Secuenciamiento de proteínas Número de cadenas polipeptídicas Separación de polipéptidos (reducción de S-S) Secuenciamiento del N-terminal Composición de aa Residuos N-terminal Residuos

C-terminal Hidrólisis Enzimática Espectrometría de masas Elucidación de puentes disulfuro Síntesis química

miércoles 17 de febrero de 2010

Voet Biochemistry 3e © 2004 John Wiley & Sons, Inc.

miércoles 17 de febrero de 2010
Voet Biochemistry 3e © 2004 John Wiley & Sons, Inc.

Estructura primaria de la Insulina

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 163 © 2004 John Wiley & Sons, Inc.

• Las cisteinas proveen estabilidad estructural a las proteinas

Oxidation

miércoles 17 de febrero de 2010

Voet Biochemistry 3e © 2004 John Wiley & Sons, Inc.

Reduction

miércoles 17 de febrero de 2010
Voet Biochemistry 3e © 2004 John Wiley & Sons, Inc.

Voet Biochemistry 3e Page 164 © 2004 John Wiley & Sons, Inc.

The reaction of dansyl chloride in end group analysis

miércoles 17 de febrero de 2010

miércoles 17 de febrero de 2010
Voet Biochemistry 3e © 2004 John Wiley & Sons, Inc.

Voet Biochemistry 3e Page 165 © 2004 John Wiley & Sons, Inc.

Degradación de Edman
http://www.wiley.com/college/fob/quiz/quiz05/5-15.html

miércoles 17 de febrero de 2010

Secuenciador de amino ácidos

miércoles 17 de febrero de 2010

miércoles 17 de febrero de 2010

miércoles 17 de febrero de 2010
Voet Biochemistry 3e © 2004 John Wiley & Sons, Inc.

miércoles 17 de febrero de 2010
Voet Biochemistry 3e Page 169 © 2004 John Wiley & Sons, Inc.

Análisis de Amino ácidos

PaluIT1-GCLGEGEKCADWSGPSCCDGFYCSCRSMPYCRCRNNS
miércoles 17 de febrero de 2010

Hidrólisis enzimática

Residuos C-terminal (Exopeptidases)

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 166 © 2004 John Wiley & Sons, Inc.

Voet Biochemistry 3e Page 165 © 2004 John Wiley & Sons, Inc.

The hypothetical rate of the carboxypeptidase-catalyzed release of amino acids. (a) All bonds cleaved at the same rate.

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 165 © 2004 John Wiley & Sons, Inc.

The hypothetical rate of the carboxypeptidase-catalyzed release of amino acids. (b) Ser slow, Tyr fast, and Leu intermediate

miércoles 17 de febrero de 2010

Residuos N-terminal (Endopeptidases)

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 168 © 2004 John Wiley & Sons, Inc.

Hidrólisis con CNBr

Voet Biochemistry 3e Page 171 © 2004 John Wiley & Sons, Inc.

http://www.wiley.com/college/fob/quiz/quiz05/5-16.html

miércoles 17 de febrero de 2010

Espectrometría de masas

Voet Biochemistry 3e Page 172 © 2004 John Wiley & Sons, Inc.

Matrix-assisted laser desorption/ionization (MALDI).

miércoles 17 de febrero de 2010

Espectrometría de masas

Voet Biochemistry 3e Page 172 © 2004 John Wiley & Sons, Inc.

Electrospray ionization (ESI).

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 173 © 2004 John Wiley & Sons, Inc.

The ESI-MS spectrum of the 16,951-D horse heart protein apomyoglobin.

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 174 © 2004 John Wiley & Sons, Inc.

The use of a tandem mass spectrometer (MS/MS) in amino acid sequencing

miércoles 17 de febrero de 2010

AA sequencing using Post Source Decay MALDI has in principle been possible for many years, but has not been much used due to difficult interpretation.

Voet Biochemistry 3e © 2004 John Wiley & Sons, Inc.

a, b and c fragments carry the charge at the N-terminus x, y and z fragments carry the charge at the C-terminus

miércoles 17 de febrero de 2010

To make life even more complicated, many of the six ion-types possess ”clones”:

Voet Biochemistry 3e © 2004 John Wiley & Sons, Inc.

It takes a long experience or a bright software to interprete a standard PSD spectrum!

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 174 © 2004 John Wiley & Sons, Inc.

The tandem mass spectrum of the doubly charged ion of the 14-residue human [Glu1]fibrinopeptide B

miércoles 17 de febrero de 2010

Tandem-MALDI

miércoles 17 de febrero de 2010

Separación del veneno de C. suffusus suffusus
Abs 280 nm

C.s. suffusus
Zona de CssF54

0

60

min

CssF54 FFGSLLSLGSKLLPSVFKLFQ... MW: 2,869.9 (Avg)

miércoles 17 de febrero de 2010

C. suffusus suffusus protein fraction 54

mAU 120

Digestión enzimática con Lys-C

100

80 m/z 803.62 m/z 948.74 m/z 691.73

m/z 1156.03

Css54 MWexp. 2869.4 N-terminal FFGSLLSLGSKLLPSVFKLFQ..XX. 1156.03+803.62+948.74=2,908.39 2908.39-(18)-(18)=2872.39 2872.39-(m/z,3)=2869.39 ---------------------m/z=948-691=257 [=] (Q/K)E, E(Q/K) RT, TR WA, AW min

60

40

20

0 10 20 30 40 50

miércoles 17 de febrero de 2010

5 x10
491.491

1.50

FFGSLLSLGSK

1.25

1.00

0.75

404.438

b

---
295.14
352.16
439.19
552.28
665.36
752.39
865.48
922.50
1009.53
---

y
1
2
3
4
5
6
7
8
9
10
11

F
F
G
S
L
L
S
L
G
S
K

yion
11
10
9
8
7
6
5
4
3
2
1
--1008.57 861.50 804.48 717.45 604.36 491.28 404.25 291.16 234.14 147.11
861.802

0.50
439.402 524.516 552.514 717.706

291.311

604.592

637.620

734.652

507.482

234.243 258.270

473.478

314.341

587.551

86.185 120.183

700.654

847.757

147.208

791.651

819.766

922.816

0.00 200 400 600 800 1000 1200
m/z

miércoles 17 de febrero de 2010

991.868

1138.027

0.25
201.217

345.340 371.384

421.386

665.595

1008.949

804.769

1156.037

bion

5 x10 2.0

577.

I

LLPSVFK
b

1.5

y

1
2
3
4
5
6
7

L
L
P
S
V
F
K

7
6
5
4
3
2
1

--690.41 577.33 480.28 393.24 294.18 147.11

---
227.17
324.22
411.26
510.32
1.0 657.39
---

294.242

0.5

266.209

393.325

667.177

227.227

185.148

431.301

256.225

411.333

474.262

492.402

520.222

147.162

202.164

324.281

129.158

0.0 100 200 300 400 500 600 700 800 900
m/z

miércoles 17 de febrero de 2010

70.119

167.130

379.278

544.378

690.596

803.627

5 x10
948.748

Analisis de MS/MS del fragmento m/z 948.74
1.5

FFGSLLSLGSKLLPSVFK LFQ…RK(K/Q)E
b y

--1.0

Intens. [a.u.]

261.1598 389.2183 545.3194
129.166

673.4144 801.5094
0.5
101.142

545.377 562.426

233.223

84.147 112.157

378.281

404.314 415.272

257.250

---

1 7 2 835.4785 3 688.4100 4 560.3515 5 404.2504 6 276.1554 7 148.0604
268.219 208.194

L --F Q R K K E

6 5 4 3 2 1
801.660 517.383 654.453 690.555

157.163

285.227

835.656

819.682

703.463

614.452

784.586

0.0 200 400 600 800 1000
m/z

miércoles 17 de febrero de 2010

889.689

913.791 933.060

Francia

Tiempos de retención en fase reversa del péptido nativo Css54 y los péptidos sintéticos sCss54-KKE y sCss54-QKE
Sintesis química Css54-KQE Css54-KKE FFGSLLSLGSKLLPSVFK LFQ…RKQE FFGSLLSLGSKLLPSVFK LFQ…RKKE CMI<10 ug CMI<10 ug

mAU

80

nCss54 sCss54-KQE sCss54-KKE

60

40

20

0

FFGSLLSLGSKLLPSVFKLFQRKKE
0 5 10 15 20 min

miércoles 17 de febrero de 2010

Gel PAGE-SDS-Isoelectric Focusing

Voet Biochemistry 3e Page 175 © 2004 John Wiley & Sons, Inc.

Hemoglobina

miércoles 17 de febrero de 2010

miércoles 17 de febrero de 2010
Voet Biochemistry 3e Page 175 © 2004 John Wiley & Sons, Inc.

Hemoglobina

General flow for proteomics analysis

miércoles 17 de febrero de 2010

IDENTIFICATIO N

SEPARATION

Espectrometro de masas

miércoles 17 de febrero de 2010

miércoles 17 de febrero de 2010

miércoles 17 de febrero de 2010

Sintesis química de proteinas

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 204 © 2004 John Wiley & Sons, Inc.

BOC(tert)-(B)utyl (O)xy (C)arbonyl FMOC (F)luorenyl-(M)eth(O)xy-(C)arbonyl

Voet Biochemistry 3e Page 206 © 2004 John Wiley & Sons, Inc.

A selection of amino acids with benzyl-protected side chains and a Boc-protected α-amino acid group.

miércoles 17 de febrero de 2010

Evolución de proteínas

Voet Biochemistry 3e Page 187 © 2004 John Wiley & Sons, Inc.

Phylogenic tree of cytochrome c

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 188 © 2004 John Wiley & Sons, Inc.

Rates of evolution of four unrelated proteins

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 189 © 2004 John Wiley & Sons, Inc.

A phylogenetic tree for cytochrome c

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 191 © 2004 John Wiley & Sons, Inc.

Phylogenetic tree of the globin family

miércoles 17 de febrero de 2010

Genetic Defect in Sickle Cell Anemia

miércoles 17 de febrero de 2010

Voet Biochemistry 3e © 2004 John Wiley & Sons, Inc.

• Change is in beta chain of hemoglobin • Protein sequence changed from Glu to Val at position 6 Homozygous patients have sickle cell anemia

Voet Biochemistry 3e Page 183 © 2004 John Wiley & Sons, Inc.

Scanning electron microscope of human erythrocytes. (a) Normal human erythrocytes revealing their biconcave disklike shape

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 183 © 2004 John Wiley & Sons, Inc.

Scanning electron microscope of human erythrocytes. (b) Sickled erythrocytes from an individual with sickle-cell anemia

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 184 © 2004 John Wiley & Sons, Inc.

A map indicating the regions of the world where malaria caused by P. falciparum was prevalent before 1930.

miércoles 17 de febrero de 2010