Moléculas biológicas

Polímeros

Membranas

• • • • • • Proteínas Ácidos nucleicos Carbohidratos Lípidos Coenzimas Hormonas

Funciones de las macromoléculas
Enzimas Reconocimiento molecular Proteínas de soporte

Proteínas..............

Ácidos nucleicos.. Información genética

Carbohidratos.....

Acumular energía

Lípidos.................

Separar compartimentos

Proteínas

• Su estructura química está formada por la unión en cadena lineal de un conjunto de bloques. • Cada bloque es uno de los 20 aminoácidos que se listan.

Aminoácidos

Son los “ladrillos” de las proteínas. Todos tienen la misma estructura básica.

Carbon chemistry - covalent bonds H C H
Lehninger , 3rd edition

H

H

Propiedades de los aminoácidos

*Existen 20 tipos (de manera general). *Las propiedades de cada aminoácido están determinadas por su cadena lateral. *Existen abreviaciones con códigos de una y tres letras (!).

Residuos hidrofóbicos

Residuos hidrofílicos no-cargados

Residuos hidrofílicos cargados

Residuos anfipáticos

Residuos conformacionalmente importantes

8,926,016 entries

Ala (A) 8.55 Arg ( R) 5.50 Asn (N ) 4.17 Asp (D ) 5.28 Cys ( C) 1.31 Glx (Z) 0.00

Gln (Q) 3.89 Glu (E) 6.13 Gly (G) 7.07 His (H) 2.21 Ile (I) 5.96

Leu (L) 9.81 Lys (K) 5.27 Met (M) 2.43 Phe (F) 4.03 Pro (P) 4.78

Ser (S) 6.78 Thr (T) 5.60 Trp (W) 1.32 Tyr (Y) 3.05 Val (V) 6.70 Xaa (X) 0.06

Asx ( B) 0.00

Propiedades de aa

Ácido-básicas.

Comportamiento de cualquier aminoácido cuando se ioniza. Cualquier aminoácido puede comportarse como ácido y como base, se denominan sustancias anfóteras.

Cuando una molécula presenta carga neta cero está en su punto isoeléctrico. Si un aminoácido tiene un punto isoeléctrico de 6,1 su carga neta será cero cuando el pH sea 6,1.

Los aminoácidos y las proteínas se comportan como sustancias tampón.

Aminoácidos
amino

R
ácido

NH2 H

COOH

Los grupos amino y ácido carboxílico tienen pKa’s

COOH

COO-

NH3+
pKa ~ 9.4

NH2

pKa ~ 2.2

R
+NH 3

Cα H

COO-

A pH fisiológico los aminoácidos son zwitteriones

pKa

El pH se define como la concentración de iones hidronio.

…esto se basa en el equilibrio que se logra entre una molécula y sus ácidos y bases conjugados.

La constante de equilibrio de esta reacción esta dada por:

Si despejamos [H+]

Aplicando log en ambos lados de la ecuación (..y un signo negativo).

Esta es la ecuación de Henderson-Hasselbach

Que significa la ecuación de Henderson-Hasselbalch

pH = pK + log ([A-]/[HA])

Si consideramos que un ácido HA esta 50% disociado i.e. [HA] = [A-]

HA

H+ + A-

En la ecuación el término log ([A-]/[HA]) es log 1 y log 1 = 0 pH = pK

Lo cual se traduce a

Luego entonces:

El pK es una medida del pH al cual un grupo Ionizable esta disociado en un 50%

Titulación de la alanina con NaOH

http://www.wiley.com/college/fob/quiz/quiz04/4-8.html

Titulación de la histidina con NaOH

Histidina

Debido a que el pKa de la histidina es cercano a un pH neutro, su estado de protonación depende fuertemente de su ambiente local. Esta característica es empleada frecuentemente en la naturaleza para usarlo como un interruptor molecular.

Enlace Peptidico

Para generar una proteína, los aminoácidos se unen en una cadena polipeptidica a través de un enlace peptidico.

Polipéptidos

Las proteínas no son mas que larguísimas cadenas polipéptidicas.

Las cadenas que tienen menos de 50 (en ocasiones el limite se fija en 100!) aminoácidos o residuos son llamada polipéptidos.

Si las cadenas son mas grandes…se les llama proteínas.

8,926,016 entries 204aa=160,000 206aa=64,000,000 208aa=2.56 x 1010 2077aa=7.5 x 1098

The average sequence length in UniProtKB/TrEMBL is 323 amino acids. 4 amino acids. 36805 amino acids.

The sho rtest sequence is Q16047_ HUMAN: The longest sequence is Q3ASY8_CHLCH:

Ángulos y Enlaces

Angulos dihedrales

Grafica de Ramachandran

Los ángulos φ y ψ presentes en los aminoácidos que conforman una cadena polipeptidica o una proteína se encuentran restringidos. Esto se debe mayoritariamente a impedimentos estéricos (excepto la glicina!)

Estructura Secundaria

La estructura primaria, o mejor dicho, la cadena principal de una proteína debe organizarse en una manera compacta. Esto se hace produciendo elementos de estructura secundaria. Los dos elementos mas comunes son las hélices alfa y las hojas beta, formadas por aminoácidos con ángulos φ y ψ mas o menos similares. Existen mas elementos de estructura secundaria como son: turns, coils, hélices 3 10, etc.

Puentes Disulfuro

Pares de cisteínas son capaces de formar enlaces covalentes entre ellos (cistinas).

Esto adiciona estabilidad y es común e proteínas extracelulares.

Estructura Terciaria

•Para lograr que una proteína parezca una proteína, los elementos de estructura secundaria se agrupan formando elementos de estructura terciaria.

•Frecuentemente, estos agrupamientos de estructuras secundarias dan lugar a agrupamientos llamados motifs (greek key, EF hand, beta hairpin, etc).

Estructura Cuaternaria

•Las proteinas plegadas pueden reagruparse formando oligomeros.

•Muchas enzimas necesitan encontrase en estado multimerico para poder realizar su función biologica.

Enlaces No-Covalentes

•Los enlaces que forman al polipéptido, así como los puentes disulfuro, son enlaces covalentes.

•Sin embargo los enlaces no-covalentes son muy usados en la estabilización de estructuras secundarias, terciarias y cuaternarias.

•Estos enlaces incluyen: Puentes de hidrogeno, puentes salinos, interacciones de van der waals, etc

Enlaces de Hidrógeno

•Se forman al compartir un protón entre un donador y un aceptor.

•Su energía de enlace esta entre 2 y 5 kcal/mol y su distancia ideal de enlace es de entre 2.8 y 3 Å.

Puentes Salinos

•Son uniones electrostáticas entre grupos con carga opuesta.

•Su energía de enlace esta entre 4 y 7 kcal/mol.

Interacciones de van der Waals

•Las interacciones electrostáticas no explican a todas las interacciones no-covalentes entre moléculas (especialmente en especias con carga parcial, o bien, no cargadas).

•Los átomos con dipolos (o multipolos) inducen e interactúan con dipolos en otros átomos (siguiendo el principio de dispersión de fuerzas 1/r6)

Lennard-Jones

Interacciones hidrofóbicas

•Las interacciones hidrofóbicas no son interacciones de atracción, resultan de la imposibilidad del agua para formar enlaces de hidrogeno con ciertas cadenas laterales.

Excepciones a la cadena lineal

• El enlace de disulfuro

Estrategias de investigación en bioquímica

• Estudio de una función • Detección de la función elegida (ensayo). • Búsqueda de una molécula responsable de la función (en general de una proteína????). • Selección de una fuente (organismo y/o tejido idóneo). • Caracterización de proteínas puras.

Purificación de proteínas

OBTENCIÓN DE MATERIAL

• • • • • • •

Proteínas extracelulares Lisis enzimática (protoplastos) Sonicación Prensa de French Extracción Congelado y descongelado ETC…

Fraccionamiento subcelular por centrifugación secuencial

Fraccionamiento en gradientes de sacarosa/percoll

•Cada técnica ofrece un balance entre resolución, velocidad, capacidad y recuperación y deben ser seleccionadas en función de los objetivos de cada paso de la purificación. •En general, la optimización de cualquiera de estos parámetros puede obtenerse solamente a costas de los otros de forma que cada paso de la purificación debe ser seriamente evaluado. •La importancia de cada parámetro variará dependiendo si el paso de purificación esta dirigido a capturar, si es intermedio o si es de refinado.

Propiedad fisicoquímica

Técnica recomendada Intercambio iónico Permeación en gel Interacción hidrofóbica, fase reversa Afinidad

Carga

Talla

Hidrofobicidad

Especificidad

SOLUBILIDAD

Fraccionamiento por salting-out

Voet Biochemistry 3e Page 139 © 2004 John Wiley & Sons, Inc.

Tamaño molecular, Dialisis

CARGA

Cromatografía de intercambio iónico

Generación de un gradiente lineal de concentración Conc.salina

Vol. Eluente

Separación de proteinas con diferente pI rCssII-CO2H, nCssII-CONH2 y 6HisrCssII-CO2H rCssIIE15R-CO2H y 6HisrCssII-CO2H

1. 2.

nCssII

KEGYLVSKSTGCKYECLKLGDNDYCLRECKQQYGKSSGGYCYAFACWCTHLYEQAVVWPLPNKTCN-CONH2 Theoretical pI/Mw: 8.15 / 7546.61

HisrCssII MRGSHHHHHHGSIEGRKEGYLVSKSTGCKYECLKLGDNDYCLRECKQQYGKSSGGYCYAFACWCTHLYEQAVVWPLPNKTCN-CO2H Theoretical pI/Mw: 8.43 / 9400.62

rCssII

KEGYLVSKSTGCKYECLKLGDNDYCLRECKQQYGKSSGGYCYAFACWCTHLYEQAVVWPLPNKTCN-CO2H Theoretical pI/Mw: 8.15 / 7546.61

rCssIIE15R

KEGYLVSKSTGCKYRCLKLGDNDYCLRECKQQYGKSSGGYCYAFACWCTHLYEQAVVWPLPNKTCN-CO2H Theoretical pI/Mw: 8.65 / 7573.69

HisrCssIIIE15R MRGSHHHHHHGSIEGRKEGYLVSKSTGCKYRCLKLGDNDYCLRECKQQYGKSSGGYCYAFACWCTHLYEQAVVWPLPNKTCN-CO2H Theoretical pI/Mw: 8.82 / 9427.69

Separación de proteinas con diferente pI rCssII-CO2H, nCssII-CONH2 y 6HisrCssII-CO2H rCssIIE15R-CO2H y 6HisrCssII-CO2H©

1. 2.

VOLÚMEN HIDRODINÁMICO

Cromatografía de permeación en gel

Voet Biochemistry 3e © 2004 John Wiley & Sons, Inc.

Voet Biochemistry 3e Page 138 © 2004 John Wiley & Sons, Inc.

Masa molecular de varias proteínas

HIDROFOBICIDAD

Cromatografía de interacción hidrofóbica

Fase reversa- elución con solvente no-polar

Voet Biochemistry 3e © 2004 John Wiley & Sons, Inc.

elución con solvente polar

ESPECIFICIDAD

Voet Biochemistry 3e Page 139 © 2004 John Wiley & Sons, Inc.

Cromatografia de afinidad

INSTRUMENTACIÓN

High Performance Liquid Chromatography System

Equipos de purificación

REPORTE DE UNA PURIFICACIÓN

Voet Biochemistry 3e © 2004 John Wiley & Sons, Inc.

ANÁLISIS

Electroforésis en líquido y en papel

Voet Biochemistry 3e Page 147 © 2004 John Wiley & Sons, Inc.

Electroforésis en gel

Voet Biochemistry 3e Page 146 © 2004 John Wiley & Sons, Inc.

Electroforesis en gel

Electroforesis en gel de poliacrilamida (PAGE)

SDS-PAGE
[CH3-(CH2)10-CH2-O-SO3 ]Na+
DOCECIL SULFATO DE SODIO (SDS)

Formula general de ampholytes para separación por punto isoeléctrico

Isoelectric focusing

Voet Biochemistry 3e Page 150 © 2004 John Wiley & Sons, Inc.

Voet Biochemistry 3e Page 150 © 2004 John Wiley & Sons, Inc.

Two-dimensional (2D) gel electrophoresis

Voet Biochemistry 3e Page 148 © 2004 John Wiley & Sons, Inc.

Immunoblot

Determinación de proteína

1) UV absorbancia (Coeficientes de extinción)

2) Colorimétricos (Biuret, BCA, Bradford)

3) Enzimáticos (ELISA-proteínas específicas)

Voet Biochemistry 3e © 2004 John Wiley & Sons, Inc.

4) Otros

Voet Biochemistry 3e © 2004 John Wiley & Sons, Inc.

Espectro de absorbancia UV de aminoácidos aromáticos

BIURET o de LOWRY. Complejo coloreado de cobre con el enlace peptídico

BRADFORD Se basa en la unión de un colorante, Comassie Blue G-250 Las lecturas se realizan a longitudes de onda 400-560 nm

Voet Biochemistry 3e © 2004 John Wiley & Sons, Inc.

BCA El ácido bicinconínico, sal sódica, es un compuesto capaz de formar un complejo púrpura intenso con iones Cu 1+ en medio alcalino.

Enzyme-Linked ImmunoSorbent Assay (ELISA) http://www.wiley.com/college/fob/quiz/quiz05/5-3.html

Voet Biochemistry 3e Page 130 © 2004 John Wiley & Sons, Inc.