Estructura de Proteínas

Enlace peptídico

miércoles 17 de febrero de 2010

Aprox. 59,000

NMR (8, 000) X-Rayos (>50, 000) Microscopia eléctronica (250)

Agosto 18, 2009
miércoles 17 de febrero de 2010

Jerarquía estructural en proteinas

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 162 © 2004 John Wiley & Sons, Inc.

psi (Ψ ) phi (Φ )

Voet Biochemistry 3e Page 220 © 2004 John Wiley & Sons, Inc.

Conformación Trans

miércoles 17 de febrero de 2010

miércoles 17 de febrero de 2010
Voet Biochemistry 3e Page 220 © 2004 John Wiley & Sons, Inc.

Conformación Cis

Voet Biochemistry 3e Page 221 © 2004 John Wiley & Sons, Inc.

La Interferencia Estérica genera mas conformaciones trans

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 222 © 2004 John Wiley & Sons, Inc.

Probabilidad de ángulos en proteínas

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 223 © 2004 John Wiley & Sons, Inc.

Diagrama de Ramachandran para los residuos de Gly

miércoles 17 de febrero de 2010

Estructura secundaria Las estructuras secundarias son originadas por la existencia de una gran cantidad de puentes de Hidrógeno. La importancia de los puentes de Hidrógeno es; -Neutralizar dipolos en regiones densas -Proveer de estabilidad y rigidez a la proteína - Los aminoácidos tienen tendencias a formar estructuras secundarias (Gly, Pro, Val).

miércoles 17 de febrero de 2010

La hélice alfa (3.6) -Estructura secundaria en espiral de las proteínas estabilizadas por puentes de hidrógeno entre los enlaces peptídicos de cada cuatro aminoácidos. Características esenciales -Angulos de torsión Φ (phi) = -57° ; Ψ (psi) = -47° -Hélice derecha, pitch (distancia) = 5.4 Å -Puentes de hidrógeno fuertes -C=O……..H-N ~ 2.8 Å -Cn=O ……H-Nn+4 -Distancia media es de 10 residuos ~ 15 Å -Distancia mínima es de 4 residuos -Distancia maxima es de 40 residuos -3.6 residuos por turno/vuelta
miércoles 17 de febrero de 2010

miércoles 17 de febrero de 2010
Voet Biochemistry 3e Page 223 © 2004 John Wiley & Sons, Inc.

Ejemplos de hélices

Estructura secundaria α Helice

H-bond

miércoles 17 de febrero de 2010

Voet Biochemistry 3e Page 224 © 2004 John Wiley & Sons, Inc.

α hélice
http://www.wiley.com/college/fob/quiz/quiz06/6-8.html

miércoles 17 de febrero de 2010

miércoles 17 de febrero de 2010
Voet Biochemistry 3e Page 227 © 2004 John Wiley & Sons, Inc.

Hélice de prolina

Importancia de las alfa-hélices -Alpha-hélices Hidrofóbicas o Hidrofílicas -Dan estabilidad a las proteínas -Caracter polar y no-polar (anfipáticas) -Pasan a través de las membranes lipídicas -Elementos de proteínas globulares y fibrosas

La secuencia primaria dicta la formación de una estructura secundarias tipo alfa o tipo beta.

miércoles 17 de febrero de 2010

Ejemplos de alfa-hélices- Segmentos transmembranales en canales ionicos

Sato et al. Nature, 2001

Catterall, Nature, 2001
miércoles 17 de febrero de 2010

Péptidos antibióticos Edmunson wheel

Vista lateral

Formación de poros en membranas lipídicas

miércoles 17 de febrero de 2010

Estructura beta plegada Estructura secundaria en capas de las proteínas, estabilizada por puentes de hidrógeno de lado a lado entre enlaces peptídicos ubicados en diferentes cadenas o partes de una cadena Características esenciales -C=O ……H-N en cadenas situadas ~ 5 Å -Estructura beta paralela (dos cadenas de N->C) -Estructura beta antiparalela (dos cadenas N->C, C->N) C C C N

N
miércoles 17 de febrero de 2010

N

N

C

Tipos de hojas beta

miércoles 17 de febrero de 2010

Representación molecular de hojas beta Angulos de torsión Φ(phi) = -139° Ψ(psi) = +135°

Angulos de torsión Φ(phi) = -119° Ψ (psi) = +113°

miércoles 17 de febrero de 2010

Hojas beta antiparalela mostrando las distancias de los puentes de Hidrógeno

miércoles 17 de febrero de 2010

Ejemplo: Toxinas de invertebrados especialmente de Caracoles marinos y Arañas

miércoles 17 de febrero de 2010

Otras estructuras secundarias Hélice derecha 2.27 -Angulos de torsión Φ (phi) = -78° ; Ψ (psi) = +59° ; pitch= 4 Å Hélice derecha 310 -Angulos de torsión Φ (phi) = -49° ; Ψ (psi) = -26° ; pitch= 6 Å Hélice derecha π ó 4.416 -Angulos de torsión Φ (phi) = -57° ; Ψ (psi) = -70° ; pitch= 5.2 Å Dobleces β tipo I , I` Dobleces β tipo II, II` -Todos conectan las cadenas antiparalelas β

miércoles 17 de febrero de 2010

70% estabilizados por COi…HNi+3 Tipo I puede estar adicional mente estabilizado por ROi….HNi+3 Pro es el residuo mas comun en i+1

miércoles 17 de febrero de 2010

Imagenes en el espejo de estructuras Tipo I y Tipo II Estructuras Tipo I` y Tipo II`` requieren un aa con valor Φ positivo el cual favorece a Gly en posicion 1 = i+1

miércoles 17 de febrero de 2010

Determinación de estructuras secundarias

Experimental: Dicroismo circular (basado en absorción uv de las proteínas) Rayos infrarojos (proteína en estado sólido) Teórica: (basada en datos experimentales; Chou & Fasman, 1978) -Propensidad de aminoácidos a formar hélices o cadenas plegadas

miércoles 17 de febrero de 2010

Dicroismo circular de estructuras secundarias puras

miércoles 17 de febrero de 2010

Magainin1 (PBS) sPin1 (PBS) sPin2 (PBS) Delta Epsilon (cm-1M-1)
15.0000 2.5000 -10.0000 -22.5000 -35.0000 178 188 198 208 218 228 238 248 258

Antibióticos peptídicos

Wavelength (nm) Magainin1 (TFE) sPin1 (TFE) sPin2 (TFE) Delta Epsilon (cm-1M-1)
60.0000 35.0000 10.0000 -15.0000 -40.0000 178 188 198 208 218 228 238 248 258

Wavelength (nm)

Magainin1 (PBS+DPC) Pin1 (PBS+DPC) Pin2 (PBS+DPC)

Delta Epsilon (cm-1M-1)

40.0000 25.0000 10.0000 -5.0000 -20.0000 178 188 198 208 218 228 238 248 258

Wavelength (nm)

miércoles 17 de febrero de 2010

Probabilidad de amino ácidos de encontrarse en alpha-helice o cadena beta (Chou and Fasman, 1978)
--------------------------------------Name P(H) P(E) P(turn) --------------------------------------Alanine 142 83 66 Arginine 98 93 95 Aspartic Acid 101 54 146 Asparagine 67 89 156 Cysteine 70 119 119 Glutamic Acid 151 037 74 Glutamine 111 110 98 Glycine 57 75 156 Histidine 100 87 95 Isoleucine 108 160 47 Leucine 121 130 59 Lysine 114 74 101 Methionine 145 105 60 Phenylalanine 113 138 60 Proline 57 55 152 Serine 77 75 143 Threonine 83 119 96 Tryptophan 108 137 96 Tyrosine 69 147 114 Valine 106 170 50 ----------------------------------------

Si el promedio de 4 amino acidos: P(H) > 100 - α helice P(E) > 100 - cadena β Si el promedio de 2 amino acidos P(turn) > 100 - turno, dobles, vuelta

miércoles 17 de febrero de 2010

Ribbon and Topology Diagrams Representations of Secondary Structures

miércoles 17 de febrero de 2010

Ribbon and Topology Diagrams Representations of Secondary Structures

Sheets (arrows), Helices (cylinders)

miércoles 17 de febrero de 2010

Estructura terciaria

miércoles 17 de febrero de 2010

Estructura terciaria
 Interacciones electrostáticas

miércoles 17 de febrero de 2010

Estructura terciaria
 Interacciones electrostáticas  Puentes de hidrógeno (O→H, N→ H, S → H)

miércoles 17 de febrero de 2010

Estructura terciaria
 Interacciones electrostáticas  Puentes de hidrógeno (O→H, N→ H, S → H)  Interacciones hidrofóbicas

miércoles 17 de febrero de 2010

Estructura terciaria
 Interacciones electrostáticas  Puentes de hidrógeno (O→H, N→ H, S → H)  Interacciones hidrofóbicas Las proteínas se pliegan

miércoles 17 de febrero de 2010

Estructura terciaria
 Interacciones electrostáticas  Puentes de hidrógeno (O→H, N→ H, S → H)  Interacciones hidrofóbicas Las proteínas se pliegan  Dirigidas esencialmente por su relación de aa hidrofílicos/hidrofóbicos

miércoles 17 de febrero de 2010

Estructura terciaria
 Interacciones electrostáticas  Puentes de hidrógeno (O→H, N→ H, S → H)  Interacciones hidrofóbicas Las proteínas se pliegan  Dirigidas esencialmente por su relación de aa hidrofílicos/hidrofóbicos  Las cadenas laterales se distribuyen entre el exterior y el interior

miércoles 17 de febrero de 2010

Estructura terciaria
 Interacciones electrostáticas  Puentes de hidrógeno (O→H, N→ H, S → H)  Interacciones hidrofóbicas Las proteínas se pliegan  Dirigidas esencialmente por su relación de aa hidrofílicos/hidrofóbicos  Las cadenas laterales se distribuyen entre el exterior y el interior  Existen interacciones interiores y exteriores

miércoles 17 de febrero de 2010

Estructura terciaria
I. Interacciones iónicas (exterior) Entre dos grupos cargados: ! 1 Negativo – Glu,Asp 1 Positivo – Lys,Arg,His    Tambien llamados “puentes salinos”.  Son dependientes del pH (pKa).  Ocurren en el exterior  NOTA: pKs en el interior de una proteína tal vez muy diferente al del interior.

miércoles 17 de febrero de 2010

II. Puentes de hidrógeno (interior y exterior) Formados entre las cadenas laterales/esqueleto peptídico/agua: Grupos laterales cargados: Glu,Asp,His,Lys,Arg Grupos polares: Ser,Thr,Cys,Asn,Gln,Tyr,Trp

miércoles 17 de febrero de 2010

III. Interacciones hidrofóbicas (interior) Formadas entre grupos laterales de residuos no-polares: ! ! Alifáticos (Ala,Val,Leu,Ile,Pro,Met) Aromáticos (Phe,Trp,Tyr)

 Agregados de grupos nopolares - estos agregados no requieren orientacion como en el caso de puentes de hidrógeno  Ocurren en el interior y alejados del agua  No son dependientes de pH

miércoles 17 de febrero de 2010

IV. Puentes disulfuro (interior y exterior) Formados entre residuos Cys: ! Cys-SH + HS-Cys → Cys-S-S-Cys

 Catalizados por enzimas o agentes oxidantes  Restringe la flexibilidad de las proteínas

miércoles 17 de febrero de 2010

Dentro de las proteinas plegadas existen pocas moléculas de agua Es decir casi anhidro. Densidad de empaquetamiento -Termino usado para describir la efectividad del arreglo molecular -Residuos Phe, Leu, Ile, Val y Met tienden a estar dentro de la proteína, al igual los enlaces Cys. -Los amino ácidos cargados Arg, Lys, His, Glu and Asp tienden a estar expuestos en la superficie.

miércoles 17 de febrero de 2010

Plegamiento de proteínas
El plegamiento es determinado por la secuencia primaria  Reacción reversible  Mutaciones pueden crear patrones de plegamiento diferente.

El efecto hidrófobico dirige mayormente el plegamiento
Otras interacciones dan fuerza al plegamiento  Puentes hidrógeno  Interacciones electrostaticas  Puentes disulfuro, iones metálicos
miércoles 17 de febrero de 2010

miércoles 17 de febrero de 2010

Random folding has too many possibilities

miércoles 17 de febrero de 2010

Random folding has too many possibilities • Backbone restricted but side chains not

miércoles 17 de febrero de 2010

Random folding has too many possibilities • Backbone restricted but side chains not • A 100 residue protein would require 1087 s to search all conformations (age of universe < 1018 s)

miércoles 17 de febrero de 2010

Random folding has too many possibilities • Backbone restricted but side chains not • A 100 residue protein would require 1087 s to search all conformations (age of universe < 1018 s) • Most proteins fold in less than 10 s!!

miércoles 17 de febrero de 2010

Random folding has too many possibilities • Backbone restricted but side chains not • A 100 residue protein would require 1087 s to search all conformations (age of universe < 1018 s) • Most proteins fold in less than 10 s!!

Proteins must fold along specific pathways!!

miércoles 17 de febrero de 2010

Rutas de plegamiento

miércoles 17 de febrero de 2010

Rutas de plegamiento
Eventos del plegamiento

miércoles 17 de febrero de 2010

Rutas de plegamiento
Eventos del plegamiento  Estructuras secundarias se forman rapidamente

miércoles 17 de febrero de 2010

Rutas de plegamiento
Eventos del plegamiento  Estructuras secundarias se forman rapidamente  Estructuras secundarias se agrupan para formar dominios estructurales

miércoles 17 de febrero de 2010

Rutas de plegamiento
Eventos del plegamiento  Estructuras secundarias se forman rapidamente  Estructuras secundarias se agrupan para formar dominios estructurales  Colapso hidrofóbico para generar dominios estructurales

miércoles 17 de febrero de 2010

Rutas de plegamiento
Eventos del plegamiento  Estructuras secundarias se forman rapidamente  Estructuras secundarias se agrupan para formar dominios estructurales  Colapso hidrofóbico para generar dominios estructurales  Agrupación de dominios

miércoles 17 de febrero de 2010

Rutas de plegamiento
Eventos del plegamiento  Estructuras secundarias se forman rapidamente  Estructuras secundarias se agrupan para formar dominios estructurales  Colapso hidrofóbico para generar dominios estructurales  Agrupación de dominios Chaperonas ayudan al plegamiento in-vivo

miércoles 17 de febrero de 2010

Rutas de plegamiento
Eventos del plegamiento  Estructuras secundarias se forman rapidamente  Estructuras secundarias se agrupan para formar dominios estructurales  Colapso hidrofóbico para generar dominios estructurales  Agrupación de dominios Chaperonas ayudan al plegamiento in-vivo  Proteinas complejas con multidominios

miércoles 17 de febrero de 2010

Rutas de plegamiento
Eventos del plegamiento  Estructuras secundarias se forman rapidamente  Estructuras secundarias se agrupan para formar dominios estructurales  Colapso hidrofóbico para generar dominios estructurales  Agrupación de dominios Chaperonas ayudan al plegamiento in-vivo  Proteinas complejas con multidominios  Ambiente intracelular es rico en interacciones moleculares, en donde las chaperonas secuestran a las proteínas y permiten su plegamiento.
miércoles 17 de febrero de 2010

Plegamiento progresivo de proteínas

Protein Folding Funnel

miércoles 17 de febrero de 2010

Plegamiento in vitro de 3 proteínas
CssII! Magi4! Ts1! KEGYLVSKSTGCKYECLKLGDNDYCLRECKQQYGKSSGGYCYAFACWCTHLYEQAVVWPLPNKTCN CGSKRAWCKEKKDCCCGYNCVYAWYNQQSSCERKWKYLFTGEC DHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC

HisrMagi4 (oxydized)

HisrMagi4 (reduced)

HisrTs1(reduced) HisrCssII (reduced)

HisrTs1 (oxydized)

HisrCssII (oxydized)

Gina

miércoles 17 de febrero de 2010

Plegamiento de variantes de discrepina

Peptide Discrepin Aa1 BmTx3

Amino acid sequence ZIDTNVKCSGSSKCVKICIDRYNTRGAKCINGRCTCYP ZNETNKKCQGGS-CASVCRRVIGVAAGKCINGRCVCYP ZVETNVKCQGGS-CASVCRKAIGVAAGKCINGRCVCYP

Similarity (%) 100 48 51

Discrepin [Del13]
mAU 160 140 40 30 120 100 80 20 10 0 0 Corzo 5 10 15 20 25 min 60 40 20 0 0

Discrepin [V6K,D20K]

mAU

5

10

15

20

25

min

miércoles 17 de febrero de 2010

Tipos estructurales de proteínas
• Receptores- sensación de estímulos, e.g.neuronas • Canales membranales- controlan el interior de las células • • • • • • Transporte- e.g. hemoglobina Almacenamiento- e.g. ferritina en hígado Enzimas- catalisis Función celular- multiméricas Estructurales- collageno Respuesta inmmune - anticuerpos

miércoles 17 de febrero de 2010

Tipos estructurales de proteínas
1. Proteínas globulares (enzimas)  Variedad de estructuras secundarias  Forma casi esférica  Solubles en agua  Funciones dinámicas (e.g. catálisis, regulación, transporte)

miércoles 17 de febrero de 2010

Proteínas globulares

Hemoglobin α

Conconavalin A

Triose Phosphate isomerase

V/V/P- Figure 6.27
miércoles 17 de febrero de 2010

Tipos estructurales de proteínas
2. Proteínas fibrosas (proteínas de citoesqueleto)  Una estructura secundaria dominante  Estructura elongada  Poca solubilidad en agua  Función estructural (e.g. citoesqueleto, hueso, piel)

miércoles 17 de febrero de 2010

Colágeno: Proteína fibrosa
Triple Helix

Stabilizing Inter-strand H-bonds

Gly-Pro-Pro Repeat
V/V/P- Figures 6.17/18
miércoles 17 de febrero de 2010

Tipos estructurales de proteínas
3. Proteínas de membrana (receptores, canales)  Insertados en membranas  Dominios para expander la membrana y dominios extracelulares  Poca solubilidad en agua  Función en comunicación celular (e.g. señalización celular, transporte)

miércoles 17 de febrero de 2010

Citocromo C

Extracellular

Membranespanning Intracellular (cytoplasmic)
B/T Figure 13.6
miércoles 17 de febrero de 2010

Determinantes de la superficie molecular

miércoles 17 de febrero de 2010

Determinantes de la superficie molecular
La función de una proteína requiere aa con propiedades particulares

miércoles 17 de febrero de 2010

Determinantes de la superficie molecular
La función de una proteína requiere aa con propiedades particulares  No todos los aa son útiles

miércoles 17 de febrero de 2010

Determinantes de la superficie molecular
La función de una proteína requiere aa con propiedades particulares  No todos los aa son útiles  AA abundantes: Leu, Ala, Gly, Ser, Val, Glu, His

miércoles 17 de febrero de 2010

Determinantes de la superficie molecular
La función de una proteína requiere aa con propiedades particulares  No todos los aa son útiles  AA abundantes: Leu, Ala, Gly, Ser, Val, Glu, His  AA raros: Trp, Cys, Met

miércoles 17 de febrero de 2010

Los aa en la superfice determinan con que receptores interaccionan
1. Acceso Estérico 2. Forma 3. Superficie hidrofóbica 4. Superficie electroestática

miércoles 17 de febrero de 2010

Superficie molecular que pudiera reconocer el canal de sodio en insectos
Bogan and Thorn. J Mol Biol. 1998

miércoles 17 de febrero de 2010

Estructura cuaternaria

miércoles 17 de febrero de 2010

Estructura cuaternaria
Definición: Asociación de cadenas polipeptídicas

miércoles 17 de febrero de 2010

Estructura cuaternaria
Definición: Asociación de cadenas polipeptídicas  Interacciones Electroestáticas

miércoles 17 de febrero de 2010

Estructura cuaternaria
Definición: Asociación de cadenas polipeptídicas  Interacciones Electroestáticas  Puentes de Hidrógeno (O→H, N→ H, S → H)

miércoles 17 de febrero de 2010

Estructura cuaternaria
Definición: Asociación de cadenas polipeptídicas  Interacciones Electroestáticas  Puentes de Hidrógeno (O→H, N→ H, S → H)  Interacciones Hidrofóbicas

miércoles 17 de febrero de 2010

Estructura cuaternaria
Definición: Asociación de cadenas polipeptídicas  Interacciones Electroestáticas  Puentes de Hidrógeno (O→H, N→ H, S → H)  Interacciones Hidrofóbicas  Puentes disulfuro (no frecuente)

miércoles 17 de febrero de 2010

Estructura cuaternaria

The classic example- hemoglobin α2-β2

miércoles 17 de febrero de 2010

miércoles 17 de febrero de 2010