV\UHPRYDO SXPSSURWHFWLRQ
‡5HPRYHVXSWRRIGHEULV
‡6XSSRUWVELRORJLFDOKHDOWKSURYLGHVPHFKDQLFDOILOWUDWLRQDQGSROLVKHVZDWHU
‡(OLPLQDWHVJUHHQZDWHU LPSURYHVZDWHUTXDOLW\ZKHQRSHUDWHGZLWKRSWLRQDO89&
‡2QHEXLOWLQ89SRUWIRURSWLRQDO89FODULILHU

6DYLR6NLPPHUSXUFKDVHGEHIRUHZLOOQHHGEDIIOHVKLHOGVIRUWKHQHZ89OLJKWV

 ,WHP :HLU)DFHSODWH )ORZ5DWH 'LPHQVLRQV 3ULFH


 &6&6: ´ JSK ´:[´/[´+ 
 &6&6: ´ JSK ´:[´/[´+ 

6DYLR&RPSDFW 6DYLR6NLPPHUILOWHU$FFHVVRULHV
6NLPPHU$FFHVVRULHV ,WHP 1DPH 3ULFH  ,WHP 1DPH 3ULFH
 689 :DWW89LQH[$VVHPEO\   .5 $XWR¿OO.LW5LJKW 
,WHP 1DPH 3ULFH  689 :DWW89LQH[$VVHPEO\   ./ $XWR¿OO.LW/HIW 
 689 :DWW89LQH[$VVHPEO\   58 :7UDQVIRUPHU   56 5HSODFHPHQW/LG 
 58 :7UDQVIRUPHU   58 :7UDQVIRUPHU   56 5HSODFHPHQW%DVNHW 
 58 :DWW%XOE   58 :DWW%XOE SURQJ    56 5HSO0HGLD)UDPH$VV\ 
 58 :DWW&RDWHG/DPS   58 :DWW%XOE SURQJ    56 5HSODFHPHQW0DW 
 5& 5HSODFHPHQW0HGLD   58 896OHHYHIRU:DWW   56 6FUHZ3DFNDJH 
 5& 6FUHZ3DFNHW   58 :DWW89%XOE   56 %DIÀH6KLHOG/HIW6LGH 
 5& 5HSODFHPHQW/LG   58 :DWW%XOE   56 %DIÀH6KLHOG5LJKW6LGH 
 5& 5HSODFHPHQW%DVNHW   . 0LG:DWHU,QWDNH.LW   56 %DIÀH%ORFN 
 5&$ 5HSODFHPHQW%DVNHWZ+DQGOH   . ([WHUQDO3XPS.LW   . 6WRQH&RYHU 
 . 'LVFKDUJH.LW:06 
 . 'LVFKDUJH.LWIRU:0&3XPSV  6DYLR'LVFKDUJH.LWV
 . 6WRQH&RYHU 
 5& SLHFHPHGLDIUDPH  ,WHP 3XPSV 3ULFH ,WHP 3XPSV 3ULFH
 5& %DIÀH6KLHOG   . :DWHU0DVWHU&OHDU3XPSV   . :06  
 . :06  

6DYLR6NLPPHUILOWHU
 0DFUR)LOWUDWLRQ7UDSVODUJHGHEULVIRUHDV\UHPRYDO 6WXUG\PXOWLIXQFWLRQDOILOWUDWLRQUHGXFHVPDLQWHQDQFH
DQGSXPSSURWHFWLRQ FROOHFWVGHEULVDQGKLGHVXQVLJKWO\SXPSVDQGSOXPELQJ
 6NLPPHU)LOWUDWLRQ5HPRYHVXSRIRIGHEULV ‡3URYLGHVFRPSOHWHILOWUDWLRQIRUSRQGVXQGHUJDOORQV
 %LRORJLFDO)LOWUDWLRQ6XSSRUWVKHDOWKSURYLGHV ‡7UDSVODUJHGHEULVIRUHDV\UHPRYDO SXPSSURWHFWLRQ
PHFKDQLFDO¿OWUDWLRQDQGSROLVKHVZDWHU ‡5HPRYHVXSWRRIGHEULV
 89)LOWUDWLRQ(OLPLQDWHVJUHHQZDWHUDQGLPSURYHVZDWHU ‡6XSSRUWVELRORJLFDOKHDOWKSURYLGHVPHFKDQLFDOILOWUDWLRQ
TXDOLW\ZKHQRSHUDWHGZLWKRSWLRQDO89&ODUL¿HU DQGSROLVKHVZDWHU
‡(OLPLQDWHVJUHHQZDWHU LPSURYHVZDWHUTXDOLW\ZKHQ
RSHUDWHGZLWKRSWLRQDO89&

:KDWPDNHVWKH6DYLR6NLPPHU%HWWHU
‡6WXUG\QRQVNLGFRYHUZLWKVHFXULW\ORFNQXWV
  ‡%XLOWLQ89SRUWVWRKRXVHRSWLRQDO89&ODULILHUV
 ‡2SWLRQDOH[WHUQDOSXPSFRQQHFWLRQ
‡,QWHJUDWHGZDWHUVWRSIODQJHIRUFRQFUHWHLQVWDOODWLRQV
 ‡2QHFOLFNORFNLQJZHLUDOORZVFRPSOHWHLVRODWLRQIRUFOHDQLQJ ZLQWHUL]DWLRQ
‡&RPHVZLWKIUHHGHVLJQ FRQVWUXFWLRQJXLGH
‡\HDUZDUUDQW\
 ,WHP :HLU)DFHSODWH )ORZ5DWH 'LPHQVLRQV 3ULFH
 6666: ´ JSK ´:[´/[´+ 
 6666: ´ JSK ´:[´/[´+ 
 6666: ´ JSK ´:[´/[´+ 


6.,00(56 321'/,1(5&20

$WODQWLF:DWHU*DUGHQV%LJ%DKDPD6NLPPHUV
%LJ%DKDPD6NLPPHUVDQG)LOWHU)DOOVIHDWXUH
KHDY\GXW\FRPSRQHQWVWKDWVWDQGXSWR\HDUV
RIXVH6NLPPHUVFRPHHTXLSSHGZLWK6XSHU
)ORZZHLUGRRUVGHEULVQHWDQGRYHUVL]HG
EUXVKSDQHOVWKDWUHGXFHPDLQWHQDQFH$WODQWLF
DOVRRIIHUVDFRPSOHWHOLQHRIDFFHVVRULHVVR
\RXFDQFXVWRPL]H\RXUVNLPPHUIRUHYHU\
DSSOLFDWLRQ%HVWRIDOO$WODQWLFVWDQGVEHKLQG
LWVUXJJHGHQFORVXUHVZLWKD/LIHWLPH:DUUDQW\
3636 36 3636 3636

 ,WHP )DFHSODWH )ORZ5DWH )LOWHULQJ 0DWFKLQJ)LOWHUIDOOV 'LPHQVLRQV 3ULFH


 36 ´ JSK %DVNHW %) ´:[´/[´+ 
 36 ´ JSK 1HW%UXVK3DQHO %) ´:[´/[´+ 
 36 ´ JSK 1HW%UXVK3DQHO %) ´:[´/[´+ 
 36 ´ JSK 1HW%UXVK3DQHO %) ´:[´/[´+ 
 36 ´ JSK 1HW%UXVK3DQHO %) ´:[´/[´+ 
 36 ´ JSK 1HW%UXVK3DQHOV %) ´:[´/[´+ 
 36 ´ JSK 1HW%UXVK3DQHOV %)%)[ ´:[´/[´+ 

$WODQWLF:DWHU*DUGHQV5HWDLO6HULHV6NLPPHUV
$WODQWLF¶VUHWDLOVHULHVSURYLGHVWKHKLJKHVWFRPELQDWLRQRIWHFKQRORJ\DQGKLJKTXDOLW\DWDQDIIRUGDEOHSULFH
‡6XSHU)ORZ:HLUGRRUVIRUPD[LPXPVXUIDFHFOHDQLQJ
‡+HDY\GXW\EDVNHWWRFDWFKODUJHGHEULVOLNHOHDYHVDQGJUDVV
‡)LOWUDWLRQPDWIRUPHFKDQLFDOILOWUDWLRQ
‡'HVLJQHGWREHHDVLO\FDPRXIODJHGZLWKQDWXUDOPDWHULDOVDQGSODQWV
‡5XJJHGKLJKPROHFXODUZHLJKWSRO\HWK\OHQHVKHOOKDVDOLIHWLPHZDUUDQW\
‡(DFKXQLWLQFOXGHVUHPRYDEOHOLGILOWHUPDWEDVNHWDQGVLOLFRQH

,WHP)DFHSODWH )ORZ5DWH )LOWHULQJ 0DWFKLQJ)LOWHUIDOOV 'LPHQVLRQV 3ULFH


36 ´ JSK %DVNHW0DW %)%) ´:[´/[´+ 
36 ´ JSK %DVNHW0DW %) ´:[´/[´+ 

$WODQWLF)LOWHUIDOO $WODQWLF6NLPPHU$FFHVVRULHV
,WHP 1DPH 6NLPPHU 3ULFH
6NLPPHU&RPERV  %. 5HSODFHPHQW%UXVK.LW 3636 
 0. 0DW.LW 3636 
 ,WHP 1DPH 3ULFH
 60 5HSODFHPHQW0DW 3636 
 ),/7 &RPER%)36 
 60 5HSODFHPHQW0DW 3636 
 ),/7 &RPER%)36 
 17 5HSODFHPHQW1HW 3636 
 ),/7 &RPER%)36 
 %6 5HSODFHPHQW%DVNHW 3636 
 %. 5HSO%UXVK.LW 3636 
5RFN/LGV)RU %. 5HSO%UXVK.LW 3636 

$WODQWLF6NLPPHUV  0.
 60
0DW.LW
5HSODFHPHQW0DW
3636
3636


 17 5HSODFHPHQW1HW 3636 
‡6DQGVWRQH%URZQ
17 5HSODFHPHQW1HW 3636 
 ,WHP 6NLPPHU 3ULFH  $) $XWR)LOO.LW $OO 
 6/% 36 
 *. *DWH.HHSHU%UXVKHV´:HLU 36 
 6/% 3636 
 *. *DWH.HHSHU%UXVKHV´:HLU 36 
6/% 3636 
 *. *DWH.HHSHU%UXVKHV´:HLU 3636 
 *. *DWH.HHSHU%UXVKHV´:HLU 36 


 6.,00(56

/LWWOH*LDQW6NLPPHUV

 6WXUG\HDV\WRUHPRYHOLGZLWK 7KHVHGXUDEOHVNLPPHUVLPSURYH
RSWLRQDOVDQGILOOSRUW
VXUIDFHFOHDQLQJZLWKDQHDV\IORZ
 (DV\WRFOHDQEUXVKHVKHOSEUHDNXS WKURXJKGHVLJQWKDWERWKVLPSOLILHV
 GHEULV LQVWDOODWLRQDQGPLQLPL]HVPDLQWHQDQFH
 +HDY\GXW\QHWFDWFKHVODUJHGHEULV ‡6NLPPHUVFRPHZLWKDEXONKHDG
  +DQGOHVODUJHSXPSV EXWQRWQHFHVVDU\IRUXVH
 3OXPEIURPHLWKHUVLGH ‡\HDUZDUUDQW\
 /RFNDEOHVNLPPHUGRRUUHVWULFWVZDWHU
HDVLHUFOHDQLQJDQGPDLQWHQDQFH

  6XSSRUWHGJHDGGVVWUHQJWKDQG 3XPSV3HRSOH3DUWQHUVKLSV
ULJLGLW\

 &LUFXODUGHVLJQIRUPD[LPXPVWUHQJWK  ,WHP 1DPH 0D[)ORZ 'LPHQVLRQV 3ULFH

   6. JSK ´[´[´ 
 ,QOHWVFUHHQSUHYHQWVDTXDWLFOLIH
  IURPHQWHULQJXQLW  6. JSK ´[´[´ 
 %RWWRPVLSKRQSDUWV  6. JSK ´[´[´ 

/LWWOH*LDQW6NLPPHU$FFHVVRULHV
 ,WHP 1DPH 6NLPPHU 3ULFH  ,WHP 1DPH 6NLPPHU 3ULFH
  5HSODFHPHQW/LG 66.    0DWDOD3DG 66. 
  5HSODFHPHQW/LG 66.    %UXVK5HSO.LW $OO 
  5HSO,QOHW6FUHHQ 6.    $XWR)LOO.LW $OO 
  5HSO,QOHW6FUHHQ 66.    9&XW2II6ZLWFK $OO 
  5HSO,QOHW6FUHHQ 66.    9&XW2II6ZLWFK $OO 
  5HSODFHPHQW1HW 6.    %RWWRP'UDLQ.LW $OO 
  5HSODFHPHQW1HW 66.    ´'LVFKDUJH.LW '.$  $OO 
  5HSODFHPHQW1HW 66.    ´´'LVFKDUJH.LW '.%  $OO 
  0DWDOD3DG 6.    ´'LVFKDUJH.LW '.&  $OO 
  0DWDOD3DG 66. 

/DJXQD3RZHU)OR6NLPPHU)LOWHU
7KH/DJXQD3RZHU)OR6NLPPHU)LOWHULVDKLJKSHUIRUPDQFHVXUIDFHVNLPPLQJILOWHUWKDWSURYLGHVWKHXOWLPDWHZDWHU
PDQDJHPHQWVROXWLRQIRUODUJHSRQGVXSWR86JDOORQV

,WLVGHVLJQHGWRPDNH\RXUZDWHUJDUGHQLQJH[SHULHQFHVLPSOHDQGHQMR\DEOH7DQJLEOHEHQHILWVLQFOXGHFOHDUDQGKHDOWK\
SRQGZDWHUORZPDLQWHQDQFHDQGDSOHDVDQWZDWHUJDUGHQHQYLURQPHQW

7KHXQLWIHDWXUHVODUJHFDSDFLW\FKDPEHUVWKDWFDQDFFRPPRGDWHVSHFLDOILOWHUSDGVDVZHOODVELRORJLFDODQGFKHPLFDO
ILOWHULQJPHGLD$OOFKDPEHUVLQFOXGHDKDQGOHIRUHDV\UHPRYDODQGFOHDQLQJ7KHILUVWFKDPEHULVVXSHUVL]HGDQGGHVLJQHG
WRFROOHFWOHDYHVDQGODUJHGHEULV$VZDWHUIORZVWKURXJKWKHFKDPEHUVLWLVWKRURXJKO\FOHDQVHGDQGILOWHUHG7KHUHVXOWLV
FOHDQDQGKHDOWK\SRQGZDWHUIRUILVKDQGSODQWVWRWKULYHLQ

2WKHUIHDWXUHVLQFOXGHDVHOIDGMXVWLQJIORDWLQJGRRUWKDWKHOSVSUHYHQWILVKIURPEHLQJGUDZQLQVLGHDPSOHVSDFHIRUSXPS
LQVWDOODWLRQDZLQWHUL]LQJDQGZDWHUGUDLQDQGKHDY\GXW\FRQVWUXFWLRQZLWKUHLQIRUFHGOLG

$PHFKDQLFDOILOWHUSDG/DJXQD%LRVSKHUHVELRORJLFDOILOWHUPHGLDDQGD\HDUZDUUDQW\DUHDOVRLQFOXGHG

7KHILOWHUFDQEHFRQQHFWHGWR/DJXQD¶V3RZHU)OR)LOWHU)DOOVIRUH[WUDILOWHULQJFDSDFLW\IRUSRQGVXSWR86JDO

‡ODUJHPHGLDFKDPEHUV ‡6HOIDGMXVWLQJIORDWLQJGRRUKHOSVSUHYHQWILVKIURP
‡+DQGOHVRQDOOFKDPEHUVIRUHDV\UHPRYDODQGFOHDQLQJ HQWHULQJWKHILOWHU
‡)LUVWFKDPEHULVVXSHUVL]HGDQGGHVLJQHGWRFROOHFW ‡$ZLQWHUL]LQJDQGZDWHUGUDLQ
OHDYHVDQGODUJHGHEULV ‡+HDY\GXW\FRQVWUXFWLRQZLWKUHLQIRUFHGOLG
‡$PSOHVSDFHIRUSXPSLQVWDOODWLRQ ‡)RUODUJHSRQGVXSWR86JDOORQV

 ,WHP 3RQG6L]H )ORZ5DWH 'LPHQVLRQV 2XWOHW 3ULFH


 37 JDO JSK ´:[´/[´+ ´6OLS 


SKIMMERS PONDLINER.COM

EasyPro Pond Skimmer


• Large capacity chambers for mechanical, biological and chemical
filter media.
• Removable chamber is super-sized and designed to collect leaves
and large debris.
• Reinforced lid (supports up to 400 lbs.)
• Heavy duty injection molded construction for durable performance.
• Replacement parts available upon request.
• Extension fits the small and medium skimmers.
Small Mini • Small and medium skimmers include filter brushes.
• Large skimmer does not include filter mat.
Large • 5 year warranty

Item # Size Pond Size Pump Size Faceplate Price


PSMFB Mini 250 sq.ft. 3,000 gph 6” $245.00
PS1FB Small 600 sq.ft. 6,000 gph 8” $335.00
PS2 Large 600 sq.ft. 15,000 gph 16” $499.00

Cal Pump Skimmers


Clearing the pond surface of organic material, such as leaves and airborne
pollen, can greatly aid pond clarity. Use the Cal Pond Skimmer as the intake
unit for your pump and enjoy clean, clear water. Cal Pump Pond Skimmers
are ideal for use in preformed ponds, where cutting a hole is not an option.
CSK2 Includes both 1” and 1 1/2” MNPT Inlet Fittings.

SK1 • Can be installed in any new or existing pond • Compact size, making it easy to conceal
• Hanger straps for easy installation • Skims debris from the surface for less organic
• 1” and 11/2” MNPT fittings included material in the water
• UV resistant for longevity • 1 year warranty
• Lift-out strainer basket for easy service

Item # Pond Size Faceplate Filtering Fittings Dimensions Price


SK1 150 sq.ft. 8” Basket, Mat 1” & 1 1/2” MNPT 14” x 8.5” x 10.75” $75.00
CSK2 300 sq.ft. 12” Basket, Mat 1” & 1 1/2” MNPT 24.75” x 13.25” x 14.5” $149.00

TIP

Skimmer Installation tips


Pond skimmers collect debris and dirt from • Always use hand tools when installing the screws. Power tools will strip out the screws.
the surface of the water, keeping your pond • Leave extra liner under the opening of the skimmer for expansion of the pond water. Leave
clean. Most pond skimmers also house the several inches of extra liner to allow it to move during the filling process. As the pond fills the
pond pump, and contain filter media to clean liner will expand, and if the liner is too tight against the skimmer you will not have a good fit.
the water. Pond skimmers are effective while • Make sure to set the skimmer at ground level and deep enough to have the water level mid
being easy to disguise or hide – helping the point to 3/4 way up on opening when the pond is full.
pond to retain a natural look. • If you have trouble getting the screw started use a hole punch to make a hole through the
liner then set the screw into the faceplate.

40
 $,538036

3RQGPDVWHU$LU3XPSV
‡(QHUJ\HIILFLHQW
‡+LJKYROXPHZLWKVWHDG\DLUIORZ
‡4XLHWRSHUDWLRQ
‡$LUGLIIXVHULQFOXGHG
 WXELQJQRWLQFOXGHG
‡¶&RUG
‡\HDUZDUUDQW\
$3 $3
$3
$3
7KH3RQGPDVWHUDLUSXPSVKDYHEHHQGHVLJQHGWRVDWLVI\WKHUHTXLUHPHQWVRIDPXOWLWXGHRIZDWHUUHODWHGDSSOLFDWLRQV7KH
QRQRLOOXEULFDWHGPRWRULVGHVLJQHGWRRSHUDWHHIILFLHQWO\DQGVDYHHQHUJ\)RURXWGRRUDSSOLFDWLRQVLWLVUHFRPPHQGHGWKDW
WKHXQLWEHHQFORVHGWRSURWHFWLWIURPWKHHOHPHQWV$LUWXELQJQHHGVWRPDWFKDLUSXPSRXWOHWVL]H

   $LU9RO  
 ,WHP 1DPH &X,QSHU0LQ  :DWWV 2XWOHW 3RQG6L]H 'LPHQVLRQV 3ULFH
  $3   ´  ´[´[´ 
  $3   ´  ´[´[´ 
  $3   ´  ´[´[´ 
  $3   ´  ´[´[´ 

/DJXQD$HUDWLRQ.LW
/DJXQD$HUDWLRQ.LWLQFOXGHVHYHU\WKLQJ\RXQHHGWRHQKDQFHWKHTXDOLW\RISRQGZDWHUGXULQJWKHFROGZLQWHUPRQWKV
DVZHOODVWKHKRWVXPPHUVHDVRQ,QZLQWHULWFUHDWHVDQRSHQLQJDWWKHSRQGVXUIDFHDQGSUHYHQWVWKHVXUIDFHIURP
FRPSOHWHO\IUHH]LQJRYHU7KLVDOORZVWKHUHOHDVHRIWR[LFJDVHVDQGWKHUHSOHQLVKPHQWRIIUHVKR[\JHQWKDWLVFULWLFDO
IRUWKHVXUYLYDORIILVK,QWKHVXPPHULWSURYLGHVVXSSOHPHQWDODHUDWLRQZKLFKLPSURYHVWKHTXDOLW\RISRQGZDWHUDQG
LWVLQKDELWDQWV ,QFOXGHV
‡2SWLPDKLJKRXWSXWDGMXVWDEOHDLUSXPS ‡6W\URIRDPIORDW
‡¶DLUOLQHWXELQJ ‡\HDUZDUUDQW\
‡´DLUVWRQH

 ,WHP :DWWV 9ROWV 3ULFH


 37   

/DJXQD´$LUVWRQH /DJXQD$LUVWRQH7XELQJ
7KH/DJXQD´$LU6WRQHVDUHVSHFLILFDOO\GHVLJQHG /DJXQD$LUOLQH´7XELQJIRUSRQGVLVVSHFLILFDOO\
IRUWKH/DJXQD$HUDWLRQ.LW7KH\DWWDFKWRWKHDLUOLQH GHVLJQHGIRUWKH/DJXQD$HUDWLRQ.LW7KHUHSODFHPHQW
WXELQJDQGGLIIXVHVDLUWKURXJKRXWWKHSRQG WXELQJLVVDIHIRUZLQWHUDQGVXPPHUXVH
 ,WHP 3ULFH  ,WHP /HQJWK 3ULFH
 37   37 ¶ 

/LWWOH*LDQW$LU3XPS
‡&DQEHXVHGXQGHUZDWHURUDERYHJURXQG
‡,QFOXGHVWXELQJDQGGLIIXVHU
‡8SWRIRRWGHHS
3XPSV3HRSOH3DUWQHUVKLSV ‡3URYLGHVYDOXDEOHSRQGDHUDWLRQIRUSODQWVDQGILVK
‡¶FRUG
‡\HDUZDUUDQW\
‡´:[´+[´/

 ,WHP :DWWV 9ROWV $LU9ROSHU+RXU 3ULFH


    *DOORQV 


$,538036 321'/,1(5&20

$TXD&RQWURO$LU3UR/DNH%HG$HUDWLRQ6\VWHP
‡3RZGHUFRDWHGDOXPLQLXPHQFORVXUHIHDWXUHVDOLIHWLPH ‡4XLHWRSHUDWLRQFRPSUHVVRUVDUHLQDXGLEOHDWIHHW
ZDUUDQW\DJDLQVWFRUURVLRQ ‡$LU3RGGLIIXVHUVUHOHDVHDLUDSSUR[LPDWHO\´DERYHSRQG
‡KS:2%/SLVWRQFRPSUHVVRUVDUHRLOIUHHDQGIHDWXUH ERWWRPSUHYHQWLQJGLVUXSWLRQRIVHWWOHGRUJDQLFV
D\HDUZDUUDQW\ ‡2YHUVL]HG&)0FRROLQJIDQVKDYHVHDOHGEHDULQJV
‡$LU3RGGLIIXVHUVDUHVHOIFOHDQLQJZLWKD\HDUZDUUDQW\ ‡$LU3URV\VWHPLVDYDLODEOHLQ9RU9VLQJOHSKDVH
‡$QFKRU/LQHVHOIZHLJKWHGDLUWXELQJ #+]RU9VLQJOHSKDVH#+]
 ,WHP 1DPH $PSV 9  $PSV 9  'LIIXVHUV 5HF3RQG6L]H 3ULFH
 $3 $LU3UR   $LU3RG'LIIXVHU 8S7RDFUH 
 $3 $LU3UR   $LU3RG'LIIXVHUV 8S7RDFUHV 
 $3 $LU3UR   $LU3RG'LIIXVHUV 8S7RDFUHV 
 $3 $LU3UR   $LU3RG'LIIXVHUV 8S7RDFUHV 
 $3 $LU3UR   $LU3RG'LIIXVHUV 8S7RDFUHV 
 $3 $LU3UR   $LU3RG'LIIXVHUV 8S7RDFUHV 

$TXD&RQWURO$LU(FR/DNH%HG$HUDWLRQ6\VWHP
‡3HUIHFWV\VWHPIRUWKHKRPHRZQHU ‡$LU3RGGLIIXVHUVUHOHDVHDLUDSSUR[LPDWHO\´DERYHSRQG
‡)LEHUJODVV1(0$7\SH5RXWGRRUHQFORVXUHIHDWXUHVD ERWWRPSUHYHQWLQJGLVUXSWLRQRIVHWWOHGRUJDQLFV
\HDUZDUUDQW\ ‡2YHUVL]HG&)0FRROLQJIDQVKDYHVHDOHGEHDULQJV
‡KS:2%/SLVWRQFRPSUHVVRUVDUHRLOIUHHDQGIHDWXUH ‡$LU(FRV\VWHPLVDYDLODEOHLQ9RU9VLQJOHSKDVH
D\HDUZDUUDQW\ #+]RU9VLQJOHSKDVH#+]
‡$LU3RGGLIIXVHUVDUHVHOIFOHDQLQJZLWKD\HDUZDUUDQW\ ‡(TXLSPHQWSDGFRPHVVWDQGDUGZLWKHYHU\XQLWHOLPLQDWLQJ
‡$QFKRU/LQHVHOIZHLJKWHGDLUWXELQJIHDWXUHVD\HDU WKHQHHGIRUDFRQFUHWHEDVH
ZDUUDQW\
,WHP 1DPH $PSV 9 $PSV 9  'LIIXVHUV 5HF3RQG6L]H 3ULFH
 $( $LU(FR   $LU3RG'LIIXVHU 8S7RDFUH 
 $( $LU(FR   $LU3RG'LIIXVHUV 8S7RDFUHV 
 $( $LU(FR   $LU3RG'LIIXVHUV 8S7RDFUH 

$TXD&RQWURO6KDOORZ3RQG$HUDWLRQ6\VWHP
)HDWXUHVDQG%HQHILWV,QFOXGH ‡3URPRWHVDKHDOWK\HFRV\VWHPDQGODUJHUILVKE\
‡6WDLQOHVVVWHHOGLIIXVHUEDVHGHVLJQHGWRODQGXSULJKWZKHQ HOLPLQDWLQJR[\JHQKLJKVDQGORZVDQGFUHDWLQJHTXDO
SODFHGLQWRSRQGDQGWKHODUJHDUHDRIWKHEDVHUHVLVWV ZDWHUWHPSHUDWXUHVIURPWRSWRERWWRP
VLQNLQJLQWRWKHSRQGERWWRP ‡&RPSUHVVRUVDUHVLOHQWRLOIUHHDQGGRQRWUHTXLUHD
‡,QFUHDVHVR[\JHQOHYHOVLQSRQGZKLFKUHGXFHVILVKVWUHVV SURWHFWLYHKRXVLQJ
‡,QFUHDVHVWKHEUHDNGRZQRIILVKZDVWHE\SURYLGLQJWKH ‡&RPSUHVVRULVKRXVHGLQDKHDY\FDVWDOXPLQLXP
KDELWDWIRUEHQHILFLDOSRQGEDFWHULDWRIORXULVK UDLQSURRIHQFORVXUH
‡:KHQRSHUDWHGFRQWLQXRXVO\LQIUHH]LQJFOLPDWHVWKHVH ‡'HVLJQHGIRUFRQWLQXRXVRSHUDWLRQ
SXPSVZLOONHHSRSHQDUHDVLQWKHLFHWRDOORZWR[LFJDVHV ‡,QFOXGHGPDQLIROGPDGHRIEUDVVDQGVWDLQOHVVVWHHO
WRHVFDSHDQGVXQOLJKWWRHQWHU &RPSHWLWLYHPDQLIROGVDUHPDGHRISODVWLFWKDWFDQ
‡7KHVHSXPSVGHJDVDSRQGE\OLIWLQJKDUPIXOJDVHVVXFK H[SORGHLQFROGFOLPDWHV
DVK\GURJHQVXOILGHDQGFDUERQGLR[LGHWRWKHVXUIDFHDQG ‡8/OLVWHGDQG&(DSSURYHGIRURXWGRRURSHUDWLRQ
WKHQUHSODFLQJWKHPZLWKR[\JHQ ‡2SHUDWHRQO\LQZDWHUERGLHVOHVVWKDQ¶GHHS
‡&RPSUHVVRUVSXPSKLJKYROXPHVRIDLUDWORZSUHVVXUH ‡±\HDUZDUUDQW\ QRWLQFOXGLQJGLDSKUDJPRUILOWHU 

 ,WHP :DWWV $PSV 0D[&)0 'LIIXVHUV $LU+RVH 5HF3RQG6L]H 3ULFH


 63     2QH¶+RVH ¶'LD 
 63     2QH¶+RVH ¶'LD 
 63     6ROG6HSDUDWHO\ 8S7RDFUH 
 63     6ROG6HSDUDWHO\ 8S7RDFUH 

$TXD&RQWURO$QFKRU/LQH6HOI:HLJKWHG$LU7XELQJ
8VHGDVDFRQQHFWLRQIURPFRPSUHVVRUFDELQHWORFDWLRQVWR¿QDO$LU3RGGLIIXVHUORFDWLRQDLUVXSSO\WXELQJLVOHDGIUHHDQGVHOIZHLJKW
HGIRUVXEPHUVLEOHFDSDELOLWLHVDQGFDQEHXVHGLQGLUHFWEXULDODSSOLFDWLRQV7XELQJLVPDGHRI39&FRPSRVLWHDQGUHPDLQVÀH[LEOHLQ
FROGWHPSHUDWXUHV7XELQJLVFRPSDWLEOHZLWKWKHXVHRIVWDQGDUG´LQVHUWFRXSOHU¿WWLQJV
 ,WHP /HQJWK 'LDPHWHU 3ULFH
 $ ¶ ´ 


 )2817$,16

.DVFR+3'HFRUDWLYH)RXQWDLQ

(DJOH¶V1HVW 2VSUH\ &RQGRU )DOFRQ +DZN¶V1HVW

‡)LYHLQWHUFKDQJHDEOH ‡)ORDWPRRULQJURSHV 3HUIHFWIRUSRQGVXSWRDFUH)XOO\DVVHPEOHGIRUHDV\³SOXJDQGSOD\´


QR]]OHV VHHQDERYH ‡¶SRZHUFRUG 7KLVIRXQWDLQLVLGHDOIRUWKHEDFN\DUGSRQGRUZDWHUJDUGHQDQGFUHDWH
‡/('OLJKWULQJZLWK ‡&RQWUROER[ ZDWHUSDWWHUQVUDQJLQJIURP¶WDOOWR¶ZLGH
WUDQVIRUPHU ‡\HDUZDUUDQW\
 ,WHP 'HVFULSWLRQ 3ULFH
 -) +3)RXQWDLQ 
 -)/ +3)RXQWDLQZLWK/LJKWV 

.DVFR9);'LVSOD\$HUDWRUV
   +RUVH :DWHU 3RQG 3DWWHUQ 3DWWHUQ 2SWLRQDO
 ,WHP 9ROWV 3RZHU 'HSWK 6L]H +HLJKW 'LDPHWHU /LJKWLQJ
 9);   ´ 8SWR$FUH ¶ ¶ /LJKW.LW
 9);   ´ 8SWR$FUH ¶ ¶ /LJKW.LW
 9);   ´ 8SWR$FUH ¶ ¶ /LJKW.LW
 9);   ´ 8SWR$FUHV ¶ ¶ /LJKW.LW
 9);   ´ 8SWR$FUHV ¶ ¶ /LJKW.LW

 ,WHP &RUG 3ULFH  ,WHP &RUG 3ULFH  ,WHP &RUG 3ULFH


 9); ¶   9); ¶   9); ¶  .DVFR¶V9);'LVSOD\DHUDWRUVSURGXFH
DSOHDVLQJ³9´VKDSHSDWWHUQZKLOH
9); ¶  9); ¶  9); ¶  HIIHFWLYHO\DHUDWLQJ\RXUSRQG$HUDWLRQ
9); ¶  9); ¶  9); ¶  KHOSVVWLPXODWHIDVWHUELRGHJUDGDWLRQ
9); ¶  9); ¶  9); ¶  RIRUJDQLFZDVWHDQGDOORZVIRUODUJHU
KHDOWKLHU¿VKSRSXODWLRQV
 ,WHP &RUG 3ULFH  ,WHP &RUG 3ULFH ‡)ORDWZLWKERWWRPVFUHHQ
 9); ¶   9); ¶  ‡7ZR¶PRRULQJURSHV
9); ¶   9); ¶  ‡&RQWUROER[
9); ¶   9); ¶  ‡)RDP¿OOHGÀRDWV
‡òô KSKDYHD\HDUZDUUDQW\
9); ¶   9); ¶ 
‡DQGKSPRGHOVKDYH\HDU
9); ¶   9); ¶  ZDUUDQW\
9); ¶   9); ¶ 
9); ¶ 

7,3 :K\$HUDWH<RXU3RQG"
$HUDWLQJ\RXUSRQGZLOOLQFUHDVHFLUFXODWLRQDQGR[\JHQDWLRQRIWKHUPDO
VWUDWLILHG ZDWHU ZKLFK KHOSV WR VWLPXODWH WKH QDWXUDO ELRGHJUDGDWLRQ RI
RUJDQLFZDVWH VXFKDVJUDVVFOLSSLQJVOHDYHVUXQRII DQGSROOXWDQWV
$HUDWLRQFDQKHOSSUHYHQWVSULQJDQGIDOOWXUQRYHU$SRQGDHUDWRUDOVR
SURPRWHVDODUJHUYROXPHRIILVK

$HUDWLQJ'LVSOD\)RXQWDLQVDGGEHDXW\DQGLQWHUHVWWR\RXUSRQGZKLOH
LPSURYLQJZDWHUTXDOLW\E\DGGLQJR[\JHQDQGFLUFXODWLRQRIZDWHU


)2817$,16 321'/,1(5&20

-)6HULHV'HFRUDWLYH)RXQWDLQV

:LOORZ /LQGHQ &\SUHVV -XQLSHU 6HTXRLD

5HGZRRG 6SUXFH %LUFK


 ,WHP 3DWWHUQV,QFOXGHG .DVFR-6HULHV$HUDWLQJ)RXQWDLQVLPSURYHWKHRYHUDOOZDWHUTXDOLW\RI\RXUSRQGZKLOHHQKDQFLQJLWVDSSHDUDQFH
 -) /LQGHQ ¶+[¶: ZLWKLQWHUFKDQJHDEOHVSUD\SDWWHUQV²LQFOXGHGLQWKHIRXQWDLQSULFH
  &\SUHVV ¶+[¶:
.DVFR-6HULHV$HUDWLQJ)RXQWDLQVDUH
  :LOORZ ¶+[¶:
‡7KHOHDVWH[SHQVLYHWRSXUFKDVHPDLQWDLQDQGRSHUDWH²SURYLGLQJWKHEHVWYDOXHRQWKHGROODU
  -XQLSHU ¶+[¶: ‡9HUVDWLOH²JHWPXOWLSOHLQWHUFKDQJHDEOHVSUD\SDWWHUQVIRUWKHSULFHRIRQH
  6HTXRLD ¶+[¶: KS SDWWHUQVKSDQGKS SDWWHUQVKS SDWWHUQV
‡&RPSOHWHZLWKHYHU\WKLQJ\RXQHHG²QR]]OHVWRFUHDWHPXOWLSOHGHFRUDWLYHVSUD\SDWWHUQVFRQWUROSDQHO
ZLWK*URXQG)DXOW,QWHUUXSWHUDQGSKRWRH\HIRURSWLRQDOOLJKWNLWSRZHUFRUG DYDLODEOHLQ¶LQFUHPHQWVIURP
 ,WHP 3DWWHUQV,QFOXGHG
¶WR¶FRUGV DQGPRRULQJOLQHV
 -) /LQGHQ ¶+[¶: ‡,QGXVWULDOVWUHQJWK²GHVLJQHGZLWKKHDY\GXW\VWDLQOHVVVWHHOFRPSRQHQWVIRUFRQWLQXRXVRSHUDWLRQ
  &\SUHVV ¶+[¶: H[WHQGHGPRWRUOLIHDQGFRUURVLRQSUHYHQWLRQ HYHQLQVDOWZDWHU
  :LOORZ ¶+[¶: ‡(QHUJ\HIILFLHQW²USPPRWRUVPHDQORZHUSRZHUFRQVXPSWLRQDQGORQJHUOLIHIRUVHDOVDQGEHDULQJV
&RPSDUH.DVFR¶VDPSGUDZVWRFRPSHWLWLYHXQLWVDQGVHHZKDW\RXVDYHRQ\RXUPRQWKO\SRZHUELOO
  -XQLSHU ¶+[¶:
‡+LJKO\GHSHQGDEOH²XQLWVDUHGHVLJQHGWRRSHUDWHFRQWLQXRXVO\ZLWKPLQLPDOPDLQWHQDQFHHYHQLQVKDOORZ
  6HTXRLD ¶+[¶:  ZDWHU7KH\DUHWKHOHDVWOLNHO\IRXQWDLQVWRFORJRIDQ\PDQXIDFWXUHUEHFDXVHRI.DVFR¶VGHIOHFWRUWHFKQRORJ\
SURSJXDUGDQGVWDQGDUGERWWRPLQWDNHVFUHHQ
 ,WHP 3DWWHUQV,QFOXGHG ‡(DV\WRXVHDQGLQVWDOO²IRXQWDLQVDUHHDV\WRLQVWDOOPRYHDQGRSHUDWH6SUD\QR]]OHVDUHHDVLO\VZLWFKHG
 -) /LQGHQ ¶+[¶: ZLWKLQVHFRQGV
  :LOORZ ¶+[¶:    +RUVH :DWHU RI  2SWLRQDO
  -XQLSHU ¶+[¶:
 ,WHP 9ROWV 3RZHU 'HSWK 3DWWHUQV :DUUDQW\ /LJKWLQJ
 -)   ´  <HDU /LJKW.LW
  5HGZRRG ¶+[¶:
 -)   ´  <HDU /LJKW.LW
  6SUXFH ¶+[¶:
 -)   ´  <HDU /LJKW.LW
  %LUFK ¶+[¶:
 -)   ´  <HDU /LJKW.LW
 -)   ´  <HDU /LJKW.LW
 ,WHP 3DWWHUQV,QFOXGHG
 -)   ´  <HDU /LJKW.LW
 -) /LQGHQ ¶+[¶:
  :LOORZ ¶+[¶:  ,WHP &RUG 3ULFH  ,WHP &RUG 3ULFH  ,WHP &RUG 3ULFH
  -XQLSHU ¶+[¶:  -) ¶ 
 -) ¶   -) ¶ 
  5HGZRRG ¶+[¶:  -) ¶ 
 -) ¶   -) ¶ 
  6SUXFH ¶+[¶:  -) ¶ 
 -) ¶   -) ¶ 
  %LUFK ¶+[¶:  -) ¶ 
 -) ¶   -) ¶ 
 -) ¶ 
 ,WHP &RUG 3ULFH  ,WHP &RUG 3ULFH  -) ¶ 
 ,WHP 3DWWHUQV,QFOXGHG
 -) ¶   -) ¶   -) ¶ 
 -) /LQGHQ ¶+[¶:
 -) ¶   -) ¶ 
  :LOORZ ¶+[¶:  ,WHP &RUG 3ULFH
 -) ¶   -) ¶ 
  -XQLSHU ¶+[¶:  -) ¶ 
 -) ¶   -) ¶ 
  5HGZRRG ¶+[¶: -) ¶ 
 -) ¶   -) ¶ 
  6SUXFH ¶+[¶: -) ¶ 
 -) ¶   -) ¶ 
  6HTXRLD ¶+[¶:  -) ¶ 
 -) ¶ 
  %LUFK ¶+[¶: -) ¶ 
-) ¶ 


 )2817$,16

-)6HULHV3UHPLXP1R]]OHV

3DOP
0DJQROLD 0DGURQH 0DKRJDQ\
 ,WHP 1DPH )RXQWDLQ7\SH 3ULFH .DVFR3UHPLXP1R]]OHVRIIHUVSOHQGLGEHDXW\DERYHDQGEH\RQGRXU
  0DKRJDQ\ -) -)  LQFOXGHGSDWWHUQVIRUWKHDQGKS-)VHULHV7KH\PD\EHSXUFKDVHG
  0DKRJDQ\ -)  VHSDUDWHO\DQGDOORZ\RXWRGHILQH\RXUH[SHULHQFHE\VHOHFWLQJWKH
 ± 0DKRJDQ\ -) &RPLQJ6RRQ SUHPLXPQR]]OHRI\RXUFKRLFH7KH\VLPSO\ILWRQWKHIRXQWDLQDQGDUH
KHOGLQSODFHZLWKWKUHHVHWVFUHZV&KRRVHIURPRQHRIWKHIROORZLQJIRXU
  0DGURQH -) -) 
SDWWHUQVDERYH
  0DGURQH -) 
 ± 0DGURQH -) &RPLQJ6RRQ
 1R]]OH -) -) -) -)
  0DJQROLD -) -) 
0DKRJDQ\ ¶+[¶: ¶+[¶: ¶+[¶: ¶+[¶:
  0DJQROLD -) 
 0DGURQH ¶+[¶: ¶+[¶: ¶+[¶: ¶+[¶:
 ± 0DJQROLD -) &RPLQJ6RRQ
 0DJQROLD ¶+[¶: ¶+[¶: ¶+[¶: ¶+[¶:
  3DOP -) -) 
 3DOP ¶+[¶: ¶+[¶: ¶+[¶: ¶+[¶:
  3DOP -) 
 ± 3DOP -) &RPLQJ6RRQ

.DVFR)RXQWDLQ $HUDWRU/LJKW.LWV
/LJKW.LWV /LJKW.LWV
 ,WHP &RUG 3ULFH  ,WHP &RUG 3ULFH
 /5 ¶   /5 ¶ 
 /5 ¶   /5 ¶ 
 /5 ¶   /5 ¶ 
 /5 ¶   /5 ¶ 
 /5 ¶   /5 ¶ 
 /5 ¶ 
.DVFR0RXQWLQJ  /5 ¶ 

%UDFNHWV .DVFR¶V:DWWEXOEVWKDWFRPHRQWKH/5 WKH


)RUPRXQWLQJOLJKWVRQ  /5OLJKWNLWVUHTXLUHRQO\SDUWLDOVXEPHUVLRQWR
KSIRXQWDLQV DHUDWRUV SURYLGHJUHDWOLJKWLQJDWOHVVHUZDWWDJHWKDQFRPSHWLWLYH
EUDQGVWKDWPXVWEHIXOO\VXEPHUJHG.DVFR)RXQWDLQ 
 ,WHP 3ULFH $HUDWRU/LJKWVFRPHZLWKD\HDUZDUUDQW\
   /LJKW2ULHQWDWLRQ /LJKW2ULHQWDWLRQ

.DVFR&OHDU .DVFR%OXH  .DVFR5HG 


:DWW%XOE :DWW%XOE :DWW%XOE
 ,WHP 3ULFH  ,WHP 3ULFH  ,WHP 3ULFH
        

.DVFR&OHDU .DVFR*UHHQ .DVFR<HOORZ


:DWW%XOE :DWW%XOE :DWW%XOE
 ,WHP 3ULFH  ,WHP 3ULFH  ,WHP 3ULFH
        


)2817$,16 321'/,1(5&20

$TXD&RQWURO(YROXWLRQ6HULHV'LVSOD\)RXQWDLQV
7KH(YROXWLRQ6HULHVIRXQWDLQZDVGHYHORSHGIURPWKUHHEDVLFLGHDVVLPSOHWRDVVHPEOHDQGPDLQWDLQORZFRVWWRRSHUDWH
DQGSDWWHUQVWKDWORRNJUHDW7KLVHYROXWLRQRILGHDVEURXJKWDERXWDIRXQWDLQWKDWKDVIRXUPDLQSDUWV ÀRDWVXFWLRQVFUHHQ
WKURDWDQGPRWRU DFRVWWRRSHUDWHRIDSSUR[LPDWHO\¿YHFHQWVSHUKRXUDQGVSUD\SDWWHUQVWKDWULYDOPRVWODUJHVFDOH
IRXQWDLQV$ORQJWKHZD\ZHEXLOWLQDQRWKHULPSRUWDQWDVSHFWTXDOLW\:HIHHOWKDWWKHKLJKTXDOLW\SODVWLFVVWDLQOHVVVWHHO
PRWRUDQGIDVWHQHUVXVHGLQWKH(YROXWLRQ6HULHVIRXQWDLQZLOOJLYHPDQ\\HDUVRIUHOLDEOHVHUYLFH
)HDWXUHV &RQWUROOHU,QIRUPDWLRQ ,QFOXGHV
‡\HDUZDUUDQW\RQIRXQWDLQ ‡8/OLVWHG ‡+39VLQJOHSKDVH
‡,PSURYHVZDWHUFODULW\ ‡+RXVHGLQDZHDWKHUSURRIHQFORVXUH IORDWLQJIRXQWDLQ
‡5HGXFHVDOJDHEORRPV ‡3OXJLQDQGJRRSHUDWLRQ ‡¶RU¶PRWRUFRUG
‡$HUDWHVXSWRDFUHSRQG ‡DPS&ODVV$+XPDQ5DWHG ‡PRRULQJVWDNHV
‡2SHUDWHVLQ´RIZDWHU *)&, ‡¶PRRULQJURSH
‡=HURPDLQWHQDQFHPRWRU ‡KRXUPHFKDQLFDOWLPHUIRUPRWRU ‡&RQWUROOHU
‡$OOLQWHUQDOEDOOEHDULQJVSURYLGH ‡3KRWRVHQVRUIRURSWLRQDOOLJKWLQJ ‡7RUQDGRVSUD\SDWWHUQQR]]OH
VXSHULRUPRWRUTXDOLW\ ‡$DPSFLUFXLWEUHDNHULVUHTXLUHG ¶+[¶'LD
‡2QHSHUVRQLQVWDOODWLRQ IRUSURSHUIRXQWDLQRSHUDWLRQ
‡)RXQWDLQVKLSVLQRQHER[
‡0DGHLQWKH86$
 ,WHP +RUVH3RZHU &RUG 3ULFH
 (9 +3 ¶ 
 (9 +3 ¶ 

$TXD&RQWURO1R]]OHVIRU(YROXWLRQ6HULHV)RXQWDLQV

$UXP &OXVWHU$UFK )OHXU'H/LV 6SLGHU $UFK 7LDUD


¶+[¶'LD ¶+[¶'LD ¶+[¶'LD ¶+[¶'LD ¶+[¶'LD

 ,WHP 1R]]OH 6HULHV 3ULFH


 (91&/$ &OXVWHU$UFK (YROXWLRQ 
 (91)/( )OHXU'H/LV (YROXWLRQ 
 (916$5 6SLGHU $UFK (YROXWLRQ 
 (917,$ 7LDUD (YROXWLRQ 
 (91$58 $UXP (YROXWLRQ 

$TXD&RQWURO/LJKW.LWVIRU(YROXWLRQ6HULHV)RXQWDLQV
‡)RXUKLJKSRZHU/('OLJKWV HTXLYDOHQWWRZDWWV  ‡2SWLRQDOUHSODFHPHQWODPSFRORUV5HG%OXH*UHHQ
‡&RPHVVWDQGDUGZLWK&RRO:KLWHODPSV <HOORZ3XUSOH:DUP:KLWH
 ,WHP 1DPH 6HULHV 3ULFH
 (9/ /LJKW.LWZ¶&RUG (YROXWLRQ 
 (9/ /LJKW.LWZ¶&RUG (YROXWLRQ 
 (95%/%5(' 5HG/DPS (YROXWLRQ 
 (95%/%%/8 %OXH/DPS (YROXWLRQ 
 (95%/%*5( *UHHQ/DPS (YROXWLRQ 
 (95%/%<(/ <HOORZ/DPS (YROXWLRQ 
 (95%/%:+: :DUP:KLWH/DPS (YROXWLRQ 


 )2817$,16

$TXD&RQWURO)RXQWDLQV

&DVFDGH

)ODUH 6N\*H\VHU

7UHOOLV 6N\*H\VHU
%XFNLQJKDP

7LDUD )OHXUGH/LV

)XOO*H\VHU

0DMHVWLF

7UHOOLV

6KRRWLQJ6WDU 6SRNH 7UHOOLV

6N\*H\VHU

$TXD&RQWURO)RXQWDLQVDUHGHVLJQHGWRSURGXFHKLJKHUSDWWHUQVIRUGUDPDWLFODNHHIIHFWV)RXQWDLQVXVHFHQWULIXJDOSXPSVWRSURGXFHWKHKLJKHUSUHVVXUHQHHGHGIRU
GUDPDWLFGLVSOD\VZKLOHSXPSLQJPXFKOHVVZDWHUWKDQ'LVSOD\$HUDWRUV(YHQWKRXJKWKH$TXD&RQWURO)RXQWDLQVVKRXOGQRWEHFRQVLGHUHGDHUDWRUVWKH\GRSURYLGH
OLPLWHGDHUDWLRQZLWKWKHVSODVKRIWKHHIIHFW

&DOOIRUGHWDLOVDQGSULFLQJ


)2817$,16 321'/,1(5&20

$TXD&RQWURO'LVSOD\$HUDWRUV

$UXP
6SLGHU

&DQGHODEUD
7ULOOLXP

'DIIRGLO 'RXEOH$UFK

&URZQ*XVKHU

'HOPDU

/LO\

3HQWDODWRU 6FHSWHU

4XDG

$HUDWLRQYHU\VLPSO\LVWKHWUDQVIHURIR[\JHQIURPDLULQWRZDWHU$OOKHDOWK\ERGLHVRIZDWHUQHHGR[\JHQIRUWKHQRUPDOELRORJLFDOF\FOHWREHFRPSOHWHG,QODUJH
ERGLHVRIZDWHUWKLVRFFXUVQDWXUDOO\DVDUHVXOWRIZDYHDFWLRQ,QVPDOOHUODNHVDQGSRQGVLWLVHDV\IRUELRORJLFDOIDFWRUVWREHFRPHXQEDODQFHGFDXVLQJWKHR[\JHQ
OHYHOVWRGURSPDNLQJLWQHFHVVDU\IRUPHFKDQLFDODHUDWLRQ

,QVXI¿FLHQWDHUDWLRQDQGORZR[\JHQOHYHOVFDQFDXVH¿VKNLOOVREQR[LRXVVPHOOVDQGXQVLJKWO\ZDWHU:LWKRXWVXI¿FLHQWFLUFXODWLRQDSRQGEHFRPHVVWUDWL¿HGZLWK
ZDUPHUZDWHURQWKHVXUIDFHDQGFROGHUR[\JHQGHSOHWHGZDWHURQWKHERWWRP/DFNRIR[\JHQLQFUHDVHVWKHDQDHURELF ZLWKRXWR[\JHQ GHFRPSRVLWLRQRIWKHVOXGJHDW
WKHERWWRP7KDWLQFUHDVHVQXWULHQWVLQWKHSRQGZKLFKLQWXUQLQFUHDVHVDOJDHEORRPV

7KHDPRXQWRIDHUDWLRQUHTXLUHGIRUDSRQGRUODNHGHSHQGVRQLWVVXUIDFHDFUHVLWVGHSWKZKHWKHULWFROOHFWVUXQRIIIURPIHUWLOL]HGDUHDVDQGLWVZDWHUTXDOLW\2QH  
KRUVHSRZHURIVXUIDFHDHUDWLRQSHUVXUIDFHDFUHVKRXOGEHDGHTXDWHDHUDWLRQIRUDW\SLFDOSRQG0XOWLSOHVPDOOHUXQLWVFDQEHPRUHHIIHFWLYHWKDQRQHODUJHXQLWLIWKH
SRQGLVVKDOORZRUKDVDQLUUHJXODUVKDSH7KHVPDOOHUWKHSRQGRUODNHWKHPRUHDHUDWLRQLWQHHGVSHUDFUH
&DOOIRUGHWDLOVDQGSULFLQJ


 )2817$,16

2$6(5DLQERZ6WDU
7KHQHZJHQHUDWLRQRIWKH5DLQERZ6WDUFRPELQHVIXQFWLRQDOLW\YLUWXDOO\XQOLPLWHG
FUHDWLYHIUHHGRPDQGXQLTXHGHVLJQ7KHFRPELQDWLRQRIWKHVHIHDWXUHVJLYHVWKHV\VWHP
DQLQGLYLGXDOIODLU7KHLQWHJUDWHG5*%OLJKWFDQEHIUHHO\VHOHFWHGDQGFDQEHVXSSRUWHG
LQLWVHIIHFWE\QXPHURXVVZLWFKDEOHUXQQLQJOLJKWIXQFWLRQV5DLQERZ6WDUFDQDOVRFXWWKH
ZDWHUIRUDGGLWLRQDOLQWHUHVWLQJHIIHFWV
‡'HVLJQDQG&RQWURO6RSKLVWLFDWHG:DWHU ‡(DV\WR,QVWDOO³3OXJDQG3OD\´&RQQHFWLRQV
6KRZV ‡(OHFWURQLF:DWHU)ORZ&KRSSHU
‡(DVLO\,QVWDOOHGDQG&RQWUROOHG/DPLQDU ‡5HTXLUHVJSKPDJGULYHSXPS
)ORZ/('1R]]OH QRWLQFOXGHG
‡,QWHJUDWHG/RZ9ROWDJH/(' ‡)RU,QGRRUDQG2XWGRRU8VH

 ,WHP :DWWV-HW'LD :DWHU'HSWK /LJKWV 'LPHQVLRQV 3ULFH


  : ´ ´´ /('5*% ´[´[´ 

2$6(5DLQERZ6WDU$FFHVVRULHV
 ,WHP 1DPH 3ULFH
  ¶'DWD&DEOH SHU5DLQERZ6WDU  
  ¶3RZHU&DEOH SHU5DLQERZ6WDU  

2$6(5DLQERZ6WDU(DV\&RQWUROOHU
:LWKWKH2$6((DV\&RQWURO\RXFDQHDVLO\SURJUDP\RXUV\VWHPIURPD3&
RUODSWRS2$6((DV\&RQWUROKDVDZHOORUJDQL]HGXVHULQWHUIDFHZLWKIUHHO\
SURJUDPPDEOHVHTXHQWLDOSURJUDPVRIXSWRSURJUDPPDEOHFKDQQHOVDQGHYHU\
WKLQJLVWUDQVPLWWHGVLPSO\YLD86%

7KHGHYLFHLVTXLWHVLPSOHWRRSHUDWH

7KHLQWHUIDFHPRGXOHLVFRQQHFWHGWRDODSWRSRU3&YLD86%FRQQHFWRUVWKH
VRIWZDUHLVLQVWDOOHGDQG\RXDUHUHDG\WRSURJUDP7KDQNVWRWKHZHOORUJDQL]HG
DQGFOHDUO\VWUXFWXUHGXVHULQWHUIDFH\RXFDQFUHDWHVHTXHQWLDOSURJUDPVZLWKRXW
SURJUDPPLQJVNLOOV7KHLQWHUIDFHPRGXOHKDVFKDQQHOVWKDWFDQEHFRQWUROOHG
LQGLYLGXDOO\6LJQDOVDUHWUDQVPLWWHGYLD'0;
7KH(DV\&RQWUROOHUFDQEHXVHGRQ
‡&RQQHFWVWRFRPSXWHUYLD86%FDEOH
‡9DULRQDXWSXPS
‡,QFOXGHG6RIWZDUHPDNHVGHVLJQLQJFXVWRPVKRZVHDV\QR
‡9DULRQDXWSXPS
SURJUDPPLQJVNLOOVQHHGHG
‡-XPSLQJ-HW5DLQERZ6WDU
‡&RPSXWHULVGLVFRQQHFWHGIURPWKH(DV\&RQWUROOHURQFH
‡-XPSLQJ-HW5DLQERZ)ODVK
SURJUDPPLQJLVFRPSOHWHG
‡/('1R]]OH6WDU
‡/('7ZLQ6WDU
‡%HVW/('

 ,WHP 1DPH 3ULFH


  (DV\&RQWUROOHU 

$OSLQH)ORDWLQJ)RXQWDLQ
6SUD\)RXQWDLQ635$<6ZDWHULQWRWKHDLUFUHDWLQJDVRRWKLQJVLJKWDQGUHOD[LQJDWPRVSKHUH
DGGLQJYLWDOLW\WRDQRUGLQDU\ODQGVFDSH/LYHQVXSDQRUGLQDU\SRQGRUSRRODGHILQLWH
FRQYHUVDWLRQDOSLHFHWRPDNHDQ\KRPHHYHQWDVXFFHVV

‡3HUIHFWIRUVPDOOWRPHGLXPZDWHUJDUGHQV ‡6SUD\'LDPHWHU´
‡FRORUFKDQJLQJ/('OLJKWV ‡&RUG/HQJWK¶
‡,QFOXGHVIORDWLQJULQJDQGDQFKRU ‡\HDUZDUUDQW\
‡6SUD\+HLJKW¶

 ,WHP 0D[)ORZ 3ULFH


 )7& *3+ 


/,*+7,1* 321'/,1(5&20

6DYLR  6DYLR+DORJHQ
/('3RQG/LJKW 3RQG/LJKW
‡%ULOOLDQWZDWW ‡*ODVVOHQVHV
‡1HZ7HFKQRORJ\ ‡(QHUJ\HIILFLHQW KDORJHQOLJKW ‡([WHQGVKRXUVRIZDWHU
‡,QFUHGLEOHEXOEOLIH ZDWWVSHUXQLW ‡2IIHUVPRUHLQWHQVH JDUGHQHQMR\PHQW
KRXUV ‡8VHLQRURXWRIZDWHU LOOXPLQDWLRQWKDQ/(' ‡8VHLQRURXWRIZDWHU
‡(PLWVDOPRVWQRKHDW ‡\HDUZDUUDQW\ SRQGOLJKWV ‡\HDUZDUUDQW\
$QH[FHOOHQWZD\WRVDYHPRQH\DQGHQHUJ\5DGLDQFH/('OLJKWVFDQ 3RZHUIXOVXEPHUVLEOH5DGLDQFH+DORJHQOLJKWVFDVWEULJKWOLJKWLQ
EHDGGHGDVDFFHQWVLQRURXWRIWKHZDWHU/('OLJKWVHPLWDOPRVWQR XQGHUZDWHUHQYLURQPHQWV5DGLDQFH+DORJHQVKDYHUHLQIRUFHGJODVV
KHDWDUHLQFUHGLEO\HQHUJ\HIILFLHQWGHOLYHULQJUHPDUNDEOHEULJKWQHVV OHQVHVDQGRIIHUPRUHLQWHQVHLOOXPLQDWLRQWKDQ/('OLJKWV KRXU
DQGORQJHYLW\ KRXUVDYHUDJHOLIH  DYHUDJHEXOEOLIH 
 ,WHP 1DPH :DWWV &DEOH 3ULFH
 ,WHP 1DPH :DWWV &DEOH 3ULFH
 5$' 6PDOO+DORJHQ/LJKW  ¶ 
 5$' 6PDOO/('/LJKW  ¶ 
 5$' /DUJH+DORJHQ/LJKW  ¶ 
 5$' /DUJH/('/LJKW  ¶ 
  :5HSO%XOE   

&DO3XPS/('(JJ/LWHV
7KHVHSRZHUIXOFRPSDFW/('(JJ/LWHVDUHWKHVL]HRIDTXDUWHUDQG\HWDUHFDSDEOHRIOLJKWLQJ\RXUSRQGVWDWXDU\
SRWWHGSODQWVRUODQGVFDSLQJ$YDLODEOHLQIRXUFRORUVZKLWHUHGEOXHRUJUHHQDQGHTXLSSHGZLWKDORZYROWDJH
WUDQVIRUPHUWKDWZLOOSRZHUXSWROLJKWV\RXFDQFUHDWHEHDXWLIXOYLVXDOHIIHFWVIRU\RXUSRQGRUZDWHUJDUGHQV7KH
0LQL(JJ/LWHVKDYHDSOLDEOHFRUGWKDWDOORZV\RXWRXVHWKHOLJKWVLQDYDULHW\RISRVLWLRQVRUZUDSWKHPDURXQG\RXU
IDYRULWHSODQWRUIRXQWDLQKHDG%\DGGLQJWKHILQLVKLQJWRXFK(JJ/LWHV\RXFDQWUDQVIRUP\RXUSRQGRUZDWHUJDUGHQ
LQWRDQLJKWWLPHSDUDGLVH

/('(JJ/LWHV /('(JJ/LWH 7UDQVIRUPHU /('6RODU3RZHUHG(JJ/LWH.LW


‡7ZR/('OLJKWVZLWK´ ‡7UDQVIRUPHUFDQUXQXSWR(JJOLWHV ‡)XOO\VXEPHUVLEOHOLJKWVDQGFRUGRU
SRVLWLRQDEOHSOLDEOHFRUGV ‡7ZRZKLWH/('OLJKWVZLWK´ XVHRXWRISRQG
‡¶ORZYROWDJHSRZHUFRUG SRVLWLRQDEOHSOLDEOHFRUGV ‡KRXUVUXQWLPHRQIXOOFKDUJH 
ZLWKZD\RXWOHWWKDWFRQQHFWV ‡¶ORZYROWDJHSRZHUFRUGZLWKD OLJKWV 
OLJKWVWRWUDQVIRUPHU ZD\RXWOHWWKDWFRQQHFWVOLJKWVWRD ‡3RZHUVXSWR/('(JJOLWHV
‡7UDQVIRUPHUQRWLQFOXGHG WUDQVIRUPHU ‡$XWRPDWLFDOO\WXUQVOLJKWVRQRII
‡7UDQVIRUPHU

/('6RODU(JJ/LWH3DQHO /('(JJ/LWH&RUG /('(JJ/LWH7UDQVIRUPHU


‡3RZHUVXSWR/('(JJOLWHV ‡5DWHGIRULQRURXWRISRQGXVH ‡/RZ9ROWDJH
‡:HDWKHUUHVLVWDQW ‡/RZYROWDJHFRUGIRUVDIHRSHUDWLRQ ‡3RZHUVXSWR/('(JJ/LWHV
‡$XWRPDWLFDOO\WXUQVOLJKWVRQRII ‡8VHWRGLVSOD\(JJ/LWHVDFURVV
‡6RODUSDQHOFKDUJHV/LWKLXP JUHDWHUGLVWDQFHV
3RO\PHUEDWWHU\ ‡0)H[WHQVLRQWRXVHEHWZHHQZD\
DGDSWHUDQGOLJKW

 ,WHP 'HVFULSWLRQ &RORU 3ULFH


 /;(5 ([WUD/('(JJ/LWH 5HG 
 /;(: ([WUD/('(JJ/LWH :KLWH 
 /;(* ([WUD/('(JJ/LWH *UHHQ 
 /;(% ([WUD/('(JJ/LWH %OXH 
 /&(: &RPSOHWH/('(JJ/LWH.LW :KLWH 
 /6(: /('6RODU(JJ/LWH.LW :KLWH 
 /635 /('6RODU(JJ/LWH3DQHO ± 
 /97 /('(JJ/LWH7UDQVIRUPHU ± 
 /(&/(' ¶/('(JJ/LWH&RUG ± 
 /(&/(' ¶/('(JJ/LWH&RUG ± 


 /,*+7,1*

8QGHUZDWHU)LEHUJODVV 8QGHUZDWHU%UDVV
3RQG/LJKW 6SRW:HOO/LJKW
‡5HTXLUHVWUDQVIRUPHU ‡9 ‡+HDY\'XW\FRPPHUFLDO ‡´ORQJ[Ǭ´'LD
‡¶FRUGVFUHZLQVWDNH ‡:DWWVPD[ TXDOLW\FRQVWUXFWLRQ ‡,QFOXGHVZEXOE
‡&DQEHXVHGXQGHU ‡ó´ORQJ[´'LD ‡:DWHUWLJKWLGHDOIRUSRQGV ‡&DQEHXVHGXQGHU
ZDWHURURXWVLGHRIWKHSRQG ‡\HDUZDUUDQW\ ‡¶FRUG ZDWHURURXWVLGHRIWKHSRQG
‡9 ‡\HDUZDUUDQW\
‡:DWWVPD[
 ,WHP 1DPH 3ULFH  ,WHP 1DPH 3ULFH
 *%78 )LEHUJODVV/LJKW   *%7% %UDVV6SRW:HOO/LJKW 
  :5HSODFHPHQW%XOE    :5HSODFHPHQW%XOE 

$OSLQH/XPLQRVLW\/('3RQG/LJKWV

         
6PDOO6LQJOH/(' /DUJH6LQJOH/('

7KHVHOLJKWVDUHPXOWLSXUSRVHDQGWKH\FDQEHXVHGXQGHUZDWHURULQRSHQDLULQVWDOODWLRQV%XLOWLQSKRWRFHOOVDXWRPDWLFDOO\
WXUQWKHOLJKWVRQDWGXVNDQGRIIDWGDZQHOLPLQDWLQJWKHQHHGIRUWLPHUVDQGVZLWFKHV\HDUZDUUDQW\ 3DFN/('
‡&RORUOHQVHVDUHUHGJUHHQ\HOORZDQGEOXH ‡¶FRUG ¶RIFRUGOHQJWKEHWZHHQWKHSDFNOLJKWVHW

 ,WHP 1DPH ,QFOXGHV :DWWV 3ULFH


 /('7 6PDOO6LQJOH/(' /LJKW%DVHFRORUOHQVHVSKRWRFHOOVWDNH WUDQVIRUPHU  
 /('7 SDFN/(' /LJKW%DVHVFRORUOHQVHVSKRWRFHOOVWDNH WUDQVIRUPHU  
 /('7 /DUJH6LQJOH/(' /LJKW%DVHSKRWRFHOOVWDNH WUDQVIRUPHU  

&DO3XPS(JJ/LWHV
7KHSDWHQWHG(JJ/LWHOLJKWLQJV\VWHPDGGVQLJKWWLPHEHDXW\WRSRQGVIRXQWDLQVVWDWXDU\SRWWHGSODQWVDQGODQGVFDSLQJ7KH
ZDWWDOOSXUSRVH(JJ/LWHLVDFRPSDFWVSRWOLJKWWKDWFDQEHXVHGZHWRUGU\DQGLVVXLWDEOHIRUIUHVKVDOWRUFKORULQDWHG
ZDWHUPDNLQJLWH[WUHPHO\YHUVDWLOH6XEPHUJHGZLWKWKHLUEDVHVDWWDFKHGWKH\VHUYHDVGUDPDWLFXQGHUZDWHUOLJKWLQJ
(JJ/LWHVFRPHVWDQGDUGZLWKIRXUGLFKURLFOHQVHVLQEOXHUHG\HOORZDQGJUHHQZKLFKGHOLYHUXQLTXHDQGEHDXWLIXOUDLQERZV
RIFRORU7KRXJK(JJ/LWHVDUHSRZHUIXOOLJKWVRXUFHVWKH\DUHVPDOOHQRXJKWRILWLQWKHSDOPRI\RXUKDQGZKLFKDGGVWR
WKHLUH[FHSWLRQDOYHUVDWLOLW\7KHKLJKSRZHUHGZDWW(JJ/LWHLVDQXQGHUZDWHUIORRGOLJKWEXWRIIHUVWKHVDPHFRPSDFWVL]H
DVWKHZDWW(JJ/LWH
7KHWUDQVIRUPHUDQGDOOFRQQHFWLRQVPXVWUHPDLQGU\
/&(:RU/&(: /(.:
:HWRU'U\(JJ/LWHLQFOXGHV 7KH(JJ/LWHSDFNFRQWDLQV
‡(JJ/LWH ‡/&(:±7KUHHZDWW(JJ/LWHV
‡ZDWWWUDQVIRUPHU XSWRVL[ZDWWRUWKUHHZDWW(JJ/LWHV ‡/75:±2QHZDWWWUDQVIRUPHU XSWRVL[ZDWW(JJ/LWHVFDQ
FDQEHUXQLQVHULHVXVLQJRXUVWDQGDUGZDWWWUDQVIRUPHU  EHUXQLQVHULHVXVLQJRXUVWDQGDUGZDWWWUDQVIRUPHU 
‡0RXQWLQJVWDQG ‡/0%66±7KUHHPDJQHWLFEDVHVZLWKVWDLQOHVVVWHHOVFUHZVDQGQXWV
‡&OHDUIURQWOHQVFRYHU ‡/'/6±7KUHHGLFKURLFOHQVVHWV EOXHUHG\HOORZDQGJUHHQ 
‡)RXUFRORUGLFKURLFOHQVHV ‡/(&0±2QH¶H[WHQVLRQFRUGZLWKFRQQHFWRUV
‡0DJQHWLFEDVHZLWKVWDLQOHVVVWHHOVFUHZDQGQXW ‡/063&±7KUHHPRXQWLQJVWDQGV
‡OLVWHGIRUFRQVXPHUFRQILGHQFH ‡/)/&/5±7KUHHFOHDUIURQW (JJ/LWH$FFHVVRULHV
‡(DFK(JJ/LWHKDV¶RIFRUGDQGLV´WDOOZLWKEDVHDWWDFKHG OHQVFRYHUV
 ,WHP 'HVFULSWLRQ 3ULFH
‡/LVWHGIRUFRQVXPHUFRQILGHQFH
 /'/6 (JJ/LWH&RORU/HQV6HW 
 ,WHP 'HVFULSWLRQ 3ULFH
 /(&0 ¶([WHQVLRQ&RUG 
 /&(: 6LQJOH(JJ/LWH:.LW 
 /)/&/5 )URQW/HQVIRU(JJ/LWH 
 /&(: 6LQJOH(JJ/LWH:.LW 
 /0%66 0DJQHWLF%DVH 
 /(.: 3DFN(JJ/LWHV:.LW 
 /063& 0RXQWLQJ6WDQG 
 /;(: :(JJ/LWH 
/5%: :5HSODFHPHQW%XOE 
 /;(: :(JJ/LWH 
/5%: :5HSODFHPHQW%XOE 
 /75: :7UDQVIRUPHU 


/,*+7,1* 321'/,1(5&20

/DJXQD3RZHU*OR /(' 3RQG/LJKWV


3RZHU*OR6XEPHUVLEOH/('/LJKWVDUHH[WUHPHO\FRPSDFW
DQGFDQEHXVHGDOPRVWDQ\ZKHUHLQRURXWRIWKHZDWHUWR
SURGXFHVWXQQLQJOLJKWLQJHIIHFWV7KHOLJKWVDUHSUHZLUHGWR
PDNHLQVWDOODWLRQHDV\VLPSO\SODFHLQWKHGHVLUHGORFDWLRQ
DQGFRQQHFWWRWKHHOHFWULFDORXWOHW,QFOXGHVDQRQRIISKRWR
VHQVRUDQGD\HDUZDUUDQW\

 ,WHP 'HVFULSWLRQ RI/LJKWV 3ULFH


 37 6XEPHUVLEOH/('/LJKW.LW  

/DJXQD3RZHU*OR /(' 3RQG/LJKWV


3RZHU*OR6XEPHUVLEOH/('/LJKWVDUHH[WUHPHO\FRPSDFW
DQGFDQEHXVHGDOPRVWDQ\ZKHUHLQRURXWRIWKHZDWHUWR
SURGXFHVWXQQLQJOLJKWLQJHIIHFWV7KHOLJKWVDUHSUHZLUHGWR
PDNHLQVWDOODWLRQHDV\VLPSO\SODFHLQWKHGHVLUHGORFDWLRQ
DQGFRQQHFWWRWKHHOHFWULFDORXWOHW,QFOXGHVDQRQRIISKRWR
VHQVRUDQGD\HDUZDUUDQW\

 ,WHP 'HVFULSWLRQ RI/LJKWV 3ULFH


 37 3RZHU*OR/('/LJKWV  

/DJXQD3RZHU*OR0LQL+DORJHQ/LJKWV
&RPSDFWDFFHQWOLJKWVIRUSRQGVDUHGHVLJQHGIRUXVHLQRURXWRIZDWHU7KHOLJKWVDUHSUHZLUHGIRUHDV\LQVWDOODWLRQ
VLPSO\SODFHDQGFRQQHFWWRWKHWUDQVIRUPHU
 ,WHP 1DPH 3ULFH
‡7KUHHZDWWKDORJHQOLJKWV ³[´   37 3RZHU*OR+DORJHQ/LJKWV 
WKDWFDQEHDQJOHGLQWKHGHVLUHGSRVLWLRQ  37 5HSODFHPHQW%XOEVSN 
‡YROWWUDQVIRUPHU  37 5HG/HQV6HW 
‡FRORUHGOHQVHV
‡YROWV  37 %OXH/HQV6HW 
‡:DWWV  37 $PEHU/HQV6HW 
‡\HDUZDUUDQW\

$WODQWLF:DWHU*DUGHQV/(')RXQWDLQ/LJKW
$WODQWLF¶V/(')RXQWDLQ/LJKWPDNHVLWHDV\WRWXUQ\RXUZDWHUIHDWXUHLQWRDGD\
DQGQLJKWDWWUDFWLRQ%XLOWLQSKRWRFHOOVDXWRPDWLFDOO\WXUQWKHOLJKWVRQDWGXVNDQG
RIIDWGDZQHOLPLQDWLQJWKHQHHGIRUWLPHUV7KH/('EXOERIIHUVORQJOLIHDQGORZ
HQHUJ\FRQVXPSWLRQ
‡/RZRSHUDWLQJFRVWV
‡:DUPZKLWHFRORU
‡/RQJEXOEOLIH
‡,QFOXGHV/('IRXQWDLQZ´LQOHW
 ,WHP 1DPH 3ULFH
RXWGRRUWUDQVIRUPHU ¶SRZHUFRUG  $:*)7 /(')RXQWDLQ/LJKW 
‡\HDUZDUUDQW\


 /,*+7,1*

$WODQWLF:DWHU*DUGHQV&RPSDFW/('6SRWOLJKW
$WODQWLF¶V1(:&RPSDFW/('6SRWOLJKWLVWKHVPDOOHVWPRVWSRZHUIXO³EXOOHW´
VW\OHVXEPHUVLEOHOLJKWDYDLODEOH7KHDQRGL]HGDOXPLQLXPERG\KRXVHVDKLJK
SRZHU.ZDUPZKLWH/('WKDWEOHQGVVHDPOHVVO\ZLWKWUDGLWLRQDOKDORJHQ
OLJKWLQJIL[WXUHV7KHZD\VSOLWWHUVLPSOLILHVLQVWDOODWLRQDQGLVFRPSDWLEOH
ZLWKDOO62//LJKWLQJPRGHOV
‡:DUP:KLWHFRORU &RPSDFW/('6SRWOLJKW.LW,QFOXGHV
‡2SHQDLURUXQGHUZDWHU ‡/('6SRWOLJKW
‡YROW ‡¶3RZHU&RUGZTXLFNFRQQHFWSOXJ
‡:DWWV *URXQGVWDNHWUDQVIRUPHU ZD\VSOLWWHU
‡´:[´/
‡\HDUZDUUDQW\
 ,WHP 'HVFULSWLRQ 3ULFH
 62/:& &RPSDFW/('6SRWOLJKW.LW 
 62/:( &RPSDFW/('6SRWOLJKW 
 62/[ :7UDQVIRUPHUDQG:D\6SOLWWHU 

&DO3XPS/&8QGHUZDWHU/LJKWZLWK%DVH
‡2QH\HDUZDUUDQW\RQIL[WXUH ‡YROWZDWWWXQJVWHQKDORJHQEXOE
‡´[´[´ZLWKEUDFNHWDWWDFKHG ‡&RQYHQLHQWVZLYHOVWDQGLQFOXGHGIRUHDV\SODFHPHQW
‡´KHLJKW OLJKWRQO\  ‡/DPSPRXQWHGLQVWDLQOHVVVWHHOFDVHZLWKKHDY\FDVW
‡´GLDPHWHU OLJKWRQO\  EUDVVJULOO
‡0XVWEHWRWDOO\VXEPHUVHGLQZDWHUIRUFRROLQJ
‡YROWZLWK¶FRUGVRUFXVWRPOHQJWKVXSWR¶
1RWH&XVWRPFRUGOHQJWKVGRQRWFRPHZLWKSOXJV
‡7KHUPDOO\SURWHFWHG

 ,WHP &RUG/HQJWK :DWWV 3ULFH


 /& ¶  
 /& ¶  

$OSLQH:DWW6XEPHUVLEOH+DORJHQ/LJKW.LW
:DWWKDORJHQOLJKWV\VWHPLQFOXGHVZDWWKDORJHQOLJKWWUDQVIRUPHUFRORUOHQVHVDQG¶FDEOH7ZR\HDUOLPLWHG
ZDUUDQW\,PSRUWDQW'DPDJHWROLJKWPD\RFFXULIWKHXQLWLVQRWIXOO\VXEPHUJHG

 ,WHP :DWWV 3ULFH


 8/&/ : 

$OSLQH:DWW6XEPHUVLEOH+DORJHQ/LJKW.LW
:DWWKDORJHQOLJKWV\VWHPLQFOXGHVZDWWKDORJHQOLJKWWUDQVIRUPHUFRORUOHQVHVDQG¶FDEOH7ZR\HDUOLPLWHG
ZDUUDQW\,PSRUWDQW'DPDJHWROLJKWPD\RFFXULIWKHXQLWLVQRWIXOO\VXEPHUJHG

 ,WHP 'LPHQVLRQV 3ULFH


 3/7 ´/[´:[¶+ 


/,*+7,1* 321'/,1(5&20

/RZ9ROWDJH7UDQVIRUPHU 3KRWR&HOO
:DWWDQG:DWW :DWW
:DWW ‡,QWHJUDWHGSKRWRFHOOWLPHU ‡&RQVWUXFWHGRISRZGHUFRDWHGVWHHO
:DWW ‡(TXLSSHGZLWKDSURQJSOXJWKDW ‡,QWHJUDWHGSKRWRFHOOWLPHUFDQEH
SOXJVLQWRVWDQGDUGZDOORXWOHWV VHWWRRSHUDWHIURPKRXUV
‡\HDUZDUUDQW\ ‡(TXLSSHGZLWKDSURQJSOXJWKDW
:DWW SOXJVLQWRVWDQGDUGZDOORXWOHWV
‡\HDUZDUUDQW\

 ,WHP 1DPH 'LPHQVLRQV 3ULFH


 *%7'$ :DWW7UDQVIRUPHU ´+[´:[´' 
 *%7'$ :DWW7UDQVIRUPHU ´+[´:[´' 
 *%73767 :DWW7UDQVIRUPHU ´+[´:[´' 

5HSODFHPHQW  &RQQHFWLRQ6RFNHW
/LJKW%XOEV )RU7UDQVIRUPHUV
 ,WHP 1DPH 3ULFH ‡:DWW7UDQVIRUPHUFDQDFFHSWOLJKWV
  -&:DWW  ‡:DWW7UDQVIRUPHUFDQDFFHSWOLJKWV
‡:DWW7UDQVIRUPHUFDQDFFHSWOLJKWV
  -&:DWW 
  05:DWW   ,WHP 1DPH 3ULFH
  05:DWW   3/ ZD\VRFNHWFRQQHFWLRQ 
  05:DWW   3/ ZD\VRFNHWFRQQHFWLRQ 
  3DU:DWW   3/ ZD\VRFNHWFRQQHFWLRQ 

4XLFN/LJKWLQJ&DEOH 5HPRWH3KRWRFHOO
:DWHUWLJKWFDEOHDOORZV\RXWRKDYHPDQ\ 3URJUDPPDEOH7LPHU
$OSLQHOLJKWVFRQQHFWHGWRWUDQVIRUPHUEXW
ZLWKDVLQJOHFRUG4XLFNFRQQHFWORFDWHG ‡3KRWRFHOODXWRPDWLFDOO\WXUQVSRZHURQDQG
HYHU\IRRW RIIWROLJKWVSXPSVDQGRWKHUHOHFWURQLF
DFFHVVRULHVDWGXVN
 ,WHP 1DPH 3ULFH ‡3URJUDPPDEOHIRUWRKRXUVLQWHUYDOV
 3/ ¶&DEOH  ‡+DQGOHVXSWRZDWWVDQGRUDPSV
 3/ ¶&DEOH  ‡9ROWV
‡\HDUZDUUDQW\
 ,WHP 1DPH 3ULFH
 3/ 3URJUDPPDEOH7LPHU 

$OSLQH:DWHU)HDWXUH)RJJHUV
$GGDQH[RWLFWRXFKWRDQ\LQGRRUIRXQWDLQZLWKWKH³)RJJHUV´
6LPSO\SODFHLQIRXQWDLQSOXJLWLQDQGLQVWDQWO\WKHIUHH
IORZLQJIRJFUHDWHVDQDWPRVSKHUHRIP\VWHU\DQGLQWULJXH
$GGLQJDIHZGURSVRIHVVHQFHRLOSURGXFHVDEHDXWLIXODURPD
WRLPPHGLDWHVXUURXQGLQJVHQKDQFLQJWKHPRRG8OWUDVRQLF
WHFKQRORJ\HOLPLQDWHGWKHQHHGIRUDQ\FKHPLFDOV'U\LFHHIIHFW
7KH)RJJHU 7KH)RJJHU +HDG)RJJHU +HDG)RJJHU
Z/('/LJKWV Z/('/LJKWV ZLWKRXWWKHGU\LFH&RPSOHWHO\VDIH2QH\HDUOLPLWHGZDUUDQW\
+HDG*DOD[\)RJJHU
Z/('/LJKWV
 ,WHP 1DPH 'LPHQVLRQV &RUG 5HSODFHPHQW'LVF¶V 3ULFH
 )* 7KH)RJJHU ´'LD[´+ ¶ )*'56LQJOH'LVN 
 )*/ 7KH)RJJHUZ/(' ´'LD[´+ ¶ )*'56LQJOH'LVN 
 )*/5 +HDG0LQL)RJJHUZ/(' ´'LD[´+ ¶ )*'5'LVN 
 )*5 +HDG)RJJHU ´'LD[´+ ¶ )*'5'LVN 
 )*/5 +HDG)RJJHUZ/(' ´'LD[´+ ¶ )*'5'LVN 
+HDG)RJJHUZ/('  )*/5 +HDG*DOD[\)RJJHUZ/(' ´'LD[´+ ¶ )*'5'LVN 


 /,*+7,1*

,OOXPLQ)[/LJKWLQJ
‡7KH,OOXPLQ)[)LEHU2SWLF3RQG/LJKWLQJV\VWHPFRQVLVWV ‡7KHFRORUZKHHOFRQVLVWVRIZKLWHJUHHQPDJHQWDDQGEOXH
RIDVSHFLDOL]HGOLJKWVRXUFHHQFORVHGLQDER[FDOOHGDQ ‡8VHXQGHUZDWHUQH[WWRWKHZDWHURXWRIWKHZDWHUEHWZHHQ
LOOXPLQDWRU URFNVRUYLUWXDOO\DQ\ZKHUHRQHZLVKHVWRSODFHWKHP
‡8SWRVL[WHHQLQGLYLGXDOILEHURSWLFFDEOHVDUHEXQGOHG ‡OLJKWEXOELVDEOHWRLOOXPLQDWHXSWRVHSDUDWHIL[WXUHV
WRJHWKHUDWRQHHQGDQGWHUPLQDWHLQIURQWRIWKHOLJKWVRXUFH SODFHGLQDQGDURXQGWKHSRQG
LQVLGHWKHLOOXPLQDWRU ‡2QFHSODFHGWKHUHLVQRQHHGWRZDGH
‡0XOWLSOH³HQGSRLQWV´RIOLJKWRUOLJKWIL[WXUHVPD\EH EDFNLQWRWKHZDWHUWRFKDQJHDOLJKW
LOOXPLQDWHGE\MXVWRQHOLJKWEXOE EXOEWKHOLJKWEXOELVORFDWHGRXWVLGH
‡1RKHDWRUHOHFWULFLW\WUDYHOVWKURXJKWKHILEHUVPDNLQJ WKHSRQGLQDQHDVLO\DFFHVVLEOH
ILEHUVDIHIRUPDQ\HQYLURQPHQWV ORFDWLRQ
‡7KHOLJKWVRXUFHPD\EHSRVLWLRQHGLQDUHPRWHORFDWLRQ ‡7KHVHIL[WXUHVDUHDERXWò´GLDPHWHUDW
DZD\IURPWKHOLJKWRXWSXWDOORZLQJHDV\DFFHVVWRWKH WKHZLGHVWSRLQWDQGDUHDURXQGWKHVL]H
VRXUFHIRUODPSFKDQJHV RIDEDOOSLQWSHQFDS
$Q\OHQJWKFRPELQDWLRQLV
‡$FRORUZKHHOFDQEHSODFHGEHWZHHQWKHOLJKWVRXUFHDQG ‡.LWVLQFOXGHLOOXPLQDWRUZLWKFRORU DYDLODEOH0D[LPXPFDEOH
WKHILEHUWRFUHDWHFRORUHGOLJKW ZKHHOSUHFXWSUHDVVHPEOHGILEHU OHQJWKLV¶3OHDVHFDOOIRU
‡(DV\WRSODFHDQGKLGH RSWLFFDEOHKDUQHVVGHVLJQDWHGQXPEHU SULFLQJRQFXVWRPOHQJWKV

‡7KHZKHHOPD\EHVWRSSHGDWRQHFRORURUPD\URWDWH RIIL[WXUHVLQVWDOODWLRQ PDLQWHQDQFH


FRQWLQXRXVO\IURPFRORUWRFRORU PDQXDOV
6HULHV 6HULHV 6HULHV
‡.LWVLQFOXGHD:4XDUW]KDORJHQLOOXPLQDWRU ‡.LWVLQFOXGHD:PHWDOKDOLGHLOOXPLQDWRU ‡+LJK/LJKW2XWSXWNLWVLQFOXGHD:PHWDO
ZLWKUDWHGODPSOLIHRIKRXUV7KLV ZLWKUDWHGODPSOLIHRIKRXUV2XU KDOLGHLOOXPLQDWRUZLWKUDWHGODPSOLIHRI
LOOXPLQDWRURIIHUVLQVWDQWRQDQGORZHVWFRVW EULJKWHVWPRVWHQHUJ\HIILFLHQWLOOXPLQDWRU KRXUV(DFKILEHURSWLFFDEOHFRQWDLQVWZLFHDV
ILEHUVWUDQGV UHTXLUHVVHYHUDOPLQXWHVWRIXOOEULJKWQHVVDQG PDQ\ILEHUVDVRXUSRSXODU6HULHVDQG6HULHV
DPLQXWHUHVWULNHWLPHILEHUVWUDQGV NLWVILEHUVWUDQGVSHUIL[WXUH
 ,WHP 1DPH %XOE 6HULHV 4XDQWLW\ &DEOH/HQJWK 3ULFH
 $4 /LJKW*XSSLH)LEHU2SWLF +DORJHQ   ¶  ¶ 
 ,); /LJKW)LEHU2SWLF 0HWDO+DOLGH   ¶  ¶ 
 ,); /LJKW)LEHU2SWLF 0HWDO+DOLGH   ¶  ¶  ¶ 
 $4 /LJKW)LEHU2SWLF +DORJHQ   ¶  ¶  ¶ 
 $4 /LJKW)LEHU2SWLF 0HWDO+DOLGH   ¶  ¶  ¶ 
 ,); /LJKW)LEHU2SWLF 0HWDO+DOLGH   ¶  ¶  ¶ 
 $4 /LJKW)LEHU2SWLF +DORJHQ   ¶  ¶  ¶  ¶  ¶ 
 $4 /LJKW)LEHU2SWLF 0HWDO+DOLGH   ¶  ¶  ¶  ¶  ¶ 
 $4 /LJKW)LEHU2SWLF +DORJHQ   ¶  ¶  ¶  ¶ 
 $4 /LJKW)LEHU2SWLF 0HWDO+DOLGH   ¶  ¶  ¶  ¶ 

,OOXPLQ)[7DGSROH/LJKWLQJ
7DGSROH/(')LEHU2SWLFLQFOXGHVWKUHHRUIRXUHLJKWIRRWOHQJWKVRI(()VWUDQG6XQEXUVW
RU(()VWUDQG6XQEXUVW,,HQGHPLWWLQJILEHUSRZHUHGE\RQH/(' ZKLWHRQO\ RURQH
/('& 5*%FRORUFKDQJLQJLOOXPLQDWRU7KHVHNLWVRSHUDWHRIIRI9$&RU'&SRZHU
VXSSOLHVDQGFRQVXPHZDWWV7LHLQWRDQH[LVWLQJORZYROWDJHWUDQVIRUPHURUHYHQXVHLWLQD
YHKLFOHUXQQLQJRIIWKH'&SRZHU7DGSROH/(')LEHU2SWLF.LWVKDYHDOLIHRIKRXUV

$FFHVVRULHV
 ,WHP 1DPH 3ULFH
./::07 05/DPS:/('5HSO%XOE:KLWH 

 ,WHP 'HVFULSWLRQ /LJKW6RXUFH )LEHUV 3ULFH


 /(' /LJKW7DGSROH /(' :KLWH2QO\  6WUDQG6XQEXUVW 
 /(' /LJKW7DGSROH /(' :KLWH2QO\  6WUDQG6XQEXUVW,, 
 /('& /LJKW7DGSROH /('& 5*%FRORUFKDQJLQJ,OOXPLQDWRU  6WUDQG6XQEXUVW 
 /('& /LJKW7DGSROH /('& 5*%FRORUFKDQJLQJ,OOXPLQDWRU  6WUDQG6XQEXUVW,, 
 /(' /LJKW7DGSROH /(' :KLWH2QO\ 6WUDQG6XQEXUVW 
 /(' /LJKW7DGSROH /(' :KLWH2QO\ 6WUDQG6XQEXUVW,, 
 /('& /LJKW7DGSROH /('& 5*%FRORUFKDQJLQJ,OOXPLQDWRU  6WUDQG6XQEXUVW 
 /('& /LJKW7DGSROH /('& 5*%FRORUFKDQJLQJ,OOXPLQDWRU  6WUDQG6XQEXUVW,, 


321'0$,17(1$1&( 321'/,1(5&20

2$6(3RQGR9DF
0RUHSRZHUIRU\RXUSRQGDQGSRRO

2$6(UHLQYHQWHGWKHSRQGYDFXXP DJDLQ 1RZ\RXFDQQRWRQO\FOHDQ\RXUSRQG


HDVLO\EXWDOVRPDLQWDLQ\RXUSRRORUVZLPSRQG±DOOLQFRPIRUWIURPWKHHGJHRI
WKHZDWHUZLWKWKHLQFOXGHGDFFHVVRULHV3RQGRYDFLVWKHSUHPLHUSRQGSRRODQG
KRXVHKROGZHWYDFXXPRQWKHPDUNHWDQGLW
LVQRZHYHQEHWWHU$QHZPRUHUXJJHGGHVLJQDOXPLQLXPVXFWLRQDQGPRUHVXFWLRQ
SRZHUWXEHVPDNH3RQGRYDFWKHRQO\SRQGYDFXXP\RXHYHUQHHGWRRZQ
‡)RUXVHLQSRQGVSRROVDQGKRXVHKROG
‡3DWHQWHGWZRFKDPEHUV\VWHPIRUFRQWLQXRXVVXFWLRQ
‡3RZHUIXO:PRWRU
‡5LJLGDOXPLQLXPVXFWLRQWXEHV
‡/DUJHDFFHVVRU\DVVRUWPHQWLQFOXGHG
‡6XFWLRQKHLJKWLVIHHW
‡\HDU/LPLWHG:DUUDQW\\HDUVSOXV)5((\HDUH[WHQVLRQXSRQ
SURGXFWUHJLVWUDWLRQ

 ,WHP 1DPH :DWWV 9ROWV 'UDLQ+RVH 6XFWLRQ+RVH &RUG 3ULFH


  2$6(3RQGR9DF :  ¶ ¶ ¶ 

/DJXQD3RZHU&OHDQ&RUGOHVV3RQG&OHDQHU
6ROLGV+DQGOLQJ±WZRURWDWLQJEODGHVEUHDNXSGHEULVPDNLQJLWHDVLHUWRSDVV
WKURXJKWKHXQLWDQGLQWRWKHGHEULVEDJ

%UXVK$WWDFKPHQW±ORRVHQVGHEULVDOORZLQJLWWREHUHPRYHGIURPWKHSRQG
5HF\FOHVZDWHULQWRWKHSRQGRUJDUGHQ

,QFOXGHV6KRXOGHU6WUDS'HEULV%DJ5HFKDUJHDEOHOLWKLXP%DWWHU\ZLWKFKDUJHU

‡&RQWLQXRXVZDWHUIORZ
‡(DV\SULPH
‡/LJKWZHLJKWDQGEDODQFHG
‡%DWWHU\RSHUDWHG
‡7HOHVFRSLFUHDFKH[WHQGVWR´LQOHQJWK

 ,WHP 1DPH :DWWV 3ULFH


 37 3RZHU&OHDQ : 

/DJXQD3RQG9DF
/DJXQD3RQG9DFSURYLGHVDIDVWDQGFRQYHQLHQWZD\WRFOHDQ\RXUSRQG7KHYDFXXP
LVSRZHUHGE\ZDWHUDQGGRHVQRWUHTXLUHHOHFWULFLW\6LPSO\DWWDFKLWWRDJDUGHQKRVH
DQGWKHFRQWUROYDOYHDOORZV\RXWRDGMXVWWKHZDWHUIORZLQJWKURXJKWKHYDFXXP7KH
NLWLQFOXGHVD3RZHU9DFDWWDFKPHQWZKLFKFROOHFWVGLUWDQGGHEULVDWWKHERWWRPRI
WKHSRQGDQGD+\GUR%UXVKDWWDFKPHQWIRUVFUXEELQJDQGFOHDQLQJ7KHNLWFRPHV
FRPSOHWHZLWKDILOWHUEDJDQGDQH[WHQVLRQSROH

‡)DVWDQGFRQYHQLHQWSRQGPDLQWHQDQFH 7KHNLWLQFOXGHV
‡9DFXXPLVSRZHUHGE\IORZLQJZDWHU ‡3RZHU9DFDWWDFKPHQWZKLFK
DQGGRHVQRWUHTXLUHHOHFWULFLW\ FROOHFWVGLUWDQGGHEULVDWWKH
‡6LPSO\DWWDFKLWWRDJDUGHQKRVHDQGD ERWWRPRIWKHSRQG
FRQWUROYDOYHDGMXVWVWKHZDWHUIORZLQJ ‡+\GUR%UXVKDWWDFKPHQWIRU
WKURXJKWKHYDFXXP VFUXEELQJDQGFOHDQLQJ
‡)LOWHUEDJ
‡([WHQVLRQSROH

 ,WHP 1DPH 3ULFH 


 37 3RQG9DF 
 37 3RQG9DF5HSODFHPHQW%DJ 


 321'0$,17(1$1&(

$WODV1LWULOH7RXFK*ORYHV $WODV1LWULOH7RXJK*ORYHV
7KHVHOLJKWZHLJKWQ\ORQNQLWJORYHVILWOLNHD 7KHIOH[LEOHQLWULOHFRDWLQJLVWRXJKHUWKDQ
VHFRQGVNLQ7RXJKHUWKDQUXEEHUWKHQLWULOH UXEEHUSURWHFWLQJSDOPV ILQJHUWLSVIURPWKH
FRDWLQJSURWHFWVSDOPVDQGILQJHUWLSVIURPWKH ULJRUVRIHYHU\GD\ZRUN6HDPOHVVOLJKWZHLJKW
KD]DUGVRIVHULRXVJDUGHQLQJ7KHVHXOWUDWKLQ EODFNQ\ORQNQLWOLQHULQFUHDVHVFRPIRUWZKLOH
JORYHVOHW\RXIHHOZKDW\RX¶UHGRLQJZHHGLQJ LWUHSHOVGLUW VWDLQV,GHDOIRUMREVUHTXLULQJ
SUXQLQJHYHQSLFNLQJXSLQGLYLGXDOVHHGV PD[LPXPGH[WHULW\ IUHHGRPRIKDQG
$VVRUWHG&RORUV PRYHPHQWZLWKRXWWKHIDWLJXHDVVRFLDWHGZLWK
KHDYLHUEXONLHUJORYHV0DFKLQHZDVKDEOH
%ODFN2QO\
 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH
 17;6 ;6PDOO 
 17%.0 0HGLXP 
 176 6PDOO 
 17%./ /DUJH 
 170 0HGLXP 
 17%.;/ ;/DUJH 
 17/ /DUJH 

/DJXQD%OXH+HURQ'HFR\
7KLVGHFR\LVDJUHDWZD\WRSURWHFW\RXUSRQGRIWKHEOXHKHURQ7KLVOLIHOLNHUHSOLFDLVPDGHRIGXUDEOHEORZPROGHG
´
SODVWLF7KLVKHURQVWDQGVRQD´VWLOWDQGPHDVXUHV´7KHGHFR\LVDYHU\HIIHFWLYHZD\WRFRQWURO+HURQVLQ0D\
WKURXJK)HEUXDU\+HURQVGHIHQGWKHLUWHUULWRU\DQGVWD\RXWRIRWKHUKHURQVGHIHQGHGWHUULWRULHVDIWHUPDWLQJVHDVRQ
:HVXJJHVWZKHQ\RXXVHDGHFR\WRSHULRGLFDOO\PRYHLWDURXQG\RXUSRQGWRNHHSXSWKHDSSHDUDQFHRIDOLYHELUG$
JRRGWLPHWRPRYH\RXUKHURQGHFR\LVZKHQ\RXIHHG\RXUILVK

 ,WHP 3ULFH
 37 

0LFUREH/LIW0RVTXLWR&RQWURO
6SHFLILFDOO\IRUPXODWHGIRUGHFRUDWLYHZDWHUJDUGHQVIRXQWDLQDQGDUHDVZKHUHVWDQGLQJZDWHUH[LVWV
0LFUREH/LIW%0& %LRORJLFDO0RVTXLWR&RQWURO NLOOVGHYHORSLQJPRVTXLWRHVEHIRUHWKH\EHFRPHEUHHGLQJELWLQJ
DGXOWVLQFOXGLQJWKRVHZKLFKPD\WUDQVPLW:HVW1LOH9LUXVDQG(TXLQH(QFHSKDOLWLVDQGWKRVHZKLFKPD\WUDQVPLW
+HDUWZRUP'LVHDVHWRGRJVDQGFDWV
0LFUREH/LIW%0&FDQEHDSSOLHGWRDUHDVWKDWFDQFRQWDLQDTXDWLFOLIHILVKDQGSODQWV0LFUREH/LIW%0&FDQEH
DSSOLHGWRDUHDVXVHGE\RULQFRQWDFWZLWKKXPDQVDQLPDOVOLYHVWRFNSHWVELUGVRUZLOGOLIH

‡8SWRGD\VDFWLYLW\GHSHQGLQJRQVLWH ‡6LJQLILFDQWO\ORZHUSRWHQWLDOIRUGHYHORSPHQWRI
‡'LVSHUVHVHDVLO\LQZDWHU UHVLVWDQFHLQWDUJHWLQVHFWSRSXODWLRQVWKDQFKHPLFDO
‡1RILVKWR[LFLW\ ODUYDFLGHVVXFKDVPHWKRSUHQH
‡1RWR[LFLW\WRQRQWDUJHWLQYHUWHEUDWHV ‡1RRUJDQLFRULQRUJDQLFUHVLGXHV
‡1RDGYHUVHDHVWKHWLFVWRWKHSRQG ‡POSHUJDOORQVRIZDWHU

 ,WHP 6L]H 7UHDWV 3ULFH


 %0& R] JDO 
 %0& R] JDO 
 %0& R] JDO 
 %0& R] JDO 

/DJXQD /DJXQD
3UXQLQJ7RRO )ORDWLQJ7KHUPRPHWHU
‡7KHVFLVVRUKHDGFXWVDQGUHPRYHVGHDG ‡(DV\YLHZLQJZLQGRZZLWKODUJHWHPSHUDWXUH
OHDYHVIURPSRQGSODQWVLQRQHHDV\VWHS LQGLFDWLRQV
‡7KHSLQFHUKHDGDOORZV\RXWRJUDVSDQG ‡&RPHVZLWKDKDQG\DQFKRULQJFRUG
UHPRYHGHEULVZLWKHDVHDQGSUHFLVLRQ ‡'HVLJQHGWRIORDWRQWKHZDWHUVXUIDFHIRU
HDV\DFFHVV
‡/LJKWDOOSODVWLFFRQVWUXFWLRQZLOOQRWUXVW

 ,WHP /HQJWK 3ULFH  ,WHP 7HPSHUDWXUH5DQJH 3ULFH


 37 ´   37 ƒWRƒ) 


321'0$,17(1$1&( 321'/,1(5&20

/DJXQD&ROODSVLEOH3RQG1HW

3RQG1HW 6NLPPHU 7KH/DJXQD&ROODSVLEOH3RQG1HWDQG3RQG6NLPPHUKHOSPDNH


PDLQWHQDQFHZRUNLQDQGDURXQGSRQGVYHU\FRQYHQLHQW(DFKQHWKDV
WKHIROORZLQJIHDWXUHV

‡6OLSUHVLVWDQWKDQGOHUHGXFHV ‡)LVKIULHQGO\VRIWQHWWLQJ
VOLSSDJHZKHQ\RXUKDQGVJHWZHW ‡&ROODSVLEOHKDQGOHIRUHDV\
‡7HDUUHVLVWDQWQHWJXDUG VWRUDJH

 ,WHP 1DPH 6L]H +DQGOH 3ULFH


 37 3RQG6NLPPHU ´ ´´ 
 37 3RQG1HW ´ ´´ 

/DJXQD3UR3RQG1HW /DJXQD3UR6NLPPHU1HW
7KHKHDY\GXW\GXUDEOH/DJXQD3UR3RQG1HW 7KHKHDY\GXW\GXUDEOH/DJXQD3UR3RQG1HW
KHOSVPDNHPDLQWHQDQFHZRUNLQDQGDURXQG KHOSVPDNHPDLQWHQDQFHZRUNLQDQGDURXQG
SRQGVYHU\FRQYHQLHQW SRQGVYHU\FRQYHQLHQW
‡6DIHILVKIULHQGO\QHWWLQJ ‡+HDY\'XW\&RQVWUXFWLRQ
‡7HDUUHVLVWDQWQHWJXDUG ‡7HDUUHVLVWDQWQHWJXDUG
‡1RQVOLSKDQGOH ‡1RQVOLSKDQGOH
‡+DQJLQJVWULQJIRUHDV\VWRUDJH ‡+DQJLQJVWULQJIRUHDV\VWRUDJH
‡([WHQGDEOH$OXPLQLXP6KDIW ‡([WHQGDEOH$OXPLQLXP6KDIW

 ,WHP 6L]H +DQGOH 3ULFH  ,WHP 6L]H +DQGOH 3ULFH


 37 ´[´ ´´   37 ´[´ ´´ 

/DJXQD3RQG1HWV /RNL.RL1HWV
.RL1HWVDUHWKHLGHDOZD\WRFDUHIRU\RXU
SUL]HGILVK7KHXQLTXHEODFN0RQRUDLOŒ
KRRSSUHYHQWVQHWDEUDVLRQIURPURFNVRU
VDQG7KHVKDOORZEDJVDUHPDGHIURPVRIW
37 37 DQGGXUDEOHEODFN´$FHPHVKZKLFK
/DJXQD3RQG1HWVKHOSPDNHPDLQWHQDQFH DOORZVIRUHDV\ILVKKDQGOLQJDQGDFFHVV$OO
ZRUNLQDQGDURXQGSRQGVYHU\FRQYHQLHQW KDQGOHVIHDWXUHEODFNIRDPJULSV

(DFKQHWKDVWKHIROORZLQJIHDWXUHV  ,WHP 6L]H +DQGOH 3ULFH


‡6OLSUHVLVWDQWKDQGOHUHGXFHVVOLSSDJHZKHQ\RXUKDQGVJHWZHW  3. ´ ¶ 
‡7HDUUHVLVWDQWQHWJXDUG  3. ´ ¶ 
‡5RXQGHGFRUQHUVWKDWDOORZDFFHVVWRKDUGWRUHDFKSODFHV
‡)LVKIULHQGO\VRIWQHWWLQJ
‡+DQJLQJVWULQJIRUHDV\VWRUDJH
 ,WHP 6L]H +DQGOH 3ULFH
 37 ´ ´´([WHQGDEOH 
 37 ´ ´´([WHQGDEOH 
:*%'
/RNL8WLOLW\1HWV
8WLOLW\1HWVDUHGHVLJQHGWRKDQGOH\RXU
/RNL7HOHVFRSLQJ+DQGOH WRXJKHVWSRQGPDLQWHQDQFHFKRUHV±IURP
:*%' KDQGOLQJNRLWRVNLPPLQJOHDYHVRUDOJDH
/RNL¶V7HOHVFRSLQJ+DQGOH.LWVFDQDGGD
7KHVHQHWVIHDWXUHRXUXQLTXH0RQRUDLO
QHZGLPHQVLRQWR\RXU/RNL8WLOLW\1HWRU
DOXPLQLXPERZVWKDWHQFDVHWKHQHWWLQJLQVLGH
/RNL.RL1HW'HVLJQHGWRILWRXUVWDQGDUG
WKHKRRSIRUORQJODVWLQJGXUDELOLW\7KHVPDOO
0RQRUDLOWXELQJWKHVHFRPHFRPSOHWH
VRIWPHVKNQRWOHVVQHWWLQJLVVWURQJ\HWJHQWOH
ZLWKIRDPJULSVVSULQJEXWWRQVVFUHZV
RQNRLDQGRWKHUILVK
DQGSUHGULOOHGKROHVIRUDVVHPEO\
 ,WHP 6L]H +DQGOH 3ULFH
 ,WHP 6L]H 3ULFH  :*%' ´[´ ¶ 
 $. ¶¶ 
 :*%' ´[´ ¶ 
 $. ¶¶ 
 :*%' ´[´ ¶ 


 321'0$,17(1$1&(
:*%'7
/RNL+HDY\'XW\ /RNL8WLOLW\1HWV
0DJQXP.RL1HWV Z7HOHVFRSLQJ+DQGOH
7KHVHQHWVKDYHD\HOORZ´ILEHUJODVV :HILWWHGRXUPRVWSRSXODUSRQGXWLOLW\ :*%'7
VOLGLQJ¶KDQGOHVKHDY\GXW\DOXPLQXP QHWVZLWKH[WUDVWURQJWZRSLHFHDOXPLQXP
FRQQHFWLQJEORFNVDQGVKDOORZEODFNQHWEDJV KDQGOHVWKDWWHOHVFRSHIURP¶´WR¶´
PDGHRIWRXJK´$FHQ\ORQ7KH´EODFN %RWKKDYH0RQRUDLOKRRSVDQG´GHHS
KRRSLV´URXQG ZKLWH$FHNQRWOHVVQ\ORQQHWV

 ,WHP 6L]H +DQGOH 3ULFH  ,WHP 6L]H +DQGOH 3ULFH


 3.+') ´GLD ¶ZIRDPJULSV   :*%'7 ´[´ 7HOHVFRSLQJ 
 :*%'7 ´[´ 7HOHVFRSLQJ 

/RNL+'&RQWUDFWRU /RNL([WUHPH3RQG
&OHDQ2XW1HW6HW &RQWUDFWRU1HW6HW
7KLVVHWZDVGHVLJQHGIRUSURIHVVLRQDOSRQG 7KLVUXJJHGVHWLVGHVLJQHGIRUGHPDQGLQJ
FRQWUDFWRUVWRXVHIRUURXWLQHSRQGPDLQWHQDQFH DSSOLFDWLRQVZKHUHODUJHDPRXQWVRIOHDYHV
RUFOHDQRXWV7KH0RQRUDLOKHDGVFDQVFUDSH SODQWGHEULVDQGWUDVKPXVWEHUHPRYHG7KH
RYHUURXJKJUDYHODQGURFNERWWRPVUHSHDWHGO\ HLJKWIRRW´ILEHUJODVVKDQGOHFRPHVZLWK
ZLWKRXWGDPDJLQJWKHQHWWLQJ DEHHI\´[´WUDVKQHWRQ´WXELQJ
DQGRXU´GLD0DJQXP.RLQHWIRUHIILFLHQW
.LW,QFOXGHV ILVKKDQGOLQJDQGUHPRYDO
‡+DQGOH ‡´[´3RQG8WLOLW\1HW
‡´GLD3UR.RL1HW ‡´[´7ULDQJOH6NLPPHUQHW  ,WHP 'HVFULSWLRQ 3ULFH
 ,WHP 'HVFULSWLRQ 3ULFH :*;3&6 ¶+DQGOHDQG7ZR1HWV 
 :*+'&6 +DQGOHDQG7KUHH1HWV 

/DJXQD'HOX[H6SULQJ2SHQLQJ.LW
7KH/DJXQD'HOX[H6SULQJ2SHQLQJ.LWFRPHVZLWKHYHU\WKLQJ\RXQHHGWRSUHSDUH\RXUSRQGIRULW¶VVSULQJRSHQLQJ7KH
/DJXQD'HOX[H6SULQJ2SHQLQJ.LWLVGHVLJQHGWRSUHSDUH\RXUSRQGIRUWKHKLJKWHPSHUDWXUHVGXULQJWKHVXPPHUPRQWKV
ZKLOHKHOSLQJWRJHWULGRIGHEULVDQGDOJDHWKURXJKRXWWKH\HDU
.LW,QFOXGHV
‡%DUOH\6WUDZ3HOOHWVOEV ‡3UHPLXP*ROGILVK.RL6SLUXOLQD:KHDW*HUP
‡3HDW3HOOHWVOEV )ORDWLQJ)RRG6WLFNVR]
‡%LR6OXGJH&RQWUROR] ‡)ORDWLQJ7KHUPRPHWHU
‡%LR%RRVWHUR] ‡%XLOGLQJWKH3HUIHFW3RQG'9'
‡2QFH$<HDU$TXDWLF3ODQW)HUWLOL]HU6SLNHVSN ‡,QVWUXFWLRQDO*XLGHV
 ,WHP 1DPH 3ULFH
 37 6SULQJ2SHQLQJ.LW 

321''(,&(56

3HUIHFW&OLPDWH 7KHUPR3RQG
'HOX[H3RQG'H,FHU +HDWHU'H,FHU
3HUIHFW&OLPDWH3RQG'H,FHUKDVDGHWDFKDEOH 7KHUPR3RQGLVDIORDWLQJSRQGGHLFHUWKDW
IORDWWKDWZLOONHHSWKHGHLFHURQWKHVXUIDFHRI PDLQWDLQVDKROHLQWKHSRQGLFHWRKHOSWKHSURSHU
WKHZDWHU7KLVZLOOKHOSSURWHFW\RXUILVKIURP JDVH[FKDQJHWDNHSODFHRQLFHGRYHUSRQGVDQG
WR[LFJDVEXLOGXSE\PDLQWDLQLQJDKROHLQWKH KHOSVSURWHFWILVKIURPWR[LFJDVEXLOGXS
VXUIDFHLFHIRUSURSHUJDVH[FKDQJH 8VHRQH7KHUPR3RQG+HDWHUIRUHYHU\
JDOORQVLQ\RXUSRQGRUJDOORQVLI
3RQG'H,FHUVLQFOXGH \RXKDYHH[FHVVLYHSODQWGHFD\RUDKHDY\
‡5HPRYDEOHIORDWHUULQJ ILVKORDG
‡¶FRUG ‡8VHVRQO\ZDWWVRIHQHUJ\ ‡¶HOHFWULFDOFRUG
‡\HDUZDUUDQW\ ‡:LOOQRWKDUPRUEXUQSRQGOLQHUV ‡0DLQWDLQVKROHWRž)
ZR)ORDW
‡7KHUPRVWDWLFDOO\FRQWUROOHG ‡2QH\HDUZDUUDQW\
 ,WHP :DWWV 'LPHQVLRQV 3ULFH ‡([WHQGHGKHDWGXUDWLRQWRFUHDWH
  : ´'LD[´+  ODUJHUKROH
  : ´'LD[´+   ,WHP 6L]H 3ULFH
  : ´'LD[´+    ´'LD[´+ 


321''(,&(56 321'/,1(5&20

/DJXQD:DWW3RZHU /DJXQD:DWW3RZHU
+HDW'H,FHUIRU3RQGV +HDW'H,FHUIRU3RQGV
‡.HHSVDQDUHDWKDZHGSUHYHQWLQJWKHSRQGIURP ‡.HHSVDQDUHDWKDZHGSUHYHQWLQJWKHSRQGIURP
FRPSOHWHO\IUHH]LQJDQGDOORZVIRUFUXFLDOJDV FRPSOHWHO\IUHH]LQJDQGDOORZVIRUFUXFLDOJDV
H[FKDQJH H[FKDQJH
‡6DIHIRUSODVWLFDQGOLQHUSRQGVZLOOQRWKDUPILVK ‡6DIHIRUSODVWLFDQGOLQHUSRQGVZLOOQRWKDUPILVK
‡IWFRUGZLWKJURXQGHGSOXJ ‡IWFRUGZLWKJURXQGHGSOXJ
‡&RQYHQLHQWKRRNIRULQVWDOOLQJDHUDWLRQKRVLQJ ‡0DGHRI6WDLQOHVV6WHHOZKLFKJLYHVLWDQH[WUHPHO\
‡$XWRPDWLFVKXWRIIWKDWSUHYHQWVRYHUKHDWLQJ KLJKLPSDFWUHVLVWDQFH
‡,QFOXGHVDZDWWKHDWLQJHOHPHQWWKDWPHOWV ‡$XWRPDWLFVKXWRIIWKDWSUHYHQWVRYHUKHDWLQJ
VQRZIDOORQFRQWDFW ‡/('OLJKWRQWRSOHWV\RXNQRZLIWKHXQLWLQRQ
‡/('OLJKWRQWRSOHWV\RXNQRZLIWKHXQLWLQRQ ‡\HDUZDUUDQW\
‡\HDUZDUUDQW\

 ,WHP :DWWV 3ULFH  ,WHP :DWWV 3ULFH


 37 :   37 : 

321'1(77,1*

/DJXQD3RQG1HWWLQJ 3UHPLXP3RQG1HWWLQJ
7KH/DJXQDEODFNSRQGQHWWLQJSURYLGHV 3RQGQHWWLQJVKLHOGVWKHSRQGIURPIDOOLQJ
VHYHUDOEHQHILWVGHVLJQHGWRPDNHZDWHU OHDYHVDQGSURWHFWV\RXUILVKIURPSUHGDWRUV
JDUGHQLQJPRUHHQMR\DEOH,WSURWHFWVYDOXDEOH ‡´KROHV
SRQGILVKIURPSUHGDWRUV,WDOVRNHHSVOHDYHV ‡%UDVVJURPPHWVHYHU\IHHWIRUHDV\
DQGGHEULVRXWRIWKHSRQG&RPHVFRPSOHWH LQVWDOODWLRQ
ZLWKVWDNHVWRVHFXUHLWLQSODFH ‡0DGHRI3RO\SURS\OHQH
‡(GJHVKDYHò´ZLGH5HLQIRUFHGEDFNLQJ
‡6WDNHVQRWLQFOXGHG
‡%ODFNQHWWLQJIORDWVDQGLV ‡3UHYHQWVSRQGILVKIURP
YLUWXDOO\LQYLVLEOHPDLQWDLQLQJ MXPSLQJ  ,WHP 6L]H 3ULFH
WKHEHDXW\RI\RXUSRQG ‡3URWHFWVSRQGILVKIURP
 1 ¶[¶ 
‡.HHSVOHDYHVDQGGHEULVRXWRI SUHGDWRUV
WKHSRQGUHGXFLQJPDLQWHQDQFH ‡´KROHV  1 ¶[¶ 
 1 ¶[¶ 
 ,WHP 6L]H 3ULFH
 1 ¶[¶ 
 37 ¶[¶ 
 1 ¶[¶ 
 37 ¶[¶ 
 1 ¶[¶ 
 37 ¶[¶ 
 1 ¶[¶ 
 1 ¶[¶ 
 1 ¶[¶ 

/DJXQD&RPSOHWH :DWHU*DUGHQ
:LQWHUL]LQJ.LW 3RQG3URWHFWRU
,QFOXGHV
.LW,QFOXGHV
‡8OWUD3RQG1HW
‡3RZHU+HDW:+HDWHG'H,FHU
‡1\ORQ%DVH
‡6DIHIRUSODVWLFDQGOLQHUSRQGVZLOOQRW
‡&HQWHU5HFHSWRU
KDUPILVK
‡  )LEHUJODVV3ROHV
‡¶[¶3RQG1HWWLQJ
‡  ¶7LHGRZQV
‡$HUDWLRQ.LW
‡  *URXQG6WDNHV
‡3UHPLXP6SLUXOLQD :KHDW*HUP)RRG
‡  1HW6WDNHV
6WLFNV
‡  1HW&OLSV
 ,WHP 3ULFH ‡´KROHV
 37  ‡$OOFRPSRQHQWVSDFNHGLQD
UHXVDEOHGUDZVWULQJEDJ

 ,WHP 'HVFULSWRQ 1HWWLQJ 3ULFH


 3*360 ¶[¶3RQG3URWHFWRU ¶[¶ 
 3*3/* ¶[¶3RQG3URWHFWRU [¶ 


 $/*$(75($70(176

&U\VWDO&OHDU$OJDH2II
$OJDH2IIZLOOKHOSUHPRYHVWULQJDOJDHIURPZDWHUIDOOVVWUHDPVDQGURFNVLQVHFRQGV8VHWKHPDLQWHQDQFHGRVDJH
RI$OJDH2IIRQFHDZHHNDQGHOLPLQDWHFRPSOHWHSRQGVKXWGRZQIRU\HDUO\FOHDQRXWVIRUHYHU$OJDH2IIZLOODOVR
NHHSIRXQWDLQLQWDNHVFOHDQDQGUHPRYHXQVLJKWO\VFXPDQGDOJDHIURPWKHSHULPHWHURIDQ\VL]HSRQG$OJDH2IILV
\RXUSHUVRQDOSRQGFOHDQHULQDERWWOHZLWKRXWWKHWLPHPRQH\PHVVHIIRUWWRFDWFKWKHILVKGUDLQWKHSRQGZDVK
DQGVFUXEWKHVFXPLQWKHSRQGUHILOOWKHSRQGDQGSXWWKHILVKEDFNLQKRSLQJ\RXGRQ¶WVWUHVVWKHPDQGNLOOWKHP
7KLVXVXDOO\±KRXUSURFHVVFDQEHHOLPLQDWHGIRUHYHUE\VLPSO\WUHDWLQJ\RXUSRQGRQFHZHHNO\ZLWK$OJDH2II

‡,PPHGLDWHVWULQJDOJDHUHPRYDO ‡WDEOHVSRRQV FXS‡FXSV SRXQG


‡+HOSVHOLPLQDWHJUHHQZDWHU
‡:RUNVLPPHGLDWHO\RQFRQWDFW
 3RQG6L]H /LJKW$OJDH +HDY\$OJDH
‡1RQ7R[LF7R)LVK  VTIW FXS FXS
‡(3$5HJLVWHUHG  VTIW FXS FXS
‡0RQH\%DFN*XDUDQWHH  VTIW FXS FXSV
‡\HDUVKHOIOLIH
 VTIW FXS FXSV
‡2[\JHQEDVHGJUDQXOHV
 VTIW FXSV FXSV

 ,WHP 6L]H 3ULFH


 && R] 
 && OEV 
 && OEV 
 && OEV 

&U\VWDO&OHDU'6ROY
‡&OHDUV3RQG:DWHU5HJDUGOHVVRI&RORU ‡$SSO\RQFHDZHHNWRWUHDWGLVFRORUHGZDWHU
‡5HPRYHV6XVSHQGHG2UJDQLF'HEULV ‡'6ROYLV6WURQJHUWKDQPRVW³IL[´SURGXFWV
‡&RQWDLQVD³)L[,W´6ROXWLRQIRU5DSLG$FWLRQ RQWKHPDUNHWWRGD\VRLWLVLPSRUWDQWWRIROORZ
‡7KHIRUPXODLVGHVLJQHGWRFOHDUSRQGZDWHU SURGXFWODEHOGLUHFWLRQVH[DFWO\
TXLFNO\ HIILFLHQWO\UHJDUGOHVVRIZDWHUYROXPH ‡'212786('6ROYLQFRQMXQFWLRQRUPL[ZLWK
‡$OZD\VPDNHVXUHWKHUHLVYLJRURXVDHUDWLRQ RWKHUSRQGFKHPLFDOV
‡'6ROYUHTXLUHVKHDY\DHUDWLRQHVSHFLDOO\LQKRW ‡6DIHIRUKXPDQVDQGGRPHVWLFDQLPDOVZKHQXVHG
ZHDWKHU DVGLUHFWHG
WVS7UHDWV*DOORQV WVS7UHDWV*DOORQV
WVS7UHDWV*DOORQV WVS7UHDWV*DOORQV

 ,WHP 6L]H 3ULFH


 && R] 
 &&* JDO 

&U\VWDO&OHDU&ODULW\0D[
&U\VWDO&OHDU&ODULW\0D[3OXVZLWK$FWLYDWHG%DUOH\LVGHVLJQHGWRUHVWRUHEDODQFHWRWKHSRQGHFRV\VWHPE\EUHDNLQJ
GRZQRUJDQLFPDWHULDOWKDWFUHDWHVSUREOHPVIRUSRQGKREE\LVWVLQDQGDURXQGZDWHUIDOOVURFNVVWUHDPEHGVSODQWSRWV
SXPSVDQGILOWUDWLRQV\VWHPV

&U\VWDO&OHDU&ODULW\0D[3OXVZLOOZRUNTXLFNO\ HIILFLHQWO\WRFOHDQWKHSRQGE\UHGXFLQJVOXGJHLQWKHSRQG 
ILOWUDWLRQGHYLFHV&U\VWDO&OHDU&ODULW\0D[3OXVUHGXFHVFORXG\ZDWHUE\SUHFLSLWDWLQJRUJDQLFDQGLQRUJDQLFPDWHULDOV
:RUNVTXLFNO\DQGHIILFLHQWO\WRFOHDQZDWHUIDOOVDQGVWUHDPEHGVRIVWULQJDOJDH

&U\VWDO&OHDU&ODULW\0D[3OXV,V1DWXUDO$QG6DIH)RU$OO3RQG)LVK$QG3ODQWV

3ULRUWRXVLQJ&U\VWDO&OHDU&ODULW\0D[3OXVWKHVHFRQGLWLRQVPXVWH[LVWIRUEHVWUHVXOWV
‡S+RIZDWHUPDLQWDLQHGEHWZHHQ  &XS7UHDWV*DOORQV
‡:DWHUWHPSHUDWXUHDERYHƒ) ƒ&  &XS7UHDWV*DOORQV
‡'LVVROYHGR[\JHQOHYHOVDERYH330 PJO  &XS7UHDWV*DOORQV
&XS7UHDWV*DOORQV
 ,WHP 6L]H 7UHDWV 3ULFH
 &&% OE JDO 
 &&% OEV JDO 
 &&% OEV JDO 
 &&% OEV JDO 


$/*$(75($70(176 321'/,1(5&20

3RQG&DUH$OJDH)L[
7KHSRQGRZQHU¶VQXPEHURQHSUREOHPKDVEHHQJUHHQZDWHUFDXVHGE\VLQJOHFHOODOJDHEODQNHWZHHG VWULQJDOJDH
3UHYLRXVO\DOODOJDHFLGHVZHUHQRQVHOHFWLYH NLOOHGRUGDPDJHGDOOSODQWVLQWKHSRQGDORQJZLWKWKHDOJDH$OJDH)L[LVDQ
HIIHFWLYH(3$UHJLVWHUHGVHOHFWLYHDOJDHFRQWUROSURGXFWWKDWVROYHVDOJDHSUREOHPV

‡$TXDWLFSODQWDQGILVKVDIH ‡(3$UHJLVWHUHG$OJDHFLGHWKDWKHOSVUHVROYHIXWXUH
‡&RQWUROV³JUHHQZDWHU´DOJDHEORRPVDQGEODQNHWZHHG DOJDHSUREOHPV
‡.HHSVRUQDPHQWDOSRQGVDQGZDWHUJDUGHQVDOJDHIUHH ‡&DQQRWEHVKLSSHGWR&DQDGDRUWKH8.

 ,WHP 6L]H 7UHDWV 3ULFH


 $ R] JDO 
 % R] JDO 
 * R] JDO 
 ' R] JDO 
 & JDO JDO 
 - JDO JDO 

3RQG&DUH$OJDH'HVWUR\HU
&RQWUROVWKHJURZWKRIDOJDHZKLFKFORXGSRQGZDWHU RIWHQFRYHURUQDPHQWV JUDYHO

‡'LVFRXUDJHVWKHJURZWKRIPDQ\IRUPVRIDOJDH ‡5HFRPPHQGHGIRUSRQGVZLWKRXWSODQWV
‡+HOSVHOLPLQDWHDOJDHEORRPV ‡$GGWHDVSRRQIXOVIRUHYHU\86JDOORQV
‡&RQWDLQVRQHRIWKHPRVWHIIHFWLYHDOJDHFLGHV
DYDLODEOH

 ,WHP 6L]H 7UHDWV 3ULFH


 $ R] JDO 
 % R] JDO 

&U\VWDO&OHDU)RDP%*RQH
&U\VWDO&OHDU)RDP5HPRYHUZLOOUHPRYHSURWHLQIRDPIURP\RXUSRQGRUIRXQWDLQ¶VVXUIDFHLQVHFRQGV0DQ\
IRXQWDLQVDUHFROOHFWLRQDUHDVIRURUJDQLFPDWHULDOV7KLVEXLOGXSLQFRPELQDWLRQZLWKWKHKHDY\DHUDWLRQFRPPRQ
ZLWKWKHVSODVKLQJRIDIRXQWDLQRUDURDULQJZDWHUIDOORIWHQUHVXOWVLQIRDPIRUPDWLRQ
‡&RPSOHWHO\UHPRYHVIRDPIURPZDWHU ‡QDWXUDO ZLOGOLIHVDIH
‡:RUNVLQVHFRQGV ‡WDEOHVSRRQWUHDWVJDOORQV
‡)RUXVHLQSRQGVIRXQWDLQV VWDWXDU\ ‡\HDUVKHOIOLIH

 ,WHP 6L]H 7UHDWV 3ULFH


 && R] JDO 
 &&* JDO JDO 

&U\VWDO&OHDU6XE/LPH &U\VWDO&OHDU6SDUNOH
)RXQWDLQ/LPHVFDOH5HPRYHU )RXQWDLQ&OHDQHU
&U\VWDO&OHDU6XE/LPH)RXQWDLQ/LPH6FDOH &U\VWDO&OHDU6SDUNOH)RXQWDLQ&OHDQHULVD
5HPRYHULVIRUPXODWHGWRUDSLGO\ VDIHO\UHPRYH UHYROXWLRQDU\SURGXFWGHVLJQHGWRVSHFLDOO\WRNHHS
OLPHVFDOH FDOFLXPGHSRVLWVLQDOOPRGHOVRI \RXUIRXQWDLQFOHDQ FOHDU+HOSVSUHYHQWVWDLQV
IRXQWDLQV FHUDPLFFHPHQWSODVWLFHWF VOXGJHPLQHUDOGHSRVLWV RUJDQLFFRQWDPLQDQWV
IURPIRUPLQJLQEDVLQV
‡5HPRYHVOLPHVFDOHEXLOGXS ‡:LOGOLIHVDIH ‡:RUNVRQFHUDPLFPDUEOHPHWDO  ‡QDWXUDO ZLOGOLIHVDIH
‡$OORZVIRUIUHHIORZRIZDWHU ‡R]WUHDWVJDOORQV VWRQHEDVLQV ‡6HHGVIRXQWDLQEDVLQVWRFRQWLQXDOO\
WKURXJKWXELQJ SXPSV ‡\HDUVKHOIOLIH ‡5HPRYHVRUJDQLFGHEULV NHHSWKHZDWHUFOHDQ KHDOWK\
‡.HHSVEDVLQVORRNLQJQHZ ‡R]WUHDWVJDOORQV ‡\HDUVKHOIOLIH
 ,WHP 6L]H 7UHDWV 3ULFH  ,WHP 6L]H 7UHDWV 3ULFH
 && R] JDO   && R] JDO 


 $/*$(75($70(176

&U\VWDO&OHDU3RQG7LQW 3RQG&DUH3KRV2XW
&U\VWDO&OHDU%OXH3RQG7LQWWXUQV\RXUSRQGDQ 3KRVSKRURXVLVDQHVVHQWLDOQXWULWLRQDOLQJUHGLHQW
DOOXULQJVKDGHRIEOXHWRKHOSSKRWRV\QWKHVLVIURP LQILVKIRRGDVILVKUHTXLUHSKRVSKRUXVIRUVXUYLYDO
RFFXUULQJZLWKLQ\RXUSRQG7KLVZLOOKHOSNHHSDOJDH DQGJURZWK$IWHUHDWLQJWKHILVKUHOHDVHH[FHVV
IURPIRUPLQJSURYLGHVDIHW\IRUILVKIURPSUHGDWRUV SKRVSKRUXVYLDZDVWHSURGXFWVLQWRWKHSRQGZDWHU
DQGZLOOKHOSNHHSWKHZDWHUFRROHURQKRWVXPPHU $VWKHILVKZDVWHDQGXQHDWHQIRRGGHFRPSRVH
GD\V&U\VWDO&OHDU%OXH3RQG7LQWLVDPLOGG\HWKDWLV SKRVSKDWHLVUHOHDVHGDVLQRUJDQLFRUUHDFWLYH
QRWRYHUSRZHULQJVRWKDW\RXZLOOVWLOOEHDEOHWRVHH SKRVSKDWHLQWRWKHZDWHU
\RXUILVK,WLVGHVLJQHGWRIXQFWLRQPRUHOLNHDFDU
‡5HPRYHVH[FHVVSKRVSKDWHWKDWFORXGSRQGZDWHU
ZLQGRZWLQWLQVWHDGRIDFRPSOHWHFRYHU
‡+HOSVWRUHVWRUHDQGPDLQWDLQWKHQDWXUDOEDODQFHRISRQGZDWHU
‡+HOSVNHHSZDWHUFOHDU ‡6DIHIRUILVK SODQWV ‡POIRUHDFKJDOORQV
‡)LOWHUVVXQOLJKWWRFRROSRQGZDWHU ‡R]WUHDWVJDOORQV
‡1RQWR[LF ‡\HDUVKHOIOLIH  ,WHP 6L]H 7UHDWV 3ULFH
 % R] JDO 
 ,WHP 6L]H 3ULFH  * R] JDO 
 && R]   ' R] JDO 
 && R] 
 && R] 
 &&* JDO 

/DJXQD3KRV; 3RQG&DUH0LFURELDO
/DJXQD3KRV;LVVSHFLILFDOO\IRUPXODWHGIRU $OJDH&OHDQ
IUHVKZDWHUSRQGVWRUHGXFHPDQ\RIWKHFRPSRXQGV
WKDWHQFRXUDJHXQVLJKWO\ZDWHUFRQGLWLRQVDQGIRXO ‡7KHILUVWEDFWHULDODOJDHFLGHUHJLVWHUHGZLWKWKH(3$
RGRUV3KRV;DEVRUEVDQGWUDSVSKRVSKDWHQLWULWHDQG ‡%LRORJLFDOLQKLELWRURIJUHHQZDWHUDOJDH
QLWUDWHJUDGXDOO\DQGVDIHO\$VDUHVXOW\RXUSRQG ‡3URPRWHVDFOHDQHUSRQGHQYLURQPHQW
ZDWHUZLOOEHFU\VWDOFOHDUDQGSURYLGHLGHDOOLYLQJ ‡+HOSVLPSURYHGLVVROYHGR[\JHQOHYHOV
FRQGLWLRQVIRUILVKDQGSODQWV3KRV;LVHDV\WRXVH ‡(OLPLQDWHVWURXEOHVRPHRUJDQLFVOXGJHDQGGHEULV
DQGJUHDWO\UHGXFHVKDQGVRQSRQGPDLQWHQDQFH ‡:LOOQRWKDUPOLYHSODQWVRUILVK
6LPSO\SODFHRQHRUPRUHSDFNVRI3KRV;LQWKH
SRQGILOWHUWRPD[LPL]HLWVHIIHFWLYHQHVV
&DQQRW6KLS7R&DOLIRUQLD&DQDGDRU8.
‡4XLFNO\UHGXFHVSKRVSKDWH
‡&UHDWHVDFU\VWDOFOHDUZDWHUJDUGHQ  ,WHP 6L]H 7UHDWV 3ULFH
‡6DIHIRUILVKDQGSODQWV  % R] JDO 
 ,WHP 6L]H 7UHDWV 3ULFH  0 R] JDO 
 37 R] JDO   ' R] JDO 
 37 R] JDO   & JDO JDO 

:$7(5&21',7,21(56

&U\VWDO&OHDU9DQLVK'HFKORULQDWRU
&U\VWDO&OHDU9DQLVK'HFKORULQDWRUZKHQXVHGDVGLUHFWHGZLOOVDIHO\ HIIHFWLYHO\UHPRYHFKORULQHFKORUDPLQH
$PPRQLD+HDY\0HWDOV DGGVD6WUHVV&RDW3URWHFWDQWIRUILVK+DVD\HDUVHOIOLIH

&KORULQH FKORUDPLQHDUHVXEVWDQFHVDGGHGWRPRVWFLW\¶VZDWHUVXSSOLHVWRPDNHZDWHUVDIHIRUKXPDQFRQVXPSWLRQ
&KORULQH FKORUDPLQHDUHWR[LFWRDOOSRQGILVK/HIWXQWUHDWHGWKHVHVXEVWDQFHVFDQWKLFNHQJLOOILODPHQWV FDXVH
JLOOOHVLRQVWRGHYHORSOHDYLQJWKHILVKXQDEOHWREUHDWK
 ,WHP 6L]H 7UHDWV 3ULFH
 && /LTXLGR] JDO 
 && /LTXLGR] JDO 
 && /LTXLGR] JDO 
 &&* /LTXLG*DO JDO 
 && 'U\R] JDO 
 && 'U\OEV JDO 
 && 'U\OEV JDO 


:$7(5&21',7,21(56 321'/,1(5&20

3RQG&DUH6WUHVV&RDW
5HSODFHVWKHQDWXUDOPXFRXVVOLPHFRDWLQJRQWKHVNLQRISRQGILVKZKHQLWKDVEHHQGDPDJHGE\KDQGOLQJQHWWLQJRU
RWKHUIRUPVRIVWUHVV
‡,QVWDQWO\UHPRYHV ‡&RQWDLQV$ORH9HUDWR ‡8VHZKHQVHWWLQJXSD ‡$OLTXLGEDQGDJHWR
FKORULQH EUHDNVWKH KHOSKHDOZRXQGV  SRQGDGGLQJILVKRU SUHYHQWWKHORVVRI
FKORUDPLQHERQG WRUQILQV FKDQJLQJZDWHU HOHFWURO\WHV

 ,WHP 6L]H 7UHDWV 3ULFH


 $ R] JDO 
 % R] JDO 
 * R] JDO 
 ' R] JDO 
 & *DO JDO 

3RQG&DUH$PPR/RFN 3RQG&DUH&KORULQH 
3RQG&DUH$PPR/RFNKDVEHHQXQLTXHO\GHYHORSHG +HDY\0HWDO1HXWUDOL]HU
WRHOLPLQDWHWKHWR[LFHIIHFWVRIFKORULQHFKORUDPLQH
DQGDPPRQLDWKDWPD\EHSUHVHQWLQPXQLFLSDOZDWHU ,QVWDQWO\QHXWUDOL]HVFKORULQHFRSSHUOHDG ]LQFDV
XVHGWRILOOSRQGV)LVKZDVWHGHFRPSRVLQJDOJDH ZHOODVRWKHUKHDY\PHWDOVIRXQGLQWDS ZHOOZDWHU
SODQWVDQGXQHDWHQILVKIRRGSURGXFHDPPRQLD DOORIZKLFKPD\EHWR[LFWRILVK SODQWV
$PPRQLDLVWKHQXPEHURQHNLOOHURISRQGILVK ‡,QVWDQWO\PDNHVWDS ZHOOZDWHUVDIHIRU
SRQGOLIH
‡5HPRYHVFKORULQH FKORUDPLQH ‡(OLPLQDWHVDPPRQLDVWUHVV 
‡8VHZKHQVHWWLQJXSDSRQGRUFKDQJLQJ
IURPWDS ZHOOZDWHU SURPRWHVKHDOWK\JLOOIXQFWLRQ
SRQGZDWHU
‡8VHZKHQHYHUDPPRQLDLV ‡WVSWUHDWVJDO
‡WVSIRUHYHU\JDO
GHWHFWHG

 ,WHP 6L]H 7UHDWV 3ULFH  ,WHP 6L]H 7UHDWV 3ULFH


 % R] JDO   $ R] JDO 
 * R] JDO   % R] JDO 
 ' R] JDO   * R] JDO 

&U\VWDO&OHDU &U\VWDO&OHDU
S+XVLRQ'RZQ 6DS+*XDUGS+EXIIHU
S+XVLRQIXVHVS+ORZHULQJTXDOLWLHVZLWKQDWXUDO &U\VWDO&OHDU6DS+*XDUGS+%XIIHUZLOOVWDELOL]HSRQG
HOHFWURO\WLFVXSSOHPHQWVWRVDIHO\ORZHUS+ ZDWHUS+ PDLQWDLQEXIIHULQJFDSDFLW\EHWZHHQ
OHYHOVLQSRQGZDWHUDWQRPRUHWKDQSRLQWV SSP$SURSHUO\EXIIHUHGV\VWHPUHVLVWVFKDQJHV
SHUDSSOLFDWLRQS+XVLRQDOVRDGGVPXFKQHHGHG LQS+GXHWRDFLGUDLQ RWKHUH[WHUQDOIDFWRUV
HOHFWURO\WHVWRKHOSSRQGILVKPDLQWDLQDVWURQJVOLPH $ONDOLQLW\LVDOVRHVVHQWLDOIRUEDFWHULDWRFRPSOHWH
FRDWDQGKHDOWK\DSSHDUDQFH WKHQLWULILFDWLRQSURFHVVZKLFKDOORZVDPPRQLDWREH
‡8VHGFRUUHFWO\&U\VWDO&OHDU ‡WDEOHVSRRQVWUHDWV FRQYHUWHGLQWRQLWULWH QLWUDWH
S+XVLRQZLOOVDIHO\ORZHUS+ JDOORQV ‡+HOSVSUHYHQWZLGHS+VZLQJVZKLFK ‡òFXSWUHDWVJDOORQV
DQGLVHQWLUHO\VDIHIRUILVKDQG ‡\HDUVKHOIOLIH DUHYHU\FRPPRQIURPGDZQWRGXVN ‡\HDUVKHOIOLIH
DTXDWLFSODQWV GXHWRUHVSLUDWLRQDQGSKRWRV\QWKHVLV
 ,WHP 6L]H 7UHDWV 3ULFH  ,WHP 6L]H 7UHDWV 3ULFH
 && OE JDO   && OE JDO 
 && OE JDO 

3RQG&DUHS+8S 3RQG&DUHS+'RZQ
6ORZO\DGMXVWVWKHS+RISRQGZDWHUZKLFK 6ORZO\DGMXVWVWKHS+RISRQGZDWHUZKLFKFDQ
FDQFKDQJHIURPGD\WRGD\ZLWKRXWKDUPLQJ FKDQJHIURPGD\WRGD\ZLWKRXWKDUPLQJGHOLFDWH
GHOLFDWHSRQGILVKRUSRQGSODQWV SRQGILVKRUSRQGSODQWV
‡0DNHVZDWHUPRUHDONDOLQH ‡0DNHVZDWHUPRUHDFLGLF
‡3KRVSKDWHIUHH ZLOOQRWSURPRWH ‡3KRVSKDWHIUHH ZLOOQRWSURPRWH
DOJDHJURZWK DOJDHJURZWK
‡WVSIRUHYHU\JDOORQV ‡WVSWUHDWVJDOORQV

 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH


 % R]   % R] 


 &/($183%$&7(5,$

0LFUREH/LIW3/ 0LFUREH/LIW
6SHFLDOO\IRUPXODWHGIRUGHFRUDWLYHILVKSRQGV
$XWXPQ:LQWHU3UHS
ODJRRQV VPDOOHUZDWHUIHDWXUHV 0,&52%(/,)7$:3KHOSVDFFHOHUDWHWKH
‡,PSURYHVGLVVROYHGR[\JHQOHYHOV GHFRPSRVLWLRQRIOHDYHVVHGLPHQWDQGRWKHURUJDQLF
‡5HGXFHVDPPRQLDQLWURJHQOHYHOV PDWWHUGXULQJWKHIDOODQGZLQWHUPRQWKV0,&52%(
‡'LVVROYHVDZD\RUJDQLFVOXGJH /,)7$:3ZLOODOVRMXPSVWDUW\RXUSRQGWRD
‡6HHGV PDLQWDLQVELRORJLFDOSRQGILOWHUV KHDOWKLHUHQYLURQPHQWLQVSULQJ
‡%UHDNVGRZQGHDGSRQGDOJDH ‡&RQWLQXHVWRSURYLGHVXVWDLQHGELRORJLFDODFWLYLW\
‡5HGXFHVQR[LRXVRGRUVFDXVHGE\GHDGDOJDH HYHQLQZDWHUWHPSHUDWXUHVXQGHUž) ž&
ILVKZDVWH ‡&RQWDLQVSV\FKURSKLOLFVWUDLQV
‡&OHDQHUHQYLURQPHQWIRU\RXUSRQGSURPRWLQJ FROGZHDWKHUEDFWHULD
IDVWHUILVKJURZWK ‡,IIUR]HQEDFWHULDZLOOUHPDLQHIIHFWLYHDIWHU
‡5HGXFHVFORXG\ZDWHUE\SURPRWLQJIORFFXODWLRQ WKDZLQJRXW
VHWWOLQJRIRUJDQLF LQRUJDQLFSDUWLFOHV ‡(IIHFWLYHLQGDUNHUFRQGLWLRQV XQGHULFHDQGVQRZ
‡+HOSVPDLQWDLQDKHDOWK\LPPXQHV\VWHPIRU\RXU
 3RQG6L]H VW$SSOLFDWLRQ 1H[W:HHNV 0DLQWHQDQFH ILVKGXULQJWKHZLQWHUPRQWKV
 LQJDOORQV  SXUJH  RQFHZHHNO\  PRQWKO\
 3RQG6L]H VW0RQWK QG0RQWK UG0RQWK WK0RQWK
  R] R] R]  LQJDOORQV  SXUJH   
  R] R] R]   R] R] R] R]
  R] R] R]   R] R] R] R]
  R] R] R]   R] R] R] R]
 R] R] R] R]
 ,WHP 6L]H 3ULFH
 3/3 3LQW   ,WHP 6L]H 3ULFH
 3/4 4XDUW   $8735(3 4XDUW 
 3/* *DOORQ   $8735(3*. *DOORQ 

&U\VWDO&OHDU2QH)L[ &U\VWDO&OHDU
%LRORJLFDO&ODUL¿HU
&U\VWDO&OHDUŠ2QH)L[Š0RQWK1DWXUDO&ODULILHULV
GHVLJQHGWRKHOSNHHSZDWHUFOHDQDQGFOHDU\HDUURXQG &U\VWDO&OHDU%LRORJLFDO&ODULILHU3OXVZLWK$FWLYDWHG
7KHEDFWHULDDQGHQ]\PHVWUDLQVIRXQGLQ&U\VWDO&OHDUŠ %DUOH\ZRUNVWRUHPRYHVOXGJHRUJDQLFPDWHULDOV
2QH)L[ŠDUHDPRQJWKHVWURQJHVWRIIHUHGRQWKH XQHDWHQILVKIRRG ILVKZDVWHTXLFNO\ HIILFLHQWO\
PDUNHWWRGD\6RQRPDWWHUZKDWVHDVRQ\RXDUHKDYLQJ
‡6HHGVELRORJLFDOILOWHUV ‡R]WUHDWVJDOORQV
SUREOHPV2QH)L[ŠLVWKHDQVZHU
‡6DIHIRUILVK SODQWV ‡5HPRYHVVOXGJH RUJDQLF
‡&DQEHXVHGDOO\HDUORQJ ‡R]WUHDWVJDOORQV ‡\HDUVKHOIOLIH PDWHULDOVWRFOHDUZDWHU
‡VDIHIRUILVKDQGSODQWV ‡5HPRYHVRUJDQLFGHEULVTXLFNO\
‡&DQEHXVHGRQDOOZDWHUIHDWXUHV GHDGOHDYHVXQHDWHQIRRG ZDVWH
 ,WHP 6L]H 7UHDWV 3ULFH
 &&% R] JDO 
 ,WHP 6L]H 7UHDWV 3ULFH  &&% OEV JDO 
 && R] JDO   &&% OEV JDO 
 && R] JDO   &&% OEV JDO 

0LFUREH/LIW6OXGJH$ZD\ 3RQG&DUH3RQG=\PH3OXV
(VSHFLDOO\KHOSIXOIRUSRQGVWKDWKDYHDURFNRU 6SHFLDOO\VHOHFWHGEDFWHULDVWUDLQVLQ3RQG=\PH
JUDYHOERWWRPRUZKHUHYDFXXPLQJLVLPSUDFWLFDO 3OXVLPPHGLDWHO\EHJLQEUHDNLQJGRZQILVKZDVWH 
‡0LFUREH/LIW6OXGJH$ZD\LVVSHFLDOO\ GHDGDOJDHWKDWFDXVHFORXG\ZDWHUVOXGJHEXLOGXS
IRUPXODWHGIRUWKHUHPRYDORIRUJDQLF GHEULVWKDWFORJVSXPSV ILOWHUV3RQG=\PH3OXV
ERWWRPVROLGVWKDWDUHVORZWRGHJUDGH UHGXFHVSRQGPDLQWHQDQFH NHHSVSRQGZDWHUFOHDQ
‡0LFUREH/LIW6OXGJH$ZD\ZRUNVIDVWHUDW FOHDUQDWXUDO VDIHIRUDOOSRQGILVKSODQWV
KLJKHUWHPSHUDWXUHVEXWFDQEHXVHGDWDQ\ DQGZLOGOLIH
WHPSHUDWXUH\HDUURXQG ‡&OHDQV FODULILHVSRQGZDWHU ‡+HOSVPDLQWDLQDQDWXUDO
‡$SSOLFDWLRQ5DWHVR]SHUJDOORQVRI ‡(OLPLQDWHVWURXEOHVRPHRUJDQLF EDODQFHLQWKHSRQG
SRQGZDWHU VOXGJH GHEULV ‡6WDUWVZRUNLQJLQPLQXWHV

 ,WHP 6L]H 3ULFH  ,WHP 6L]H 7UHDWV 3ULFH


 0/;6$4 4XDUW    R] JDO 
 0/;6$* *DOORQ   % OE JDO 


&/($183%$&7(5,$ 321'/,1(5&20

0LFUREH/LIW3UR%OHQG
&RQFHQWUDWHGEDFWHULDIRUSURIHVVLRQDOXVHRQO\

)RU3RQGV )RU)LVK )RU3ODQWV


‡.HHSVSRQGVFOHDQDQGFOHDU ‡+HOSVZKHQILVKORDGH[FHHGVQRUPDO ‡,PSURYHVEORRPUHWHQWLRQ
‡6HHGVDQGPDLQWDLQVELRORJLFDOILOWHUV JXLGHOLQHV ‡,QFUHDVHVWKHOXVWHURIOHDYHV
‡5HGXFHVDPPRQLDQLWURJHQOHYHOV ‡%LRGHJUDGHVXQHDWHQIRRG DQGSODQWV
‡6LJQLILFDQWO\UHGXFHVQR[LRXVRGRUV ‡2[LGL]HVERWKDPPRQLDDQGQLWULWH ‡6WLPXODWHVURRWIRUPDWLRQ
‡,PSURYHVGLVVROYHGR[\JHQOHYHOV DOVRUHGXFHVQLWUDWH DQGJURZWK
‡$LGVLQUHVSLUDWLRQDQGJDVH[FKDQJH
‡3URPRWHVUDSLGILVKJURZWK
 ,WHP 6L]H 3ULFH
 3%/;4 R] 
 3%/;* JDO 
 3%/;* JDO 

3RQG&DUH(FR)L[
0XUN\FORXG\ZDWHUNHHSV\RXIURPHQMR\LQJ\RXUSRQGDQGILVKDVPXFKDV\RX¶GOLNH,QDGGLWLRQ
GLVVROYHGRUJDQLFVDQGVOXGJHEXLOGXSFDQUHGXFHWKHR[\JHQFRQFHQWUDWLRQLQWKHZDWHUFUHDWLQJD
EUHHGLQJJURXQGIRUGLVHDVHFDXVLQJSDWKRJHQLFEDFWHULD%\GLJHVWLQJVOXGJHDQGUHGXFLQJGLVVROYHG
RUJDQLFV(FR)L[UHGXFHVRUJDQLFSROOXWLRQLQFUHDVHVWKHFRQFHQWUDWLRQRIGLVVROYHGR[\JHQLQWKHZDWHU
DQGPDLQWDLQVDKHDOWK\HFRV\VWHPLQ\RXUSRQG

‡0DNHVSRQGZDWHUFOHDQ FOHDU
‡%UHDNVGRZQGHDGDOJDH
‡R]IRUHYHU\JDOORQV

 ,WHP 6L]H 7UHDWV 3ULFH


 $ R] JDO 
 % R] JDO 
 * R] JDO 
 ' R] JDO 
 & *DOORQ JDO 

3RQG&DUH3RZHUSDNV &U\VWDO&OHDU
3RQG /DNH
(DV\WRXVHVXSHUFRQFHQWUDWHGZDWHU
VROXEOHSDFNHWVEHJLQWRGLVVROYHLQ
7UHDWPHQW
VHFRQGV6LPSO\WRVVWKHUHTXLUHGQXPEHU 3RQG  /DNH7UHDWPHQWLVGHVLJQHG
RI32:(53$.6LQWRWKHSRQG7KH WRWUHDWODUJHERGLHVRIZDWHUVDIHO\DQG
FOHDQLQJEXEEOHVUDSLGO\GLVSHUVHWKH HFRQRPLFDOO\3RQG /DNH7UHDWPHQW
EDFWHULD EDUOH\WKURXJKRXWWKHSRQG FRQWDLQVDVWURQJIDPLO\RIEDFWHULD
DQGHQ]\PHVFXOWXUHGRQDEDUOH\
‡1RPHDVXULQJRUPL[LQJUHTXLUHG VXEVWUDWHWRUHPRYHDQGILJKWSHUVLVWHQW
‡+HOSVWRUHVWRUHDQGPDLQWDLQWKH SRQGSUREOHPV7KLVFDQEHXVHGIRU
QDWXUDOEDODQFHRISRQGZDWHU JROIFRXUVHSRQGVUHWHQWLRQSRQGVDQG
‡'RVDJH2QHSRZHUSDNIRUXSWR DTXDFXOWXUHSRQGVWRUHPRYHRGRUGHEULV
JDOORQV DQGVXVSHQGHGRUJDQLFPDWHULDO
‡2QHERWWOHWUHDWVJDOORQV ‡5HPRYHVVOXGJHDQGRGRUIDVW
‡%UHDNVGRZQGHDGDOJDH GHEULV

 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH


 $  R]SNV   &&% OEV 


 &/($183%$&7(5,$

0LFUREH/LIW6SULQJ6XPPHU&OHDQHU
$6HDVRQDO$SSURDFKWRWKH3URSHU2UJDQLF%DODQFHLQ3RQGV 1RWDFKHPLFDO+DUPOHVVWRKXPDQVILVK SODQWV
‡$FFHOHUDWHVWKHEUHDNGRZQRIOHDYHVWZLJV RWKHUDFFXPXODWHG (DFKER[FRQWDLQV  R]ZDWHUVROXEOH
GHDGRUJDQLFZDVWH SDFNHWVRIFHOOXODVHHQ]\PHV K\SHUFHOOXODVH
‡+HOSVMXPSVWDUW\RXUSRQGLQWKHVSULQJ SURGXFLQJEDFWHULD
‡5HGXFHVWKHEXLOGXSRIGHDGOHDYHV UHVLGXDORUJDQLFVHGLPHQW

3RQG6L]H :HHN :HHN :HHN :HHN


  3DFNHW 3DFNHW 3DFNHW 3DFNHW
  3DFNHWV 3DFNHW 3DFNHWV 3DFNHW
  3DFNHWV 3DFNHWV 3DFNHWV 3DFNHWV

 ,WHP 6L]H 3ULFH


 ;66&; OE%R[ 

67$5783%$&7(5,$

0LFUREH/LIW3/*(/ &U\VWDO&OHDU$PPRQLD)L[
&RQYHQLHQWHDV\WRXVIOLSWRSVTXHH]HERWWOH &U\VWDO&OHDU$PPRQLD)L[LVDOVRDQDOOQDWXUDO
3/*(/LVDWHFKQRORJLFDOEUHDNWKURXJKEHFDXVH EDFWHULDDQGHQ]\PHEDVHGSURGXFWVSHFLILFDOO\
LW¶VWKHILUVWSURGXFWWKDWSXWVEDFWHULDULJKWZKHUH GHVLJQHGWRFRPSOHWHWKHQLWULILFDWLRQF\FOH
\RXZDQWLWDQGLWVWD\VWKHUH3/*(/ZLOOTXLFNO\ &U\VWDO&OHDU$PPRQLD)L[FRQWDLQVVSHFLDOVWUDLQV
DWWDFKWRDQGSRSXODWHDQ\ILOWHUPHGLDLQFOXGLQJ RIEDFWHULDWKDWZLOOVDIHO\FRQYHUWDPPRQLDWR
IRDPVWUDSSLQJIORVVELREDOOVFHUDPLFPHGLDHWF QLWULWHDQGQLWULWHWRQLWUDWHZKLFKFDQEHXWLOL]HG
E\DTXDWLFSODQWVDVDQXWULHQWVRXUFH
‡(DVLO\DSSOLHVWRWKHILOWHUSDGVPHGLD ‡&RQWDLQVWKHVDPHVSHFWUXPRIEDFWHULD ‡1DWXUDOO\UHGXFHVDPPRQLDQLWULWH QLWUDWH
ZLWKRXWUXQQLQJRUJHWWLQJPHVV\ IRXQGLQ0LFUREH/LIW3/ ‡6HHGVELRORJLFDOILOWHUV
‡+HOSVWRHVWDEOLVKGHQLWULILFDWLRQLQWKH ‡$OORZVIRUPRUHIUHTXHQWFOHDQLQJRI ‡6DIHIRUILVK 3ODQWV
ILOWHUZKLFKFDQORZHUQLWUDWHOHYHOVLQ ILOWHUVLQKLJKVROLGVORDGLQJSRQGV ‡\HDUVKHOIOLIH
WKHSRQG ZLWKRXWVXEVHTXHQWELRORJLFDOLQVWDELOLW\
‡&RQWDLQVQDWXUDOO\RFFXUULQJELRSRO\PHUV‡5HGXFHVWKHIUHTXHQF\RIFOHDQLQJE\
KHOSLQJRUJDQLVPVTXLFNO\DWWDFKWRWKH DFFHOHUDWLQJWKHEUHDNGRZQRIRUJDQLF  ,WHP 6L]H 7UHDWV 3ULFH
PHGLDDOORZLQJIRUDQUHGXFWLRQLQ VROLGVWKDWFDQOHDGWRKLJKPDLQWHQDQFH
 && R] JDO 
ILOWHUVWDUWXSWLPH UHTXLUHPHQWV
 && R] JDO 
 ,WHP 6L]H 3ULFH  && R] JDO 
 *(/ R]   &&* *DO JDO 
 *(/ R] 
 *(/ R] 

)/2&&8/$176$1'%$5/(<

&U\VWDO&OHDU &U\VWDO&OHDU5DSL&OHDU
1DWXUHV&KRLFH &U\VWDO&OHDU5DSL&OHDULVGHVLJQHGWRFOHDU
&U\VWDO&OHDU%DUOH\6WUDZ3HOOHWVXWLOL]HEDUOH\ SRQGZDWHUE\FRPELQLQJVXVSHQGHGSDUWLFXODWH
GHJUDGDWLRQWHFKQRORJ\WRKHOSPDQDJHSRQG RUJDQLFPDWHULDO YLDDSURFHVVNQRZQDV
SUREOHPVWKURXJKRXW6SULQJ6XPPHU:LQWHU )DOO IORFFXODWLRQ7KLVDOORZVDOOVXVSHQGHGRUJDQLFV
:KHQSODFHGLQDQDUHDRIWKHSRQGZKHUHWKHUHLV ZLWKLQWKHZDWHUFROXPQWREHDWWUDFWHGWRJHWKHU
DVWHDG\ZDWHUIORZWKHEDUOH\SHOOHWVZLOOVORZO\ HDVLO\UHPRYHGOHDYLQJWKHSRQGHFRV\VWHP
GHJUDGH$VWKHSHOOHWVGHJUDGHWKH\HPLWDVXEVWDQFH VSDUNOLQJFOHDQ
WKDWDVVLVWVLQNHHSLQJ\RXUSRQGFOHDQDOOVHDVRQORQJ ‡&RPELQHVVXVSHQGHGSDUWLFXODWHVLQ ‡)DVWHIIHFWLYHFOHDQLQJDFWLRQ
SRQGZDWHUIRUHDV\ILOWUDWLRQ ‡6DIHIRUDOODTXDWLFOLIH
‡+HOSVUHPRYHWKHSRQGRZQHU¶VZRUVW ‡(DV\DSSOLFDWLRQLQFOXGHVIORZ
SUREOHP WKURXJKQHW  ,WHP 6L]H 7UHDWV 3ULFH
‡6ORZVXVWDLQHGUHOHDVH ‡6DIHIRUILVK SODQWV  && R] JDO 
 ,WHP 6L]H 7UHDWV 3ULFH  && R] JDO 
 && OEV JDO   && R] JDO 
 && OEV JDO   &&* *DO JDO 


)/2&&8/$176$1'%$5/(< 321'/,1(5&20

3RQG&DUH$FFX&OHDU
4XLFNO\FOHDUVFORXG\SRQGZDWHUE\FDXVLQJWLQ\VXVSHQGHGSDUWLFOHVRIGLUW GHEULVWRFOXPSWRJHWKHU
IRUPLQJODUJHUSDUWLFOHVWKDWIDOOWRWKHERWWRPRIWKHSRQG DUHVLSKRQHGRXWRUUHPRYHGE\WKHSRQGILOWHU

‡.HHSVSRQGVFOHDUGXULQJSHDNVXPPHU ‡8VHLQFRQMXQFWLRQZLWK3RQG=\PH3OXVIRU
PRQWKV DFOHDQHUFOHDUHUSRQG
‡WVSIRUHYHU\JDOORQV ‡,PSURYHVILOWHUHIILFLHQF\

 ,WHP 6L]H 7UHDWV 3ULFH


 $ R] JDO 
 % R] JDO 
 * R] JDO 
 ' R] JDO 
 & *DOORQ JDO 

3RQG&DUH%DUOH\&OHDU 0LFUREH/LIW%DUOH\([WUDFW
‡$IDVWDFWLQJEDUOH\EDVHGFODULILHUZKLFKTXLFNO\ ‡*RHVWRZRUNRQFRQWDFW
DQGQDWXUDOO\FOHDUVPXUN\SRQGZDWHU ‡(VSHFLDOO\KHOSIXOZKHUHERWWRPGUDLQVDUHSUHVHQW
‡&RQWDLQVQDWXUDOFODULILHUV ‡'HFRPSRVLWLRQSURFHVVVWDUWVLPPHGLDWHO\
‡+LJKO\FRQFHQWUDWHGVXVSHQVLRQRIQDWXUDOEDUOH\ ‡1RPHVV\UHVLGXDO
DQGSHDWSOXVQDWXUDODFWLYDWRUVWKDWTXLFNO\ ‡1RWKDUPIXOWRDTXDWLFOLIHSODQWVKXPDQVRUSHWV
XQOHDVKWKHSRZHURIEDUOH\DQGSHDWLQWRWKHZDWHU ‡2QHFDSIXOLVHTXDOWRDPXOWLSOHRIEDUOH\VWUDZ
‡6DIHIRUZLOGOLIH EDOHV
‡WVSIRUHYHU\JDOORQV ‡&DQEHXVHGDOO\HDUURXQG
‡3URPRWHVILVKKHDOWK

 ,WHP 6L]H 7UHDWV 3ULFH  ,WHP 6L]H 7UHDWV 3ULFH


 % R] JDO   0/&%6( R] JDO 
 * R] JDO   0/&%6( R] JDO 
 ' R] JDO   0/&%6(/ R] JDO 
 0/&%6(/ R] JDO 
 0/&%6(* *DOORQ JDO 

0LFUREH/LIW%DUOH\3HOOHWV
‡(QULFKHGZLWK3HDW +XPLF$FLGWRZRUNIDVWHU  ‡5HOHDVHVGHFRPSRVLWLRQE\SURGXFWVLPPHGLDWHO\
%HWWHUZLWK/HVV0HVV &RDWDQGLV(DVLHUWR$SSO\ ‡5HFRPPHQGHGIRUXVHZLWKDOO0LFUREH/LIWEDFWHULDO
WKDQ%DOHV3LOORZ 3DGV HQ]\PDWLFSRQGSURGXFWV
‡0DWXUHVSRQGZDWHUFKHPLVWU\ ‡3URYLGHVDVORZVWHDG\UHOHDVHRIEHQHILFLDO
‡'LVSHUVHVTXLFNO\E\VLPSOHEURDGFDVWRIEDUOH\ LQJUHGLHQWVWKURXJKQDWXUDODFWLYLW\
SHOOHWVLQWRWKHSRQG ‡:RUNV\HDUURXQG²VWDUWDQ\WLPH
‡%XIIHUVS+ ‡:RUNVIDVWHUWKDQEDOHV
 ,WHP 6L]H 3ULFH
 %633 OEV 
 %633 OEV 
 %633 OEV 
 %33; OEV 
 %33; OEV 

/LO¶%DOH)DUPV%DUOH\%ULFN /DJXQD%DUOH\6WUDZ3HOOHWV
‡3UHPLXPEDUOH\VWUDZ /DJXQD%DUOH\6WUDZKHOSVPDLQWDLQVXSHULRU
‡7KHPRVWQDWXUDOZD\WRFOHDUSRQGZDWHU SRQGZDWHUFRQGLWLRQVLQDFRPSOHWHO\QDWXUDO
‡óWREDOHVSHUVTXDUHIHHWRIVXUIDFHDUHD ZD\7KHEDUOH\VWUDZFRPHVLQVPDOOVORZUHOHDVH
SHOOHWIRUPIRUHDV\KDQGOLQJDQGFRQYHQLHQFH
 ,WHP 6L]H 3ULFH
‡0DLQWDLQVFOHDUSRQGZDWHUQDWXUDOO\
  R]%DOH  ‡/DVWZHHNV
  R]%DOHV  ‡7UHDWVXSWRJDOORQV
  OE%DOH  ‡8VHDWWKHEHJLQQLQJRIWKHSRQGVHDVRQ
 ,WHP 6L]H 3ULFH
 37 OEV 


 ),6+0(',&$7,216

&U\VWDO&OHDU &U\VWDO&OHDU
3DUDFLGH&RQWURO 3DUD6DOW7UHDWPHQW
&U\VWDO&OHDU3DUDFLG&RQWUROLVDZLGHO\XVHG 3DUD6DOW7UHDWPHQWLVIRUPXODWHGWRLQFUHDVHNRL
PDWHULDOE\SRQGDQGDTXDULXPKREE\LVWVDQG DQGJROGILVKHOHFWURO\WLFLQWDNH(OHFWURO\WHVDUH
SURIHVVLRQDOVIRUFRQWURORILQIHVWDWLRQVRI FULWLFDOLQEXLOGLQJDQGPDLQWDLQLQJDKHDOWK\VOLPH
ILVKOLFHDQFKRUZRUPDQGIOXNHVZKLFKDUH FRDW(OHFWURO\WHVVXFKDVSRWDVVLXPDUHHVVHQWLDO
FRPPRQLQSRQGDQGDTXDULXPKDELWDWV,WZRUNV LQZRXQGUHSDLUDQGLQWLPHVRIKHDY\VWUHVV GXULQJ
H[WUHPHO\ZHOORQSRQGILVKVSHFLHVVXFKDV ZDWHUFKDQJHVRUFOHDQRXWV 6DOWLVH[FHOOHQW
NRLDQGJROGILVKDVZHOODVRQFRPPRQO\IRXQG IRUPXFRXVSURGXFWLRQZKHQKHDOLQJIURPDZRXQG
DTXDULXPILVKVSHFLHV
‡)RUPXODWHGWRLQFUHDVHNRLDQG ‡+HOSVZDUGRIIDQGUHPRYHPRVW
‡:RUNVTXLFNO\ VDIHO\ ‡WVSIRUHYHU\JDOORQV JROGILVKHOHFWURO\WLFLQWDNH FRPPRQSURWR]RDQSDUDVLWHVIRXQGLQ
‡3UHYHQWVVHFRQGDU\LQIHFWLRQIURP ‡7UHDWVXSWRJDOORQV ‡\HDUVKHOIOLIH NRLDQGJROGILVK
RFFXUULQJ ‡\HDUVKHOIOLIH ‡FXSIRUHYHU\JDOORQV ‡7UHDWVXSWRJDOORQV
‡6DIHIRUDOOSRQGILVK
 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH
 && R]   && OEV 

&U\VWDO&OHDU &U\VWDO&OHDU
:LSH2XW%DFWHULD&RQWURO .QRFN2XW,FN&RQWURO
:LSH2XW%DFWHULD&RQWUROLVH[FHOOHQWIRUFRQWUROOLQJ .QRFN2XW,FNLVIRUPXODWHGIRUKHOSLQJFRQWURO
JLOOGLVHDVHVLQSRQGDQGDTXDULXPILVK%DFWHULDO ,FNRQSRQGILVK7UHDWHGFRUUHFWO\.QRFN2XW,FN
GLVHDVHVJHQHUDOO\UHVXOWIURPILVKVWUHVVGXHWRDGYHUVH ZLOOUHPRYHLFNSDUDVLWHVSURWR]RDEDFWHULDDQG
ZDWHUTXDOLW\FRQGLWLRQV S+R[\JHQRUWHPSHUDWXUH IXQJLIURPPRVWILVKVSHFLHV.QRFN2XW,FNLVD
SUREOHPV KDELWDWFOHDQRXWVXQWUHDWHGDEUDVLRQVRU EURDGVSHFWUXPWUHDWPHQWIRUIXQJXVLFNDQGIOXNHV
SUHGDWRUV,WZRUNVH[WUHPHO\ZHOORQSRQGILVKVSHFLHV
‡3UHYHQWV,FNLQIHVWDWLRQ
VXFKDVNRLDQGJROGILVKDVZHOODVRQFRPPRQO\IRXQG
‡(OLPLQDWHVIXQJL SURWR]RD
DTXDULXPILVKVSHFLHV
‡6DIHIRUDOOSRQGILVK
‡&RQWUROV SUHYHQWVEDFWHULDO ‡WVSIRUHYHU\JDOORQV ‡WVSIRUHYHU\JDOORQV
LQIHFWLRQV ‡7UHDWVXSWRJDOORQV ‡7UHDWVXSWRJDOORQV
‡6DIHIRUDOOSRQGILVK ‡\HDUVKHOIOLIH ‡\HDUVKHOIOLIH

 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH


 && R]   && R] 

&U\VWDO&OHDU &U\VWDO&OHDU
5HVWRUH)XQJXV&RQWURO 3RQG6DOW
5HVWRUH)XQJXV&RQWURONHHSV\RXUNRLRUJROGILVK ‡6XSHULRUWRWDEOHVDOW VRGLXPFKORULGH 
VDIHIURPFRPPRQO\IRXQGSDUDVLWLFSURWR]RDQV IRUPD[LPXPHIIHFWLYHQHVV
VXFKDV,FKWK\RSWKLULXV7ULFKRGLQD&RVWLDDQG ‡(QKDQFHVILVK¶VQDWXUDOVOLPHFRDWLQJ
&KLORGRQHOOD,WLVDOVRYHU\JRRGIRUWUHDWLQJ ‡5HGXFHVILVKVWUHVV
PDQ\FRPPRQEDFWHULDOGLVHDVHV ‡$GGLWLRQDOHOHFWURO\WHV
‡5HPRYHVPRVWIRUPVRIVNLQIXQJXV ‡,PSURYHVGLVHDVHUHFRYHU\
‡4XLFN HDV\WUHDWPHQW ‡SXUHPDGHIURPHYDSRUDWHGVHDZDWHU
‡6DIHIRUDOOSRQG DTXDULXPILVK ‡òFXSVIRUHYHU\JDOORQV
‡R]IRUHYHU\JDOORQV ‡$PXVWIRUKHDOWK\ILVK
‡7UHDWVXSWRJDOORQV  ,WHP 6L]H 3ULFH
‡\HDUVKHOIOLIH
 && OEV 
 ,WHP 6L]H 3ULFH  && OEV 
 && R] 

0HGL.RL0HGLFDWHG)LVK)RRG
‡+DVSRZHUIXOPHGLFDWLRQVWRKHOS\RXUSRQGILVKILJKW ‡3DFNDJHGLQ]LSVHDOYDSRUORFNHGVWDQGXSIRLOEDJVWR
WRXJKEDFWHULDO IXQJXVLQIHFWLRQVVXFKDVILQURWPRXWK HQVXUHIUHVKQHVV
URWERG\VRUHV RWKHUV
‡6RDSSHWL]LQJHYHQVLFNILVKFDQ¶WUHVLVWLW  ,WHP 6L]H 3ULFH
‡6ORZVLQNLQJIRRGWRUHDFKVLFNILVKRQWKHSRQGERWWRP  )0. OEV 
‡7HVWHGDQQXDOO\RQVLFNSRQGILVKE\WKRXVDQGVRISRQG  )0. OEV 
NHHSHUVDFURVVWKH86ZLWKH[FHOOHQWUHVXOWV  )0. OEV 


),6+0(',&$7,216 321'/,1(5&20

3RQG&DUH3LPD)L[
0DQ\RIWRGD\¶VFXUUHQWPHGLFDWLRQVKDYHEHFRPHOHVVHIIHFWLYHGXHWRUHVLVWDQWVWUDLQVRISDWKRJHQV,QUHVSRQVH
WRWKLVSUREOHP$TXDULXP3KDUPDFHXWLFDOVLQYHVWLJDWHGKXQGUHGVRIERWDQLFDOH[WUDFWVIRUXVHDJDLQVWILVK
GLVHDVHV0DQ\\HDUVRIUHVHDUFK GHYHORSPHQWUHVXOWHGLQWKHIRUPXODWLRQRI3LPD)L[

3LPD)L[LVDQDWXUDOERWDQLFDOUHPHG\PDGHIURP3LPHQWDUDFHPRVD :HVW,QGLDQ%D\ RLOSURYLGLQJXQLTXH


DFWLYHFRPSRXQGVZKLFKKDUPRQLRXVO\ZRUNWRJHWKHUWRDWWDFNILVKGLVHDVHV7KHDFWLYHFRPSRXQGVIRXQGLQ
3LPHQWDUDFHPRVDQRWRQO\SURYLGHPDQ\GLIIHUHQWPRGHVRIDFWLRQEXWDOVRHOLPLQDWHWKHSRVVLELOLW\RIWKH
GHYHORSPHQWRIUHVLVWDQWVWUDLQVRIGLVHDVHFDXVLQJRUJDQLVPV

‡7UHDWVIXQJDOLQIHFWLRQV 0HDVXUHPHQWV
‡7UHDWVERWKLQWHUQDODQGH[WHUQDOEDFWHULDOLQIHFWLRQV ‡WVSIRUHYHU\JDOORQV
‡3LPD)L[KDVEHHQIRUPXODWHGWRZRUNLQFRPELQDWLRQZLWK0HODIL[ ‡R]WUHDWVJDOORQV
WRHQKDQFHHIIHFWLYHQHVVDJDLQVWILVKGLVHDVHV ‡R]WUHDWVJDOORQV

 ,WHP 6L]H 3ULFH


 % R] 
 & R] 

3RQG&DUH0HOD)L[
0HOD)L[LVDQDOOQDWXUDOPHGLFDWLRQWKDWLVDQHIIHFWLYHDQWLEDFWHULDOUHPHG\IRUSRQGILVK0HOD)L[KDVSRZHUIXO
DQWLEDFWHULDOSURSHUWLHVWKDWWUHDWWKHZRXQGDQGSURPRWHUDSLGWLVVXHKHDOLQJ+HDOLQJDQGWLVVXHUHJHQHUDWLRQ
FDQXVXDOO\EHVHHQLQWKHILUVWIRXUGD\VRIWUHDWPHQW0HOD)L[DOVRSURPRWHVUHJURZWKRIGDPDJHGILQUD\V
DQGWLVVXH,QWHVWFDVHVZKHUHILVKKDGORVWDOOWDLODQGGRUVDOILQV0HOD)L[FRPSOHWHO\UHVWRUHGERWKILQVWRWKHLU
RULJLQDOFRQGLWLRQ0HOD)L[KHDOVWKHZRXQGDQGUHVWRUHVGDPDJHGWLVVXH
‡7UHDWVXOFHUV RSHQZRXQGV 0HDVXUHPHQWV
‡5DSLGO\UHSDLUVGDPDJHGILQV ‡R]WUHDWVJDOORQV
‡7UHDWVILQ WDLOURW ‡R]WUHDWVJDOORQV
‡WVSIRUHYHU\JDOORQV ‡R]WUHDWVJDOORQV
‡6DIHIRUDTXDWLFSODQWV
‡:LOOQRWDIIHFWWKHELRORJLFDOILOWHURUDOWHUWKHS+RIWKHSRQG

 ,WHP 6L]H 3ULFH


 $ R] 
 % R] 
 & R] 

7,3 )LVK7UHDWPHQW7LSV
‡%HQHILWVRI6DOW
ª'RHVQRWKDUPWKHPDMRULW\RIILVKVSHFLHV
ª'RHVQRWSXVKVLFNILVKRYHUWKHHGJH
ª(OLPLQDWHVRIPDMRUSDUDVLWHVUDSLGO\
ª'RHVQRWKDUPWKHILOWUDWLRQV\VWHP
ªòFXSVSHUJDOORQVRIZDWHU

‡1HYHUIHHG\RXUILVKRQFHWKHWHPSHUDWXUHRIWKHZDWHUIDOOVEHORZž
)2QFHFROGZHDWKHUVHWVLQ\RXUILVKZLOOVORZGRZQ)LVKGRQRWKDYH
VWRPDFKVLIWKH\HDWGXULQJWKHLULQDFWLYHVHDVRQWKHIRRGZLOOVLWLQWKHLU
JXWDQGURW7KLVZLOODQGGRHVNLOOWKHP'RQRWIHHGWKHPDJDLQXQWLO
6SULQJZKHQWKHZDWHUWHPSHUDWXUHLVRYHUž)

‡7KHUXOHRIWKXPEIRUWKHQXPEHURIILVKLQ\RXUSRQGLV´RIILVKIRUHYHU\
JDOORQVRIZDWHU%HVXUHWRDOORZIRUJURZWKWRRWKH\ZLOOJURZIDVW
.RLDQGJROGILVKFDQJURZXSWR´ORQJEXWRQUDUHRFFDVLRQVFDQJURZ
HYHQODUJHU


 $48$7,&3/$17352'8&76

,VODQGVFDSHV
,VODQGVFDSHVLQFUHDVHWKHEHDXW\ZDWHUTXDOLW\DQGKDELWDWLQDQ\ZDWHUIHDWXUH7KHLURSHQ
ZHDYHPDWUL[LVSHVWLFLGHIUHHVXSSRUWVWKHJURZWKRISODQWPDWHULDODQGFRQFHQWUDWHVQXWULHQWV
IRUWKHHQMR\PHQWRIILVKDQGRWKHUZLOGOLIH

8QOLNHRWKHUSURGXFWVPDGHRI6W\URIRDPRU3RO\HWK\OHQHWKH,VODQGVFDSH¶VPDWUL[FDQEHIXOO\
SODQWHGDQGDOORZVURRWVWRJURZWKURXJKWRWKHZDWHU:K\ZRXOG\RXZDQW\RXUIORDWLQJLVODQG
WREHZDWHUUHVLVWDQW"7KHZKROHLGHDLVWKDW\RXU,VODQGVFDSHFUHDWHVDEHDXWLIXOVHOIVXIILFLHQW
OLYLQJHFRV\VWHPSURYLGLQJDKDELWDWIRUILVKELUGVDPSKLELDQVSROOLQDWRUVDQGSODQWOLIH
7KH\¶UHHYHQFHUWLILHGDVD:LOGOLIH+DELWDWE\WKH1DWLRQDO:LOGOLIH)HGHUDWLRQ

1RWRQO\DUH,VODQGVFDSHVEHDXWLIXOIORDWLQJJDUGHQVWKH\QDWXUDOO\UHGXFHWKHQHHGIRUFKHPLFDOV
WRFRQWUROZDWHUTXDOLW\$VWKHSODQWURRWVGULQNIURPWKHSRQGWKH\SURGXFHDQDHURELFHIIHFW
ZKLFKGHFUHDVHV$PPRQLDDQGQLWULWHVUHGXFLQJDOJDHDQGPDNLQJILVKOHVVVXVFHSWLEOHWR
GLVHDVH

,QDGGLWLRQWRDOOWKHVHEHQHILWV,VODQGVFDSHVDUHPDQXIDFWXUHGKHUHLQWKH86$IURP
UHF\FOHGPDWHULDOV,WZRXOGEHSRLQWOHVVIRUXVWRFUHDWHDJRUJHRXVKDELWDWLIZHKDGWRGHVWUR\
0RWKHU1DWXUHLQWKHSURFHVV

(DFK,VODQGVFDSHFRQWDLQVWKHIROORZLQJ
‡,VODQGVFDSHV6RLO%OHQG
‡7HWKHU5LQJIRU$QFKRU
‡3ODQWLQJ,QVWUXFWLRQV

,3    ,3 , 3 ,3    ,3   

,3DQG,3PXVWVKLSYLDIUHLJKWWUXFNGXHWRWKHLUVL]H
 ,WHP 6L]H 3RQG6L]H 3ULFH
 ,3 ´[´[´ 8SWR*DOORQ 
 ,3 ´[´[´ 8SWR*DOORQ 
 ,3 ´[´[´ 8SWR*DOORQ 
 ,3 ´[´[´ 8SWR*DOORQ 
 ,3 ´[´[´ 8SWR*DOORQ 
-XVWSRSRXW $QGDGG
WKHKROHV SODQWV

6DIH$QFKRU
$GGD6DIH$QFKRUWRNHHS\RXU,VODQGVFDSHLQSODFH
6RIWDQFKRULQJV\VWHPFRQWRXUVWRWKHSRQGERWWRP
DQGSUHYHQWVGDPDJHWR\RXUSRQGOLQHU

‡OEPRRULQJFDSDFLW\

 ,WHP 3ULFH
 6$ 


$48$7,&3/$17352'8&76 321'/,1(5&20

3RQG&DUH$TXDWLF 3RQG&DUH
3ODQW)RRG/LTXLG 3ODQW1XWULHQW6SUD\
5HDG\WR8VH3ODQW)RRG$FRQFHQWUDWHG ‡(DV\WRXVHVSUD\
VROXWLRQFRQWDLQLQJVL[RIWKHPRVWLPSRUWDQW ‡0DGHZLWKQDWXUDOKXPDWHV
WUDFHHOHPHQWVHVVHQWLDOIRUVWLPXODWLQJSODQW ‡1RXULVKHVSODQWVIRUVWURQJDQGKHDOWK\
JURZWKWKHODFNRIDQ\RQHRIZKLFKFDQ SODQWJURZWK
UHVXOWLQGHFUHDVHGIORZHULQJDQGJURZWKRI ‡3URYLGHVHVVHQWLDOQXWULHQWVDORQJZLWK
DOODTXDWLFSODQWVLQFOXGLQJZDWHUK\DFLQWKV QDWXUDODFWLYHLQJUHGLHQWV
DQGZDWHUOLOLHV ‡(QFRXUDJHVGHYHORSPHQWRIKHDOWK\OHDYHV
VWHPVDQGURRWV
‡3URPRWHVJURZWKRIDOODTXDWLFSODQWV ‡:LOOQRWVWLPXODWHDOJDHEORRPV ‡3URPRWHVKHDOWK\DQGOXVKIROLDJH
‡%HQHILWVERJDQGPDUJLQDOSODQWVVXFK ‡&DQQRWVKLSWR1HZ<RUNRU:LVFRQVLQ ‡6DIHIRUXVHLQSRQGVFRQWDLQLQJILVK
DVLULVDQGOREHOLD ‡WEVSIRUHYHU\JDOORQV  ,WHP 6L]H 3ULFH
 ,WHP 6L]H 3ULFH  % OEV 
 % R] 
 * OEV 

0LFUREH/LIW 3RQG&DUH$TXDWLF
$TXDWLF3ODQW6RLO 3ODQW)RRG7DEOHWV
‡&RQFHQWUDWHG$TXDWLF3ODQWLQJ0HGLD &RQWLQXRXVUHOHDVHWDEOHWIRUPXOD
‡1R)HUWLOL]HU&RPSRVW3HDWRU FRQWDLQLQJHVVHQWLDOQXWULHQWVDQGWUDFH
3HVWLFLGHV HOHPHQWVRIQRQVWRSEORRPLQJRIKDUG\
‡,GHDOZKHQ3URPRWLQJDTXDWLFSODQWV WURSLFDODTXDWLFSODQWV
‡5HWDLQVR[\JHQ
‡(QRUPRXVVXUIDFHDUHDSHUIHFWWR ‡5LFKLQLURQIRUOXVKJUHHQJURZWK
FRORQL]HEHQHILFLDOQLWULI\LQJEDFWHULD ‡&RQWDLQVERURQWRSURPRWHIORZHU
‡$OORZVPL[LQJDQ\UDWLRRIORDPWR IRUPDWLRQ
SODQWLQJPHGLD ‡.HHSZDWHUOLOLHVEORRPLQJDOOVHDVRQ
‡1RQWR[LFWRSODQWV ‡1DWXUDOPLQHUDOV ORQJ
‡:RQ¶WEUHDNGRZQIORDWRU ‡$OO,QHUW,QJUHGLHQWV ‡3URPRWHVEHDXWLIXOIROLDJH
FORXGSRQGZDWHU ‡.LOQ)LUHG ‡%HQHILWVERJDQGPDUJLQDOSODQWVVXFK
‡6DIHIRUDOOILVKDQGDTXDWLFOLIH ‡3UH&RORQL]HGZLWK%HQHILFLDO DVLULV&DQQDDQG7DUR
‡&RQWDLQV1R1XWULHQWV %DFWHULD

 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH


 0/&$30 OE%DJ   $ FW 
 0/&$30 OE%DJ   % FW 

7,3 'LIIHUHQW7\SHVRI$TXDWLF3ODQWV

$TXDWLFSODQWVJHQHUDOO\IDOOLQWRIRXUFDWHJRULHV)ORDWLQJ0DUJLQDO6XEPHUJHGDQG%RJ  

)ORDWLQJSODQWVDUHDEOHWRWKULYHZLWKRXWEHLQJURRWHGLQVRLORURWKHUPHGLD7KHVHLQFOXGH
ZDWHUK\DFLQWKZDWHUOHWWXFHZDWHUFKHVWQXW

0DUJLQDODVWKHQDPHLPSOLHVOLYHDURXQGWKHPDUJLQVRIWKHSRQGDQGZDQWWRKDYHWKH
VRLODQGWKHLUURRWVZHWFRQWLQXDOO\DQGFDQOLYHZLWKYDU\LQJGHSWKVRIZDWHUDVWKHSRQG 
ULVHVDQGIDOOVZLWKWKHVHDVRQ3RSXODUPDUJLQDOSODQWVDUH0DUVK0DULJROGV&DQQD0LQW
6ZHHW)ODJV)ODJ,ULV3LFNHUHO

6XEPHUJHGSODQWVDUHWRWDOO\XQGHUZDWHUDQGPD\URRWGLUHFWO\LQWKHVRIWVHGLPHQWLQWKH
ERWWRPRIWKHSRQGRULQDFRQWDLQHURIVRLORURWKHUPHGLD7KHWRSVXEPHUJHGSODQWVDUH
KDUG\ZDWHUOLOLHVWURSLFDOZDWHUOLOLHVDQG$VLDQORWXV2WKHUVLQFOXGH(ORGHD&DERPED
DQG+RUQZRUW

%RJSODQWVDUHQRWWUXHDTXDWLFSODQWVEXWDUHQRUPDOJDUGHQSODQWVWKDWOLNHHLWKHUZHWRU
YHU\PRLVWVRLODQGFDQXVXDOO\EHIRXQGDORQJWKHPDUJLQVRULQSDUWLFXODUO\ZHW $TXDWLFSODQWVVKRZQKHUHDUH
DUHDVDURXQG\RXUSRQG7KHVHPLJKWLQFOXGH3ODQWDLQ/LO\$VWLOEH)HUQV/DG\¶V 0DUJLQDO6ZHHW)ODJ'ZDUI%DPERR
0DQWOHRU3ULPXOD 6XEPHUVLEOH+DUG\:DWHU/LO\


 $48$7,&3/$17352'8&76
3RQGWDEEV 3RQGDEEV-U
321'7$%%6ŠZDWHUVROXEOHWDEOHWVFRPELQHFRQWUROOHGQLWURJHQUHOHDVH $SSUR[LPDWHO\WKHVL]HRIUHJXODU321'7$%%6Š321'7$%%6Š-U
ZLWKUDSLGQXWULHQWDYDLODELOLW\LQDIRUPZKLFKSURYLGHVRSWLPXPIHHGLQJIRU ZDWHUVROXEOHWDEOHWVFRPELQHFRQWUROOHGQLWURJHQUHOHDVHZLWKUDSLGQXWULHQW
DOORI\RXUDTXDWLFSODQWV:KHQXVHGDVGLUHFWHGWKLVSURGXFWZLOOQRWHIIHFW DYDLODELOLW\LQDIRUPZKLFKSURYLGHVRSWLPXPIHHGLQJIRUDOORI\RXUDTXDWLF
DOJDHJURZWKRUKDYHDQ\QHJDWLYHHIIHFWRQILVK,WLVUHFRPPHQGHGWKDW\RX SODQWV:KHQXVHGDVGLUHFWHGWKLVSURGXFWZLOOQRWHIIHFWDOJDHJURZWKRUKDYH
IHHG\RXUSODQWVPRQWKO\GXULQJWKHJURZLQJVHDVRQDWDUDWHRIRQHWDEOHWSHU DQ\QHJDWLYHHIIHFWRQILVK,WLVUHFRPPHQGHGWKDW\RXIHHG\RXUSODQWVPRQWKO\
JDOORQRIVRLO:KHQWKHZDWHUWHPSHUDWXUHULVHVDERYHGHJUHHVIHHGLQJ GXULQJWKHJURZLQJVHDVRQDWDUDWHRIRQHWDEOHWSHUJDOORQRIVRLO:KHQWKH
VKRXOGEHLQFUHDVHGWRHYHU\WZRZHHNV1XWULHQWVZLOOUHOHDVHZLWKLQILYH ZDWHUWHPSHUDWXUHULVHVDERYHGHJUHHVIHHGLQJVKRXOGEHLQFUHDVHGWRHYHU\
PLQXWHV WZRZHHNV1XWULHQWVZLOOUHOHDVHZLWKLQILYHPLQXWHV

 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH


  FW „   FW 
  FW    FW 
  FW 
  FW 
  FW 

3RQGWDEEV3OXV+XPDWHV 3RQGWDEEV/DQGRQ)RUPXOD
+XPDWHVDUHDKLJKO\GHFRPSRVHGRUJDQLFPDWHULDOWKDWLVPLOOLRQVRI\HDUV 3ODQWDEEV/DQGRQ)RUPXODLVDFRPELQDWLRQRIERWKRUJDQLFDQGLQRUJDQLF
ROGDQGFRQWDLQVH[WUDRUGLQDU\SURSHUWLHVWKDWDUHLPSRUWDQWWRSODQWJURZWK LQJUHGLHQWVWKDWZRUNLQFRQMXQFWLRQZLWKRQHDQRWKHUWRFUHDWHVSHFWDFXODU
+XPDWHVLQFUHDVHWKHDYDLODELOLW\RIWKHQXWULHQWVLQWKHIHUWLOL]HUPDNLQJWKHP UHVXOWV,WLVDYHU\µKRW¶IRUPXODWKDWUHTXLUHVYHU\VWULFWDGKHUHQFHWRWKH
HDVLHUIRUWKHSODQWVWRWDNHXS&UHDWLQJQDWXUDOPLFURELDODFWLYLW\HQKDQFHV GLUHFWLRQVIRUXVH7\SLFDOO\WKLVIHUWLOL]DWLRQPHWKRGVKRXOGEHVXIILFLHQWIRU
SODQWGHYHORSPHQWDQGUHVLVWDQFHWRVWUHVV WRGD\V

 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH


  FW    R] 
  FW    OEV 

5RXQG3ODQWLQJ%DVNHWV 6TXDUH3ODQWLQJ%DVNHWV
‡3URYLGHVDQHDV\DQGFRQYHQLHQWZD\WRSODFH ‡3URYLGHVDQHDV\DQGFRQYHQLHQWZD\WRSODFH
SODQWVLQSRQGV SODQWVLQSRQGV
‡8QLTXHGHVLJQDOORZVWKHIUHHIORZRIZDWHUVR ‡8QLTXHGHVLJQDOORZVWKHIUHHIORZRIZDWHUVR
WKDWSODQWVUHFHLYHDEXQGDQWZDWHUVXSSO\ WKDWSODQWVUHFHLYHDEXQGDQWZDWHUVXSSO\
‡+HOSVSUHYHQWWKHFRPSDFWLRQRIURRWV ‡+HOSVSUHYHQWWKHFRPSDFWLRQRIURRWV
‡0DGHRIVWXUG\SODVWLFPDWHULDO ‡0DGHRIVWXUG\SODVWLFPDWHULDO
‡,GHDOIRUSURWHFWLQJWKHURRWVRIIORDWLQJSODQWV ‡,GHDOIRUSURWHFWLQJWKHURRWVRIIORDWLQJSODQWV
IURPILVKZKROLNHWRELWHRQWKHP IURPILVKZKROLNHWRELWHRQWKHP
‡,QFOXGHVFRQYHQLHQWKDQGOHVIRUHDV\JUDVSLQJ ‡,QFOXGHVFRQYHQLHQWKDQGOHVIRUHDV\JUDVSLQJ
 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH
 37 ´'LD[´+   37 ´[´+ 
 37 ´'LD[´+   37 ´[´+ 

/LO\7XEV &RQWRXU3ODQWLQJ%DVNHWV
‡3URYLGHVDQHDV\DQGFRQYHQLHQWZD\WRSODFH
‡,GHDOIRUSODQWLQJOLOLHVORWXVRUJURXSLQJV
SODQWVLQSRQGV
RIERJSODQWV
‡8QLTXHGHVLJQDOORZVWKHIUHHIORZRIZDWHUVR
‡/DUJHGHHSWXESURYLGHVURRPIRUWURSLFDO
WKDWSODQWVUHFHLYHDEXQGDQWZDWHUVXSSO\
RUKDUG\OLOLHVWRH[SDQG
‡+HOSVSUHYHQWWKHFRPSDFWLRQRIURRWV
‡1RKROHVSUHYHQWVHDUWKIURPHVFDSLQJ
‡0DGHRIVWXUG\SODVWLFPDWHULDO
‡,GHDOIRUSURWHFWLQJWKHURRWVRIIORDWLQJSODQWV
IURPILVKZKROLNHWRELWHRQWKHP
 ,WHP 6L]H 3ULFH ‡,QFOXGHVFRQYHQLHQWKDQGOHVIRUHDV\JUDVSLQJ
 37 ´'LD[´+   ,WHP 6L]H 3ULFH
 37 ´'LD[´+   37 ´/[´:[´+ 


$48$7,&3/$17352'8&76 321'/,1(5&20

)ORDWLQJ3ODQWLQJ%DVNHWV 3ODQWLQJ%DJV
‡,GHDOIRUSRQGVWKDWGRQ¶WKDYH ‡&DQEHXVHGIRUPRVWSRQGSODQWV
DGHTXDWHSODQWVKHOYHV ‡0DGHRIDIOH[LEOHPDWHULDO
‡0DGHRIILQHO\ZRYHQIDEULF ‡&DQEHSODFHGLQDUHDVVXFKDVQDUURZVKHOYHV
‡(DVLO\DQFKRUHG RUVPDOOQRRNV
‡$OORZVZDWHULQDQGVRLOFDQ¶WHVFDSH ‡)LQHO\ZRYHQIDEULFDOORZVZDWHULQEXWNHHSV
‡3URWHFWVSODQWVIURPILVK VRLOIURPOHDFKLQJLQWRWKHSRQG
‡%XR\DQW6W\URIRDPIORDWHQVXUHVWKH ‡5HVLVWVURWWLQJ
EDVNHWVWD\VDWWKHVXUIDFH ‡)XOO\VXEPHUVLEOHDQGHQYLURQPHQWIULHQGO\

 ,WHP 'HVFULSWLRQ 6L]H 3ULFH  ,WHP 6L]H 'LPHQVLRQV 3ULFH


 37 6PDOO)ORDWLQJ%DVNHW ´'LD   37 6PDOO ´[´[´ 
 37 0HGLXP)ORDWLQJ%DVNHW ´'LD   37 0HGLXP ´[´[´ 
 37 /DUJH)ORDWLQJ%DVNHW ´'LD   37 /DUJH ´[´[´ 
 37 )ORDWLQJ%DVNHW.LW ,QFOXGHV37  

*URZHUV3RW´'[´+ *URZHUV3RW´'[´+

 ,WHP 3ULFH  ,WHP 3ULFH


 *3   %)1 

:KLVNH\%DUUHO/LQHU :KLVNH\%DUUHO/LQHU
ZLWKD´6SLOOZD\
 ,WHP 3ULFH
 :%/   ,WHP 3ULFH
 :%/6 

),6+)22'

/DJXQD$OO6HDVRQ)LVK)RRG3HOOHWV
7KHKLJKO\SDODWDEOHDQGGLJHVWLEOHIRRGFUHDWHVOHVVZDVWHZKLFKUHVXOWVLQFOHDQHUKHDOWKLHUSRQGZDWHU7KH
IORDWLQJIRRGVWLFNVDUHVSHFLDOO\IRUPXODWHGWRVRIWHQTXLFNO\ZKLOHPDLQWDLQLQJWKHLUVKDSHDOORZLQJILVKRI
DOOVL]HVWRIHHG(YHQWKHVPDOOHVWILVKFDQELWHRIIVPDOOSRUWLRQV

6PDOO3HOOHWV)RU¿VKIURP´´
 ,WHP 6L]H 3ULFH
 37 R] 
 37 R] 
 37 R] 
0HGLXP3HOOHWV)RU¿VKIURP´´
 ,WHP 6L]H 3ULFH
 37 R] 
 37 R] 
 37 R] 
 37 OEV 
/DUJH3HOOHWV)RU¿VKIURP´DQGODUJHU
‡3URYLGHVVXSHULRUQXWULWLRQDQGUHGXFHV  ,WHP 6L]H 3ULFH
RUJDQLFZDVWH  37 R] 
‡:LOOQRWFORXGZDWHU  37 OEV 
‡6FLHQWLILFDOO\IRUPXODWHGGLHWLQFOXGHV
PXOWLYLWDPLQVDQGVWDELOL]HGYLWDPLQ&  37 OEV 
ZKLFKKHOSVLPSURYHGLVHDVHUHVLVWDQFH  37 OEV 
DQGWKHKHDOWKDQGORQJHYLW\RIILVK
‡+LJKO\SDODWDEOHIRRG

 ),6+)22'

/DJXQD6SLUXOLQDDQG /DJXQD$OO6HDVRQ
:KHDW*HUP)RRG6WLFNV )RRG6WLFNV
8QLTXHIRUPXODWLRQVZLWKVXSHULRU 8QLTXHIRUPXODWLRQVZLWKVXSHULRU
LQJUHGLHQWVSURPRWHDQXPEHURIKHDOWK LQJUHGLHQWVSURPRWHDQXPEHURIKHDOWK
EHQHILWVLQFOXGLQJKLJKHUUHVLVWDQFHWR EHQHILWVLQFOXGLQJKLJKHUUHVLVWDQFHWR
GLVHDVHEHWWHUJURZWKEULOOLDQWFRORUVDQG GLVHDVHEHWWHUJURZWKEULOOLDQWFRORUVDQG
OXVWURXVDSSHDUDQFH OXVWURXVDSSHDUDQFH
‡)RU6SULQJDQG)DOOZKHQZDWHU ‡)RUDOOVHDVRQVZKHQZDWHU
WHPSHUDWXUHLVDERYHƒ WHPSHUDWXUHLVDERYHƒ)

 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH


 37 R]   37 R] 
 37 R]   37 R] 

/DJXQD /DJXQD&RORU
:KHDW*HUP6SLUXOLQD (QKDQFLQJ)RRG6WLFNV
$GLHWULFKLQ6SLUXOLQDVXSSRUWVRSWLPDO 8QLTXHIRUPXODWLRQVZLWKVXSHULRU
JURZWKUDWHVUHGXFHVREHVLW\LQFUHDVHV LQJUHGLHQWVSURPRWHDQXPEHURIKHDOWK
VXUYLYDOUDWHVDQGSURGXFHVKHDOWKLHU EHQHILWVLQFOXGLQJKLJKHUUHVLVWDQFHWR
ORRNLQJVSHFLPHQ GLVHDVHEHWWHUJURZWKEULOOLDQWFRORUVDQG
‡37LVIRU´WR´ILVK OXVWURXVDSSHDUDQFH
‡37LVIRU´WR´ILVK
‡+LJKO\QXWULWLRXVVWLFNVULFK
‡37LVIRU´DQGODUJHUILVK
LQNULOODQGVKULPS

 ,WHP 6L]H 3HOOHWV 3ULFH  ,WHP 6L]H 3ULFH


 37 R] 6PDOO   37 R] 
 37 OEV 0HGLXP   37 R] 
 37 OEV /DUJH 

0LFUREH/LIW/HJDF\
0LFUREH/LIW/HJDF\ 6XPPHU6WDSOH)LVK)RRG
9DULHW\0L[)LVK)RRG
:KHQZDUPHUZDWHUWHPSHUDWXUHVEHJLQ
7KHZD\WRIHHG\RXUILVKDFRPSOHWH LQFUHDVLQJWKHIUHTXHQF\ TXDQWLW\
EOHQGRIIUXLWVJUHHQVFDUERK\GUDWHV RI\RXUIHHGLQJV0LFUREH/LIW/HJDF\
SURWHLQZKHDWJHUPYLWDPLQVDQG 6XPPHU6WDSOHIRRGKDVDQLPDOSURWHLQ
SURELRWLFVWR\RXUNRLDQGSRQGILVK FRORUHQKDQFHUVWKDWDUHQHHGHGGXULQJ
WKLVVHDVRQ
‡3ULPDU\)LVK)RRG
‡)HHGGD\VSHUZHHN
 ,WHP 6L]H 3ULFH
 ,WHP 6L]H 3ULFH  0//6660 R] 
 0//9060 R] 
 0//660' OEVR] 
 0//900' OEV 
 0//66/* OEV 
 0//90/* OEV 
 0//66;/ OEV 
 0//90;/ OEV 
 0//66%$* OEV 
 0//90%$* OEV 

7,3 )HHGLQJ<RXU)LVKLQ&ROG:HDWKHU
7KHPHWDEROLVPRINRLDQGJROGILVKLVFRQWUROOHGSULPDULO\E\ WKHLUZLQWHUVXUYLYDELOLW\:KHQWKHZDWHUWHPSHUDWXUHGURSV
ZDWHUWHPSHUDWXUH$VWKHZDWHUFRROVSRQGILVKUHTXLUHOHVV WRDSSUR[LPDWHO\ƒ)VWDUWIHHGLQJZLWK6SULQJ $XWXPQ
SURWHLQLQWKHLUGLHW,PSURSHUVHDVRQDOIHHGLQJFDQOHDGWRD 3RQG)RRG6WRSIHHGLQJSRQGILVKZKHQWKHZDWHUIDOOV
EXLOGXSRIWR[LFDPPRQLDZKLFKVWUHVVHVILVKDQGUHGXFHV EHORZƒ)


),6+)22' 321'/,1(5&20

0LFUREH/LIW/HJDF\ 0LFUREH/LIW/HJDF\
)UXLWV *UHHQV +LJK*URZWK 
)LVK)RRG (QHUJ\)LVK)RRG
9DULHW\LVWKHVSLFHRIOLIH,I\RXGRQ¶W :KHQZDUPHUZDWHUWHPSHUDWXUHV
KDYHWLPHWRFXWXSIUXLWV YHJHWDEOHV DUULYHNRL JROGILVKQHHGDERRVW
IRU\RXUSRQGILVKIHHGWKHP0LFUREH RISURWHLQIRUJURZWKVLQFHWKH\KDYH
/LIW/HJDF\)UXLWV *UHHQV)LVK)RRG GHSOHWHGWKHLUIDWUHVHUYHVRYHUWKH
7KHFXWWLQJ EOHQGLQJKDVEHHQGRQH ZLQWHU,QWKHIDOODKLJKHUSURWHLQ
IRU\RXZLWKDSSOHVDSULFRWVNLZLV GLHWLVDOVRUHTXLUHGVLQFHSRQGILVK
PDQJRVSDSD\DVSHDFKHVSHDUV QHHGWREXONXSLQSUHSDUDWLRQIRU
EURFFROLFDEEDJHSHDVUHGSHSSHUV WKHLUZLQWHUIDVW
WRPDWRHV]XFFKLQL VSLQDFKLQWKLV
VFLHQWLILFEOHQG ‡3ULPDU\)LVK)RRG
‡)HHGGD\VSHUZHHN
‡6XSSOHPHQWDO)LVK)RRG
‡)HHGGD\VSHUZHHN
 ,WHP 6L]H 3ULFH
 ,WHP 6L]H 3ULFH  0//+*(60 R] 
 0//)*60 R]   0//+*(0' OEVR] 
 0//)*0' OEVR]   0//+*(/* OEVR] 
 0//)*/* OEV   0//+*(;/ OEV 
 0//)*;/ OEVR]   0//+*(%$* OEV 
 0//)*%$* OEV 

0LFUREH/LIW/HJDF\
&ROG:HDWKHU:KHDW*HUP)LVK)RRG
8VHGXULQJWKHFROGHUZHDWKHUSHULRGVRIVSULQJDQGIDOOZKHQQLJKWWLPHWHPSHUDWXUHVFDQJREHORZƒ)
:KHQSRQGWHPSHUDWXUHVGURSSRQGILVKUHTXLUHDKLJKO\GLJHVWLEOHFRROZDWHUGLHW
‡3ULPDU\)LVK)RRG ‡)HHGGD\VSHUZHHN

 ,WHP 6L]H 3ULFH


 0//:*60 R] 
 0//:*0' OEV 
 0//:*/* OEVR] 
 0//:*;/ OEV 

3RQG&DUH6SULQJ  3RQG&DUH6XPPHU
$XWXPQ3RQG)RRG 6WDSOH3RQG)RRG
6SHFLDOO\IRUPXODWHGIRUIHHGLQJNRL  ,QVXPPHUPRQWKVZLWKZDWHU
JROGILVKLQVSULQJDQGDXWXPQZDWHU WHPSHUDWXUHVDERYHƒ)NRLDQGJROGILVK
FRQGLWLRQV:KHQNRL JROGILVKDUHIHG KDYHLQFUHDVHGPHWDEROLVPDQGUHTXLUH
DKLJKSURWHLQGLHWLQZDWHUWHPSHUDWXUHV LQFUHDVHGSURWHLQIRULQFUHDVHGHQHUJ\
EHORZƒ)WKH\FDQRQO\GLJHVWDOLPLWHG QHHGV7KLVLVZKHQ3RQG&DUH6XPPHU
DPRXQWRISURWHLQ7KHUHPDLQLQJSURWHLQLV 6WDSOH3RQG)RRGLVWKHSHUIHFWSRQGIRRG
H[FUHWHGDVWR[LFDPPRQLDGHFUHDVLQJWKH IRUNRL JROGILVK
ZDWHUTXDOLW\
 ,WHP 6L]H 3ULFH
 ,WHP 6L]H 3ULFH
  R] 
  R] 
 $ R] 
 $ R] 
 % R] 
 % R] 
 . OEV 
 . OEV 


 ),6+)22'

3RQG&DUH 0LFUREH/LIW
)LVK)HHGHU%ORFN /HJDF\)LVK7UHDWV
‡$XWRPDWLFDOO\IHHGV\RXUILVKZKLOH ‡4XDUW6L]HG&RQWDLQHU
\RX¶UHDZD\ ‡)LQDOO\DNRLWUHDWWKDWFDQEHIHG
‡&RQWDLQVQXWULWLRXVSHOOHWVIRUNRL  DOO\HDUORQJ
JROGILVKWKDWDUHDXWRPDWLFDOO\UHOHDVHG ‡7KH/HJDF\.RL7UHDWVFRQWDLQ
LQWRWKHSRQG IHHGWKHILVK VWDELOL]HGYLWDPLQ&DORQJZLWKNULOO
NHOSFUDEDQGOREVWHUPHDO1DWXUH¶V
%XLOGLQJ%ORFNVŒDUHDOVREOHQGHGLQWR
WKHVHWKUHHIORDWLQJWUHDWVZKLFKZLOOGUDZSRQG
 ,WHP 3ULFH ILVKWRWKHWRSRIWKHZDWHUIRUYLHZLQJDQGHYHQWXDO
 %  KDQGIHHGLQJ

 ,WHP 1DPH 3ULFH


 0//&5867 &UXVWDFHDQ 
 0//.(/3 .HOS 
 0//.5,// .ULOO 
/DJXQD)HHGLQJ6WDWLRQ
‡+HOSVSUHYHQWRYHUIHHGLQJDQG
ZDVWHGIRRG /DJXQD
‡%ULQJVILVKWRRQHDUHDRIWKHSRQG
IRUHDVLHUYLHZLQJ )LVK)RRG7UHDWV
‡(DVLO\DQFKRUHGWRWKHVLGHRU
ERWWRPRIWKHSRQGV  ,WHP )ODYRU 3ULFH
 ,WHP 3ULFH  37 /HPRQ 
 37   37 2UDQJH 

:$7(57(67.,76

3KRVSKDWH7HVW.LW 3RQG&DUH
3KRVSKDWHFDQHQWHU\RXUSRQGWKURXJKWDS
0DVWHU7HVW.LW
ZDWHUILVKZDVWHDQGGHFD\LQJRUJDQLFV 3RQG&DUH0DVWHU7HVW.LWLVDFRPSOHWH
VXFKDVXQHDWHQIRRGDQGGHDGDOJDH NLWIRUWHVWLQJWDSZDWHUDQGSRQGZDWHUIRU
([FHVVSKRVSKDWHFRQWULEXWHVWRXQVLJKWO\ 3+DPPRQLDQLWULWHDQGSKRVSKDWH
DOJDHEORRPVLQSRQGV7KLVNLWDOORZV
7HVW.LW,QFOXGHV
\RXWRHDVLO\DQGDFFXUDWHO\PHDVXUHWKH
‡,QVWUXFWLRQ%RRN
SKRVSKDWHOHYHODQGPDLQWDLQDKHDOWK\
‡)RXUWHVWWXEHVDQGKROGLQJWUD\
SRQG
‡&RPSXWHUDQDO\VHGODPLQDWHGFRORUFDUGV
‡7HVWSKRVSKDWHOHYHOIURPWRSSP
‡WHVWV
 ,WHP 3ULFH
 ,WHP 3ULFH  0 
 / 

:LGH5DQJH 3RQG&DUH
/LTXLGS+7HVW.LW 1LWULWH7HVW.LW
$OLTXLGWHVWNLWWKDWLQVWDQWO\PHDVXUHVWKH
ZLGHS+UDQJHVHQFRXQWHUHGLQSRQGZDWHU ‡5HDGVQLWULWHOHYHOVIURPWRSSP
‡.LWLQFOXGHVDERWWOHRIWHVWVROXWLRQ
‡3URSHUS+FRQWUROLVLPSHUDWLYHWR JODVVWHVWWXEHZLWKFDSLQVWUXFWLRQVDQG
SUHYHQWWKHKDUPIXOHIIHFWVRIWRRDONDOLQH FRORUFKDUW
RUWRRDFLGLFSRQGZDWHURQILVKSODQWOLIH ‡3HUIRUPVWHVWV
‡7HVWS+OHYHOVIURPWR
‡.LWLQFOXGHVDERWWOHRIWHVWVROXWLRQ
JODVVWHVWWXEHZLWKFDSLQVWUXFWLRQVDQG
FRORUFKDUW
 ,WHP 3ULFH
‡3HUIRUPVWHVW   
 ,WHP 3ULFH
  


:$7(57(67.,76 321'/,1(5&20

$PPRQLD7HVW.LW LQ3RQG7HVW6WULSV
‡$NLWIRUGHWHUPLQLQJWKHOHYHORI ‡+LJKO\SUHFLVH
DPPRQLD ‡1RVHSDUDWHWHVWYLDOUHTXLUHGGLS
‡5HDGVDPPRQLDOHYHOVIURPWRSSP GLUHFWO\LQWRWKHSRQG
‡.LWLQFOXGHVDERWWOHRIWHVWVROXWLRQ ‡(DV\7R5HDGGLUHFWLRQV
JODVVWHVWWXEHZLWKFDSLQVWUXFWLRQVDQG ‡VWULSVSHUER[
FRORUFKDUW ‡7HVWS+1LWUDWH1LWULWH&DUERQDWH
‡3HUIRUPVWHVW +DUGHQHU *HQHUDO+DUGQHVV

 ,WHP 3ULFH  ,WHP 3ULFH


 /5   ) 

321'&216758&7,21$&&(6625,(6

5RFN5HFHSWDFOH&RYHUV
,GHDOIRUFRYHULQJXQVLJKWO\SRZHUEDUVNHHSLQJ\DUG¶VORRNLQJQDWXUDO

 ,WHP 6L]H 'LPHQVLRQV 3ULFH


 37 6PDOO ´'[´+ 
 37 /DUJH ´'[´+ 

´6WHHO:DWHUIDOO ´6WHHO3RO\PHU
)RDP*XQ :DWHUIDOO)RDP*XQ
8VLQJWKH*XQ&OHDQHULVKLJKO\ 8VLQJWKH*XQ&OHDQHULVKLJKO\UHFRPPHQGHG
UHFRPPHQGHGDIWHUXVLQJZDWHUIDOOIRDP DIWHUXVLQJZDWHUIDOOIRDPZLWKWKLVGLVSHQVHUJXQ
ZLWKWKLVGLVSHQVHUJXQ
‡(FRQRPLFDOGXUDEOHXQLW
‡3URIHVVLRQDO5HOLDELOLW\ ‡([FHOOHQW6WDUWHU*XQ
‡7HIORQL]HGEDVNHW QHHGOHYDOYH
 ,WHP 3ULFH
 ,WHP 3ULFH  ) 
 ) 

%ODFN:DWHUIDOO %ODFN:DWHUIDOO )RDP*XQ


)RDPR] *XQ)RDPR] &OHDQHUR]
 ,WHP 3  ,WHP 3  ,WHP 3
 3ULFH   3ULFH   3ULFH 

$WODQWLF:DWHU /DJXQD /DJXQD


*DUGHQV6LOLFRQH 6LOLFRQH/XEULFDQW 7HÀRQ7DSH
‡%ODFN
‡.HHSV2ULQJVOXEULFDWHG 6HDOVDQGOXEHULFDWHVWKUHDGHG
‡3URORQJVOLIHRI2ULQJV ILWWLQJVDQGFRQQHFWLRQV

 ,WHP 6L]H 3ULFH  ,WHP 3ULFH  ,WHP 6L]H 3ULFH


 61 R]7XEH   37   37 ´:[¶/ 


 321'&216758&7,21$&&(6625,(6

&DO3XPS3RZHU&HQWHU
7KH3RZHU&RQWURO&HQWHUDOORZVEDFN\DUGZDWHUJDUGHQHUVWKHIOH[LELOLW\RILQVWDOOLQJDSRQGZKHUHQRHOHFWULFLW\
LVQHDUWKHSRQGVLWH1RZ\RXFDQFRQWUROWKHRSHUDWLRQRI\RXUSXPSV89FODULILHUVXQGHUZDWHUOLJKWVDQGRWKHU
QHFHVVDU\LWHPVZLWKWKH3RZHU&RQWURO&HQWHU7KHXOWLPDWHOX[XU\WRSRZHU\RXUSRQG
‡)RUSXPSVDQGORZYROWDJHOLJKWLQJ ‡JDXJHRXWGRRUFRUGV ‡\HDUZDUUDQW\
‡'XDOGLJLWDOWLPHUV IRU9DQG9 ‡)XVHSURWHFWHG

 ,WHP 1DPH 3ULFH


 3& 3RZHU&HQWHU¶&RUG 
 3& 3RZHU&HQWHU¶&RUG 
 3&) 3RZHU&HQWHU)XVH „
 3&)& 3RZHU&HQWHU)XVH&DS 

3RQGPDVWHU3OXJLQ*), .LOO$:DWW
%ODFNSOXJLQJURXQGIDXOWLQWHUUXSWHU ‡/DUJH/&'6FUHHQ
ZLWKDVLQJOHIHPDOHRXWOHW ‡'LVSOD\V9ROWV$PSV:DWWV+]9$
‡2SHUDWLQJ9ROWDJH9$&
‡%XLOWLQVXUJHSURWHFWLRQ ‡0D[&XUUHQW$PSV
‡5DLQSURRI ‡0D[3RZHU9$
‡'LPHQVLRQV´[´[´
 ,WHP 3ULFH <RXFDQFDOFXODWH\RXUHOHFWULFDOH[SHQVHV
   E\WKHGD\ZHHNPRQWKHYHQDQHQWLUH
\HDU$OVRFKHFNWKHTXDOLW\RI\RXUSRZHUE\
PRQLWRULQJYROWDJHOLQHIUHTXHQF\DQGSRZHUIDFWRU1RZ\RX¶OONQRZLILWLV
WLPHIRUDQHZSXPSRULI\RXUFXUUHQWRQHLVVWLOOVDYLQJ\RXPRQH\
 ,WHP 1DPH 3ULFH
 3 .LOO$:DWW 

',6&+$5*(.,76

/LWWOH*LDQW'LVFKDUJH.LWV 6DYLR'LVFKDUJH.LWV
7KHVHNLWVLQFOXGHDOOWKHFRPSRQHQWV\RX 7KHVHTXLFNFRQQHFWNLWVIRU:DWHU0DVWHU
QHHGLQFOXGLQJUXEEHUFRXSOLQJVFKHFN '.$
3XPSVDOORZ\RXWRDFKLHYHWKHSURSHU
YDOYHVDQGDGDSWRUV GLVFKDUJHKHLJKWWRH[LWWKH6NLPPHU¿OWHU
'.%DQG'.&
$GYDQFHG*DWRU/RFN6\VWHPSURYLGHVTXLFN
GLVFRQQHFWIRUVHUYLFLQJRUZLQWHUVWRUDJH

 ,WHP 1DPH3ULFH 3ULFH ,WHP 3XPSV )RU8VH,Q 2XWOHW/HQJWK3ULFH


  '.$´'LVFKDUJH.LW   . :0&3XPSV 5HJXODU6NLPPHU ´%DUE ´ 
  '.%´ ´'LVFKDUJH.LW   . :06 5HJXODU6NLPPHU ´%DUE ´ 
  '.&´'LVFKDUJH.LW   . :06 5HJXODU6NLPPHU ´%DUE ´ 
 . :06&RPSDFW6NLPPHU ´%DUE ´ 
 . :0&3XPSV &RPSDFW6NLPPHU ´%DUE ´ 
$WODQWLF:DWHU*DUGHQV  . :0&3XPSV :DWHUIDOO:HOO ´6OLS ´ 
7ULWRQ&KHFN9DOYH  . :0&3XPSV :DWHUIDOO:HOO([W ´6OLS ´ 
$VVHPEO\
7KH7ULWRQ&KHFN9DOYHLVWKHRQO\FKHFNYDOYH
%HQHILWV2I$'LVFKDUJH.LW
GHVLJQHGH[FOXVLYHO\IRUWKHZDWHUJDUGHQLQGXVWU\
7KHµVZLQJVW\OH¶7ULWRQ&KHFN9DOYHIHDWXUHVD´ 'LVFKDUJHNLWVVLPSOLI\LQVWDOODWLRQRISXPSVLQVNLPPHUV
7,3
VRFNHWXQLRQRQWKHLQOHW´RU´VRFNHWXQLRQV DQGYDXOWV7KH\DUHGHVLJQHGWRGLVFKDUJHDWWKHSURSHU
IRUWKHRXWOHWDPROGHGLQHOERZDQGDVOLP KHLJKW IRU WKH SUHGULOOHG KROHV LQ VNLPPHU DQG YDXOW
GHVLJQWKDWDOORZVFOHDUDQFHZKHQLQVWDOOHGZLWK KRXVLQJVZLWKQRPHDVXULQJ7KH\DOVRDOORZWKHSXPS
GLUHFWGULYHSXPSV WREHGLVFRQQHFWHGTXLFNO\IRUPDLQWHQDQFH
 ,WHP ,QOHW 2XWOHW 3ULFH
 75&9 ´RU´ ´RU´ 

:$7(5&872))6:,7&+(6 321'/,1(5&20

6KLQ0D\ZD'LVFKDUJH.LWV $WODQWLF:DWHU*DUGHQV
´&KHFN9DOYH$VVHPEO\
$GYDQFHG*DWRU/RFN6\VWHPSURYLGHVTXLFN
GLVFRQQHFWIRUVHUYLFLQJRUZLQWHUVWRUDJH
 ,WHP 6L]H 3ULFH
 ,WHP 2XWOHW /HQJWK 3ULFH  $:*&9 ´&KHFN9DOYH$VVHPEO\
 6'. ´6OLS ´ 

:$7(5&872))6:,7&+(6

9ROW/RZ:DWHU 9ROW/RZ:DWHU
&XW2II6ZLWFK &XW2II6ZLWFK
‡$XWRPDWLFDOO\WXUQVRIISXPSDIWHU ‡$XWRPDWLFDOO\WXUQVRIISXPSDIWHU
VNLPPHUEHOORZVLVFORVHGDQGZDWHU VNLPPHUEHOORZVLVFORVHGDQGZDWHU
OHYHOGURSVLQVNLPPHUEDVLQ OHYHOGURSVLQVNLPPHUEDVLQ
‡$XWRPDWLFDOO\WXUQVRIISXPSLI ‡$XWRPDWLFDOO\WXUQVRIISXPSLI
VNLPPHUZDWHUOHYHOGURSVGXHWRGLUW\ VNLPPHUZDWHUOHYHOGURSVGXHWRGLUW\
RUFORJJHG¿OWHUPHGLD RUFORJJHG¿OWHUPHGLD
‡¶SOXJOHVVFRUGIRUHDV\GLUHFWZLUH ‡¶&RUGZLWKSLJJ\EDFNSOXJHDV\
LQVWDOODWLRQ LQVWDOODWLRQDQGPDQXDOUXQRSHUDWLRQ
‡&RQWUROVSXPSVUDWHGXSWRDPSV ‡&RQWUROVSXPSVUDWHGXSWRDPSV
‡\HDUZDUUDQW\ ‡\HDUZDUUDQW\

 ,WHP 1DPH 3ULFH  ,WHP 1DPH 3ULFH


  5)619ROW/RZ:DWHU&XW2II6ZLWFK    569ROW/RZ:DWHU&XW2II6ZLWFK 

6-(9HUWLFDOPDVWHU3XPS6ZLWFK
‡+HDY\GXW\FRQWDFWV ‡6ZLWFKKRXVLQJGLPHQVLRQV´+[´:
‡&RQWUROVSXPSVXSWR+3DW9$&DQG+3DW9$& QRWLQFOXGLQJFDEOHHQWUDQFH 
‡$GMXVWDEOHSXPSLQJUDQJHRIWR´ ‡)ORDWKRXVLQJGLPHQVLRQV´+[´:
‡2YHUDOOGLPHQVLRQV´+[´'[´: ‡\HDUZDUUDQW\

 ,WHP 1DPH 3ULFH


 6-90:3 6-(9HUWLFDOPDVWHU3XPS6ZLWFK 

$872),//.,76

$TXD)LOO:DWHU/HYHO&RQWUROOHU
6LPSOH,QVWDOODWLRQ(DVLO\+LGGHQ7URXEOH)UHH $OVR5HVLVWDQW7R
‡8QOLNHPHFKDQLFDOIORDWVWKH$TXD)LOOZLOOQRWVWLFNRUMDP ‡5XVWLQJ
‡,WFDQEHLQVWDOOHGDQ\ZKHUHLQWKHSRQG ‡&RUURVLRQ
‡,WFRQWUROVD9VROHQRLGXVLQJORZYROWDJHZLUH ‡:DYHV 7XUEXOHQFH
‡,WZRUNVZLWKDQ\9SRZHUVXSSO\DQGDODZQVSULQNOHU
VROHQRLGYDOYH
‡,WPHDVXUHV´[´DQGLVHDV\WRKLGH
‡8QOLNHWKHPHFKDQLFDOIORDWVWKHZDWHUVRXUFHFDQHQWHUWKH
SRQGDWDQ\HTXLSPHQWORFDWLRQ
‡7KH³)DLO6DIH´LQVWDOODWLRQLQVXUHVDJDLQVWRYHUIORZV
‡&RPHVZLWKIORDW6ROHQRLGDQG7UDQVIRUPHU
‡<HDU:DUUDQW\
 ,WHP 1DPH 3ULFH
 $)3 $TXD)LOO:DWHU/HYHO 


 $872),//.,76

6DYLR0HFKDQLFDO /LWWOH*LDQW$XWR)LOO.LW
:DWHU/HYHOHU
‡´037$XWR)LOO9DOYH
‡)LWVLQVLGH\RXU6NLPPHUILOWHU ‡´%DUE$GDSWRU
‡&RQQHFWVWRD´ZDWHUOLQHDQGHDVLO\ILWV ‡´)HPDOH$GDSWRU
LQWRDIXOOVL]H6NLPPHUILOWHU89&KDPEHU ‡´*DUGHQ+RVH$GDSWRU
‡6HOIWDSSLQJYDOYHFRQQHFWVWRFRSSHU
SODVWLFRULURQZDWHUVXSSO\OLQHVWR´
GLDPHWHU  ,WHP 3ULFH
‡,QFOXGHV¶RI´OLQH   

 ,WHP 1DPH 3ULFH


 .5 5LJKW6LGH6DYLR:DWHU/HYHOHU 
 ./ /HIW6LGH6DYLR:DWHU/HYHOHU 

6DYLR0HFKDQLFDO$XWR)LOO:DWHUIDOO:HOO.LW
‡0DLQWDLQRSWLPDOZDWHUOHYHOZLWKDUHJXODWHGIORZRIZDWHU ‡,QFOXGHV¶RI´OLQH
‡6HOI7DSSLQJYDOYHFRQQHFWVWRFRSSHUSODVWLFRULURQZDWHUVXSSO\ ‡:KLWHIORDWHULVDERXW´ORQJDERXW´ORQJWRWDOOHQJWK
OLQHVXSWR´'LDPHWHU ´GLDPHWHU

 ,WHP 3ULFH
 . 

/DJXQD$XWR)LOO.LW $WODQWLF:DWHU*DUGHQV
$XWR)LOO.LW
‡.HHSVSRQGZDWHUDWGHVLUHGOHYHO
‡5HSOHQLVKHVZDWHUORVV ‡,QFOXGHVDGDSWRUVIRUJDUGHQKRVHRU´
‡$GMXVWDEOHWRYDULRXVVHWWLQJV LUULJDWLRQOLQH
‡(DVLO\FRQQHFWVWRJDUGHQIDXFHW ‡:KLWHIORDWHULVDERXW´ORQJ
‡$ERXW´ORQJWRWDO
‡´PD[GLDPHWHU
 ,WHP 3ULFH
 37   ,WHP 3ULFH
 $) 

9$/9(6$1'&211(&7256

8QLRQV %XONKHDGV
 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH
  ´8QLRQ6OLS   7)3( ´%XONKHDG)LWWLQJ 
  ´8QLRQ7KUHDGHG)37   7)3( ´%XONKHDG)LWWLQJ 
  ´8QLRQ6OLS   7)3( ´%XONKHDG)LWWLQJ 
  ´8QLRQ7KUHDGHG)37   7)3( ´%XONKHDG)LWWLQJ 
 7)3( ´%XONKHDG)LWWLQJ 
 7)3( ´%XONKHDG)LWWLQJ 
 7)3( ´%XONKHDG)LWWLQJ 


9$/9(6$1'&211(&7256 321'/,1(5&20

%DOO9DOYHV
 ,WHP 6L]H 3ULFH
 (%97 ´%DOO9DOYH7KUHDGHG)37 
 (%97 ´%DOO9DOYH7KUHDGHG)37 
 (%96 ´&KHFN9DOYH6OLS 
 (%97 ´%DOO9DOYH7KUHDGHG)37 
 (%96 ´%DOO9DOYH6OLS 
 (%97 ´%DOO9DOYH7KUHDGHG)37 
 (%96 ´%DOO9DOYH6OLS 

&KHFN9DOYHV
 ,WHP 6L]H 3ULFH
 .6&7 ´&KHFN9DOYH7KUHDGHG)37 
 .6&7 ´&KHFN9DOYH7KUHDGHG)37 
 .6&7 ´&KHFN9DOYH7KUHDGHG)37 
 .6&6 ´&KHFN9DOYH6OLS 
 .6&7 ´&KHFN9DOYH7KUHDGHG)37 
 .6&6 ´&KHFN9DOYH6OLS 
 .6&7 ´&KHFN9DOYH7KUHDGHG)37 
 .6&6 ´&KHFN9DOYH6OLS 

/DJXQDRIIHUVDZLGHUDQJHRI¿WWLQJVWRPDNHFRQQHFWLQJSXPSVKRVLQJDQGRWKHUSDUWVHDV\$OOFRQQHFWRUVIHDWXUHWKHSDWHQWHG³&OLFN)LW´
FRXSOLQJGHVLJQZKLFKDOORZV\RXWRPDNHTXLFNDQGVHFXUHDWWDFKPHQWV7KLVGRLW\RXUVHOIDSSURDFKPDNHVLQVWDOODWLRQVLPSOH0XOWLSOH
FRPELQDWLRQVDUHSRVVLEOHWRVXLW\RXULQGLYLGXDOQHHGV

/DJXQD /DJXQD /DJXQD


´&OLFN)LW&RQQHFWRU ´&RQQHFWRU 7UDQVLWLRQ&RQQHFWRU
 ,WHP 037 3ULFH  ,WHP 037 3ULFH  ,WHP 6L]H 3ULFH
 37 ´´´   37 ´   37 ´ 

/DJXQD /DJXQD /DJXQD


´&OLFN)LW&RQQHFWRU +RVH&RQQHFWRU 8QLYHUVDO)DVW&RXSOLQJ
 ,WHP 037 3ULFH  ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH
 37 ´   37 ´   37 ´´´ 

/DJXQD /DJXQD7KUHDG /DJXQD


<&RQQHFWRU WR&OLFN)LW$GDSWRU 0XOWL+RVH$GDSWRU
 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH
 37 ´´´   37 ´´   37 ´´ 
 37 ´´´   37 ´´ 

0DOH$GDSWHU)37 )0$GDSWHU037
 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH
 */3$ ´   /3%1/ ´
* 
 */3$ ´  */3%1/ ´ 

0DOH$GDSWHU037 )0$GDSWHU)37
 ,WHP 6L]H 3ULFH
 ,WHP 6L]H 3ULFH
 */3) ´ 
 /3'1/ ´
* 
 */3) ´ 
*/3'1/ ´ 


 78%,1*$1'+26(&/$036

)OH[LEOH%ODFN 6SLUDO7XELQJ %ODFN39&+RVH


9LQ\O7XELQJ  ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH
 ,WHP 6L]H 3ULFH   ´[¶   3+%. ´[¶ 
  ´[¶   3+%.´[¶ 
 93%. ´[¶ 
  ´[¶   3+%. ´[¶
 93%. ´[¶ 
 3+%. ´[¶ 
 93%. ´[¶    ´[¶ 
 3+%. ´[¶ 
93%.´[¶    ´[¶ 
 3+%. ´[¶ 
93%./) ´[/) „ /) ´[/) „  3+%. ´[¶ 
93%./) ´[/) „ /) ´[/)   3+%. ´[¶ 
/) ´[/)   3+%. ´[¶ 
93%./) ´[/) 
93%./) ´[/)   /)´[/) 
/) ´[/)  &KRRVH\RXUWXEHDQGKRVHVL]HDFFRUGLQJWR
KRZPXFKIORZ\RXUSXPSZLOOSURYLGH
7,3
´'LD *3+

+RVH&ODPSV )OH[LEOH3LSH ´'LD *3+

 ,WHP 6L]H 3ULFH *URPPHW ´'LD *3+


 +766 ´[´ „ ´'LD *3+
 ,WHP 6L]H 3ULFH
 +766 ´[´  ´'LD *3+
  ´ 
 +766 ´[´    ´  ´'LD *3+
 +766 ´[´    ´  ´'LD *3+
 +66 ´[´ 
 +66 ´[´ 

),77,1*6

,QVHUW7 %DUE 6FK0DOH


$GDSWRU 6FKHGXOH
8VHGWRFRQQHFWWKUHHSLHFHVRI
ÀH[LEOHWXELQJ5HFRPPHQGHG 037[6OLS 3OXJ 037
IRU6SLUDO7XELQJ $GDSWV6FKHGXOHSLSHWRWKUHDGV
 ,WHP 6L]H 3ULFH 5HFRPPHQGHGIRU39&+RVH  ,WHP 6L]H 3ULFH
 7 ´[´[´ „  ,WHP 6L]H 3ULFH   ´ 
 7 ´[´[´    ´[´    ´ 
 7 ´[´[´    ´[´    ´ 
 7 ´[´[´    ´[´ 
 7 ´[´[´    ´[´ 
 7 ´[´[´    ´[´ 
  ´[´ 

7KUHDG&RXSOLQJV
6WUDLJKW+RVH )37[)37
0HQGHU 1LSSOHV
037[037 8VHGWRFRQQHFW037¿WWLQJV
%DUE[%DUE
 ,WHP 6L]H 3ULFH
8VHGWRFRQQHFWSLHFHVRIÀH[LEOHWXELQJ 8VHGWRFRQQHFWWZR)37¿WWLQJV   ´[´ „
5HFRPPHQGHGIRU6SLUDO7XELQJ  ,WHP 6L]H 3ULFH   ´[´ 
 ,WHP 6L]H 3ULFH  0 ´[´ „   ´[´ „
 6+0 ´[´ „  0 ´[´ „   ´[´ 
 6+0 ´[´   0 ´[´ „   ´[´ 
 6+0 ´[´ „  0 ´[´    ´[´ 
 6+0 ´[´ „  0 ´[´    ´[´ 
 6+0 ´[´   0 ´[´    ´[´ 
 6+0 ´[´    ´[´ 
 6+0 ´[´   )7/3 ´[´ 


),77,1*6 321'/,1(5&20

6WUDLJKW+RVH 5HGXFLQJ
$GDSWRUV %XVKLQJV 6FKHGXOH:\H
037[%DUE 037[)37 )LWWLQJV 6OLS
8VHGWRFRQQHFWDQ)37WRÀH[LEOHWXELQJ 8VHGWRFRQQHFWDQ)37WKUHDGWRD
5HFRPPHQGHGIRU6SLUDO7XELQJ UHGXFHGVL]HRIDQ037¿WWLQJ  ,WHP 6L]H 3ULFH
  ´6OLS 
 ,WHP 6L]H 3ULFH  ,WHP 6L]H 3ULFH
 $ ´[´ „   ´[´ 
 $ ´[´ „   ´[´ 
 $ ´[´ „   ´[´ 
 $ ´[´ „   ´[´ 
 $ ´[´ „   ´[´  6FKHGXOH
 $ ´[´ „   ´[´ 
 $ ´[´    ´[´ 
6OLS&RXSOLQJV
 $ ´[´ „   ´[´ 
 $ ´[´ „   ´[´   ,WHP 6L]H 3ULFH
 $ ´[´ „   ´[´    ´ „
 5% ´[´    ´ 
 $ ´[´ 
 5% ´[´    ´ 
 $ ´[´ 
  ´[´    ´ 
 $ ´[´ 
 $ ´[´   5% ´[´ 
 $ ´[´ 
 $ ´[´ 
 $ ´[´  )HPDOH6WUDLJKW
 $ ´[´  6FK5HGXFLQJ $GDSWRU
 $ ´[´ 
%XVKLQJ )37[%DUE
637[)37  ,WHP 6L]H 3ULFH
 ,WHP 6L]H 3ULFH  $) ´[´ „
  ´[´   $) ´[´ 
6FKHGXOH   ´[´ 
ƒ(O 6OLS   ´[´ 
  ´[´ 
 ,WHP 6L]H 3ULFH 6FKHGXOH
  ´  )0$GDSWRU
  ´ 
)37[6OLS
  ´ 
6FK5HGXFLQJ
 ,WHP 6L]H 3ULFH
%XVKLQJ   ´[´ 
637[6OLS   ´[´ 
  ´[´ 
6FK  ,WHP 6L]H 3ULFH   ´[´ 
  ´[´ 
7KUHDGHG(OERZ
  ´[´ 
 ,WHP 6L]H 3ULFH   ´[´ 
  ´[´ 
  ´)37[´)37 
  ´[´ 

&DO3XPS &DO3XPS
%DUEHG$GDSWRU %DUEHG$GDSWRU
 ,WHP 6L]H 3ULFH ,WHP 6L]H 3ULFH
 6) ´)37[´%DUEHG   6) ´)37[´%DUEHG 


 6<17+(7,&*2/)*5((16

3URIHVVLRQDO6\QWKHWLF*ROI*UHHQVDUHPDQXIDFWXUHGZLWKWKHPRVWDGYDQFHG HIIHFWVRIUDLQVQRZDQGWKHVXQ*ROIJUHHQVDUHGHVLJQHGWRKDYHWKHH[DFWVDPH
V\QWKHWLFWXUIDYDLODEOHRQWKHPDUNHWWRGD\0DGHZLWKDKLJKO\GXUDEOH FKDUDFWHULVWLFVRIDQDWXUDOSXWWLQJJUHHQ2QFHRXUJROIJUHHQLVLQVWDOOHGLW¶V
XOWUDYLROHWWUHDWHGSRO\SURS\OHQHILEHURXUSXWWLQJJUHHQVDUHGHVLJQHGWRZLWKVWDQG YLUWXDOO\PDLQWHQDQFHIUHH$OOWKDWLVUHTXLUHGLVGHEULVUHPRYDO
WHPSHUDWXUHVIURPGHJUHHVWRGHJUHHVDQGFDQZLWKVWDQGWKHGDPDJLQJ

7KHJROIJUHHQWXUIDQGIULQJHLVFRYHUHGE\D\HDUOLPLWHGPDQXIDFWXUHZDUUDQW\DQGD\HDUQRIDGHZDUUDQW\
*ROIJUHHQVVKRZQDUHH[DPSOHVRQO\*UHHQVDUHVROGLQUROOVDQGZLOOKDYHWREHFXWWRWKHGHVLUHGVKDSH,IWKHUHDUHVHDPV\RXZLOOQHHGVHDPLQJ
WDSHDQGDGKHVLYHWRVSOLFHWKHWZRSLHFHVRIWXUIWRJHWKHU3XWWLQJ*UHHQVZLOOUHTXLUHEODFNVODJWKDWFDQEHSXUFKDVHGORFDOO\3XWWLQJ*UHHQ)ULQJH
FRXOGDOVREHQHHGHGGHSHQGLQJRQ\RXUGHVLJQ)ULQJHLVVROGVHSDUDWHO\&DOOIRUVL]LQJDQGSULFLQJRIIULQJH

*ROI*UHHQ7XUI VTIW )ULQJH 5.10VTIW


15’ 15’

30’
6T)W 6T)W 10’
6T)W
15’ 25’
‡2QH¶[¶5ROO ‡2QH¶[¶5ROO ‡2QH¶[¶5ROO
‡1R6HDP ‡2QH6HDP ‡1R6HDP

 ,WHP 3ULFH  ,WHP 3ULFH  ,WHP 3ULFH


 3*$   3*$   3*$ 

15’
15’
30’
6T)W 6T)W 20’
15’
6T)W
15’
15’ 35’
‡2QH¶[¶5ROO ‡2QH¶[¶5ROO ‡2QH¶[¶5ROO
‡1R6HDP ‡2QH6HDP 30’
‡1R6HDP

 ,WHP 3ULFH  ,WHP 3ULFH  ,WHP 3ULFH


 3*$   3*$   3*% 
15’ 15’

30’

6T)W 6T)W 6T)W


20’
40’ 45’
‡2QH¶[¶5ROO ‡2QH¶[¶5ROO ‡2QH¶[¶5ROO
‡2QH6HDP ‡1R6HDP ‡1R6HDP

 ,WHP 3ULFH  ,WHP 3ULFH  ,WHP 3ULFH


 3*$   3*%   3*$ 
30’
30’
35’

6T)W 6T)W 30’


6T)W 15’
25’

‡2QH¶[¶5ROO ‡2QH¶[¶5ROO ‡2QH¶[¶5ROO 15’


‡2QH6HDP ‡2QH6HDP ‡2QH6HDP
25’

 ,WHP 3ULFH  ,WHP 3ULFH  ,WHP 3ULFH


 3*$   3*$   3*% 


6<17+(7,&*2/)*5((16 321'/,1(5&20

7KHJROIJUHHQWXUIDQGIULQJHLVFRYHUHGE\D\HDUOLPLWHGPDQXIDFWXUHZDUUDQW\DQGD\HDUQRIDGHZDUUDQW\
*ROIJUHHQVVKRZQDUHH[DPSOHVRQO\*UHHQVDUHVROGLQUROOVDQGZLOOKDYHWREHFXWWRWKHGHVLUHGVKDSH,IWKHUHDUHVHDPV\RXZLOOQHHGVHDPLQJ
WDSHDQGDGKHVLYHWRVSOLFHWKHWZRSLHFHVRIWXUIWRJHWKHU3XWWLQJ*UHHQVZLOOUHTXLUHEODFNVODJWKDWFDQEHSXUFKDVHGORFDOO\3XWWLQJ*UHHQ)ULQJH
FRXOGDOVREHQHHGHGGHSHQGLQJRQ\RXUGHVLJQ)ULQJHLVVROGVHSDUDWHO\&DOOIRUVL]LQJDQGSULFLQJRIIULQJH

35’ 40’ 36’

6T)W 30’
6T)W 30’
6T)W
30’

‡2QH¶[¶5ROO ‡2QH¶[¶5ROO ‡2QH¶[¶5ROO


‡2QH6HDP ‡2QH6HDP ‡7ZR6HDPV

 ,WHP 3ULFH  ,WHP 3ULFH  ,WHP 3ULFH


 3*$   3*$   3*$ 

30’

30’ 40’
60’

40’
6T)W 6T)W 45’
6T)W
30’
25’
‡2QH¶[¶5ROO ‡7ZR¶[¶5ROOV ‡2QH¶[¶5ROOV
‡7ZR6HDPV ‡2QH6HDP 50’
‡2QH¶[¶5ROOV
45’
‡7ZR6HDPV

 ,WHP 3ULFH  ,WHP 3ULFH  ,WHP 3ULFH


 3*$   3*$   3*% 

75’ 35’

30’
6T)W 40’
30’
25’ 6T)W
20’
‡7ZR¶[¶5ROOV ‡7ZR¶[¶5ROOV
‡2QH¶[¶5ROO 75’ ‡2QH¶[¶5ROO
‡)RXU6HDPV ‡)RXU6HDPV

 ,WHP 3ULFH  ,WHP 3ULFH


 3*$   3*% 

*2/)*5((1$&&(6625,(6

*ROI*UHHQ$FFHVVRU\.LW
.LW,QFOXGHV ‡&XS6OHHYH
‡5HJXODWLRQ&XS ‡:ULWWHQ,QVWUXFWLRQV
‡2QH´7+DQGOH3ROHZEDOOWUDSGLVN
‡)ODJ

 ,WHP 3ULFH
 3*$. 


321'/,1(5&20 6+,33,1* 3$<0(17
6KLSSLQJ +DQGOLQJ7HUPVDQG&RQGLWLRQV
$OOSURGXFWVVROGE\3RQGOLQHUFRPDUH)2%6KDZQHH2NODKRPDZKLFKPHDQVVKLSSLQJDQGKDQGOLQJFRVWVDUHQRWLQFOXGHGLQWKHOLVWHG
SULFH3RQGOLQHUFRPQHJRWLDWHVZLWKFRPPRQFDUULHUVWRUHFHLYHWKHEHVWVKLSSLQJUDWHVDQGVHUYLFHDYDLODEOH:HSDVVWKHVHVDYLQJV
GLUHFWO\RQWR\RX

3DFNDJHVWKDWDUHOEVDQGOLJKWHUDUHVKLSSHGYLD)HG([JURXQGVHUYLFHXQOHVVRWKHUZLVHUHTXHVWHG([SUHVV)HG([VHUYLFH 1H[W'D\
$LU6HFRQG'D\$LUHWF DUHDYDLODEOH3DFNDJHVLQH[FHVVRIOEVDUHVKLSSHGYLD)UHLJKW7UXFN

7KURXJKDVSHFLDODJUHHPHQWZLWK3RQGOLQHUFRPDOOXVXDOIUHLJKWWUXFNVXUFKDUJHVIRUUHVLGHQWLDOGHOLYHU\DUHZDLYHGVRSLFNLQJXSWKH
VKLSPHQWDWWKHIUHLJKWGRFNRUVHDUFKLQJIRUDEXVLQHVVWRDFFHSWGHOLYHU\IRU\RXLVQ¶WQHFHVVDU\&RQ:D\RU&HQWUDO DQGDOORWKHUWUXFN
IUHLJKWFRPSDQLHV GRUHTXLUHWKDWVRPHRQHEHSUHVHQWIRUGHOLYHU\&RQ:D\RU&HQWUDOXVHVODUJH¶ORQJVHPLWUXFNVVR\RXUORFDWLRQ
PXVWEHHDVLO\DFFHVVLEOHIRUWKHWUXFNVWRPDNHWKHGHOLYHU\2IIORDGLQJSDFNDJHVIURPWKHWUXFNLVWKHFXVWRPHU¶VUHVSRQVLELOLW\
DOWKRXJKVRPHWLPHVWKHGULYHUZLOODVVLVW\RX8QGHUQRFLUFXPVWDQFHVZLOO3RQGOLQHUFRPEHKHOGOLDEOHIRUXQORDGLQJ\RXUSURGXFWRU
DGGLWLRQDOFKDUJHVLQFXUUHGLI\RXUVKLSWRDGGUHVVLVLQDFFHVVLEOHWRWKHGHOLYHU\WUXFN

3RQGOLQHUFRPZLOOKHOS :$
FRRUGLQDWHGHOLYHU\WLPH
07 97 0(
ZLWKWKHVKLSSLQJFRPSDQLHV 1' 01
3RQGOLQHUFRPFDQQRW 25 1+
,' 6' :, 1< 0$
JXDUDQWHHGHOLYHU\WLPHVDQG
:< 0, 5,
ZLOOQRWEHKHOGUHVSRQVLEOH
,$ 3$ &7
IRUFRVWDVVRFLDWHGZLWK 19 1( 1-
GHOD\HGSURGXFWGHOLYHU\ 87 ,/ ,1 2+ '(
LQFOXGLQJEXWQRWOLPLWHGWR &$ &2 .6 :9 9$ 0'
ODERUVWDQGE\FKDUJHVRU 02 .<
HTXLSPHQWUHQWDO 71 1&
$= 10 2.
$5 6&
3RQGOLQHUFRPGRHVQRWVKLS
RXWVLGHWKHORZHUVWDWHV 06 $/ *$
7;
,WLVLPSRVVLEOHWRSURYLGH
/$
DGHTXDWHFXVWRPHUVHUYLFH
WR+DZDLL$ODVNDRWKHU )/
)HG([
86WHUULWRULHVDQGIRUHLJQ *URXQG7UDQVLW
FRXQWULHV
'D\7UDQVLW 'D\7UDQVLW 'D\7UDQVLW 'D\7UDQVLW

3D\PHQW7HUPV
7KHUHVLGHQWVRI2NODKRPDDQG7H[DVPXVWSD\VDOHVWD[XQOHVVWD[H[HPSWVWDWXVLVSURYHG
3RQGOLQHUFRPDFFHSWV9,6$0DVWHU&DUG'LVFRYHU$PHULFDQ([SUHVV:LUH7UDQVIHUV
3HUVRQDO &RPSDQ\&KHFNVDQG0RQH\2UGHUV

&UHGLW&DUGWUDQVDFWLRQVZLOOEHSURFHVVHGDQGRUGHUVZLOOEHVKLSSHGXSRQDSSURYDORIWKHSXUFKDVHSULFHE\WKHFUHGLWFDUGFRPSDQ\
:LUH7UDQVIHUVRU0RQH\2UGHUWUDQVDFWLRQVZLOOEHSURFHVVHGLPPHGLDWHO\XSRQUHFHLSW:HFKDUJHDQDGGLWLRQDOWRSURFHVVZLUH
WUDQVIHUV
3HUVRQDORU&RPSDQ\&KHFNWUDQVDFWLRQV
RUOHVV7KHRUGHUZLOOEHSURFHVVHGLPPHGLDWHO\XSRQUHFHLSWRIWKHFKHFN
DQGDERYH<RXURUGHUPD\EHKHOGXSWREXVLQHVVGD\VXQWLOWKHFKHFNFOHDUV

3ULFLQJ
7KLVFDWDORJKDVEHHQLQVSHFWHGIRUPLVWDNHVEXWGHVSLWHRXUEHVWHIIRUWV
HUURUVPD\RFFXU3RQGOLQHUFRPUHVHUYHVWKHULJKWWRDPHQGSULFLQJDWDQ\WLPH


5HWDLO&DWDORJ

:H6KLS(YHU\WKLQJEXWWKH:DWHU
1RUWK.LFNDSRR6KDZQHH2NODKRPD
_)D[
ZZZSRQGOLQHUFRP