You are on page 1of 274

Dhollera Speecial Invvestmen

nt Region
nal Devvelopmen
nt Auth
hority

AL DE
EVELO
OPMEN
NT PL
LAN DSIRD
D
DA
FINA
REPO
ORT 2
GENE
ERAL DEVELO
D
OPMEN
NT CONT
TROL REGULA
R
ATIONS
S

SAN
NCTION
NED BY APE
EX AUT
THORIITY (G
GIDB) ON
O

10TH SEPTE
EMBER
R, 20122 AND
D
CAM
ME INT
TO FOR
RCE ON
N 10THH SEPT
TEMBE
ER, 2012

DraftGeneralDevelopmentControlRegulations(DGDCR)
TableofContents
1.

Definitions..................................................................................................................................1
1.1.

Act...................................................................................................................................................1

1.2.

AdditionsAnd/OrAlterations........................................................................................................1

1.3.

AdvertisingSign/Hoarding..............................................................................................................1

1.4.

AgriculturalUse..............................................................................................................................1

1.5.

AirConditioning.............................................................................................................................1

1.6.

Amenities........................................................................................................................................1

1.7.

MultistoreyApartmentsorFlats...................................................................................................2

1.8.

Atrium(pluralatria)........................................................................................................................2

1.9.

AutomaticSprinklerSystem...........................................................................................................2

1.10.

BasementorCellar.....................................................................................................................2

1.11.

Building.......................................................................................................................................2

1.12.

BuildingLine...............................................................................................................................5

1.13.

BuildingUnit...............................................................................................................................5

1.14.

BuiltUpArea..............................................................................................................................5

1.15.

CompetentAuthority..................................................................................................................5

1.16.

Chimney......................................................................................................................................5

1.17.

Chhajja........................................................................................................................................5

1.18.

Chowk/Courtyard.....................................................................................................................5

1.19.

CombustibleMaterial.................................................................................................................5

1.20.

ContiguousHolding....................................................................................................................5

1.21.

Corridor.......................................................................................................................................6

1.22.

CommonPlot..............................................................................................................................6

1.23.

CRZ..............................................................................................................................................6

1.24.

CulDeSac...................................................................................................................................6

1.25.

Developer...................................................................................................................................6

1.26.

Dharmashala...............................................................................................................................6

1.27.

Drain...........................................................................................................................................6

1.28.

DwellingUnit..............................................................................................................................6

1.29.

EnclosedStaircase......................................................................................................................7

1.30.

ExistingBuilding..........................................................................................................................7

1.31.

ExistingUse.................................................................................................................................7

1.32.

Exit..............................................................................................................................................7

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

DraftGeneralDevelopmentControlRegulations(DGDCR)
1.33.

ExternalWall...............................................................................................................................7

1.34.

EscapeRoute..............................................................................................................................7

1.35.

FarmHouse.................................................................................................................................7

1.36.

Fireand/orEmergencyAlarmSystem........................................................................................7

1.37.

FireLift........................................................................................................................................7

1.38.

FireProofDoor...........................................................................................................................7

1.39.

FirePump....................................................................................................................................8

1.40.

FirePumpBoosterFirePump....................................................................................................8

1.41.

FireResistance............................................................................................................................8

1.42.

FireSeparation...........................................................................................................................8

1.43.

FireServiceInlet.........................................................................................................................8

1.44.

FireTower...................................................................................................................................8

1.45.

Floor............................................................................................................................................8

1.46.

FloorSpaceIndex(F.S.I.)............................................................................................................8

1.47.

FloorArea...................................................................................................................................9

1.48.

Front...........................................................................................................................................9

1.49.

Footing........................................................................................................................................9

1.50.

Foundation.................................................................................................................................9

1.51.

Gamtal(VillageSettlement).......................................................................................................9

1.52.

GroundCoverage........................................................................................................................9

1.53.

GroundLevel..............................................................................................................................9

1.54.

GaragePrivate............................................................................................................................9

1.55.

GaragePublic...........................................................................................................................10

1.56.

HabitableRoom........................................................................................................................10

1.57.

HazardousMaterial..................................................................................................................10

1.58.

HeightofBuilding.....................................................................................................................10

1.59.

HeightofaRoom......................................................................................................................10

1.60.

HeavyIndustry..........................................................................................................................10

1.61.

HomeOccupation.....................................................................................................................10

1.62.

Hotel.........................................................................................................................................11

1.63.

LightIndustry............................................................................................................................11

1.64.

Lift.............................................................................................................................................11

1.65.

Loft............................................................................................................................................11

1.66.

L.P.GasDeliveryCentre...........................................................................................................11

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

ii

DraftGeneralDevelopmentControlRegulations(DGDCR)
1.67.

Margin/Setback......................................................................................................................11

1.68.

MezzanineFloor.......................................................................................................................11

1.69.

MultiplexComplex....................................................................................................................11

1.70.

NeighbourhoodCentreandCivicCentre..................................................................................11

1.71.

NaturalHazard..........................................................................................................................12

1.72.

NaturalHazardProneAreas.....................................................................................................12

1.73.

NonCombustible......................................................................................................................12

1.74.

OccupancyorUse.....................................................................................................................12

1.75.

OpenSpace...............................................................................................................................12

1.76.

Owner.......................................................................................................................................12

1.77.

Parapet.....................................................................................................................................12

1.78.

ParkingSpace............................................................................................................................12

1.79.

Partition....................................................................................................................................12

1.80.

PercolationWell.......................................................................................................................12

1.81.

PermanentOpenAirSpace......................................................................................................13

1.82.

Permission................................................................................................................................13

1.83.

PetroleumProductsRetailOutlets...........................................................................................13

1.84.

Plinth.........................................................................................................................................13

1.85.

PlinthArea................................................................................................................................13

1.86.

Podium......................................................................................................................................13

1.87.

Porch.........................................................................................................................................13

1.88.

PublicPurpose..........................................................................................................................13

1.89.

Registered Architect / Engineer / Structural Designer, Clerk of Works, Site Supervisor,


Developer.................................................................................................................................14

1.90.

RetentionActivity.....................................................................................................................14

1.91.

ResidentialUse.........................................................................................................................14

1.92.

Road/Street.............................................................................................................................14

1.93.

Road/StreetLevelorGrade....................................................................................................14

1.94.

Road/StreetLine.....................................................................................................................15

1.95.

RoadWidthorWidthofRoad/Street..............................................................................15

1.96.

RightOfWay............................................................................................................................15

1.97.

Rules.........................................................................................................................................15

1.98.

Saltpan.....................................................................................................................................15

1.99.

SelfUseDevelopment..............................................................................................................15

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

iii

DraftGeneralDevelopmentControlRegulations(DGDCR)
1.100.

ServiceRoad.............................................................................................................................15

1.101.

SepticTank................................................................................................................................15

1.102.

Sewerage..................................................................................................................................15

1.103.

Sewage......................................................................................................................................16

1.104.

Sewer........................................................................................................................................16

1.105.

ShoppingCentreorCommercialCentre...................................................................................16

1.106.

ShoppingMall...........................................................................................................................16

1.107.

SmokeStopDoor......................................................................................................................16

1.108.

SolarPark..................................................................................................................................16

1.109.

StairCover................................................................................................................................16

1.110.

Storey........................................................................................................................................16

1.111.

StubStreet................................................................................................................................16

1.112.

Subdivisions..............................................................................................................................16

1.113.

Tenement.................................................................................................................................16

1.114.

TenementBuildingandOwnershipFlats.................................................................................17

1.115.

TravelDistance.........................................................................................................................17

1.116.

WaterCloset(W.C)...................................................................................................................17

1.117.

WaterCourse............................................................................................................................17

1.118.

WaterCourse,Major................................................................................................................17

1.119.

WaterHarvesting......................................................................................................................17

1.120.

WaterTanksorTalavorPondorLake......................................................................................17

1.121.

WarehouseorGodown............................................................................................................17

1.122.

Window....................................................................................................................................17

1.123.

WidthofaStreet......................................................................................................................17

2.

ProcedureforSecuringDevelopmentPermission.....................................................................18
2.1.

ApplicationforDevelopmentPermission.....................................................................................18

2.2.

ScrutinyFee..................................................................................................................................18

2.3.

FormsofApplication....................................................................................................................19

2.4.

GeneralNotationforPlan............................................................................................................22

2.5.

DocumentstobefurnishedwiththeApplication........................................................................22

2.6.

PlansandSpecificationstobepreparedbyRegisteredArchitect/Engineer..............................23

2.7.

RejectionofApplication...............................................................................................................23

2.8.

CancellationofPermission...........................................................................................................23

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

iv

DraftGeneralDevelopmentControlRegulations(DGDCR)
3.

GeneralRequirementsforDevelopment..................................................................................24
3.1.

Marginand/orSetback.................................................................................................................24

3.2.

DevelopmentoflandintheDevelopmentArea..........................................................................24

3.3.

DevelopmentWorktobeinConformitywiththeRegulations....................................................25

3.4.

Documentatsite..........................................................................................................................26

3.5.

Inspection.....................................................................................................................................26

3.6.

General.........................................................................................................................................26

4.

DecisionoftheAuthority..........................................................................................................28
4.1.

GrantorRefuseofthePermissionApplication............................................................................28

4.2.

SuspensionofPermission.............................................................................................................29

4.3.

GrantofDevelopmentPermission...............................................................................................29

4.4.

Liability..........................................................................................................................................30

4.5.

ResponsibilitiesoftheApplicant..................................................................................................30

4.6.

DevelopmentwithoutpriorLegitimatePermission.....................................................................30

4.7.

DeviationduringcourseofConstruction.....................................................................................30

5.

Inspection................................................................................................................................31
5.1.

GeneralRequirements..................................................................................................................31

5.2.

ProcedureduringConstruction....................................................................................................31

5.3.

OccupancyCertificate...................................................................................................................32

5.4.

IllegalOccupationofBuilding.......................................................................................................32

5.5.

IllegalDevelopment......................................................................................................................33

5.6.

DevelopmentwithoutPermission................................................................................................33

6.

OccupancyCertificate...............................................................................................................34
6.1.

ApplicationforOccupancy...........................................................................................................34

6.2.

IssueofOccupancyCertificate.....................................................................................................34

7.

DevelopmentUndertakenOnBehalfOfGovernment...............................................................35

8.

RegistrationsofProfessionals...................................................................................................36
8.1.

ApplicationforRegistration..........................................................................................................36

8.2.

RevocationofRegistration...........................................................................................................36

8.3.

Duties&Responsibilities..............................................................................................................36

8.4.

AppointmentofEmployees..........................................................................................................43

9.

GeneralDevelopmentandBuildingRequirements...................................................................44
9.1.

DevelopmentControl...................................................................................................................44

9.2.

OpenSpaces.................................................................................................................................44

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

DraftGeneralDevelopmentControlRegulations(DGDCR)
9.3.

Sustainability................................................................................................................................45

9.4.

MinimumPlotSizes......................................................................................................................45

9.5.

Parking..........................................................................................................................................46

9.6.

PlantationandMaintenanceofTrees..........................................................................................50

9.7.

DistancefromWaterCourse........................................................................................................51

9.8.

DrainageandFloodPrevention....................................................................................................52

9.9.

DesignforWindandSeismicLoads..............................................................................................53

9.10.

CompoundWallsandGates.....................................................................................................53

9.11.

GeneralBuildingRequirements................................................................................................54

9.12.

RecycleandReuseofWater.....................................................................................................64

10.

ZoningRegulations...................................................................................................................65

10.1.

Introduction..............................................................................................................................65

10.2.

ResidentialZone.......................................................................................................................67

10.3.

HighAccessCorridorZone........................................................................................................70

10.4.

CityCentreZone.......................................................................................................................74

10.5.

KnowledgeandITZone............................................................................................................78

10.6.

IndustrialZone..........................................................................................................................82

10.7.

LogisticZone.............................................................................................................................85

10.8.

VillageBufferZone...................................................................................................................87

10.9.

Recreation,SportsandEntertainmentZone............................................................................90

10.10.

GreenSpace.............................................................................................................................92

10.11.

AgricultureZone.......................................................................................................................92

10.12.

SolarParkZone.........................................................................................................................95

10.13.

Tourism&Resorts....................................................................................................................95

10.14.

StrategicInfrastructure............................................................................................................96

10.15.

PublicFacilitiesZone................................................................................................................97

11.

DevelopmentofLandandSubdivisionRegulations.................................................................99

11.1.

Scope........................................................................................................................................99

11.2.

GeneralRequirements..............................................................................................................99

11.3.

PlanRequirements.................................................................................................................100

11.4.

CommunityFacilitiesandOpenSpaces..................................................................................101

11.5.

DesignStandardsforStreets..................................................................................................101

11.6.

DesignStandardsforLots.......................................................................................................104

11.7.

CommonPlot..........................................................................................................................104

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

vi

DraftGeneralDevelopmentControlRegulations(DGDCR)
12.

DevelopmentofLowCostHousing.........................................................................................106

12.1.

Planning..................................................................................................................................106

12.2.

GeneralBuildingRequirements..............................................................................................106

12.3.

StructuralRequirements........................................................................................................107

12.4.

RoadsandPathWays.............................................................................................................107

12.5.

MinimumRequiredAccommodation.....................................................................................107

13.

FuelFillingandServiceStations..............................................................................................108

13.1.

Definitions..............................................................................................................................108

13.2.

RequirementsofFillingStationsandServiceStation.............................................................108

13.3.

TrafficRequirements..............................................................................................................108

13.4.

EntryandExitConsiderations.................................................................................................109

14. ControlofSigns(Hoardings)andOutdoorDisplayStructuresandPagingTowerandTelephone
TowerandOutdoorDisplayStructures..............................................................................................110
14.1.

Permission..............................................................................................................................110

14.2.

DesignandSize.......................................................................................................................110

14.3.

ProhibitedSigns......................................................................................................................110

14.4.

GeneralRestrictions...............................................................................................................110

14.5.

HoardingonRoof....................................................................................................................111

14.6.

WallSigns................................................................................................................................111

14.7.

ProjectingSigns......................................................................................................................112

14.8.

SignsInUrbanRenewalProjectAreas....................................................................................112

14.9.

HistoricBuildings....................................................................................................................112

14.10.

DepositandFees....................................................................................................................112

14.11.

TelecommunicationInfrastructure(Paging,CellularMobiles,VSat.,MTNLEtc.)...............112

14.12.

ControlSignBoard..................................................................................................................113

15.

Mining,QuarryingandBrickKiln............................................................................................114

16.

ApplicabilityofRegulations....................................................................................................115

16.1.

General...................................................................................................................................115

16.2.

AdditionorExtensiontoaBuilding........................................................................................115

16.3.

SafeguardAgainstReductionofOpenSpaces......................................................................115

16.4.

MaintenanceofBuildings.......................................................................................................115

17.

FacilitiesforPhysicallyHandicappedPersons.........................................................................117

17.1.

ShortTitle,Extent&Commencement...................................................................................117

17.2.

Definitions..............................................................................................................................117

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

vii

DraftGeneralDevelopmentControlRegulations(DGDCR)
17.3.

Scope......................................................................................................................................117

17.4.

SiteDevelopment...................................................................................................................117

17.5.

BuildingRequirements...........................................................................................................118

17.6.

ExplanatoryNotes..................................................................................................................121

18.

HeritageRegulations..............................................................................................................123

18.1.

Applicability............................................................................................................................123

18.2.

RestrictiononDevelopment/Redevelopment/RepairsEtc................................................123

18.3.

PreparationofListofHeritageBuildings,HeritagePrecinctsandListedNaturalFeatures...123

18.4.

PowertoAlter,ModifyorRelaxOtherGeneralDevelopmentControlRegulations.............124

18.5.

SpecialRegulationsforListedHeritagePrecincts..................................................................124

18.6.

ApplicabilityofDevelopmentProposalstoListedHeritageBuildingListedHeritagePrecincts..
................................................................................................................................................124

18.7.

IncentiveUsesforListedHeritageBuildings..........................................................................125

18.8.

CreationofNewIncentivesforHeritageConservation..........................................................125

18.9.

MaintainingSkylineandArchitecturalHarmony....................................................................125

18.10.

RestrictiveCovenants.............................................................................................................125

18.11.

GradingoftheListedHeritageBuildings/ListedHeritagePrecincts.....................................126

18.12.

Demolition/Reconstruction/Alteration...............................................................................127

18.13.

ExteriorDesignandHeightofBuildings.................................................................................127

18.14.

CompositionofHeritageConservationCommittee...............................................................127

18.15.

ProvisionofLetterBox...........................................................................................................129

18.16.......................................................................................................................................................129
19.

RegulationsforSpecialStructures..........................................................................................130

19.1.

GeneralRequirements............................................................................................................130

19.2.

Fireprotection:General.........................................................................................................133

19.3.

FireEscapeExits.....................................................................................................................133

19.4.

IndividualFireEscapeExitsatEachFloor...............................................................................134

19.5.

StructuralSafety:General......................................................................................................136

19.6.

BuildingServices.....................................................................................................................138

19.7.

CommunicationDevices.........................................................................................................138

19.8.

RenewableEnergyDevices.....................................................................................................139

20.

PollutionControl....................................................................................................................140

20.1.

General...................................................................................................................................140

20.2.

MeasurestoControlPollution...............................................................................................140

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

viii

DraftGeneralDevelopmentControlRegulations(DGDCR)
20.3.

Regulation...............................................................................................................................140

20.4.

Applicability............................................................................................................................140

21.

SupplementalandMiscellaneousProvisions..........................................................................141

21.1.

Interpretation.........................................................................................................................141

21.2.

DiscretionaryPowers..............................................................................................................141

21.3.

AppealCommittee..................................................................................................................141

22.

Penalties................................................................................................................................142

23.

Relaxation..............................................................................................................................143

23.1.

InCaseofPublicOwnership...................................................................................................143

23.2.

InCaseofPrivateOwnership.................................................................................................143

23.3.

InCaseofExistingBuildingUnits............................................................................................143

24.

RegulationsforResidentialTownship.....................................................................................144

24.1.

ShortTitle,ExtentandCommencement................................................................................144

24.2.

Applicability............................................................................................................................144

24.3.

Definition................................................................................................................................144

24.4.

DutiesofthePrescribedOfficer:............................................................................................145

24.5.

StateLevelScreeningCommittee:.........................................................................................146

24.6.

ProceduretoNotifyanyArea.................................................................................................146

24.7.

ProcedureforSecuringthePermission..................................................................................146

24.8.

ContentsoftheTownshipProposals......................................................................................146

24.9.

PublicPurposeInfrastructure.................................................................................................147

24.10.

Socially&EconomicallyWeakerSectionHousing(SEWH)andOtherInfrastructure............147

24.11.

PhysicalPlanningParameters;................................................................................................147

24.12.

ResponsibilitiesoftheTownshipDeveloper..........................................................................148

24.13.

Grant/RefusalofthePermission:.........................................................................................149

24.14.

FloorAreaRatio......................................................................................................................149

24.15.

BuiltUpAreaandHeight:.......................................................................................................149

24.16.

Zoning,GroundCoverage&OtherRegulations.....................................................................150

24.17.

DevelopmentofExternal(OffsiteInfrastructure)..................................................................150

24.18.

SupervisionandMonitoringOftheQualityofConstruction..................................................150

24.19.

GrievanceRedressal:..............................................................................................................150

25.

RegulationsfortheRehabilitationandRedevelopmentoftheSlums.....................................153

25.1.

ShortTitle,ExtentandCommencement................................................................................153

25.2.

Applicability............................................................................................................................153

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

ix

DraftGeneralDevelopmentControlRegulations(DGDCR)
25.3.

Definitions..............................................................................................................................153

25.4.

PrescribedAuthority...............................................................................................................155

25.5.

FunctionsoftheSlumRehabilitationCommittee(SRC).........................................................155

25.6.

NotificationoftheSlumArea.................................................................................................155

25.7.

NotificationoftheSlumRehabilitationZone.........................................................................155

25.8.

ContentsofaRehabilitationScheme.....................................................................................156

25.9.

DutiesoftheSchemeDeveloper............................................................................................156

25.10.

ProcedureforSecuringthePermission:.................................................................................156

25.11.

GrantorRefusalofthePermission:.......................................................................................157

25.12.

PlanningRegulationsforRehabilitationScheme...................................................................158

25.13.

RehabilitationoftheProjectAffectedPersonsandOtherEligibleSlumDwellers................159

25.14.

RegulationsforAllotment......................................................................................................159

25.15.

ExternalDevelopmentCharges..............................................................................................159

25.16.

DeNotificationofSlums.........................................................................................................159

25.17.

EffectofOtherZonesandRegulations;..................................................................................160

25.18.

SupervisionandMonitoringoftheQualityofConstruction..................................................160

25.19.

GrievanceRedressal...............................................................................................................160

26.

ControlRegulationswithinCRZ..............................................................................................161

26.1.

Definition................................................................................................................................161

26.2.

ClassificationoftheCRZ.........................................................................................................161

26.3.

DeclarationofCRZ..................................................................................................................162

26.4.

DemarcationofHTL................................................................................................................162

26.5.

ProhibitedactivitieswithinCRZ..............................................................................................163

26.6.

RegulationofpermissibleactivitiesinCRZarea.....................................................................165

26.7.

PreparationofCoastalZoneManagementPlans...................................................................167

26.8.

EnforcementoftheCRZ,notification,2011...........................................................................168

26.9.

Normsforregulationofactivitiespermissibleunderthisnotification..................................168

27.

GreyWaterReuse..................................................................................................................183

27.1.

ByelawsforDSIRDA(TheGreyWaterRecyclingandReuseByelaws)...................................183

27.2.

Definitions..............................................................................................................................183

27.3.

SectionI:GreyWaterReuseByelaws..................................................................................186

27.4.

SectionII:WaterincentiveByelaws....................................................................................189

28. DraftRegulationsforControl of Pollutiondue toSewage/IndustrialWasteWaterinDholera


SpecialInvestmentRegion.................................................................................................................192
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

DraftGeneralDevelopmentControlRegulations(DGDCR)
29.

SpecialRegulationsforHospital.............................................................................................198

29.1.

ShortTitle,ExtentandCommencement................................................................................198

29.2.

Applicability............................................................................................................................198

29.3.

Definition................................................................................................................................198

29.4.

DutiesofDSIRDA:...................................................................................................................199

29.5.

ProcedureforSecuringthePermission:.................................................................................199

29.6.

PlanningProvision..................................................................................................................199

29.7.

StructureSafety......................................................................................................................203

29.8.

MiscellaneousProvisions.......................................................................................................203

29.9.

SpecialPlanningProvisions(SPP)Where4.0orMoreFARIsGranted:.................................203

30.

SpecialRegulationsforHotel..................................................................................................211

30.1.

ShortTitleExtentandCommencement.................................................................................211

30.2.

Applicability............................................................................................................................211

30.3.

Definition................................................................................................................................211

30.4.

DutiesoftheDSIRDA:.............................................................................................................212

30.5.

ProcedureforSecuringthePermission:.................................................................................212

30.6.

PlanningProvisions.................................................................................................................212

30.7.

StructureSafety......................................................................................................................215

30.8.

MiscellaneousProvisions.......................................................................................................215

APPENDICES..........................................................................................................................................222
Appendices........................................................................................................................................222
AppendixA:ClassificationofIndustries.................................................................................................222
AppendixB:ProtectionofBuildings,StructuresandInfrastructuresinHazardProneAreas................227
AppendixC:GuidelineforDeterminationofIndustrialPlotSizes.........................................................229
AppendixD:Forms.................................................................................................................................230

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

xi

DraftGeneralDevelopmentControlRegulations(DGDCR)
ListofFigures
Figure101:SpatialDevelopmentPlanwithRoadHierarchy..........................................................................66
Figure271:ConceptualGreyWaterRecyclesystemproposedunderByelaws..........................................191

ListofTables
Table91:Minimumplotsizesforbuildings....................................................................................................45
Table92:EquivalentCarSpace.......................................................................................................................47
Table93:StandardforMinimumParkingRequirementsbyBuildingUse.....................................................47
Table94:PlantingStriprequirementsforstreettrees...................................................................................51
Table95:Wallthicknessesforloadbearingbuildings....................................................................................56
Table96:Minimumclearcorridorwidthsforbuildings.................................................................................57
Table101:DevelopmentControlRegulationsforResidentialZone...............................................................68
Table102:DevelopmentControlRegulationsfortheHighAccessCorridor..................................................72
Table103:DevelopmentControlRegulationsfortheCityCentreZone........................................................76
Table104:DevelopmentControlRegulationsfortheKnowledgeandITZone............................................................81
Table105:BufferRequirementsforIndustrialPlots......................................................................................83
Table106:DevelopmentControlRegulationsforIndustrialAreas................................................................84
Table107:DevelopmentControlRegulationsforLogisticZone....................................................................86
Table108:DevelopmentControlRegulationsforVillageBufferZone...........................................................89
Table109:DevelopmentControlRegulationsfortheRecreation,SportsandEntertainmentZone.............91
Table1010:DevelopmentControlRegulationsforGreenSpaceandAgriculturalZone...............................93
Table 1011: Development Control Regulations for Solar Park, Tourism & Resorts, Strategic Infrastructure
andPublicFacilityZone....................................................................................................................................98
Table111:StreetRightofWayStandards...................................................................................................102
Table141:MarginSpaceforHoardings........................................................................................................111
Table142:HoardingSize...............................................................................................................................111
Table143:ControlSignBoard......................................................................................................................113
Table181:GradesandbasicguidelinesforHeritageBuildings....................................................................126

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

xii

GENERALDEVELOPMENTCONTROLREGULATIONS

DraftGeneralDevelopmentControlRegulations(DGDCR)
1.

Definitions

Intheseregulations,unlessthecontextotherwiserequires,thetermsandexpressionsdefinedasfollows
shallhavethemeaningindicatedagainsteachofthem.
ThetermsandexpressionsnotdefinedintheseregulationsshallhavethesamemeaningsasintheGujarat
Town Planning & Urban Development Act, 1976 or Local Acts and the rules framed there under or as
mentionedinNationalBuildingCode(NBC)asthecasemaybe,unlessthecontextotherwiserequires.

1.1. Act
TheGujaratSpecialInvestmentRegionAct2009andTheGujaratTownPlanningandUrbanDevelopment
Act,1976,hereinafterreferredastheAct,2009andAct,1976respectively.

1.2. AdditionsAnd/OrAlterations
Any change in existing authorized building or change from one use to another use, or structural change
suchasadditionstotheareaorheight,ortheremovalofpartofabuilding,orchangetothestructuresuch
astheconstructionorcuttingintoorremovalofanywallorpartofawall,partition,column,beam,joist,
floor including a mezzanine floor or other support or a change to or closing of any required means of
ingressoregressorachangetofixturesorequipments,asprovidedintheseregulations.Theadditionto
any existing structure shall only be permitted if it complies with the current relevant provisions of the
GDCR.

1.3. AdvertisingSign/Hoarding
Any surface or a structure with character, letter or illustration, applied there to and displayed in any
mannerwhatsoeveroutofdoorsforthepurposeofadvertisinggivinginformationregardingortoattract
thepeopletoanyplace,person,publicperformance,articleormerchandise,andwhichsurfaceorstructure
isattachedto,formspartof,orisconnectedwithanybuildingorisfixedtoatreeortothegroundorto
any pole, screen, hoarding or displayed any space or in or over any water body included in the limits of
notifiedareaofDSIRDA.

1.4. AgriculturalUse
Agricultural use means use of land for the purpose of the agriculture, horticulture, sericulture, animal
husbandry,poultryfarming,plantnursery,piggery,dairyfarming,vegetablefarming,anyactivityrelatedto
agricultureormilkchillingplant.

1.5. AirConditioning
Theprocessoftreatingairtocontrolsimultaneouslyitstemperature,humidity,cleanlinessanddistribution
tomeettherequirementofanenclosedspace.

1.6. Amenities
Roads, streets, open spaces, parks, recreational grounds, playgrounds, gardens, water supply, electric
supply, street lighting, drainage, sewerage, public works and other utilities, communication network,
surfaceandconvenience,etc.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

1|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
1.7. MultistoreyApartmentsorFlats
Multistorey Apartments or Flats shall mean residential buildings constructed in a detached or semi
detached manner being designed as ground floor plus more upper floors and constructed as separate
dwellingunitwithcommonstaircase.
1.8. Atrium(pluralatria)
Shallmeanalargeopenspace,generallygivethebuildingafeelingofspaceandlight,oftenseveralstories
highandhavingasoftroofing/glazedroofand/oranyroofingofanymaterialforsafetyfromweather,but
nottogiveaspace/supportforanyactivitytobecarriedaboveit,oftensituatedwithinanofficebuilding,
shoppingarcade,shoppingcentre,andusuallocatedimmediatelybeyondthemainentrance.

1.9. AutomaticSprinklerSystem
An arrangement of pipes and sprinklers, automatically operated by heat and discharging water on fire,
simultaneouslysoundinganaudiblealarm

1.10. BasementorCellar
Shallmeanthelowerstoreyofabuildingshouldhaveatleasthalfoftheclearfloorheightofthebasement
orcellarbelowaveragegroundlevel.

1.11. Building
All types of permanent building defined in (a) to (r) below, but structure of temporary nature like tents,
hutment as well as shamianas erected for temporary purposes for ceremonial occasions, with the
permissionoftheDSIRDA,shallnotbeconsideredtobebuildings.
(a) Assemblybuilding
Abuildingorpartthereofwheregroupsofpeoplecongregateorgatherforamusement,
(i)

Recreation:dramaandcinematheatres,townhalls,auditoria,exhibitionhalls,

(ii) Social:marriagehall,eatingorboardinghouses,club,dancehallsandclub,
(iii) Religious:temple,derasar,girjaghar,masjid,church,gurudwara,agiyarietc.,
(a1) Religious building means a premise dedicated to accommodation and service of God or
other such objects of religious nature. It may have different nomenclature in different
religions like temple, mosque, choack, gurudwara, synagogue and may have ancillary
facilitieslikeashram,bathingghat,madarsaandghaushala.
(b) Businessbuilding
Any building or part thereof used for transaction of record, offices, banks, all professional
establishments,courthousesclassifiedasbusinessbuildingsiftheirprincipalfunctionistransaction
ofbusinessand/orkeepingofbooksandrecords.
(c) Detachedbuilding
A building with walls and roofs independent of any other building and with open spaces on all
sides.VillasandBungalowsaretypesofdetachedbuildingsforresidentialpurposes.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

2|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
(d) SemiDetachedBuilding
Abuildinghavingoneormoresideattachedwithwallandroofwithotherbuilding.Terraced/row
Housesaretypesofsemidetachedbuildingsforresidentialpurposes.
(e) Educationalbuilding
A building exclusively used for a school or college, recognized by the appropriate Board or
University, or DSIRDA involving assembly for instruction, education or recreation incidental to
educationaluse,andincludingabuildingforsuchotherusesincidentaltheretosuchasalibraryor
a research institution. It shall also include quarters for essential staff required to reside in the
premises,andabuildingusedasahostelcaptivetoaneducationalinstitutionwhethersituatedin
itscampusornot.
(f) Hazardousbuildingmeansabuildingorpartthereofusedfor:
Storage,handling,manufactureorprocessingofradioactivesubstancesorofhighlycombustibleor
explosive materials or products which are liable to burn with extreme rapidity and/or producing
poisonousfumesorexplosivematerials.
Storage, handling, manufacture or processing of, which involves highly corrosive, toxic obnoxious
alkalis,acids,oraotherliquids,gasesorchemicalsproducingflame,fumes,andexplosivemixtures
orwhichresultindivisionofmatterintofineparticlesandcapableofspontaneousignition.
(g) Industrialbuilding
A building or part thereof wherein products or, material are fabricated, assembled or processed,
such as assembly plants, laboratories, power plants, refineries, gas plants, mills dairies and
factories.
(h) Institutionalbuilding
A building constructed by Government, GIDB, DSIRDA, public sector undertakings, registered
CharitableTrustsfortheirpublicactivities,suchaseducation,medical,recreationalandcultural,
hostelforworkingwomenormenorforanauditoriumorcomplexforculturalandalliedactivities
or for an hospice, care of orphans, abandoned women, children and infants, convalescents,
destitute or aged persons and for penal or correctional detention with restricted liberty of the
inmates ordinarily providing sleeping accommodation, and includes dharamshalas, hospitals,
sanatoria, custodian and penal institutions such as jails, prisons, mental hospitals, houses of
correction,detentionandreformatoriesbuildingconstructedforthepromotionofTourismsucha,
staredhotels,clubs,golfcourse,sportstadiumandallactivitiesofTouristUnitasmaybedeclared
byGovernmentfromtimetotime.
(i) Mercantilebuilding
A building or part thereof used as shops, stores or markets, for display and sale of wholesale or
retail goods or merchandise, including office, storage and service facilities incidental thereto
locatedinthesamebuilding.
(j) Lowrisebuilding
Abuildinghavingheightupto16.50mandhavinggroundplusfourfloors.Howeverhollowplinth
upto2.8mandparapetonterraceupto1.5mshallnotbecounted.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

3|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
(k) Highrisebuilding
Building other than mentioned in 1.4 (j) Low Rise Building provided the maximum permissible
heightshallnotexceed150m
(l) Officebuilding
A building or premises or part thereof whose sole or principal use is for an office or for office
purposesorclericalwork.Officepurposesincludesthepurposeofadministration,clericalwork,
handling money, telephone, telegraph and computer operation; and clerical work includes
writing,bookkeeping,sortingpaperstyping,filing,duplicating,punchingcardsortapes,machines
calculations,drawingofmatterforpublicationandeditorialpreparationofmatterofpublication
GradeAofficespacedefinedbybuildingswithglassfaade,plushinteriors,excellentlandscaping,
efficient maintenance, power backup and good tenant profile will be reserved largely for service
sectorindustriessuchasBFARandrealestatesector
NonGradeAofficespaceiswheretheremainingserviceindustriesisassumedtooperateoutof.
(m) PublicBuilding
A building constructed by Government, SemiGovernment organisations, public sector under
takings, registered Charitable Trust or such other organizations for their nonprofitable public
activities
(n) ResidentialBuilding
A building in which sleeping accommodation is provided for normal residential purposes, with or
withoutcookingordiningfacilities,andincludesoneormorefamilydwellings,lodgingorboarding
houses,hostels,dormitories,apartmenthouses,flatsandprivategaragesofsuchbuildings.
(o) SpecialBuilding
i.

Abuildingsolelyusedforthepurposeofadramaorcinematheatre,motionpictureadrivein
theatre, an assembly hall or auditorium, town hall, lecture hall, an exhibition hall, theatre
museum,stadium,communityhall,marriagehall.

ii.

Ahazardousbuilding;

iii.

Abuildingofawholesaleestablishment;

iv.

Centrally airconditioned building which exceeds 15 m in height, in case where in building is


constructedonstilt

(p) StorageBuilding
Abuildingorpartthereofusedprimarilyforstorageorshelterofgoods,merchandiseandincludes
abuildingusedasawarehouse,coldstoragefreightdepot,transitshed,storehouse,publicgarage,
hanger,truckterminalgrainelevator,barnandstable.
(q) UnsafeBuilding
Abuildingwhich,isstructurallyunsafe,
i.

isinsanitary,

ii.

isnotprovidedwithadequatemeansofegress,

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

4|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
iii.

constitutesafirehazard,

iv.

isdangeroustohumanlife,

v.

in relation to its existing use constitutes a hazard to safety or health or public welfare by
reasonsofinadequatemaintenance,dilapidationorabandonment.

(r) Wholesaleestablishment
An establishment wholly or partly engaged in wholesale trade and, manufactures wholesale
outlets, including related storage facilities, warehouses and establishments engaged in truck
transport,includingtrucktransportbookingwarehouses.

1.12. BuildingLine
Thelineuptowhichthe plinthofabuildingadjoiningastreet oranextensionofastreetoronafuture
street may lawfully extend and includes the lines prescribed, in any Town Planning scheme and/or Draft
DevelopmentPlan.

1.13. BuildingUnit
Shallmeanaland/plotorpartofaland/plotorcombinationofmorethanoneland/plotasapprovedbythe
DSIRDA. Provided however where an alignment has been fixed on any road by any DSIRDA, the building
unitshallmeanandrefertothelandexcludingtheportionfallinginalignment.

1.14. BuiltUpArea
Meanstheareacoveredbyabuildingonallfloorsincludingcantileveredportion,ifany,excepttheareas
excludedspecificallyundertheseRegulations.

1.15. CompetentAuthority
MeansanypersonorpersonsorAuthorityorAuthoritiesauthorizedbytheApexAuthority(GIDB)/DSIRDA
asthecasemaybetoperformsuchfunctionsasmaybespecified.DifferentpersonsorAuthoritiesmaybe
authorizedtoperformdifferentfunctions.

1.16. Chimney
Aconstructionbymeansofwhichaflueisformedforthepurposeofcarryingproductsofcombustionto
theopenairandincludesachimneystackandthefluepipe.

1.17. Chhajja
Astructuraloverhangprovidedoveropeningonexternalwallsforprotectionfromtheweather.

1.18. Chowk/Courtyard
Afullyorpartiallyenclosedspacepermanentlyopentotheskywithinabuildingatanylevel,innerchowk
beingenclosedonallsidesexceptfromaboveandanouterchowkhavingoneunenclosedside.

1.19. CombustibleMaterial
MaterialwhichwhenburntaddsheattoafirewhentestedforcombustibilityinaaccordancewiththeIS:
38081966MethodofTestforCombustibilityofBuildingMaterial,NationalBuildingCode(NBC).

1.20. ContiguousHolding
A contiguous piece of land in one ownership irrespective of separate property register cards /record of
rights.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

5|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
1.21. Corridor
Acommonpassageorcirculationspaceincludingacommonentrancehall

1.22. CommonPlot
Shallmeanacommonopenspaceexclusiveofmargins/setbacksandapproaches,ataheightnotmorethan
groundlevelofthebuildingunit.Theownershallhavetogiveanundertakingthatthecommonplotshall
beforthecommonuseofalltheresidentoroccupantsofthebuildingunit,freeofcost.
On sanction of the development permission, the common plot shall deem to have vested in the
society/association of the residents/occupants. In case such society or Association is to be formed, the
possession/custodyofcommonplotshallremainwithDSIRDAuntilsuchassociation/societyisformed.The
commonplotshallnotbesoldtoanyotherpersonanditshallnotbeputtoanyotheruseexceptforthe
commonuseoftheresidents/occupants.

1.23. CRZ
Thecoastalstretchesofseas,bays,estuaries,creeks,riversandbackwaterswhichareinfluencedbytidal
action(inthelandwardside)upto500mfromthehightideline(HTL)andthelandbetweenlowtideline
(LTL)andtheHTLisdeclaredasCoastalRegulationsZoneunderclause(d)ofsubrule(3)ofrule5ofthe
Environmental(protection)Rules,1986.

1.24. CulDeSac
Astreetwithasinglemeansofingressandegressandhavingaturnaround.Thedesignoftheturnaround
mayvary.CuldesacsshallbedesignedaccordingtoanticipatedAverageDailyTrafficlevelandasperthe
turning radii of predominantly used vehicles for example a residential street will use the design
standards of typical passenger cars; a nonresidential street will use the design standards for buses and
largercommercialvehicles.

1.25. Developer
The person who is legally empowered to construct or to execute work on a building unit, building or
structure;orwherenopersonisempowered,theownerofthebuildingunit,buildingorstructure.

1.26. Dharmashala
A building used as a place of religious assembly, a rest house, a place in which charity is exercised with
religiousorsocialmotives,oraplacewhereinacertainsectionofpeoplehavearightof,oraregranted
residencewithoutpaymentornominalpayment.

1.27. Drain
Asystemoralineofpipes,withtheirfittingsandaccessoriessuchasmanholes,inspectionchambers,traps
gullies, floor traps used for drainage of building or yards appurtenant to the buildings within the same
cartilage.Adrainincludesanopenchannelforconveyingsurfacewaterorasystemfortheremovalofany
liquid.

1.28. DwellingUnit
A shelter consisting of residential accommodation for one family; provided that the minimum
accommodation in a dwelling unit shall be one room of minimum carpet area of 9 sqm with a minimum
sideof2.4mandawatercloset
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

6|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
1.29. EnclosedStaircase
Astaircaseseparatedbyfireresistantwallsanddoorsfromtherestofthebuilding.

1.30. ExistingBuilding
A building or an existing structure authorized before the commencement of these Development Control
Regulations.

1.31. ExistingUse
UseofabuildingoranexistingstructureauthorisedbeforethecommencementoftheseRegulations.

1.32. Exit
A passage, channel or means of egress from any building, storey or floor area to a street or other open
spaceofsafety;horizontalexit,outsideexitandverticalexisthavingmeaningsat(i),(ii)and(iii)respectively
asunder:
HORIZONTALEXIT:meansanexitwhichisaprotectedopeningthroughoraroundatfirewallorbridge
connectingtwoormorebuildings.
OUTSIDEEXIT:meansanexitfromabuildingtoapublicway,toanopenarealeadingtopublicwayorto
anenclosedfireresistantpassageleadingtoapublicway.
VERTICALEXIT:meansanexitusedforascendingordescendingbetweentwoormorelevels,including
stairways,smokeprooftowers,ramps,escalatorsandfireescapes.

1.33. ExternalWall
Anouterwallofabuildingnotbeingapartywalleventhoughadjoiningawallofanotherbuilding;andalso
meansawallabuttingonaninterioropenspaceofanybuilding.

1.34. EscapeRoute
Any well ventilated corridor, staircase or other circulations space, or any combination of the same, by
meansofwhichasafeplaceintheopenairatgroundlevelcanbereached.

1.35. FarmHouse
Farm House means a plot of land including construction thereon in the area designated for agricultural
usebytheAuthority.

1.36. Fireand/orEmergencyAlarmSystem
Meansanarrangementofcallpointsordetectors,soundersandotherequipmentforthetransmissionand
indicationofalarmsignalsworkingautomaticallyormanuallyintheeventoffire.

1.37. FireLift
Aspecialliftdesignedfortheuseoffireservicepersonnelintheeventoffireorotheremergency.

1.38. FireProofDoor
Adoororshutterfittedtoawallopening,andconstructedanderectedwiththerequirementtocheckthe
transmissionofheatandfireforaspecifiedperiod.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

7|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
1.39. FirePump
Amachine,drivenbyexternalpowerfortransmittingenergytofluidsbycouplingthepumptoasuitable
engineormotor,whichmayhavevaryingoutputs/capacitybutshallbecapableofhavingapressureof3.2
kg/cm2atthetopmostlevelofmultistoreyorhighrisebuilding.

1.40. FirePumpBoosterFirePump
Amechanical/electricaldevicewhichbootsupthewaterpressureatthetoplevelofamultistoried/high
2

risebuildingandwhichiscapableofapressureof3.2kg/cm atthenearestpoint.

1.41. FireResistance
Thetimeduringwhichafireresistantmateriali.e.materialhavingacertaindegreeoffireresistance,fulfils
itsfunctionofcontributingtothefiresafetyofabuildingwhensubjectedtoprescribedconditionsofheat
andloadorrestraint.ThefireresistancetestofstructuresshallbedoneinaccordancewithIS:38091966
FireResistanceTestofStructure.

1.42. FireSeparation
The distance in metre measured from any other building on the site or from another site, or from the
oppositesideofastreetorotherpublicspacetothebuilding.

1.43. FireServiceInlet
A connection provided at the base of a building for pumping up water through inbuilt firefighting
arrangementsbyfireservicepumpsinaccordancewiththerecommendationoftheChiefFireOfficer.

1.44. FireTower
An enclosed staircase which can only be approached from the various floors through landings or lobbies
separatedfromboththefloorareaandthestaircasebyfireresistingdoors.

1.45. Floor
Thelowersurfaceinastoreyonwhichonenormallywalksinabuilding,anddoesnotincludeamezzanine
floor.
Theflooratgroundlevelwithadirectaccesstoastreetoropenspaceshallbecalledthegroundfloor;the
floor above it shall be termed as floor 1, with the next higher floor being termed as floor 2, and so on
upwards.

1.46. FloorSpaceIndex(F.S.I.)
Meansquotientoftheratioofthecombinedgrossfloorareaoftheallfloorsincludingareasofallwalls,
exceptareasspecificallyexemptedundertheseRegulations,tothetotalareaoftheplot.
FloorSpaceIndex=Totalfloorareaincludingwallsofallfloors/PlotArea
ProvidedthatthefollowingshallnotbecountedtowardscomputationofF.S.I.
i.

Parkingspaceswithoutanyenclosuresandpartitionsofanykind,withclearheightof2.4mandin
caseofslabswithbeams,heightshouldnotexceed2.8m.

ii.

Spacesofhollowplinth(alsoknownasstilts)withmaximumclearheightof2.8mincludingbeams
in residential buildings only (not even in mixed development) at ground level without any
enclosures/wallsandpartitionsinanyform

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

8|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
iii.

InterioropenspacesandductsrequiredundertheseRegulations.

iv.

Basement exclusively used for required parking with maximum clear height of 2.6m excluding
beams.

v.

SecurityCabinupto4sqm.

vi.

Weathershedupto0.60mwidth.

vii.

Staircasewithmaximumintermediatelandingwidthequaltothewidthofstair,maximumlanding
widthatfloorlevelshallbetwicethewidthofstair.

viii.

Lift,liftwellwithliftcabin,staircabin,liftlandingofliftwellandwatertank.

ix.

Openairspace/chowk/courtyards

x.

ElectricroomasspecifiedbyG.E.B.orcompetentpowersupplyagency

1.47. FloorArea
Builtupareaexcludingareaofwalls.

1.48. Front
Frontasapplicabletoaplot;meanstheportionfacingtheroadandincaseofplotabuttingonmorethan
one road, or road more than 20m in width, the front shall be decided by the DSIRDA considering the
orientationoftheplotandexistingandfuturedevelopmenttrendofthesurroundingarea.

1.49. Footing
Afoundationunitconstructedinbrickwork,stonemasonryorconcreteunderthebaseofawallcolumnfor
thepurposeofdistributingtheloadoveralargearea.

1.50. Foundation
Meansthatpartofthestructurewhichisindirectcontactwithandtransmittingloadstotheground.

1.51. Gamtal(VillageSettlement)
ShallmeanalllandsthathavebeendeclaredbytheGovt./Collectorwithinthesiteofvillage,Townorcity
undertheprovisionsofLandRevenueCode.

1.52. GroundCoverage
The ratio of land within a plot directly under a building footprint, or in the case of stilts, under the
maximumfootprintoftheimmediateupperfloor,tothetotalplotareaexpressedasapercentage.
%GroundCoverage=(AreaunderbuildingFootprint/TotalPlotArea)x100

1.53. GroundLevel
Shall mean the level of the crown of the existing nearest constructed road or existing ground level, high
floodlevelwhicheverishigherasmaybedecidedbyDSIRDA.
Note:HighfloodlevelshallbedecidedbyDSIRDA.

1.54. GaragePrivate
Meansabuildingoraportionthereofdesignedandusedfortheparkingofvehicles.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

9|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
1.55. GaragePublic
Abuildingorportionthereof,designedotherthanasaprivategarage,operatedforgain,designedand/or
usedforrepairing,servicing,hiring,sellingorstoringorparkingmotordrivenorothervehicles.

1.56. HabitableRoom
Aroomoccupiedordesignedforoccupancyforhumanhabitationandusesincidentalthereto,includinga
kitchenifusedasalivingroom,butexcludingabathroom,waterclosetcompartment,laundry,servingand
storing,pantry,corridor,cellar,attic,storeroom,pujaroomandspacesnotfrequentlyused,heightofsuch
roomshallnotbelessthan2.80mmeasuredfromfinishedfloortofinishedceiling.

1.57. HazardousMaterial
Includesthefollowing
i.

Radioactivesubstances

ii.

Material which is highly combustible or explosive and/or which may produce poisonous fumes
explosive emanations, or storage, handing, processing or manufacturing of which may involve
highlycorrosive,toxic,obnoxiousalkalisoracidsorotherliquids;

iii.

Otherliquidsorchemicalsproducingflame,fumes,explosive,poisonous,irritantorcorrosivegases
orwhichmayproduceexplosivemixturesofdustorfineparticlescapableofspontaneousignition.

1.58. HeightofBuilding
Meanstheverticaldistancemeasuredfromtheaveragegroundlevel/highfloodlevel/plotlevelandupto
thetopofthefinishedlevelofthetopmostfloorslabincaseofflatroofsanduptothemidpointofthe
heightofthesloppingroofexcludingthegenuinestaircabin,watertankandliftroom.
Theheightoftheslopingroofshallbetakenasanaverageheightoftherelevantfloor.
Note:HighfloodlevelshallbedecidedbytheDSIRDA

1.59. HeightofaRoom
The vertical distance measured from the finished floor surface to the finished ceiling/slab surface. The
heightofaroomwithapitchedroofmeanstheaverageheightbetweenthefinishedfloorsurfaceandthe
bottomoftheeavesandthebottomoftheridge.

1.60. HeavyIndustry
Shall mean manufacturing activities engaged in the conversion of large volumes of raw materials and
partially processed materials into products of higher value; hallmarks of this form of industry are
considerable capital investment in large machinery, heavy energy consumption, and final products of
relativelylowvalueperunitweight.Theseindustriestendtobeverypolluting.

1.61. HomeOccupation
Means customary home occupation other than the conduct of an eating or a drinking place offering
servicestothegeneralpublic,customarilycarriedoutbyamemberofthefamilyresidingonthepremises
without employing hired labour, and for which there is no display to indicate from the exterior of the
buildingthatitisbeingutilisedinwholeorinpartforanypurposeotherthanaresidentialordwellinguse
andinconnectionwithwhichnoarticleorserviceissoldorexhibitedforsaleexceptthatwhichisproduced
therein,whichshallbe nonhazardous andnotaffecting thesafetyoftheinhabitantsofthebuildingand
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

10|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
theneighbourhood,andprovidedthatnomechanicalequipmentisusedexceptthatasiscustomarilyused
forpurelydomesticorhouseholdpurposesand/oremployinglicensablegoods.Ifmotive powerisused,
the total electricity load should not exceed 0.75 KW. Home Occupation may also include such similar
occupations as may be specified by the DSIRDA and subject to such terms and conditions as may be
prescribed.

1.62. Hotel
Meansapremiseswithroomsandaccessoryfacilitiesforlodgingofpeopleisprovidedinreturnofpayment
withorwithoutmeds.Itmayincludeaccessoryfacilitieslikelaundrycafeteria,restaurant,swimmingpool,
banquethall,conventionhalletc.
NonStarHotelwouldmean,hotelsotherthanonescomplyingwithstargrading

1.63. LightIndustry
Shall mean an industry in which the processes are carried out without detriment to the neighbouring
residentialareasbyreasonofnoise,vibration,smell,fumes,smoke,soot,ash,dustandgrit.

1.64. Lift
Amechanicallyguidedcar,platformortransportforpersonsandmaterialsbetweentwoormorelevelsina
verticalorsubstantiallyverticaldirection.

1.65. Loft
Anintermediatefloorbetween twofloorswitha maximumheightof1.2mandwhichisconstructedand
adoptedforstoragepurpose.Theloftifprovidedinaroomshallnotcovermorethan30%ofthefloorarea
oftheroom.

1.66. L.P.GasDeliveryCentre
Meansapremiseusedforretailoutletbooking,storageanddeliveryofgascylinderstocustomers.

1.67. Margin/Setback
Shallmeanspacefullyopentoskyprovidedattheplotlevelfromtheedgeofthebuildingwhereinbuiltup
areashallnotbepermittedexceptspecificallypermittedprojectionsunderthisregulation.

1.68. MezzanineFloor
Shallmeananintermediatefloorbetweentwofloorsoverhangingoroverlookingafloorbeneath.

1.69. MultiplexComplex
Shall mean an integrated entertainment and shopping centre/complex having at least three cinema halls
withtotalminimumseatingcapacityof1000seats,setupinanareaof3344sqm(4000Sq.Yards)orabove.
The multiplex may include retail outlets, showrooms, restaurant, fast food outlet, video game parlours,
bowlingalleys,healthspa/centresandotherrecreationalactivities

1.70. NeighbourhoodCentreandCivicCentre
NeighbourhoodCentreandcivicCentreshallincludefollowingactivitiessuchassectoralshoppingcentre,
market, office building, cinema, small hospital, playground, swimming pool, Town hall, open air theatre,
civicandculturalfacilities,library,highersecondaryschool,parkingplots,publicutilityandservicebuilding
suchaspostoffice,firestation,policestation,religiousbuildingandbuildingofpublicuses.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

11|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
1.71. NaturalHazard
The probability of occurrence, within a specific period of time in a given area, of a potentially damaging
naturalphenomenon.

1.72. NaturalHazardProneAreas
Areaslikelytohavemoderatetohighintensityofearthquake,orcyclonicstorm,orsignificantfloodflowor
inundation,orlandslides/mudflows/avalanches,oroneormoreofthesehazards.
Note:ModeratetoveryhighdamageriskzonesofearthquakesareasshowninSeismicZonesIII,IVandV
specifiedinIS:1893;moderatetoveryhighdamageriskzonesofcyclonesarethoseareasalongthesea
coastofIndiapronetohavingwindvelocitiesof39m/sormoreasspecifiedinIS:875(Part3);andflood
proneareasinriverplains(unprotectedandprotected)areindicatedintheFloodAtlasofIndiapreparedby
theCentralWaterCommission.

1.73. NonCombustible
NotliabletoburnoraddheattoafirewhentestedforcombustibilityinaccordancewiththeIS38081966
MethodofTestforCombustibilityofBuildingMaterials.

1.74. OccupancyorUse
Theprincipaloccupancyoruseforwhichabuildingorapartofitisusedorintendedtobeused,including
contingent subsidiary occupancies; mixed occupancy building being those in which more than one
occupancyarepresentindifferentportionsofthebuilding.

1.75. OpenSpace
Anareaforminganintegralpartoftheplot,leftpermanentlyopentosky.

1.76. Owner
Owner,inrelationtoanyproperty,includesanypersonwhoisforthetimebeing,receivingorentitledto
receive, whether on his own account or on account of or on behalf of, or for the benefit of, any other
personorasanagent,trustee,guardian,managerorreceiverforanyotherpersonorforanyreligiousor
charitable institution, the rents or profits of the property; and also includes a mortgaging possession
thereof.

1.77. Parapet
Alowwallorrailingbuiltalongtheedgeofroofofaflooratleast0.9mhighfromthefinishedfloorlevel.

1.78. ParkingSpace
Anenclosedorunenclosedcoveredoropenareasufficientinsizetoparkvehicles.Parkingspacesshallbe
servedbyadrivewayconnectingthemwithastreetoralleyandpermittingingressoregressofvehicles.

1.79. Partition
Aninteriornonloadbearingdividerwallonestoreyorpartstoreyinheight.

1.80. PercolationWell
Percolation Well is a small diameter (min 150 mm) well or bore done in the ground by boring or other
methodtofacilitateartificialrechargeofgroundwater.Thewellshouldbeofdepthsufficienttobeableto
recharge the aquifer (underground layer of waterbearing permeable rock or unconsolidated materials
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

12|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
(gravel,sand,orsilt)fromwhichgroundwatercanbeusefullyextracted).Rechargewells/PercolationWells
couldbecasedthroughthematerialoverlyingtheaquiferandiftheearthmaterialsareunconsolidated,a
screen can be placed in the well in the zone of injection. In some cases, several recharge wells may be
installedinthesameborehole.Rechargewellsareasuitableonlyinareaswhereathickimperviouslayer
existsbetweenthesurfaceofthesoilandtheaquifertobereplenished

1.81. PermanentOpenAirSpace
Spacespermanentlyopentoair
i.

ifitisastreet,

ii.

if its freedom from encroachment is protected by any law or contract ensuring that the ground
belowitiseitherastreetorispermanentlyandirrevocablyappropriatedasanopenspace.

Indeterminingtheopenairspacerequiredforconstructionofabuilding,anyspaceoccupiedbyanexisting
structuremay,ifitisultimatelytobecomeapermanentlyopenairspace,betreatedasifitwerealready
suchaplace.

1.82. Permission
Means a valid permission or authorisation in writing by DSIRDA to carry out development or a work
regulatedbytheRegulations.

1.83. PetroleumProductsRetailOutlets
Meansaplaceofretailsbusinessengagesinsupplyinganddispensingofpetrol,DieselandMotorOiland
otherpetroleumproductstoconsumersessentialforthenormaloperationofautomobiles.

1.84. Plinth
Plinthshallmeantheportionoftheexternalwallbetweenthelevelofthestreetandthelevelofthestorey
immediatelyabovethestreet.

1.85. PlinthArea
Meansthebuiltupcoveredareameasuredatthefloorlevelofthebasementorgroundlevelofanystorey.

1.86. Podium
A projecting lower structure (max. G+1) with ground coverage (max. 40%) around the base of a tower
block.

1.87. Porch
Means a covered surface supported on pillars or otherwise for the purpose of a pedestrian or vehicular
approachtoabuilding.

1.88. PublicPurpose
TheexpressionPublicPurposeincludes
i.

The provision of village sites, or the extension, planned development or improvement of existing
villagesites;

ii.

Theprovisionoflandfortownorruralplanning;

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

13|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
iii.

The provision of land for planned development of land from public funds in pursuance of any
scheme or policy of Government and subsequent disposal thereof in whole or in part by lease,
assignmentoroutrightsalewiththeobjectofsecuringfurtherdevelopmentasplanned;

iv.

TheprovisionoflandforacorporationownedorcontrolledbytheState;

v.

Theprovisionoflandforresidentialpurposestothepoororlandlessortopersonsresidinginareas
affectedbynaturalcalamities,ortopersonsdisplacedoraffectedbyreasonoftheimplementation
if any scheme undertaken by Government, any local Authority or a corporation owned or
controlledbytheState;

vi.

Theprovisionoflandforcarryingoutanyeducational,housing,healthorslumclearancescheme
sponsored by Government or by any Authority established by Government for carrying out any
suchschemeorwiththepriorapprovaloftheappropriateGovernmentbyaLocalAuthorityora
society registered under the societies Registration Act, 1860 or under any corresponding law for
thetimebeinginforceinaState,oracooperativesocietywithinthemeaningofanylawrelating
tocooperativesocietyforthetimebeinginforceinanyState;

vii.

TheprovisionoflandforanyotherschemeofdevelopmentsponsoredbyGovernmentorwiththe
priorapprovalofappropriateGovernment,byalocalAuthority;

viii.

The provision of any premises or building for locating a public office, but, does not include
acquisitionoflandforCompanies.

1.89. Registered Architect / Engineer / Structural Designer, Clerk of Works, Site Supervisor,
Developer
RespectivelyapersonregisteredbyDSIRDAforthepurposeofthisActasanArchitect,Engineer,Structural
Designer,Clerkofworks,SiteSupervisor,Developer,undertheseRegulationsoranyotherActprevailingfor
thearea.

1.90. RetentionActivity
Anactivityorusewhichisallowedtocontinue,notwithstandingitsnonconformingnatureinrelationto
theusepermittedintheadjoiningorsurroundingarea.

1.91. ResidentialUse
A use of any building unit for the purpose of human habitation only except hotels and hostels as
commercialentities.

1.92. Road/Street
Any highway, street, lane, pathway, alley, stairway, passageway, carriageway, footway, square place or
bridge, whether a thoroughfare or not, over which the public have a right of passage or access or have
passedandhadaccessuninterruptedlyforaspecifiedperiod,whetherexistingorproposedinanyscheme,
andincludesallbundschannels,ditches,stormwaterdrains,culverts,sidewalks,trafficislands,roadside
treesand,hedgesretainingwalls,fences,barriersandrailingswithinthestreetRightofwaylines.

1.93. Road/StreetLevelorGrade
Theofficiallyestablishedelevationorgradeofthecentrelineofthestreetuponwhichaplotfronts,andif
thereisnoofficiallyestablishedgrade,theexistinggradeofthestreetatitsmidpoint.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

14|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
1.94. Road/StreetLine
The line defining the side limits of a road/street including the footpath and elements within the defined
rightofwayofastreet.

1.95. RoadWidthorWidthofRoad/Street
Thewholeextentofspacewithintheboundariesofaroadwhenappliedtoanewroad/street,aslaiddown
inthecitysurveyorDraftDevelopmentPlanorprescribedroadlinesbyanyactorlawandmeasuredat
rightanglestothecourseorintendedcourseofdirectionofsuchroad.

1.96. RightOfWay
Thetotalwidthofanylandreservedordedicatedasastreet,alley,pedestrianway,orforotherpublicor
privateuse.

1.97. Rules
TheGujaratTownPlanningandUrbanDevelopmentRules1979,hereinafterreferredasRules1979

1.98. Saltpan
Shallmeanaflatexpanseofgroundnaturallycoveredwithsaltandotherminerals;thisistheaccumulation
ofsaltsandmineralsaswater,unabletodrainintotheground,evaporates;Amanmadepondwheresalty
waterisevaporatedtoconcentrateitduringthemakingofsalt

1.99. SelfUseDevelopment
Developmentundertakenbyanownerforhisuse.

1.100. ServiceRoad
A road/lane provided at the front, rear or side of a plot for service purposes providing continuous inter
parcel/interplotaccess,attimesparalleltothehighwayorlimitedaccessfacilityincludingarterialroads.

1.101. SepticTank
A singlestory, watertight, onsite treatment system for domestic sewage, consisting of one or more
compartments, in which the sanitary flow is detained to permit concurrent sedimentation and sludge
digestion. The septic tank is constructed of materials not subject to decay, corrosion, or decomposition,
suchasprecastconcrete,reinforcedconcrete,concreteblock,orreinforcedresinandfibreglass.Thetank
mustbestructurallycapableofsupportingimposedsoilandliquidloads.Septictanksareusedprimarilyfor
individual residences, isolated institutions, and commercial complexes such as schools, prisons, malls,
fairgrounds,summertheatres,parks,orrecreationalfacilities.Septictankshavelimiteduseinurbanareas
wheresewersandmunicipaltreatmentplantsexist.
Atank,commonlyburied,towhichallofthewastewatersfromthehomeshouldflowandinwhich,primary
digestionoftheorganicmatteroccursbyanaerobicbacteria;themainpartofasepticsystemwherescum
andsolidsaccumulate;derivedfromasepsismeaningputriddecayordecaywithoutoxygen.

1.102. Sewerage
Shall mean system of pipes, pumps, devices and other appurtenant structures for the collection,
transportationandfinaldisposalofwastewater.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

15|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
1.103. Sewage
Shall mean a combination of the liquid or watercarried wastes from residences, business buildings, and
institutions, together with those from industrial establishments, and with such ground water, surface
water,andstormwatermaybepresent.

1.104. Sewer
Shallmeanapipe,conduitorchannelintendedtoconveysewage.

1.105. ShoppingCentreorCommercialCentre
Agroupofshops,officesand/orstallsdesignedtoformmarketofficecomplex.

1.106. ShoppingMall
Shallmeanbuildingormultiplebuildingsconsistingofcomplexshopsrepresentingleadingmerchandisers,
with interconnecting walkways enabling visitors to easily walk from unit to unit and convenient parking
area.

1.107. SmokeStopDoor
Adoorforpreventingorcheckingthespreadofsmokefromoneareatoanother.

1.108. SolarPark
A contiguous area which is used for installation of Equipments which are used for generation of power
throughSolarEnergy.TheareamaybeusedbySingleormultipleusers.

1.109. StairCover
A structure with a covering roof over a staircase and its landing built to enclose only the stairs for the
purposeofprovidingprotectionfromtheweather,andnottobeusedforhumanhabitation.

1.110. Storey
Theportionofabuildingincludedbetweenthesurfaceofanyfloorandthesurfaceofthefloornextabove
it,oriftherebenoflooraboveit,thenthespacebetweenanyfloorandtheceilingnextaboveit.

1.111. StubStreet
Ashortdeadendstreetwhichisaportionofaroadthathasbeenapprovedinitsentiretyiscalledasastub
street.Oncetheremainingportionoftheroadisconstructedinfuture,astubstreetwillbecalledaroad.
Stubstreetsmayextendtoapropertylinetopermitconnectionofstreetsinadjoiningsubdivisions.

1.112. Subdivisions
Thedivisionorredivisionofalandparcelbyanymeansintotwoormoreplots,tracts,parcels,orother
divisionsofland,includingchangesin existinglotlinesforthepurpose,whetherimmediateorfuture, of
lease, partition by the court for distribution to heirs or devises, transfer of ownership, or building, or lot
development; provided, however, that the subdivision by lease of land for agricultural purposes into
parcelsofmorethanten(10)acres,notinvolvinganynewstreetoreasementsofaccessoranyresidential
dwellingshallnotbeconsideredassubdivisions

1.113. Tenement
Anindependentdwellingunitwithakitchen,oracookingspace.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

16|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
1.114. TenementBuildingandOwnershipFlats
Residentialbuildingconstructedinasemidetachedmannerinabuildingunit,eachdwellingunitisbeing
designedandconstructedforseparateoccupationwithindependentprovisionofbath,w.c.

1.115. TravelDistance
Thedistancefromtheremotestpointofabuildingtoaplaceofsafety,beitaverticalexitoranhorizontal
exitoranoutsideexitmeasuredalongthelineoftravel.

1.116. WaterCloset(W.C)
Aprivywithanarrangementforflushingthepanwithwater,butdoesnotincludeabathroom.

1.117. WaterCourse
A natural channel or an artificial channel formed by draining or diversion of a natural channel meant for
carryingstormandwastewater.

1.118. WaterCourse,Major
A water course which carries storm water discharging from a contributing area of not less than 160
hectares,thedecisionofDSIRDAontheextentofcontributingareabeingfinal.Aminorwatercourseisone
whichisnotamajorone.

1.119. WaterHarvesting
"Waterharvesting"isthegeneralnameusedforallthedifferenttechniquestocollectrunofforfloodwater
forstorageinthesoilprofileorintankssothatitcanbeusedfortheproductionofcrops,treesorfodder.
"Waterharvesting"alsocanbethecollectionofrunoffwaterforhumanorlivestockconsumption.

1.120. WaterTanksorTalavorPondorLake
A natural existing low lying ground forming a natural water body or wherein rain water gets collected
and/orplotsdesignatedasTalavundertherevisedDraftDevelopmentPlanoranyotherlegitimaterecords.

1.121. WarehouseorGodown
Abuildingthewholeorasubstantialpartofwhichisusedorintendedtobeusedforthestorageofgoods
whetherforstoringorforsaleorforanysimilarpurpose.Itisneitheradomesticnorapublicbuilding,nor
merelyashopifsousednotastoreattachedtoandusedfortheproperfunctioningofashop.

1.122. Window
An opening, other than a door, to the outside of a building, which provides all or part of the required
ventilation.

1.123. WidthofaStreet
Meanstheclearaveragewidthoftheexistingcarriagewayandfootpathsonlyonwhichthebuildingorplot
lineabuts.Theaveragewidthshallbecomputedbytakinglengthofstreetbetweentwoextremepointson
building unit abutting the street at right angles to the direction of such streets excluding the steps
projections, forecourts, open areas of other spaces in front of the building erected or intended to be
erected. However in case where a regular line of street is prescribed by DSIRDA, such width shall be
consideredforthepurposeofcomputingbuildingheight.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

17|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
2.

ProcedureforSecuringDevelopmentPermission

2.1. ApplicationforDevelopmentPermission
AnypersonintendingtocarryoutanydevelopmentasdefinedintheAct1976,inanybuildingorinor
over any land, within the limits of the development area in conformity with the Draft Development Plan
proposalsshallmakeanapplicationinwritingtoDSIRDAinprescribedFormNo.CorC(A)alongwiththe
receiptofthepaymentofthescrutinyfee,developmentchargesbettermentcharges,netdemandasper
sanctionedfinallandpooling&landreadjustmentschemeandotherchargesandduesifanytobeleviable
undertheActandtheregulations.

2.2. ScrutinyFee
Apersonapplyingforpermissiontocarryoutanydevelopmentshallhavetopayscrutinyfeesalongwith
hisapplicationtoDSIRDAatthefollowingrates:
2.2.1.

ForBuiltUpArea

ForlowrisebuildingRs.3.00persqmofBuiltupareaofallfloorsfortheintendedresidentialdevelopment
orpartthereofsubjecttominimumscrutinyfeeofRs.300.00
2.2.2.

CommercialandMixDevelopment

Forhighrise,commercial,mixdevelopmentandotherthanresidentialuseRs.5.00persqmofBuiltareaof
allfloorsfortheintendeddevelopmentorpartthereofsubjecttominimumscrutinyfeeRs.300.00.
2.2.3.

SubDivisionandAmalgamationofLand

a) Rs. 1.50 per sqm of building unit/plot area for subdivision and amalgamation of all types of
development.
b) Rs.0.50persqmofbuildingunit/plotareaforsubdivisionandamalgamationforagriculturaluse.
c) MinimumscrutinyfeeshallnotbelessthanRs.300.00
2.2.4.

UrbanCentres,RuralCentresandAreaOutsideUrbanComplexandFallingInAgricultureZone
Only

50% of the scrutiny fee as mentioned in Regulation No.2.2.1, 2.2.2 and 2.2.3 for the respective uses and
typeofdwellingunitssubjecttominimumscrutinyfeeRs.300.00
2.2.5.

RenewalofDevelopmentPermission

Developmentpermissiongrantedunderthisregulationshallbedeemedtobelapsed,ifsuchdevelopment
work has not been commenced till the expiry of one year from the date of commencement certificate /
developmentpermission.Providedthat,DSIRDAmayonapplicationmadetoitbeforetheexpiryofabove
period(oneyear)extendedsuchperiodbyafurtherperiodofoneyearatatimebychargingRs.300.00for
renewal of development permission. The extended period shall in no case exceed three years in the
aggregate.
2.2.6.

PublicCharitableTrust

Rs.500.00 if the intended development is for hospitals, dispensaries, schools or colleges or a place of
worship, dharmshala, hostels etc. constructed by a public charitable trust registered under Public
CharitableTrustAct,1950orforanyotherpurposewhichtheAuthoritymayspecifybyageneralorspecial
order.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

18|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
2.2.7.

DevelopmentPermissionForMining,QuarryingAndBrickKilnOperations

Incaseofmining,quarryingandbrickkilnoperations,thescrutinyfeeswillbeasunder.
i.

Mining, quarrying and brick kiln operation: Rs.500.00 per 0.4 hectare or part thereof and a
maximumofRs.2500.00

ii. BrickkilnwithoutChimney:Rs.25.00per0.1hectareorpartthereofandamaximumofRs.500.00
iii. Processing of lime sagol etc. without construction: Rs. 25.00 per 0.1 Hectare or part thereof and
maximumofRs.250.00
iv. Renewalofpermissionformining,quarryingRs.50.00foroneyear.
v. Renewalofpermissionforbrickkiln(withoutchimney)Rs.25.00foroneyear.
vi. Renewal of permission for processing of sagol, lime etc. without construction Rs. 10.00 for one
year.
Note:FeestoberevisedbyDSIRDAfromtimetotime.

2.3. FormsofApplication
Every person who gives notice under relevant section of the Act shall furnish all information in forms,
format &procedures prescribed under these regulations and as may be amended from time to time by
DSIRDA.Thefollowingparticularsanddocumentsshallbesubmittedalongwiththeapplication.
i.

ia. Theapplicantshallsubmitsatisfactorydocumentarylegalevidenceofhisrighttodeveloporto
buildonthelandinquestionincludingextractfromthePropertyRegisterforcitysurveylands
oranextractfromtheRecordofRightsforRevenuelandsorthecopyoftheindexofregistered
saledeedasthecasemaybe.
ib. He shall also submit a certified copy of approved sub divisions/layout of final plot from the
concernedAuthorityorlatestapprovedsubdivision/layoutofcitysurveynumbersorrevenue
numbersfromrelevantAuthority,asthecasemaybe,showingtheareaandmeasurementsof
theplotorlandonwhichheproposestodevelop(RefertothePlotSubDivisionGuidelines
Chapter 11) ; provided that the Authority may dispense with this requirement in the cases
whereitissatisfiedregardingtheownershipoflandonthebasisofanydocumentaryevidence
orproofproducedbytheapplicant.

ii. A certificate of the licensed structural designer in regard to the proposed building shall be
submittedundertheseDevelopmentControlRegulations.
iii. Asiteplan(requiredcopies)oftheareaproposedtobedevelopedtoascalenotlessthan1:500as
thecasemaybeshowingthefollowingdetailswhereverapplicable;Inthecasewhereplotismore
than10hectares;scaleshallnotbelessthan1:1000.
a. Theboundariesoftheplotandplotlevelinrelationtoneighbouringroadlevel.
b. Thepositionsoftheplotinrelationtoneighbouringstreets.
c. Thenameofthestreetsinwhichtheplotissituated.
d. Alltheexistingbuildingsandotherdevelopmentexistsonorunderthesite.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

19|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
e. Thepositionofbuildingsandofallotherbuildingsandconstructionwhichtheapplicantintends
toerect.
f.

Yards and open spaces to be left around the buildings to secure free circulation of air,
admissionoflightandaccess

g. Thewidthofstreetinfrontandofthestreetatthesideorrearofthebuilding.
h. Thedirectionofnorthpointrelativetotheplanofthebuildings
i.

Anyphysicalfeaturesuchastrees,wells,drains,well&pipeline,hightensionline,railwayline.

j.

a. Existing streets on all the sides indicating clearly the regular line for streets if any
prescribedundertheAct,1976,thisDraftDevelopmentPlanorsubsequentsubsetsof
thisDraftDevelopmentPlan;andpassingthroughthebuildingunits.
b. Thelocationofthebuildingintheplotwithcompletedimensions
c. Theareawithintheregularlineofthestreetnottobebuiltuponbuttobeaddedtothe
street,hatchedingreentogetherwithitsmeasurements.

k. Areaclassifiedforexemptionofbuiltupareacalculations.
l.

Aplanindicatingparkingspaces,ifrequiredundertheseregulations.

m. Thepositionsofthebuildingunitsimmediatelyadjoiningtheproposeddevelopment.
n. The position of every water closet, privy, urinal, bathrooms, cess pool, well or cistern in
connectionwiththebuildingotherthanthoseshowninthedetailedplan.
o. The lines of drainage of the building, the size, depth and inclination of every drain and the
meanstobeprovidedfortheventilationofthedrains.
p. Thepositionandleveloftheoutfallofthedrain.
q. Thepositionofsewer,wherethedrainageisintendedtobeconnectedtosewer.
r.

OpenspacesrequiredundertheseDevelopmentControlRegulations.

s. TreeplantationrequiredaspernormssetinthisDraftDevelopmentPlan
iv. Adetailedplan(4copies)showingtheplans,sectionsandelevationsoftheproposeddevelopment
worktoascaleof1:100showingthefollowingdetailswhereverapplicable:
a. Floorplansofallfloorstogetherwiththecovered,area;clearlyindicatingthesizeandspacing
ofallframingmembersandsizesofroomsandthepositionofstaircases,rampsandliftwells.
b. Theuseofallpartsofthebuilding.
c. Thicknessofwalls,floorslabsandroofslabswiththeirmaterials.Thesectionshallindicatethe
heightofbuildingandheightofroomsandalsotheheightoftheparapet,thedrainageandthe
slopeoftheroof.Atleastonesectionshouldbetakenthroughthestaircase.Theposition,form
anddimensionsofthefoundation,wall,floor,roofs,chimneysandvariouspartsofthebuilding,
means of ventilation and accesses to the various parts of the building and its appurtenances
alsoshouldbeshowninonecrosssection.
d. Thebuildingelevationfromthemajorstreet.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

20|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
e. Thelevelofthesiteofthebuilding,theleveloflowestportionsofbuildinginrelationtothe
levelofanystreetadjoiningthecartilageofthebuildinginrelationtooneanotherandsome
knowndatumorcrownofroad.
f.

Securitycabinplan,ifany

g. Thenorthpointrelativetotheplans.
h. Theformsanddimensionsofeverywaterclosets,privy,urinals,bathrooms,cesspools,welland
watertankorcisterntobeconstructedinconnectionwiththebuilding
i.

One copy of the detailed working drawing including structural design calculation and details
basedontheapprovedbuildingplanshallbesubmitted7daysbeforecommencementofthe
construction work at site for information and record. The applicant will inform the date for
commencement of work to the DSIRDA. Provided that in the case of individual residential
buildings up to G+2 on a plot not more than 500 sqm. in size, DSIRDA shall not enforce, on
requestoftheowner/developer,tosubmitsuchdetails,subjecttotheconditionthatforsuch
areasimilartypesofstructuresandsoilinvestigationreportarealreadyavailableonrecord.

v. For high rise building and for special building like assembly, institutional, industrial storage and
hazardous occupancy the following additional information shall be furnished/indicated in the
followingplansinadditiontotheitemsunderclause2.3.
a. Access to fire appliances/vehicles with details of clear motorable access way around the
buildingandvehicularturningcircle.
b. Size (width) of main and alternate staircase along with balcony approach, corridor, and
ventilatedlobbyapproachasthecasemaybe.
c. Locationanddetailsofliftenclosures.
d. Locationandsizeoffirelift.
e. Smokestopslobby/door,whereprovided.
f. Refusechutes,refusechamber,serviceductetc.whereprovided.
g. Vehicularparkingspace.
h. Refugearea,ifany.
i. Details of building services, airconditioning system with position or dampers, mechanical
ventilationsystem,electricalservices,boilers,gaspipesetc.whereprovided.
j. Detailsofexitsincludingprovisionoframpsetc.forhospitals.
k. Locationofgenerator,transformerandswitchgearroomwhererequired.
l. Smokeexhaustersystem,ifany.
m. Detailsoffirealarmsystemnetwork.
n. Location of Centralized control, connecting all for air, suste, builtin fire protection
arrangementsandpublicaddresssystemetc.whererequired.
o. Locationanddimensionofstaticwaterstoragetankandpumproom.
p. Location and details of fixed fire protection installations such as sprinkles wet risers, hose
reels,drenchers,CO2installationsetc.
q. Locationanddetailsoffirstaid,firefightingequipment/installations.
r. Locationforelectrictransformer.
vi. Incaseoflayoutoflandorplot:

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

21|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
a. Certificateofundertaking:CertificateintheprescribedFormNo.2(A),2(B),2(C)and2(D),the
registeredArchitect/Engineer/StructuralDesigner/ClerkofWorks//Developer/Owner.
b. FullinformationshouldbefurnishedinFormNo3andFormNo.4,asthecasemaybealong
withtheplan.

2.4. GeneralNotationforPlan
Thefollowingnotationgenerallyshallbeusedforplansreferredtoin2.3:(iii);(iv);(v)and(vi).
SR.
NO.
1
2
3
4
5
6
7
8
9
10
11

ITEM

SITEPLAN

BUILDINGPLAN

Plotline
ExistingStreet
Futurestreetifany
Permissiblelines
Openspaces
Existingwork
Workproposedtobedemolished
Proposedwork
Workwithoutpermissionifstartedonsite
DrainageandSewerageWork
Watersupplywork

ThickBlack
Green
Greendotted
Thickblackdotted
Nocolour
Blue
yellowhatched
Red
Grey
Reddotted
Blackdotted

ThickBlack
NA
NA
NA
Nocolour
Blue
yellowhatched
Red
Grey
Reddotted
Blackdotted

2.5. DocumentstobefurnishedwiththeApplication
2.5.1.

A person who is required under relevant section of the Act, 1976 to give any notice or to furnish any
plans/sections or written particulars by these Development Control Regulations, shall sign such notice,
plans,sectionsorwrittenparticularsorcausethemtobesignedbyhimandhisdulyauthorizedregistered
Architect, Engineer, Developer etc. as the case may be. Such person or authorized registered Architect,
Engineer,DevelopershallfurnishdocumentaryevidenceofhisAuthority.Ifsuchnoticeorotherdocument
issignedbysuchauthorizedregisteredArchitect,Engineer,DeveloperitshallStatethenameandaddress
ofthepersononwhosebehalfithasbeenfurnished.
2.5.2.
AnynoticeordocumentshallbedeliveredtotheofficeofDSIRDA,withinsuchhoursasmaybeprescribed
byDSIRDA.
2.5.3.

Theforms,plans,sectionsanddescriptionstobefurnishedundertheseDevelopmentControl
Regulationsshallallbesignedbyeachofthefollowingpersons:
1. Apersonmakingapplicationfordevelopmentpermission
2. A person who has prepared the plans and sections with descriptions who may be registered,
engineeroranarchitect
3. Apersonwhoisretainedorengagedtosupervisethesaidconstruction
4. A person who is responsible for the structural design of the construction i.e. a structural
designer/engineer
5. Aclerkofworkswhoistolookafterthedaytodaysupervisionoftheconstruction
6. ADeveloper

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

22|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
2.5.4.

Apersonwhoisengagedeithertoprepareplanortoprepareastructuraldesignandstructuralreportorto
supervisethebuildingshallgiveanundertakinginFormNo.2(A),2(B),2(C)and2(D)prescribedunderthese
DevelopmentControlRegulations.
Applicationshallbeaccompaniedwiththestructuralcalculationsandassumptions,withnecessarysoiland
structuralstabilityreports,dulycertifiedbytheappointedstructuralengineer.
2.5.5.
EverypersonwhoundertheprovisionsoftherelevantsectionsoftheActmayberequiredtofurnishtothe
Authorityanyplanorotherdocumentsshallfurnishcopies(inrequirednumbers)ofsuchplansandother
documentsandcopies(inrequirednumbers)ofsuchdocumentswhichhemaybecalledupontofurnish.
Onecopyofeachsuchplananddocumentshallbereturned,onapproval,totheapplicantdulysignedby
theauthorizedofficerofDSIRDA.
2.5.6.
Itshallbeincumbentoneverypersonwhoseplanshavebeenapprovedtosubmitamendedplansforany
deviationamountingtoincreaseinbuiltuparea,F.S.I.,buildingheightorchangeinplansheproposesto
makeduringthecourseofconstructionofhisbuildingworkand,theprocedurelaiddownforplansorother
documentsheretobeforeshallbeapplicabletoallsuchamendedplans.
2.5.7.

It shall be incumbent on every person whose plans have been approved, to submit a completion plan
showing the final position of erected or reerected building in duplicate or in required numbers and one
copyofplantobereturnedtotheapplicantafterapproval.
2.5.8.
ApprovalofdrawingsandacceptanceofanyStatement,documents,structuralreport,structuraldrawings,
progresscertificate,orbuildingcompletioncertificatesshallnotdischargetheowner,engineer,architect,
clerk of works and structural designer, Developer, Owner from their responsibilities, imposed under the
Act,1976,theDevelopmentControlRegulationsandthelocallaws.
2.5.9.
The landowner shall be held responsible if any unauthorized construction, addition & alteration is done
withoutpriorpermissionofDSIRDA.

2.6. PlansandSpecificationstobepreparedbyRegisteredArchitect/Engineer
The plans and particulars prescribed under regulation No.2.3 above shall be prepared by a registered
architect/engineer. The procedure for registration of architect/engineer shall be as laid down in these
regulations.

2.7. RejectionofApplication
If the plans and information given as per regulation No.2.1, 2.2 and 2.3 do not give all the particulars
necessarytodealsatisfactorilywiththedevelopmentpermissionapplication,theapplicationmaybeliable
toberejected.

2.8. CancellationofPermission
The development permission if secured by any person by any misrepresentation or by producing false
documents,suchdevelopmentpermissionwillbetreatedascancelled/revoked.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

23|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
3.

GeneralRequirementsforDevelopment

3.1. Marginand/orSetback
Anyplanfortheconstructionofanystructureorbuildingoranypartthereofshouldprovidesetbackand
margin from the boundary of the plot or the road line as the case may be as required under these
regulations.Theroadlineshallbedeterminedasperthemaximumwidthoftheroadorstreetproposed
undertheDraftDevelopmentPlanproposalsortheTownPlanningSchemesoranyotherLocalActs.

3.2. DevelopmentoflandintheDevelopmentArea
3.2.1.

ConformitywithotherActsandRegulations

a. SituatedandabuttingonanyoftheclassifiedroadsoftheDholeraSpecialInvestmentRegionand
the Panchayat shall be regulated and controlled by the Building line and Control line prescribed
undertheGovt.DepartmentResolutionasamendedfromtimetotime
b. Provided that the setback for the building line prescribed in the above resolution of the
Departmentandthemarginaldistancestobekeptopenorsetbackstobeobservedfromtheroad
side, prescribed in the Development Control Regulations or in the Town Planning Scheme
Regulationswhicheverismoreshallbeenforced.
c. WhoserightofuserisacquiredunderthePetroleumPipelines(Acquisitionofrightofuserinland)
Act, 1962 as amended from time to time shall be regulated and controlled according to the
provisionofthesaidAct,inadditiontotheseregulations.
d. SituatedinthevicinityofanoilwellinstalledbyOil&NaturalGasCommissionshallberegulated
andcontrolledaccordingtotheprovisionoftheIndianOilMinesRegulations,1984inadditionto
theseregulations
e. Situated in the vicinity of the Grid Lines laid by the Uttar Gujarat Vij Company Limited (UGVCL),
Gujarat Energy Transmission Corporation Ltd. (GETCO) or other authority/co. under the grid line,
the horizontal clear distances shall be kept as per Indian Electric Rules, 1956 Iand shall not be
permittedunderhightensiongridlineandundertheclearhorizontaldistanceasperIndianElectric
Rules,1956andshallbekeptpermanentlyopentothesky.
f. In restricted/critical zone near the Airport, construction of building shall be regulated as per the
provisionsoftheCivilAviationDepartment.
g. SituatedinthevicinityoftheRailwayBoundaryshallberegulatedandcontrolledaccordingtothe
standingorder/instructionsinforceoftheRailwayAuthoritiesandasamendedfromtimetotime.
h. Situated anywhere in the Development Area shall be subject to previsions of the Gujarat Smoke
NuisanceAct,1963.
i. SituatedanywhereintheDevelopmentareashallbesubjecttoprovisionsofWater(Preventionand
ControlofPollution)Act,1974.
j. Situated anywhere in the Development area shall be subject to provisions of the Air Pollution
ControlAct,1981.
k. Situated in the vicinity of the Jail, shall be regulated and controlled according to the standing
orders/instructions/manualinforceoftheJailAuthorityandasamendedfromtimetotime.
l. Situated anywhere in the Development area shall be subject to provisions of the act related to
telecommunication,I.S.R.O.,archaeologyandconservation/preservationofmonuments.
m. Development Permission granted by DSIRDA on the basis of any document/NOC received is not
finalandconclusive.ThisAuthorityhasnolegalresponsibilityforsuchdevelopmentpermission.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

24|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
n. SituatedanywhereintheDevelopmentareashallbesubjecttoprovisionsoftheactrelatedtothe
protectedmonumentoraspertheproposalsoftheDraftDevelopmentPlan.
3.2.2.

RequirementsofSite

Nolandshallbeusedasasitefortheconstructionofbuilding
(a) IfDSIRDAconsidersthatthesiteisinsanitaryorthatitisdangeroustoconstructabuildingonitor
nowatersupplyislikelytobeavailablewithinareasonableperiodoftime;
(b) Ifthesiteisnotdrainedproperlyorisincapableofbeingwelldrained;
(c) Ifthebuildingisproposedonanyareafilledupwithcarcasses,excreta,filthyoroffensivemanner,
tilltheproductionofacertificatefromDSIRDAtotheeffectthatitisfittobebuiltuponformthe
healthandsanitarypointofview;
(d) IftheusedofthesaidsiteisforapurposewhichinDSIRDAsopinionmaybeasourceofdangerto
thehealthandsafetyoftheinhabitantsoftheneighbourhood;
(e) If DSIRDA is not satisfied that the owner of the building has taken the required measures to
safeguardtheconstructionfromconstantlygettingdamp;
(f) If the level of the site is lower than the Datum Level prescribed by DSIRDA depending on
topographyanddrainageaspects.
(g) For assembly use, for cinemas, theatres, places of public worship, residential hotels, lodging and
boarding houses, unless the site has been previously approved by DSIRDA and the Competent
PoliceAuthority;
(h) Unlessitderivesaccessfromtheauthorisedstreet/meansofaccessdescribedintheseRegulations;
(i) For industrial use other than a service industry unless the application is accompanied by a no
objectioncertificatefromtheappropriateofficeroftheIndustrialLocationPolicy.
(j) If the proposed development is likely to involve damage to or have deleterious impact on or is
against urban aesthetic of environment or ecology and/or on historical/architectural/esthetical
buildingsandprecinctsorisnotinthepublicinterest.
(k) IfthesiteisfoundtobeliabletoliquefactionbyDSIRDAundertheearthquakeintensityofthearea,
exceptwhereappropriateprotectionmeasurearetakentopreventtheliquefaction.
(l) If DSIRDA finds that the proposed development falls in the area liable to storm surge during
cyclone,exceptwhereprotectionmeasuresareadoptedtopreventstormsurgedamage.

3.3. DevelopmentWorktobeinConformitywiththeRegulations
a) All development work shall confirm to the Draft Development Plan proposals and the provisions
madeundertheseregulations.Ifthereisaconflictbetweentherequirementsoftheseregulations
andTownPlanningSchemesRegulations,ifany,inforcetherequirementoftheseregulationsshall
prevail.
Providedrelaxation/specialprovisionsmentionedagainstrespectivefinalplotsshallprevailabove
theseregulations
Providedincaseofproposedroad,townplanningschemeroadshallprevail
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

25|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
b) Change of use: No building or premises should be changed or converted to a use other than the
sanctioned use without prior permission of the Authority in writing. Change of use not in
conformitywiththeseregulationsshallnotbepermissible

3.4. Documentatsite
i)

DevelopmentPermission:Thepersontowhomadevelopmentpermissionisissuedshallduring
construction,keep
(a) Postedinaconspicuousplace,onthesiteforwhichpermissionhasbeenissuedacopyof
thedevelopmentpermissionand
(b) AcopyoftheapproveddrawingsandspecificationreferredtointheRegulationNo.2.5on
thesiteforwhichthepermissionwasissued.

3.5. Inspection
1) Inspectionatvariousstages:
DSIRDAatanytimeduringerectionofabuildingortheexecutionofanyworkordevelopment,makean
inspectionthereofwithoutgivingpriornoticeofhisintentiontodoso.
2) InspectionbyFireDepartment:
Forallmultistoried,highriseandspecialbuildingtheworkshallalsobesubjecttoinspectionbytheChief
Fire Officer, or DSIRDA shall issue the occupancy certificate only after clearance by the said Chief Fire
Officer/DSIRDA.
3) UnsafeBuilding:
Incaseofunauthoriseddevelopment,DSIRDAshall
a) Take suitable action which may include demolition of unauthorised works as provided in the
Act,2009andAct,1976.
b) Take suitable action against the registered architect/ engineer, developer and other as
mentionedinDeveloperRegulationClause.

3.6. General
1) Kabrastan,BurialGroundetc.
The land occupied by the graveyards, kabrastans, burial grounds, crematoria and allied actions
whicharemarkedbygreenvergeintheplanshallnotbeallowedtobebuiltuponandshallbekept
permanentlyopen
2) EducationalInstitution
No Educational institution except, K.G., primary, secondary schools and higher secondary school
shallbepermittedwithintheareaofvillagebufferzone.
3) ImprovementScheme
No development permission shall be issued for development of the area designated for
improvementschemeuntilsuchschemeispreparedandfinalisedbytheDSIRDA.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

26|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
4) CoOwnersConsent
In cases where the building construction is as per regulations by the coowners are not giving
consent either at the time of building permission or at the time of occupation permission, the
DSIRDA might issue permission after giving opportunity of hearing to the coowners and
consideringthemeritsanddemeritsofindividualcase
5) WidthofApproachatBridge
Widthoftheapproachofoverbridgeshallnotbeconsideredtowardswidthoftheroadatthetime
ofpermittingtheheight,usedevelopmentofbuildingsneartheoverbridgeorunderbridge.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

27|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
4.

DecisionoftheAuthority

4.1. GrantorRefuseofthePermissionApplication
On receipt of the application for Development Permission, DSIRDA (Regional Development Authority for
theDSIR)aftermakingsuchinquiryandclearancefromsuchanexpertwheneverconsiderednecessaryfor
the safety of building, as it thinks fit may communicate its decisions granting with or without condition,
including condition of submission of detailed working drawing/ structural drawing along with soil
investigationreportbeforethecommencementofthework,orrefusingpermissiontotheapplicantasper
theprovisionsoftheAct,1976.
DSIRDA,however,mayconsidergrantingexemptionforsubmissionofworkingdrawing,structuraldrawing
andsoilinvestigationreportincaseDSIRDAissatisfiedthatintheareawheretheproposedconstructionis
to be taken, similar types of structure and soil investigation reports are already available on record and
suchrequestisfromanindividualowner/developer,havingplotofnotmorethan500sqminsizeandfora
maximum3storiedresidentialbuilding.
Aspertheguidelinesonsoiltesting,ifthelocalsiteconditionsdonotrequireanysoiltestingorifasoil
testingindicatesthatnospecialstructuraldesignisrequired,asmallbuildinghavingground+1or2floors,
havingloadbearingstructure,maybeconstructed.Iftheproposedsmallhouseistobeconstructedwith
load bearing type masonry construction technique, where no structural design is involved, no certificate
from a Structural Designer will be required (to be attached with Form 2D). Such load bearing masonry
construction has to be done as per the following guidelines prepared by Dr. Anand Swarup Arya and
publishedbyGujaratStateDisasterManagementAuthority.
For buildings having heights more than 30 mt , the entire Structural Design which will include design of
foundations and design of Superstructure will have to be designed by a experienced competent
Geotechnical and Structural Engineer. The design calculations along with GFC (Good For Construction)
drawings will have to be independently vetted / proof checked by an institute approved by DSIRDA for
proofcheckingofsuchdesigns.Thevetteddesignsanddrawingsshouldbesubmittedforapproval.
OnreceiptoftheapplicationforDevelopmentPermission,DSIRDAaftermakingsuchinquiryasitthinksfit
maycommunicateitsdecisionsgrantingorrefusingpermissiontotheapplicantaspertheprovisionsofthe
Act, 2009 and Act, 1976. The permission may be granted with or without conditions or subject to any
generalorspecialordersmadebytheGIDB/DSIRDAinthisbehalf.Thedevelopmentpermissionshallbein
Form No. D; Act, 1976 and it should be issued by an officer authorized by DSIRDA in this respect. Every
ordergrantingpermissionsubjecttoconditionsorrefusingpermissionshallstatethegroundsforimposing
suchconditionsorforsuchrefusal.
DSIRDA, after making preliminary scrutiny of the plans received, may give preliminary development
permission by taking an affidavit from the owner. The margin, setbacks, ground coverage, builtup area,
internal roads, open spaces, parking and common plots shall be kept as per G.D.C.R. after making final
scrutiny of the plans the final development permission may be granted provided that the preliminary
developmentpermissionshallbevalidonlyfordevelopmentuptoplinthlevel.Fordevelopmentabovethe
plinth level, regular development permission shall be taken; otherwise such development shall be
consideredasunauthorizeddevelopment.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

28|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
4.2. SuspensionofPermission
Development permission granted under the relevant section of the Act, 1976 deems to be suspended in
cases of resignation by any of the licenses till the new appointments are made. During this period,
construction shall not be done on the site. Any work on site during this time shall be treated as
unauthorizeddevelopmentwithoutanyduepermission.

4.3. GrantofDevelopmentPermission
4.3.1.

GrantofDevelopmentPermission

GrantofdevelopmentpermissionshallmeanacceptanceofthefollowingrequirementsbytheAuthority:
a. Permissiblebuiltuparea.
b. Permissiblefloorspaceindex.
c. Heightofabuildinganditsvariousstories.
d. Permissible open spaces enforced under regulations, common plot areas, marginal spaces, other
openspaces,setbacks,groundcoverageetc.
e. Permissibleuseoflandandbuiltspaces.
f.

Arrangementsofstairs,lifts,corridorsandparking.

g. Minimum requirements of highrise buildings including N.O.C. from Fire Officer/Fire Safety
ConsultantasappointedbyDSIRDA/GIDB.
h. Minimumrequirementofsanitaryfacilityandothercommonfacility.
i.

Requiredlightandventilation.

Providedthatitshallnotmeanacceptanceofcorrectness,confirmation,approvalorendorsementofand
shallnotbindorrendertheAuthorityliableinanywayinregardto:

titleofthelandorbuilding.

easementrights.

variationinareafromrecordedareasofaplotorabuilding.

structuralreportsandstructuraldrawings.

workmanshipandsoundnessofmaterialusedinconstructionofthebuilding.

locationandboundaryoftheplot.

4.3.2.

ServiceandAmenitiesFees

PermissionforcarryingoutanydevelopmentshallbegrantedbyDSIRDAonlyonpaymentofserviceand
amenitiesfeesforexecutionofworksreferredtoinclause[(vi)a]ofsubsection(I)ofSection23oftheAct,
1976andforprovisionofotherservicesandamenitiesatthefollowingratesinDholeraSpecialInvestment
RegionasdelineatedintheDraftDevelopmentPlan.
ThefeesandmaintenancechargesmayberevisedonreviewbyDSIRDAfromtimetotime.
1. ServiceandamenitiesfeesshallbeleviedasunderforanydevelopmentwithintheDholeraSpecial
InvestmentRegionexcludingagriculturalzone,andgamtal.
Rs.100.00persq.mt.ofbuiltupareafortheintendeddevelopmentofalluses.
Rs. 50.00 per sq. mt. of built up area of intended development for schools, colleges, educational
institution,charitabletrusts,GovernmentandsemiGovernmentbuilding.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

29|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
These regulations shall not be applicable in the Town Planning Scheme area, for the approved
existing buildings. These fees shall not be leviable once the intention of making a Town Planning
Schemeisdeclared.
2. Howevertheseserviceandamenitiesfeesshallbeadjustedagainstthenetamounttobepaidby
theownerinthetownplanningscheme.

4.4. Liability
Notwithstanding any development permission granted under the Act 2009, Act 1976 and these
regulations,anypersonundertakinganydevelopmentworkshallcontinuetobewhollyandsolelyliablefor
anyinjuryordamageorlosswhatsoeverthatmaybecausedtoanyoneinoraroundtheareaduringsuch
constructionandnoliabilitywhatsoeverinthisregardshallbecastontheAuthority.

4.5. ResponsibilitiesoftheApplicant
Neither the grant of development permission nor the approval of the plans, drawings and specifications
shallinanywayrelievetheapplicantoftheresponsibilityforcarryingoutthedevelopmentinaccordance
withrequirementoftheseregulations.

4.6. DevelopmentwithoutpriorLegitimatePermission
Incaseswheredevelopmenthasalreadystarted/commencedonsiteforwhichdevelopmentpermissionin
writingofDSIRDAisnotobtained,butwherethisdevelopmentonsiteisinaccordancewiththeprovisions
oftheseregulations,thedevelopmentpermissionforsuchworkonsitewithoutthepriorpermissionmay
begrantedbyDSIRDAonthemeritsofeachindividualcase.
For such development works, over and above such other charges/fees may be otherwise leviable, the
additionalamountshallbechargedonsuchtotalbuiltupareaasperthefollowingrates:
1.

Application for development permission is made but development is commenced without


permission:5timesofregulationno.2.2.1to2.2.4

2.

Applicationismadeanddevelopmenthascommencedbutnotaspersubmittedplan:10timesof
regulationno.2.2.1to2.2.4

3.

Applicationfordevelopmentpermissionisnotmadeanddevelopmentiscommenced:15timesof
regulationno.2.2.1to2.2.4

4.

All other open uses including layout and subdivision of land without permission: 2 times of
regulationno.2.2.1to2.2.4

NOTE:MinimumadditionalamountshallbeRs.1000.00forresidentialandRs.5000.00forothers.

4.7. DeviationduringcourseofConstruction
Notwithstanding anything Stated in the above regulations it shall be incumbent on every person whose
plans have been approved to submit revised (amended) plans for any deviations he proposes to make
during the course of construction of his building work and the procedure laid down for plans or other
documentsheretobeforeshallapplytoallsuchRevised(amended)plans.
EXPLANATION:for4.1to4.7:
ThisprovisiondoesnotentitletheownerorhissupervisortomakeanydeviationsinContraventionofthe
provisionsoftheAct2009andAct1976,theseregulations.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

30|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
5.

Inspection

5.1. GeneralRequirements
ThebuildingunitintendedtobedevelopedshallbeinconformitywithRegulationNo.3.2.2.Generallyall
developmentworkforwhichpermissionisrequiredshallbesubjecttoinspectionbyDSIRDA.
a. TheapplicantshallpermitauthorizedofficersoftheconcernedDSIRDAtoentertheplotforwhich
the development permission has been sought granted for carrying out development, at any
reasonabletimeforthepurposeofenforcingtheseregulations.
b. Theapplicantshallkeep,duringcarryingoutofdevelopment,acopyoftheapprovedplansonthe
premiseswherethedevelopmentispermittedtobecarriedout.
c. TheapplicantshallkeepaboardatsiteofdevelopmentmentioningthesurveyNo,citysurveyNo,
Block No, Final Plot No., Sub plot No., etc. name of owner and name of Architect, Engineer ,
Developer,StructuralDesigner,ClerkoftheWorks.

5.2. ProcedureduringConstruction
5.2.1.

Recognizedstagesforprogresscertificateandchecking

Followingshallbetherecognizedstagesintheerectionofeverybuildingortheexecutionofeverywork:
1. Plinthorbasement,incaseofbasementbeforethecastingofbasementslab.
a. Firststorey.
b. MiddlestoreyincaseofHighrisebuilding.
c. Laststorey.
At each of the above stages, the owner / developer under these Development Control Regulations shall
submit to the competent designated officer of DSIRDA a progress certificate in the given formats [Form
Nos.6(A)6(D).Thisprogresscertificateshallbesignedbythearchitectandsupervisingengineer.
No person incharge at any stage shall, except with previous written permission of DSIRDA, carry out
furtherworkaftertheissueofanyrequisitionoftheseDevelopmentControlRegulationsinrespectofthe
anypreviousstageunlesstherequisitionhasbeendulycompliedwithandthefactreportedtoDSIRDA.
Theprogresscertificateshallnotbenecessaryinthefollowingcases:
a. AlterationinBuildingnotinvolvingthestructuralpartofthebuilding.
b. Extensionofexistingresidentialbuildingonthegroundflooruptoamaximum15sqmarea.
2. Onreceiptoftheprogresscertificatefromtheowner/developer,itshallbethedutyofDSIRDA,if
foundnecessary,tocheckanydeviationfromtheapprovedplanandconveydecisionwithin7days
totheowner/developeraccordinglyforcompliance.
3. CompletionReport:
a. It shall be incumbent on every person whose plans have been approved, to submit a
completionreportinFormNo.7.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

31|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
b. ItshallalsobeincumbentoneverypersonwhoisengagedunderthisDevelopmentControl
Regulations to supervise the erection or reerection of the building, to submit the
completionreportinFormNo.7prescribedundertheseDevelopmentControlRegulations.
c. NocompletionreportshallbeacceptedunlesscompletionplanisapprovedbyDSIRDA.
4. ThefinalinspectionoftheworkshallbemadebytheconcernedDSIRDAwithin21daysfromthe
dateofreceiptofnoticeofcompletionreport.

5.3. OccupancyCertificate
TheapplicantshallobtainoccupancycertificatefromDSIRDApriortoanyoccupancyoruseofdevelopment
socompleted.

5.4. IllegalOccupationofBuilding
1. Notwithstanding the provision of any other law to the contrary, DSIRDA may, by written notice,
order any building or any portion thereof to be vacated forthwith or within the time specified in
suchnotice:
a. If such building or portion thereof has been unlawfully occupied in contravention of these
regulation.
b. Ifanoticehasbeenissuedinrespectofsuchbuildingorpartthereofrequiringthe
c. Alterationorreconstructionofanyworksspecifiedinsuchnoticehavenotbeencommencedor
completed.
d. Ifthebuildingorpartthereofisinaruinousordangerouscondition,whicharelikelytofalland
causedamagetoanypersonoccupying,restoringtoorpassingbysuchbuilding/structuresor
anyotherstructureorplaceintheneighbourhoodthereof.
2. Thereasonsforrequiringsuchbuildingorportionthereoftobevacatedshouldbeclearlyspecified
ineverysuchnotice.
3. The affixing of such written notice on any part of such premises shall be deemed a sufficient
intimationtotheoccupiersofsuchbuildingorportionthereof.
4. Ontheissueofsuchnotice,everypersoninoccupationofthebuildingorportionthereoftowhich
thenoticerelatesshallvacatethebuildingorportionasdirectedinthenoticeandnopersonshall,
solongasthenoticeiswithdrawn,enterthebuildingorportionthereof,exceptforthepurposeof
carryingoutanyworkofreinstatementwhichhemaylawfullybepermittedtocarryout.
5. DSIRDAmaydirectthatanypersonwhoactsincontraventionofaboveprovisionorwhoobstructs
him in any action taken under these regulations shall be removed from such building or part
thereofbyanypoliceofficer,andmayalsousesuchforceasisreasonablynecessarytoaffectentry
inthesaidpremises.
6. The cost of any measures taken under this provision shall be recovered from the
owners/occupants.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

32|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
5.5. IllegalDevelopment
1. If DSIRDA certifies that the erection of any building or the execution of any such work has been
unlawfully commenced or is being unlawfully carried on upon any premises he may, by written
notice, requires the person directing or carrying on such erection or execution to stop the same
forthwith.
2. Ifsucherectionorexecutionisnotstoppedforthwith,DSIRDAmaydirectthatanypersondirecting
orcarryingonsucherectionorexecutionshallberemovedfromsuchpremisesbyanypoliceofficer
andmaycausesuchstepstobetakenasmayconsidernecessarytopreventthereentryofsuch
persononthepremiseswithoutpermission.
3. Thecostofanymeasurestakenundersubpoint(2)shallbepaidbythesaidperson.

5.6. DevelopmentwithoutPermission
Ifanyworkorthing,requiringthewrittenpermissionofDSIRDAunderanyprovisionofthisActoranyrule/
regulationisdonebyanypersonwithoutobtainingsuchwrittenpermission,issubsequentlysuspendedor
revokedforanyreasonbyDSIRDA,suchworkorthingshallbedeemedtobeunauthorisedand,subjectto
anyotherprovisionofAct,1976;DSIRDAmayatanytime,bywrittennotice,requirethatthesameshallbe
removed,pulleddownorundone,asthecasemaybe,bythepersonsocarryingoutordoingthework.If
thepersoncarryingoutsuchworkordoingsuchthingisnottheowneratthetimeofgivingsuchnotice,
theownershallbeliableforcarryingouttherequisitionsofDSIRDA.
Ifwithintheperiodspecifiedinsuchwrittennoticetherequisitionscontainedtherearenotcarriedoutby
thepersonorowner,asthecasemaybe,DSIRDAmayremoveoraltersuchworkorundosuchthingand
theexpensesthereofshallbepaidbysuchpersonorownerasthecasemaybe.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

33|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
6.

OccupancyCertificate

6.1.

ApplicationforOccupancy

DSIRDA shall, within twenty one days from the date of receipt of the completion report required under
Regulation 5.2.1 (3) communicate its decision after necessary inspection about grant of occupancy
certificateindicatedinRegulationNo.5.3.
TheConcernedBodyissuingoccupancycertificatebeforedoingsoshallconsultDSIRDA/GIDBtoinspectthe
buildingandissueacertificatethatnecessaryrequirementsforthefireprotectionundertheseregulations
pertaining to fire protection have been fulfilled and if not so, the applicant shall be asked to carry out
necessary additions, alterations or rectification to the satisfaction of the designated Authority before
issuingoccupancycertificate.

6.2. IssueofOccupancyCertificate
TheAuthorityissuingoccupancycertificatebeforedoingsoshallensurethat
1. Thetreesareplantedonsiteorensurethisbytakingsuitabledepositsasdecidedfromtimetotime
forspecificperiodbyDSIRDA.
2. Parking space is properly paved & the layout of parking space is provided as per the approved
plans.Signboardsindicatingtheentrance,exitandlocationofparkingspacefordifferenttypesof
vehicles shall be permanently erected and maintained at the prominent place in every building
unit.
3. CertificateofliftInspector(GovernmentofGujarat)hasbeenprocured&submittedbytheowner,
regardingsatisfactoryerectionofLift.
4. ProperarrangementsaremadeforregularmaintenanceofliftasprovidedinNBC
5. The Certificate of DSIRDA and or fire department for completion and or fire requirements as
providedintheseregulationshasbeenprocuredandsubmittedbytheowner.
6. Properarrangementsaremadeforregularmaintenanceoffireprotectionservicesasprovidedin
NBCandintheseregulations.
7. Thereshallbeapercolatingwellinabuildingunithavingareamorethan1500sqm.
8. If any project consists of more than one detached or semidetached building, and any
building/buildingsthereofiscompletedasperprovisionsofthisGDCR(suchasParking,Common
Plots,InternalRoads,HeightoftheBuilding,Infrastructurefacilities,liftandfiresafetymeasures),
DSIRDA may issue completion certificate for such one detached or semidetached
building/buildings in a building unit. The occupancy certificate shall not be issued unless the
information is supplied by the owner and the Engineer / Architect concerned in the schedule as
prescribedbyDSIRDAfromtimetotime.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

34|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
7.

DevelopmentUndertakenOnBehalfOfGovernment

As per the provisions of Section 39 of the Act, 1976 and Rule 15 of the Rules, the OfficeinCharge of a
GovernmentDept.shallinforminwritingtotheAuthorityoftheintentiontocarryoutdevelopmentforits
purposealongwithsuchdevelopmentorconstruction:
1. AnofficialletterofGovernmentDepartmentaddressedtotheAuthorityorasthecasemaybeto
the authorized officer giving full particulars of the development work or any operational
construction.
2. Building plan confirming to the provisions of Development Control Regulations and Draft
DevelopmentPlanfortheproposeddevelopmentworktoascaleofnotlessthan1:100.
3. Plans confirming to the provisions of Draft Development Plan showing complete details of the
operational construction as defined under Clause (xvii) of Section 2 of the Act, 1976 such as
detailedalignment,layouts,locationsandsuchothermatterswithmeasurements.
4. Statementindicatingtheuseoflandconfirmingtothepermissiblelandusezone,proposedtobe
madebytheGovernmentDept.forcarryingoutthedevelopmentwork.
5. TheproposalsoftheDraftDevelopmentPlanorlandpooling/readjustmentschemeaffectingthe
land.
6. Asiteplan(withrequirednumberofcopies)oftheareaproposedtobedevelopedtoascaleofnot
lessthan1:500.
7. Detailedplan(withrequirednumberofcopies)showingtheplans,sectionsandelevationsofthe
proposeddevelopmentworktoascaleof1:100.
8. Incaseoflayoutoflandorplot:

Asiteplan(withrequirednumberofcopies)drawntoascaleof1:500showingthesurrounding
landandexistingaccesstothelandincludedinthelayout.

A layout plan (with required number of copies) drawn to a scale of not less than 1 : 500
showingsubdivisionsofthelandorplotwithdimensionsandareaofeachoftheproposedsub
divisionsandtheiruse.Providedthatinthecaseofworksproposedtobeundertakenbythe
local military Authority of the Defence Ministry, the provisions of clause (2) and (3) shall not
applyandsuchAuthorityshallberequiredtosubmitonlythelayoutplans.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

35|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
8.

RegistrationsofProfessionals

8.1. ApplicationforRegistration
DSIRDA shall register architects, engineers, structural designers, clerk of works, site supervisors, and
developers. ApplicationforregistrationforallrequiredprofessionalsshallbeinFormNo.10.Registration
shallbevalidfortheperiodoffiveyearsorpartthereofandshallberenewableorpartthereof.

8.2. RevocationofRegistration
AregistrationshallbeliabletoberevokedtemporarilyorpermanentlybyDSIRDAiftheregisteredpersonis
foundguiltyofnegligenceordefaultindischargeofhisresponsibilitiesanddutiesorofanybreachofanyof
these Regulations; provided that he shall be given a show cause notice and afforded reasonable
opportunityofbeingheardbyDSIRDAforthepurposeoftheseRegulations.

8.3. Duties&Responsibilities
8.3.1.
i.

GeneralDutiesandResponsibilitiesApplicableToAll
They shall study and be conversant with the provisions of Act, 2009 and Act, 1976 and other
applicable acts rules and regulations made thereunder, policyorders and standing orders
approved by DSIRDA and the other instructions circulated by DSIRDA and the provisions in force
fromtimetotimealongwiththeinstructionsprinted/mentionedonprescribedapplicationforms
andpermissionletter.

ii. TheyshallinformDSIRDAoftheiremployment/assignment/resignationforanyworkwithin7days
ofthedateofsuchanevent.
iii. Theyshallprepareandsubmitallplans,neworrevisedwhennecessary.Therequireddocuments
andotherdetailswillbesubmittedinaneat,clean,legiblemannerandonadurablepaperproperly
arrangedandfoldedinaccordancewiththeprovisionsprevailingtimetotime.
iv. They shall submit plans, documents and details without any scratches or corrections. Only small
corrections will be permitted with proper initials. They shall correctly represent all the site
conditionsincludingexistingtrees.
v. Theyshallpersonallycomplywithallrequisitions/queriesreceivedfromDSIRDAinconnectionwith
the work under their charge, promptly expeditiously and fully at onetime. Where they do not
agree with requisitions/ queries, they shall State objections in writing, otherwise for non
complianceofanyrequisition/querywithinstipulatedtime,theplansandapplicationsshallbefiled
forthwith,andshallnotbereopened.
vi. Theyshallimmediatelyintimatetotheownersthecorrectionsandotherchangestheymakeonthe
plans,documentsanddetailsasperrequisitions/queriesfromDSIRDA.
vii. Theyshallclearlyindicateoneveryplan,document&submission,thedetailsoftheirdesignation
suchasregisteredEngineer,registeredStructuralDesigneretc.withregistrationnumberwithdate,
fullnameandtheiraddressbelowthesignatureforidentification.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

36|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
viii. Theyortheirauthorisedagentoremployee,shallnotaccepttheemploymentforpreparationand
submissionofplansdocumentsandsupervisionofanyworkifthesameisintendedorproposedto
beorbeingexecutedoralreadyexecutedincontraventionofprovisionsofLocalActs,Act1976,
rules,regulationsandanyordersmadethereunderandanyRegulationsorrulesforthetimebeing
inforceundertheAct.
ix. Theregisteredpersonshallapplyforundertakingtheresponsibilityfortheparticularworkinthe
formsprescribedbyDSIRDA.
x. Theregisteredpersonshallprovidetheinformation andundertakingfortheworkundertakenby
himintheformsprescribedbyDSIRDAfromtimetotime.
xi. Itshallbemandatorytoappointaclerkofworksirrespectiveoftypeofbuilding/constructioninall
buildingunitsthathaveproposedbuiltupareasmorethan1000sqm.Theclerkofworksshallbe
assignedconstantsupervisionoverallconstruction workonsiteandsuchpersonappointedshall
notbeallowedtosupervisemorethanonesiteatatime.
xii. The architect and structural designer shall be responsible for adhering to the provisions of the
relevant and prevailing Indian Standard Specifications. They will not be held responsible for the
severe damage or collapse that may occur under the natural forces going beyond their design
forcesprovidedintheIndianStandardSpecifications.

8.3.2.

Architect

A. QualificationAndExperience:
A person registered under the provision of Architect Act, 1972 as an Architect or a person holding a
BachelorsDegreeinArchitecture/DiplomainArchitectureEquivalenttoB.Arch.with2yrs.Experienceand
registeredwiththeCouncilofArchitecture.
B. ScopeWork&Competence:
i.

Preparation&planningofalltypesoflayouts&submissiondrawingsandtosubmitcertificateof
supervision,progressreport&certificateofcompletionforalltypesofbuildingsinaccordanceto
theprovisionsofbuildingregulations

ii. Supervision and execution of construction work as per specifications and drawings prepared by
authorisedregisteredstructuraldesignerandengineer
C. DutiesAndResponsibilities:
i.

The architect shall be responsible for making adequate arrangements to ensure that the work is
executed as per the approved plans and also is confirms with the stipulations of the National
Building Code (NBC) and the I.S.I. standards for safe and sound construction and nonhazardous
functioningoftheservicesincorporatedinthebuilding.Thearchitectshallalsoberesponsiblefor
making adequate provisions for protection of services and equipment in the buildings from fire
hazardsasperthestipulationsoftheNationalBuildingCode(NBC)andshallobtainaNoObjection
Certificate(N.O.C)fromtheChiefFireOfficerorconcerneddesignatedAuthority/Consultantbefore
applyingforoccupationcertificate.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

37|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
ii. Thearchitectshallonbehalfoftheowner,submittheprogresscertificates,completioncertificates
andtheoccupationcertificateandobtainthesameasrequiredundertheregulations.
iii. Iftheservicesoftheregisteredarchitectareterminated,heshallimmediatelyinformDSIRDAabout
histerminationandthestageofworkatwhichhisserviceshavebeenterminated.Theregistered
architectappointedasreplacementoftheprecedingarchitectshallinformabouthisappointment
onthejob,andinformDSIRDAofanydeviationthatmighthaveoccurredonthesitewithreference
to the approved drawings and the stage at which he is taking over the charge. After DSIRDA has
inspected the site for his report, the newly appointed architect shall allow the work to proceed
underhisdirection.
iv. TheregisteredarchitectappointedontheworkshallinformDSIRDAimmediatelyonterminationof
the services of the registered/structural designer, construction contractor, clerk of works, site
supervisor,plumberorelectricianandshallnotallowtheworktocontinuetillthevacancyisfilled
byappointmentofanotherpersonandthecertificateofappointmentofsuchpersonissubmitted
inDSIRDA.
v. He or she shall instruct the relevant agency that adequate provisions are made for ensuring the
safetyofworkersandothersduringexcavation,constructionanderection.
vi. Heorsheshallinstructtherelevantagencythatadequateprovisionsaremadeforprovidingsafe
andadequatetemporarystructuresrequiredforconstructionanddevelopment.
D. Registration:
i.

TheregistrationfeeifanyshallbepayableasprescribedbyDSIRDAfromtimetotime.

ii.

DSIRDAmayblacklistanarchitectincaseofseriousdefaultsorrepeateddefaultsandshallinform
theCouncilOfArchitect,Indiatotakesuitableactionagainstsuchpersonundertheprovisionsof
Architect Act, 1972. The registration shall be liable to be revoked temporarily or permanently by
DSIRDAinsuchcasesofnegligenceordefault.

8.3.3.

Engineer

A. QualificationAndExperience
The required qualification for an engineer will be a degree in Civil Engineering or Associate Membership
(Civil Engineering) of the Institution of Engineers, India (AMIE) or building construction or its equivalent
qualification recognised by All India Board of Technical Education or a Diploma in Civil Engineering or
DiplomainbuildingconstructionrecognisedbyStateBoardofTechnicalExaminationofanyStateofIndia.
In addition to the qualifications Stated above, the applicant should have at least five years experience in
professionalworkifheisaholderofaDiplomainCivilEngineering/orAMIE.
B. ScopeOfWork&Competence:
i.

Preparationandplanningofalltypesoflayoutsandsubmissiondrawingsandtosubmitcertificate
ofsupervisionandcompletionforalltypesofbuildings.Providedpersonhavingqualificationofa
DiplomainCivilEngineeringshallbepermittedforlowrisebuildingsonly.

ii. Supervision and execution of construction work as per specifications & drawings prepared by
authorisedregisteredstructuraldesigner.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

38|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
iii. He/she can prepare and submit structural details & calculations for buildings of load bearing
structures.
C. DutiesAndResponsibilities:
Duties and responsibilities of an engineer will be as per 8.3.2(C), with reference to engineer in place of
Architect.
D. Registration:
TheregistrationfeesifanyshallbepayableasprescribedbyDSIRDAfromtimetotime.
Ifhe/sheisfoundnegligenttohis/herduties&responsibilities,DSIRDAmayblacklistanEngineerincaseof
serious defaults or repeated defaults and shall inform the Institution of Engineers, India to take suitable
action against such person. The registration shall be liable to be revoked temporarily or permanently by
DSIRDAinsuchcasesofnegligenceanddefault.

8.3.4.

StructuralDesigner

A. QualificationAndExperience:
TherequiredqualificationforastructuraldesignershallbeadegreeinCivilEngineeringoritsequivalent
qualificationrecognisedbyAllIndiaCouncilofTechnicalEducationorAssociateMember(CivilEngineer)of
theInstituteofEngineers.Inadditiontoabovequalification,theapplicantshouldhaveatleastfiveyears
experienceinstructuraldesign,twoyearsofwhichmustbeinaresponsiblecapacityinformofstructural
designer.
OR
AMastersdegreeinstructuralengineeringfromarecognisedinstituteandatleasttwoyearsexperiencein
structuraldesignwork.
OR
A Doctoral degree in structural design from a recognised institute and at least one year experience in
structuraldesignwork.
B. ScopeOfWork&Competence:
Toprepare&submitstructuraldetailsfor:
i.

AlltypesofBuildings,

ii. Specialstructures.
C. DutiesAndResponsibilities:
i.

Topreparereportofthestructuraldesign.

ii. Topreparedetailedstructuraldesignandtoprescribethemethodandtechniqueofitsexecution
strictlyonthebasisoftheNationalBuildingCode(NBC)orrelevantIndianStandardspecifications.
iii. Topreparedetailedstructuraldrawingsandspecificationsforexecutionindicatingthereon,design
liveloads,safesoilbearingcapacity,specificationsofmaterial,assumptionsmadeindesign,special
precautionstobetakenbycontractortosuitthedesignassumptionsetc.whateverapplicable.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

39|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
iv. Tosupplytwocopiesofstructuraldrawingstothesitesupervisor.
v. Toinspecttheworksatallimportantstagesandcertifythattheworkbeingexecutedisuptothe
satisfactionoftheArchitect/Engineer.
vi. To certify the structural safety and overall structural soundness of the building to the
Architect/Engineer.
vii. ToadvisetheOwner/Architect/Engineerforarrangingfortestsandtheirreportsforsoil,building
materialetc.forhisevaluationanddesignconsideration.
viii. Heshallpreparetherevisedcalculations&drawingsincaseofanyrevisionwithreferencetothe
earliersubmissionofdrawing&designinaparticularcase.
ix. To submit the certificate of structural safety and over all structural soundness of building to
DSIRDA.
x. To inform in writing to DSIRDA within 7 days, if for any reason he is relieved of his
appointment/responsibilitiesastheregisteredStructuraldesignerforthedevelopment.
xi. Nottoprovideservicestofurtheroradvanceworkofanytypeonanydevelopmentthatdoesnot
complywiththeregulationorisunauthorisedaspertheGDCR.
D. Registration:
Registrationofthestructuraldesignerwillbeasper8.3.2(D),withreferencetostructuraldesignerinplace
ofArchitect.

8.3.5.

ClerkofWork/SiteSupervisor

A. QualificationAndExperience:
TherequiredqualificationfortheclerkofworksorthesitesupervisorshallbeaDegreeinCivilEngineering
or its equivalent qualification recognised by All India Board of Technical Education or Diploma in Civil
EngineeringrecognisedbyStateBoardofTechnicalExaminationsofanyStateinIndia.
ii. In addition to the above qualifications, the applicant should have at least three years experience in
professionalworkifheholdsaDiplomainCivilEngineeringorArchitectureandmusthaveatleastoneyear
experienceifheholdsaDegreeinCivilEngineeringorArchitecture.
OR
DiplomainBuildingconstructiontechnologyfromarecognisedinstitute&atleastfiveyearsexperiencein
buildingconstructionwork
OR
BachelorsdegreewithspecialisedtraininginbuildingconstructionandtechnologyatBachelorslevelfrom
arecognisedinstituteandatleasttwoyearsexperienceinconstructionwork.
B. ScopeOfWork:
i.

Executionofallframedstructurehighrisebuildings,publicbuildings,buildingswith

ii. basement/cellar, and irrespective of above type of buildings/construction in all building units
havingbuiltupareamorethan1000sqm.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

40|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
C. DutiesAndResponsibilities:
i.

Toadherestrictlytothestructuraldrawingspecificationsandwritteninstructionsofthestructural
designerandarchitect/Engineer.

ii. To follow the provisions of N.B.C. or I.S. specifications as regards materials, components, quality
controlandtheprocessofconstruction.
iii. Toprovideforsafetyofworkersandothersduringexcavation,constructionanderection.
iv. Toprovidesafeandadequatetemporarystructurerequiredforconstruction&erection.
v. To bring to the notice of the structural designer and Architect/ Engineer/ any situation or
circumstanceswhichinhisopinionareliabletoendangerthesafetyofstructure.
vi. TodepositwithDSIRDAonesetofworkingdrawingsoftheworksexecutedalongwiththeprogress
certificatesbeforeproceedingtothenextstageofthework.
vii. Heshallbeinchargeofsiteandresponsibleforoverallsupervisionofthework.
viii. Heshallensurethatalltheworksunderhischargearecarriedoutinconformitywiththeapproved
drawingsandasperthedetailsandspecificationssuppliedbytheregisteredArchitect/Engineer.
ix. He shall take adequate measures to ensure that no damage is caused to the work under
constructionandtheadjoiningproperties.
x. Heshallalsoensurethatnoundueinconvenienceiscausedinthecourseofhisworktothepeople
inneighbourhood.
xi. Heshallalsoensurethatnonuisanceiscausedtotraffic&neighbouringpeoplebywayofnoise,
dust,smell,vibrationetc.inthecourseofhiswork.
D. Registration
Registrationoftheclerkofworksorsitesupervisorshallbeasper8.3.2(D).

8.3.6.

Developer

A. QualificationAndExperience:
Theperson/firmactingasDevelopershallbeofprovedmeritsandexperience.
B. DutiesAndResponsibilities
Theresponsibilitiesofdevelopersshallbe:
i.

To obtain and submit to DSIRDA, along with application for development permission, each
progressreportandapplicationforoccupationcertificate.

ii.

ToappointaRegisteredArchitect/EngineerandStructuralDesigner.

iii.

Toobtainatrelevantstagescertificatesfromthem,forsubmissiontoDSIRDA,thatindesigning
therealestatedevelopmentandprovidingdetaileddrawingsandspecificationsforittheyhave
compliedwithrequirementsaslaidoutintheGDCR.

iv.

Toappointaregisteredsitesupervisor.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

41|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
v.

To obtain and adhere to the quality assurance procedure prepared by the registered site
supervisor.

vi.

Toadequatelyenablethesitesupervisortocarryouthisresponsibilities.

vii.

To certify along with the site supervisor that construction of the real estate development has
been carried out as per the design, detailed drawings and specifications provided by the
Architect/EngineerandtheStructuralDesigner.

viii.

ToobtaindevelopmentpermissionfromDSIRDApriortocommencementofconstructionofthe
realestatedevelopment

ix.

ToregularlysubmitprogressreportsandcertificatesasrequiredbyDSIRDA.

x.

ToinforminwritingDSIRDAwithin7days,ifforanyreasonheceasestobethedeveloperoris
relievedofhisresponsibilitiesasthedeveloperoftherealestatedevelopment.

xi.

ToinforminwritingDSIRDAwithin7days,ifforanyreasonanyoftheregisteredprofessionals
appointedbyhimhavebeenrelievedoftheirresponsibilities.

xii.

The appointment of the registered Architect/ Engineer shall mean that he has authorised the
Architect/Engineertodoallthingsnecessaryandtotakealladequatemeasuresforpreparingthe
design, drawings and specifications for the project and to appoint on his behalf appropriate
personstoactasregistered,clerkofworkssitesupervisor,requiredfortheproperexecutionof
theprojectandtoretainonbehalfoftheowneranyotherspecialistorexpertrequiredonthe
workoftheproject.

xiii.

He shall not cause or allow any deviations from the approved drawings in the course of the
execution of the project against the instruction the instruction of Architect /Engineer /Site
Supervisor/ClerkofWorks/StructuralDesignerandshallbearallresponsibilityforanyirregularity
committedintheuseandfunctionofthebuildingoritspartsforwhich theapprovalhasbeen
obtained.

xiv.

When no registered construction contractor or site supervisor is required to be appointed and


notappointedheshallberesponsiblefortheirdutiesandresponsibilitiesundertheRegulations.

xv.

Heshallnotcommencetheuseofbuildingorshallnotgivethepossessiontooccupythebuilding
toanyonebeforeobtainingtheoccupancycertificatefromDSIRDA.

xvi.

He shall provide adequate safety measures for structural stability and protection against fire
hazards likely from installation of services like electrical installation, plumbing, drainage,
sanitation,watersupplyetc.whereverrequiredundertheregulations.

xvii. He shall exhibit the names of registered persons only, on site and no additional names will be
exhibited/displayed.
xviii. Heshallexplaintheconstructiondesignanditsintendeduseasperapprovedplanonly,tothe
prospectivepurchaserofthepremisesunderconstruction.
C. Registration:
Registrationofadevelopershallbeasper8.3.2(D).

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

42|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
8.3.7.

ResponsibilitiesofOwners

A. TheResponsibilitiesOfAnOwnerShallBe:
i.

Toappointaregisteredarchitect/engineerandstructuraldesigner;

ii. Toobtainatrelevantstages,forsubmissiontoDSIRDA,certificatesfromthemthatindesigningthe
development and providing detailed drawings and specifications for it they have complied with
requirementsaslaidoutintheGDCR.
iii. Toappointaregisteredsitesupervisor.
iv. To obtain and adhere to the quality assurance procedure prepared by the registered site
supervisor.
v. Toadequatelyenablethesitesupervisortocarryouthisresponsibilities.
vi. Tocertifyalongwiththesitesupervisorthatconstructionofthedevelopmenthasbeenundertaken
as per designs, detailed drawings and specifications provided by the Architect/Engineer and the
StructuralDesigner.
vii. ToobtaindevelopmentpermissionfromDSIRDApriortothedevelopment.
viii. ToregularlysubmitprogressreportsandcertificatesasrequiredbyDSIRDA.
ix. ToobtainoccupancycertificatefromDSIRDApriorusebeingmadeofthedevelopment.
x. To inform in writing DSIRDA within 7 days, if for any reason he ceases to be relieved of his
responsibilitiesastheownerofthedevelopment.
xi. To inform in writing DSIRDA within 7 days if for any reason any of the registered professionals
appointedbyhimhavebeenrelievedoftheirresponsibilities.

8.4. AppointmentofEmployees
8.4.1.

TerminationofEmployees

In case of termination of employment of any of the persons employed under Regulations, it shall be the
dutyofthepersonemployedtointimateimmediatelyinwritingtoDSIRDAspecificallyindicatingthestage
up to which he has supervised the construction. In the absence of any such intimation and until such
intimationhasbeenreceived,personsolastengagedshallbedeemedtocontinuetosupervisetheworkin
question.
8.4.2.

InCaseofDeathofEmployees

WhereanyofthepersonsemployedundertheseRegulationsandrequiredfortheexecutionoftheprojects
diesorceasestobeemployeebeforesuchbuildingworkiscompleted,thefurthererectionofsuchbuilding
orthefurtherexecutionofsuchworkshallforthwithbesuspendeduntilanotherpersonasrequiredunder
theseRegulationsisengagedandhisnamehasbeendulycommunicatedtoDSIRDA.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

43|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
9.

GeneralDevelopmentandBuildingRequirements

9.1. DevelopmentControl
RegulationofanydevelopmentintermsofpermissibleFAR,buildingheight&setbacksinalllandusezones
shallbegovernedbythewidthoftheroadwhichtheplotisaccessedby.Theseregulationsareprovidedin
acomprehensiveforminChapter10,ZoningRegulations
This chapter deals with other general provisions for all developments such as parking, plantation and
maintenanceoftrees,resourceefficiency,waterconservation,andgeneralbuildingrequirements.
9.1.1.
A.

RelaxationinFARorOtherDevelopmentControls
DSIRDAshallpermittheFARandBuiltupAreaofanyland/plotorbuildingunitonthebasisofits
original area, if the owner of such land surrenders the land affected by road widening or for
construction of new road without claiming any compensation thereof; provided that all other
requirementmentionedinthisregulationsarefulfilled.
Minimumrequiredspaceofsetback/marginshallhavetobeprovidedfromthenewboundaryof
land/plotaffectedbyroadwidening.

B.

In case of new construction, constructed according to the provisions of the sanctioned Draft
DevelopmentPlanwherepermissibleheightisnotachievedevenafterconsumptionofpermissible
FAR,additionalFAR upto 25%ofpermissibleFARmaybepermittedsubjecttootherprovisionof
theregulation.
Provided for such construction, structural stability shall be furnished for the existing and new
constructionbyanAuthorisedStructuralEngineer.TheaboveadditionalFARmaybepermittedon
paymentofanamounttowardsadditionalinfrastructurechargeattherateofRs.1500.00persqm.

C.
D.

DSIRDA may give permission for public facilities (CETPs, STPs, substations etc.) in any zone as/if
requiredirrespectiveofzoningdesignatedintheDevelopmentplaninpublicinterest
DSIRDA can grant special permission in height, FAR, Ground Coverage for Special Buildings (Star
Hotels,Hospitals etc.) which have special privileges (under various Government Policies issued
timetotime)(inreferencetoSpecialRegulationsforHospital&Hotels)

9.2. OpenSpaces
Inanylayoutorsubdivisionforalllandusezones,minimumpercentofplotareaasgiveninChapter11
shall be reserved for open spaces as either park, play area or recreational space, which shall, as far as
possible,beprovidedinoneplaceandshallbeofregularshape.
A minimum 50 percent of the minimum open space shall be left unpaved. Paving, if required shall be of
pervioustypewithgridpaversorconcreteblocksallowingpercolationofwaterintothesoil.
Treeplantationisencouragedinopenspacesonlargetractsofopenspacesandnativevegetationareamay
beleftundisturbedintheirnaturalState.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

44|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
9.3. Sustainability
ItisrecommendedthatnewconstructionbuildingsadheretosustainabilityguidelineslaidoutbytheGreen
Rating for Integrated Habitat Assessment (GRIHA) rating system developed by the Ministry of New and
RenewableEnergy,GovernmentofIndiaandTheEnergyResearchInstitute(TERI).
OfthecompletecriterialistedundertheGRIHAratingsystemthefollowingareofgreatersignificanceto
thesedevelopmentregulations:
1. Preserveandprotectlandscapeduringconstruction/compensatorydepositaryforestation
2. Soilconservation(postconstruction)
3. Designtoincludesitefeatures
4. Reducehardpavingonsite
5. Planutilitiesefficientlyandoptimiseinsitecirculationefficiency
6. Provideatleastminimumlevelofsanitation/safetyfacilitiesorconstructionworkers
7. Reduceairpollutionduringconstruction
8. Reducelandscapewaterrequirement
9. Reducebuildingwateruse
10. Efficientwateruseduringconstruction
11. Optimisebuildingdesigntoreduceconventionalenergydemand
12. Renewableenergyutilization
13. Renewableenergybasedhotwatersystem
14. Waterrecycleandreuse(includingrainwater)
15. Storageanddisposalofwaste
16. Minimiseozonedepletingsubstances
17. Ensurewaterquality
18. Tobaccoandsmokecontrol
19. Operationsandmaintenanceprotocolforelectricalandmechanicalequipment
20. Innovation
ItisrecommendedthatnewconstructionshouldtargetachievingcertificationundertheGRIHAevaluation
systemataminimum,whichentailsachievingaminimumscoreof50.

9.4. MinimumPlotSizes
General
MinimumplotsizesforbuildingsshallbeaspertheTable9.1below.
Table91:Minimumplotsizesforbuildings
RESIDENTIALBUILDINGTYPE
LowRiseApartment
MultistoryApartment
RowHouse
Villa
NightShelter/Dharamshala

MINIMUMPLOTSIZE
500sqm
2000sqm
200sqm
300sqm
500sqm

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

45|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
RESIDENTIALBUILDINGTYPE
ReligiousBuilding
COMMERCIALBUILDINGTYPE
StarHotel
LowerGradeHotel
OrganisedRetailMall
UnbrandedRetail
NonGradeAoffice
GradeAOffice
Petrol/CNG/LPGPumpwithservicestation
Petrol/CNG/LPGPumpwithoutservicestation
ServiceEstablishment/workshop
CommunityHall/Theatre/Multiplex/PartyPlot
UtilityBuildings/PublicAmenities

MINIMUMPLOTSIZE
1000sqm
MINIMUMPLOTSIZE
4000sqm
3000sqm
8000sqm
2000sqm
8000sqm
12000sqm
2000sqm
1200sqm
500sqm
3000sqm
500sqm

Plotshavingarealessthan300sqmshouldhavesetbacks/marginsonthreesides(frontrearanyone
side)andplotshavingarea300sqmormorethanshouldhavesetbacks/marginonfoursides(frontrear
bothsides)

9.5. Parking
9.5.1.

General

The principle objective of the parking standards is to ensure that, in assessing development proposals,
appropriate consideration is given to the accommodation of vehicles attracted to the site within the
contextoftherecommendedcitywidepolicyaimedatpromotingmoresustainableformsoftransportation
suchaspublictransitbybusesandtrams.
Where developments incorporate more than one land use which is functioning simultaneously, e.g. a
warehouse containing a large office or a multistorey residential apartment containing a restaurant, the
combinedfiguresapplicabletobothuseswillapply.Conversely,inmultipurposedevelopmentwhereitcan
beshownthatseparateusesoperateatdifferenttimesofthe daygreaterflexibilitywill beapplicableto
considersharedparkingstrategies
ParkingrequirementforallbuildingtypesisgiveninTable9.2intermsofEquivalentCarSpace.
Theminimumareaofparkingspacewillbeasfollows:
EquivalentCarSpace:

Foropenparking18sqmperECS(3mx6m)

Forgroundfloorcoveredparking23sqmperECS(3.5mx6.5m)

ForBasement28sqmperECS(4mx7m)

Truck/bus:3.75mx7.5m

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

46|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Table92:EquivalentCarSpace
VEHICLETYPE
Car/taxi
TwoWheeler
Autorickshaw
Bicycle
Truck
Bus

EQUIVALENTCARSPACE
1
0.25
0.5
0.1
2.25
2.25

9.5.2.

OffStreetParking

The required minimum offstreet parking spaces shall be provided for every new building constructed as
mentionedintheTable9.3below.
Thefollowingreservationsshallbeprovidedwithinallplots

25%ofthetotalparkingareashallbereservedfor2wheelers

5%ofthetotalparkingareashallbereservedforbicycles

Table93:StandardforMinimumParkingRequirementsbyBuildingUse

BUILDINGTYPE
PublicPlaces
PlaceofWorship
Auditorium,Cinema
hall/Multiplex
PublicGarden/Multi
purposeGround
Hospital

EQUIVALENT
CARSPACE
REQUIRED
MINIMUM

UNIT

REMARKS(VISITORSPARKNING)

100sqmofgrossBUA

NoVisitorsParking

20seats

NoVisitorsParking

0.5

100sqmofplotarea

NoVisitorsParking

100sqmofgrossBUA

CommunityHall
0.5
EmploymentCentres
GovernmentOffice,
IT/BusinessPark,
2
CommercialOfficeand
Bank
MixedCommercial
2
OfficeandRetail
Industries
Industrial
1
establishments
CommercialRetailandHospitality
Restaurant/Caf
2
Mall
2
Hotel
2
Wholesale
2.5

100sqmofgrossBUA

50%oftheparkingspacereserved
forvisitors
NoVisitorsParking

100sqmofgrossBUA

Novisitorsparking

100sqmofgrossBUA

50%oftheparkingspacereserved
forvisitors

100sqmofgrossBUA

Novisitorsparking

100sqmofgrossBUA
100sqmofgrossBUA
150sqmofgrossBUA
100sqmofgrossBUA

Novisitorsparking
Novisitorsparking
Novisitorsparking
Novisitorsparking

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

47|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

BUILDINGTYPE

EQUIVALENT
CARSPACE
REQUIRED
MINIMUM

UNIT

REMARKS(VISITORSPARKNING)

75sqmofgrossBUA

Novisitorsparking

trade/FreightComplex
ConvenienceShopping
Centre
Residential
2.5

1.5
Residentialpremises
1

0.5
ParkingforRetailin
MixeduseApartments
(inadditiontoparking
forresidential)
OldAgeHome/Care
Centrefor
Handicapped
Worker
Housing/Dormitory
Education
School
ProfessionalCollege
andUniversity
Campus
Training/Research
Centre
CoachingCentre

foreveryone
Tenementabove150
sqmofbuiltuparea
foreverytenementof
builtupareamore
than100sqmandup
to150sqm
foreverytwo
tenementsofbuiltup
areamorethan60
sqmupto100sqm
foreveryfour
tenementsofbuiltup
areaupto60sqm

25%oftheparkingspacestobe
reservedforvisitorsparking
25%oftheparkingspacestobe
reservedforvisitorsparking

25%oftheparkingspacestobe
reservedforvisitorsparking
25%oftheparkingspacestobe
reservedforvisitorsparking

100sqmofnetretail
space

NoVisitorsParking

1.25

100sqmofgrossBUA

NoVisitorsParking

0.33

100sqmofgrossBUA

NoVisitorsParking

2.25

100sqmofgrossBUA

50%oftheparkingspacereserved
forvisitorsparking

2.25

100sqmofgrossBUA

25%oftheparkingspacestobe
reservedforvisitorsparking

0.7

100sqmofgrossBUA

NoVisitorsParking

2.25

100sqmofgrossBUA

25%oftheparkingspacestobe
reservedforvisitorsparking

NOTE:
1.

BuildingUnits/Plotsabutson9.00mormorewidthroadParkingshallbeprovidedasunder.
ForGroundfloorBuiltupAreawithouthollowplinththeParkingshallbeprovidedasperCommercial
StandardsandforotherfloorsBuiltupAreaParkingshallbeprovidedasperRegulations.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

48|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
2.

Above space shall be provided in addition to adequate vehicular access from street to the parking
space.

3.

Inamarginalspaceof3.0mormoremaybeallowedforparkingifitformspartofparkinglayoutas
requiredgivenbelowthissection

4.

Parking requirement for mix development shall be calculated on prorate basis F.S.I. consumed for
differentuses.

5.

Incaseswheremisuseofparkingspaceisnoticed,theuseofentirebuildingshallbediscontinuedand
the use shall be permitted only after the parking spaces are made possible for parking use. High
penaltyasdecidedbyDSIRDAfromtimetotimeshallbeleviedconsideringtheperiodofmisuseofthe
parkingspaceandthebenefitderivedoutofmisuse.

6.

Incaseswheremoreparkingspaceisrequested,theCompetentAuthoritymaygranttherequest
for providing parking in cellar or at upper floors with specific conditions to take care of genuine
requirements.

7.

Parkingreservedforthevisitorsshallbeprovidedongroundlevelonly.

8.

ProvidedparkingspaceshallnotbecountedtowardscomputationofF.S.I.

TheParkinglayoutshouldfulfilthefollowingconditions
(1)

Theminimumwidthofaccesstostreetfromparkingspaceshallbe

(a)

Fortwowheeler

2.0m

(b)

Forcar

3.0m

(c)

Forlightweightvehiclelike(minibusetc.)

4.5m

(d)

ForHeavyvehiclelike(bus,trucketc.)

6.0m

(2)

ThetwowheelerandCarparkingspaceshallhavetwoindependentingress&egressleadingstreet
ifitsareacapacityexceeds500sqmhavingconcernedwidthasper(a)and(b)aboveprovidedthat
onesuchaccessmaybepermittedifitsminimumwidthis6m.

(3)

In case of cellar for additional 1000sqm parking area an additional two independent ingress &
egresspointsofwidthasper(a)and(b)aboveshallbeprovided.

Thecurvesshallbeprovidedatthejunctionsoframpasprescribedbelow:
i.

1.5mradiusifthewidthofthedrivewaywidthis2.0m

ii.

2mradiusifthewidthofthedrivewaywidthis3.0m

iii.

4.5mradiusifthewidthofthedrivewaywidthis6.0m

(4)

The light and heavy vehicles parking space shall have two independent ingress & egress leading
streetifitsareacapacityexceeds1500sqmhavingconcernedwidthasper(c)and(d)insubpoint
(1)

(5)

Iftheparkingspaceisnotprovidedatstreetlevelthegradientoframpleadingtoparkingspace
shall not be more than 1:7 i.e. the vertical rise shall not exceed more than 1m over a horizontal
distanceof7m.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

49|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
(6)

Clearheadwayof2.4m,shallbeprovidedoneveryaccessleadingtoparkingspaceandatanypoint
inparkingspace.

(7)

Thegeneralarrangementofparkinglayoutshallbeinconformitywiththegeneralinstructionas
maybeissuedbyDSIRDAfromtimetotime.

9.5.3.

Treeplantationincaseofopenparking

Shadetreesshallbeprovidedinopenparkinglotsattherateof1treeforevery10carspacesprovided.The
maturetreesshallbeofaminimum8callipermeasuredataheightof1.5mfromtheground.
9.5.4.

BicycleParking

Communalbicyclestandsneededforresidentialareasandemploymentcentresshouldbelocatedsothat
theycanreadilybeseenfromfrontwindowsandentrancestoprovideinformalsurveillance.
Theyshouldbewelllitafterdarktoenhancepersonalandbicyclesecurity.
Topromotesecurity,theparkingfacilityshouldmakeitpossiblefortheframeofthebicycleandifpossible,
bothwheelstobelockedtothefixture.
9.5.5.

ParkingAreaLayout

Aparkingarealayoutshallfulfilthefollowingconditions:

Theminimumwidthofaccesstostreetfromparkingspaceshallbe3m.

TheCarparkingspaceshallhavetwoindependentaccessesleadingtoastreetifitsareacapacity
exceeds300sqm;onesuchaccessmaybepermittedprovideditsminimumwidthis6m.

Ifparkingspaceisnotprovidedatstreetlevelthegradientoframpleadingtoparkingspaceshall
not be more than 1:10 i.e. the vertical rise shall not exceed more than 1m over a horizontal
distanceof10m.

Clearheadwayof2.4mshallbeprovidedoneveryaccessleadingtoparkingspaceandatanypoint
withintheparkingarea.

Incasewhereabasementisusedforparking,minimumwidthoftheramptothecellarshallbe3m;
Ifthebasementifusedexclusivelyfortwowheelerparking,minimumwidthoftherampshallbe
2mineachdirection.

The general arrangement of parking layout shall be in conformity with the general instruction as
maybeissuedbyDSIRDAfromtimetotime.

9.6. PlantationandMaintenanceofTrees
9.6.1.

InternalTreePlantingPlanforallDevelopments

All applications for building permits or development permits shall include a tree planting plan. The tree
plantingplanshallbesubmittedinwritten/designformandshallconformtothegeneralprovisionsofthis
sectionandallspecificationssetoutintheapplicableguidelinesasissuedbytheDSIRDA.
A. Fordevelopmentsinallzonesexcludingtheindustrialzone:

Atleastonetreeofaminimumcalliperof5cmshallbeplantedper100sqmofgrossbuiltuparea
incaseofnonindustrialdevelopments

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

50|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

Atleast60percentofthetotalnumberoftreesshallbelarge maturingshadetreeswithcanopy
greaterthan5m

B. Fordevelopmentsintheindustrialzone:
At least two trees of a minimum calliper of 5cm shall be planted per 100sqm of gross builtup/industrial
shedareaincaseofnonindustrialdevelopments
Atleast60percentofthetotalnumberoftreesshallbelargematuringshadetreeswithcanopygreater
than5m
C. For all commercial and public buildings with gross built up area more than 5000sqm, a continuous
plantingstripalongtheedgeofthepropertyshallbeprovidedwithspacingasperprovisionsbelow.

For large maturing shade trees, with canopy greater than 5m between 12m to 15m centre to
centre

Forsmallmaturingshadetrees,withcanopybetween2mand5mbetween9mto12mcentreto
centre

9.6.2.

TreePlantingPlanforPublicRoadRightsofWay

A continuous perimeter planting strip, located between the street and sidewalk shall be required for the
variousroadcategoriesasgiveninTable9.4.Spacingrequirementsshallbeinaccordancetosubsection
9.5.3PlantingStriprequirementsforstreettrees
Table94:PlantingStriprequirementsforstreettrees
ROADROW

MINIMUMCALIPER

55m
40m
30m
30m
20m
15m

8cm
8cm
5cm
5cm
5cm
5cm

MINIMUMWIDTHOF
PLANTINGSTRIP
2.5m
2.0m
1.5m
1.5m
1m
1m

9.7. DistancefromWaterCourse
Nodevelopmentwhatsoever,whetherbyfillingorotherwiseshallbecarriedoutwithinthedistancesfrom
waterbodiesasgivenbelow:
1. 150mfromtheboundaryofariverbankwherethereisnoriverembankment;
2. 30mfromanembankmentofariverand
3. 18mfromanala,canal,talav,lake,oranyotherwaterbody.
Exception:
Areaswhereawatercoursepassesthroughalowlyinglandwithoutanywelldefinedbankorchannel,the
applicantmaybepermittedbytheDSIRDAtorestrictordirectthewatercoursestoanalignmentandcross
sectiondeterminedbytheAuthority.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

51|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
9.8. DrainageandFloodPrevention
9.8.1.

GeneralRequirement

Applications for development permission shall be accompanied by a drainage and grading plan.
Developmentonaplotshallnotbepermittedunlesstheadjoiningroadsareconstructed withthestorm
waterdrainageinplace.Applicationsforlargetownships,industrialdevelopmentandsubdivisionoflarge
landparcelsshallbeaccompaniedwithastormwaterdrainageplan.
9.8.2.

Facilities

The developer of plot or subdivision shall provide for installation of all necessary facilities, including
undergroundpipe,inlets,catchbasinsoropendrainageditches,fortheadequatedisposalofsurfacewater,
to maintain any natural drainage course and to establish easements for future sewers and outfalls, if
needed. Other improvements, such as widening, deepening, relocating, clearing, protecting or otherwise
improvingstreambedsandotherwatercoursesforthecontrolofmosquitoesandpublichealthnuisances
shallbeprovidedbythedeveloperinaccordancewiththestandardsandrequirementsoftheappropriate
localpermittingauthorityandapplicableregulations.
9.8.3.

ContentsoftheDrainageandGradingPlan

Drainageandgradingplanshallincludethefollowinginformationaboutthesite:
1. Flowlinesofsurfacewatersontoandoffthesite.
2. Existingandproposedcontoursat0.5mintervals.
3. Existingandproposedretainingwalls.
4. Estimatesofexistingandincreasedrunoffresultingfromtheproposedimprovements.
5. Complete grading plan showing all proposed detention and retention facilities, swales, and
drainage structures. Each plot should be graded at a minimum 1 percent slope for efficient
drainageintothecommonstormwaterdrains.
6. Allproposedpipingincludingsizeandlocationofproposedstormwaterlines,aswellasplanand
profiledrawingsforallproposedimprovements.
7. Drainagefacilitiesshallbeprovidedtocontrolrunofffromallupstreamdrainageareasandfromall
areaswithinthesitetoalocationadequatetoreceivesuchrunoff.Furthermore,drainagefacilities
shall:
a. Bedesignedandconstructedinaccordancewithcityutilitiesdepartmentstandards.
b. Bedurable,easilymaintained,retardsedimentation,andretarderosion.
c. Facilities shall not endanger the public health and safety, or cause significant damage to
property.
d. Be sufficient to accept runoff from the site after development and the present water runoff
fromallareasupstreamtoachievedischargeratesmeetingcityutilitiesdepartmentstandards.
e. Provide storm water runoff quality mitigation in compliance with city utilities department
standards.
f.

Existing water ways or channels should not be filled up; it shall be diverted through proper
drainsintothenaturalwatercourse.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

52|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
9.8.4.

DevelopmentonSitesthathavePoorNaturalDrainage

Developmentproposedforsitesthatareadjacenttoafloodplainarea,locatedinanareawithconverging
drainageflows,locatedinanareacharacterizedbydocumenteddrainageproblems,orlocatedinanarea
withclosed,depressedcontourlinesshallbesubjecttoahigherlevelofdrainageplanreview.Siteplansfor
these areas are additionally subject to the submittal of drainage plans documenting that finished floor
elevationsofstructuresshallbeatleast60cmaboveareasthatwouldbefloodedduringaonehundred
yearstormevent.TheBenchMarksetbytheAuthorityinthenearestlocationshouldbereferredforfixing
thehighfloodlevel.

9.9. DesignforWindandSeismicLoads
All development within the DSIR shall be designed to meet the requirements of the Indian Standard (IS
1893,2002)CriteriaforEarthquakeResistantDesignofStructuresfortheSeismicZoneIII.Necessarywind
load and other factors shall be considered as specified by the Indian Standard (IS 875: part 3, 1987
reaffirmed1997).Everydevelopmentapplicationshallbeaccompaniedbydetailedstructuralcalculations
andassumptions,certifiedbytheappointedstructuralengineer.
Theguidelinessuggested bytheInstituteofSeismologicalResearch,Gandhinagarshallbefollowedwhile
performingStructuralDesignofthebuildings.

9.10. CompoundWallsandGates
9.10.1. SubmissionRequirement
Detailed drawings of gates and boundary walls shall be submitted along with the application for
developmentpermission.Cactushedgeshallnotbeallowedalongtheboundariesofaplotinanyportionof
thedevelopmentarea.Necessaryarrangementsshallbedonetoenablemovementofnaturalwaterways.
9.10.2. HeightofCompoundWalls
A road side compound wall not exceeding 1.5m in height from the crown of the road shall be permitted
whileontheothersidealongtheboundaryofthebuildingunit,themaximumheightofthecompoundwall
shallbe1.8m.
In the case of plots at the junction of streets, boundary wall below the fence grill (with at least 50%
perforation)facingthestreetsshallberaisedtotheheight,nomorethan0.8mfromthekerbforalength
of9mfromthejunctionofthestreets.
Except on the junction of the roads where heights shall be prescribed as per standard design of a
compound wall approved by DSIRDA. In case of mills, buildings of DSIRDA, municipality and Government
buildings,theAuthoritymayallowthecompoundwalltoberaisedtoaheightnotexceeding3mfromthe
crownoftheroadinfrontandonsides;providedthattheheightabove1.5misintheformofafencegrill
withinminimum50%perforation.
9.10.3. PartitionWalls
Apartitionwallshallnotbeallowedanywhereinthemarginsofbuildingunit;providedthatapartitionwall
up to 1.5m height shall be permitted on common boundary of semidetached building and marginal
distancesbetweentwostructures.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

53|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
9.10.4. BurialGroundsandCrematoriums
Theplotsofactiveburialgroundsandcrematoriumabuttingonthemainroadinresidentiallocalityshallbe
providedbytheownerswithacompoundwallhavingaheightnotlessthan1.5mfromthecrownofthe
roadinfront.
9.10.5. Gates
No gates of compound wall shall open outward and shall be provided with a contrivance which shall
preventthegatefromopeningoutwardonthefootpathorroad.
9.10.6. Access
Theentryorexittotheplotsituatedonthejunctionoftheroadshavingawidthof12mormoreshallbe
locatedatleast15mawayfromthecornerpointoftheplotonsuchjunctions.Ifthelengthofasideinsuch
aplotislessthanwhatisprescribedabove,suchentryorexitshallbeprovidedatthefarthestendofthe
plotfromthejunction.

9.11. GeneralBuildingRequirements
9.11.1. Elevators(Lifts)
Aliftshallbeprovidedinallbuildingsasprescribedhereunder:
1. IncaseofBuildinghavingheightmorethan13.0mfromgroundlevel
2. Forresidentialbuildingsoneliftevery20dwellingunitsofallthefloors,orpartthereof
3. Fornonresidentialbuildingsoneliftper1000sqmorpartthereofofbuiltuparea
4. The tenement and builtup area on ground floor and two upper floors shall be excluded in
computingtheaboverequirement.
5. Liftshallbeprovidedfromgroundfloorandshallhaveaminimumcapacityofsixpersons.Onthe
basisofdetailedcalculationsbasedontherelevantprovisionsofNationalBuildingCode(NBC),the
numberofliftscanvary.
6. Notwithstanding anything contained in the Development Control Regulations, for buildings with
heightmorethan21mormore,atleasttwoliftsshallbeprovided.
9.11.2. FireProtections
Incaseofhighrisebuildings,thefollowingprovisionshallbemadeforsafetyofbuildingsfromfire:
1. In addition to the requirement under Regulation 9.11.1, at least one lift designed as firelifts
definedintheNationalBuildingCode(NBC)shallbeinstalled.
2. AtleastonestaircaseshallbeprovidedasafirestaircaseasdefinedintheNationalBuildingCode
(NBC).Providedthatthisshallnotbeapplicableifanytwosidesofastaircasearekepttotallyopen
toexternalopenairspace.
3. Underground water tank shall be provided as fire tank as specified in recommendation of expert
committeeonfiresafety.
4. For high rise buildings, the internal fire hydrants shall be installed as provided in the National
BuildingCode(NBC)orasprescribedintheIndianStandardCode(IS14665,14671,15259,15330,
4591 and 8216) of practice for installation of internal fire hydrants in high rise buildings. The
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

54|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
detailed plan showing the arrangement of pipe lines, booster pumps and watertanks at various
levelsshallbesubmittedforapprovaloftheconcernedauthorityalongwiththeplansandsections
ofthebuildings.Thesameshallbedisplayedateachfloorofthebuilding.
5. Forhighrisebuildings,anexternalfirehydrantshallbeprovidedwithintheconfinesofthebuilding
site, and shall be connected with municipal water mains not less than 101.6 mm in diameter. In
addition, the fire hydrant shall be connected with a booster pump from the static supply
maintainedonsite.
6. In case of high rise buildings separate electric circuits for lift installation, lighting of passages,
corridorsandstairsandforinternalfirehydrantsystemshallbeprovided.
7. Alltherequirementsundertheaboveregulations/shallbeclearlyindicatedonplansdulysignedby
the owner and the person who has prepared the plans. DSIRDA may direct the owner to submit
suchfurtherdrawingsasmaybenecessary,toclarifytheimplementationoftheprovisionsofthe
aboveregulations.
8. Everybuildingwithheightofmorethan25mshallbeprovidedwithdieselgeneratorswhichcanbe
utilizedincaseofpowerfailure.
9. The standard of National Building Code (NBC) must be adopted fully in providing staircase and
alarmsystem.
10. Thereshouldbeprovisionofdrypowder,fireextinguishertotheextentoftwooneachfloorwitha
capacityof5kginallthehighrisebuildings.
9.11.3. SafetyofBuildings
1. All external walls shall be as per the provisions of National Building Code (NBC) and Indian Standard
Specifications.
2. Thethicknessoftheloadbearingwallsinthecaseofmasonrywalledbuildingshallbeasunder:

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

55|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Table95:Wallthicknessesforloadbearingbuildings
BUILDING
FLOORS
Ground+1
Ground+2
Ground+3

GROUNDFLOOR
23
23
35

THICKNESSOFWALLIN(CM)
FIRSTFLOOR
SECONDFLOOR
23

23
23
23
23

THIRDFLOOR

23

IncaseofcellarstheexternalwallsshallbeofR.C.C.onlyanditshallhaveminimumthicknessof0.23mor
0.46mincaseofbrickwork.
3. Subjecttoanyoftheaboveregulationseverypersonwhoundertakesconstructionofabuildingand/or
whodesignsthestructuralmemberofthebuildingshallcomplywiththeprovisionsofNationalBuilding
Code (NBC) prevailing at the relevant time or the provisions of the Indian Standard Specifications
publishedfromtimetotime.
4. Everypersonwhoundertakestheconstructionworkonabuildingordirectsorsupervisessuchworks
shall be responsible and shall ensure use of sound and good quality building materials, properly put
together for optimum safety. He shall be liable for all consequences arising out of breach of these
regulations.
9.11.4. Plinth
1. Habitableroomsshallhaveminimumplinthheightof0.6mfromgroundlevel.
2. Parkinggaragemayhavenoplinth.
3. Providedthatthegroundfloorofabuildingmaybepermittedonstilts/pillarsinsteadofasolidplinth
withaclearheightof2.4mincaseofslabswithbeamsheightshouldnotexceed2.8mandfurtherthat
this space shall at all times be kept free from any enclosure except for genuine staircase. Provided
furtherthataelectricmeterroom,roomfortelephoneD.B;bathroom,waterroom,staircaseroom,
pumproom,watercloset,servantroom,securitycabinmaybepermittedsubjecttomaximumbuiltup
area of 15sqm allowed with a minimum plinth 0.3mand this area shall not be considered towards
computationofF.S.I.
9.11.5. Cellar/Basement
Inabuildingunit,thecellarmaybepermittedonthefollowingconditions:
1. Areaandextent:Thetotalareaofanycellar(basement)shallnotexceedtwicetheplinthareaofthe
building or the area of the plot whichever is less. It may be in one level or two. No cellar shall be
permittedintherequiredminimummarginalspacefromplotboundaryofbuildingunit
2. Cellarshallbepermitted under commonplot,internalroadandinternal marginalspaceforexclusive
useofparkingonly
3. Height of the cellar shall not be less than 2.6 m clear from top of the flooring to the bottom of the
loweststructuralmember.Clearwidthofthestairoftheregularstaircaseleadingtoupperfloors.
4. Nostairstobeconstructedundertheseregulationsshallconsistofanywoodenmaterial.
5. Adequate opening for ventilation should be provided as directed by DSIRDA. The materials of the
constructionandfixturesofthecellarshouldbeoffireresistingnatureandinnocase;woodshallbe
usedasstructuralpartofthecellaroranyfixturesthereof.Theextentofventilationshallbethesame
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

56|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
asrequiredbytheparticularoccupancyforwhichthebasementisused.Anydeficiencymustbemade
goodbyresorttoamechanicalsystem,viz.blowers,exhaustfans,airconditioningsystem,accordingto
the standards in Part VIII Building Services, SectionI Lighting and Ventilation, National Building Code
(NBC).
6. Nowaterconnectionordrainageconnectionshallbepermittedinthecellar.
7. Innocasecellarshallbepermittedtobeconnectedwithnormaldrainageline.
8. Inallthecasednecessaryarrangementsofsumpandpumpingdeviceshallbemadefordewatering.
9. Uses permitted: parking, safe deposit vault, A.C. Plant, Storage other than inflammable material
(NOTE:AreauseforparkingpurposeonlyshallbedeductedforcountingFAR)
10. Ingenuinerequirementofparking,DSIRDAmaypermitthesecondcellariftheparkingspaceavailable
atgroundlevelandinfirstcellarisnotsufficient,forthereasonsStatedinwriting.
9.11.6. Loft
The loft at a minimum height of 2m from floor level not exceeding 30% floor area of the room may be
allowedinanyroom.
9.11.7. Stairs,Lifts,LobbiesandCorridor
Thewidthoflobbiesorcorridorsinbuildingshallbeasunder:
Incaseofresidentialandnonresidentialbuildingexceptindividualdetachedbuildingminimumclearwidth
ofcorridorshallbeasunder:
Table96:Minimumclearcorridorwidthsforbuildings
LENGTHOFCORRIDOR(M)

WIDTHOFCORRIDOR
RESIDENTIAL

NONRESIDENTIAL

Upto6

1.2

Upto9

1.2

1.5

Upto15

1.2

Above15

1.5

2.5

NOTE:
a. Foreveryadditional9mlengthorpartthereofthewidthofcorridorshallbeincreasedby0.30mup
toamaximumof3m
b. Incaseofstarredhotels,thewidthofthecorridorshallbeaspertheauthorizedstandardsofthe
starredhotels.
c. In case of residential dwelling unit occupied by single family and constructed up to three floors
widthofthestairsshallnotbelessthan1.0m.
d. Incaseofallnonresidentialandhighriseresidentialbuildings,theclearwidthofstairandlending
exclusiveofparapetshallnotbelessthan1.5m.
e. Minimumstairwidthformorethan6tenementsoneachfloorshallbe1.5m
f.

Thestaircase&lifts(elevators)shallbesolocatedthatitshallbewithinaccessibledistanceofnot
morethan25mfromanyentranceoftenementoranofficeprovidedoneachfloor.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

57|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
g. Thedesignofthelift&stairalongwiththetreadandrisershallcomplywiththeprovisionsofthe
NationalBuildingCode(NBC)forthatclassofbuilding.
h. Nowindersshallbeallowedexceptincaseofindividualdwellingunit.
9.11.8. SanitaryAccommodation
All the buildings when erected or reerected from foundation or when additions to the floors are made
shallbeprovidedwithminimumsanitaryaccommodation.
1. In the case of use of building as office and public building except cinemas, theatres, meetings and
lecturehalls,minimumsanitaryfacilitiesshouldbeprovidedasunder:
a. Everyofficebuildingorpublicbuildingshallbeprovidedwithatleastonewatercloset.
b. Water closets shall be provided for each sex and the number of such water closets for each sex
shallineverycasebebaseduponthemaximumnumberlikelytooccupysuchbuildingatanyone
time.
c. Oneurinalshallbeprovidedforevery25malesorpartthereofandonewaterclosetforevery25
femalesorpartthereofupto100persons.Foranynumberexceeding100,oneurinalforevery50
personsshallbeprovided.
d. Thereshallbeprovidedonewaterclosetforevery50personsofeachsexorpartthereofupto500
personsandforexcessover500,onewaterclosetforevery100personsofeachsexorpartthereof
shallbeprovided.However,ifthetotalnumberofemployeesinsuchabuildingorthenumberof
personslikelytousesuchbuildingdoesnotexceed20.
e. Onewatercloseteachforbothsexesshallbesufficientandnourinalmaybeprovided.
f.

Thebuildingshallbedeemedtobeoccupiedbypersonsoremployeesattherateofoneperevery
5sqm of the floor area and sanitary facilities shall be provided according to the number of
employeesoroccupantssoworkedout.

g. Such watercloset and urinals shall be in an accessible location and shall be provided with signs
plainlyindicatingtheirpurposesandthesexforwhichtheyaremeant.
2. IndustrialBuildingsandWarehouses:
Alltypesofindustrialbuildingsshallbeprovidedwithminimumsanitaryfacilitiesasunder:
a. Everysuchbuildingshallbeprovidedwithatleastonewaterclosettoprivy:
b. Water closets or privies shall be provided for each sex and number of such closets or privies for
eachsexshallineverycasebebaseduponthemaximumnumberorpersonsofthatsexemployed
inoccupyingsuchbuilding.
c. WaterclosetsorprivyaccommodationshallbeprovidedineveryW.C.onthefollowingscale:
i.

Wherefemalesareemployedthereshallbeatleastonewaterclosetoroneprivyforevery
25females.

ii.

Wheremalesareemployed,thereshallbeatleastonewaterclosetoroneprivyforevery25
males.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

58|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
iii.

Providedthatwherethenumberofmalesemployedexceed100,itshallbesufficientifthere
isonewaterclosetoroneprivyforevery25malesuptothefirst100,andonewatercloset
oroneprivyforevery50thereafter.

iv.

In calculating the number of water closets or privies required under these regulations any
numberofworkerslessthan25or50,asthecasemaybeshallbereckonedas25or50and
thenumberofworkerstobeconsideredshallbethemaximumnumberemployedatanyone
timeduringtheday.

d. Ineverysuchfactorythereshallbeprovidedoneurinalforevery100personsofeachsexorany
lessnumberthereof.
e. Ineverysuchfactorythereshallbeprovidedonewashingplaceof3.6sqminareawithsufficient
numberoftapsasperstandardslaiddownbyrulesinrespectoffactories.
f.

In every building of the warehouse class there shall be provided one water closet for every 50
malesoranylessnumberthereofand onewaterclosetforevery50femalesoranylessnumber
thereofandonewaterclosetforevery50femalesoranylessnumberthereof.Thereafterwater
closetshallbeprovidedattherateofoneclosetforevery70persons.

g. Ineverybuildingofthewarehouseclass,thereshallbeprovidedoneurinalforevery100persons
ofeachsexoranylessnumberthereof.
h. Forthepurposeofdeterminingthenumberofwaterclosetsandurinalseach30sqmofthegross
floorspaceofsuchbuildingshallbedeemedtobeoccupiedbyoneperson.
i.

Such waterclosets and urinals shall be accessible in location and shall be provided with signs
plainlyindicatingtheirpurposeandthesexforwhichtheyaremeant.

3. EducationalBuildings
a. Any building used for educational purpose shall be provided with minimum sanitary facilities as
follows:
b. Subjecttominimumprovisionsoftwowaterclosetsandfiveurinalsforeachsex,thereshallbeone
waterclosetandfoururinalsforevery200studentsorpartthereof.
c. DSIRDAmayenforcethedistributionoftheabovesanitaryfacilitiestobeprovidedateachfloorof
thebuilding.
d. The building shall be deemed to be occupied by students at the rate of one student per every
1.00sqmofthefloorareaofalltheclassroomsandsanitaryfacilitiesshallbeprovidedaccordingto
thenumberofstudentssoworkedout.
4. ResidentialBuildingorResidentialTenements
Eachresidentialbuildingorresidentialtenementshallbeprovidedwithatleastonewatercloset.
9.11.9. Ventilation
1. VentilationofRooms:Everysuchroomwhetheritislivingroomorakitchenshallbeconstructedthat
thesamehaveforthepurposeofventilation:
a. Awindoworwindowsand/orventilatorsclearofthesuchframes,openingdirectlyintoaninterior
or exterior open air space or into an open verandah or gallery abutting on such open air spaces
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

59|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
havinganopeningofnotlessthanonetenthofthefloorareaoftheroomofanaggregateopening
ofdoors,windowsandventilatorsofnotlessthanoneseventhofthefloorareaoftheroom.
b. Suchaggregateopeninginrespectofsittingroomordiningroomofthreeormoreroomtenements
maybeprovidedeitherbywindows,ventilatorsordoors,ifsuchroomabutsonanopenverandah
orgallery.
2. Factoriesandbuildingsofthewarehouses:Everyroominsuchbuildingshallbelightedandventilated
bysufficientnumberofwindows,ventilatorsandskylightsexclusiveofdoorshavingclearopeningnot
lessthan1/7thofthefloorareaabuttingonopenairspaceofwidthnotlessthan1/3rdoftheheightof
thepartofthebuildingabuttingsuchopenspace.
3. Providedthatthisrequirementmayberelaxedifartificiallightingandventilationareinstalledtothe
satisfactionofDSIRDA.
4. Ventilation of staircases: Every stair case provided under the foregoing clauses shall be lighted and
ventilatedtothesatisfactionoftheAuthorityfromanopenairspacenotlessthan1sqm.
5. Windows in staircase bay: There shall be provided a window or windows of an aggregate area of at
least1.2sqmoneachstoreyinsuchofthewallofthestaircaseroomwhichabutsonsuch1sqmopen
airspacetolightandventilatesuchstaircase.
6. VentilationfromtheTopandSkylight:Whereanopenwellforlightandventilation,withinthespace
enclosedbyastairwayanditslandingsisproposedtobeprovided,theleasthorizontaldimensionsof
whichareequaltotwotimesthewidthofthestaircasethentherequirementsofclause(c)and(d)may
be dispensed with provided that there shall be in the roof directly over each such stair well, a
ventilating skylight with provided fixed or movable louvers to the satisfaction of DSIRDA. The glazed
roofoftheskylightshallnotbelessthan3.7sqminarea.Noliftoranyotherfixtureshallbeerectedin
suchstaircasewell.
9.11.10. LocationofOpenings
Everypersonwhoundertakesconstructionworkonabuildingshallsolocateeveryopeningabuttingonany
openspacethatthesillofsuchopeningshallnotbelessthan90cmabovethelevelofthefloorfromwhich
suchopeningisaccessible.
Providedthatifsuchopeningistobeconstructedflushedwithfloorlevel,itslowerportionuptoaheight
of90cmshallbeprotectedbybarsorgrillorsimilarotherdevicestothesatisfactionofDSIRDA.
9.11.11. Stairway
Stairway shall confirm to the following provisions below. In addition, in order to satisfy fire fighting
requirements any stairway identified as an exit stairway shall confirm to the requirement stippled in fire
protectionregulationsprovidedintheseregulations.
1. Width:TheminimumwidthofastaircaseotherthanafireescapeshallbeasgiveninTablehereunder:

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

60|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Table97:MinimumwidthofcommonStairway/Corridorsforoccupancies

SRNO
1

2
3

5
6

TYPEOFOCCUPANCY

MINIMUMWIDTHOF
STAIRCASE/
STAIRWAY/CORRIDOR(IN
METRES)

Residentialbuilding:
Lowrise
HighRise
Hotels
Educationalbuilding
Upto24m.high
Over24m.high
InstitutionalbuildingsHospitals
Upto10beds
Over10beds
AssemblyBuildings
Mercantile,business,industrialstorage,hazardousbuildings
LowRise
HighRise

1.2
1.5
1.5
1.5
2
1.5
2
2
1.5
2

2. Flight:Aflightshallnotcontainmorethan12risers,butinresidentialbuildings,innarrowplotsandin
highdensityhousingasingleflightstaircasemaybepermitted.
3. Risers:Themaximumheightofarisershallbe0.19m.inaresidentialbuildingand0.16minanyother
occupancy.However,onaninternalstairwaywithinadwellingunitarisermaybe0.25mhigh.
4. Treads:Theminimumwidthofthetreadwithoutnosingshallbe0.25mforstaircaseofaresidential
building,otherthanfireescapes.Inotheroccupanciestheminimumwidthofthetreadshallbe0.3m.
Itshallhaveanonslipperyfinishandshallbemaintainedinthatfashion.
5. Headroom:Theminimumheadroominapassageunderthelandingofastaircaseunderthestaircase
shallbe2.2m.
6. Floorindicator:Thenumberofeachfloorshallbeconspicuouslypaintedinfiguresatleast0.15mlarge
onthewallfacingthefightofastairwayoratsuchsuitableplaceasisdistinctlyvisiblefromthefights.
7. HandRail:Handrailaminimumheightof0.9mfromthecentreofthetreadshallbeprovided.
9.11.12. Ramps
1. Rampsforpedestrians:
a. General:Theprovisionsapplicabletostairwayshallgenerallyapplytoramps.Arampinahospital
shallnotbelessthan2.25mwideinadditiontosatisfythefirefightingrequirements,
b. Slope:Arampshallhaveslopeofnotmorethan1:10,itshallbeofnonslipperymaterial.
c. Handrail:Ahandrailshallbeprovidedonboththesidesoftheramp.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

61|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
2. Rampsforhandicappedpeople:Theprovisionoftherampwithahandrailtoeverypublicbuildingon
ground floor only as compulsory for handicapped people, as per the revised National Building Code
(NBC).
3. Rampforbasementorstoriedparking:Forparkingspacesinabasementandupperatleasttworamps
of adequate width and slope shall be provided preferably at the opposite and such ramps may be
permittedinthesideandrearmarginalopenspaces,afterleavingsufficientspaceformovementoffire
fightingequipments.
9.11.13. Roofs
Effectivedrainageofrainwater:Theroofabuildingshallbesoconstructedorframedastopermiteffectual
drainageoftherainwatertherefrombymeansofrainwaterpipes.Suchpipesshallbesoarranged,jointed
andfixedastoensurethattherainwateriscarriedawayfromthebuildingwithoutcausingdampnessin
anypartofthewallsorfoundationsofthebuildingorthoseofadjacentbuildings.
Manner of fixing rain water pipes: Rain water pipes shall be affixed to the outside of the walls of the
buildingorinrecessesorchasescutorformedinsuchwallsorinsuchothermannerasmaybeapproved
byDSIRDA.
9.11.14. Terrace
Terracesshallbefreefrompartitionsofanykindandaccessiblebyacommonstaircase.
9.11.15. Parapet
Parapetwallsandhandrailsprovidedontheedgesoftheroof,terrace,balcony,etc.shallnotbelessthan
1.15m from the finishing floor level and not more than 1.3m height above the unfinished floor level.
Parapet construction shall be made of material and design, such that it ensures optimum safety to the
user/occupantsofthebuilding.
9.11.16. MosquitoProofWaterTank
Water storage tank shall be maintained that perfectly mosquitoproof condition, by providing a properly
fittinghingedcoverandeverytankmorethan1.50minheightshallbeprovidedwithapermanentlyfixed
ironladdertoenableinspectionbyantimalariastaff.
9.11.17. RefuseArea/DisposalofSolidWaste
Whereverapropertyisdevelopedorredeveloped,aspaceforcommunityBinfordisposalofSolidWaste
shallbeprovidedintheroadsidefrontmarginalopenspace.Theowners/occupantsshallberequiredto
providethecommunityBinwithairtightcoverontopatthestandardsprescribedasfollows:
1. The size of community bin (container) shall be calculated at the rate of 10 litres capacity per
tenement/dwelling unit, for Residential use of building; provided that the maximum capacity of
container shall be 80 litres. The numbers of bins shall be calculated on the basis of total no. of
dwelling units/tenements. The waste shall be segregated and placed in the bins provided as per
the MSW 2000 rules. All the recyclable waste and bio degradable waste shall be collected
separatelyanddisposedoffaspertheMSW2000rules.
2. The size of community bin (container) shall be calculated at the rate of the 20 litres capacity for
each100sqmoffloorarea,incaseofnonresidentialuseofbuilding;providedthatthemaximum
capacityofcontainershallbe80litres.Thenumberofbinsshallbecalculatedonthebasisoftotal
number of dwelling units/tenements. The waste shall be segregated and placed in the bins
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

62|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
provided as per the MSW 2000 rules. All the recyclable waste and bio degradable waste shall be
collectedseparatelyanddisposedoffaspertheMSW2000rules.
3. Providedthatincaseofhospitals,hotels,restaurantslikeusesthedisposalofsolidwasteshallbe
carriedoutasperthenormsdecidedbytheauthorityfromtimetotime.
9.11.18. DischargeofRainWater
Norooforterraceabuttingonapublicstreetshallbeconstructedwithoutprovidingsufficientnumberof
downtakepipesandsuchpipesshallbesofixedastodischargetherainwateratalevelnothigherthan0.6
mabovethestreetlevel.
9.11.19. SepticTank
(i)

Locationandsubsoildispersion`Asubsoildispersionsystemshallnotbecloserthan12mto
anysourceofdrinkingwater,suchasawell,tomitigatethepossibilityofbacterialpollutionof
watersupply.Itshallalsobeasfarremovedfromthenearesthabitablebuildingiseconomically
feasiblebutnotcloserthan2mtoavoiddamagetothestructure.

(ii)

Dimensionsetc.

(iii)

a) Septic tank shall have a minimum inner width of 75 cm a minimum depth of 1m below the
waterlevelandapercapitalminimumliquidcapacityof85litres.Thelengthofthetanksshall
beleasttwicethewidth.
b) Septic tanks may be constructed of brick work, stone masonry, concrete or other suitable
materialasapprovedbyDSIRDA.
c) Under no circumstances should effluent from a septic tank or allowed into an open channel
drainorbodyofwaterwithoutadequatetreatment.
d) The minimum normal diameter of the pipe shall, be 100 mm. Further at junction of pipes in
manholes,thedirectionofflowfromabranchconnectionshouldnotmakeanangleexceeding
45withthedirectionofflowinthemainpipe.
e) Thegradientsoflanddrains,underdrainageaswellasthebottomofdispersiontrenchesand
soakwellsshouldbebetween1:300and1:1400.
f)

Everyseptictankshallbeprovidedwithaventilatingpipeofatleast50mmdiameter.Thetop
ofthepipeshallbeprovidedwithasuitablecageofmosquitoproofwiremesh.Theventilating
pipe shall extend to a height which would cause no smell or nuisance to any building in the
area. Generally, the ventilating pipe should extend to a high of about 2 m above the septic
tankbuildingwhenitislocatedcloserthan15m

g) When the disposal of a septic tank effluent is to a seepage pit, the seepage pit may be of
sectionaldimensionof90cmandnotlessthan100cmindepthbelowtheinnerlevelofthe
inletpipe.Thepitmaybelinedwithstone,brickandconcreteblockswithdryopenjointwhich
shouldbebackedwithatleast7.5cmofcleancoarseaggregate.Theliningabovetheinletlevel
should be narrowed to reduce the size of the R.C.C. cover slabs. Where no lining is used,
especiallyneartreestheentitledpitshouldbefilledwithloosestones.Amasonryringshould
beconstructedatthetopofthepittopreventdamagebyfloodingofthepitbysurfacerunoff.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

63|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
The inlet pipe should be taken down to a depth of 90 cm from the top an anti Mosquito
Measure.
h) Whenthedisposalofseptictankeffluentistoadispersiontrench,thedispersiontrenchshall
be50to100cmwideexcavatedtoaslightgradientandshallbeprovidedwithalayerofshed
gravelorcrushedstones15to25cmdeep.Openjoinedpipesplacedinsidethetrenchshallbe
madeofunglazedearthenwareclayorconcreteandshallhaveaminimuminternaldiameteror
70to100mm.Eachdispersiontrenchshouldnotbelongerthan30mandtrenchesshouldnot
beplacedcloserthan1.8mtoeachother.
TheabovementionedRegulationsshallbesubjecttomodificationformtimetotimeasrequiredbyGujarat
PollutionControlBoard/DSIRDA
9.11.20. PercolatingwellwithRainWaterharvestingandrecyclingsystem
Fortheareaofbuildingunitabove500sqmandupto1500sqm,theowner/developershallcarryoutwater
harvestingsystemasspecifiedbytheauthority.
Inthecasewheretheareaofbuildingunitexceeds1500sqmandupto4000sqmowner/developerhasto
provide/constructpercolatingwellwithrainwaterharvestingsysteminbuildingunitandattherateofone
percolatingwellforevery4000sqmorpartthereofbuilding
i.

ii.

iii.

Conservationandharvestingofrainwaterinbuildings
Havingplinthbuiltupareaof80sqmormore,everysuchbuildingshallbeprovidedwithrequired
facilitiesandinfrastructureforconservationandharvestingofrainwaterviz.
Percolationpits
The ground surface around the building shall have percolation pit or bore as recommended by
DSIRDA covering within the building site, or bore recharge. Such pits shall be filled with small
pebblesorbrickjellyorriversandandcoveredwithperforatedconcreteslabs
Terracewatercollection
The terrace may be connected to a sump or bore well through a filtering tank by PVC pipe as
recommended by DSIRDA. A valve shall be incorporate to enable the first part of the rain water
collectedtobedischargedouttothegroundifitisdirty

9.12. RecycleandReuseofWater
9.12.1. UseofRecycledWaterorDesalinatedWaterforIndustries
ForIndustriesrequiringtheuseofwaterexceeding5000m3perday,itwillbemandatoryforthemtouse
IndustrialGradeRecycledWaterordesalinatedwater.Thismaybethroughcaptiverecyclingplantor
desalinationplantorthroughamerchantrecyclingplant/merchantdesalinationplant.Incasetheuseor
recycledwaterordesalinatedisnotfoundfeasibleornotpermittedunderanotherlaw/rule/rules,aNo
objectionforthesameshallbeobtainedfromDSIRDA.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

64|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
10. ZoningRegulations
10.1. Introduction
TheDraftDevelopmentPlanfortheDSIRcomprisesof15landusezones.Developmentwithinthelanduse
zoneswillberegulatedonthebasisofhierarchyoftheroadfromwhichanygivenlandparcelisaccessed.
Figure10.1illustratesthelandusezonesandroadhierarchyrespectivelyoftheDraftDevelopmentPlan.
This chapter describes the permitted uses and development control regulations applicable for each land
usezone.
10.1.1. SpecialRegulation
DSIRDA may give permission for public facilities (CETPs, STPs, substations etc.) in any zone as/if
requiredirrespectiveofzoningdesignatedintheDevelopmentplaninpublicinterest
10.1.2. RegulationinNotifiedForest

RegulationsandPermissionsinNotifiedforestwillbeinadherencetotheForestConservationAct
1980. PermissionwillbegivenonobtainingNOCfromCompetentForestAuthority.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

65|P a g e

Figure101:SpatialDevelopmentPlanwithRoadHierarchy

DraftGeneralDevelopmentControlRegulations(DGDCR)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

66|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
10.2. ResidentialZone
10.2.1. Intent
Theintentinestablishingaresidentialzoneis:

To promote residential development on a range of building typologies on existing undeveloped


land;

To provide for the development of recreational, religious and educational facilities as basic
elementsofabalancedcommunity;

Toprotecttheresidentialcommunitiesfromnuisancesarisingfromincompatibleuses.

10.2.2. UsesPermitted
A. Theresidentialzoneisprimarilyintendedforthefollowingbuildinguses

Residentialmultistoreyapartment

Terraced/RowHouse

Villas/Bungalow

Siteandservices/otherhousingschemesfortheEWS

Oldagehome

B. Nonresidentialbuildingusesthatarecomplimentarytotheresidentialdevelopmentwillbepermitted

Banquet/Communityhall

Library

Garden/playground

Recreationalclubhouse

PlacesforWorship

Nightshelter

Neighbourhoodretail

10.2.3. DevelopmentControlRegulations
Table 10.1 provides development control regulations for development density (FAR), minimum
requirements for open space, setbacks and permitted uses. These regulations are applicable for plots
measuring 3ha or smaller. For plots larger than 3ha, additional requirements as per the Subdivision
Guidelines(Chapter11)shallapply.
10.2.4. GeneralDevelopmentRequirements
In addition to the above given development control regulations, all developments shall adhere to the
commondevelopmentrequirements(Chapter9)whichcoverthefollowingelements:

Sustainability
Parking(refertable9.3)
MinimumPlotsizes(refertable9.1)
Plantationandmaintenanceoftrees
Drainageandfloodprevention
Seismicdesign
Compoundwallsandgates
Generalbuildingrequirements

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

67|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Table101:DevelopmentControlRegulationsforResidentialZone
MINIMUM
SR
ROAD
NO
ROW
(METRES)

MAXIMUM
GROUND
MAXIMUM
COVERAGEAS
FAR
PERCENTOF
PLOTAREA

MAXIMUM
BUILDING
HEIGHT

55and
above

60%

G+5or18m
whicheveris
less

25to
Below55

1.5

60%

G+3or15m
whicheveris
less

Below25

50%

G+2or10m
whicheveris
less

MINIMUM
SETBACKS
(FRONT
PERMITTEDUSEPREMISES
REARBOTH
SIDES)
RESIDENTIALZONE
CinemaHall,RetailMall,
5m6m Petrol/CNG/LPGPump,Bank,HospitalA
6m6m
andBandallusesgivenin(2)and(3)
below
(2)NeighbourhoodRetail/Service
Shop,Restaurant/Caf,HawkerZone,
DesignatedVegetableMarket/bazaar,
CommercialCentre,Primary
andSecondarySchool;Multipurpose
5m5m
groundlargerthan5ha;Placeof
5m5m
WorshiponPlotlargerthan1000sqm;
Service/RepairShop;Veterinary
Hospital;Public
Facility/Infrastructure/Utility
Buildings;andallusesgivenin(3)below
(3)Multistoreyapartmentandclusters
thereof;Rowhouse,Villa/Bungalow;
Multipurposegroundsmallerthan5ha;
Terraced/RowHouse;Villa/Bungalow;
HousingforEWS;NightShelter;OldAge
3m3m3m Home;
3m
MaternityHome,NursingHome,
Kindergarten,Daycare,Dispensary,
VeterinaryClinic,Healthclub,Placeof
Worshiponplotsmallerthan1000sqm,
CommunityHall,HealthClub,Swimming
Pool

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

68|P a g e

CONDITIONALUSESUBJECTTOSPECIALPERMIT
FROMDSIRDA

Thefollowingusesmaybepermittedsubjectto
approvalofaspecialpermitonacasebycasebasis:
Cemeteries/BurialGround
Broadcastingtowersandlineofsiterelaydevices
fortelephonic,radioortelevisioncommunications
Thefollowingusesandstructuresshallbepermitted
asancillaryusestothemainuseofthebuilding
providedtheirname,location
andsize(ifapplicable)isindicatedinthesiteplan
submittedforapproval.
1.Partofaresidencemaybepermittedforuseas
professionalofficeforadvocates,chartered
accountants,architects,doctors,engineersorthe
like,orasasmallscalehomebasedworkshop
subjecttothefollowing
conditions:
itisnotlocatedinamultistoreyapartment;
thenumberofemployeesdonotexceed10;
itdoesnotinvolveinstallationanduseofheavy
machinery,anddoesnotcreatenoise,vibration,
fumeordust;
separatemeansofaccessandadesignated
parkingareaforstaffandvisitorsisprovidedand
markedonthesiteplansubmittedforapproval.
2.Devicesforgenerationofnonconventional
energy,suchassolarpanels,windpower
3.Servantquartersorlodgingfacilitiesfor

DraftGeneralDevelopmentControlRegulations(DGDCR)
MINIMUM
SR
ROAD
NO
ROW
(METRES)

MAXIMUM
GROUND
MAXIMUM
COVERAGEAS
FAR
PERCENTOF
PLOTAREA

MAXIMUM
BUILDING
HEIGHT

MINIMUM
SETBACKS
(FRONT
PERMITTEDUSEPREMISES
REARBOTH
SIDES)
RESIDENTIALZONE

CONDITIONALUSESUBJECTTOSPECIALPERMIT
FROMDSIRDA

caretaker/securitypersonnel
DSIRDAcangrantspecialpermissioninheight,FAR,
GroundCoverageforSpecialBuildings(StarHotels,
Hospitalsetc.)whichhavespecialprivileges(under
variousGovernmentPoliciesissuedtimetotime)(in
referencetoTownship,SpecialRegulationsfor
hospitals,SpecialRegulationsforHotels)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

69|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
10.3. HighAccessCorridorZone
10.3.1. Intent
TheintentinestablishingaHighAccessCorridorzoneis:

To promote high density, mixeduse, transit oriented development on existing undeveloped land
alongplannedpublictransportroutesandencourageuseofpublictransit;

To achieve higher levels of mobility in the zone and choice for residents and visitors to access
employmentcentres,servicesandrecreationalactivities;

Toachievehighresidentialdensity

To create dense walkable communities in proximity to public transport infrastructure, providing


forahighqualitypublicrealmandcommunityfacilities.

10.3.2. UsesPermitted
A. Thehighaccesscorridorzoneisprimarilyintendedforthefollowingpremises:
Residentialmultistoreyapartment

WorkerHousing/Dormitories

Siteandservices/otherhousingschemesfortheEWS

Oldagehome

Nightshelter/Dharamshala

B. Thefollowingnonresidentialusepremiseswillbepermitted:
CommunityFacilities

Banquet/communityhall
Library
Garden/playground
Recreationalclubhouse
Placesofworship
Healthclub/swimmingPool
Crche/daycarecentre

Education

Anganwari/kindergarten
Primaryandsecondaryschool
Schoolforphysically/mentallychallenged
Coaching/TrainingCentres
Junior,SeniorandProfessionalCollege

Service/Commercial

NeighbourhoodRetailShop
CommercialCentre
DesignatedBazaar/HawkerZone
Service/RepairShop

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

70|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

LightIndustrialWorkshopwitharealessthan50sqm
AutoServiceStation
Restaurant/InformalEatery
Bank
Hotel
CinemaHall/Multiplex
Mall
MultilevelParkingGarage
Health
Dispensary
NursingHomeandMaternityHome(upto25beds)
HospitalC(upto100beds)andD(upto200beds)
Diagnostic/RadiologyCentre/BloodBank
VeterinaryClinicandHospital

10.3.3. DevelopmentControlRegulations
Table 10.2 provides development control regulations for development density (FAR), minimum
requirements for open space, setbacks and permitted uses. These regulations are applicable for plots
measuring 3ha or smaller. For plots larger than 3ha, additional requirements as per the Subdivision
Guidelines(Chapter11)shallapply.Minimumroadwidthshallbe18m.
10.3.4. GeneralDevelopmentRequirements
In addition to the above given development control regulations, all developments shall adhere to the
commondevelopmentrequirements(Chapter9)whichcoverthefollowingelements:

Sustainability
Parking(refertable9.3)
MinimumPlotsizes(refertable9.1)
Plantationandmaintenanceoftrees
Drainageandfloodprevention
Seismicdesign
Compoundwallsandgates
Generalbuildingrequirements

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

71|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Table102:DevelopmentControlRegulationsfortheHighAccessCorridor
SR
NO

MINIMUM
ROADROW
(METRES)

MIN.PLOT
SIZE

MAXIMUM
FAR

MAXIMUM
GROUND
COVERAGEAS
PERCENTOFPLOT
AREA

MAXIMUM
BUILDING
HEIGHT*

MINIMUM
SETBACKS
(FRONT
REARBOTH
SIDES)

PERMITTEDUSEPREMISES

CONDITIONALUSESUBJECTTOSPECIAL
PERMITFROMDSIRDA

HIGHACCESSCORRIDOR

55m&
above

25m&
Below55

5000
sqm**

1500sqm

010%

150m

10m8m6m
6m

Above1020%

126m

9m7m6m
6m

Above2030%

32m

8m6m6m
6m

2.5

40%

20m

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

8m6m6m
6m

Multistoreyapartmentand
clustersthereof;Serviced
apartments;Dormitories/
WorkerHousing;
Dharamshala;
CinemaHall,Mall
Petrol/CNG/LPGPump,Auto
ServiceStation,LightIndustrial
Workshopwitharealessthan
50sqm;HospitalCandD,
Budgetand3StarHotel,
Junior,SeniorandProfessional
Colleges;MultilevelParking
andallusepremisesgivenin
thecategoriesbelow
Multistoreyapartmentand
clustersthereof;Serviced
apartments;Dormitories/
WorkerHousing;P
Petrol/CNG/LPGPump
Dispensary,Maternity
home/NursingHome,
Diagnostic/Radiology
Centre/BloodBank,Placeof
Worshiplargerthan1000sqm;
CommercialCentre;Public
Facility/Infrastructure/Utility

72|P a g e

Thefollowingusesmaybepermitted
subjecttoapprovalofaspecialpermiton
acasebycasebasis:
Cemeteries/BurialGround
Broadcastingtowersandlineofsite
relaydevicesfortelephonic,radioor
televisioncommunications

Thefollowingusesandstructuresshallbe
permittedasancillaryusestothemain
useofthebuildingprovidedtheirname,
locationandsize(ifapplicable)isindicated
inthesiteplansubmittedforapproval.
1.Partofaresidencemaybepermitted
foruseasprofessionalofficefor
advocates,
charteredaccountants,architects,
doctors,engineersorthelike,orasa
smallscalehomebasedworkshopsubject
tothefollowingconditions:
itisnotlocatedinamultistorey
apartment;
thenumberofemployeesdonot
exceed10;
itdoesnotinvolveinstallationanduse
ofheavymachinery,anddoesnotcreate
noise,vibration,fumeordust;

DraftGeneralDevelopmentControlRegulations(DGDCR)
SR
NO

MINIMUM
ROADROW
(METRES)

MIN.PLOT
SIZE

MAXIMUM
FAR

MAXIMUM
GROUND
COVERAGEAS
PERCENTOFPLOT
AREA

MAXIMUM
BUILDING
HEIGHT*

MINIMUM
SETBACKS
(FRONT
REARBOTH
SIDES)

PERMITTEDUSEPREMISES

HIGHACCESSCORRIDOR
Buildings;Hostelsforworking
professionals;Restaurants,
FoodPlazasandFoodStreets

Below25m

1500sqm

40%

16m

8m6m6m
6m

Multistoreyapartmentand
clustersthereof;Serviced
apartments;Dormitories/
WorkerHousing;
NeighbourhoodRetailShop;
PlaceofWorshipsmallerthan
1000sqm;ServiceandRepair
Shopssmallerthan25sqm;
garden

CONDITIONALUSESUBJECTTOSPECIAL
PERMITFROMDSIRDA

separatemeansofaccessanda
designatedparkingareaforstaffand
visitorsisprovidedandmarkedonthe
siteplansubmittedforapproval.
2.Devicesforgenerationofnon
conventionalenergy,suchassolarpanels,
windpower
3.Servantquartersorlodgingfacilitiesfor
caretaker/securitypersonnel

DSIRDAcangrantspecialpermissionin
height,FAR,GroundCoverageforSpecial
Buildings(StarHotels,Hospitalsetc.)
whichhavespecialprivileges(under
variousGovernmentPoliciesissuedtime
totime)(inreferencetoTownship,Special
Regulationsforhospitals,Special
RegulationsforHotels)

*HeightofthebuildingmustcomplytotheprevalentFireSafetyNorms,withpermissionsfromDSIRDA
** ForPlotsizesof5000sqmandaboveIncaseofabuildingwithpodiumandtower,agroundcoverageofmaximum40%willbeallowedforamaximumheightupto8

m,includingGorG+1whicheverisless.Theuppertypicalfloorsabovepodiumwillhaveamaximumplanareaof10%.ThemaximumFARallowedinthiscasewillbe5.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

73|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
10.4. CityCentreZone
10.4.1. Intent
TheintentinestablishingaCityCentrezoneis:

Topromoteconcentrationofandmixtureofcommercialofficeandretail,institutional,health,civic
andmediumtohighdensityresidentialuses;

Tocreateavibranturbanenvironmentthroughachievingabalanceintheshareoflandbetween
the public and private realm, providing opportunities for the creation of pedestrian friendly
streetscapeandpublicplazas;

Toprovideadevelopmentpatternthatsupportspedestrianmovement,bicyclesanduseofpublic
transportation

10.4.2. UsesPermitted
A. Thefollowingnonresidentialusesshallbepermitted:
Commercial

IntegratedCommercialOfficeandRetailComplex
BankingandFinancialInstitutions
Hotel
CinemaHall/Multiplex
Mall
Restaurant/InformalEatery
AllRetailStores
LargeDepartmentalStore
MultilevelParkingStructure

PublicBuildings

CityAdministrativeComplex
PoliceHeadquarters
CityCourt
RegionalPostOffice
TelephoneExchange
Research/TrainingCentre
Integratedmultimodalpassengertransporthub

CommunityFacilities

ConventionandExhibitionCentre
PublicLibrary
Museum/ArtGallery
Auditorium/Theatre
IntegratedSportsComplex
RegionalPark/LocalGarden
RecreationalClub
PlaceofWorship

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

74|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

Healthclub/swimmingPool
Crche/daycarecentre
Education
Junior,SeniorandProfessionalCollege

Health
Polyclinic
HospitalA,B,CandD
Diagnostic/RadiologyCentre
Otherhealth/familywelfarecentre
B. The following residential use premises is intended for the following premises, subject to the
developmentnorms:
Residentialmultistoreyapartment/ServicedApartment
10.4.3. DevelopmentControlRegulations
Table 10.3 provides development control regulations for development density (FAR), minimum
requirements for open space, setbacks and permitted uses. These regulations are applicable for plots
measuring 3ha or smaller. For plots larger than 3ha, additional requirements as per the Subdivision
Guidelines(Chapter11)shallapply.Minimumroadwidthshallbe18m.
10.4.4. GeneralDevelopmentRequirements
In addition to the above given development control regulations, all developments shall adhere to the
commondevelopmentrequirements(Chapter9)whichcoverthefollowingelements:

Sustainability
Parking(refertable9.3)
MinimumPlotsizes(refertable9.1)
Plantationandmaintenanceoftrees
Drainageandfloodprevention
Seismicdesign
Compoundwallsandgates
Generalbuildingrequirements

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

75|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Table103:DevelopmentControlRegulationsfortheCityCentreZone

SR
NO

MINIMUM
ROADROW
(METRES)

MIN.PLOT
SIZE

MAXIMUM
FAR

MAXIMUM
GROUND
COVERAGEAS
PERCENTOFPLOT
AREA

MAXIMUM
BUILDING
HEIGHT*

MINIMUM
SETBACKS
(FRONT
REARBOTH
SIDES)

PERMITTEDUSEPREMISES

CONDITIONALUSESUBJECTTOSPECIAL
PERMITFROMDSIRDA

CITYCENTRE

55m&
above

25m&
Below55

5000
sqm**

1500sqm

010%

150m

10m8m6m
6m

Above1020%

126m

9m7m6m
6m

Above2030%

32m

8m6m6m
6m

2.5

40%

20m

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

8m6m6m
6m

ConventionandExhibition
Centre;SportsComplex;
Auditorium;
IntegratedMultimodal
PassengerTransportHub;
Dormitories;
Museum;Superspecialty
Hospital
ResidentialMultistorey
Apartments;Serviced
Apartments,Petrol/CNG/LPG
Pumpandallusesgivenbelow
MultilevelParking;Office
Complex,RetailMall,Cinema
Hall;CommercialComplex,
Restaurants,FoodPlazasand
FoodStreets;OtherRetail;
Public/GovtInstitutional
Buildings,TrainingCentre;Art
Gallery;Diagnostic/Radiology
Centre;HospitalCandD;
Health/WelfareCentre;Place
ofWorshiplargerthan
1000sqm;Public
Facility/Infrastructure/

76|P a g e

Thefollowingusesmaybepermitted
subject
toapprovalofaspecialpermitonacase
bycasebasis:
Cemeteries/BurialGround
Broadcastingtowersandlineofsite
relaydevicesfortelephonic,radioor
televisioncommunications
Thefollowingusesandstructuresshallbe
permittedasancillaryusestothemain
useofthebuildingprovidedtheirname,
location
andsize(ifapplicable)isindicatedinthe
siteplansubmittedforapproval.
1.Partofaresidencemaybepermitted
foruseasprofessionalofficefor
advocates,charteredaccountants,
architects,doctors,engineersorthelike,
orasasmallscalehomebasedworkshop
subjecttothefollowing
conditions:
itisnotlocatedinamultistorey
apartment;
thenumberofemployeesdonotexceed
10;
itdoesnotinvolveinstallationanduseof
heavymachinery,anddoesnotcreate

DraftGeneralDevelopmentControlRegulations(DGDCR)
SR
NO

MINIMUM
ROADROW
(METRES)

MIN.PLOT
SIZE

MAXIMUM
FAR

MAXIMUM
GROUND
COVERAGEAS
PERCENTOFPLOT
AREA

MAXIMUM
BUILDING
HEIGHT*

MINIMUM
SETBACKS
(FRONT
REARBOTH
SIDES)

PERMITTEDUSEPREMISES

CONDITIONALUSESUBJECTTOSPECIAL
PERMITFROMDSIRDA

CITYCENTRE
UtilityBuildings;
Petrol/CNG/LPGPump

Below25m

1500sqm

40%

16m

8m6m6m
6m

Restaurants,FoodPlazasand
FoodStreets;Neighbourhood
RetailShop;CommunityHall;
HealthClub;Dispensary;Place
ofWorshipsmallerthan
1000sqm;

noise,vibration,fumeordust;
separatemeansofaccessanda
designatedparkingareaforstaffand
visitorsisprovidedandmarkedonthesite
plansubmittedforapproval.
2.Devicesforgenerationofnon
conventional
energy,suchassolarpanels,windpower
3.Servantquartersorlodgingfacilitiesfor
caretaker/securitypersonnel

DSIRDAcangrantspecialpermissionin
height,FAR,GroundCoverageforSpecial
Buildings(StarHotels,Hospitalsetc.)
whichhavespecialprivileges(under
variousGovernmentPoliciesissuedtime
totime)(inreferencetoTownship,Special
RegulationsforHospitals,Special
RegulationsforHotels

*HeightofthebuildingmustcomplytotheprevalentFireSafetyNorms,withpermissionsfromDSIRDA
**ForPlotsizesof5000sqmandaboveIncaseofabuildingwithpodiumandtower,agroundcoverageofmaximum40%willbeallowedforamaximumheightupto8

m,includingGorG+1whicheverisless.Theuppertypicalfloorsabovepodiumwillhaveamaximumplanareaof10%.ThemaximumFARallowedinthiscasewillbe5.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

77|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
10.5. KnowledgeandITZone
10.5.1. Intent
TheintentinestablishingaKnowledgeandITzoneis:

To create a conducive environment for development of business/IT parks and educational


campuses;
To provide an environment for campus residential use such as guest houses, staff quarters and
studentshostel,supportingtheintendedprimaryuses;
Toprovideforsupportingcommercialretail,servicesandcivicuseswithinplannedbusiness/ITand
educationalcampuses

10.5.2. PrerequisiteforDevelopment
AnydevelopmenttobecarriedoutaspartofthiszonewillrequireapprovalofaCampusMasterPlanwhich
shallbesubjecttotheSubdivisionGuidelines(Chapter11).Themasterplanshouldataminimum,caterto
thefollowing:

Illustrationofactivityzones/buildinguses
Trafficandtransportationstudy
Landscapemasterplan
Pedestrianandvehicularcirculation
Urbandesignguidelines
Infrastructureandutilitiesplan

10.5.3. UsesPermitted
A. Thefollowingnonresidentialusepremiseswillbepermitted:
Office

OfficeComplex
Business/ITParkCampus

EducationalUses

Educationalcampuswithintegratededucation,administrative,residentialbuildingsandsupporting
facilities
Junior,seniorandprofessionalcollege
Medicalcollegewithattachedhospital
Technicalinstituteforresearchanddevelopment
Scientificresearchcentre
Vocationaltrainingcentre
K12integratedschoolwithorwithouthostel

Commercial

Hotels
Neighbourhoodretail
Restaurant/Informaleatingplaces

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

78|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
CommunityFacilities

LocalGarden
RecreationalClub
PlaceofWorship
Healthclub/swimmingPool
Crche/daycarecentre

Health

Polyclinic
Medicalcollegewithattachedhospital
Diagnostic/radiologycentre
Otherhealth/familywelfarecentre

B. The following residential use premises shall be permitted only as components within the Campus
MasterPlan.Singleusedevelopmentfortheseusesisnotallowedunlessthe areaisdesignatedasa
campusdistrict/zoneorisunderguidanceofacomprehensivemasterplanprimaryservingeducational
orITcampuses.

Hostel
Servicedapartment
Terraced/rowhouse
Villa/bungalow

10.5.4. DevelopmentControlRegulations
Table 10.4 below provides development control regulations for development density (FAR), minimum
requirements for open space, setbacks and permitted uses. These regulations are applicable for plots
measuring 3ha or smaller. For plots larger than 3ha, additional requirements as per the Subdivision
Guidelines(Chapter11)shallapply.Minimumroadwidthshallbe18m.
10.5.5. GeneralDevelopmentRequirements
In addition to the above given development control regulations, all developments shall adhere to the
commondevelopmentrequirements(Chapter9)whichcoverthefollowingelements:

Sustainability
Parking(refertable9.3)
MinimumPlotsizes(refertable9.1)
Plantationandmaintenanceoftrees
Drainageandfloodprevention
Seismicdesign
Compoundwallsandgates
Generalbuildingrequirements

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

79|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Table104:DevelopmentControlRegulationsfortheKnowledgeandITZone
MAXIMUM
MINIMUM
GROUND
MAXIMUM
SR
MIN.PLOT MAXIMUM
ROADROW
COVERAGEAS
BUILDING
NO
SIZE
FAR
(METRES)
PERCENTOFPLOT
HEIGHT*
AREA

MINIMUM
SETBACKS
(FRONT
REARBOTH
SIDES)

PERMITTEDUSEPREMISES

CONDITIONALUSESUBJECTTOSPECIAL
PERMITFROMDSIRDA

KNOWLEDGEANDIT

55m&
above

5000
sqm**

25m&
Below55

1500sqm

2.5

010%

Above1020%

Above2030%

40%

150m

126m

32m

20m

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

10m8m6m
6m

9m7m6m
6m

UniversityCampus;Fourand
FiveStarHotel,Multistorey
ServicedApartment;Hostel
andallusepremisesin(2)and
(3)exceptVilla/Bungalowand
terraced/RowHouse;
Petrol/CNG/LPGPump

8m6m6m
6m

8m6m6m
6m

MultilevelParking;Office
BusinessPark;Commercial
Office;ITPark;Professional
College;
3StarHotel;Commercial
Retail;Restaurants,Food
PlazasandFoodStreets;
CinemaHall/Multiplex;Multi
storeyServicedApartment;
andallusepremisesin(2)and
(3)exceptVilla/Bungalow
andterraced/RowHouse;
Petrol/CNG/LPGPump

80|P a g e

Auditorium/CinemaHallmaybepermitted
withinarecreationcentremeantfor
university
studentsandstaff.Suchabuildingwillnot
bepermittedtsupportlargescaleretail
usesuchasamall.

Thefollowingusesmaybepermitted
subjecttoapprovalofaspecialpermiton
acasebycasebasis:
Cemeteries/BurialGround
Broadcastingtowersandlineofsite
relaydevicesfortelephonic,radioor
televisioncommunications

Thefollowingusesandstructuresshallbe
permittedasancillaryusestothemain
useofthebuildingprovidedtheirname,
location
andsize(ifapplicable)isindicatedinthe
siteplansubmittedforapproval:
Devicesforgenerationofnon
conventionalenergy,suchassolarpanels,
windpower
Servantquartersorlodgingfacilitiesfor

DraftGeneralDevelopmentControlRegulations(DGDCR)
SR
NO

MINIMUM
ROADROW
(METRES)

MIN.PLOT
SIZE

MAXIMUM
FAR

MAXIMUM
GROUND
COVERAGEAS
PERCENTOFPLOT
AREA

MAXIMUM
BUILDING
HEIGHT*

MINIMUM
SETBACKS
(FRONT
REARBOTH
SIDES)

PERMITTEDUSEPREMISES

CONDITIONALUSESUBJECTTOSPECIAL
PERMITFROMDSIRDA

KNOWLEDGEANDIT

Below25m

1500sqm

40%

16m

8m6m6m
6m

OfficeBuildingwithlessthan
100employees;BudgetHotel;
Restaurants,FoodPlazasand
FoodStreetsNeighbourhood
Retail;Dispensary,Community
Hall;Library;HealthClub;Day
CareCentre;Public
Facility/Infrastructure/Utility
BuildingVilla/Bungalow;
Terraced/RowHouse

caretaker/securitypersonnel
DSIRDAcangrantspecialpermissionin
height,FAR,GroundCoverageforSpecial
Buildings(StarHotels,Hospitalsetc.)
whichhavespecialprivileges(under
variousGovernmentPoliciesissuedtime
totime)(inreferencetoTownship,Special
RegulationsforHospitals,Special
RegulationsforHotels

*HeightofthebuildingmustcomplytotheprevalentFireSafetyNorms,withpermissionsfromDSIRDA
**ForPlotsizesof5000sqmandaboveIncaseofabuildingwithpodiumandtower,agroundcoverageofmaximum40%willbeallowedforamaximumheightupto8

m,includingGorG+1whicheverisless.Theuppertypicalfloorsabovepodiumwillhaveamaximumplanareaof10%.ThemaximumFARallowedinthiscasewillbe5.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

81|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
10.6. IndustrialZone
10.6.1. Intent
TheintentinestablishinganIndustrialzoneis:
1. Tocreateaconduciveenvironmentfordevelopmentindustrieswithpriorityforthefollowingsectors:
Automobileandautoancillary
Hitechandelectronics
Generalmanufacturing
Heavyengineering
Metalsandmetallurgicalproducts
Agro/foodprocessing
PharmaandBiotech
2. Toprovideforretailandconvenienceusessupportingindustrialestablishments
3. Tominimizethenuisancecausedbyindustrialactivitiestoadjacentnonindustrialuses
10.6.2. UsePremisesPermitted
A. IndustrialestablishmentsintheorangeandgreencategoriesaslistedbytheMinistryofEnvironment
and Forests, Government of India will be permitted. Special approval will be required for industries
belonging to the red category, or for industries which are not listed in any of the categories, by the
competentcommitteewithintheDSIRDA.
B. Thefollowingusepremiseswillbepermitted
Lightandserviceindustry/workshop
Petrol/CNG/LPGstationwithservicestation
Truckterminalwithsupportingamenities
Warehouse/Godownandstoragefacility
FireStation
Restaurants/Foodcourt/Canteen
Industrialconveniencecentre
Retailestablishmentssupportingindustrialzone
Solidwastesegregationfacility
Bank
10.6.3. SpecialRegulationsforIndustrialDevelopment
In case of industrial plots adjacent to nonindustrial uses, buffer as indicated in Table 10.5 shall be
maintained on all common edges of the plot adjacent to the nonindustrial zone. This buffer shall be
planted with trees of minimum 6 calliper at the rate of 1 tree per 6sqm of area within the buffer. This
buffer shall supersede the minimum setback requirements for all edges of the plot adjacent to non
industrialuses.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

82|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Table105:BufferRequirementsforIndustrialPlots

INDUSTRIALCATEGORY*
GreenIndustry
OrangeIndustry
RedIndustry

MINIMUMBUFFER
10m
15m
20m

*Note:RefertoAppendixAforlistofindustriesinGreen,OrangeandRedCategories.
10.6.4. DevelopmentControl
Table 10.6 provides development control regulations for development density (FAR), minimum
requirements for open space, setbacks and permitted uses. These regulations are applicable for plots
measuring 3ha or smaller. For plots larger than 3ha, additional requirements as per the Subdivision
Guidelines(Chapter11)shallapply.Minimumroadwidthshallbe18m.
10.6.5. GeneralDevelopmentRequirements
In addition to the above given development control regulations, all developments shall adhere to the
commondevelopmentrequirements(Chapter9)whichcoverthefollowingelements:

Sustainability
Parking(refertable9.3)
MinimumPlotsizes(refertable9.1)
Plantationandmaintenanceoftrees
Drainageandfloodprevention
Seismicdesign
Compoundwallsandgates
Generalbuildingrequirements

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

83|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Table106:DevelopmentControlRegulationsforIndustrialAreas
MAXIMUM
MINIMUM
GROUND
SR
ROAD
MIN.PLOT MAXIMUM
COVERAGEAS
NO
ROW
SIZE
FAR
PERCENTOF
(METRES)
PLOTAREA

MAXIMUM
BUILDING
HEIGHT*

MINIMUM
SETBACKS
(FRONT
REARBOTH
SIDES)

PERMITTEDUSEPREMISES

CONDITIONALUSESUBJECTTOSPECIAL
PERMITFROMDSIRDA

INDUSTRIAL

55m&
above

1.8

50%

25m

8m8m6m
6m

Below
55mupto
30m

1.6

50%

25m

8m8m6m
6m

1.2

50%

25m

8m8m6m
6m

1000sqm

Below
30m

Thefollowingusesmaybepermittedsubject
toapprovalofaspecialpermitonacaseby
casebasis:
Broadcastingtowersandlineofsiterelay
devicesfortelephonic,radioortelevision
IndustrialConvenience
communications
Centre;Petrol/CNG/LPG
Thefollowingusesandstructuresshallbe
Station;AutoServiceStation;
permittedasancillaryusestothemainuseof
Weighing
thebuildingprovidedtheirname,locationand
Station;FireStation;Solid
size(ifapplicable)isindicatedinthesiteplan
WasteSegregationFacility;
submittedforapproval:
Public
Devicesforgenerationofnonconventional
Facility/Infrastructure/Utility
energy,suchassolarpanels,windpower
Building;
Lodgingfacilitiesforcaretaker/security
Allusesin(3)below
personnel

Allindustrialestablishments DSIRDAcangrantspecialpermissioninheight,
Industrialsheds,utility
FAR,GroundCoverageforSpecialBuildings
buildings,industrialplants;
(StarHotels,Hospitalsetc.)whichhavespecial
Lightindustry;Service
privileges(undervariousGovernmentPolicies
workshop;Caf/Restaurant/ issuedtimetotime)(inreferenceto
Canteen;Bank;
Township,SpecialRegulationsforHospitals,
Warehouse/Godown/Storage SpecialRegulationsforHotels)
Facility;Dormitories
Truckterminal;andalluses
in(2)and(3)below

*HeightofthebuildingmustcomplytotheprevalentFireSafetyNorms,withpermissionsfromDSIRDA

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

84|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
10.7. LogisticZone
10.7.1. Intent
TheintentinestablishingaLogisticszoneisasfollows:

To provide for the development of a State of the art integrated logistics facility that is Centrally
locatedfromallindustrialareasandhasdirectaccesstothebroadgaugerailline;

10.7.2. PrerequisiteforDevelopment
Alldevelopmentpermissionswillbeaccompaniedbyasiteplanwithrelatedtraffic/circulationstudies.
10.7.3. UsePremisesPermitted
A. Thefollowingusepremiseswillbepermitted:
Centralwarehousingandstoragefacility
LogisticsParks
Multimodalfreighttransportstation
ContainerfreightStation
Inlandcontainerdepot
Truckterminal
Truckservicestation
Railyard
Petrol/CNG/LPGstation
Agriculturalproducemarket
10.7.4. DevelopmentControlRegulations
Table 10.7 provides development control regulations for development density (FAR), minimum
requirements for open space, setbacks and permitted uses. These regulations are applicable for plots
measuring 3ha or smaller. For plots larger than 3ha, additional requirements as per the Subdivision
Guidelines(Chapter11)shallapply.
10.7.5. AdditionalRegulationsforLogisticsZone
Incaseofplotsadjacenttononindustrialuses,10mwidebuffershallbemaintainedonallcommonedges
of the plot adjacent to the nonindustrial zone. This buffer shall be planted with trees of minimum 6
calliperattherateof1treeper6sqmofareawithinthebuffer.
10.7.6. GeneralDevelopmentRequirements
In addition to the above given development control regulations, all developments shall adhere to the
commondevelopmentrequirements(Chapter9)whichcoverthefollowingelements:

Sustainability
Parking(refertable9.3)
MinimumPlotsizes(refertable9.1)
Plantationandmaintenanceoftrees
Drainageandfloodprevention
Seismicdesign
Compoundwallsandgates
Generalbuildingrequirements

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

85|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Table107:DevelopmentControlRegulationsforLogisticZone
MAXIMUM
MINIMUM
GROUND
MAXIMUM
SR
MAXIMUM
ROADROW
COVERAGEAS
BUILDING
NO
FAR
(METRES)
PERCENTOF
HEIGHT
PLOTAREA

MINIMUMSETBACKS
(FRONTREARBOTH
SIDES)

PERMITTEDUSE
PREMISES

CONDITIONALUSESUBJECTTOSPECIAL
PERMITFROMDSIRDA

LOGISTIC

18andabove

30%

25m

6mfromallfoursides

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

IntegratedLogistics
Hub,Container
FreightStation,
Warehouse,Go
down,Inland
ContainerDepot,
Petrol/CNG/LPG
station,

86|P a g e

Thefollowingusesmaybepermittedsubjectto
approvalofaspecialpermitonacasebycase
basis:
Broadcastingtowersandlineofsite
relaydevicesfortelephonic,radioor
televisioncommunications

Thefollowingusesandstructuresshallbe
permittedasancillaryusestothemainuseof
thebuildingprovidedtheirname,locationand
size(ifapplicable)isindicatedinthesiteplan
submittedforapproval:
1.Devicesforgenerationofnon
conventionalenergy,suchassolar
panels,windpower
2.Lodgingfacilitiesforcaretaker/security
personnel

DraftGeneralDevelopmentControlRegulations(DGDCR)
10.8. VillageBufferZone
10.8.1. Intent
Theintentinestablishingphysicalbufferzonesaroundexistingvillagesettlementsis:

DemarcationofaboundaryforimplementationofTownPlanningSchemes

Protectionofcontinuedagriculturebasedactivitiesaroundvillagessettlements

Easetheintegrationofsettlementswiththesurroundingurbanlandusesovertime,

Giveasenseofownershipandcontroltothevillageresidentsontheirimmediateenvirons,

Preventoverdevelopmentinthevicinityofthesensitivevillagefabric

Allowdevelopmentofresidentialpremiseswithsupportingcommunityfacilities

10.8.2. UsesPermitted
A. Thefollowingresidentialuseswillbepermitted:
Townhouse/Rowhouse
Independentdetachedhouse/Villa
B. Thefollowingnonresidentialusepremiseswillbepermitted:

NeighbourhoodRetail
Restaurant/Caf/Informaleatingplace
HawkerZone
DesignatedVegetableMarket/bazaar
School
Multipurposeground
Service/RepairShop
PublicUtilityBuildings
MaternityHome,NursingHome
Daycare,Dispensary
VeterinaryClinic
Healthclub
PlaceofWorshiponplotsmallerthan100sqm
CommunityHall
Playground/Garden

Petrol/CNG/LPGPump

10.8.3. DevelopmentControlRegulationsforIndividualPlots
Table 10.8 provides development control regulations for development density (FAR), minimum
requirementsforopenspace,setbacksandpermitteduses.Theseregulationsareapplicableforindividual
plotsdefinedwithintheTownPlanningScheme.
10.8.4. GeneralDevelopmentRequirements
In addition to the above given development control regulations, all developments shall adhere to the
commondevelopmentrequirements(Chapter9)whichcoverthefollowingelements:

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

87|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

Sustainability
Parking(refertable9.3)
MinimumPlotsizes(refertable9.1)
Plantationandmaintenanceoftrees
Drainageandfloodprevention
Seismicdesign
Compoundwallsandgates
Generalbuildingrequirements

10.8.5. RelaxationinGeneralDevelopmentRequirements
The plots within the Village Buffer Zone can avail relaxation up to 50 percent with regard to parking
provisionwithinthegeneraldevelopmentrequirementsgiveninsubsection9.5.
10.8.6. AreaswithinCRZ
The village buffer areas that fall within the CRZ regulation zone will be governed by the development
controlregulationsoftheCRZ.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

88|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Table108:DevelopmentControlRegulationsforVillageBufferZone
MAXIMUM
MINIMUM
GROUND
MAXIMUM
SR
MAXIMUM
ROADROW
COVERAGEAS
BUILDING
NO
FAR
(METRES)
PERCENTOF
HEIGHT
PLOTAREA

MINIMUM
SETBACKS(FRONT
REARBOTHSIDES)

PERMITTEDUSEPREMISES

CONDITIONALUSESUBJECTTO
SPECIALPERMITFROMDSIRDA

VILLAGEBUFFER

Residential:Townhouse/Row
houseIndependentdetached
house/Villa

9to12

70%

G+2or10m
whicheveris
less

2m2m1.5m
1.5m

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

NonResidential:Neighbourhood
Retail
Restaurant/Caf/Informaleating
place;School;Multipurpose
ground;Service/RepairShop;
PublicUtilityBuildings;
MaternityHome,NursingHome;
Daycare,Dispensary;Veterinary
Clinic;Healthclub;Placeof
Worshiponplotsmallerthan
100sqm;Petrol/CNG/LPGPump;
CommunityHall;Playground/
Garden

89|P a g e

Thefollowingusesmaybe
permittedsubjecttoapprovalofa
specialpermitonacasebycase
basis:

Broadcastingtowersandlineof
siterelaydevicesfortelephonic,
radioortelevisioncommunications

Thefollowingusesandstructures
shallbepermittedasancillaryuses
tothemainuseofthebuilding
providedtheirname,locationand
size(ifapplicable)isindicatedinthe
siteplansubmittedforapproval:
1.Devicesforgenerationof
nonconventionalenergy,
suchassolarpanels,wind
power
2.Lodgingfacilitiesfor
caretaker/securitypersonnel

DraftGeneralDevelopmentControlRegulations(DGDCR)
10.9. Recreation,SportsandEntertainmentZone
10.9.1. Intent
The intent in establishing the Entertainment Recreation and Sports zone is to provide for an area for
promotion of specialised large scale tourism activities that are land intensive and large parks and sports
relatedactivities.
10.9.2. PrerequisiteforDevelopment
Anydevelopmenttobecarriedoutaspartofthiszonewillrequireapprovalofamasterplanwhichshallbe
subject to the Subdivision Guidelines (Chapter 11). The master plan should at a minimum, cater to the
following:

Illustrationofactivityzones/buildinguses
Trafficandtransportationstudy
Landscapemasterplan
Pedestrianandvehicularcirculation
Urbandesignguidelines
Infrastructureandutilitiesplan

10.9.3. UsesPermitted
A. Thefollowingusesshallbepermitted:
ThemePark
Outdooradventuresports
Filmcity
Sportscomplex
Stadium
Park
Botanicalgarden
Zoo
NaturePark
10.9.4. DevelopmentControlRegulations
Table10.9providesdevelopmentcontrolregulationsfordevelopmentdensity(FAR),minimumopenspace
andmaximumheightsforstructureswithintheapprovedmasterplan.Theseregulationsareapplicablefor
plotsmeasuring3haorsmaller.Forplotslargerthan3ha,additionalrequirementsaspertheSubdivision
Guidelines(Chapter11)shallapply.
10.9.5. GeneralDevelopmentRequirements
In addition to the above given development control regulations, all developments shall adhere to the
commondevelopmentrequirements(Chapter9)whichcoverthefollowingelements:

Sustainability
Parking(refertable9.3)
MinimumPlotsizes(refertable9.1)
Plantationandmaintenanceoftrees
Drainageandfloodprevention
Seismicdesign
Compoundwallsandgates
Generalbuildingrequirements

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

90|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Table109:DevelopmentControlRegulationsfortheRecreation,SportsandEntertainmentZone
MAXIMUM
MINIMUM
MINIMUM
GROUND
MAXIMUM
SETBACKS
SR
MIN.PLOT MAXIMUM
ROADROW
COVERAGEAS
BUILDING
(FRONT
NO
SIZE
FAR
(METRES)
PERCENTOFPLOT
HEIGHT*
REARBOTH
AREA
SIDES)

PERMITTEDUSE
PREMISES

CONDITIONALUSESUBJECTTOSPECIALPERMIT
FROMDSIRDA

RECREATIONSPORTS&ENTERTAINMENT

From55mto
12m

0.5

25%

25m

6m5m3m
3m

ThemePark
OutdoorAdventure
Sports,FilmCity;
Restaurants,
FoodPlazasand
FoodStreets,Sports
complex;Stadium;
Park
Botanicalgarden;
Zoo;NaturePark;
Petrol/CNG/LPG
Pump

Thefollowingusesmaybepermittedsubjectto
approvalofaspecialpermitonacasebycase
basis:
Broadcastingtowersandlineofsiterelay
devicesfortelephonic,radioortelevision
communications
Specialnonhabitablestructuresfor
entertainmentinthemeparksorforoutdoor
adventuresports
Thefollowingusesandstructuresshallbe
permittedasancillaryusestothemainuseofthe
buildingprovidedtheirname,locationandsize(if
applicable)isindicatedinthesiteplansubmitted
forapproval:
1.Devicesforgenerationofnonconventional
energy,suchassolarpanels,windpower
2.Lodgingfacilitiesforcaretaker/security
personnel
DSIRDAcangrantspecialpermissioninheight,FAR,
GroundCoverageforSpecialBuildings(StarHotels,
Hospitalsetc.)whichhavespecialprivileges(under
variousGovernmentPoliciesissuedtimetotime)
(inreferencetoTownship,SpecialRegulationsfor
Hospitals,SpecialRegulationsforHotels)

*TherelaxationofmaximumbuildingheightmaybeapplicableonthebasisofconditionalusepermitsfromDSIRDA.Specialapprovalwithregardtofiresafetynormsshall
berequiredinsuchcasesfromDSIRDA.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

91|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
10.10. GreenSpace
10.10.1. Intent
TheintentinestablishingtheGreenSpaceis:

Provisionofa200mwideprotectivebufferzonealongthenaturalstreams,rivers
Protectionofthenaturalecologyalongtheenvironmentallysensitiveareas
Prohibitionofanydevelopmentorconstructionactivitywithinthezone

10.10.2. UsesPermitted
A. Thefollowinguseswillbepermitted:
Openparks,withnopermanentstructures
Naturetrails
Botanicalgarden

10.11. AgricultureZone
10.11.1. Intent
TheintentinestablishingtheAgricultureZoneisastheprotectionoftheexistingfarmlandthatissuitable
forcontinuedfarmingactivityfromdevelopmentpressureexertedbythesurroundingurbanisation
10.11.2. UsesPermitted
A. Thefollowingusepremisesthatareanintegralpartofthefarmlandwillbepermitted

Ancillary farmshed or farmhouse not exceeding built area more than 300sqm, for agricultural
labourersorfarmowners

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

92|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Table1010:DevelopmentControlRegulationsforGreenSpaceandAgriculturalZone
MAXIMUM
GROUND
MAXIMUM
SR MINIMUMROAD
MAXIMUM
COVERAGEAS
BUILDING
PERMITTEDUSEPREMISES
NO
ROW(METRES)
FAR
PERCENTOFPLOT
HEIGHT
AREA
GREENSPACE

NA

NA

NA

NA

NA

NA

NA

NA

Openparkswithnopermanentstructures,nature
trail

AGRICULTURE
Horticulture,poultrykeepingsubjecttothe
N.O.C./approvalandconditionslaiddownbythe
Departmentofpoultry,DairyDevelopment,
fisheries,animalrearingandbreeding,open
storageofdryingmanure.Farmhouselocatedin
landofnotlessthan4000sq.Mts.,Campfor
recreationofanytypenaturalreservesand
sanctuaries,racetrack,shootingrange,zoo,
nursery,stadium,botanicalgarden,agricultural
equipment,repairoftoolsandequipmentof
agriculturaluse,tannery,sawmill,timberdepot,

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

93|P a g e

CONDITIONALUSESUBJECTTO
SPECIALPERMITFROMDSIRDA

Thefollowingusesmaybepermitted
subjecttoapprovalofaspecialpermit
onacasebycasebasis:
Broadcastingtowersandlineofsite
relaydevicesfortelephonic,radioor
televisioncommunications
Thefollowingusesandstructuresshall
bepermittedasancillaryusestothe
mainuseofthebuildingprovidedtheir
name,locationandsize(ifapplicable)
isindicatedinthesiteplansubmitted
forapproval:
1.Devicesforgenerationofnon
conventionalenergy,suchassolar
panels,windpower
2.Lodgingfacilitiesfor
caretaker/securitypersonnel
Touringcinema,driveincinema,
storageofinflammablematerialsand
explosivegoodssubjectto
NOC/Approvalandconditionslaid
downbyconcerneddepartment/
authoritydealingwithsuchwork.
Dumpingofsolidindustrialwaste
subjecttoN.O.C.andconditionslaid
downbyPollutionControlBoard.
InstitutionalBuildings,govt.,semi
govt.buildings,Buildingsofpublic

DraftGeneralDevelopmentControlRegulations(DGDCR)
SR
NO

MINIMUMROAD
ROW(METRES)

MAXIMUM
FAR

MAXIMUM
GROUND
COVERAGEAS
PERCENTOFPLOT
AREA

MAXIMUM
BUILDING
HEIGHT

PERMITTEDUSEPREMISES

uses pertainingtoprocessingofagro/farm/milk
products,institutionaluses,vocationaltraining
centre,foragriculturepurposeswaysideshops,
restaurant,icefactory&coldstorage,godowns
andwarehousessubjecttoN.O.C./approval&
conditionslaiddownbywarehousingcorporation/
FCI/AppropriateGovt./SemiGovt.Department,
hospitalforinfectiousandcontiguousdiseases,
mentalhospitalandsanitariumsubjectto
NOC/ApprovalandconditionslaiddownbyCivil
Surgeon.Petrol/CNG/LPGpumpwithorwithout
servicestation,garages,andworkshop,Studio,
roofingtilesandcementpipes,brickkiln,mining
andquarrying,cemeteryandburialground,jail.
Camp,forrecreationofanytype,club,aquarium,,
planetarium,amusementpark.Development
activityrelatedtotourism
sponsored/recommendedbytourismDepartment
oftheGovernment.1)Recreationofanytype,
Residentialaccommodationandshopsincidental
torecreation,aquarium,Naturalreserveand
sanctuaryracetrack,shootingrange,zoo,nursery,
stadium,botanicalgarden,planetarium,
amusementpark,swimmingpool,exhibitionand
mela,driveincinema,motionpicturehall,
cinema,restaurants,partyplots,recreationaluse
ofwaterpark,Resorts,hotelsandMotelsasper
normsnotifiedbythetourismcorporationof
Gujarat

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

94|P a g e

CONDITIONALUSESUBJECTTO
SPECIALPERMITFROMDSIRDA
sectorundertakings,Gardenhouses,
petrolfillingstation,educationaland
Medicalinstitutions(excluding
infectiousandcontagiousdiseases,
mentalhospitals),Trainingand
researchcentres,buildingfor
autonomousbodiesrelatedtotheir
activitiesstatutoryorganisations,
conventioncentres.Development
activitiesrelatedtoInformation
Technology.

DraftGeneralDevelopmentControlRegulations(DGDCR)
10.12. SolarParkZone
10.12.1. Intent
TheintentinestablishingtheSolarParkZoneis:

Provisionoflandforcreatinglargescalesolarparkforgenerationofrenewableenergy

Protectionofthezonefromthepressuresofdevelopmentexertedbytherapidlyurbanising
surroundings

10.12.2. UsePremisesPermitted
A.ThefollowingusepremisesthatareanintegralpartoftheSolarParkwillbepermittedprovidedaplot
forsuchusesisclearlydemarcatedonthesolarparkplan.

Administrativeblock

Storageofmaintenanceequipment

Anyotherstructurerequiredfortheoperationandmaintenanceofthefacility,provideditis
demarcatedonthesiteplansubmittedforapproval

10.12.3. DevelopmentControlRegulations
Table10.11providesdevelopmentcontrolregulationsforprovisionoffacility,minimumopenspaceand
maximumheightsforstructureswithintheforestmap.
10.12.4. GeneralDevelopmentRequirements
In addition to the above given development control regulations, all developments shall adhere to the
commondevelopmentrequirements(Chapter9)whichcoverthefollowingelements:

Sustainability
Parking(refertable9.3)
MinimumPlotsizes(refertable9.1)
Plantationandmaintenanceoftrees
Drainageandfloodprevention
Seismicdesign
Compoundwallsandgates
Generalbuildingrequirements

10.13. Tourism&Resorts
10.13.1. Intent
TheintentinestablishingtheResortsZoneistopermitdevelopmentofbeachresorts/hotelswithinthe
designatedareaofCRZIIIfortemporaryoccupationofvisitorswithpriorapprovaloftheMinistryof
environmentandForests.
10.13.2. UsesPermitted
Allactivities/usespermittedundertheprescribednormsandregulationsunderthedesignatedCRZIII.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

95|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
10.13.3. DevelopmentControlRegulations
AsindicatedinTable10.11,alldevelopmentsintendedinthiszonewillbesubjecttothedevelopment
controlnormsStatedforCRZII&III(chapter26).
10.13.4. GeneralDevelopmentRequirements
In addition to the above given development control regulations, all developments shall adhere to the
commondevelopmentrequirements(Chapter9)whichcoverthefollowingelements:

Sustainability
Parking(refertable9.3)
MinimumPlotsizes(refertable9.1)
Plantationandmaintenanceoftrees
Drainageandfloodprevention
Seismicdesign
Compoundwallsandgates
Generalbuildingrequirements

10.14. StrategicInfrastructure
10.14.1. Intent
TheintentinestablishingtheStrategicInfrastructureZoneis:

Provisionoflandforstrategicinfrastructurefacilitiessuchaswatertreatmentplants,sewage
treatmentplant,powerstation,solidwastemanagementsite

10.14.2. UsesPermitted
A. Thefollowingbuildingsthatsupportthemainstrategicinfrastructurefacilitywillbepermitted:
Administrativeblock

Storageofmaintenanceequipment

Anyotherstructurerequiredfortheoperationandmaintenanceofthefacility,provideditis
demarcatedonthesiteplansubmittedforapproval

10.14.3. DevelopmentControlRegulations
Table10.11providesdevelopmentcontrolregulationsforthestrategicinfrastructurezone.
10.14.4. PermittedAccessoryUsesandStructures

Lodgingfacilitiesforcaretaker/securitypersonnel

10.14.5. GeneralDevelopmentRequirements
In addition to the above given development control regulations, all developments shall adhere to the
commondevelopmentrequirements(Chapter9)whichcoverthefollowingelements:

Sustainability
Parking(refertable9.3)
MinimumPlotsizes(refertable9.1)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

96|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

Plantationandmaintenanceoftrees
Drainageandfloodprevention
Seismicdesign
Compoundwallsandgates
Generalbuildingrequirements

10.15. PublicFacilitiesZone
10.15.1. Intent
TheintentindemarcatingthePublicFacilitiesZoneis:

TomaketheDSIRselfcontainedintermsofhealth,education,cultural,Government,sportsand
openspacefacilities

Usinglandasaresourcestrategytoreservekeylandparcelsforcitylevelfacilitiesandfor
potentialdevelopmentofcatalystprojectsbyDSIRDA

Itisimportanttonotethatthecitylevelcommunityfacilitiesdonotformaseparatelandusezone,butare
moreofanoverlayzonelocatedwithinthebaselandusezones.
10.15.2. UsePermitted
Usespermittedinthiszonewillgenerallybethesameasthebaselandusezone.However,prioritywillbe
givenprojectrequirements.
10.15.3. DevelopmentControlRegulations
Table10.11providesdevelopmentcontrolregulationsforthestrategicinfrastructurezone.
10.15.4. GeneralDevelopmentRequirements
In addition to the above given development control regulations, all developments shall adhere to the
commondevelopmentrequirements(Chapter9)whichcoverthefollowingelements:

Sustainability
Parking(refertable9.3)
MinimumPlotsizes(refertable9.1)
Plantationandmaintenanceoftrees
Drainageandfloodprevention
Seismicdesign
Compoundwallsandgates
Generalbuildingrequirements

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

97|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Table1011:DevelopmentControlRegulationsforSolarPark,Tourism&Resorts,StrategicInfrastructureandPublicFacilityZone
MAXIMUM
MINIMUM MINIMUM
GROUND
MAXIMUM
PLOTSIZE MAXIMUM
SR ROAD
COVERAGE
BUILDING
MINPLOTSIZE
PERMITTEDUSEPREMISES
NO ROW
FAR
ASPERCENT
HEIGHT
(METRES)
OFPLOT
(SQM)
AREA
SOLARPARKZONE

NA

0.2

G+2or10m
whicheveris
less

20%

NA

4000

0.33

9m&G+1

33%

NA

NA

NA

NA

NA

NA

50%

AdministrativeOfficeor
otherstoragebuilding

TOURISM&RESORTS
Allactivities/usespermitted
undertheprescribednorms
4000sqm
andregulationsunderthe
designatedCRZIII
STRATEGICINFRASTRUCTURE
Allusespermissibleas

decidedbyDSIRDAinpublic
interest
PUBLICFACILITYZONE
Allusespermissibleas

decidedbyDSIRDA

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

98|P a g e

CONDITIONALUSESUBJECTTOSPECIALPERMIT
FROMDSIRDA

Thefollowingusesmaybepermittedsubjectto
approvalofaspecialpermitonacasebycase
basis:
Broadcastingtowersandlineofsiterelay
devicesfortelephonic,radioortelevision
communications
Thefollowingusesandstructuresshallbe
permittedasancillaryusestothemainuseofthe
buildingprovidedtheirname,locationandsize
(ifapplicable)isindicatedinthesiteplan
submittedforapproval:
1.Devicesforgenerationofnonconventional
energy,suchassolarpanels,windpower
2.Lodgingfacilitiesforcaretaker/security
personnel
Allactivities/usespermittedunderthe
prescribednormsandregulationsunderthe
designatedCRZIII

AllusespermissibleasdecidedbyDSIRDAin
publicinterest

AllusespermissibleasdecidedbyDSIRDA

DraftGeneralDevelopmentControlRegulations(DGDCR)
11. DevelopmentofLandandSubdivisionRegulations
11.1. Scope
Thissectionprovidesgeneralrequirementsusedinthedesign,reviewandapprovalofanysubdivisionplan
and applies to any private developer as well as Government agencies involved in such development.
Questionsofinterpretationofanyofthesesubsectionsshouldbediscussedwiththeplanningstaffofthe
RegionalDevelopmentAuthorityattheearliestpossibletimeinthedevelopmentofasubdivisionproposal.

11.2. GeneralRequirements
11.2.1. ConsistencewithadoptedLandUseplan
AlllayoutsubdivisionoflandapprovedunderthischaptershouldbeconsistentwiththeadoptedLandUse
plan and the applicable zone regulations. This would include specific area level plans for public facilities,
suchasstreets,parksandopenspaces,schoolsandothersimilarfacilities.
11.2.2. Conformity
The proposed street system shall be designed to provide a network of interconnected streets so as to
facilitatethemostadvantageousdevelopmentoftheentireneighbouringarea.Stubstreetsbeprovidedto
adjacentpropertieswherefeasible,soastoprovideforfutureinterparcelaccessandpotentialpublicright
ofway.
Theproposedstreetsystemshallextendexistingstreetsontheirproperprojections.Aculdesacshallnot
be used to avoid connection with an existing street or to avoid future extension. Culdesac and other
permanently deadend streets are permitted where one or more of the following conditions offer no
practicalalternativeforconnectivity:
1)
2)
3)
4)
5)

Topographicalconditions.
Environmentalconditions.
Propertyshape.
Propertyaccessibility.
Incompatiblelanduserelationships

11.2.3. Discouragementofcutthroughtraffic
Residentialstreetsystemshallbedesignedtoestablishcircuitousroutestodiscouragecutthroughtraffic.
The street design shall have multiple connections, existing and future, to disperse traffic impacts and
reducespeeding.Wherefeasible,allnewdevelopmentshallprovidemorethanoneaccessforingressand
egress at the time of development. Consideration for Cutthrough traffic shall not apply when a street is
designatedasathoroughfare.
11.2.4. RelationshiptoRailroadRightsofway
When a subdivision adjoins a railroad rightofway, the subdivider may be required to arrange the street
patterntoprovideforfuturegradeseparationofstreetandrailroadcrossing.
11.2.5. MatureTreesandNaturalVegetation
Streetsanddevelopmentsitesshallbedesignedtoprotectandpreservetheshaftsofmaturedtreesand
existingnaturalvegetationtothegreatestextentpossible.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

99|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
11.2.6. AccesstoParks,SchoolsandGreenways
Streetsshouldbedesignedandwalkwaysdedicatedforeasyaccesstoparks,schoolsandgreenwaysand
otherareasofpublicassembly.Thewidthofthededicatedstreetshallbeenoughtoaccommodateservice
vehiclesformaintenancepurpose.
11.2.7. ParallelStreetsalongThoroughfares
Whenatractoflandtobesubdividedadjoinsahighway,anarterialorsubarterialroad,thedevelopermay
berequiredtoprovideastreet,paralleltothehighway.Directaccesstopropertiesshallbeallowedonly
through public streets which in turn form a part of the larger circulation network. No direct access to
propertiesshallbeprovidedfromhighwayarterialandsubarterialroads.Directaccesstopropertiesshall
berestrictedtomajorpublicfacilitiesandlargedevelopmentsatthediscretionoftheDSIRDA.
11.2.8. PublicSchoolandParkSites
Whenatractoflandthatappearsinanyadoptedplanasafuturepublicschool,PublicPark,greenwayor
openspaceandthissitefallswithinanareaproposedtobesubdivided,theplanningstaffwillnotifythe
appropriate agency of the proposed subdivision and its effect on the future public site. The agency shall
decide, in the time period spelled out by the planning authority after preliminary approval, whether to
reserve the site. If the agency does not wish to reserve the site then the subdivision plan shall not be
approved.Theappropriateagencywillhavetimeavailablefromthedateofpreliminaryapprovaltoacquire
thesitebypurchase.
11.2.9. PublicFacilities
When a tract of land that appears in any adopted plan or policy document as a future site for any
communityservicefacility,includingbutnotlimitedtopoliceandfirestations,libraries,publichousingor
other public use sites, falls within an area proposed to be subdivided, the planning staff will notify the
appropriate agency of the proposed subdivision and its effect on the future public site. The agency shall
decide, in the time period spelled out by the planning authority after preliminary approval, whether to
reservethesite.Iftheagencydoesnotwishtoreservethesitethenthesubdivisionplanshallbeapproved.
11.2.10. Easements
Easements established to the width and in the locations required by the engineering department or the
utilitydepartment,butinnocaselessthan3mwide,shouldbeprovidedforopenorpipedstormdrainage,
sanitary sewers and water lines. This requirement applies to such lines installed at the time of the
developmentofthesubdivisionandtoeasementsforsuchlineswhichmayreasonablybeexpectedtobe
installedinthefuture.

11.3. PlanRequirements
The subdivision plan submitted for approval must be drawn to the following specifications and must
contain or be accompanied by the information listed. No processing or review of a preliminary plan will
proceedwithoutalloftheinformationlisted.
1) The name of the subdivision project; the name and signature of the owner or the owners duly
authorizedagent;thenameofthesurveyor,engineerordesigner;thenamesofproposedstreets;
thenamesofadjoiningsubdivisionsorpropertyowners.
2) Thescaleoftheplan,whichshallnotbesmallerthan1:1000;northpoint;date.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

100|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
3) Theboundaryoftheareatobesubdividedandthelocationwithinthearea,orcontiguoustoit,of
any existing streets, railroad lines, watercourses, easements or other significant features of the
tract.
4) Asmallscalelocationmapshowingthelocationofthesubdivisionwithrespecttoadjacentstreets
andproperties.
5) Originalcontoursatintervalsofnotlessthan1mfortheentireareatobesubdividedandextended
intoadjoiningpropertyforadistanceof100matallpointswherestreetrightsofwayconnectto
the adjoining property. These contours shall be referenced to a datum points established by the
DSIRDA.Proposedcontoursmustbeshownfortheallareaswhereextensivegradingisproposed.
These requirements shall not apply where the size of the subdivision and the topography make
suchinformationunnecessary.
6) Thelocation,sizesandelevationsofexistingsanitarysewers,stormdrainsandculvertswithinthe
tractandimmediatelyadjacentthereto.
7) TheareaStatementforallproposeduses.
8) In case the subdivision includes residential uses, list and areas of community facilities provided
withcorrespondingtotheresidentpopulationwithinthedevelopment.
9) Thelocationofproposedstreets,alleys,easements,lots,parksorotheropenspaces,reservations,
otherpropertylinesandbuildingsetbacklineswithstreetdimensions,tentativeplotdimensions,
otherpropertylinesandthelocationofanybuildingrestrictionfloodlines.
10) The location of all proposed storm drains and utilities with grades, inverts and sizes indicated,
together with a map of the drainage areas tributary to the proposed storm drains, a copy of the
data used in determining the sizes of drainage pipes and structures, use the building restriction
floodlineandfloodprotectionelevationforeachplotsubjecttoflooding.Theproposedmethodof
watersupplyandsewagedisposal.
11) Typicalcrosssectionsofproposedstreets,showingwidthsandproposedconstructionofroadways.
12) Wherethesubdivisionincludesastreetoranaccesswaywithagradientmorethan1:20,aprofile
of the street shall be illustrated. The profile should be extended to include 30m of the existing
roadway and storm drains if present, and a cross section of the existing street shall be shown.
Whereaproposedstreet within thesubdivisionabutsatractoflandthatadjoinsthesubdivision
andwherethestreetmaybeexpectedtoextendintotheadjoiningtractofland,theprofileshallbe
extendedtoinclude30moftheadjoiningtract.
13) Atimetableforestimatedprojectcompletionoftheareacoveredbythepreliminaryplan.

11.4. CommunityFacilitiesandOpenSpaces
The subdivision plan shall make adequate provision for community facilities and open spaces as per the
requirementgiveninSection5.2,Chapter5oftheDraftDevelopmentPlan.

11.5. DesignStandardsforStreets
Thissectioncontainsspecificationsforstreetswhichmustbefollowedinthesubdivisionprocess.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

101|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
11.5.1. Rightofway
A proposed street rightofway must be of sufficient width to accommodate the required cross section.
Howeverinnocasewillthededicatedandreservedrightofwaybeproposedtobelessthanthefollowing
standards, unless the Regional Development Authority engineer certifies that such special circumstances
exist,whichmakethededicationorreservationofthefullrightofwayunnecessaryorimpractical.
Table111:StreetRightofWayStandards

STREETTYPE
Accesscontrolledexpressway
IndustryPriorityArterial
ArterialRoads
SubArterialRoads
CollectorRoads
TruckCorridor
LocalRoads
NarrowStreets

MINIMUMRIGHTOFWAY(METRES)
250
70
55
40
30
25
20
15,12

Additionalrightofwaymaybenecessaryintheareaofinterchanges,intersections,cut/fillareas,orareas
wherehorizontalorverticalalignmentsmustbeimprovedandwillbedeterminedonacasebycasebasis.
Whenadeveloperelectstoestablisharoadwaydividedwithamedian,therightofwaywidthmustbeat
leasttheproposedwidthofthemedian,plus15m.The12mwidestreetmayonlybeusedsubjecttothe
followingconditions:
1. Itservesnomorethan50dwellingunits.
2. All land which touches the street must be subdivided into plots or must be otherwise plotted so
thatafurtherstreetextensionisnotpossible.
3. It is designed to be permanently dead ended or is a loop street with no additional street
connectionsexceptattheends.
11.5.2. ArterialRoadsRightofway
Wheneveratractoflandtobesubdividedincludesanypartofanarterialroadshownonthethoroughfare
planapprovedbytheplanningbodyoftheDSIRDA,arightofwayforthearterialstreetmustbereserved
inthelocationandtothewidthspecifiedintheplan.
Thedeveloperisresponsibleforthededicationoftherightofwayupto30m(15moneithersideofthe
centreline) or the reservation of the rightofway. The remainder of the minimum required rightofway
over30mmustbereservedforfuturerightofwayuseandmustbeshownassuchonthefinallayoutplan.
Allmeasurementsinvolvingminimumlotstandardsunderthischapterandunderthezoningordinancewill
bemadeattheedgeofthefullrightofway.
Alloftheareaofthededicatedrightofway,foranypublicstreetexcept20mwideroador12m&15mwide
roads,maybeusedinthecomputationofdevelopmentrights,butmaynotbeusedforthecomputationof
plot area, open space, required parking, stormwater retention, or to fulfil any other mandatory
requirements.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

102|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
11.5.3. StreetIntersectionGeometry
Where there is an offset in the alignment of a street across an intersection, the offset of the centrelines
maynotbelessthan30m.
11.5.4. Blocklengths
Smallerblocklengthsbetween140mto180marepreferredbutinnosituation,blockslengthswillbemore
than 300m. DSIRDA may authorize block lengths in excess of 300m where one or more of the following
conditionsexist:
1) Topographicalconditions.
2) Environmentalconditions.
3) Propertyshape.
4) Propertyaccessibility.
5) Incompatiblelanduserelationships.
Block widths must be sufficient to allow two tiers of plots except where single tiers of lots will facilitate
nonresidential development and the separation of residential and nonresidential developments or the
separationofresidentialdevelopmentfromthoroughfares.
11.5.5. Culdesac
Culdesacorotherpermanentlydeadendstreetsshallnotbelongerthan150m.Theplanningstaffmay
authorize longer culdesac lengths. The distance of a culdesac shall be measured from the centreline
intersectiontothecentrepointoftheculdesac.Theculdesacshallbeterminatedbyacircularrightof
way not less than 25m in diameter. Alternate turnaround designs as accepted by the engineer may be
considered.Ifavehicularconnectionisimpractical,apedestrianand/orbicycleconnectionmayberequired
fromtheculdesactotheneareststreets.
11.5.6. NarrowStreets
Incertaincircumstances,streetsmaybeconstructedona15mrightofwayandwitha9mcrosssection.
Whenastreetserves50dwellingunitsorlessandispermanentlydeadended,thissmallerstandardmaybe
used.Allotherappropriatestandardsofthischapterstillapplytotheconstructionofsuchastreet.
11.5.7. Collectorstreetdesignation
Thedesignationofacollectorstreet,orthedeterminationoftheneedforacollectorstreet,willbebased
on the following criteria. If the street in question meets at least two of the criteria, the street will be
designatedasacollectorstreetandmustbebuilttotheappropriatecollectorstreetstandard:

Thestreetintersectsdirectlywithanarterialstreetandprovidesaccesstoanareawithanoverall
densityofmorethanfivedwellingunitperhectare,orprovidesaccesstomorethan125dwelling
units.

Thestreetbyitsgeneralconfiguration,inrelationshiptotheexistingdevelopmentofthearea,in
effectservesacollectorfunction.

The street extends into an undeveloped area in such a manner as to serve a future collector
function.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

103|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

The street serves as a primary access to a significant nonresidential, institutional or recreational


landuse,aswellasanaccesstoaresidentialarea.

11.6. DesignStandardsforLots
11.6.1. FrontageonStreet
Eachplotin asubdivisionmusthavefrontageonastreet.However,lotsdesignedforcertainmultifamily
dwellingsneednotfrontonastreet,providedthatallportionsofthedwellingunitproposedforsuchplots
arelocatedwithin100mofapublicstreetorprivatestreetthatfurnishesdirectaccesstotheproperty,and
that access to each such plot be made available via either a public rightofway or a private vehicular or
pedestrianwayownedbytheindividualplotownerinfeeorincommonownership.
Plotsdesignedforcertainonefamily,semidetacheddwellingsneednotfrontonastreet,providedthatat
leastoneunitofeachdwellinggrouphasfrontageonastreetandthataccesstoeachdwellingunitismade
availableviaeitherapublicrightofwayoraprivatevehicularorpedestrianwayownedbytheindividual
lotownerinfeeorincommonownership.
Plotsorbuildingsiteswhicharepartofalargernonresidentialdevelopment,suchasashoppingcentre,
neednotaboutastreetsolongastheoverallsiteabutsastreetinsuchawaythataccessisfurnishedtoall
interiorlotsorbuildingsites.
11.6.2. Sidelines
Sidelotlinesshall,asnearlyaspracticable,beatrightanglesorradialtostreetlines.Wheresidelotlines
intersectattherearofthelot,theangleofintersectionshallnotbelessthan60degrees.
11.6.3. Buildinglines
Buildinglinesshallbeestablishedonallplotsinaccordancewiththeappropriatezoningclassification.The
buildinglineshallnotencroachupontherequiredsetbackandthesetbackrequirementsshallregulatethe
placementofanystructurerelativetothestreetrightofwayincludingallfront,sideandrearplotsetbacks.
11.6.4. DrivewayConnections
Priortotheconstructionofanydrivewayorotherconnectionwithintherightofwayofapublicstreet,a
permitmustbesecuredfromtheplanningdepartmentoftheRegionalDevelopmentAuthority.

11.7. CommonPlot
CommonPlotforthedevelopmentshallbeprovidedasunder:
11.7.1. Forresidentialuseandcommercialuse:
a) Inabuildingunitof2000sqmormoreinarea,thecommonplotshallbeprovided.
b) The minimum area of the common plot shall be 10% of the building unit and shall be
provided.
c) Commonplotshallbeprovidedinhighrisebuildingirrespectiveofareaofbuildingunit
11.7.2. ForIndustrialUse:
a) Inabuildingunitof5000sqmormoreinarea,thecommonplotshallbeprovided.
b) In a building unit of 5000 sqm and upto 20000 sqm in area, the common plot shall be
providedattherateof8%oftheareaofthebuildingunit.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

104|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
c) Inabuildingunitofmorethan20000sqminareathecommonplotshallbeprovidedatthe
rateof1600sqmplus5%oftheareaofthebuildingunitinexcessof20000sqm.
11.7.3. OtherthanResidential,Commercial&Industrial
Inabuildingunitof2000Sq.mts.ormoreinarea,thecommonplotshallbeprovidedattherate
of20%ofplotarea.
11.7.4. GeneralRequirement
1. The common plot area shall be exclusive of approaches, margins. No projection shall be
permittedincommonplot.
2. Minimumsizeofthecommonplotshallbe200sqmwithnosidelessthan10.50m.
3. No construction shall be permitted in the common plot. Only electric substation, over head
water tank, underground water tank, watchman room, community hall for occupier of
respective sub plots or tenements or flats, tube well and rain water recharge well shall be
permittedsubjecttomarginasperthisregulationsandmaximum15%ofrespectivecommon
plotarea.
4. Theareaofthecommonplotmaybepermittedtobesubdividedprovidedthatthecommon
plothasaminimumareaof200sqmwithnosideslessthan10.50m.
Provided for a group housing, (building with Ground floor plus two upper floors without
hollowplinth),furthersubdivisionsofthe commonplot maybeallowedbytheCompetent
Authority
5. TheareaofthiscommonplotshallbenotdeductedfortheconsiderationofFloorSpaceIndex
ofabuildingunit.
6. (a)Inthecaseofallusesacceptresidentialtotalcommonplotmaybeallowedtobeusedas
parkingspaceincludingdrivewayandtheaisles.
(b)Inthecaseofresidentialuse50%ofthetotalcommonplotmaybeallowedtobeusedas
parkingspaceincludingdrivewayandaisles.
7. In cases where in layout or subdivision of building unit is sanctioned with provision of
requiredcommonplot,commonplotsshallnotbeinsistedincaseofsubdivisionofsuchsub
divided new building unit and / or amalgamation of such sub plots and / or further
developmentofsuchsubdividednewbuildingunitirrespectiveofitsarea.
Providedforabuildingunittobedevelopedforotherthanresidentialuseexclusivevisitors
parkingshouldbeprovidedatroadsidemarginattherateof5%ofplotareainadditionto
the parking requirements under this regulation. This parking space shall have required
marginfromthebuilding.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

105|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
12. DevelopmentofLowCostHousing
These regulations shall be applicable to development of schemes for sociallyand economically backward
class of people, for economically weaker section of the society and for low cost housing projects only
undertaken by public agencies, cooperative societies, Government or semiGovernment bodies and
registereddevelopers.

12.1. Planning
Lowcosthousingdevelopmentsshallconformtothefollowingconditions:
1. Themaximumgrossdensityof225dwellingunitsperhectare.
2. The minimum and the maximum plot size shall be between 18sqm and 40sqm respectively with
builtupareanotexceeding70%oftheplotarealeavingfrontaswellasrearmarginof1.5m.
3. Theminimumfrontageofplotshallbe3.0minwidth.
4. Atevery20suchcontinuousplots,2.0mwideopentoskyspaceshallbeprovided.
5. Themaximumnumbers ofstoriesinabuildingconstructiononthe plotshallbeground plusone
upperstoreyonly.
6. Commonplotattherateof10%percentoftheareaoftheplot/landdevelopedshallbeprovided
foropenspace/communityopenspacewhichshallbeexclusiveofapproachroads,pathways,or
margins.

12.2. GeneralBuildingRequirements
1. Theminimumheightoftheplinthshallbe30cmfromthetopsurfaceofapproachroadorpathway.
2. The maximum floor space index permissible shall be as per the development control regulations for
landusezones.
3. Sizesofroomsshallbeasgivenbelow:
a. Thesizeoflivingroom,bedroomshallnotbelessthan8sqmwithminimumwidthof2.4m.
b. SizeofindependentBathroomandw.cshallbe0.9sqmwithminimumwidthof0.9meach
c. Sizeofcombinedbathroomandw.c.shallbe1.8sqmwithminimumwidthof1m.
4. Theminimumheightofroomsshallbeasgivenbelow:
a. Livingroom:2.4m
b. Kitchenroom:2.4m
c. Bath/w.c:2.1m
d. Corridor:2.1m
5. Theminimumheightsofroomsincaseofslopingroofs:
a. Averageheightoftheroofshallbe2.1m
b. Theminimumheightoftheeavesshallbe2.4m.
c. Theminimumslopesofthesloppingroofshallbe300forG.Isheets,asbestossheetsortiledroof
whileforR.C.Csloppingroof,theminimumslopshallbe120.
6. Thefenestrationssuchaswindows,ventilatorsandotheropeningforlightandventilationshallbeas
under:
a. Onetenthoftheroomfloorarea.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

106|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
b. ForW.Candbathnotlessthan0.2sqm
7. Stairs:
a.
b.
c.
d.
e.

Thereshallbeonestaircaseforevery12dwellingunitsorpartthereof.
Theminimumwidthofstaircaseshallbe0.75m.
Themaximumheightoftherisershallbe0.2m.
Theminimumwidthofthetreadshallbe0.225m.
Theminimumclearheadroofofthestaircaseshallbe2.10m.

12.3. StructuralRequirements
1. Load bearing walls of the building shall be of Brick stone or pre cast block in any mortar, however
framedstructuresarepreferred;
2. InthecaseofR.C.Cframedstructureorwoodenframedstructure:
a. Fillerwallsmaybeofsuitablelocalmaterials.
b. Roofofthebuildingshallbeofgalvanizedironsheets,tilesrooforR.C.C.roof.Inthecaseofupper
storiedbuildings,middlefloorshallbeofwoodenorR.C.C.andrestasperchoice.
3. Doorsandwindowsofbuildingshallbeofanymaterial.
4. Useofasbestossheetsshallnotbepermitted.
5. Restoftheworkofbuildingshallbeasperlocallyavailableresourcesandasperchoice.

12.4. RoadsandPathWays
1. Theareaundertheroadsandpathwaysinsuchhousingprojectshallnormallynotexceed20percentof
thetotalareaoftheproject.
2. Accesstothedwellingunitswheremotorizedvehiclesarenotnormallyexpectedshallbebymeansof
pavedfootpathswithrightofwayof6mandpathwaysof2monly.Therightofwayshallbeadequate
toallowforplyingofemergencyvehiclesandalsoforsidedrainsandplantation.
3. Whereaccesswaysformotorizedvehiclesarenotprovidedandpedestrianpathwaysareprovided,the
minimumwidthofsuchpathwayshallbe4.0mwhichshallnotexceed50minlength.

12.5. MinimumRequiredAccommodation
1. TheminimumaccommodationprovidedineverydwellingunitshallbeonelivingroomandaW.C;
whereverthereisadrainagesystem,theagencydevelopingtheareashallinstallandmaintainthe
internal drainage system; where there is no drainage system the individual soakpit shall be
providedasperprovisionofNationalBuildingCode(NBC).
2. Theloftifprovidedintheroomshallnotcovermorethan30%ofthefloorareaoftheroom.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

107|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
13. FuelFillingandServiceStations
13.1. Definitions
The term fuel filling and service station is a place of retail business engaged in supplying goods and
services essential for the normal operation of automobiles. These include dispensing gasoline and motor
oil,thesalesandservicesoftyres,batteriesandotherautomobilesaccessoriesandreplacementitemand
washing and lubrication. They do not include the body of tender work, painting or other major motors
repairsandoverhauling.

13.2. RequirementsofFillingStationsandServiceStation
TheminimumsizeforthelocationofFillingStationandfillingcumServiceStationshallbeasfollows:
1. Fillingstation:30mx36.5m(Inintenselydevelopedareastheminimumfrontagemayberelaxedby
theAuthorityaftercompleteinvestigation).
2. Fillingcumservicestationshallbe2000sqmhavingfrontagenotlessthan30m.
3. Theplotshouldbeonlevelground.
4. Everyfillingstationshouldprovideforoneparkingspaceforeachfouremployeeswithaminimum
oftwocarparkingspace.
5. Inthecaseofcombinedfillingandservicestations,additionalparkingspaceshouldbeprovidedat
therateofonecarparkingspaceforeachservicestation.

13.3. TrafficRequirements
1. Afillingstationorfillingcumservicestationisamajorgeneratoroftrafficandassuchpresentadegree
oftraffichazardontheroadonwhichitissited.Thispotentialtraffichazarddeterminesthenumberof
station that can be permitted in any section of the road or the highway or in a section of a city, the
objectivebeingtokeepthetraffichazardtotheminimum.
2. Afillingstationorfillingcumservicestationshouldnotbelocatedoppositeabreakoropeninginthe
Central verge on a dual carriage as this will encourage the traffic to cross the road while entering a
fillingstationorfillingcumservicestation.
3. Afillingstationorfillingcumservicestationpreferablymaynotbesitedtooclosetoanintersectionto
a traffic island on the main road. To assure satisfactory weaving distances, the minimum desirable
distance between an access to a station and the tangent point of the traffic island or intersection
shouldbe80m.
4. Inthecaseofmainroadprovidedalongwithaserviceroadoramarginalaccessroad,theaccesstothe
stationshouldbeprovidedfromtheservice/marginalaccessroadandnotfromthemainroad.
5. On road having heavy traffic, it is desirable to provide one station on either side of the road so that
vehiclesarenotrequiredtocrosstheroad.Onroadsthetrafficcannotsupporttwofillingstationopen
on either side, one may be located on either sides provided the site is not close to a junction and
confirmtotherequirementsof(3)above.
6. Sittingofthestationsonroadcurvesorbendsareasafetyhazardandshouldbeavoided.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

108|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
7. TheminimumdistanceofthepropertylineofthefillingstationfromtheCentrallineoftheroadmust
notbelessthan15morhalftheproposedrightofwayoftheroad,whicheverismore.Inthecaseof
NationalHighways,andmajorroadintheurbanareas,theyshouldbesetbacksoastobeoutsidethe
ultimaterightofwayofthehighwayalongwhichitistobelocated.
8. However,variationscanbeapprovedinspecialcasesifallowedbyDSIRDAaftercompleteinvestigation.

13.4. EntryandExitConsiderations
1. Thebasicprinciplegoverningentryandexittofillingstationsistominimizinginterferencewithnormal
flowoftrafficontheaccessroad.
2. Toenableeasytrafficflowaminimumfrontageof30mshallbeprovidedwitheasyentranceandexit
kerbs.Vehiclesenteringandleavingthestationshouldbefullyvisibletothetrafficonthemainroad.
3. Thereshouldnotbeanyobstructiontoviewbetweenthefillingstationpumpsandtheroad.
4. Thefollowingminimumrequirementsfortheingressshouldbeobserved:
a.
b.
c.
d.
e.
f.

Maximumwidthofthedrivewaysatthesidewalk:5m
Minimumangleofintersectionofdrivewayswiththestreetpavement60(degree)
Minimumangleofintersectionofdrivewayswiththestreetpavement60(degree)
Minimumdistancefromanydrivewaytoanyexteriorpropertyline:6m
Minimumdistancefromanydrivewaytoanyinteriorplotline:3m
Minimumdistancebetweenkerbssides:9mc/c

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

109|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
14. ControlofSigns(Hoardings)andOutdoorDisplayStructuresandPagingTowerand
TelephoneTowerandOutdoorDisplayStructures
14.1. Permission
Onlyauthorisedsigns(Hoarding)pagingtowerandtelephonetowerswillbepermitted.

14.2. DesignandSize
Every hoarding shall be designed so as to withstand the wind, dead, seismic and other loads and other
structuralrequirementsinaccordancewiththeNBC.
In the case of shopping units in commercial areas and/or residentialcumcommercial buildings, the
displayboardsshallbeatthesameheightabovetheshoppingarcadeandshallordinarilybe45.5cmto61
cm in height. The placement and size of the boards shall form a part of the building permission and no
changethereinshallbepermittednorshallanyadditionalboardsbeallowedtobedisplayed.
Size of the hording along the various roads shall be permitted as prescribed by DSIRDA. DSIRDA shall
prescribesizeofthehoardingaccordingtolocalconditionsandrequirements.

14.3. ProhibitedSigns
Thefollowingsignsareprohibitedalongmajorroads,havingwidthbeyond18m
a) Anysignthatbyreasonofitsshapes,positionorcolourmaybeconfusedwithanauthorisedtraffic
signorsignal.
b) Anysigncontainingtheword"Stop","Look","Danger"orothersimilarwordthatmightmisleador
confusethetravellers.
c) Anysignthatisattachedtoorprintedonarockorothernaturalobjectsand
d) Anysignthatislocatedwithinapublicrightofwayunlessitisanofficialstreetname,trafficsignor
signalorotherofficialsign.

14.4. GeneralRestrictions
1) Nohoardingshallbepermittedinthemarginofthebuilding
2) Nogroundsignshallbeerectedtoaheightaccordingtolocalconditionandrequirements.Lighting,
reflectionsmayextendbeyondthetopoffaceofthesign.
3) Every ground sign shall be firmly supported and anchored to the ground. Supports and anchors
shall be of treated timber in accordance with good practice or metal treated for corrosion
resistanceormasonryorconcrete.
4) Nogroundsignshallbeerectedsoastoobstructfromaccesstooregressfromanybuildingand;
5) Nogroundsignshallbesetnearertothestreetlinethantheestablishedbuildingline,
6) Distance from the junction of roads: No sign or hoarding along roads shall be permitted. In such
awaythatitisnotobstructingthevisionrequiredforsafetrafficmovement.
7) AnyhoardingwhichintheopinionoftheAuthorityislikelytobeconfusedwithunauthorisedtraffic
signorsignalshallnotbepermitted.
8) Nohoardingonroadlessthan10mwideshallbepermitted.
9) Any hoarding containing the words "Stop", "Look", "Danger" or other similar words that might
misleadorconfusethetravellersshallnotbepermitted.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

110|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
10) No hoarding shall be permitted after keeping distance, according to local condition and
requirementsfromanypublicpark.
11) Thehoardingshallbepermittedinthemarginspaceofthebuildingandonrooftopasunder
12) All permission for hording shall be given only after getting certificate from registered structural
engineerforthestability,safetyofhordingtobeerected.
Table141:MarginSpaceforHoardings

SR.
NO.
1

LOCATION

ParalleltoRoad

MAXIMUM
HOARDINGSIZE

RoadSide

6mx3m
(widthxheight)

PerpendiculartoRoad

AsperG.D.C.R.

Onrooftop

AsperG.D.C.R.

1.5m

1.5m

MARGIN
Between
Buildingsand
Hoardings

Betweentwo
hoardings

4.5m

4.5m

4.5mprovided
thehoardingis
notcrossing
buildingline,
shallnotbe
applicable

4.5m

Table142:HoardingSize

ROADWIDTHRANGE(M)

HEIGHTOFHOARDING(WIDTH)

18.0mandlessthan30.0m
30.0mandmore

4.5m
9.0m

MAXIMUMLENGTHOF
HOARDING
9.0m
27.0m

14.5. HoardingonRoof
FollowingprovisionsshallapplyforRoofSigns.
a) Location: No roof sign shall be placed on or over the roof of any building, unless the entire roof
construction is of noncombustible material. The top of sign board should confirm the building
heightregulations.
b) Projection:Noroofsignshallprojectbeyondtheexistingbuildinglineofthebuildingonwhichitis
erectedorshallextendbeyondtheroofinanydirection.
c) Support&Anchorage:Everyroofsignshallbethoroughlysecuredandanchoredtothebuildingon
or over which it is erected. All loads shall be safety distributed to the structural members of the
building.

14.6. WallSigns
Followingprovisionsshallapplyforwailsigns.
a) Dimensions:Thetotalareaofthesignshallnotexceed25percentofthetotalareaofthefacade
onwhichthesigniserected.Thefacadeofthebuildingshallbesubdividedintoblocksofuniform
heightandtheareaofthesignerectedonparticularblockshallnotexceed25percentofthearea
ofthatblock.
b) Projection:Nowallsignshallextendabovethetopofthewallorbeyondtheendsofthewallto
whichitisattached.Atanyplacewherepedestriansmaypassalongawall,anywallsignattached
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

111|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
theretoshallnotprojectmorethan7.5cmtherefromwithinaheightof2.5mmeasuredfromthe
levelofsuchplace.
c) Support & Attachment: Every wall sign shall be securely attached to walls, wooden blocks or
anchorage with wood used in connection with screws, staples or nails shall not be considered
properanchorage,exceptinthecaseofwallsignsattachedtowallsofwood.
d) Reflectors: Lighting reflectors may project 2.4m beyond the face of the wall provided such
reflectors are at least 4m above the footpath level, but in no case shall such reflectors project
beyondaverticalplaneonemetreinsidethekerbline.

14.7. ProjectingSigns
Noprojectingsignoranypartofitssupportsorframeworkshallprojectmorethan2mbeyondthemain
faceofthebuildingtowhichsuchsignisattached.Ateveryplacewherepedestriansmaypassunderneath
aprojectingsign,anoverheadclearanceofatleast2.5mshallbemaintained.
Comprehensive Sign Design: Particularly in the case of an existing structure where because of the code
amendment new signage is likely to cover less of the building facade than previously, it is hoped that
Comprehensive Sign Designs will encourage the rehabilitation of the building front itself as well as the
carefuldesignofthesignthatgoesonit.

14.8. SignsInUrbanRenewalProjectAreas
These signs must confirm with the zoning regulations and with the urban renewal plan or .special
restrictionsforthearea,whichmayincludeadditionalregulationsorrequirements.
14.8.1. Banners,SignBoardsEtc
Banners,signboardsandseveralotherkindsofsignsotherthanonpremisesignsshallbeonlytemporarily
permitted.
Nosignswithin30mdistanceofaparkentrancesorinstitutionalentrancesshallbepermitted.

14.9. HistoricBuildings
DSIRDA is empowered to deny the permission on the ground of ambiance of heritage buildings and
precincts.

14.10. DepositandFees
1) ThefeesforerectionandmaintenanceofthehoardingshallbechargedasdecidedbyDSIRDAfrom
timetotime.
2) Thefeesforhoardingshallbepaidbytheapplicantinadvance,forthecalendaryearorpanthereof

14.11. TelecommunicationInfrastructure(Paging,CellularMobiles,VSat.,MTNLEtc.)
1) Followingprovisionsshallapplyfortelecommunicationinfrastructure.
a) Location:TheTelecommunicationInfrastructureshallbeeitherplacedonthebuildingrooftops
oronthegroundoropenspacewithinthepremisessubjecttootherregulations.
b) Typeofstructure:
(i) Steelfabricatedtowerorantennaesonpole.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

112|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
(ii) Prefabricated shelters of fibre glass or P.V.C. on the building rooftop/terrace for
equipment
(iii) MasonryStructure/Shelteronthegroundforequipment.
(iv) D.G.setwithsoundproofcovertoreducethenoiselevel.
c) Requirement:
(i) Every applicant has to obtain/procure the necessary permission from the "Standing
Advisory Committee on Radio Frequency Allocation" (SACF A) issued by Ministry of
Telecommunications.
(ii) Everyapplicantwillhavetoproducethestructuralstabilitycertificatefromtheregistered
structuralengineerwhichshallbetheliabilityofbothparties
(iii) Applicantshavetoproduce/submitplansofthestructuretobeerected.
d) Projection:NoPagerand/orTelephoneTowershallprojectbeyondtheexistingbuildinglineof
thebuildingonwhichitiserectedinanydirection.
2) CriticalInfrastructureSites:
a) EveryBuildingshallbeenablesperthenormsof(TRAI)TelecomRegulatoryAuthority/DOT.so
that service provider can provide broadband and cable service to all the occupants by
connectionatsinglepoint.
b) AuthorityshallgrantpermissiontosetuptowerofTelecommunicationinanotifiedsitebyjoint
workinggroup/jointworkingcommittee
c) Any service provider/Infrastructure Provider shall have to give a commitment that the site
wouldbesharedbyatleastthreeserviceproviders
3) DEPOSITANDFEES:Thefeesforerectionandmaintenanceofthetelecommunicationinfrastructure
shallbechargedasdecidedbyDSIRDAfromtimetotime

14.12. ControlSignBoard
Table143:ControlSignBoard

WIDTHATTHE
LOCATION
1)Till9m
2)9mto18m
3)18mto40m
4)morethan40m

FORSIGNBOARD
Maroon/Grey
Maroon/Grey
Red/Grey
Grey

COLOURCODE
FORLETTERS
White
White/Pink
White/Pink
White

FORBUILDING
White
Pink
Ivory
LightGreen

Note:
1) Lengthofthesignboardshallbeaccordingtolengthoftheroadbesidetheshop
2) Heightofthesignboardshallbe0.6mto1.0maccordingtothelengthoftheshop
3) Sizeofthelettersonthesignboardshallbe0.2mto0.4maccordingtothesizeofthesignboard

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

113|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
15. Mining,QuarryingandBrickKiln
Thefollowingregulationsshallgovernthemining,quarryingandbrickkilnoperations.

15.1.
No mining, quarrying and brick kiln operations where no blasting is involved shall be permitted within a
distanceof50mfromtheboundaryofanypublicroad,railwayline,canal,transmissionlineoranyother
building. No mining and quarrying operations and brick kiln operations which involves blasting shall be
permitted within a distance of 200 m from any public road, railway line, canal, transmission line or any
otherbuilding.

15.2.
Nobuildingoperationsshallbepermittedontheplotonwhichminingandquarryingandkilnoperations
havebeenpermitted,withoutthepriorapprovaloftheAuthority.

15.3.
The mining, quarrying and brick kiln shall be permitted for a stipulated period not exceeding three years
from the date of development permission at a time and shall be so prescribed in the development
permission.

15.4.
Thefollowingshallgovernthemining,quarryingandbrickkilnoperationsandshallformconditionsofthe
developmentpermission:
1) The mining, quarrying and brick kiln operations shall not cause any nuisance to people in the
vicinity.
2) Themining,quarryingandbrickkilnoperationsbelowtheaveragegroundlevelshallbepermitted
onlyfortheextraction.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

114|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
16. ApplicabilityofRegulations
16.1. General
TheseregulationsexceptRegulationNo.16.4applytoallnewconstructionstobecarriedoutandshallalso
apply o any additions or alterations that may be made in any existing construction and also in case of
changeofuseinexistingbuilding.TheRegulationNo.16.2shallapplytoexistingbuildings.

16.2. AdditionorExtensiontoaBuilding
Noadditionorextensiontoabuildingshallbeallowedunlesstheadditionorextensionissuchaswouldbe
permissibleifthewholebuildingwerereconstructedfromtheplinthwiththeopenspacesrequiredunder
theregulationsapplicabletothesiteofthebuildingatthetimeoftheproposedadditionorextensionand,
noadditionorextensiontoabuildingshallbeallowedwhichwoulddiminishtheextentofairspacebelow
theminimumwhichisrequiredbytheregulationsapplicabletothesiteofthebuildingatthetimeofthe
proposedadditionorextension.

16.3. SafeguardAgainstReductionofOpenSpaces
Noconstructionworkonabuildingshallbeallowedifsuchworkoperatestoreduceanopenairspaceof
anyotheradjoiningbuildingbelongingtothesameownertoanextentlessthanwhatisprescribedbyany
of the regulation in force at the time of the proposed work or to further reduce such open space if it is
alreadylessthanwhatisprescribed.

16.4. MaintenanceofBuildings
16.4.1. Structural
ForthepurposeoftheseRegulations,buildingsshallbedividedintothefollowingclasses:
Class 1: All types of framed structures, factory buildings, cinema, auditorium and other public buildings,
schoolsandcollegebuildings,hostels.
Class2:Masonrywalledresidentialbuildingsconstructedwithmorethanground+twofloors.
It shall be the duty of the owner of a building to get his building examined by a registered structural
designerat theintervaloftime prescribedhereunderandtosubmitastructuralinspectionreportto the
AuthorityintheFormNo.11.
The interval at which such buildings are to be examined and a report submitted to Authority shall be as
under:
a) Withinthreeyearsfromthecomingintoforceoftheseregulationandthereafterattheintervalof
everyfifteenyearsfromthedateofsubmissionofthefirstreport.ForClassIbuildingswhichare
erectedfifteenyearsearlierfromthedateonwhichtheseRegulationshascomeintoforce,building
inspectionneedstobecarriedoutwithin5yearsofenforcementoftheseregulations.
b) WithinfiveyearsfromthecomingintoforceoftheseRegulationandthereafterattheintervalof
everyfifteenyearsfromthedateofsubmissionofthefirstreportforClassIIbuildingswhichare
erectedfifteenyearsearlierfromthedateonwhichtheseRegulationhascomeintoforceorwhich
becomefifteenyearsoldthereafter.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

115|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
16.4.2. Firesafety
FiresafetynormsshallbefollowedaccordingtoNBC2003(part4).Itshallbethedutyofeveryownerto
maintain and keep in working order the arrangement of internal fire hydrants, firelifts and firestair
providedinhisbuilding.Atintervalsofnotmorethantwelvemonthsheshallsubmitacertificatefromthe
Fire Department or Fire Consultant registered with DSIRDA certifying that the system of internal fire
hydrant, fire lifts & fire stairs and other protections required are properly maintained and is in good
workingconditions.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

116|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
17. FacilitiesforPhysicallyHandicappedPersons
17.1. ShortTitle,Extent&Commencement
17.1.1. Applicability
Theseregulationsshallbeapplicabletoallbuildingsandfacilitiesusedbythepublic.Itdoesnotapplyto
private&publicresidences.
TheyshallextendtothewholeoftheDholeraSpecialInvestmentRegion.

17.2. Definitions
17.2.1. NonambulatoryDisabilities
Impairments regardlessofcauseor manifestation,forallpracticalpurposesconfineindividualstowheel
chairs.
17.2.2. SemiambulatoryDisabilities
Impairmentsthatcauseindividualstowalkwithdifficultyorinsecurity.Individualsusingbracesorcrutches,
amputees,arthritics,spastics,andthosewithpulmonaryandcardiacillnessmaybesemiambulatory.
17.2.3. HearingDisabilities
Deafnessorhearinghandicapsthatmightmakeanindividualinsecureinpublicareasbecauseheisunable
tocommunicateorhearwarningsignals.
17.2.4. SightDisabilities
Totalblindnessorimpairmentsaffectingsighttotheextentthattheindividualfunctioninginpublicareasis
insecureorexposedtodanger.
17.2.5. WheelChair
Chair used by Disabled people for mobility. The standard size of wheel chair shall be taken as 1.05 m X
0.75m.

17.3. Scope
These regulations are applicable to all buildings and facilities used by the public. It does not apply to
private&publicresidences.

17.4. SiteDevelopment
Leveloftheroads,accesspathsandparkingareasshallbedescribedintheplanalongwithspecificationof
thematerials.
17.4.1. AccessPath/WalkWay
Accesspathfromtheentryandsurfaceparkingtobuildingentranceshallbeminimumof1.8mwidehaving
even surface without any steps. Slope if any, shall not have gradient greater than 5%. Selection of floor
materialshallbemadesuitablytoattractortoguidevisuallyimpairedpersons(limitedtocolouredfloor
materialwhosecolourandbrightnessisconspicuouslydifferentfromthatofthesurroundingfloormaterial
or the material that emit different sound to guide visually impaired persons herein after referred to as
guidingfloormaterial.Finishesshallhaveanonslipsurfacewithatexturetraversablebyawheelchair.
Curbswhereverprovidedshouldblendtoacommonlevel.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

117|P a g e

DraftG
GeneralDevelop
pmentCo
ontrolRe
egulation
ns(DGDC
CR)
17.4.2. Parking:
wingprovisio
onsshallbem
made:
Forparkingofvehiclesofhandicappedpeople,thefollow
ded near entrance for tthe physicallly handicapp
ped
1. Surfaace parking for two carr spaces shaall be provid
perssonswithmaaximumtraveeldistanceo
of30mfrombuilding.
2. Thewidthofparrkingbayshaallbeminimu
um3.60m.
n stating that the spacce is reserve
ed for wheel chair useers shall be
e conspicuou
usly
3. The information
displayed.
ding floor materials
m
shaall be provid
ded or a device which guides visuaally impaired
d persons with
w
4. Guid
audiblesignalso
orotherdeviceswhichseervesthesam
mepurposesshallbeprovvided.

17.5. BuildingRe
B
equirements
Thespeccifiedfacilitieesforthebu
uildingforph
hysicallyhand
dicappedpersonsshallb
beasfollows..
1. Apprroachtoplin
nthlevel.
2. Corrridorconnecttingtheentrrance/exitfo
orthehandiccapped.
3. Stairrways.
4. Lift.
5. Toileet.
6. Drinkingwater
17.5.1. ApproachttoPlinthLevvel
uildingshoulldhaveatleeastoneentranceaccesssibletothe handicapped
dandshallb
beindicated
dby
Everybu
propersignage.Thisentranceshallbeapproachedthrougharampto
ogetherwith
hthestepped
dentry.
a. Ramped App
proach: Ram
mp shall be finished
f
with
h non slip material
m
to en
nter the building minimum
w
width
of ram
mp shall be 1800mm. with
w maximum gradient 1:12, length
h of ramp sh
hall not exceeed
800mmhighhandrailo
9
9.0mhaving
onbothsidessextending300mm.beyyondtopand
dbottomofthe
r
ramp.Minim
mumgapfrom
mtheadjaceentwalltoth
hehandrailsshallbe50m
mm.

DholeraSpecialInvestmentRegionalDevelop
pmentAutho
ority,Gandhinagar
DSIRDA

118|P a g e

DraftG
GeneralDevelop
pmentCo
ontrolRe
egulation
ns(DGDC
CR)

b. SteppedApp
S
proach:Forssteppedapproachsizeofftreadshallnotbelesstthan300mm
mandmaximum
r
riser
shall bee 150mm. Provision
P
of 800mm
8
high
h hand rail on
o both sidees of the stepped approach
s
similartothe
erampedap
pproach.
c. Exit/Entran
nceDoorMin
nimumclearropeningof theentranccedoorshallbe900mm anditshall not
b provided with a step
be
p that obstru
ucts the passage of a wheel chair user. Thresho
old shall not be
r
raisedmore
than12mm.

d. Entrance Laanding: Entrance landin


ng shall be providing adjacent
a
to ramp with the minimum
d
dimension
1
1800x2000m
mm. The enttrance landiing that adjjoin the top
p end of a slope shall be
p
provided
wiith floor maaterials to attract the attention
a
of visually impaired perso
ons (limited to
c
coloured
flo
oor material whose colo
our and brigh
htness is conspicuously different fro
om that of the
s
surrounding
m
that emit diffeerent sound to guide vissually impaired
floor material or the material
p
persons
hereinafter refeerred to as guiding floor material (regulation
n section no
o.17.6). Finishes
s
shallhavea
nonslipsurrfacewitha texturetraversablebyaawheelchairr.Curbswhe
ereverprovid
ded
s
shouldblend
dtoacommonlevel.
17.5.2. ConnectinggtheEntrance/ExitfortheHandicap
pped
ntrance/exit for handicaapped leadin
ng directly o
outdoors to a place where
The corrridor conneccting the en
informattion concern
ning the oveerall use of the specifie
ed building can be pro
ovided to vissually impaired
personseitherbyap
personorbysigns,shallb
beprovidedasfollows:
a. Guiding floor materialss shall be provided or devices
d
that emit sound
d to guide visually impaired
p
persons.
b. Theminimum
T
mwidthshallbe1500mm
m.
c. Incasethereeisadifferen
nceoflevelsslopewaysshallbeproviidedwithasslopeof1:12
2.
d. Handrailssh
hallbeprovid
dedforramp
ps/slopewaays.

DholeraSpecialInvestmentRegionalDevelop
pmentAutho
ority,Gandhinagar
DSIRDA

119|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
17.5.3. StairWays
Oneofthestairwaysneartheentrance/exitforthehandicappedshallhavethefollowingprovisions:
a. Theminimumwidthshallbe1350mm.
b. Heightoftherisershallnotbemorethan150mmandwidthofthetread300mm.Thestepsshall
nothaveabrupt(square)nosing.
c. Maximumnumberofrisersonaflightshalllimitedto12.
d. Handrailsshallbeprovidedonbothsidesandshallextend300mmonthetopandbottomofeach
flightonsteps.

17.5.4. Lifts
Whereverliftisrequiredasperbyelaws,provisionofatleastoneliftshallbemadeforthewheelchairuser
withthefollowingcagedimensionsofliftrecommendedforpassengerliftwithcapacityof13personsby
BureauofIndianStandards.
a.
b.
c.
d.

Clearinternaldepth:1300mm
Clearinternalwidth:2000mm
Entrancedoorwidth:900mm
Ahandrailnotlessthan600mmlongat1000mm.abovefloorlevelshallbefixedadjacenttothe
controlpanel.
e. Theliftlobbyshallbeofaninsidemeasurementof1800x1800mmormore.
f. The time of an automatically closing door should be minimum 5 seconds and the closing speed
shouldnotexceed0.25m/sec.
g. Theinteriorofthecageshallbeprovidedwithadevicethataudiblyindicatesthefloorthecagehas
reachedandindicatesthatthedoorofthecageforentrance/exitiseitheropenorclosed.
17.5.5. Toilets
OnespecialW.Cinasetoftoiletshallbeprovidedfortheuseofhandicappedwithessentialprovisionof
washbasinneartheentranceforthehandicapped.
a. Theminimumsizeshallbe1000x1750mm.
b. Minimumclearopeningofthedoorshallbe900mmandthedoorshallbeswingout
c. Suitable arrangement of vertical/ horizontal hand rails with 50 mm clearance from wall shall be
madeinthetoilet.
d. TheW.Cseatshallbe500mmfromthefloor.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

120|P a g e

DraftG
GeneralDevelop
pmentCo
ontrolRe
egulation
ns(DGDC
CR)

Water
17.5.6. DrinkingW
hehandicapp
pedneartheespecialtoilletprovided for
Suitable provisionoffdrinkingwaatershallbeemadeforth
them.

17.5.7. DesigningfforChildren
p
t use of the children, it will be neceessary to su
uitably alter the
In the buildings meaant for the predominant
heightofthehandrrailandotheerfittings&ffixturesetc.

17.6. Explanatory
E
yNotes
17.6.1. Guiding/W
WarningFloo
orMaterial
ormaterialsttoguideorttowarnthe visuallyimp
pairedperso
onswithach
hangeofcolourormateerial
Thefloo
with con
nspicuously different teexture and easily
e
distingguishable from the restt of the surrrounding floor
materials is called guiding
g
or warning
w
floor materials. The materiaal with diffeerent texture
e gives audiible
withsensorywarningwhenapersonmovesonth
hissurfacew
withwalkingstick.Thegu
uiding/warn
ning
signalsw
floormaaterialismeaanttogivethedirection
naleffector warnapersonatcriticalplaces.Thisfloormateerial
shallbeprovidedintthefollowinggareas:
a.
b.
c.
d.
e.

TTheaccessp
pathtothebuildingandttotheparkin
ngarea.
lobbytowardstheinform
T
Thelanding
mationboard
d,reception,,lifts,staircasesandtoillets.
nning/endo
ofwalkwayw
wherethereisavehiculaartraffic.
Immediatelyyatthebegin
A
Atlocations
ofabruptch
hangesinlevelsoratram
mps.
Immediatelyyinfrontofaanentrance//exitandthelanding.

17.6.2. ProperSign
nage
uildingforth
hehandicapp
pedpersonsshouldbedo
one
Approprriateidentificcationofspeecificfacilitieswithinabu
with pro
oper signagee. Visually im
mpaired perssons make use
u of otherr senses succh as hearingg and touch
h to
DholeraSpecialInvestmentRegionalDevelop
pmentAutho
ority,Gandhinagar
DSIRDA

121|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
compensate for the lack of vision, whereas visual signals benefit those with hearing disabilities. Signs
shouldbedesignedandlocatedsothattheyareeasilylegiblebyusingsuitablelettersize(notlessthan20
mm.high).ForvisuallyimpairedpersonsinformationboardinBrailleshouldbeinstalledonthewallata
suitableheightanditshouldbepossibletoapproachthemclosely.
Toensuresafewalkingthereshouldnotbeanyprotrudingsignwhichcreatesobstructioninwalking.Public
Address System may also be provided in busy public areas. The symbols /information should be in
contrastingcolourandshouldbeproperlyilluminatedbecausepeoplewithlimitedvisionmaybeable to
differentiate only amongst primary colours. International symbol mark for wheel chair as shown below
should be installed at the lift, toilet, staircase, parking areas etc., which have been provided for the
handicapped.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

122|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
18.

HeritageRegulations

18.1. Applicability
Thisregulationwillapplytothosebuildings,artefacts,structures,areasandprecinctshavingaestheticand/
orarchitecturaland/orculturaland/orenvironmentalsignificance(hereinafterreferredaslistedheritage
buildings listed heritage precincts) and natural areas of scenic beauty including but not limited to sacred
groves, hills, hillocks, water bodies (and the area adjoining the same), open areas, wooded areas
(hereinafter referred to as natural features) which will be listed in a notification to be issued by
Government.
Forthepurposeofthisregulation,precinctwillhereinafterrefertoanyareadelineatedwithintheDSIR
area, containing listed heritage buildings, artefacts, structures of historic and / or aesthetic and / or
architecturaland/orculturaland/orenvironmentalsignificancebeingboundonallsidesbypathsand/or
roadsand/orwaterbodiesand/orrailwaylinesand/orplotlinesand/orbuildingsforwhichspecial
regulationsmayhenceforthbedevised.

18.2. RestrictiononDevelopment/Redevelopment/RepairsEtc.
i.

ii.

iii.

iv.
v.

vi.

No development or redevelopment or engineering operation or additions alterations, repairs,


renovation including the painting of buildings, replacement of special features or plastering or
demolitionofanypartthereofofthelistedheritagebuildingsorlistedheritageprecinctsorlisted
naturalfeaturesshallbeallowedexceptwiththepriorwrittenpermissionofDSIRDA
Beforegrantinganysuchpermission,DSIRDAshallconsulttheHeritageConservationCommitteeto
be appointed by Government (hereinafter referred to as the said Heritage Conservation
Committee)andshallactontheadviceoftheHeritageConservationCommittee.
Providedthatbeforegrantinganypermissionfordemolitionormajoralterations/additionstolisted
heritagebuilding(orbuildingswithinlistedheritageprecincts),orconstructionatanylistednatural
features,oralterationofboundariesofanylistednaturalfeatures,objectionsandsuggestionsfrom
thepublicshallbeinvitedanddulyconsideredbytheHeritageConservationCommittee.
Providing that only in exceptional cases, for reasons to be recorded in writing, DSIRDA may refer
thematterbacktotheHeritageConservationCommitteeforreconsideration.
Itshallbethedutyoftheownersofheritagebuildingandbuildinginheritageprecinctstocarryout
regular repairs and maintenance of the building at their own cost. The Government, the
Municipality or the local bodies and authorities shall not be responsible for such repair and
maintenance except for the building owned by the Government, the Municipality or the local
bodies.
However,thedecisionoftheHeritageConservationCommitteeaftersuchreconsiderationshallbe
final.

18.3. PreparationofListofHeritageBuildings,HeritagePrecinctsandListedNaturalFeatures
The list of buildings, artefacts, structures, areas and precincts or historic, and / or aesthetic and / or
architectural and / or cultural significance and / or environmental significance and the said list of those
naturalfeaturesofenvironmentalsignificanceand/orscenicbeautyincludingsacredgroves,hills,hillocks,
waterbodies(andtheareasadjoiningthesame),openareas,woodedareas,etctowhichthisregulation
appliesshallnotformpartofthisRegulationforthepurposeofSection19oftheAct,1976.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

123|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Thelistshall besupplemented/altered/deleted/modifiedfromtime totimebyGovernmentand/ or
DSIRDAontheadviceofthesaidHeritageConservationCommittee,orbytheGovernmentsuomotoorby
DSIRDA suomoto, or by the Heritage Conservation Committee suomoto, provided that after the list is
supplemented/altered/deleted/modified,themodificationstothelistshallbepublishedintheofficial
gazette and in such other manner as may be prescribed along with a notice in the prescribed manner,
inviting objections and suggestions from the public within a period of 30 days from the date of its
publication. The objections and suggestions received shall be duly considered by Government and / or
DSIRDAandontheadviceoftheHeritageConservationCommitteethelistshallbefinalizedandnotified.
When a building or group of buildings or natural features is listed it would automatically mean unless
otherwiseindicatedthattheentirepropertyincludingitscompoundsubsidiarystructuresetc.,frompartof
thelist.

18.4. PowertoAlter,ModifyorRelaxOtherGeneralDevelopmentControlRegulations
On the advice of the said Heritage Conservation Committee and for reasons to be recorded in writing,
DSIRDAmay/shallalter,modifyorrelaxtheprovisionsofotherGeneralDevelopmentControlRegulations
oftheDraftDevelopmentPlanforAUDA(hereinafterreferredtoasthesaidRegulationsifitisneededfor
the conservation, preservation, or retention of historic and / or aesthetic and / or cultural and / or
architecturalqualityofanylistedheritagebuildingsorlistedheritageprecinctsand/orthepreservationof
anylistednaturalfeatures.Providedthatanylistwhichisindraftformandpendingforapprovalwill,inthe
interimperiod,alsobedeemedtobeapartoftheheritagelistforpurposesofdevelopmentpermission.

18.5. SpecialRegulationsforListedHeritagePrecincts
In case of heritage precincts and (where deemed necessary by the Heritage Conservation Committee) of
naturalfeaturesnotifiedaspertheprovisionsofthisHeritageConservationRegulationno.17.20.2above,
development permissions shall be granted in accordance with the special regulations prescribed for
respective precincts natural features which shall be framed by DSIRDA on the advice of the Heritage
ConservationCommittee.
Before finalizing the special regulations for precincts / natural features, the draft of the same shall be
published in the official gazette and in leading newspapers for the purpose of inviting suggestions and
objectionsfromthepublic.Allsuggestionsandobjectionsreceivedwithinaperiodof60daysfromthedate
ofpublicationintheofficialgazetteshallbeconsideredbytheDSIRDA/HeritageConservationCommittee.
Afterconsiderationoftheabovesuggestionsandobjections,DSIRDAactingontheadviceoftheHeritage
ConservationCommittee,shallmodify(ifnecessary)theaforesaiddraftspecialregulationsforprecincts/
naturalfeaturesandforwardthesametoGovernmentforsanction.
Provided that pending consideration of suggestions and objections and pending final sanction from
Government to the above draft special regulations for precincts, DSIRDA / Heritage Conservation
Committeeshallhavedueregardtotheabovedraftspecialregulationswhileconsideringapplicationsfor
development/redevelopment,etc.intherespectiveprecincts/naturalfeatures.

18.6. ApplicabilityofDevelopmentProposalstoListedHeritageBuildingListedHeritagePrecincts
i.

IfroadwideninglinesareprescribedunderSection12(2)(d)and/orSection40(3)(c)oftheAct,
2009andAct,1976,oranyotheract.Theyshallbesuchsothattheywillprotectandnotdetract
fromthelistedheritageprecincts/naturalfeatures.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

124|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
ii.

iii.

iv.

IfthereareanynewroadsorroadwideninglinesproposedintheDevelopmentPlans,DSIRDA
shallconsidertheheritageprovisionsandenvironmentalaspectswhileconsideringapplications
for development permissions in these precincts. Necessary steps may be taken to modify the
Development Plan accordingly. Pending this action, the road widening / development of new
roadsshallnotbecarriedout.
No widening of the existing roads in the Development Plan for DSIR shall be carried out in a
manner which may affect the existing heritage buildings (even if they are not included in a
HeritagePrecinct)orwhichmayaffectlistednaturalfeatures.
IfthereareanyDevelopmentPlanreservationsshownonheritagebuildings,oronlistednatural
featuresthesameshallnotbeimplemented.Ifrequired,DSIRDAontheadviceoftheHeritage
ConservationCommitteeshallmovetoGovernmenttogetthesereservationsdeletedmodified
asneedbe.

18.7. IncentiveUsesforListedHeritageBuildings
Chapter 10 and 11 of these regulations define areas where commercial / office / hotel uses are not
permitted.However,incasesofbuildingsincludedintheHeritageConservationList,iftheowner/owners
/ lessees agree to maintain the listed heritage building as it is in the existing state and to preserve its
heritagestatewithduerepairsandtheowner/owners/lesseesgiveawrittenundertakingtothateffect,
the owner / owners / lessees may be allowed by DSIRDA on the advice of the Heritage Conservation
Committeetoconvertpartorthewholethereofofthenoncommercialareawithinsuchaheritagebuilding
tocommercialofficeuse/hoteluse.Providedthatiftheheritagebuildingisnotmaintainedsuitablyorif
theheritagevalueofthebuildingisallowedtobespoiledinanymanner,thecommercial/office/hotel
useshallbedisallowed.

18.8. CreationofNewIncentivesforHeritageConservation

Incentivesmaybecreatedforheritageconservationoflistedheritagebuildings/listedheritageprecincts
byDSIRDAontheadviceoftheHeritageConservationCommittee.Whereapplicableundertheprovisions
oftheGeneralDevelopmentControlRegulationsoftheDevelopmentPlanforDSIRDAorspecialregulations
for listed heritage buildings / listed heritage precincts, these incentives may include Transfer of
DevelopmentRights,thecreationofaRepairFund,Taxincentiveetc.
Thespecificprovisionsfortheseincentives,whereapplicable,maybeframedbyDSIRDAontheadviceof
the Heritage Conservation Committee following the Bombay and Hyderabad models for heritage
regulation,andthesamesubmittedtotheGovernmentforsanction.

18.9. MaintainingSkylineandArchitecturalHarmony
Buildings within listed heritage precincts and in the vicinity of listed Grade I heritage buildings / listed
natural features shall maintain the skyline and follow those architectural styles so as not to diminish or
destroythevalueandbeautyofortheviewfromthesaidlistedheritageprecinct/listedheritagebuilding
or of the listed natural features. The term vicinity shall be interpreted by the Heritage Conservation
Committee. The development within the listed heritage precinct or in the vicinity of the listed Grade I
heritagebuilding/listednaturalfeaturesshallbeinaccordancewiththeguidelinesframedbytheHeritage
ConservationCommittee.

18.10. RestrictiveCovenants
RestrictionsexistingasondateofthisNotificationimposedundercovenants,termsandconditionsbythe
leaseholdplotseitherbyGovernmentorbyDSIRDA/Panchayatshallcontinuetobeimposedinadditionto

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

125|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
the General Development Control Regulations. However, in case of any conflict with the heritage
preservationinterest/environmentalconservation,thisHeritageRegulationshallprevail.

18.11. GradingoftheListedHeritageBuildings/ListedHeritagePrecincts
Themeaningofthesegradesandbasicguidelinesfordevelopmentpermissionsareasfollows.
Listingdoesnotpreventchangeofownershiporusage.However,suchusageshouldbeinharmonywith
thesaidlistedprecinct/building.Carewillbetakentoensurethatthedevelopmentpermissionrelatingto
thesebuildingsisgivenwithoutdelay.
Table181:GradesandbasicguidelinesforHeritageBuildings
GRADEI
GRADEII
A)
Definition
HeritageGradeIcomprises
HeritageII(A&B)comprises
buildingsandprecinctsof
buildingsandprecinctsof
nationalorhistorical
regionalorlocalimportance
importance,embodying
possessingspecialarchitectural
excellenceinarchitecturalstyle, oraestheticmeritorculturalor
design,technologyandmaterial historicalsignificancethoughofa
usageand/oraesthetics,they lowerscalethaninHeritage
maybeassociatedwithagreat GradeI.Theyarelocallandmarks
historicevent,personality,
whichcontributetotheimage
movementorinstitution.They andidentityoftheregion.They
havebeenandaretheprime
maybetheworkofmaster
landmarksoftheregion.
craftsmenormaybemodelsof
proportionandornamentation,
Allnaturalsitesshallfallwithin ordesignedtosuitaparticular
climate.
GradeI.
B)
OBJECTIVE
HeritageGradeIrichlydeserves HeritageGradeIIrequired
carefulpreservation
intelligentconservation
C)

GRADEIII
HeritageGradeIIIcomprises
buildingsandprecinctsof
importancefortownscape,they
evokearchitectural,aesthetic,or
sociologicalinterestthoughnotas
muchasinHeritageGradeII.These
contributetodeterminingthe
characterofthelocalityandcanbe
representativeofthelifestyleofa
particularcommunityorregionand
mayalsobedistinguishedby
settingonastreetline,orspecial
character,ofthefaadeand
uniformityofheight,widthand
scale.
HeritageGradeIIIdeserved
intelligentconservation(thoughon
alesserscalethanGradeII)and
specialprotectiontounique
featuresandattributes.

SCOPEFORCHANGES
GRADEII(A)

Nointerventionsarepermitted
eitheronexteriororinteriorof
theheritagebuildingornatural
featureunlessitisnecessaryin
theinterestofstrengthening
andprolongingthelifeofthe
building/sorprecinctsorany
partorfeaturesthereof.For
thispurpose,absolutely
essentialandminimalchanges
wouldbeallowedandthey
mustbeinaccordancewiththe
original.

Internalchangesandadaptive
reuseandexternalchangesmay
byandlargebeallowedbut
subjecttostrictscrutiny.Care
wouldbetakentoensurethe
conservationofallspecial
aspectsforwhichitisincludedin
HeritageGradeII,GradeII(B).
Inadditiontotheabove,
extensionoradditionalbuilding
inthesameplotorcompound
could,incertaincircumstances,
beallowedprovidedthatthe

External,internalchangesand
adaptivereusewouldbyandlarge
beallowedChangescaninclude
extensions,andadditional
buildingsinthesameplotor
compound.However,anychanges
shouldbesuchthattheyarein
harmonywiththesurroundingarea
andshouldbesuchthattheydo
notdetractfromtheexisting
heritagebuildingPrecinct.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

126|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
GRADEI

GRADEII
extension/additionalbuildingis
inharmonywithlanddoesnot
detractfrom)theexisting
heritage,building(s)orprecincts,
especiallyintermsofheightand
faade.

D)
PROCEDURE
Developmentpermissionfor
Developmentpermissionforthe
thechangeswouldbegivenby changeswouldbegivenbythe
theDSIRDAontheadviceofthe DSIRDAontheadviceofthe
HeritageConservation
HeritageConservation
Committeetobeappointedby Committeetobeappointedby
theStateGovernment
theStateGovernment
E)
VISTASSURROUNDINGDEVELOPMENT
Alldevelopmentinareas
surroundingHeritageGradeI
shallberegulatedand

controlled,ensuringthatitdoes
notmarthegrandeurof,orthe
viewfromHeritageGradeI.

GRADEIII

Developmentpermissionforthe
changeswouldbegivenbythe
DSIRDAontheadviceofthe
HeritageConservationCommittee
tobeappointedbytheState
Government

18.12. Demolition/Reconstruction/Alteration
Nothingmentionedundertheseregulationsshouldbedeemedtoconferarightontheowner/occupierof
theplottodemolishand/orreconstructand/ormakealterationstohislistedheritagebuilding/buildings
in a listed heritage precinct if in the opinion of the Heritage Conservation Committee, such demolition /
reconstruction/alterationisundesirable.

18.13. ExteriorDesignandHeightofBuildings
So as to preserve the beauty of the heritage precincts and / or buildings, the Heritage Conservation
Committeeshallhavethepowertodirect,especiallyinareasdesignatedbythem,thattheexteriordesign
andheightofbuildingsshouldhavetheirpriorapproval.

18.14. CompositionofHeritageConservationCommittee
A. The Government shall constitute a Heritage Conservation Committee and frame the terms of
reference.
B. ThecompositionandqualificationsoftheHeritageCommitteeshallbeasfollows:
NO. DESIGNATION
01

Chairperson

02

Member

03

2Members

QUALIFICATION
RetiredMunicipalCommissioneroftheMunicipalCorporationorretired
SecretaryofGovt.ofGujaratwithrelevantexperience.
AStructuralEngineerhavingexperienceof10yearsinthefield.
TwoArchitectshaving10yearsexperienceindesignandmembershipinthe
CouncilofArchitecture:
i)Urbandesigner
ii)Architecthavingexperienceinconservationarchitecture.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

127|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
NO. DESIGNATION
04

Member

05

Member

06

Member

07

Member

08

Member

09
10

Member
Member
Member
Secretary

11

QUALIFICATION
AtechnicalofficeroftheArchaeologicalSurveyofIndia(notbelowtherank
ofAsst.Director)
AtechnicalofficeroftheStateArchaeologicalDept.(notbelowtherankof
Asst.Director)
AnEnvironmentalisthavingindepthknowledgeandexperienceof10years
ofsubjectmatter.
AnArchitectural/UrbanHistorianhaving10yearsexperienceinthefield.
ChiefTownPlanner,Govt.ofGujaratorhisrepresentativenotbelowthe
rankofSeniorTownPlanner.
ChiefExecutiveAuthority,DSIRDA
SeniorTownPlanner,DSIRDA
HeadofAdviseroftheHeritageCell,DSIRDA

The tenure of the members of category (2), (3), (6), and (7) above shall change after every three years
providedthatthesamepersonshallbeeligibleforreappointmentasMember.
The Committee shall have the powers to coopt upto three additional members who may have lesser
experience,butwhohavespecialknowledgeofthesubjectmatterprovidedthattheadditionalmembers
maybecooptedforspecialpurposesoronsubcommitteesoftheHeritageConservationCommittee.
C. ThetermsofreferenceoftheCommitteeshallbeinteralia.
i.
To advise DSIRDA whether development permission should be granted (under section 18.2),
andtheconditionsofsuchpermissions.
ii.
toprepareasupplementarylistofbuildings,artefacts,structures,areas,precinctsofhistoric,
aesthetic, architectural, cultural, or environmental significance and a supplementary list of
naturalfeaturesofenvironmentalsignificanceorscenicbeautyincludingsacredgroves,hills,
hillocks,waterbodies(andtheareasadjoiningthesame),openareas.Woodedareas,etc.,to
whichthisRegulationshallapply(videsection18.3).
iii.
To advise whether any relaxation, modification, alteration, or variance of any of the General
DevelopmentControlRegulations,iscalledfor(videsection18.4).
iv.
ToadviceDSIRDAinframingspecialregulationsforlistedheritageprecincts(videsection18.5).
v.
To advice DSIRDA on applicability of development proposals affecting listed heritage
buildings/listed precincts and on moving the Government to modify the same (vide section
18.6).
vi.
ToadviceDSIRDAwhetheritshouldallowcommercial/office/hotelusesinthelistedheritage
buildings/heritageprecinctsandwhentoterminatethesame(videsection18.7).
vii.
ToadviceDSIRDAincreatingnewincentivestoheritageconservation(videsection18.8).
viii.
To recommend to DSIRDA guidelines to be adopted by those private parties or public /
government agencies who sponsor beautification schemes at public intersections and
elsewherewithinlistedheritagebuildings/listedheritageprecincts.
ix.
Topreparespecialdesignsandguidelines/publicationsforlistedheritagebuildings,controlof
height and essential faade characteristics such as maintenance of special types of balconies
andotherheritageitemsofthebuildingsandtosuggestsuitabledesignsadoptingappropriate
materialsforreplacementskeepingtheoldformintacttotheextentpossible.
x.
To prepare guidelines relating to design elements and conservation principals to be adhered
to;and
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

128|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
xi.
xii.

xiii.
xiv.

ToprepareotherguidelinesforthepurposesofthisRegulation.
ToadviseDSIRDAonanyotherissuesasmayberequiredfromtimetotimeduringthecourse
of scrutiny of development permission and in overall interest of heritage / environmental
conservation.
ToappearbeforetheGovernmenteitherindependentlyorthroughoronbehalfofDSIRDAin
casesofappealsrelatedtolistedheritagebuildings/listedheritageprecincts.
CriteriaforlistingofHeritagesitesasofbelow:

1.

3
4

6
7
9
10

11
12
13

ABBREVIATIONS
Valueforarchitectural,historicalorculturalreasons

Architectural

Historical

Cultural
Thedateand/ordesignand/oruniqueuseofthebuildingorartefact

Period

Design

Use
Relevancetosocialoreconomichistory
Associationwithwellknownpersonsorevents
Abuildingorgroupsofbuildingand/orareasofadistinct
architecturaldesignand/orstyle,historicperiodorwayoflifehaving
sociologicalinterestand/orcommunityvalue

Style

Historical
Theuniquevalueofabuildingorarchitecturalfeaturesorartefactand
/orbeingpartofachainofarchitecturaldevelopmentthatwouldbe
brokenifitwerelost
Itsvalueasapartofagroupofbuilding
Representingformsoftechnologicaldevelopment
Vistasofnatural/scenicbeautyorinterest,includingwaterfront
areas,distinctiveand/orplannedlinesofsight,streetline,skylineor
topographical
Openspacesometimesintegrallyplannedwiththeirassociatedareas
havingadistinctivewayoflifeandforwhicharehavethepotentialto
berecreation.
Naturalheritagesites
Sitesofscenicbeauty

A
A(arc)
A(his)
A(cul)
B
B(per)
B(des)
B(uu)
C(she)
D(bio)
E
E(sty)
E(his)
F
G(grp)
H(tec)
I(sec)

J
NH
(sec)

18.15. ProvisionofLetterBox

Inallcaseofbuildinghavingmorethantwofloorsincludinggroundflooraletterboxesforeachseparate
unitshallbeprovidedatgroundfloorlevelinsuchawaythatpostmancaneasilydeliverthepostsinthem.

18.16.
shall be newly added as "The outer colour of newly constructed buildings and colour of size and sign
boards, size & colours of letters of sign boards of newly constructed shops & buildings as decided by
DSIRDA
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

129|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
19. RegulationsforSpecialStructures
19.1. GeneralRequirements
InadditiontotherequirementsspecifiedunderGeneralBuildingRegulations(Section9.11),thefollowing
regulationsshallalsobeapplicableforplacesofpublicassemblysuchascinemas,theatres,meetinghalls,
lecturehallsandtownhalls.
19.1.1. Location
Thebuildingfortheabovepurposeshallbelocateddirectlyonaroadwithminimumrightofwayrequired
aspertheregulationsapplicabletothelandusezonethataredescribedinChapter10,ZoningRegulations.
19.1.2. OpenSpaces
Incaseofaboveuses,openspacesshallbeprovidedasunder:
1. Front open space of 12m width from the side abutting on the road shall be provided. Such open
spacesmaybepermittedtobecoveredupto6mfromthebuildinglinewithaprojectedcantilever
structureataheightofnotlessthan3mfromthegroundlevel.
2. Side and rear open spaces of 6m width shall be provided. In addition to the above, the Bombay
CinemaRulesadoptedbytheGIDB/DSIRDAforcinemasandJantatheatresasamendedfromtime
totime,willalsobeapplicable.
19.1.3. MinimumRequirements
Thefollowingrequirementshallbeprovided:
1. Theaggregateareaoffoyerexclusiveofallpassagesshallbeprovidedateverysittinglevelatthe
rateof0.1sqmperseatatthatlevel,subjecttominimumfoyerwidthof4.5m.
2. Entryandexitpassagesofminimum3mwidthshallbeprovided.
3. Waterroomandsnackbarshallbeprovided.
4. The bookingoffice shall always be so located that intending purchasers of tickets have not to
queueupinopenspace.
5. Plinth:Theplinthshallbemeasuredatthefoyerlevelanditshallnotbelessthan45cm.
6. Corridor: No landing, lobby, corridor or passage, not being an internal passage between and/or
acrossrowsofseats,intendedforuseasanexit;shallbelessthan3minwidthandthereshallbe
norecessorprojectionsinthewallsofsuchpassagesorcorridorswithin1.8mfromtheground.
19.1.4. Doors
Theauditoriumdoorsshallbeprovidedattherateofnotlessthanonedoorof1.5mwideand2.1minclear
heightforevery150seatsorpartthereof.
Alloutsidedoorsfortheuseofthepublicshallbemadetoopenoutwardsandinsuchmannerthatwhen
opened,theyshallnotobstructanygangway,passage,stairwayorlanding.Thesedoorsshallbeprovidedin
suchawaythattheyopeninaislesorcrossaislesprovidedundertheseregulations.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

130|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
19.1.5. Balcony
Balcony,itsheight,floorofanauditoriumandarrangementofseats:
1. The height of the bottom balcony of the gallery shall not be less than 3m from the floor of the
auditorium.
2. Thecleardistancebetweenthebacksoftwosuccessiverowsshallnotbelessthan100cm,butfor
seatswithrockingbacksitmaybe90cm.
3. Theminimumwidthofbalconystepsshallbe80cm;providedthatforthefrontandrearstepsthis
distanceshallbe90cm.
4. Theminimumheightoftherooforceilingatthehigheststepsofthebalconyshallbe3.0mandat
noplacethedistancebetweenthenoddingandlowestprojectionrayshallbelessthan2.4m.
5. Theminimumwidthoftheseatshallbe50cm;providedthat25percentofthetotalseatsmaybe
permitteduptothewidthof45cmtoadjustthestaggeringoftheseats.Thewidthoftheseatsshall
bemeasuredfromcentretocentreofhandrailsorarmrests.
19.1.6. Aisles
1. Clearaislesnotlessthan1.2minwidthshallbeformedatrightanglestothelineofseatinginsuch
numberandmannerthatnoseatshallbemorethan3.8mawayfromanyaislesmeasuredinthe
lineofseating.
2. Where all these aisles do not directly meet the exit doors, cross aisles shall be provided in such
numberandmannerthatnorowofseatsshallbemorethan7mawayfromcrossaisles.
3. In computing the number of crossaisles, the door connecting the aisles with foyer shall be
consideredascrossaisles.Thefirstcrossaislesinsuchacaseshallbeprovidedafterthefourteen
rowsfromthedoor.
4. Thewidthofcrossaislesshallbe1.2m.
19.1.7. SanitaryAccommodations
1. Waterclosetattherateofonefor100seatsorpartthereofandurinalsattherateoftwofor75
seatsorpartthereof,ateachseatinglevelshallbeprovided.
2. Onewashbasinforevery200seatsorpartthereofshallbeprovided.
3. Theaboveconveniencesshallbesuitablyapportionedbetweentwosexes.
4. Suchwaterclosetandurinalsshallbeinaccessiblelocationandshallbeprovidedwithsignsplainly
indicatingtheirpurposeandthesexforwhichtheyaremeant.
19.1.8. VisibilityRequirement
1. Theseatnearesttothescreenshallnotbenearerthantheeffectivewidthofthenormalpicture
(ratio1:1.33).Thisdistanceshallbe3/4incaseofcinemascopeandotherwideanglestechniques
andonehalfincaseof70mmpresentations.
2. The elevation of the balcony seats shall be such that line of sight is not inclined more than 30
degreetothehorizontal.
3. Theseatsshouldpreferablybestaggeredsidewaysinrelationtothoseinfront,sothataspectator
inanyrowsisnotlookingdirectlyovertheheadofthepersonimmediatelyinfrontofhim.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

131|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
4. Thepositionandheightofthescreenshallberegulatedinsuchawaythatthemaximumangleof
thelineofvisionfromthefrontseattothetopofthescreenshallnotexceed50.
19.1.9. Ventilation
1. Everyauditoriumshallbelightedandventilatedbydoors,ventilatorsandwindowsabuttingonan
interiororexterioropenairspacewhichshallnotbelessthan1/5thofthetotalfloorareaprovided
that if exhaust fans are installed or if the auditorium is airconditioned, the requirement of this
clausemaybesuitablyrelaxedbyDSIRDA.
2. Permission shall not be given for converting existing airconditioned cinema theatre into nonair
conditionedcinematheatre.
19.1.10. AirConditioning
Theauditoriumorthecinemashouldbeairconditionedasperfollowinggeneralspecifications:
1. Temperaturerange72Fto80F
2. ChangeofAirperhourapproximate10times.
3. RelativeHumidity50p.c.to60p.c.
4. Freshairrequirements.7.5C.F.M.perpersonapproximately.
19.1.11. Staircases
1. Minimumclearwidthofallthestairsshallbe1.5mexceptwhereotherwiseprovidedunderthese
Regulations/byelaws
2. Nostaircaseshallhaveaflightofmorethan15stepsorlessthan3stepsandwidthofthelanding
betweensuchflightsshallbeofthesamewidthofthestaircase.Thetreadofthestepshallnotbe
lessthan30cm.
3. Therisershallnotbehigherthan10cm.
4. Nospacelessthan2.4minheightshallbeallowedunderthefloorofauditorium.
5. Exceptforadoubledeckercinemaortheatre,theaccesstotheauditoriumfromthegroundfloor,
ifitisonupperfloororonstiltsshallbeprovidedbynotlessthanthreestairs;twoofwhichshallbe
exitstairs.Theclearwidthofthesenextstairsshallnotbelessthan2m.
6. Theaccesstobalconyfloorfromauditoriumfloor shallbeprovidedbynotlessthanthreestairs,
twoofwhichshallbeexitstairs.
7. Providedthatifoneexitstairistobeprovidedinsteadoftwo,itsminimumwidthshallbe2.4m.
Incaseofdoubledeckercinemaortheatre:
8. Theaccesstoupperclassauditoriumfromgroundfloorshallbeprovidedbyatleastthreestairsout
ofwhichtwoshallbeexitstairswithminimumclearwidthof2m.
9. Theaccesstolowerclassauditoriumfromgroundfloorshallbeprovidedbyatleasttwostairs,one
ofwhichshallbeexitstair.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

132|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
19.2. Fireprotection:General
1. Theplanningdesignandconstructionofanybuildingshallbesuchastoensuresafetyfromfire.For
this purpose, unless otherwise specified in these Regulations, the provisions of Part IV: Fire
ProtectionChapter,NationalBuildingCode(NBC),shallapply.
2. For multistoried, highrise and special building, additional provisions relating to fire protection
shallalsoapply.Theapproachtothebuildingandopenspacesonallsidesupto6mwidthandtheir
layoutshallconformtotherequirementsoftheChiefFireOfficer.
3. They shall be capable to taking the weight of a fire engine weighing up to 15 tones. These open
spacesshallbefreeofanyobstructionandshallbemotorable.

19.3. FireEscapeExits
Everybuildingmeantforhumanoccupancyshallbeprovidedwithexitssufficienttopermitsafeescapeof
itsoccupantsincaseoffireorotheremergencyforwhichtheexitsshallconformtothefollowing:
19.3.1. TypeofExit
1. Exitsshouldbehorizontalorvertical.
2. Ahorizontalexitmaybeadoorwayacorridor,apassagewaytoaninternalorexternalstairwayor
toanadjoiningbuilding,aramp,averandahoraterracewhichhasaccesstothestreetortothe
roofofabuilding.
3. Averticalexitmaybeastaircaseoraramp,butnotalift.
19.3.2. GeneralRequirements
Exitsfromallthepartofthebuilding,exceptthosenotaccessibleforgeneralpublicuse,shall
1. Providecontinuousegresstotheexteriorofthebuildingortoanexterioropenspaceleadingtothe
street;
2. Besoarrangedthat,exceptinaresidentialbuilding,theycanbereachedwithouthavingtocross
anotheroccupiedunit;
3. Befreeofobstruction;
4. Beadequatelyilluminated;
5. Be clearly visible with the routes reaching them clearly marked and signs posted to guide any
persontothefloorconcerned;
6. Be fitted if necessary, with fire fighting equipment suitably located but not as to obstruct the
passage,clearlymarkedandwithitslocationclearlyindicatedonbothsidesoftheexitway;
7. Befittedwithafirealarmdevice,ifitiseitheramultistoried,highriseoraspecialbuildingsoasto
ensureitspromptevacuation;
8. Remain unaffected by any alteration of any part of the building so far as their number, width,
capacityandprotectionthereofisconcerned;
9. Be so located that the travel distance on the floor does not exceed 22.5m, in case of residential,
educationalinstitutionalandhazardousoccupancies
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

133|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
10. Be so located that the travel distance on the floor does not exceed 30m, in case of assembly,
business,mercantile,industrialandstoragebuildings.
NOTE: The travel distance to an exit from the dead end of a corridor shall not exceed half the distance
specifiedabove.
Whenmorethanoneexitisrequiredonafloor,theexitsshallbeasremotefromeachotheraspossible.
Provided that for all multistoried /high rise and special buildings, a minimum of two enclosed type
staircasesshallbeprovided,atleastoneofthemopeningdirectlytotheexteriortoaninterior,openspace
ortoanyopenplaceofsafety.

19.4. IndividualFireEscapeExitsatEachFloor
Therequirementsofindividualfireescapeexitsateachflooraregivenbelow
19.4.1. Corridors
1. Exit corridors shall be of a width not less than the total required width of exit doorways leading
fromtheminthedirectionoftraveltotheexterior/stairway.
2. Where stairways discharge through corridors, the height of the corridors shall not be less than
2.4m.
3. Wherethereismorethanonestaircaseservingabuilding,thereshallbeatleastonesmokestop
doorinthebetweenthestaircases.
19.4.2. Doorways
1. Every exit doorway shall open into an enclosed stairway, a horizontal exit or a corridor or
passagewayprovidingcontinuousandprotectedmeansofegress;
2. An exit doorway shall open outwards i.e. away from the room, but shall not obstruct the travel
alonganyexit.Nodoor,whenopened,shallreducetherequiredwidthofastairwayorlandingto
lessthan90cm.
3. Anexitdoorshallnotopenimmediatelyuponafightorstairs;alandingequaltoatleastthewidth
ofthedoorshallbeprovidedinthestairwayateachdoorway;thelevelofthelandingshallbethe
sameasthatofthefloorwhichisserves.
4. Exitdoorwaysshallbeopenablefromthesidewhichtheyserve,withouttheuseofakey.
19.4.3. RevolvingDoors
Revolvingdoorsshallnotbeusedasfireescapeexitsinanytypeofbuilding.
19.4.4. InternalStairways
1. Stairwaysshallbeconstructedofnoncombustiblematerialsthroughout.
2. Anyinteriorstaircaseshallbeconstructedasaselfcontainedunitwithatleastonesideadjacentto
anexternalwallandshallbecompletelyclosed.
3. Astaircaseshallnotbearrangedaroundaliftunlessthelaterisentirelyenclosedbyamaterialof
fireresistanceratingasthatfortypeofconstructionitself.Formultistoreyed,highriseandspecial
buildings,thestaircaselocationshallbetothesatisfactionoftheChiefFireOfficer.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

134|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
4. Inmultistoried/highriseandspecialbuilding,accesstomainstaircasesshallbegainedthroughat
least halfanhour fireresisting automatic closing doors placed in the enclosing walls of the
staircases.Theyshallswingtypedoorsopeninginthedirectionoftheescape.
5. Nolivingspace,storeorotherspace,involvingfirerisk,shallopendirectlyintoastaircase.
6. Theexternalexitdoorofastaircaseenclosureatgroundlevelshallopendirectlytotheopenspace
or should be accessible without passing through any door other than a door provided to form a
draughtlobby.
7. In multistoried high rise and special buildings, exit signs with arrows indicating the escape route
shall be provided at a height of 1.5m from the floor level on the wall and shall be painted with
fluorescent paint. All exit way signs should be flush with the wall and so designed that no
mechanicaldamagetothemcanresultfromthemovingoffurnitureorotherheavyequipment.
8. Whereabuildinghasasinglestaircase,itshallterminateatthegroundfloorlevel,andtheaccess
tothebasementshallbebyaseparatestaircase.
9. Where the building is served by more than one staircase, one of the staircases shall lead to the
basementlevelbyeitheraventilatedlobbyoracutoffscreenwallwithoutopening,havingafire
resistance of not less than 2 hours with discharge point at two different ends or through
enclosures.Thestaircaseshallalsobecutofffromthebasementareaatvariousbasementlevels
byprotectedandventilatedlobby/lobbies.
19.4.5. ExternalStairs
Multistory/high rise and special buildings shall be provided with fire escape stairs, which will be free of
FAR,andtheyshouldconformtothefollowing:
1. Theyshallnotbetakenintoaccountincalculatingtheevacuationtimeofabuilding.
2. Allofthemshallbedirectlyconnectedtotheground.
3. Entrancetothemshallbeseparateandremotefromtheinternalstaircase.
4. Routestothefireescapeshallbefreeofobstructionatalltimes,exceptforadoorwayleadingto
thefireescape,whichshallhavetherequiredfireresistance.
5. Theyshallbeconstructedofnoncombustiblematerials.
6. Theyshallhaveastraightflightnotlessthan75cmwidewith15cmtreadandrisersnotmorethan
19cm.Thenumberofrisersshallbelimitedto16perflight.
7. Theyshallbeprovidedwithhandrailsataheightnotlessthan90cmabovethetread.
19.4.6. Ramps
1. Alltherequirementsof19.4.4(InternalStairways)shallapplytoanyramp.
2. Rampsshallleaddirectlytooutsideopenspacesatgroundlevelorcourtyardsorothersafeplaces.
3. Inmultistorey,highriseandspecialbuildings,accesstorampsfromanyfloorshallbethrougha
smokestopdoor.
19.4.7. RefugeArea
1. In multistorey and highrise buildings, at least one refuge area shall be provided on the floor
immediatelyaboveevery15mofbuildingheight.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

135|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
2. Suchspaceshouldabutonexternalwalls.
3. Itshallhaveaminimumareaof1.5sqmandaminimumwidthof0.75m.

19.5. StructuralSafety:General
The structural design of foundations, elements made of masonry, timber, plain concrete, reinforced
concrete, prestressed concrete and structural steel shall conform to the provisions of part VI Structural
Design Section1 Loads, Section2 Foundation, Section3 Wood, Section4 Masonry, Section5 Concrete,
Section6Steel,NationalBuildingCode(NBC)ofIndia,takingintoconsiderationtheIndianStandardsand
Guidelinesforhazardsafetyasgivenbelow:
19.5.1. EarthquakeProtection
1. IS:18931984CriteriaforEarthquakeResistantDesignofStructures(FourthRevision)
2. IS:139201993 Ductile Detailing of Reinforced Concrete Structures subjected to Seismic Forces
CodeofPractice
3. IS:43261993 Earthquake Resistant Design and Construction of Buildings Code of Practice
(SecondRevision)
4. IS:138281993ImprovingEarthquakeResistanceofLowStrengthMasonryBuildingsGuidelines
5. IS:138271993ImprovingEarthquakeResistanceofEarthenBuildingsGuidelines,
6. IS:139351993RepairandSeismicStrengtheningofBuildingsGuidelines
7. ImprovingEarthquakeResistanceofBuildingsGuideline,byExpertGroup,GovernmentofIndia,
Ministry of Urban Affairs & Employment, published by Building Materials and Technology
PromotionCouncil,1998.
8. NationalBuildingCode(NBC)Guidelines
19.5.2. Cyclone/WindStormProtection
1. IS 875 (3)1987 Code of Practice for Design Loads (other than Earthquake) for Buildings and
Structures,Part3,WindLoads
2. Improving Wind/Cyclone Resistance of Buildings Guideline, by Expert Group, Government of
India, Ministry of Urban Affairs & Employment, published by Building Materials and Technology
PromotionCouncil,1998.
Note: Wherever an Indian Standard including those referred in the National Building Code (NBC) or the
NationalBuildingCode(NBC)isreferred,thelatestversionofthesameshallbefollowed.
In pursuance of the requirements in 19.5.1 and 19.5.2, a certificate as indicated in Form2(D) shall be
submittedalongwithbuildingplans/drawingsandotherbuildinginformationscheduleannexedthereto.
19.5.3. QualityControl
1. The quality of all materials and workmanship shall conform to accepted standards and Indian
Standard Specifications and Codes as included in Part V Building Materials and Part VII
ConstructionalPracticesandSafety,NationalBuildingCode(NBC)ofIndia.
2. Allborrowpitsduginthecourseofconstructionandrepairofbuildings,embankmentsetcshallbe
deepandconnectedwitheachotherintheformationofadraindirectedtowardsthelowestlevel
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

136|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
andproperlysteppedfordischargeintoariver,stream,channelordrain,andnopersonshallcreate
anyisolatedborrowpitwhichislikelytocauseaccumulationofwaterthatmaybreedmosquitoes.
3. Alternative materials, method of design and construction and tests: The provisions of the
Regulations are not intended to prevent the use of any material or method of design of
constructionnotspecificallyprescribedinthemprovidedanysuchalternativehasbeenapproved.
NothingoftheprovisionsoftheseRegulationsisintendedtopreventtheadoptionorarchitectural
planning and layout conceived as an integrated development scheme. DSIRDA may approve any
suchalternativeifitconformstotheprovisionsoftherelevantpartsoftheNationalBuildingCode
(NBC),regardingmaterial,designandconstruction,andthematerial,method,orworkofferedis,
for the purpose intended, at least equivalent to that prescribed in these Regulations in quality,
strength,compatibility,effectiveness,fireandwaterresistance,durabilityandsafety.
4. Allbuildingsshallbeconstructedonaqualitycontrolrequirements
5. In case of existing building under construction based on approved building permission, structural
safety requirements shall have to be observed. However, due to such structural work of
strengthening/retrofitting if certain setbacks and margin get reduced, special permission may be
grantedoncasetocasebasis.
19.5.4. Tests
WheneverthereisinsufficientevidenceofcompliancewiththeprovisionsoftheRegulationsorevidence
that any material or method of design or construction does not conform to the requirements of the
Regulations, in order to substantiate claims for alternative materials, design or methods of construction,
DSIRDAmayrequiretests,sufficientlyinadvance,asproofofcompliance.Thesetestsshallbemadebyan
approvedagencyattheexpenseoftheowner.
1. TestmethodsshallbeasspecifiedbytheRegulationsforthematerialsordesignorconstructionin
question. If there are no appropriate test methods specified in the Regulations, DSIRDA shall
determinethetestprocedure.Formethodsortestsforbuildingmaterials,referenceshallbemade
totherelevantIndianStandardsasgivenintheNationalBuildingCode(NBC)ofIndiapublishedby
theBureauofIndianStandards.
2. CopiesoftheresultofallsuchtestsshallberetainedbyDSIRDAfornotlessthantwoyearsafter
theacceptanceofthealternativematerial.
3. ThetestingofthematerialsasperIndianStandardsshallbecarriedoutbylaboratoriesapproved
byDSIRDAonthisbehalf.
4. The laboratory/agency shall work out in consultation with the construction agency a testing
programmeofmaterialssuchascement,steelandqualityofconcreteincludingitsmixing,laying
andstrengthatsiteaswellasinthelaboratory.
5. ThisshouldcovervariousstagesofconstructionfromfoundationtocompletionasperRegulation.
Thelaboratoryshallmaintainadulyauthenticatedreportinaboundregister,copyofwhichwillbe
submittedtotheconstructionagency,whichwillinturnforwardthetestingreporttoDSIRDA.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

137|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
19.5.5. StructuralStabilityandFireSafetyofExistingBuildings
1. DSIRDAshallhavetheassessmentofstructuraland/orfiresafetyofanexistingbuilding/structure
damaged/undamagedcarriedoutatstipulatedperiodicalintervalsthroughexpert(s)chosenfroma
panelofexpertsidentifiedbyDSIRDA.
2. Theowner/developer/occupantonadviceofsuchexpert(s)shallcarryoutsuchrepair/restoration
and strengthening/retrofitting of the building found necessary so as to comply with the safety
standardslaiddownintheNationalBuildingCode(NBC)andtheIndianStandardsasspecified.
3. In case, the owner/developer/occupant does not carry out such action, DSIRDA or any agency
authorizedbyDSIRDAmaycarryoutsuchactionatthecostofowner/developer/occupant.
4. DSIRDAshallspecifytheperiodwithinwhichsuchcomplianceistobecarriedout.
5. DSIRDAmayalsodirecttheowner/developer/occupant,whetherthebuildingcouldbeoccupiedor
notduringtheperiodofcompliance.
6. In case of existing building under construction based on approved building permission, structural
safety requirements shall have to be observed. However, due to such structural work of
strengthening/retrofittingifcertainsetbacksandmargingetreduced,specialpermission.

19.6. BuildingServices
19.6.1. ElectricalInstallations
The planning, design and installation of electrical installation, airconditioning and heating work shall
confirm to the provisions of Part VIII Building Services, section 2 Electrical Installations, section 3Air
conditioningandHeating;NationalBuildingCode(NBC)ofIndia.
19.6.2. Lift
Theplanninganddesignofliftsincludingtheirnumber,typeandcapacitydependingontheoccupancyof
thebuilding,thepopulationoneachfloorbasedontheoccupantloadandthebuildingheightshallbein
accordancewithSection5InstallationofLiftsandEscalators,NationalBuildingCode(NBC)ofIndia.
Maintenanceofinstalledliftsshallconformtothefollowing:
1. Theliftinstallationshouldreceiveregularcleaning,lubricationadjustmentandadequateservicing
by authorised competent persons at such intervals as the type of equipment and frequency of
service demand. In order that the lift installation is maintained at all times in a safe condition, a
proper maintenance schedule shall be drawn up in consultation with the lift manufacturer and
rigidlyfollowed.Alogbooktorecordallitemsrelatingtogeneralservicingandinspectionshallbe
maintained. The electrical circuit diagram of the lift with the sequence of operation of different
componentsandpartsshallbekeptreadilyavailableforreferencebypersonsresponsibleforthe
maintenanceandreplacement,wherenecessary,tothesatisfactionofDSIRDA.
2. AnyaccidentarisingoutofoperationofmaintenanceoftheliftsshallbedulyreportedtoDSIRDA.

19.7. CommunicationDevices
Followingprovisionsshallapplyforallstructureserectedascommunicationinfrastructure.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

138|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
19.7.1. Location
TheTelecommunicationInfrastructureshallbeeitherplacedonthebuildingrooftopsoronthegroundor
openspacewithinthepremisessubjecttootherregulations.
19.7.2. TypeofStructure
Thefollowingtypesofstructuresshallbepermitted:
1.
2.
3.
4.

SteelfabricatedtowerorantennaesonM.Spole.
PrefabricatedsheltersoffibreglassorP.V.Conthebuildingrooftop/terraceforequipment.
MasonryStructure/Shelteronthegroundforequipment.
DieselGenerator(DG)setsshallhavepermittedonlyiftheyhavesoundproofcovertoreducethe
noiselevel.

19.7.3. GeneralRequirements
Everyapplicanthastoobtain/procure thenecessarypermission fromtheStandingAdvisoryCommittee
onRadioFrequencyAllocation(SACFA)issuedbyMinistryofTelecommunications.
Every applicant will have to produce the structural stability certificate from the registered structural
engineerwhichshallbetheliabilityofbothparties
Applicantshavetoproduce/submitplansofthestructuretobeerected.
19.7.4. Projection
Anycommunicationdeviceshallnotprojectbeyondtheexistingbuildinglineofthebuildingonwhichitis
erectedinanydirection
19.7.5. DepositandFees
ThefeesforerectionandmaintenanceofthehoardingshallbechargedasdecidedbyDSIRDAfromtimeto
time.

19.8. RenewableEnergyDevices
19.8.1. Location
Installation of devices for generation or utilization of nonconventional energy such as photovoltaic cell,
wind turbine, solar water heater, solar cooker and any other similar device shall be either placed on the
buildingrooftoporontheopenspacewithinthepremises.
19.8.2. GeneralRequirements
NoPagerand/orTelephoneTowershallprojectbeyondtheexistingbuildinglineofthebuildingonwhichit
iserectedinanydirection.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

139|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
20. PollutionControl
20.1. General
Industrialeffluentshallnotbedisposedorexposedsoastocausenuisanceandendangertopublichealth.

20.2. MeasurestoControlPollution
Without prejudice to the generality of the above provisions, DSIRDA may stipulate certain conditions or
measurestocontroltheairborneemissionsandliquideffluentsfromindustrialunits.
Thesemeasuresshallbestipulatedasconditionsofthedevelopmentpermission.

20.3. Regulation
Industrieswhichemitliquidandgaseouseffluentsshallnotbeallowedtoemitsucheffluentunlesstheyare
purifiedandrenderedharmlessfromthepublichealthpointofviewbyprovisionofpurificationplants,as
maybeprescribedbyDSIRDAand/ortheGujaratPollutionControlBoard.

20.4. Applicability
Controlsasprescribedfromtimetotimebythepollutioncontrolboard(GPCB)/DSIRDAshallbeapplicable
toalldevelopmentandredevelopment.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

140|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
21. SupplementalandMiscellaneousProvisions
21.1. Interpretation
Ifanyquestionordisputeariseswithregardtointerpretation ofanyoftheseregulationsthedecisionof
DSIRDAshallbefinal.

21.2. DiscretionaryPowers
a. Inconformitywiththeintentandspiritoftheseregulations,DSIRDAmaydecideonmatterswhere:
i.

Itisallegedthatthereisanerrorinanyorder,requirement,decision,determinationmadeby
DSIRDA under delegation of powers in the regulations or interpretation in the application of
theseregulations.

ii.

Interpretationofroadalignmentaspersitesituationisrequired.

iii.

Ifalineofthezonedividesaplotintotwodifferentzonestheapprovalinthelandfallingunder
nonpermissivezoneshallbegivenupto25%oflandsubjecttomaximumareaupto1000sqm
inrespectivepermissiblezone.

iv.

Authorizationoferectionofabuildingortheuseofpremisesforapublicserviceundertaking
for public utility purposes only is required, where he finds such an authorization to be
reasonablynecessaryforthepublicconvenienceandwelfare,evenifitisnotpermittedinany
landuseclassification.

b. In specific cases where a clearly demonstrable hardship is caused, DSIRDA may, for reasons to be
recordedinwriting,byspecialpermission,permitanyofthedimensionprescribedintheseregulations
to be modified, except those relating to floor space indices unless otherwise permitted under these
regulations, provided that the relaxation that will not affect the health, safety, fire safety, structural
safetyandpublicsafetyoftheinhabitantsofthebuildingandtheneighbourhood.

21.3. AppealCommittee
Theauthorityshallformanappealcommitteeof:
1. ChairmanR.D.A
2. ChiefExecutiveAuthorityofR.D.A.(membersecretary)
3. ChiefTownPlannerofR.D.A
4. RepresentativeofG.I.D.B
5. RepresentativeofC.E.P.T.,Ahmedabad
This committee shall only function for any dispute arising for interpretation of the development control
regulations.Incaseofanyperson,referringhiscasetothecommittee,thepersonshallhavetopayappeal
feeequaltotheamountpaidasscrutinyfee,toDSIRDA.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

141|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
22. Penalties
AnypersoncontraveninganyoftheaforesaidregulationsoranyoftheprovisionsoftheDraftDevelopment
PlanshallonsuchcontraventionbeliabletoapunishmentasprovidedintheAct,2009andAct,1976and
Rulesframedthereunderasinforcefromtimetotime.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

142|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
23. Relaxation
23.1. InCaseofPublicOwnership
In the case of plot owned by any of the following bodies given below, DSIRDA may for reasons to be
recordedinwritingrelaxorwaiveanyoftheregulationsinthepublicinterest.Providedthatnorelaxation
orwaiveofanyofthedevelopmentregulationsconcerningmaximumbuiltupareaonanyfloor,common
plot, COP, marginal open space, provisions of high rise buildings, F.S.I. and parking shall be made, unless
specificallyprovidedintheseregulations.
1. DSIRDA,
2. Government,
3. HousingBoard,and
4. Anycorporatebodyconstitutedunderastatute,

23.2. InCaseofPrivateOwnership
NotwithstandinganythingcontainedinforegoingRegulationsoftheDraftDevelopmentPlanincasewhere
these regulations cause hardships to the owners because of their application to the alterations not
involving addition to the existing structures erected prior to the coming into force of these regulations,
DSIRDAafterconsideringthemeritsofeachindividualcasemayrelaxorwaive,forreasonstoberecorded
inwritingandregulationoftheDraftDevelopmentPlan,providedthatthisrelaxationshallnotbemadein
anyregulationsforhighrisebuilding.

23.3. InCaseofExistingBuildingUnits
In the case of existing building units in respect of which the layout and subdivision may have been
approved by a DSIRDA or building units affected by road widening and by the Draft Development Plan
proposals made in the Draft Development Plan, if DSIRDA is of the opinion that such building units have
become incapable of reasonable development unless all or any of the requirements of the relevant
regulations are suitably relaxed or waived DSIRDA may, for reasons to be recorded in writing, relax the
requirementoftheabovementionedregulations.
Providedthatnorelaxationshallbemadeinanyoftheregulationsforhighrisebuildings.Irrespectiveof
provisionsmadeinsubclause23.1,23.2&23.3,incaseofdevelopmentforreligiousbuilding,e.g.temple,
church,mosque,agiarietc.upto0.6orlessF.S.I.only,DSIRDAmaywaivespecialprovisionsforhighrise
building with reasons to be recorded. Provided that no relaxation or waiver in any of the regulations
concerningmargin,parking,openspace,commonplotandmaximumbuiltupareashallbemade.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

143|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
24. RegulationsforResidentialTownship
24.1. ShortTitle,ExtentandCommencement
TheseregulationsshallbeapplicablewithinthejurisdictionofDSIRDAconstitutedunderTheAct,2009and
TheAct,1976

24.2. Applicability
TheseregulationsshallapplytoanyResidentialTownshipsproposedundertheseregulations.

24.3. Definition
24.3.1. "Act"

shallmeantheGujaratSpecialInvestmentRegionAct,2009andtheGujaratTownPlanningand
UrbanDevelopmentAct,1976.

24.3.2. "AppropriateAuthority"
shallmeanauthorityasdefinedunderAct
24.3.3. "TownshipDeveloper"
shall mean and include a owner/person/persons/registered cooperative society/ association/
firm/company/jointventures/institution/trustsentitledtomakeanapplicationtodevelopany
township;
Provided that the, Residential Townships having Foreign Direct Investments (FDI), the shall be
regulatedasperGovt.ofIndianorms
24.3.4. "GrossPlotArea"
shallmeanareaaftersubtractingofthelandunderPublicpurposeinfrastructurefromthetotal
areaofthetownship..
24.3.5. GlobalFAR"
shallmean"FARpermissibleunderthisregulationirrespectiveofthezone.
24.3.6. "ResidentialTownship"
undertheseregulationsshallmeanaparceloflandownedbyatownshipdevelopersubjectto;
a. Minimum60%ofthelandeligiblefordevelopingafterdeductingthelandusedforpublic
purposeinfrastructure,isputtoresidentialuse;
b. Minimumareaornotlessthan40.0haincaseofDSIRDA;
24.3.7. "NotifiedAreas
shallmeananarearequiringspecialattentionconsideringitsoverallbalanceddevelopmentand
isnotifiedundertheseregulations.
24.3.8. "Infrastructure
shallincludesroads,streets,openspaces,parks,playgrounds,recreationalgrounds,waterand
electricsupply,streetlighting,sewerage,drainage,stormwaterdrainagepublicworksandother
utilityservicesandconvenience;
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

144|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
24.3.9. "CrossOverinfrastructure
shallbethepartoftheinfrastructurewhichisrequiredtopassthroughthetownshipsoasto
providethefacilitytothetownshipvicinityarea.
24.3.10. PublicPurposeInfrastructure(PPI)"
shallmeantheinfrastructureprovidedaspertheseregulationswhichthedevelopershall:

Develop,asperprescribedguidelinesandoncompletiontransferittoDSIRDA;
operateandmaintainforthemaintenanceperiod;
DevelopmentshallbecarriedoutasperthespecificationsapprovedbyDSIRDA.
ForthepurposeofadministrationthePPIshallvestwithDSIRDA

24.3.11. "Zone"
shallmeanthezoneasdesignatedintheprevalentsanctionedDraftDevelopmentPlan
24.3.12. "GDCR"
shallmeantheprevalentGeneralDevelopmentControlRegulationsapplicablefortherelevant
DSIRDA.
24.3.13. "Maintenanceperiod"
shallmeanminimumperiodofsevenyearsafterwhichthedevelopermayhandovertoDSIRDA,
the infrastructure and land for public purpose. This period shall be calculated from issue of
buildingusepermit.
24.3.14. "PrescribedOfficer"
shallbeasunder:

JURISDICTION

PRESCRIBEDOFFICERS
ChiefExecutiveOfficerandChief
DSIRDAinitsperipheryconstitutedundersection8,
TownPlannerofDSIRDAand
9,10and15ofAct,20091
GIDB2

24.4. DutiesofthePrescribedOfficer:
Forthepurposeoftheseregulations,theprescribedofficer:
1) shall,within30daysfromthereceiptoftheapplication,recommendtotheStateGovernmentto
approveorrefusetheproposalwithreasons;
2) shallevaluateandapprovetheprogress;
3) may deny, after giving reasons in writing, if the proposal of the township forms a part of any
notifiedwaterbodyoranydifficultarea;
4) mayrecommendtotheGovernmenttoallowthebenefitsavailableunderanyschemeoftheState
orCentralGovernment;
5) shallcarryoutsurveyandstudiesforanyareatobeconsideredforallowingspecificbenefitsunder
theseregulationsandrecommendtotheGovernmenttodeclareanyareatobeanotifiedarea;

1,2

ThesectionhasbeenmodifiedandshallbereadinaccordancewiththeGSIRAct2009.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

145|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
24.5. StateLevelScreeningCommittee:
Statelevelscreeningcommitteeofthemembermentionedhereundershallreviewtheproposalsreceived
fromDSIRDA/PrescribedAuthorityorotherwiseandrecommendtotheGovt.forapproval
MembersoftheCommittee1:
1

PrincipalSecretary,IndustriesandMinesDepartment

Chairman

PrincipalSecretary,FinanceDepartment

Member

CEO,GIDB

Member

CEO,DSIRDA

MemberSecretary

24.6. ProceduretoNotifyanyArea
1) SubjecttotheprovisionsoftheseregulationsandtheGDCR,StateGovt.mayonrecommendation
from DSIRDA or otherwise, notify any area, which would require special benefits under these
regulations.
2) TheGovernmentshallnotifysuchareaintheofficialgazettedeclaringanyareatobenotifiedarea
specifyingtheextentoflimitsofsucharea.
3) ForawarenesstheGovernmentshallpublishinatleasttwodailylocalnewspapers.

24.7. ProcedureforSecuringthePermission
1) SubjecttotheprovisionsoftheseregulationsandtheGDCR,anytownshipdeveloperintendingto
developundertheseregulations,mayapplyundersection29(1)(ii)oftheAct,2009andAct,1976;
toDSIRDAalongwiththerequireddocumentsandforwardcopytotheprescribedofficer.
2) Withregardtoprocedure,themannerapplication,thedocumentstobesubmittedalongwiththe
applications,theprotocolsofdrawingstobesubmitted,unlessotherwiseprescribed,theprovisions
ofGDCRshallapplymutatismutandis.

24.8. ContentsoftheTownshipProposals
Theproposalshallinclude:
1) masterplanofthearea;
a) demarcatingthedetailsforallparcelsoflandseparatelyfor
a. Publicpurposeinfrastructure;
b. Primaryinfrastructure;
c. Restoftheuses;
2) detailedareaStatementofeachparceloflandasmentionedin8.1,theFARcalculations;
3) layoutofbuildingsandinfrastructureaspernorms;
4) detailedplansforthebuildingsandinfrastructure;
5) estimates to develop the infrastructure separately for crossover infrastructure, other
infrastructure;
6) detailsofprojectfinance;

ThesectionhasbeenmodifiedandshallbereadinaccordancewiththeGSIRAct2009.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

146|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
7) managementplanincludingproposalsmaintenanceandupkeep;
8) proposalexpressingtheabilitytodevelopandmaintainsuchproject;

24.9. PublicPurposeInfrastructure
24.9.1. Crossoverinfrastructure&Road
ThecrossoverinfrastructureshallbeprovidedasperthespecificationsofDSIRDAandshall:
1) SyncwiththeT.P./D.P.roadsinthevicinity.
2) Include,atleast30mwideroadonapartoftheboundarywhereT.P./D.P.roaddoesnotabutto
theboundary.
3) Thetotalareaofthecrossoverinfrastructureshallbeminimum10%oftheTownshipareaof40.0
ha,andforeachadditionalareaof20.0hathecrossoverinfrastructureshallbeprovided@12%
24.9.2. Otheramenities
1) 5%forSchool,HospitalandPublicAmenities;and
2) 5%,forParksandGarden,cateringtotheneighbourhoodwithpublicaccess.Suchplotsshallhave
minimumareanotbelessthan3000sqm;
Provided that in case if the township consists of buildings exceeding height more than 40m, the
developer shall have to provide space for fire brigade services, Such services shall be operated and
maintained by the township developer but for the purpose of administration it shall be manned by
DSIRDA.

24.10. Socially&EconomicallyWeakerSectionHousing(SEWH)andOtherInfrastructure
24.10.1. SociallyEconomicallyWeakerSection,Housing(SEWH)
1) SEWShousingshallbeprovidedas5%landforSocially&economicallyweakersectionhousingand
5%consumedFARasfloatingfloorspace,attachedwithotherresidentialdwellingunitstobeused
fortheservants,driversetc,
2) thetownshipdevelopershalldeveloptheSEWHaspertheregulationsin,annexure1;
3) thetownshipdevelopershalldevelopanddisposesuchhousinginconsultationwithDSIRDA.
24.10.2. Roads
1) Minimumareaofroadsshallbe15%excludingthecrossoverinfrastructureroad.
2) Theroadnetworkshallbeprovidedinproperhierarchy,and.asperstandardroadwidths.
24.10.3. OtherInfrastructure
1) MinimumAreaofopenspacesincludinggardensshallbe5%excludingthecrossoverinfrastructure
road.

24.11. PhysicalPlanningParameters;
1) Filluporreclamationoflowlying,swampyorunhealthyareas,orlevellingupoflandasrequired;
2) Layout the new streets or roads, construction, diversion, extension, alteration, improvement and
closingupofstreetsandroadsanddiscontinuanceofcommunicationsinallcases;
3) Layoutofnewstreet/road/Cycletrackgivingaccesstotheexistinghabitationifanywithinorinits
vicinity or likely for any town planning scheme in the vicinity to develop in future. Width and
alignmentofsuchroadsshallbeassuggestedbyDSIRDA.`
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

147|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
4) Cycletracksshallhavetobeprovidedalongtheroads.
5) Design the circulation pattern to include segregation of pedestrian and vehicular traffic, entry
control,accessofemergencyvehiclestoeveryblock,provisionofadequateparkingetc.
6) Plan and design the neighbourhood regarding circulation system, including safety requirements
shallbegovernedbytheBISorperthenormsoftheconcernedagencies.
7) Designs the sewerage system for reuse of water and zero discharge and arrange to operate
permanentbasis.
8) Provide system to harvest rainwater which may be an integral part of the storm water drainage
planorstandalone;
9) Thedevelopershallplantoprovide140lpcd
10) Ensuretocollect,treatanddisposedrainageinthetownshiparea.Howeverforfutureshallmake
provisionforconnectingittothecitydrainagesystem;
11) Ensurecontinuous&qualitypowersupply;
12) Provideconnectivitytonearest30mwideroad;
13) The natural drainage pattern shall be maintained without any disturbances. Provided that
improvementsshallbepermittedforefficiencyimprovedimprovement.
14) Transitspaceandfacilityofsegregationofbiodegradableandrecyclablesolidwasteshallhaveto
beprovided;
15) Spaceandseparateaccessrequiredasperrulesshallhavetobeprovidedforpowerdistribution;
16) For public areas and commercial building, so far possible, provide energy of nonconventional
sources.
17) StreetlightsshallbeoperatedusingSolarPower.
18) MakeprovisionforHarvesting&RechargingsystemofrainWater.
19) Within3.0mdistanceoneithersideoftheroad,treesshallhavetobeplantedandmaintaintillthe
maintenanceperiod.
20) Minimum200treesperhectare,ofappropriatespecies,shallhavetobeplantedandnurturedfor
themaintenanceperiod.
21) Suitablelandscapeshallhavetobeprovidedforopenspaceandgardens;
22) UrbanDesignandHeritagetobeensured;

24.12. ResponsibilitiesoftheTownshipDeveloper
TheTownshipDevelopershallwithregardtothetownshipshall:
1)
2)
3)
4)
5)

acquire/own/poolthelandathisownexpenses;
provideathisownexpensesthefacilitiesmentionedinclause8and9inthissubsection;
developthetownshipathiscostasapproved;
developtheland&buildingswithinforpublicpurposeinfrastructureasapproved;
provideandanundertakingaboutthetermsandconditionstheplantomaintainandupkeepofthe
infrastructure;
6) disclosetothebeneficiariestheentiredetailsoftheplan,design,the,contractsandotherdetails
effectingtothebeneficiaries;
7) forthemaintenanceperiod,maintainandupkeepaspertheundertaking,theinfrastructureother
thanthepublicpurposeinfrastructure;
8) forthemaintenanceperiod,maintainandupkeepthelandandpropertyusedforpublicpurpose
infrastructure;

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

148|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
9) develop the public purpose infrastructure as per the specifications prescribed by the prescribed
committee;
10) on issue of building use permission, the township developer shall execute a bank guarantee
equivalentto2%ofthecostincurredfortheinfrastructure.Theauthorityshallrevokethis;bank
guaranteeifrequiredtomaintaintheinfrastructure.Ontheexpiryofthemaintenanceperiod,this
guaranteeshallbeconvertedintoacorpusfundofthemembersofthecooperativesociety.
11) onexpiryofthemaintenanceperiod,heshalltransferthepublicpurposeinfrastructure,freefrom
alltheencumbrancetoDSIRDA.Tothiseffectthetownshipdevelopergivesanundertaking;
12) On issue of the building use permit, organize to form a Registered Cooperative Society of all
beneficiarieselectsapromoter/president,issuesharecapitaltoeachofthebeneficiary
13) Theschemedevelopershallcreateacommonfacilitiesandcommunityutilitiesasperclauseno.8
(publicpurposeinfrastructure)andhandedovertoDSIRDA.

24.13. Grant/RefusalofthePermission:
1) On the receipt of the recommendation of the authority or otherwise, GIDB/DSIRDA under
section29(1)(ii)oftheAct,2009andAct,1976;mayrelaxtheGDCRandtheseregulationstogrant
orrefusetheproposal.
2) Validityandlapseofthepermissionshallbeaccordingtosection32oftheAct,1976.
3) Developmenttobecommencedwithinoneyearfromtheissueofthepermissiontoconstructor
theNAorder,whicheverisearlier;
4) Interpretationoftheseregulations
a. Ifanyquestionordisputeariseswithregardtointerpretationofanyoftheseregulationsthe
decisionoftheGovernmentshallbefinal.
b. Inconformitywiththeintentandspiritoftheseregulations,theGovernmentmay,ifrequired
inappropriatecases,usethediscretionarypowerstodecideinanyofthematters.

24.14. FloorAreaRatio
Forthepurposeoftheseregulations,irrespectiveoftheFloorAreaRatio(FAR)prescribedinanyzone,it
shallberegulatedasunder:
1) Total FAR permitted on Gross plot area and shall be sum of Global FAR and Additional FAR as
under;
a. GlobalFAR(GFAR)shallbe1.0
b. AdditionalPremiumFARshallbepermittedonpaymenttoDSIRDA,asbelow:
SR.NO.
1
2

ADDITIONALFAR
25%ofGFAR
Additional25%ofGFAR

PREMIUMRATES
Additional40%oftheJantriRates
Additional50%oftheJantriRates

MaximumpermissibleuseFAR1.5

24.15. BuiltUpAreaandHeight:
1) Builtupareashallberegulatedasunder:
45%incaseoflowrisebuildingand30%incaseofHighrisebuilding
2) HeightofthebuildingsshallbepermittedasperGDCR.Howeveradditionalheightmaximumupto
70mshallbepermittedonpaymentat7%ofthejantri.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

149|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
24.16. Zoning,GroundCoverage&OtherRegulations
1) Irrespectiveofanyzone,usesinthetownshipshallbepermissibleasproposedintheapplication
under these regulations. Provided that such permission can be denied by the Government on
accountofsafety.
2) Whereevernotmentioned,theprovisionsofGDCRshallbeapplymutatismutandis
3) Even after approval under these regulations, permissions from Airport Authority of India,
DepartmentofForestandEnvironmentforEIAclearance,andnecessarypermissionfromrelevant
department,asrequired,shallbemandatory.

24.17. DevelopmentofExternal(OffsiteInfrastructure)
TheTownshipDevelopershallprovidetheoffsiteinfrastructureshall:
1) ConnecttotheexistingroadorDraftDevelopmentPlanroadortownplanningschemeroadhaving
widthnotlessthan30m.
2) Thedevelopershallhimselfprovidewatersupplyathisownorconnectedwiththecitysystem.
3) Arrangetocollect,treatanddisposeinthetownshiparea.Howeverforfutureshallmakeprovision
connecttothecitydrainagesystem;
4) Arrangeforthepowersupply;
5) Beartheentirecostfortheoffsiteinfrastructure;

24.18. SupervisionandMonitoringOftheQualityofConstruction
1) Toensurethatthequalityofconstructionofpublicpurposeinfrastructure,DSIRDA,shallappointa
consultantwhowouldsupervisethequalityandtimelyexecutionoftheproject.
2) Theschemedeveloperforsupervision,deposit2%oftheestimatedcostofcostofpublicpurpose
infrastructure.Suchdepositshallberefundedoncetheconsultantissueofcompletioncertificate.

24.19. GrievanceRedressal:
1) Anyoccupantofanyofthebuildingswhoisentitledtousethefacilitiesshallhavearighttolodge
hiscomplainbeforeDSIRDA;
2) DSIRDAshall,onthemerits,addresstheissuesto:
a. Directthedevelopertoresolvetheissue;
b. Mayresolvetheissuetobyreconstructing/repairingatthecostofdeveloper
3) DSIRDAshallrecoverthecostbyrevokingthebankguaranteeforthecostincurredfortheworks
requiredtobedonebyDSIRDAasperaboveclause.
ANNEXURE1
RegulationstodevelopSocially&EconomicallyWeakerSectionHousing
1. Planning
Housingforsociallyandeconomicallybackwardclassofpeopleshallbeasperthefollowing:
1. Themaximumpermissiblenetdensityindwellingshallbe225dwellingperhectareofdesignated
land.
2. Thecarpetareaofdwellingunitshouldbeminimum25sqmandthatforothertowns,theplinth
area(builtuparea)ofminimum25sqmmaybeensured.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

150|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Eachdwellingunitdesignshouldhavethefollowingfeatures:
a. Tworoomswithindependentaccess.Forindependentuseoftheroomsitmaybeessentialto
provideslidingdoor.Thesizeoftheroomsshallbeasunder:

Living/Multipurposeroom
Bedroom
Kitchen
Bath,toilet,corridor

SHORTERSIDE(M)
2.5
2.1
1.5
1&0.9

AREA(M)
9
6.5
3.3
1.2&0.9

HEIGHT(M)
2.6
2.6
2.6
2.1

b. KitchenindicatingLshapedcookingplatform,storagecupboards,placementofsink,provision
of1ftx1ftwindowtoenablethebeneficiarytoinstallexhaustfanlater,windowinthekitchen
shouldpreferablybeontopofthesink.
c. IndependentbathandWC,WCtobeprovidedwith1ftx1ftventilatorwithdoubleshutters
(forjali&glass),toenablethebeneficiarytoinstallexhaustfanlater.
d. Provisionofminimum0.9mwidebalconyandbuiltincupboardsintherooms.Thedepthof
such cubicles be at least 600 mn. ln drawing rooms/living rooms (other than bedrooms) the
min.depthof450*mmmaybeconsidered.
e. Fromhealthpointofview,thedwellingunitshouldbevectorfree.Inordertomaketheunit
vectorfree,themaindooroftheunitshouldbeprovidedwithdoubledoorshuttershavinga
jalidoorandanormaldoor.Thewindowsmayalsobeprovidedwithjalishutters.
f. Staircaseflight
Winding2Storey,3Storeyandabove
0.9m
Riser
180mmmaximum
Tread
250mmminimum
Headroom
2.1m
g. MinimumHeightofthefloorsbetakenas2.7m.
h. The minimum height of the plinth shall be 30 cm from top surface of approach road or path
way;
i. ThemaximumFloorAreaRatiopermissibleshallbeasperGDCR
3. Buildings up to height of 15m need not be provided with a lift. There shall be one staircase for
every12(twelve)dwellingunitsorpartthereof.

2. StructuralRequirements:
i.
LoadbearingwallsofthebuildingshallbeofBrickstoneorprecastblockinanymortarinthecase
ofR.C.Cframedstructureorwoodenstructurefillerwallsmaybeofsuitablelocalmaterials.
ii.
RoofofthebuildingshallbeofgalvanizedironsheetsasbestossheettilesrooforR.C.Croofinthe
caseofupperstoriedbuildingsmiddlefloorshallbeofwoodenorR.C.Candrestasperchoice.
iii.
Doorsandwindowsofbuildingshallbeofanymaterial.
iv.
Restofthebuildingshallbeasperlocallyavailableresourcesandasperchoice.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

151|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
3. SocialFacilities
Thesocialfacilitiesshallbeprovidedasunder:
Thedevelopershallprovidedsocialinfrastructurefacilitiesasbelow:
i.Angandwadi,NurserySchool@0.1Ha/1000p
0.8Ha
Ideally,areaperschool
ii.PrimarySchool(Class15),1forevery5000p
Areaofschoolsite
Schoolbuildingarea

0.20Ha

Playfieldareaof18mx36mtobeensuredforeffectiveplay
iii.SeniorSecondarySchool(Class612)1forevery7500p

0.20Ha

Areaoftheschoolsite

1.80Ha

Schoolbuildingarea

0.60Ha

Playfieldareaof68mx126mtobeensuredforeffectiveplay

1.00Ha

Parkingarea
iv.HealthcareFacilities(1forevery15000p)
v.SocioculturalFacilities

0.20Ha
0.080.12Ha

a)CommunityFacilities(1forevery5000p)

750sqm

b)CommunityHall,WorkArea,(1forevery15000p)WelfareCentre,Library

2000sqm

Thelocationsofschoolsandhealthcarecentreshouldbesuchthattheyareequallyaccessiblefromallthe
housing clusters, preferably by pedestrian pathways with minimum road crossovers. They are also to be
locatedadjacenttoparks,playfieldetc.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

152|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
25. RegulationsfortheRehabilitationandRedevelopmentoftheSlums
25.1. ShortTitle,ExtentandCommencement
1) Theseregulationsmaybecalled"TheRegulationsfortheRehabilitationandRedevelopmentofthe
Slums"
2) TheseregulationsshallbeapplicablewithinthejurisdictionofDSIRDAconstitutedunderAct,2009
3) ItshallcomeintoforceonsuchdateasdecidedbyorderoftheStateGovernment.

25.2. Applicability
These regulations shall apply to slums on lands or; plots or part of lands or plots, irrespective of the
ownership.

25.3. Definitions
25.3.1. "Beneficiary"
means any person who may receive benefits of any slum rehabilitation scheme under these
regulations.Suchbeneficiarymayincludeeligibleslumdwelleroranyprojectaffectedperson.
25.3.2. "CompetentAuthority"
meansanypersonorpersonsorauthorityorauthorities,authorizedbyDSIRDAasthecasemay
be,toperformsuchfunctionsasmaybespecifiedundertheseregulations
25.3.3. "DwellingUnit"

meansaunitconstructedundertheslumrehabilitationscheme.

25.3.4. "EligibleSlumDweller"
meansaSlumdweller,whoisnotaforeignnationalandistheoccupantofhutmentforaperiod
ofminimumof10yearsandhasadomicileofGujaratfor25yearsorhisdescendant.
Asaproofofoccupancy,thepersonshall,fortheperiodofminimumoccupancy,produceany
twoofthefollowingdocuments:`
a.
b.
c.
d.

Copyofrationcard;
Copyoftheelectricitybills;
Proofofbeingincludedintheelectoralrolls;
anyotherproofasdecidedbyDSIRDA

25.3.5. "GDCR"
meanstheprevalentGeneralDevelopmentControlRegulationsapplicablefortheDSIRDA.
25.3.6. "NotifiedSlums"
meanstheslumnotified bythe GovernmentintheOfficialGazetteundersection3ofGujarat
SlumArea(Improvement,clearanceandRedevelopment),Act1973.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

153|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
25.3.7. "Prescribedauthority"

shallbeasunder:

JURISDICTION
DSIRDAinitsperipheryconstitutedunder
section8,9,10and15ofAct,2009

PRESCRIBEDOFFICER
ChiefExecutiveOfficerofDSIRDA

The State Government on the approval of these regulations shall by notification in the official
GazetteappointDSIRDAundersection 2(j)ofGujaratSlumArea(improvement,Clearanceand
Redevelopment),Act,1973.
25.3.8. "ProjectAffectedPerson"
means an eligible slum dweller occupying a part of any town planning scheme, road or Draft
DevelopmentPlanroadorapartunderroadwidening.
25.3.9. "Privateland"

meansanylandotherthanpublicland;

25.3.10. "Publicland"
meansanylandownedbytheurbanlocalbodyorbytheGovernmentorauthorityconstituted
underAct,2009andAct,1976.
25.3.11. "SlumArea"

meansandinclude;

slums which are censused or declared or notified by the municipal corporation or


Nagarpalika;

25.3.12. "SchemeDeveloper"
means the owner or owners of the plot or institute or Cooperative society or company or
Gujarat Housing Board and similar organization or any developer permitted to develop by
DSIRDA.
25.3.13. SlumRehabilitationScheme(SRS)"

meansanynotifiedslumapprovedundertheseregulations.

25.3.14. "SlumRehabilitationPlot(SRP)"

meansanyplotwheretheslumdwellersarerehabilitated.

25.3.15. "SlumPlot[SP)"

meansanyplotinanotifiedslumwhichformsapartofaslumrehabilitationscheme

25.3.16. SlumRehabilitationZone(SRZ)

meansanareawhichshallbedelineatedbytheSlumRehabilitationCommittee.
a. TheSlumRehabilitationZoneshallcorrespondtotheareaofequalFARaspertheGDCR.
b. Thefollowingshallbepermissiblewithinazone
i.
Clubbingoftwoormoreplotsineachslumrehabilitationscheme;
ii.
UseofspareFARfromoneplottoanother,withinascheme

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

154|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
25.3.17. "SlumRehabilitationCommittee(SRC)"

Acommitteewhichshallcompriseof:

DSIRDA:
SR.
OFFICIALS/INCHARGE
NO
1
Chairman,DSIRDA
2
ChiefExecutiveOfficer,GIDB
ChiefTownPlannerofApexBody/GIDBorhisrepresentativenot
3
belowtherankofSeniorTownplanner
4
Collector,Ahmedabad
5
DistrictDevelopmentOfficer,Ahmedabad
6
ChiefExecutiveOfficer,DSIRDA

DESIGNATION
Chairman
Member
Member
Member
Member
MemberSecretary

25.4. PrescribedAuthority
1) DSIRDA shall be vested with all the powers made available under the Gujarat Slum Area
(improvement,clearanceandRedevelopment),Act1973.
2) The DSIRDA exercise all the powers, to scrutinize and implement any rehabilitation and
redevelopmentschemeasrecommendedbytheSRC.
3) DSIRDAshallassisttheschemedeveloperineviction.
4) DSIRDA shall notify the Slum Rehabilitation Zone (SRZ) as delineated by the Slum Rehabilitation
Committee

25.5. FunctionsoftheSlumRehabilitationCommittee(SRC)
1)
2)
3)
4)
5)
6)

Delineateaslumarea;
RecommendtotheStateGovernmenttonotifytheslumarea;
DelineatetheSlumRehabilitationZone;
Evaluateandapprovetheproposalsofslumrehabilitationschemes;
DiscloseandprovideinformationrelatingtoanyoftheschemesofStateorCentralGovernment.
RecommendtotheGovernmenttoallowthebenefitsavailableunderanyschemeoftheStateor
CentralGovernment.
7) Coordinatewiththerevenueandallotherrelateddepartments.
8) Approvethelocationandfacilitiestobeprovidedinthetransitcamp;
9) AssignJantriasva1ueoftheplotsunderconsideration;

25.6. NotificationoftheSlumArea
The State Government, on the recommendation of the Slum Rehabilitation Committee or otherwise may
declareanyslumareaundersubsection(1)ofsectionoftheGujaratSlumArea(Improvement,clearance
andRedevelopment),Act1973.

25.7. NotificationoftheSlumRehabilitationZone
DSIRDAshall,ontherecommendationoftheSlumRehabilitationCommittee,notifytheslumrehabilitation
zoneintheofficialgazette.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

155|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
25.8. ContentsofaRehabilitationScheme
1) Therehabilitationschemeshallcontainthefollowing:
Proposals for the dwelling units to accommodate the beneficiaries on the same plot or on plots
whichareclubbedorbundled;
i.
Watersupply,drainage,powersupplytotheindividualdwellingunits;
ii.
Provideforevery500dwellingunits
fiveroomschoolofminimumtotalarea100sqm,
oneCommunityCentreofminimumarea50sqm,
oneAnganwadiorHealthPostofminimumarea50sqm
iii.
Providedthatincasethedwellingunitlessthan500,thefacilityforcommunitycentre,
school, anganwadi or health post shall have to be provided as decided by the slum
rehabilitationcommittee.
2) MaycontainthefollowingProposalfortheconstructionofbuildingforcommercialorresidentialor
anyotherpurpose,whichtheschemedevelopermaysaleordisposeorrentorlease.

25.9. DutiesoftheSchemeDeveloper
Theschemedevelopershall:
1) Acquire throughownershiportherightstodevelopeitherthroughpurchase/leaseofperiodnot
lessthan99years;
2) Havetopay,toDSIRDA,100%ofprevalentjantriratesforthelandusedforcommercialpurpose,if
thedeveloperintendstodevelopslumareonapublicland;
3) Organize all the eligible hutment dwellers into a Registered Cooperative Housing Society or a
RegisteredAssociation.
4) Seek consent of at least 75 percent of the occupants of any slum settlement being considered
underthescheme.Thisconsentshallcontainwillingnesstojointheslumrehabilitationschemeand
come together to form a cooperative housing society of eligible hutments through resolution to
thateffect.Theresolutionshallcontainthefollowingpoints;
a. ResolutionelectingaChiefPromoter.
b. ResolutiongivingtheChiefPromotertheAuthoritytoapplyforregistrationofnameforCo
operativeHousingSociety.
c. TocollectsharecapitalRs.50/permemberforslumsocieties)andRs.10/asentrancefee
andtoopenaccountinanynationalizedbank
5) OnthedirectionofDSIRDA,theschemedevelopershallincludetheProjectAffectedPersons(PAP)
asapartoftheCooperativeHousingSocietyandissuehimrequisitesharesandallotthedwelling
unitinthescheme.
6) OncetheslumrehabilitationschemeiscertifiedtohavebeencompletebyDSIRDA,thedeveloper
shallhandoverthemaintenanceofservicestotheregisteredcooperativehousingsociety.

25.10. ProcedureforSecuringthePermission:
SubjecttotheprovisionsofthetheseregulationsandtheGDCR,anyslumdeveloperintendingtocarryout
slumrehabilitationworkinanynotifiedslumshallapplytotheSRCalongwiththedetailsofownership.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

156|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
25.11. GrantorRefusalofthePermission:
1) TherighttorecommendforgrantortorefusetheproposalshallbevestedwithSRC.TheSRCshall:
i.
Decide the proposal within 30 days from the receipt of the application and shall
communicateitsdecisiontotheGovernment.
ii.
Forsameslumpocket,entertainanyapplicationaftersatisfyingthatnootherapplicationis
pendingbeforeittodecide;
iii.
Denyanyslumrehabilitationiftherehabilitationplotformsapartofanyareaofmilitaryor
cantonmentorrailways,airportauthorityoranynotifiedwaterbodyoranydifficultarea.
2) TheGovernmentmayreviewthedecisionoftheSRCorifnecessaryaskreconsiderorgivedirection
totheSRCwithrespecttoitsdecision.
3) Inconformitywiththeintentandspiritoftheseregulations,forapplication,theGovernmentmay,
withdiligenceandjudiciousconsideration,waiveanypartoftheseregulationsandgivedirections
totheSRC.
4) Grant of any permission under these regulations shall mean acceptance by authority of the
followingrequirements:
i.
Benefitsunderanyschemeasadmissible;
ii.
LayoutofbuildingsinSRP;
iii.
Permissiblebuiltuparea;
iv.
PermissibleFloorAreaRatio;
v.
Heightofabuildinganditsvariousstories;
Permissible open spaces enforced under regulations, common Marginal spaces, other open
vi.
spaces,setbacksetc.;
vii.
Permissibleuseoflandandbuiltspaces;
viii.
Arrangementsofstairs,lifts,corridorsandparking;
ix.
Minimum requirements of highrise buildings including N.O.C. from Officer or Fire Safety
ConsultantasappointedbyDSIRDA
x.
Minimumrequirementofsanitaryfacilityandothercommonfacility.
xi.
Requiredlightandventilation.
Provided that it shall not mean acceptance of correctness, confirmation approval or
endorsementofandshallnotbindorrendertheAuthorityliableinanywayinregardto:
titleofthelandorbuilding;
easementrights;
variationinareafromrecordedareasofaplotorabuilding;
structuralreportsandstructuraldrawings;
workmanshipandsoundnessofmaterialusedinconstructionofthebuilding.
locationandboundaryoftheplot.
5) Interpretationoftheseregulations
i.
If any question or dispute arises with regard to interpretation of any of regulations the
decisionoftheGovernmentshallbefinal.
ii.
Inconformitywiththeintentandspiritoftheseregulations,theGovernmentifrequiredin
appropriatecases,usethediscretionarypowerstodecideinanymatters.,

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

157|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
6) Any proposal submitted by any slum developer which is in conformity within the spirit of these
regulations,theGovernmentmay,afterconsideringthemeritsoftheproposals,sanctionasitisor
withmodifications.
7) Theslumdevelopermaywithouttamperingtheintentandspiritoftheseregulationsmayprovide
facilityorcompensationinadditionthatisrequiredundertheregulations.

25.12. PlanningRegulationsforRehabilitationScheme
Theschemedeveloperforthepurposeoftherehabilitationschemeshallhavetoplananddesigntofulfil
thefollowingrequirements:
1) The minimum height of the plinth shall be 45 cm from the top surface of approach road or path
way.
2) Thebuiltupareaofanydwellingunitshallbeminimum36sqmexcludingcommonareas.
3) The dwelling unit shall at least include two rooms, kitchen, and a bath, a water closet excluding,
commonareas,suchasstairspassagesetc.
4) Permissible builtup area, for the purpose of rehabilitation scheme under these regulations, shall
meantheareacoveringtheground,afterleavingmargins.
5) FloorAreaRatio.(FAR)
6) Forthepurposeoftheseregulations,thefloorspaceshallbecomputedasunder:
i.
TheFARpermittedunderGDCRfortheremainingplotshallbeonthebasisofGrossBuilding
unit/Plotarea;
ii.
TheFARshallbegrantedasunder:
FARshallbecomputedforthetotalareaoftheclubbedplots.
Clubbingofplotsshallbeallowedforrehabilitationofslumandalsoforotheruse;
Additional FARshallbeavailabletothedeveloperequivalentto theareausedforslum
rehabilitation.
Withintheclubbedplots,transferofFARfromoneplottotheothershallbepermitted
proportionatetothejantrivalueofrespectiveplots;
7) Marginsforthepurposeoftheseregulationsshallbeapplicableasunder:
MARGIN
Roadsidemargin
Otherthanroadsidemargin
Buildingtobuildingmargin
Commonplottobuildingmargin

LOWRISEBUILDING
4.50m
3.00m
4.50m
3.00m

HIGHRISEBUILDING
6.00m
6.00m
6.00m
3.00m

8) PrevailingGDCRshallapplyfordevelopmentotherthanslumrehabilitation.ForthepurposeofFSL
theplotshallbeconsideredatasingleplot.
9) Rehabilitationschemeshallbepermittedon9mandmorewideroads.
10) Parking, height, common plots and all other provisions which are not included in the regulations
shallbeprovidedasperGDCR.Howeverforthepurposeoftheseregulationsparkingshallalsobe
permittedinthecommonplot
11) Shopshavingmaximumsizeof25sqmhavetoprovideongroundflooruptomaximum25%ofthe
groundcover.Theschemedevelopermaydisposethembyallottingittotheoccupantsofshopsin
theSPorotherwise

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

158|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
25.13. RehabilitationoftheProjectAffectedPersonsandOtherEligibleSlumDwellers
Theschemedeveloperunderanyproposedslumrehabilitationschemeshall,
1) Inadditiontothedwellingunitsrequiredtorehabilitatetheoccupantsofconcernednotifiedslums,
shallforthePAPsprovideminimumof10%ofextradwellingunits;
2) SurrenderfordisposalsuchdwellingunitstoDSIRDAatnocost

25.14. RegulationsforAllotment
1) Theschemedevelopershallprovideatransitaccommodationfacilityforallthebeneficiariesasper
requirement.
2) Thenewlydevelopeddwellingunitsshallbeallotted,totheeligibleslumdwellers,bycomputerized
randomdraworwiththeunanimousconsentoftheeligibleslumdwellers.
3) Theschemedevelopershalltransfertheabsoluteownershiprightsofallthedwellingunitsandthe
related infrastructure free from all encumbrances to the Cooperative Registrar Society of the
slumdwellersfreeofcost.
4) Theallotteeorhislegalheirsshallnottransferthedwellingunitforatleast20yearsfromthedate
of owning the possession. In case if it is found that any sale or any mode of transfer during the
abovespecifiedperiod,suchallotmentshallbeconsideredtobenullandvoid.Suchnullandvoid
unitsshallbethepropertyofDSIRDA.
5) The individual occupier of the dwelling unit shall bear the responsibility of payments towards
GovernmentandMunicipalTaxesapplicablefromtimetotime.
6) Minimum10%ofthecostofrehabilitationdwellingunitsshallhavetobedepositedwithDSIRDA
whichlateronshallbetransferredtothecooperativehousingsociety.
7) The scheme developer shall be permitted to construct buildings other than those of slum
rehabilitation only after the construction of dwelling units and infrastructure relating to slum
rehabilitationiscompleted.
8) Jointownershipwithspouse:Thereconstructedtenementshallbetheownershipofthehutment
dwellerandspouseconjointly,andshallbesoenteredanddeemedtobesoenteredintherecord
of the cooperative housing society, including the share certificates or all other relevant
documents.
9) lf at any point of time it is found that the slum dweller, after the allotment under the slum
rehabilitation scheme, has encroached any land, then in such cases, the allotment under the
schemeshallstandcancelledanddwellingofdwellingunitshallbeforfeitedandsuchdwellingunit
shallbetheownershipoftheauthority.

25.15. ExternalDevelopmentCharges
1) The scheme developer shall pay, for the external development charge an amount, which is
equivalenttotheprevalentandapplicableratesofamenitiesfees.
2) Thebettermentcharge,thedevelopmentchargeamenitiesfees,scrutinyfee,proportionatetothat
usedforslumrehabilitation,shallbewaved.

25.16. DeNotificationofSlums
1) TheSlumRehabilitationCommitteeshallscrutinizetherehabilitationworkandonsatisfactionand
requesttotheStateGovernmenttodenotifyanyslumarea;
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

159|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
2) TheStateGovernmentmayconsidertherequestoftheSlumRehabilitationCommitteetodenotify
anyslumarea;

25.17. EffectofOtherZonesandRegulations;
1) Alltheregulationsunderanyprevalentact,rulesandGDCRshallapplymutatismutandisexceptfor
thespecificprovisionsmentionedundertheseregulations;
2) Forthepurposetheseregulations,therehabilitationuseshallbepermissibleirrespectivetoanyof
theprovisionsofzoningintheapplicableGDCR.

25.18. SupervisionandMonitoringoftheQualityofConstruction
1) Onsanction oftheproject,DSIRDAshallappointa consultanttosupervisethequalityandtimely
executionoftheproject.
2) Theschemedevelopershalldeposit5%oftheestimatedcostoftheprojectassecurity.
3) DSIRDA,shallontheadviceoftheconsultant,releasethedepositsonproratebasis.

25.19. GrievanceRedressal
1) For any grievance related to benefits availableunder this scheme, any eligible slum dwellers,
availingthebenefitsundertheschemeshallbeentitledtolodgehiscomplainbeforeDSIRDA.
2) DSIRDAshall,onthemeritsresolvethegrievance(s)bygivingdirectiontothedevelopertoresolve
theissue.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

160|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
26. ControlRegulationswithinCRZ
26.1. Definition
26.1.1. HighTideLine
Meansthelineonthelanduptowhichthehighestwaterlinereachesduringthespringtide
26.1.2. CoastalRegulationZone
Thecoastalstretchesofseas,bays,estuaries,creeks,riversandbackwaterswhichareinfluencedbytidal
action(inthelandwardside)upto500mfromthehightideline(HTL)andthelandbetweenlowtideline
(LTL)andtheHTLisdeclaredasCoastalRegulationsZoneunderclause(d)ofsubrule(3)ofrule5ofthe
Environmental(protection)Rules,1986.

26.2. ClassificationoftheCRZ
Forthepurposeofconservingandprotectingthecoastalareasandmarinewaters,theCRZareashallbe
classifiedasfollows,namely:
A. Theareasthatareecologicallysensitiveandthegeomorphologicalfeatureswhichplayaroleinthe
maintainingtheintegrityofthecoast,
i. CRZI
a. Mangroves, in case mangrove area is more than 1000sqm, a buffer of 50m along the
mangrovesshallbeprovided;
b. Coralsandcoralreefsandassociatedbiodiversity;
c. SandDunes;
d. Mudflatswhicharebiologicallyactive;
e. National parks, marine parks, sanctuaries, reserve forests, wildlife habitats and other
protectedareasunder theprovisionsofWildLife (Protection)Act,1972(53 of1972),the
Forest(Conservation)Act,1980(69of1980)orEnvironment(Protection)Act,1986(29of
1986);includingBiosphereReserves;
f. SaltMarshes;
g. Turtlenestinggrounds;
h. Horseshoecrabshabitats;
i. Seagrassbeds;
j. Nestinggroundsofbirds;
k. Areasorstructuresofarchaeologicalimportanceandheritagesites.
B. TheareabetweenLowTideLineandHighTideLine;
ii. CRZII
Theareasthathavebeendevelopeduptoorclosetotheshoreline.
Explanation: For the purposes of the expression developed area is referred to as that area
withintheexistingmunicipallimitsorinotherexistinglegallydesignatedurbanareaswhichare
substantially builtup and has been provided with drainage and approach roads and other
infrastructuralfacilities,suchaswatersupplyandseweragemains;

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

161|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
iii. CRZIII
AreasthatarerelativelyundisturbedandthosedonotbelongtoeitherCRZIorIIwhichinclude
coastal zone in the rural areas (developed and undeveloped) and also areas within municipal
limitsorinotherlegallydesignatedurbanareas,whicharenotsubstantiallybuiltup.
iv. CRZIV
a. thewaterareafromtheLowTideLinetotwelvenauticalmilesontheseawardside;
b. shallincludethewaterareaofthetidalinfluencedwaterbodyfromthemouthofthewater
body at the sea upto the influence of tide which is measured as five parts per thousand
duringthedriestseasonoftheyear.

26.3. DeclarationofCRZ
TheCentralGovernmentherebydeclaresthefollowingareasasCRZandimposeswitheffectfromthedate
(6th January, 2011) of the notification the following restrictions on the setting up and expansion of
industries,operationsorprocessesandthelikeintheCRZ,
i.
ii.

ThelandareafromHighTideLine(hereinafterreferredtoastheHTL)to500mtsonthelandward
sidealongtheseafront.
CRZshallapplytothelandareabetweenHTLto100mtsorwidthofthecreekwhicheverislesson
the landward side along the tidal influenced water bodies that are connected to the sea and the
distanceuptowhichdevelopmentalongsuchtidalinfluencedwaterbodiesistoberegulatedshall
be governed by the distance upto which the tidal effects are experienced which shall be
determined based on salinity concentration of 5 parts per thousand (ppt) measured during the
driest period of the year and distance upto which tidal effects are experienced shall be clearly
identifiedanddemarcatedaccordinglyintheCoastalZoneManagementPlans(hereinafterreferred
toastheCZMPs).

Explanation For the purposes of this subpoint the expression tidal influenced water bodies means the
waterbodiesinfluencedbytidaleffectsfromsea,inthebays,estuaries,rivers,creeks,backwaters,lagoons,
pondsconnectedtotheseaorcreeksandthelike.
iii.

iv.
v.

thelandareafallingbetweenthehazardlineand500mfromHTLonthelandwardside,incaseof
seafront and between the hazard line and 100m line in case of tidal influenced water body the
word hazard line denotes the line demarcated by Ministry of Environment and Forests
(hereinafter referred to as the MoEF) through the Survey of India (hereinafter referred to as the
SoI)takingintoaccounttides,waves,sealevelriseandshorelinechanges.
landareabetweenHTLandLowTideLine(hereinafterreferredtoastheLTL)whichwillbetermed
astheintertidalzone.
thewaterandthebedareabetweentheLTLtotheterritorialwaterlimit(12Nm)incaseofseaand
thewaterandthebedareabetweenLTLatthebanktotheLTLontheoppositesideofthebank,of
tidalinfluencedwaterbodies.

26.4. DemarcationofHTL
Forthepurposesofthisnotification,theHTLmeansthelineonthelanduptowhichthehighestwaterline
reaches during the spring tide and shall be demarcated uniformly in all parts of the country by the
demarcating authority(s) so authorized by the MoEF in accordance with the general guidelines issued at
AnnexureI.HTLshallbedemarcatedwithinoneyearfromthedateofissueofthisnotification.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

162|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
26.5. ProhibitedactivitieswithinCRZ
ThefollowingaredeclaredasprohibitedactivitieswithintheCRZ,
i. Settingupofnewindustriesandexpansionofexistingindustriesexcept,
a. thosedirectlyrelatedtowaterfrontordirectlyneedingforeshorefacilities;
Explanation:Theexpressionforeshorefacilitiesmeansthoseactivitiespermissibleunderthis
notificationandtheyrequirewaterfrontfortheiroperationssuchasportsandharbours,jetties,
quays, wharves, erosion control measures, breakwaters, pipelines, lighthouses, navigational
safetyfacilities,coastalpolicestationsandthelike;
b. projectsofDepartmentofAtomicEnergy;
c. facilities for generating power by nonconventional energy sources and setting up of
desalination plants in the areas not classified as CRZI based on an impact assessment study
includingsocialimpacts.;
d. reconstruction, repair works of dwelling units of local communities including fishers in
accordancewithlocaltownandcountryplanningregulations.
ii. manufacture or handling oil storage or disposal of hazardous substance as specified in the
notification of Ministry of Environment and Forests, No. S.O.594 (E), dated the 28th July 1989,
S.O.No.966(E),datedthe27thNovember,1989andGSR1037(E),datedthe5thDecember,1989
except,
a. transferofhazardoussubstancesfromshipstoports,terminalsandrefineriesandviceversa;
b. facilitiesforreceiptandstorageofpetroleumproductsandliquefiednaturalgasasspecifiedin
AnnexureII appended to this notification and facilities for regasification of Liquefied Natural
Gas (hereinafter referred to as the LNG) in the areas not classified as CRZ I subject to
implementation of safety regulations including guidelines issued by the Oil Industry Safety
DirectorateintheMinistryofPetroleumandNaturalGasandguidelinesissuedbyMoEFand
subject to further terms and conditions for implementation of ameliorative and restorative
measuresinrelationtoenvironmentasmaybestipulatedbyinMoEF.
Provided that facilities for receipt and storage of fertilizers and raw materials required for
manufactureoffertilizerslikeammonia,phosphoricacid,sulphur,sulphuricacid,nitricacidandthe
like,shallbepermittedwithinthesaidzoneintheareasnotclassifiedasCRZI(i).
iii. Setting up and expansion of fish processing units including warehousing except hatchery and
naturalfishdryinginpermittedareas;
iv. Landreclamation,bundingordisturbingthenaturalcourseofseawaterexceptthose,
a. requiredforsettingup,constructionormodernisationorexpansionofforeshorefacilitieslike
ports,harbours,jetties,wharves,quays,slipways,bridges,sealink,roadonstilts,andsuchas
meantfordefenceandsecuritypurposeandforotherfacilitiesthatareessentialforactivities
permissibleunderthenotification;
b. measures for control of erosion, based on scientific including Environmental Impact
Assessment(hereinafterreferredtoastheEIA)studies
c. maintenanceorclearingofwaterways,channelsandports,basedonEIAstudies;
d. measurestopreventsandbars,installationoftidalregulators,layingofstormwaterdrainsor
forstructuresforpreventionofsalinityingressandfreshwaterrechargebasedoncarriedoutby
anyagencytobespecifiedbyMoEF.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

163|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
v. Setting up and expansion of units or mechanism for disposal of wastes and effluents except
facilitiesrequiredfor,
a. dischargingtreatedeffluentsintothewatercoursewithapprovalundertheWater(Prevention
andControlofPollution)Act,1974(6of1974);
b. stormwaterdrainsandancillarystructuresforpumping;
c. treatment of waste and effluents arising from hotels, beach resorts and human settlements
locatedinCRZareasotherthanCRZIanddisposaloftreatedwastesandeffluents.
vi. Discharge of untreated waste and effluents from industries, cities or towns and other human
settlements.Theconcernedauthoritiesshallimplementschemesforphasingoutexistingdischarge
ofthisnature,ifany,withinatimeperiodnotexceedingtwoyearsfromthedateofissueofthis
notification.
vii. Dumpingofcityortownwastesincludingconstructiondebris,industrialsolidwastes,flyashforthe
purpose of land filling and the like and the concerned authority shall implement schemes for
phasingoutanyexistingpractice,ifany,shallbephasedoutwithinaperiodofoneyearfromdate
ofcommencementofthisnotification.
Note:The MoEF will issue a separate instruction to the State Government and Union territory
Administration in respect of preparation of Action Plans and their implementation as also
monitoringincludingthetimeschedulethereof,inrespectofparas(v),(vi)and(vii).
viii. Portandharbourprojectsinhigherodingstretchesofthecoast,exceptthoseprojectsclassifiedas
strategic and defence related in terms of EIA notification, 2006 identified by MoEF based on
scientific studies and in consultation with the State Government or the Union territory
Administration.
ix. Reclamation for commercial purposes such as shopping and housing complexes, hotels and
entertainmentactivities.
x. Miningofsand,rocksandothersubstratamaterialsexcept,
a. thoseraremineralsnotavailableoutsidetheCRZarea,
b. explorationandexploitationofOilandNaturalGas.
xi. Drawl of groundwater and construction related thereto, within 200mts of HTL; except the
following:
a. intheareaswhichareinhabitedbythelocalcommunitiesandonlyfortheiruse.
b. Intheareabetween200m500mzonethedrawlofgroundwatershallbepermittedonlywhen
done manually through ordinary wells for drinking, horticulture, agriculture and fisheries and
wherenoothersourceofwaterisavailable.
Note:Restrictions for such drawl may be imposed by the Authority designated by the State
GovernmentandUnionterritoryAdministrationintheareasaffectedbyseawaterintrusion.
xii. ConstructionactivitiesinCRZIexceptthosespecifiedinsection26.9ofthisnotification.
xiii. Dressing or altering the sand dunes, hills, natural features including landscape changes for
beautification,recreationandothersuchpurpose.
xiv. Facilitiesrequiredforpatrollingandvigilanceactivitiesofmarine/coastalpolicestations.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

164|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
26.6. RegulationofpermissibleactivitiesinCRZarea
26.6.1. Thefollowingactivitiesshallberegulatedexceptthoseprohibitedinsection26.5above
i.

a. clearance shall be given for any activity within the CRZ only if it requires waterfront and
foreshorefacilities;
b. forthoseprojectswhicharelistedunderthisnotificationandalsoattractEIAnotification,2006
(S.O.1533 (E), dated the 14th September, 2006), for such projects clearance under EIA
notification only shall be required subject to being recommended by the concerned State or
UnionterritoryCoastalZoneManagementAuthority(hereinafterreferredtoastheCZMA).
c. HousingschemesinCRZasspecifiedinsection26.9ofthisnotification;
d. Construction involving more than 20,000sqm builtup area in CRZII shall be considered in
accordance with EIA notification, 2006 and in case of projects less than 20,000sqm builtup
area shall be approved by the concerned State or Union territory Planning authorities in
accordancewiththisnotificationafterobtainingrecommendationsfromtheconcernedCZMA
andpriorrecommendationsoftheconcernCZMAshallbeessentialforconsideringthegrantof
environmental clearance under EIA notification, 2006 or grant of approval by the relevant
planningauthority.
e. MoEFmayunderaspecificorgeneralorderspecifyprojectswhichrequirepriorpublichearing
ofprojectaffectedpeople.
f. construction and operation for ports and harbours, jetties, wharves, quays, slipways, ship
constructionyards,breakwaters,groynes,erosioncontrolmeasures;
ii.
thefollowingactivitiesshallrequireclearancefromMoEF,namely:
a. thoseactivitiesnotlistedintheEIAnotification,2006.
b. construction activities relating to projects of Department of Atomic Energy or Defence
requirements for which foreshore facilities are essential such as, slipways, jetties, wharves,
quays;exceptforclassifiedoperationalcomponentofdefenceprojects.Residentialbuildings,
officebuildings,hospitalcomplexes,workshopsofstrategicand defenceprojectsintermsof
EIAnotification,2006;
c. construction,operationoflighthouses;
d. layingofpipelines,conveyingsystems,transmissionline;
e. exploration and extraction of oil and natural gas and all associated activities and facilities
thereto;
f. Foreshore requiring facilities for transport of raw materials, facilities for intake of cooling
water and outfall for discharge of treated wastewater or cooling water from thermal power
plants. MoEF may specify for category of projects such as at (f), (g) and (h) of sub section
26.6.1;
g. MiningofraremineralsaslistedbytheDepartmentofAtomicEnergy;
h. Facilitiesforgeneratingpowerbynonconventionalenergyresources,desalinationplantsand
weatherradars;
i. Demolitionandreconstructionof(a)buildingsofarchaeologicalandhistoricalimportance,(b)
heritage buildings; and buildings under public use which means buildings such as for the
purposesofworship,education,medicalcareandculturalactivities;

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

165|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
26.6.2. ProcedureforclearanceofpermissibleactivitiesAllprojectsattractingthisnotificationshallbe
consideredforCRZclearanceasperthefollowingprocedure,namely:
i.

ii.

iii.
iv.

v.

vi.

Theprojectproponentsshallapplywiththefollowingdocumentsseekingpriorclearanceunder
CRZ notification to the concerned State or the Union territory Coastal Zone Management
Authority,
a. Form1(AnnexureIVofthenotification);
b. Rapid EIA Report including marine and terrestrial component except for construction
projectslistedunder4(c)and(d)
c. Comprehensive EIA with cumulative studies for projects in the stretches classified as low
andmediumerodingbyMoEFbasedonscientificstudiesandinconsultationwiththeState
GovernmentandUnionterritoryAdministration;
d. DisasterManagementReport,RiskAssessmentReportandManagementPlan;
e. CRZmapindicatingHTLandLTLdemarcatedbyoneoftheauthorizedagency(asindicated
insection26.4)in1:4000scale;
f. Projectlayoutsuperimposedontheabovemapindicatedat(e)above;
g. TheCRZmapnormallycovering7kmradiusaroundtheprojectsite.
h. The CRZ map indicating the CRZI, II, III and IV areas including other notified ecologically
sensitiveareas;
i. No Objection Certificate from the concerned State Pollution Control Boards or Union
territory Pollution Control Committees for the projects involving discharge of effluents,
solidwastes,sewageandthelike.;
The concerned CZMA shall examine the above documents in accordance with the approved
CZMPandincompliancewithCRZnotificationandmakerecommendationswithinaperiodof
sixtydaysfromdateofreceiptofcompleteapplication,
a. MoEForStateEnvironmentalImpactAssessmentAuthority(hereinafterreferredtoasthe
SEIAA)asthecasemaybefortheprojectattractingEIAnotification,2006;
b. MoEFfortheprojectsnotcoveredintheEIAnotification,2006butattracting subsection
26.6.1(ii)oftheCRZnotification;
MoEForSEIAAshallconsidersuchprojectsforclearancebasedontherecommendationsofthe
concernedCZMAwithinaperiodofsixtydays.
TheclearanceaccordedtotheprojectsundertheCRZnotificationshallbevalidfortheperiodof
five years from the date of issue of the clearance for commencement of construction and
operation.
Forpostclearancemonitoring:
a. itshallbemandatoryfortheprojectproponenttosubmithalfyearlycompliancereportsin
respectofthestipulatedtermsandconditionsoftheenvironmentalclearanceinhardand
soft copies to the regulatory authority(s) concerned, on 1st June and 31st December of
each calendar year and all such compliance reports submitted by the project proponent
shall be published in public domain and its copies shall be given to any person on
applicationtotheconcernedCZMA.
b. thecompliancereportshallalsobedisplayedonthewebsiteoftheconcernedregulatory
authority.
TomaintaintransparencyintheworkingoftheCZMAsitshallbetheresponsibilityoftheCZMA
tocreateadedicatedwebsiteandposttheagenda,minutes,decisionstaken,clearanceletters,

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

166|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
violations,actiontakenontheviolationsandcourtmattersincludingtheOrdersoftheHonble
CourtasalsotheapprovedCZMPsoftherespectiveStateGovernmentorUnionterritory.

26.7. PreparationofCoastalZoneManagementPlans
i.
ii.

iii.

iv.
v.

vi.

vii.

viii.

ix.

x.
xi.

xii.

xiii.

TheMoEFmayobtaintheCZMPspreparedthroughtherespectiveStateGovernmentorUnion
territory;
The CZMPs may be prepared by the coastal State Government or Union territory by engaging
reputed and experienced scientific institution(s) or the agencies including the National Centre
for Sustainable Coastal Management (hereinafter referred to as the NCSCM) of MoEF and in
consultationwiththeconcernedstakeholders;
ThehazardlineshallbemappedbyMoEFthroughSoIallalongthecoastlineofthecountryand
thehazardlineshallbedemarcatedtakingintoaccount,tide,waves,sealevelriseandshoreline
changes;
Forthepurposeofdepictingthefloodingduetotides,wavesandsealevelriseinthenextfifty
andhundredyears,thecontourmappingofthecoastlineshallbecarriedoutat0.5m
intervalnormallyupto7kmfromHTLonthelandwardside,andtheshorelinechangesshallbe
demarcated based on historical data by comparing the previous satellite imageries with the
recentsatelliteimageries;
Mappingofthehazardlineshallbecarriedoutin1:25,000scaleformacrolevelplanning and
1:10,000scaleorcadastralscaleformicrolevelmappingandthehazardlineshallbetakeninto
considerationwhilepreparingthelanduseplanofthecoastalareas;
ThecoastalStatesandUnionTerritorywillpreparewithinaperiodoftwentyfourmonthsfrom
thedateofissuethisnotification,draftCZMPsin1:25,000scalemapidentifyingandclassifying
the CRZ areas within the respective territories in accordance with the guidelines given in
AnnexureIofthenotification,whichinvolvepublicconsultation;
The draft CZMPs shall be submitted by the State Government or Union territory to the
concerned CZMA for appraisal, including appropriate consultations, and recommendations in
accordancewiththeprocedure(s)laiddownintheEnvironment(Protection)Act,1986;
The State Government or Union territory CZMA shall submit the draft CZMPs to MoEF along
with its recommendations on the CZMP within a period of six months after incorporating the
suggestionsandobjectionsreceivedfromthestakeholders;
MoEFshallthereafterconsiderandapprovetheCZMPswithinaperiodoffourmonthsfromthe
dateofreceiptoftheCZMPscompleteinallrespects;
All developmental activities listed in this notification shall be regulated by the State
Government,UnionTerritoryAdministration,thelocalauthorityortheconcernedCZMAwithin
theframeworkofsuchapprovedCZMPsasthecasemaybeinaccordancewithprovisionsofthis
notification;
TheCZMPsshallnotnormallyberevisedbeforeaperiodoffiveyearsafterwhich,theconcerned
State Government or the Union territory may consider undertaking revision of the maps
followingtheaboveprocedures;
TheCZMPsalreadyapprovedunderCRZnotification,1991shallbevalidforaperiodoftwenty
fourmonthsunlesstheaforesaidperiodisextendedbyMoEFbyaspecificnotificationsubjectto
suchtermsandconditionsasmaybespecifiedtherein.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

167|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
26.8. EnforcementoftheCRZ,notification,2011
a. For the purpose of implementation and enforcement of the provisions this notification and
compliance with conditions stipulated there under, the powers either original or delegated are
availableunderEnvironment(Protection)Act,1986withtheMoEF,StateGovernmentortheUnion
territoryAdministrationNCZMAandSCZMAs;
b. The composition, tenure and mandate of NCZMA and State Government or the Union territory
CZMAshavealreadybeennotifiedbyMoEFintermsofOrdersofHonbleSupremeCourtinWrit
Petition664of1993;
c. theStateGovernmentortheUnionterritoryCZMAsshallprimarilyberesponsibleforenforcingand
monitoring of this notification and to assist in this task, the State Government and the Union
territory shall constitute district level Committees under the Chairmanship of the District
Magistrate concerned containing atleast three representatives of local traditional coastal
communitiesincludingfromfisherfolk;
d. The dwelling units of the traditional coastal communities including fisherfolk, tribals as were
permissibleundertheprovisionsoftheCRZnotification,1991,butwhichhavenotobtainedformal
approval from concerned authorities under the aforesaid notification shall be considered by the
respective Union territory CZMAs and the dwelling units shall be regularized subject to the
followingcondition,namely
i.
thesearenotusedforanycommercialactivity
ii.
thesearenotsoldortransferredtonontraditionalcoastalcommunity.

26.9. Normsforregulationofactivitiespermissibleunderthisnotification
i. The development or construction activities in different categories of CRZ shall be regulated by the
concernedCZMAinaccordancewiththefollowingnorms,namely:
Note: The word existing use hereinafter in relation to existence of various features or existence of
regularisation or norms shall mean existence of these features or regularisation or norms as on
19.2.1991whereinCRZnotification,wasnotified.
I. CRZI
i.

nonewconstructionshallbepermittedinCRZIexcept,
a. projectsrelatingtoDepartmentofAtomicEnergy;
b. pipelines,conveyingsystemsincludingtransmissionlines;
c. facilitiesthatareessentialforactivitiespermissibleunderCRZI;
d. installationofweatherradarformonitoringofcyclonesmovementandpredictionbyIndian
MeteorologicalDepartment;
e. constructionoftransharboursealinkandwithoutaffectingthetidalflowofwater,between
LTLandHTL.
f. developmentofgreenfieldairportalreadyapprovedatonlyNaviMumbai;
ii.
AreasbetweenLTLandHTLwhicharenotecologicallysensitive,necessarysafetymeasureswill
beincorporatedwhilepermittingthefollowing,namely:
a. explorationandextractionofnaturalgas;
b. construction of dispensaries, schools, public rain shelter, community toilets, bridges, roads,
jetties,watersupply,drainage,seweragewhicharerequiredfortraditionalinhabitantsliving
withinthebiospherereservesafterobtainingapprovalfromconcernedCZMA.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

168|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
c. necessary safety measure shall be incorporated while permitting such developmental
activitiesintheareafallinginthehazardzone;
d. saltharvestingbysolarevaporationofseawater;
e. desalinationplants;
f. storage of nonhazardous cargo such as edible oil, fertilizers and food grain within notified
ports;
g. construction of trans harbour sea links, roads on stilts or pillars without affecting the tidal
flowofwater.
II. CRZII
i.

buildings shall be permitted only on the landward side of the existing road, or on the
landwardsideofexistingauthorizedstructures;
buildings permitted on the landward side of the existing and proposed roads or existing
authorized structures shall be subject to the existing local town and country planning
regulationsincludingtheexistingnormsofFloorSpaceIndexorFloorAreaRatio:
Providedthatnopermissionforconstructionofbuildingsshallbegivenonlandwardsideof
anynewroadswhichareconstructedontheseawardsideofanexistingroad:
reconstruction of authorized building to be permitted subject with the existing Floor Space
IndexorFloorAreaRatioNormsandwithoutchangeinpresentuse;
facilitiesforreceiptandstorageofpetroleumproductsandliquefiednaturalgasasspecified
in AnnexureII appended to this notification and facilities for regasification of Liquefied
NaturalGassubjecttotheconditionsasmentionedinsubpoint(ii)ofsection26.5;
desalinationplantsandassociatedfacilities;
storageofnonhazardouscargo,suchasedibleoil,fertilizersandfoodgraininnotifiedports;
facilitiesforgeneratingpowerbynonconventionalpowersourcesandassociatedfacilities;

ii.

iii.
iv.
v.

vi.
vii.
viii.

III. CRZIII
A. Area upto 200mts from HTL on the landward side in case of seafront and 100m along tidal
influenced water bodies or width of the creek whichever is less is to be earmarked as No
DevelopmentZone(NDZ),
i.
ii.

iii.

theNDZshallnotbeapplicableinsuchareafallingwithinanynotifiedportlimits;
No construction shall be permitted within NDZ except for repairs or reconstruction of
existing authorized structure not exceeding existing Floor Area Ratio, existing plinth area
and existing density and for permissible activities under the notification including facilities
essential for activities; Construction/reconstruction of dwelling units of traditional coastal
communitiesincludingfisherfolkmaybepermittedbetween100mand200mfromtheHTL
along the seafront in accordance with a comprehensive plan prepared by the DSIRDA in
consultationwiththetraditionalcoastalcommunitiesincludingfisherfolkandincorporating
the necessary disaster management provision, sanitation and recommended by the
concernedStateortheUnionterritoryCZMAtoNCZMAforapprovalbyMoEF;
however,thefollowingactivitiesmaybepermittedinNDZ
a. agriculture,horticulture,gardens,pasture,parks,playfield,andforestry;
b. projectsrelatingtoDepartmentofAtomicEnergy;
c. miningofrareminerals;
d. saltmanufacturefromseawater;

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

169|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
e. facilities for receipt and storage of petroleum products and liquefied natural gas as
specifiedinAnnexureII;
f. facilities for regasification of liquefied natural gas subject to conditions as mentioned in
subpoint(ii)ofsection26.5;
g. facilitiesforgeneratingpowerbynonconventionalenergysources;
h. Foreshorefacilitiesfordesalinationplantsandassociatedfacilities;
i. weatherradars;
j. construction of dispensaries, schools, public rain shelter, community toilets, bridges,
roads,provisionoffacilitiesforwatersupply,drainage,sewerage,crematoria,cemeteries
andelectricsubstationwhicharerequiredforthelocalinhabitantsmaybepermittedon
acasetocasebasisbyCZMA;
k. construction of units or auxiliary thereto for domestic sewage, treatment and disposal
withthepriorapprovaloftheconcernedPollutionControlBoardorCommittee;
l. facilitiesrequiredforlocalfishingcommunitiessuchasfishdryingyards,auctionhalls,net
mending yards, traditional boat building yards, ice plant, ice crushing units, fish curing
facilitiesandthelike;
m. developmentofgreenfieldairportalreadypermittedonlyatNaviMumbai.

B.Areabetween200mtsto500mts,
Thefollowingactivitiesshallbepermissibleintheaboveareas;
i.
ii.
iii.
iv.
v.
vi.
vii.

viii.

ix.
x.

developmentofvacantplotindesignatedareasforconstructionofhotelsorbeachresortsfor
touristsorvisitorssubjecttotheconditionsasspecifiedintheguidelinesatAnnexureIII;
facilitiesforreceiptandstorageofpetroleumproductsandliquefiednaturalgasasspecifiedin
AnnexureII;
facilitiesforregasificationofliquefiednaturalgassubjecttoconditionsasmentionedinsub
point(ii)ofsection26.5;
storageofnonhazardouscargosuchas,edibleoil,fertilizers,foodgraininnotifiedports;
foreshorefacilitiesfordesalinationplantsandassociatedfacilities;
facilitiesforgeneratingpowerbynonconventionalenergysources;
construction or reconstruction of dwelling units so long it is within the ambit of traditional
rightsandcustomaryusessuchasexistingfishingvillagesandgoathans.Buildingpermission
forsuchconstructionorreconstructionwillbesubjecttolocaltownandcountryplanningrules
withoverallheightofconstructionnotexceeding9mtswithtwofloors(ground+onefloor);
Construction of public rain shelters, community toilets, water supply drainage, sewerage,
roadsandbridgesbyCZMAwhomayalsopermitconstructionofschoolsanddispensariesfor
localinhabitantsoftheareaforthosepanchayats,themajorpartofwhichfallswithinCRZifno
otherareaisavailableforconstructionofsuchfacilities;
reconstructionoralterationofexistingauthorizedbuildingsubjecttosubpoints(vii),(viii);
developmentofgreenfieldairportalreadypermittedonlyatNaviMumbai.

IV. CRZIV
Theactivitiesimpugningontheseaandtidalinfluencedwaterbodieswillberegulatedexceptfor
traditionalfishingandrelatedactivitiesundertakenbylocalcommunitiesasfollows:

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

170|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
a. No untreated sewage, effluents, ballast water, ship washes, fly ash or solid waste from all
activities including from aquaculture operations shall be let off or dumped. A comprehensive
planfortreatmentofsewagegeneratingfromthecoastaltownsandcitiesshallbeformulated
within a period of one year in consultation with stakeholders including traditional coastal
communities,traditionalfisherfolkandimplemented;
b. Pollutionfromoilandgasexplorationanddrilling,mining,boathouseandshipping;
c. There shall be no restriction on the traditional fishing and allied activities undertaken by local
communities.

ANNEXUREI
GuidelinesforPreparationofCoastalZoneManagementPlans
I.
A. DemarcationofHighTideLine
1. Demarcation of High Tide Line (HTL) and Low Tide Line (LTL) shall be carried out by one of the
agenciesauthorisedbyMoEFbasedontherecommendationsoftheNationalCentreforSustainable
CoastalManagement(NCSCM).
2. Demarcation of the High Tide Line or LTL shall be made on the Coastal Zone Management (CZM)
Mapsofscale1:25,000preparedbytheagenciesidentifiedbytheMoEF.
3. LocallevelCZMMapsshallbepreparedforuseofofficialsoflocalbodiesfordeterminationofthe
CRZ.
4. ThelocallevelCZMMapsshallbepreparedonaCadastralscaleinaccordancewiththeCZMMaps
approvedbytheCentralGovernment.

B. PreparationofCZMMaps
5. BaseMapsof1:25,000scaleshallbeacquiredfromtheSurveyofIndia(SOI)andwherever1:25,000
maps are not available, 1:50,000 maps shall be enlarged to 1:25,000 for the purpose of base map
preparationandthesemapswillbeofthestandardspecificationgivenbelow:
Unit:

7.5minutesX7.5minutes

Numbering:

SurveyofIndiaSheetNumberingSystem

HorizontalDatum:

EverestorWGS84

VerticalDatum:

MeanSeaLevel(MSL)

Topography:

Topography in the SOI maps will be updated using latest satellite


imageriesoraerialphotographs

6. TheHighWaterLevel(HWL)andLowWaterLevel(LWL)markedontheBasemapswillbetransferred
totheCZMmaps.
7. Coastalgeomorphologicalsignaturesinthefieldorsatelliteimageriesoraerialphotographswillbe
usedforappropriateadjustment,intheHWLorLWLfordemarcatingHTLorLTLinaccordancewith
theCRZnotification.
8. ThefollowinggeomorphologicalfeaturesshallbeconsideredwhiledemarcatinginHTLorLTL:
a. Landward(monsoonal)bermcrestinthecaseofsandybeaches
b. Rocks,Headlands,Cliffs
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

171|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
c. Seawallsorrevetmentsorembankments
9. 500mand200mlineswillbedemarcatedwithrespectofHTL.
10. HTL(asdefinedintheCRZnotification)andLTLshallalsobedemarcatedintheCZMmapsalongthe
banks of tidal influenced inland water bodies with the help of the geomorphological signatures or
features.
11. ClassificationofdifferentcoastalzonesshallbedoneaspertheCRZnotification
12. Standardnationalorinternationalcolourcodesshallbeusedtohighlightsubclassificationofdata.

C. LocallevelCZMMaps
LocallevelCZMMapsarefortheuseoflocalbodiesandotheragenciestofacilitateimplementationofthe
CoastalZoneManagementPlans
13. Cadastral(village)mapsin1:3960orthenearestscale,shallbeusedasthebasemaps.
14. ThesemapsareavailablewithrevenueAuthoritiesandarepreparedasperstandardnorms.
15. HTL (as defined in the CRZ notification) and LTL will be demarcated in the cadastral map based on
detailed physical verification using coastal geomorphological signatures or features in accordance
withtheCZMMapsapprovedbytheCentralGovernment.
16. 500mand200mlinesshallbedemarcatedwithrespecttotheHTLthusmarked.
17. HTL(asdefinedintheCRZnotification,1991)andLTLwillalsobedemarcatedalongthebanksoftidal
influencedinlandwaterbodieswiththehelpofgeomorphologicalsignaturesorfeatures.
18. ClassificationsshallbetransferredintolocallevelCZMmapsfromtheCZMPlans.
19. SymbolswillbeadoptedfromCZMMaps.
20. ColourcodesasgiveninCZMMapsshallbeused.
21. DemarcationofcadastralmapswillbedonebylocalagenciesapprovedbytheCentralGovernment.
The local agencies shall work under the guidance of the concerned State Government or Union
TerritoryCoastalZoneManagementAuthorities.

D. Hazardmapping
II. ClassificationofCRZareas
1. TheCZMMapsshallbepreparedinaccordancewithsection26.7oftheCRZnotificationdemarcating
CRZI,II,III,IVandV.
2. TheCZMMapsshallclearlydemarcatethelanduseplanoftheareaandlistsouttheCRZIareas.All
theCRZIareaslistedundersection26.2AandBshallbeclearlydemarcatedandcolourcodesgiven
sothateachoftheCRZIareascanbeclearlyidentified.
3. Bufferzonealongmangroveareasofmorethan1000sqmshallbestipulatedwithadifferentcolour
distinguishingfromthemangrovearea.
4. ThebufferzoneshallalsobeclassifiedasCRZIarea.
5. ThehazardlinetobedrawnupbyMoEFshallbesuperimposedontheCZMmapsin1:25,000scale
andalsoonthecadastralscalemaps.
6. TheCRZIIareasshallbethoseareaswhich havebeensubstantiallybuiltupwitharatioofbuiltup
plotstothatoftotalplotsismorethan50%.
7. In the CRZ areas, the fishing villages, common properties of the fishermen communities, fishing
jetties, ice plants, fish drying platforms or areas infrastructure facilities of fishing and local
communities such as dispensaries, roads, schools, and the like, shall be indicated on the cadastral
scale maps. States shall prepare detailed plans for long term housing needs of coastal fisher
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

172|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

8.

9.

10.
11.
12.
13.
14.

communitiesinviewofexpansionandotherneeds,provisionsofbasicservicesincludingsanitation,
safety,anddisasterpreparedness.
Nodevelopmentalactivitiesotherthanthoselistedaboveshallbepermittedintheareasbetween
thehazardlineand500mtsor100mtsorwidthofthecreekonthelandwardside.Thedwellingunit
ofthelocalcommunitiesincludingthatofthefisherswillnotberelocatedifthedwellingunitsare
located on the seaward side of the hazard line. DSIRDA will provide necessary safeguards from
naturaldisastertosuchdwellingunitsoflocalcommunities.
The water areas of CRZ IV shall be demarcated and clearly demarcated if the water body is sea,
lagoon,backwater,creek,bay,estuaryandforsuchclassificationofthewaterbodiestheterminology
usedbyNavalHydrographicOfficeshallbereliedupon.
ThefishingZonesinthewaterbodiesandthefishbreedingareasshallbeclearlymarked.
The water area shall be demarcated indicating the pollution levels as per Central Pollution Control
Boardstandardsonwaterquality.
IntheCRZVareasthelandusemapsshallbesuperimposedontheCoastalZoneManagementPlan
andclearlydemarcatingtheCRZI,II,III,IV.
Theexistingauthorizeddevelopmentsontheseawardsideshallbeclearlydemarcated.
The features like cyclone shelters, rain shelters, helipads and other infrastructure including road
networkmaybeclearlyindicatedontheCZMMapsforthepurposeofrescueandreliefoperations
duringcyclones,storms,tsunamiandthelike.

III. CZMPsapprovedbyMoEFinaccordancewithCRZnotification,1991
1. WhilepreparingtheCZMPsunderCRZnotification,2011,theCZMPsthathavebeenapprovedunder
the CRZ Notification, 1991 shall be compared. A justification shall be provided by the concerned
CZMAincasetheCZMPspreparedunderCRZnotification,2011varieswithrespecttotheapproved
CZMPpreparedunderCRZnotification,1991.

IV. PublicViewsontheCZMP.
a. ThedraftCZMPspreparedshallbegivenwidepublicityandsuggestionsandobjectionsreceivedin
accordancewiththeEnvironment(Protection)Act,1986.PublichearingonthedraftCZMPsshallbe
heldatdistrictlevelbytheconcernedCZMAs.
b. BasedonthesuggestionsandobjectionsreceivedtheCZMPsshallberevisedandapprovalofMoEF
shallbeobtained.
c. TheapprovedCZMPshallbeputuponthewebsiteofMoEF,concernedwebsiteoftheState,Union
TerritoryCZMAandhardcopymadeavailableinthepanchayatoffice,Districtcollectorofficeandthe
like.

V. RevisionofCoastalZoneManagementPlans
1. Whenever there is a doubt the concerned State or Union territory Coastal Zone Management
Authority shall refer the matter to the National Centre for Sustainable Coastal Management who
shallverifytheCZMPbasedonlatestsatelliteimageryandgroundtruthing.
2. TherectifiedmapwouldbesubmittedtoMoEFforitsrecord.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

173|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
AnnexureII
Listofpetroleumandchemicalproductspermittedforstoragein[CRZexceptCRZI(A)]
i.
ii.
iii.
iv.
v.
vi.
vii.
viii.
ix.
x.
xi.
xii.
xiii.
xiv.
xv.

Crudeoil;
LiquefiedPetroleumGas;
Motorspirit;
Kerosene;
Aviationfuel;
Highspeeddiesel;
Lubricatingoil;
Butane;
Propane;
CompressedNaturalGas;
Naphtha;
Furnaceoil;
LowSulphurHeavyStock;
LiquefiedNaturalGas;
Fertilizersandrawmaterialsformanufactureoffertilizers.

AnnexureIII
Guidelines for development of beach resorts or hotels in the designated areas of CRZIII and CRZII for
occupationoftouristorvisitorswithpriorapprovaloftheMinistryofEnvironmentandForests
I.

ConstructionofbeachresortsorhotelswithpriorapprovalofMoEFindesignatedareasofCRZIIand
IIIforoccupationoftouristorvisitorsshallbesubjecttothefollowingconditions,namely:
a. Theproject proponentshallnotundertakeanyconstructionwithin200minthelandward sideof
HighTideLineandwithintheareabetweenLowTideLineandHighTideLine;
b. The proposed constructions shall be beyond the hazard line or 200m from the High Tide Line
whicheverismore;
c. live fencing and barbed wire fencing with vegetative cover may be allowed around private
propertiessubjecttotheconditionthatsuchfencingshallinnowayhamperpublicaccesstothe
beach;
d. noflatteningofsanddunesshallbecarriedout;
e. nopermanentstructuresforsportsfacilitiesshallbepermittedexceptconstructionofgoalposts,
netpostsandlampposts;
f. Constructionofbasementmaybeallowedsubjecttotheconditionthatnoobjectioncertificationis
obtained from the State Ground Water Authority to the effect that such construction will not
adverselyaffectfeeflowofgroundwaterinthatarea;
g. the State Ground Water Authority shall take into consideration the guidelines issued by Central
Governmentbeforegrantingsuchnoobjectioncertificate;
h. thoughnoconstructionisallowedinthenodevelopmentzoneforthepurposesofcalculationof
FloorAreaRatio,theareaofentireplotincludingtheportionwhichfallswithinthenodevelopment
zoneshallbetakenintoaccount;

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

174|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
i.

j.
k.
l.
m.
n.

o.

p.
q.

r.

the total plot size shall not be less than 0.4 ha and the total covered area on all floors shall not
exceed33percentoftheplotsizei.e.,theFloorAreaRatioshallnotexceed0.33andtheopenarea
shallbesuitablylandscapedwithappropriatevegetalcover;
theconstructionshallbeconsistentwiththesurroundinglandscapeandlocalarchitecturalstyle;
theoverallheightofconstructionuptothehighestridgeoftheroof,shallnotexceed9mandthe
constructionshallnotbemorethantwofloors(groundfloorplusoneupperfloor);
groundwatershallnotbetappedwithin200moftheHighTideLine;withinthe500mzoneitcanbe
tappedonlywiththeconcurrenceoftheCentralorStateGroundWaterBoard;
extraction of sand, leveling or digging of sandy stretches except for structural foundation of
building,swimmingpoolshallnotbepermittedwithin500moftheHighTideLine;
the quality of treated effluents, solid wastes, emissions and noise levels and the like, from the
projectareamustconformtothestandardslaiddownbythecompetentauthoritiesincludingthe
CentralorStatePollutionControlBoardandundertheEnvironment(Protection)Act,1986;
necessaryarrangementsforthetreatmentoftheeffluentsandsolidwastesmustbemadeandit
mustbeensuredthattheuntreatedeffluentsandsolidwastesarenotdischargedintothewateror
onthebeach;andnoeffluentorsolidwasteshallbedischargedonthebeach;
toallowpublicaccesstothebeach,atleastagapof20mwidthshallbeprovidedbetweenanytwo
hotelsorbeachresorts;andinnocaseshallgapsbelessthan500mapart;and
iftheprojectinvolvesdiversionofforestlandfornonforestpurposes,clearanceasrequiredunder
the Forest (Conservation) Act, 1980 shall be obtained and the requirements of other Central and
Statelawsasapplicabletotheprojectshallbemetwith;and
approvaloftheStateorUnionterritoryTourismDepartmentshallbeobtained.

II. In ecologically sensitive areas (such as marine parks, mangroves, coral reefs,breeding and spawning
grounds of fish, wildlife habitats and such other area as may be notified by the Central or State
GovernmentUnionterritories)constructionofbeachresortsorhotelsshallnotbepermitted

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

175|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
AnnexureIV
FormIforseekingclearanceforprojectattractingCRZnotification
I. Basicinformation:
NameoftheProject:
Locationorsitealternativesunderconsideration:
Sizeoftheproject(intermsoftotalarea):
CRZclassificationofthearea:
Expectedcostoftheproject:
ContactInformation:
II. Activity
1. Construction, operation or decommissioning of the Project involving actions, which will cause
physicalchangesinthelocality(topography,landuse,changesinwaterbodies,andthelike)
S.
NO.

1.1

1.2
1.3
1.4
1.5

1.6
1.7
1.8
1.9
1.10
1.11
1.12
1.13
1.14

INFORMATION/CHECKLISTCONFIRMATION

Permanentortemporarychangeinlanduse,
landcoverortopographyincludingincrease
inintensityoflanduse(withrespecttolocal
landuseplan)
DetailsofCRZclassificationasperthe
approvedCoastalZoneManagementPlan?
WhetherlocatedinCRZIarea?
ThedistancefromtheCRZIareas.
Whetherlocatedwithinthehazardzoneas
mappedbyMinistryofEnvironmentand
Forests/NationalDisasterManagement
Authority?
Whethertheareaispronetocyclone,
tsunami,tidalsurge,subduction,earthquake
etc.?
Whethertheareaisproneforsaltwater
ingress?
Clearanceofexistingland,vegetationand
buildings?
Creationofnewlanduses?
Preconstructioninvestigationse.g.bore
hole,soiltesting?
Constructionworks?
Demolitionworks?
Temporarysitesusedforconstructionworks
orhousingofconstructionworkers?
Abovegroundbuildings,structuresor
earthworksincludinglinearstructures,cut

YES/NO

DETAILSTHEREOF(WITH
APPROXIMATEQUANTITIES/RATES,
WHEREVERPOSSIBLE)WITHSOURCE
OFINFORMATIONDATA

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

176|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
S.
NO.

1.15
1.16
1.17
1.18
1.19
1.20
1.21
1.22
1.23

1.24

1.25
1.26
1.27
1.28
1.29
1.30
1.31
1.32
1.33
1.34
1.35
1.36
1.37

INFORMATION/CHECKLISTCONFIRMATION

andfillorexcavations
Undergroundworksincludingminingor
tunnelling?
Reclamationworks?
Dredging/reclamation/landfilling/disposalof
dredgedmaterialetc.?
Offshorestructures?
Productionandmanufacturingprocesses?
Facilitiesforstorageofgoodsormaterials?
Facilitiesfortreatmentordisposalofsolid
wasteorliquideffluents?
Facilitiesforlongtermhousingofoperational
workers?
Newroad,railorseatrafficduring
constructionoroperation?
Newroad,rail,airwaterborneorother
transportinfrastructureincludingnewor
alteredroutesandstations,ports,airports
etc?
Closureordiversionofexistingtransport
routesorinfrastructureleadingtochangesin
trafficmovements?
Newordivertedtransmissionlinesor
pipelines?
Impoundment,damming,culverting,
realignmentorotherchangestothe
hydrologyofwatercoursesoraquifers?
Streamandrivercrossings?
Abstractionortransfersofwaterform
groundorsurfacewaters?
Changesinwaterbodiesorthelandsurface
affectingdrainageorrunoff?
Transportofpersonnelormaterialsfor
construction,operationordecommissioning?
Longtermdismantlingordecommissioning
orrestorationworks?
Ongoingactivityduringdecommissioning
whichcouldhaveanimpactonthe
environment?
Influxofpeopletoanareaineither
temporarilyorpermanently?
Introductionofalienspecies?
Lossofnativespeciesorgeneticdiversity?
Anyotheractions?

YES/NO

DETAILSTHEREOF(WITH
APPROXIMATEQUANTITIES/RATES,
WHEREVERPOSSIBLE)WITHSOURCE
OFINFORMATIONDATA

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

177|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
2. UseofNaturalresourcesforconstructionoroperationoftheProject(suchasland,water,materials
orenergy,especiallyanyresourceswhicharenonrenewableorinshortsupply):
S.
INFORMATION/CHECKLISTCONFIRMATION
NO.
2.1
2.2
2.3
2.4
2.5
2.6
2.7

Landespeciallyundevelopedoragricultural
land(ha)
Water(expectedsource&competingusers)
unit:KLD
Minerals(MT)
Constructionmaterialstone,aggregates,
sand/soil(expectedsourceMT)
Forestsandtimber(sourceMT)
Energyincludingelectricityandfuels(source,
competingusers)Unit:fuel(MT),energy
(MW)
Anyothernaturalresources(useappropriate
standardunits)

DETAILSTHEREOF(WITH
APPROXIMATEQUANTITIES/RATES,
YES/NO
WHEREVERPOSSIBLE)WITHSOURCE
OFINFORMATIONDATA

3. Use,storage,transport,handlingorproductionofsubstancesormaterials,whichcouldbeharmfulto
humanhealthortheenvironmentorraiseconcernsaboutactualorperceivedriskstohumanhealth.
DETAILSTHEREOF(WITH
S.
INFORMATION/CHECKLIST
APPROXIMATEQUANTITIES/RATES,
YES/NO
NO. CONFIRMATION
WHEREVERPOSSIBLE)WITHSOURCE
OFINFORMATIONDATA
Useofsubstancesormaterials,whichare
hazardous(asperMSIHCrules)tohuman
3.1
healthortheenvironment(flora,fauna,

andwatersupplies)
Changesinoccurrenceofdiseaseoraffect
3.2 diseasevectors(e.g.insectorwaterborne

diseases)
Affectthewelfareofpeoplee.g.by
3.3
changinglivingconditions?

Vulnerablegroupsofpeoplewhocouldbe
3.4 affectedbytheprojecte.g.hospital

patients,children,theelderlyetc.,
Anyothercauses,thatwouldaffectlocal
communities,fisherfolk,theirlivelihood,
3.5
dwellingunitsoftraditionallocal

communitiesetc

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

178|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
4.

Productionofsolidwastesduringconstructionoroperationordecommissioning(MT/month)

S.
NO.

INFORMATION/CHECKLIST
CONFIRMATION

4.1

Spoil,overburdenorminewastes
Municipalwaste(domesticandor
commercialwastes)
Hazardouswastes(asperHazardous
WasteManagementRules)
Otherindustrialprocesswastes
Surplusproduct
Sewagesludgeorothersludgefrom
effluenttreatment
Constructionordemolitionwastes
Redundantmachineryorequipment
Contaminatedsoilsorothermaterials
Agriculturalwastes
Othersolidwastes

4.2
4.3
4.4
4.5
4.6
4.7
4.8
4.9
4.10
4.11

YES/NO

DETAILSTHEREOF(WITH
APPROXIMATEQUANTITIES/RATES,
WHEREVERPOSSIBLE)WITHSOURCE
OFINFORMATIONDATA

5. Releaseofpollutantsoranyhazardous,toxicornoxioussubstancestoair(Kg/hr)
DETAILSTHEREOF(WITH
S.
INFORMATION/CHECKLIST
APPROXIMATEQUANTITIES/RATES,
YES/NO
NO. CONFIRMATION
WHEREVERPOSSIBLE)WITHSOURCE
OFINFORMATIONDATA
Emissionsfromcombustionoffossilfuels
5.1
fromstationaryormobilesources

5.2
Emissionsfromproductionprocesses
Emissionsfrommaterialshandling
5.3
includingstorageortransport

Emissionsfromconstructionactivities
5.4
includingplantandequipment

Dustorodoursfromhandlingofmaterials
5.5
includingconstructionmaterials,sewage

andwaste
5.6
Emissionsfromincinerationofwaste
Emissionsfromburningofwasteinopen
5.7
air(e.g.slashmaterials,construction

debris)
5.8
Emissionsfromanyothersources

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

179|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
6. GenerationofNoiseandVibration,andEmissionsofLightandHeat:
S.
NO.

6.1
6.2
6.3
6.4
6.5
6.6
6.7

INFORMATION/CHECKLISTCONFIRMATION

DETAILSTHEREOF(WITHAPPROXIMATE
QUANTITIES/RATES,WHEREVER
POSSIBLE)WITHSOURCEOF
INFORMATIONDATAWITHSOURCEOF
INFORMATIONDATA

YES/NO

Fromoperationofequipmente.g.
engines,ventilationplant,crushers
Fromindustrialorsimilarprocesses
Fromconstructionordemolition
Fromblastingorpiling
Fromconstructionoroperationaltraffic
Fromlightingorcoolingsystems
Fromanyothersources

7. Risksofcontaminationoflandorwaterfromreleasesofpollutantsintothegroundorintosewers,
surfacewaters,groundwater,coastalwatersorthesea:
S.
NO.

7.1
7.2
7.3
7.4
7.5

INFORMATION/CHECKLISTCONFIRMATION

DETAILSTHEREOF(WITHAPPROXIMATE
QUANTITIES/RATES,WHEREVER
POSSIBLE)WITHSOURCEOF
INFORMATIONDATAWITHSOURCEOF
INFORMATIONDATA

YES/NO

Fromhandling,storage,useorspillageof
hazardousmaterials
Fromdischargeofsewageorother
effluentstowaterortheland(expected
modeandplaceofdischarge)
Bydepositionofpollutantsemittedtoair
intothelandorintowater
Fromanyothersources
Isthereariskoflongtermbuildupof
pollutantsintheenvironmentfromthese
sources?

8. RiskofaccidentsduringconstructionoroperationoftheProject,whichcouldaffecthumanhealthor
theenvironment
S.
NO.

8.1
8.2
8.3

INFORMATION/CHECKLISTCONFIRMATION

Fromexplosions,spillages,firesetcfrom
storage,handling,useorproductionof
hazardoussubstances
Fromanyothercauses
Couldtheprojectbeaffectedbynatural
disasterscausingenvironmentaldamage
(e.g.,floods,earthquakes,landslides,
cloudburstetc)?

DETAILSTHEREOF(WITHAPPROXIMATE
QUANTITIES/RATES,WHEREVER
POSSIBLE)WITHSOURCEOF
INFORMATIONDATAWITHSOURCEOF
INFORMATIONDATA

YES/NO

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

180|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
9. Factors which should be considered (such as consequential development) which could lead to
environmental effects or the potential for cumulative impacts with other existing or planned
activitiesinthelocality
S.
NO.

9.1

9.2
9.3
9.4

INFORMATION/CHECKLISTCONFIRMATION

DETAILSTHEREOF(WITHAPPROXIMATE
QUANTITIES/RATES,WHEREVER
POSSIBLE)WITHSOURCEOF
INFORMATIONDATAWITHSOURCEOF
INFORMATIONDATA

YES/NO

Leadtodevelopmentofsupporting.lities,
ancillarydevelopmentordevelopment
stimulatedbytheprojectwhichcould
haveimpactontheenvironmente.g.:
Supportinginfrastructure(roads,power
supply,wasteorwastewatertreatment,
etc.)housingdevelopmentextractive
industriessupplyindustriesother
Leadtoafteruseofthesite,whichcould
haveanimpactontheenvironment
Setaprecedentforlaterdevelopments
Havecumulativeeffectsduetoproximity
tootherexistingorplannedprojectswith
similareffects

III.
S.
NO.

3
4
5
6
7
8
9

EnvironmentalSensitivity

AREAS
Areasprotectedunderinternationalconventions,
nationalorlocallegislationfortheirecological,
landscape,culturalorotherrelatedvalue
Areaswhichareimportantorsensitivefor
ecologicalreasonsWetlands,watercoursesor
otherwaterbodies,coastalzone,biospheres,
mountains,forests
Areasusedbyprotected,importantorsensitive
speciesoffloraorfaunaforbreeding,nesting,
foraging,resting,overwintering,migration
Inland,coastal,marineorundergroundwaters
State,Nationalboundaries
Routesorfacilitiesusedbythepublicforaccess
torecreationorothertourist,pilgrimareas
Defenceinstallations
Denselypopulatedorbuiltuparea
Areasoccupiedbysensitivemanmadelanduses
(hospitals,schools,placesofworship,community
facilities)

AERIALDISTANCE
(WITHIN15KM.)
PROPOSEDPROJECT
LOCATIONBOUNDARY

NAME/
IDENTITY

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

181|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
S.
NO.

NAME/
IDENTITY

AREAS
Areascontainingimportant,highqualityorscarce
resources(groundwaterresources,surface
resources,forestry,agriculture,fisheries,tourism,
minerals)
Areasalreadysubjectedtopollutionor
environmentaldamage.(thosewhereexistinglegal
environmentalstandardsareexceeded)
Areassusceptibletonaturalhazardwhichcould
causetheprojecttopresentenvironmental
problems(earthquakes,subsidence,landslides,
erosion,floodingorextremeoradverseclimatic
conditions)

10

11

12

AERIALDISTANCE
(WITHIN15KM.)
PROPOSEDPROJECT
LOCATIONBOUNDARY

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

182|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
27. GreyWaterReuse
27.1. ByelawsforDSIRDA(TheGreyWaterRecyclingandReuseByelaws)
Whereasitisexpedienttoregulatetheactivitiessuchas
a) Acceptanceoflongterm,intermittent,ortemporaryreuseand/ordischargeofgreywaterwaste
totheGreyWater/Seweragesystem.
b) EstablishmentofGreyWaterCriteria
c) Classificationofdomestic/industrialwastedischargesagainstspecifiedcriteria.
d) Pretreatmentofgreywaterbeforeitisacceptedforreuseforthepurposeofnonpotableuses.
e) Installationofflowmeters,samplersorotherdevicestomeasureflowandqualityofrecycledgrey
water.
f) Pretreatment of Grey water as per criteria before it is accepted for discharge to the sewerage
system
g) Separationofunpotablewaterplumbingandpotablewaterplumbingsystems.
h) SamplingandmonitoringofGreyWaterdischargestoensurecomplianceofconditionsunderthe
byelaw.
i) DSIRDAtoacceptorrefuseGreyWaterdischarge.
j) Taxes to be levied to cover the cost of conveying, treating and / or disposing of Grey Water and
associatedcostsofadministrationandmonitoring.
k) Establishment of waste minimization and management programmes for commercial waste and
householdwasteproducers.
l) Encouragingtheuseoftreatedrecycledgreywaterfornonpotableandnoncontactuses.

27.2. Definitions

Inthisbyelaw

27.2.1. AccessPoint
means a place where access may be made to a private sewer for inspection (including sampling or
measurement),cleaningormaintenancethatmeetstherequirementsoftheDSIRDAnormsinthatrespect
andalsotermedasanopeningbeforedischarge.
27.2.2. Approved
meansapprovedinwritingbyanauthorizedofficeroftheDSIRDA.
27.2.3. AuthorizedOfficer
meansanypersonappointedbytheDSIRDAforthepurposesofactingasanauthorizedofficerunderthis
Byelaw.
27.2.4. Characteristic
meansanyofthephysical,chemicalandbiologicalcharacteristicsofcommercialwasteor/domesticwaste
(GreyWater).
27.2.5. DischargeManagementPlan
meansaplanforthemonitoring,programmingandcontrollingoftheeffluentfromrecycling(greywater)
treatmentplantanddischargesintotheseweragesystemofDSIRDA.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

183|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
27.2.6. DischargeorDischargeofwastes
meanstheremovalofwastesfrompremisesintotheGreyWatersystemorbymeansofanyothersystem;
27.2.7. Disconnection
meansthephysicalcuttingand/orsealingoftheprivatesewerfromthewastewatersystem.
27.2.8. DomesticWasteWater
means either waste water that is typically discharged from premises that are used solely for residential
activitiesorwastewaterofthesamecharacterdischargedfromotherpremises.
27.2.9. GreyWater
meansinvolvingwaterfromsinks,tubs,showers,washingandkitchenthroughwhichnoanimal/human
excretaisallowedtopass.
27.2.10. Commercialpremises
meansanypremiseswhichbeingusedorintendedtobeused(whetherforprofitornot)forcarryingonany
trade,business,education,researchorinstitution.
27.2.11. Commercialwasteorwastes
arethewasteremovedfromcommercialpremisesorotherpremisesbywayofdischargeofanyliquid,with
orwithoutmatterinsuspensionorsolutiontherein.Itmaybedischargedfromtradepremises.
27.2.12. Inspector
includeswhomevertheDSIRDAhasappointedinwritingforthepurposeofimplementationofthisByelaw;
27.2.13. ISO5667
meansthelatestedition,completewithanyamendments,ofInternationalstandardISO5667:1994Water
QualitySampling:
Part1:1980Guidanceonthedesignofsamplingprogrammes
Part2:1991Guidanceonsamplingtechniques
Part3:1994Guidanceonthepreservationandhandlingofsamples
Part10:1992GuidanceonsamplingofGreyWaters
27.2.14. ISOTR9824
means the latest edition, complete with any amendments, of International standard ISO TR
9824:Measurementofliquidflowinopenchannels.

Part1:1990MeasurementoffreesurfaceflowinclosedconduitsMethods
Part2:1990MeasurementoffreesurfaceflowinclosedconduitsEquipment

27.2.15. Laboratory
meanstheagencypermittedtotestthesamplesofwastewaterorwaste.
27.2.16. License
means the license, is issued and / or renewed annually for the discharge of waste, given in writing by
DSIRDAforpurposesofthisbyelaw;

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

184|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
27.2.17. Masslimit
meansthetotalmassofanycharacteristicthatisallowedtobedischargedtothewastewatersystemover
any twenty four hour period from any single point of discharge or collectively from several points of
discharge.
27.2.18. Maximumconcentration
meansthepeakconcentration,inthewastewater,ofanycharacteristicthatmaynotbeexceeded.
27.2.19. Occupier
for the purposes of an industrial plant complexes, or premises whoever in fact occupies a industry /
premisesorpartofone,eitherasanowner,onrentoronleaseorinanyotherway;
27.2.20. Person
includes a corporation sole and also a body of persons whether corporate or incorporate or partnership
firm;
27.2.21. Pointofdischarge
isthephysicalpointwherewastedischargeentersthewastewatersystem.
27.2.22. Pretreatment
meansanyprocessingofgreywaterdesignedtoreduceanycharacteristicinawaste,beforedischargeto
thewastewatersystemorforreuses.
27.2.23. Notice
means a written communication issued by the DSIRDA or his authorized officer to the occupier of
propertytoprovidetherecyclefacilitywithinthepremises.
27.2.24. Premises
meanseither

a property which is led under a separate card of title or for which a separate title card may be
issuedandinrespecttowhichabuildingplanshavebeenormaybeissued,or
abuildingwhichisinpossessionasanindividualunitbyacrosslease,unittitleorcompanylease
andforwhichacertificateoftitleisavailable,or
landheldinpublicownership,foraparticularpurpose,or
separatelyassessedtoDSIRDAtaxes,individualunitwithinbuildings.

27.2.25. PrivateSewer
meansthatsectionofasewerbetweenthepremisesandtheseweragesystem.
27.2.26. Prohibitedindustrialwaste
meansaindustrialwastehavingphysical,chemicalaswellasbiologicalcharacteristicsinexcessofwhatis
definedinthisByelaw.
27.2.27. Publiclynotified
means published on atleast one occasion in a newspaper circulating in the DSIRDA territory, or under
emergencyconditionsbythemostpracticalmeansavailableatthattime.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

185|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
27.2.28. Receivingwaters
meanscoastalwatersoranynaturalwaters,whichwillreceivetreatedwastes.
27.2.29. Seweragesystem
meansalltypesofsewers,appurtenances,pumpingstations,storagetanks,wastewatertreatmentfacility
plants,marineoutfallsandotherrelatedstructuresownedbytheurbanlocalbody/DSIRDAandusedfor
reception,treatmentanddisposalofwastewaterandalsotermedaswastewatersystem
27.2.30. Standardmethodsfortheexaminationofwaterandwastewater
means the latest edition complete with any amendments and supplements as published by Pollution
ControlBoard.
27.2.31. Stormwater
meansallsurfacewaterrunoffsresultingfromprecipitation.
27.2.32. Temporarydischarge
means any discharge of an intermittent or short duration. Such discharges include the shortterm
dischargeof anunusualwastefrompremisessubjecttoan existingpermitandthedischargeoftinkered
wastes.
27.2.33. UrbanLocalAuthority
means a local municipal authority of a town, regional council, or a union of towns conforming to Article
243QoftheConstitutionofIndia.
27.2.34. Waste
meansanywaterwithmatterinsolutionorsuspension,domesticwastewater,(greywastewater)orliquid
wastebutexcludingsewageandindustrialwastewaterforthepurposeofthisbyelaw.
27.2.35. Wasteminimization
means the implementation on trade premises, of operations and restrictions, appropriate to the goal of
reducingoreliminatingthequantityandtoxicityofwastes.
27.2.36. Wastewatersystem
meansalltypesofsewer,appurtenances,pumpingstations,storagetanks,wastewatertreatmentsfacility/
plants,marineoutfallsandotherrelatedstructuresownedbytheurbanlocalauthority/DSIRDAandused
forthereception,treatmentanddisposalofwastewaterandalsotermedseweragesystem.
27.2.37. Zones
means the drainage catchments areas of a project area that are served by a separate waste water /
seweragetreatmentplants.

27.3. SectionI:GreyWaterReuseByelaws
27.3.1. ApplicationoftheByelaws
Thesebyelawsareapplicabletoallcommercialandindustrialpremiseswhichfallinone ofthefollowing
categories.

Category1:Threestarorhighercategoryhotels
Category2 : Commercial, industrial and all other establishments (except any residential) having
builtuparea2000sq.m.ormore.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

186|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
27.3.2. SeparationandreuseofGreyWater
Thegreywateristhewastewaterfrombathroom,sink,tubandkitchen.Thewastesfromtoiletsineach
premiseshallbeseparatedfromthegreywaterbyseparatedowntakedischargesystem.Thisseparated
greywatershallberecycledbyprovidingrecyclingtreatmentplantineachpremisesandthetreatedgrey
water shall be reused for nonpotable and / or noncontact uses, after storing the grey water in the
distinctlyseparatetanksbymeansofpurplecolourdowntakeplumbingpipes.Thisshallbedonebyeach
person,industrialunit,processingunitoranyotherestablishmentinDSIRDAarea,whomaybeconsuming
waterandcreatinganywasteintheirpremises.
InadditiontoseparationandrecyclingthegreywaterintheirunitsinDSIRDA,eachperson,industrialas
well as process units and all other establishments, shall reuse the grey water in their premises for non
potable and noncontact purposes or shall obtain permission from DSIRDA to discharge such grey water
into the proposed DSIRDA irrigation reuse waste distribution network, if the same is of the accepted
quality.
Exemptionscouldbeaccordedunderfollowingcircumstances,asdecidedbytheDSIRDA:

In case the existing premises cannot permit the provision of additional overhead tank for the
purposeoftheuseoftreated(grey)water
If, in the existing structure, there is no space for installation of grey water treatment facility and
collectionchamber

27.3.3. Dischargeofgreywater
Theowneroroccupierofpremisesshallutilizetheirgreywaterintheirpremisesasfaraspossible.Ifthisis
notfeasible,theyshalldischargegreywaterintotheseweragesystemand/orshallallowanyotherperson
todischargethesamefromhispremisesintothesystem
Onlyinamanner,quantity,orqualitythatshallnotcausedamagetotheseweragesystemortotheflowof
thegreywaterortothetreatmentprocessthereofornotinexcessofwatersupplyreceived.
Onlywithavalidpermissioninaccordancewiththeprovisionsofthisbyelawwillbeallowtheoccupierto
connectthegreywatertotheDSIRDAsewer.
Inanatureormannerorinawaythatshallnotconstituteanuisanceoffoulgasesorcauseapublichazard
orotherwiseincomplianceofthisByelaw.
Therecycledgreywatershallbeusedfornonpotable,nocontactpurposeswithinpremisesandshallnot
beconnectedtosewage/wastewatersystemofDSIRDAwithoutthepermission,providedthequalityof
grey water is acceptable by DSIRDA. However, the waste generated by the recycling plant can be
connectedtoDSIRDAsewernetworkifitisoftheacceptedquality.
27.3.4. EnforcementofByelaws
Incaseofexistingproperties,DSIRDAorhisauthorizedofficerwillissueanoticetotheoccupierformaking
arrangementsofReuseofGreyWaterwithinspecifiedtime.
Incaseofproposed/intending/underredevelopmentproperties,theoccupier/developer/builderwill
submit an application directly or through his authorized consultant to the DSIRDA with details of
proposedDischargeManagementPlanalongwiththeapplicationfordemandofwaterandpermission
toconnecttheGreyWaterfordischargingintosewagesystemofDSIRDA.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

187|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
27.3.5. GrantingaPermission
EverypremisewillbegrantedpermissionforthedischargeofdomesticwastesorwastestotheDSIRDA
seweragesystemonlyiftherecyclingmeasuresforGreyWaterandconditionssetforthinthisByelaware
fulfilled.
27.3.6. Greywatertestsandtheirresults
An occupier of an industrial plant or premises requiring a license shall provide to the DSIRDA or an
authorized officer once a year for the purpose of receiving a license, test results of the industrial wastes
dischargedfromtheplantorpremises.
Withoutderogatingtheprovisionsspecifiedinclauseofbyelaw27.3.5,theoccupierofapremisesrequiring
a license or the occupier of a controlled plant or premise, shall provide to the DSIRDA test results of
industrialwastesorwastedischargedfromtheplantorpremisesatanytimeheisrequiredinwritingtodo
sobytheDSIRDA.
Thetestingofwastesandthesubmissionoftheresultsshallbedoneinamannerinaccordancewiththe
termsandconditionsprescribedbytheDSIRDAoranauthorizedofficerinthisregard.
ThisbyelawaccordstheauthorityofDSIRDA,hisagentoranauthorizedofficeroftheirauthoritytovisitthe
plant/premisesatallreasonabletime.
27.3.7. Noticefortestingofgreywaterdischarge
The DSIRDA may order the testing of samples of industrial wastes or sewage / grey water wastes as
describedinclauseofbyelaw27.3.6ifhefeelsthatthecircumstancessodemandandhemay,bywritten
notice,directtheplantorpremisesoccupiertopaytheexpensesofperformingsuchtests.
A controlled plant whose occupier received notice as stated in clause of byelaw 27.3.6 shall comply the
provisionsofbyelaw(27.3.5)prescribedaboveforthatpurpose.
27.3.8. OperationalPermissionfortheGreyWaterRecyclingTreatmentPlant
The DSIRDA may determine on the basis of test results of the wastes that were provided to him or that
wereperformedathisinstanceorbehalf,thatarecycledgreywaterplantisfulfillingtherequirementsand
willissuepermissioninwritingtoputtheplantonpermanentbasistotheoccupier.
Theoccupiershalloperatetheplantasspecified.
27.3.9. SeparationofGreyWater
Thewastesfromtoiletsinthepremiseswillbeseparatedfromgreywaterthatisofbathroomandkitchen
wastesbymeansofseparatedowntakedischargesystem.Thegreywatershallberecycledbyproviding
recyclingplantandshallbereusedfornonpotableandnoncontactpurposesafterstoringthesameinthe
distinctlyseparatetankbymeansofpurplecoloreddowntakepipes.Thegreywaterqualityshallconform
to standards of non potable water. The recycled grey water shall be tested once in six months and the
resultsshallbemadeavailabletotheDSIRDAorhisauthorizedofficerwheneverdemanded.
27.3.10. ConditionalGreyWaterDischargePermission
Waste discharges of the conditional type plant will be allowed on the issue of a conditional permission
providedtheconditionaltypeplanthasrecyclingandreuseofgreywaterfacilityandnotexceedinglimits
giveninasperGPCB/DSIRDAnorms.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

188|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
27.3.11. Mandatorynoticeregardingcharges
AnoccupierofapremisesshallinformtheDSIRDAorhisauthorizedofficerofanychangeinthequantity,
natureorqualityofthegreywaterdischargedfromhisplantorpremises,themanneroftheirdischargeor
extrarequirementofexternalsupplyofwaterimmediatelyifthechangeislikelytocausedischargeofgrey
waterinvariationorviolationoflicenseissuedunderthesebyelaws.
27.3.12. Authoritytochangelicense/noticeconditions
TheDSIRDAorhisauthorizedofficer,havinggivenalicenseoranoticeinwritingbytheauthorityvestedin
him by this byelaw, may revoke, modify or stipulate conditions to the license or notice if satisfied on
inspectionoftheplant,premisesortestreports.
27.3.13. InterferencewiththeAuthority
Interference with the authority of the DSIRDA or his agent or with the authorized officer is strictly
prohibited.
27.3.14. DeliveryofNotice/Permission
Notice/PermissionrequiredbythisByelawshallbedeemedtohavebeendeliveredlawfullyifitisgiven
into the hand of their intended receiver acknowledgement, or delivered to his place of residence or his
place of occupation or place known to be so with acknowledgement, or if sent by registered mail to the
samepersonaccordingtohisplaceofresidence,ornormalplaceofemploymentrecentlyknowntobesoif
itisnotpossibletomakethedeliveryasstated,thenoticewillbeassumedtohavebeendeliveredlawfully
ifthenoticeispastedinaconspicuousplaceinoneoftheabovestatedlocations.
27.3.15. Correctiveaction
AnypersonviolatingtheprovisionsofthesebyelawsshallbefinedRs.5000/onlyonthedayofdetection
and if the violation continues shall be fined Rs. 100/ for every day as corrective action after a written
noticefromtheauthorizedofficerisdeliveredtohim.
Failuretooperate(asdeterminedbytheInspectororauthorizedofficerofDSIRDAfromtheobservationsof
testresultsand/orphysicalverification)fromtherecyclingplantwillattractapenaltyofRs.500/perday
and/ordisconnectionofwaterand/orsewageconnection.
27.3.16. Authorizationofofficers
The DSIRDA will authorize his officers / inspectors and will delegate the necessary powers for carrying
variousdutiesunderthisbyelaw.

27.4. SectionII:WaterincentiveByelaws
27.4.1. Separate plumbing for grey water (in purple colour) and provisions of recycling for new
buildings
Everydeveloper/buildershallprovidethenewlyconstructedbuildingwiththeprovisionofseparatedown
take plumbing for grey water (in purple colour), recycling grey water treatment plant, storage and reuse
fittingsbeforesellingthebuilding.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

189|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
27.4.2. Separate plumbing for grey water (in purple colour) and provision of recycling for existing
buildings
Everyexistingbuildingstructureshallprovidewiththeprovisionofrecycledgreywatertreatmentplantand
relevantadequateseparateplumbingforgreywaterandreusefittingsinpurplecolour.
27.4.3. Reuseofgreywaterstrictlyfornotpotableandnoncontactuses
The reuse of water will be strictly for not potable use by means of providing a distinctly separate reuse
plumbing system coloured in purple. The noncontact uses shall be restricted to toilet flushing, drip
irrigationoftrees/shrubs,subsurfaceirrigationoflawnsandrechargeofgroundwater.
27.4.4. Nocrossconnectionofpotablewaterandnotpotablewater(greywater)
There shall not be any crossconnection of fitting of the potable and not potable water pipelines at any
point.Therecycledgreywatersystemsshallbemaintainedataloweroperatingpressurethanthatofthe
potable water system. Precautions should be taken at the makeup connection to prevent cross
contamination.
27.4.5. Recycledgreywatermeasurement
Therecycledgreywaterwillbemeasuredbymeansofflowmeter/watermeterbeforestoringthesamein
aseparatestoragetank.Theflowmeter/watermeterwillbesealedbyDSIRDA.Theflowmeter/water
metershallbereadmonthlybytheoccupierandshallmakeavailabletheresultswheneverdemanded.
27.4.6. Disputeresolution
AllthedisputesarisingintheenforcementofthisbyelawshallbereferredtotheDSIRDAwhointurnwill
resolvethedisputesinconsultationwithhisAuthorizedofficers/Technicalcommitteeandintimatetothe
occupier/builder/developer.ThedecisionoftheDSIRDAwillbefinalandbindingontheoccupier.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

190|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

Figure271:ConceptualGreyWaterRecyclesystemproposedunderByelaws

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

191|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
28. DraftRegulationsforControlofPollutionduetoSewage/IndustrialWasteWater
inDholeraSpecialInvestmentRegion
28.1.
Itshallbeunlawfulactforanyperson,organization,industry,productionunitoranyotherestablishmentin
DSIRDA area to place, deposit or incinerate in any manner in public or private property within the
jurisdictionofDSIRDA,anyhuman/animalexcretaand/orotherhazardous/objectionablewaste(s).

28.2.
It shall be unlawful for any person, organization, industry, production unit or any other establishment in
DSIRDAareatodischargeanysewage/industrialwastewaterorotherpollutedwastewater,exceptwhere
suitabletreatmenthasbeenprovidedinaccordancewiththeprovisionsprescribedbyDSIRDA.

28.3.
Forpermissiontodischargeintothesewerage/wastewatersystemfromestablishments/industriesetc.
producing industrial wastes, the owner or his authorized agent shall apply to the DSIRDA alongwith the
proposal / plans for primary treatment of waste water, specifications, method of primary and secondary
treatment, sample test reports or other information, considered pertinent in Judgment of DSIRDA. All
industrialunitsandtradeestablishmentwhetherexistingorproposedare/willbedischargingindustrial
waste into the sewer / waste water system of DSIRDA shall require permission from the DSIRDA to
discharge the same into the sewerage / waste water system, if the quality of such waste water is found
permissible.

28.4.
Noperson,industry,establishmentetc.shalldischargeorcausetobedischargedanystormwater,surface
water, roof runoff or subsurface drainage to any sewer / waste water system of DSIRDA without such
permission.

28.5.
Storm water and other unpolluted drainage, unpolluted industrial cooling water or unpolluted process
watershallbeallowedtobedischargedtoastormwatersystemornaturaloutlet,forwhichthewritten
permissionofDSIRDAwouldberequired.

28.6.
Theinterceptorsforremovalofgrease,oil,sand,siltetc.shallbeprovidedbyeachindustry/manufacturing
units,whenandwhererequiredforproperhandlingofliquidwastes.

28.7.
Nostorageunitswhereacids,cyanideandanyotherhazardousmaterials(Rawmaterialorbyproduct)are
stored, shall be connected directly to the sewage / storm water / waste water or natural outlet. The
holdingpitorotherapprovedarrangementsshallberequiredtobeprovidedbyeachunitsothataccidental
dischargecanbecaughtanddisposedoffinasafemanner.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

192|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
28.8.
Noperson,organization,industryoranyotherestablishmentsinDSIRDAareashalldischargeorcausedto
bedischargedintoanysystem,waterbodieswithinorenteringDSIRDAarea

Anyliquidorvapourhavingatemperaturehigherthan45oC.

AnywaterorwastehavingapHlowerthan5.5orhigherthan9.5.

Any water or liquid waste containing fats, wax, grease, tars or oils whether emulsified or not or
containingsubstanceswhichmaysolidifyorbecomeviscousattemperaturesbetween0oCand65oC.

Fuel oil, calcium carbide, benzene, cleaning solvents or other inflammable or explosive material in
solid,liquidorgaseousformandhavingaflashpointlowerthan187oC.

Anysolidorviscoussubstancesinquantitiesorofsuchsizeorspecificgravityaswouldbecapableof
causing obstructions to the flow in any sewerage system or other interference with the proper
operation of sewage / storm water / liquid waste water system such as, but not limited to ash,
cinders, dust, clay, mud, straw, glass, rags, feathers, plastics, lime slurries and residues, pulp and
paper,millwastes,garbage,paperdishes,cups,foodcontainersetc.eitherwholeorgroundedetc.

Any soluble substances in such concentration as to increase the viscosity of the water or greater
than1.10specificviscosity.

Anywatersorwastescontainingtoxic,poisonous,solids,liquidsorgaseousmaterialsinsufficient
quantity either singly or by interaction with other wastes likely to injure or interfere with any
waste water treatment processes, constitute a hazard to humans or animals, create a public
nuisanceorcreateanyhazardinthereceivingwaters,includingbutnotlimitedto
(1) Cyanidesinexcessof0.2mg/lasCN
(2) Hexavalentchromiuminexcessof1.0mg/lasCr.
(3) Totalironinexcessof3.0mg/lasFe.
(4) Copperupto3.0mg/l.
(5) Zincupto15mg/l.
(6) Leadupto1.0mg/l.
(7) Nickelupto2mg/l.
(8) Phenols or other tastes and odour producing substances in concentrations in excess of 0.005
mg/l.

Anyradioactivewasteshallnotexceedthefollowinglimits
Radioactivematerial
(i)

Alpha

(7)

EmittersMaximum:1.0mc/ml
(ii)

Beta

(6)

EmittersMaximum:1.0mc/ml

Anymalodorousgasesandacetylenegenerationsludge.

Anywaterorwastewatercontainingsulfides,sulphurdioxide,nitrousoxideoranyofthehalogens
exceeding10mg/linconcentration.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

193|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

Anywaterorwastecontainingsulphatesinexcessof1000mg/linconcentration.

AnywaterorwastehavingBODmorethan300mg/l.

Anywaterorwastehavingaveragesuspendedsolidsmorethan600mg/l.

Anywaterorwastehavingdissolvedsolidsinexcessof2100mg/linconcentration.

Any water or waste containing the following elements in excess of respective concentration
mentionedagainsteach.
ELEMENTS

STANDARDMG/L

Chloride(ascl),max

600

Fluoride

15

AmmoniaNitrogen(asN),max

50

Percentsodium,max

60

Boron(asB)max

FreeAmmonia(asNH)

Pesticide

Absent

Arsenic(asAs)

0.2

Mercury(asHg)

0.01

Cadmium(asCd)

28.9.
Noperson,industry,organizationoranyotherestablishmentinDSIRDAareashalldischargeorcausedto
discharge substances, materials, waters or wastes, if it appears likely in opinion of DSIRDA that such
wastesare
notamenabletosatisfactorytreatment

harmfuleithertosewerage/drainagesystem,wastewatertreatmentprocessorequipment
/totheenvironment

havinganadverseeffectonthereceivingstreamor

causingdangertolife,limbs,propertyorconstituteanuisance

28.10.
Ifanywatersorwasteswhicharedischargedorareproposedtobedischargedinthesewerage/drainage
systemofDSIRDA,containthesubstancesorprocesscharacteristicsandwhichinthejudgmentofDSIRDA
mayhaveadeleteriouseffectuponthecollection,treatmentsystems,processes,equipmentorreceiving
waterbodiesorwhichotherwisecreateahazardtolifeorconstituteapublicnuisance,theDSIRDAmay
a) Rejectthewastes
b) Requireprimaryandsecondarytreatmentinaprivatewastetreatmentsystemtoanacceptable
levelforsafedischargetotheDSIRDAsystem.
c) Require provision of flow equalizing facilities for control over the quantities and rates of
dischargetoavoidunusualvolumesorfloworconcentrationofwaste,constitutingslugs.
d) Requirepaymentofsurchargeasdetailedbelowin(28.11).

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

194|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
28.11.
ThepermissionasperregulationswillbegivenbyDSIRDAonpaymentofsurcharge,inadditiontotheusual
changes and it shall be liable to be withdrawn on 3 months notice. The rates for surcharge etc. will be
decidedbyDSIRDAfromtimetotime.

28.12.
For any person, organization, industry, production / manufacturing unit or any other organization in
DSIRDAarea,usingwaterof1000m3/dayormore,shallhavetocarryoutthefollowing
Atleast30%oftotalwaterusagebyeachoneunit,(tobeachievedattherateof10%everyyear,
subjecttototal30%within3yearsofstartingoperations),shallreusetherecycledwastewater,
eithersuppliedbyDSIRDAorthroughprivateagency(ies)fornonpotableandnoncontactusesin
their premise(s). In case, due to certain reasons of process requirements etc. if this is not
feasible,specialpermissionshallhavetobesoughtfromDSIRDAwithcompletedetailsanddata
forthesame.

28.13.
Anyperson,industrial/processing/manufacturing unitoranyotherestablishmentinDSIRDAareashall
have full waste treatment facilities of their sewage / industrial waste water (in case there is water
consumptionofsuchunitwillbe1000m3/dayormore)intheirarealikesegregation/sedimentation/
equalization / neutralization / screening / oil and grease removal as well as primary and secondary
biologicalwastetreatmentfacilitiesoranysuchunitsetc.asmaybenecessaryattheirowncostandshall
have to operate and maintain continuously and effectively at their expense, conforming to the
prescribed standards, before discharging (if and when permitted by DSIRDA) to the main sewerage /
wastewatercollectingsystem.ThequalityoffullytreatedeffluentshallbeprescribedbyDSIRDAand/or
GPCBfromtimetotime.

28.14.
Theownerofanypropertycreatingsewage/industrialwastewatershallprovidesuitablecontrolmanhole
(structure / arrangement) together with such necessary appurtenances to facilitate to take test samples
andmeasurethevolumeofwastewaterbeingdischarged.Suchfacilitieswhenrequiredshallbeaccessible
at all times to DSIRDA. In a default of the owner to install and maintain a control system alongwith
necessaryappurtenanceswithinonemonthofwrittennoticefromtheDSIRDAtodoso,thelattershallbe
entitled to estimate the quality and quantity of waste water in any manner or method practicable for
computingthevolumeofthesurchargeofwastewaterandthepresenceofobjectionableconstituents,laid
downintheseRegulationNo.8,9,10and11above.

28.15.
Waste water sampling shall be carried out to reflect the effect of constituents of waste water upon the
sewerage as well as sewage treatment processes, equipment, material etc. and also to determine the
adverseandhazardouseffectstolife,propertiesandtotalenvironmentalso.Thewastewateranalysisshall

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

195|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
be carried out on grab samples and / or composite samples based on 24 hours collection, as decided by
DSIRDA.

28.16.
All samples shall be collected in the presence of representatives of all the concerned parties and be
analyzedbytheapprovedlaboratoriesofGPCBand/orDSIRDA.Alltestsandanalysisoftheparametersof
collected samples of waste water shall be carried out in accordance of the latest edition of Standard
Methodsfortheexaminationofwater,sewageandindustrialwastespublishedjointlybytheAmerican
Public Health Engineers Association, the American Water Works Association and the Water Pollution
Control Federation. However, the use of identified analytical procedures, outlined by WHO or ISI of
GovernmentofIndia,fromtimetotime,wheneversuchproceduresexist,willalsobepermitted.

28.17.
TheDSIRDAmayatanytimebeforeorafterissueofpermitorgrantofconnection,runadditionalsampling
and analysis of sewage / waste water being discharged by any industry, unit or establishment over such
period,asitmaybefoundnecessary,costofsuchtestsshallbebornebytheDSIRDA.

28.18.
Intheeventofsuchtests,showinghigherdegreetopollutionthanpermissibleundertheseregulations,the
abovesurcharge,ifanytobepaid,shallbecomputedonthebasisoflatesttest(s)andshallbeleviedfrom
thebillingperiodinwhichthetestsarecarriedout.IfanysuchtestsbyDSIRDAshallshowreduceddegree
ofpollutioninthewastewatersufficienttoexemptfrompaymentofsurcharge,thesameshallbeeffective
fromthenextbillingperiod.

28.19.
Iftheownerisoftheopinionthatforanyreason,thenatureofsewage/industrialwastewaterpresently
beingdischargedintothecollectingsystemhasasubstantiallylesseneddegreeofpollutionthanasshown
bythepriortests,hemayrequesttheDSIRDAtocarryoutnewtests,morethanonceineachbillingperiod
athisowncosts.SuchnewtestswillbecarriedoutbytheDSIRDAatitsdiscretionwithin3monthsfrom
thedateofapplication.IftheDSIRDAissatisfiedthatsuchnewtestswerecarriedoutwhentheplantwas
runningundernormalconditions,theresultsofthelatesttestsshallbeadoptedincomputing/exempting
fromthesurcharge.

28.20.
Authorized personneloftheDSIRDAshallbepermittedtoallpropertiesoftheownerforthepurposeof
inspection,observationoftheseregulationsandhavingdirectbearingonthenatureandsource(s)ofwaste
waterdischarge.

28.21.
Anyperson,unit,establishmentfoundtobeviolatinganyprovisionsoftheseregulations,shallbeservedby
the DSIRDA with written notice stating the violation and providing a reasonable time limit, not less than

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

196|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
onemonth,forsatisfactorycorrectionthereof.Theoffendershallwithintheperiodoftimelimitstatedin
suchnotice,permanentlyceasealltheviolations.

28.22.
Any person, unit, establishment who shall continue any violation for these regulations, shall be liable for
prosecutionandwillbepunishedwithafine,whichmayextendtoRs.500/foreachviolationandincase
ofacontinuingbreachtoRs.50/dayafterthedateoffirstconviction.

28.23.
Anyperson,unit,establishmentviolatinganyoftheprovisionsoftheseregulationsshallbecomeliableto
theDSIRDAforanyexpenses,lossordamagedoccurredtoDSIRDAbythereasonofsuchviolationandshall
beliabletosuspension,revocationorcancellation,ifpermissionsweregrantedundertheregulations.

28.24.
Shouldanycourtofcompetentjurisdictiondeclareanyprovisionofthisregulationultravires(beyondones
legalpowerorauthority),thenthedecisionshalleffectonlysuchprovisionsodeclaredtobeultraviresand
shallnotaffectanyotherprovisions.

28.25.
TheseregulationsshallbesubjecttomodificationfromtimetotimeasrequiredbyGPCBand/orDSIRDA.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

197|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
29. SpecialRegulationsforHospital
29.1. ShortTitle,ExtentandCommencement

Shall be applicable within the jurisdiction of DSIRDA constituted under GSIR Act 2009 and
GTPUDAct1976

29.2. Applicability

TheseregulationsshallapplytoanyHospitalbuildingsproposedundertheseregulations.

29.3. Definition
29.3.1. Act
meansGujaratSpecialInvestmentRegionAct2009&GujaratTownPlanning&UrbanDevelopmentAct
1976.
29.3.2. AppropriateAuthority
meansauthorityasdefinedunderAct
29.3.3. CompetentAuthority
meansanyperson/personsorauthorityorauthorities;authorizedbythePrescribedOfficerasthecasemay
betoperformsuchfunctionsasmaybespecifiedundertheseregulations.
29.3.4. Developer
meansandincludeaowner/person/persons/registeredsociety/association/firm/company/joint
ventures/institution/trustsentitledtomakeanapplicationtodevelopanyhospitalityproject;
29.3.5. Escaperoutes
meansanywellventilatedcorridor,staircaseorothercirculationspace,oranycombinationofthesame,
designedforthepurposeofevacuationandbymeansofwhich,theoccupantscanreachtosafeplacein
theopenairatgroundlevel.
29.3.6. FloorSpaces
meansthesumoftheareaofeachfloorcalculatedforthepurposeofFAR;
29.3.7. Fireescapestairwaysandroutes
meansescaperoutesdesignedandplacedasadvisedandapprovedbythefireofficer;
29.3.8. FireOfficer
meanstheChieffireofficeroftheCompetentAuthority;
29.3.9. GDCR
means the prevalent General Development Control Regulations applicable for the relevant appropriate
authority.
29.3.10. EntranceCanopy
meansthecanopyatthemainentrance.
29.3.11. Atrium(pluralatria)
meansalargeopenspace,generallygivethebuildingafeelingofspaceandlight,oftenseveralstorieshigh
andhavingasoftroofing/glazedroofand/orroofingofanymaterialforsafetyfromweather,butnotto
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

198|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
give a space / support for any activity to be carried above it, often situated within an office building,
shoppingarcade,shoppingcentre,andlocatedimmediatelybeyondthemainentrance.
29.3.12. RefugeArea
meansanareadesignedandprovidedatvariouslevelsorfloorsinthebuildingasperrequirementsinNBC,
toholdoccupantsduringafireoranyotheremergency.
29.3.13. Hospital
meansunderSingle Management,any buildingor groupofbuildingsormultiplebuildings consistingof a
complexaccommodatingfacilitiestoprevent,treat,andmanageillnessandthepreservationofmentaland
physical wellbeing through the services offered by the medical and allied health professions including
researchandhealthclubandphysiotherapycentres.
29.3.14. GlobalFAR
meansFARpermissibleundertheseregulationsirrespectiveofthezone.
29.3.15. Zone
meansthezoneasdesignedintheprevalentsanctioneddevelopmentplanoftheappropriateauthority.

29.4. DutiesofDSIRDA:
Forthepurposeoftheseregulations,thecompetentauthorityshall;

Within30daysfromthereceiptoftheapplication,recommendtotheapexauthoritytoapprove
orrefusetheproposal;

Maydeny,aftergivingreasonsinwriting,iftheproposalformsapartofanynotifiedwaterbody
oranydifficultarea;

May recommend to the government to allow the benefits available under any scheme of the
stateorcentralgovernment;

29.5. ProcedureforSecuringthePermission:

SubjecttotheprovisionsoftheseregulationsandtheGDCR,anydeveloperintendingtodevelop
under special planning provisions of these regulations shall apply to the competent authority
undersection26oftheAct,1976,alongwiththerequireddocumentsandshallforwardcopyto
theStateGovernment.

TheStateGovernmentshallundersection29(1)(ii)takedecisionandmakenecessaryorders.In
accordancetosuchorderstheauthorityshallgrantpermission.

With regard to procedure to be followed the manner of application, the documents to be


submitted along with the applications, the protocols of drawings to be submitted, etc. unless
otherwise prescribed, the provisions of GDCR of the appropriate authority shall apply mutatis
mutandis.

29.6. PlanningProvision
1.

FloorAreaRatio:
2.1

Irrespectiveofanyzone,permissibleFloorAreaRatio(FAR)undertheseregulationsbeas
under:

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

199|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
2.2

MaximumFARshallbeasunder

5
4
3

MAX
GROUND
COVERAGE
010%
Above1020%
Above2030%

MAX
HEIGHT*
(M)
150m
126m
32m

MINIMUMSETBACKS
(FRONTREARBOTH
SIDES)
10m8m6m6m
9m7m6m6m
8m6m6m6m

1500sqm

2.5

40%

20m

8m6m6m6m

1500sqm

40%

16m

8m6m6m6m

MINROAD
ROW(M)

MIN.PLOT
SIZE

MAX
FAR

55m&
above

5000sqm**

25m&
Below55
Below25m

** For Plot sizes of 5000 sqm and above In case of a building with podium and tower, a ground coverage of

maximum 40% will be allowed for a maximum height upto 8 m, including G or G+1 whichever is less. The upper
typicalfloorsabovepodiumwillhaveamaximumplanareaof10%.ThemaximumFARallowedinthiscasewillbe5.

2.3

TheFARonanyplotshallbethesumoftheGlobalFARandPremiumFARwhere
o

GlobalFAR(GFAR)shallbe

0.6inanyareaor

Permissible FAR in any zone, not having premium and applicable for
residentialuse.

PremiumFloorAreaRatio(PFAR).PFARshallbeavailableonpaymentforthearea
at40%oflandjantriratestothecompetentauthority.

2.4. ThebuiltupareaoffollowingshallbeexcludedfromthecomputationoftheFAR:
o

Basementandotherfloorsusedfortheparking;

RefugeareaasrequiredasperNBC;

EntranceCanopyarea;

Atrium;

Fireescapestairwaysandroutes,Escaperoutes,

Rampsleadingtoparkingspacesoranyotherfloors;

ControlroomforsecurityandFireControl

Equipment / Air Handling Rooms (AHU) for air conditioning and ventilation
requirements.

2.

EntranceCanopy,PorchandLiftfortheaccesstoparking,atthegroundlevelshallbepermitted.
Suchcanopymaybepermittedtobeonraisedlevelnotexceeding2.5m

3.

Oneachfloor,forsafetyemergencyexit,provideescaperoutesandrefugeareas,onlocationsas
requiredindesign.

4.

Therefugeandtheescapeareashallberegulatedasunder:
o

Toholdoccupantsduringafireorterrorattackoranyotheremergencyuntilrescued;

RefugeAreashallberegulatedasunder:

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

200|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

5.

Oneormorerefugespaces,notnecessarilybecontiguousbutconnectedwithescape
routes;

Minimumareaof15sqmandaminimumwidthof3.0m.

Atleastonerefugespacebeprovidedforevery6floorsorpartthereof;

Therefugeandtheescapeareashallbedesignedforsafetyoftheoccupants;

DesignofrefugeareashouldcomplywiththeprovisionsofNBC

MarginsandBuiltuparea:
6.1 NotwithstandinganythingcontainedinGDCR,marginsshallberegulatedasunder:
a. Nothing except cabin and structures related to security may be permitted in the
margins;
b. Vehicleliftsshallbepermittedwithinthemarginspaces.Howeveraclearmarginof9.0
minthefrontand3.5monothersidesshallhavetobemaintained.
6.2 BuiltupArea:Builtupareashallberegulatedasunder;
o

45%incaseoflowrisebuildingand30%incaseofHighrisebuilding

6.3 Area under the atrium shall not be considered while calculating the ground coverage and
builtuparea;

Providedthat;
a. Suchareaundertheatriumshallnotexceed40%ofthegroundcoverage;
b. No intermediate covered spaces at any floor shall be permitted in the area under the
atrium;
c. Only elevators, Reception counter, inquiry counter spaces for sitting and circulation
lobbiesshallbepermittedundertheatrium;
d. Projection in margin in GDCR shall apply mutatis mutandis to projections within the
atrium;
7. HeightofBuilding
a. Higher than that permitted under the GDCR shall be known as additional height. The
Additionalheight(AH)shallberegulatedasunder:
b. Maximumheightof70mshallbepermitted;
a) AHshallbepermittedonpayment.Suchpaymentshallbebasedonapplicablerates(AR),
whichwouldbeequivalentto15%ofthelandjantrirates.
b) Thecalculationshallbeasunder:
i. Forindividualfloors,multiplythefloorareaforwhichAHisaskedforwithAR;or
ii. For building, multiply the sum of the floor area of all the floors which are above the
permissibleheightwithAR;

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

201|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
c. AdditionalFloortoFloorHeightmorefloorheightthenasprescribedinGDCRforpublicareas,
plant rooms, banquets, ball rooms, restaurant, entrance canopy / porch, entrance lobby,
basementscanbeavailedonpaymentasperabovesubclauses.
8. Basements
8.1 Thefollowingmaybepermittedinthebasements:

8.1.1

Parkingonmorethanonelevel;

8.1.2 Space for services which may include, electric cabin, substation, A.C. plant room, boiler,
housekeeping,roomsforthecaretakers,morgue,collectionofwaste,suchasbiomedical,plastic,
paper,glass,diagnostics,etc.,centrallaundry,CSSDchangeroom,libraryroom,restroomforthe
reservestaff.Howeversuchservicesshallonlybepermittedononelevelofbasement.Suchuses
shallstrictlybeancillarytotheprincipaluse.Howevertheseareasshallnotexceed20%ofthetotal
basementareaandforsuchareapaymentattherateof5%ofthejantrishallhavetobemade.

8.1.3. Securitycabinsmaybepermittedateverylevelofbasement;

8.1.4. Basementsmaybepermittedinthemarginalspaces,howeverforthesafetyrequirements.
Itshallnotbepermittedin3mwideareaalongtheperimeterofthebuildingunit;
9. Parking,MovementandMobility(PMM)shallberegulatedasunder
9.1 Parkingshallbepermittedonanyfloor/basementsatanylevels;
9.2 Parking shall not be insisted at Ground level or as surface parking. However parking for
physicallychallengedpeopleshallhavetobeprovidedongroundlevel;
9.3 Ramp leading to parking place may be permitted in margins after leaving all around the
building,minimum3.5mwidespace.
9.4 Minimumparkingequivalentto50%oftheconsumedFARshallbeprovided;
9.5 Theparkingcanbeprovidedinoneormorelots.Howeveritshallhavetobeprovidedwithin
thesamebuildingunit;
9.6 Access for private cars, cyclists, pedestrians, service vehicles, emergency vehicles and public
utilityvehiclesshallbedesignedforsafetyandconvenience;
9.7 AccessPointsontopublicroadsshouldbelocatedanddesignedinsuchawayastominimize
traffichazards,queuingonpublicroads.
9.8 Oneachfloorminimumofoneservicecorridorofminimum2.5mtswidthhavingaccessfrom
eachfloorandisconnectedtotheliftshallbeprovided;

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

202|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
29.7. StructureSafety
29.7.1. Structuresafetyregulationsasperannexure1shallbeapplicable

29.8. MiscellaneousProvisions
29.8.1. Liftsplanninganddesign:TheplanninganddesignofliftsshallbeinaccordancewithNational
BuildingCodeofIndia.
29.8.2. Ecofriendly Practices (a) Sewage Treatment Plant (b) rain water harvesting (c) waste
management (d) pollution control method for air, water and light (e) introduction of non CFC
equipmentforrefrigerationandairconditioning.
29.8.3. Provisionsreuseofwater(annexure2),solarwaterheating(annexure3)shallbeapplicable.
29.8.4. ThebuildingshallpreferablybedesignedasperEnergyConservationBuildingCode.
29.8.5. For public safety, in consultation with security experts, CCTV Cameras, Night vision devices,
Motion sensors, Control Room, Refuge Areas, escapes routes, etc. shall be included in building
planning&designandbeinstalledoncompletion
29.8.6. Whereevernotmentioned,theprovisionGDCRshallapplymutatismutandis.
29.8.7. Hospitalunderthisprovisionshallbepermittedinanyzoneinthedevelopmentplan.
29.8.8. Providedthatsuchpermissioncanbedeniedbythegovernmentonaccountofsafety
29.8.9. Even after approval under these regulations, permissions from Airport Authority of India,
DepartmentofForestandEnvironmentforEIAclearance,andallotherrelevantdepartment,as
required,shallbemandatory.
29.8.10. The structural safety of the building shall be the responsibility of the developer. The developer
shall, at his cost, get an audit of Structural Stability and Safety through any independent
Competent Authority or a Structural expert of adequate experience and good reputation
identifiedandadvisedbythecompetentauthority.
29.8.11. Deductionasdecidedbythecompetentauthorityshallbeapplicableincasewheretheplotsare
notthepartoftheTownPlanningSchemearea.
29.8.12. FiresafetyprovisionshallbemadeinaccordancetoGDCR
29.8.13. EntranceCanopy,PorchandLiftfortheaccesstoparkingatthegroundlevelshallbepermitted.
Suchcanopymaybepermittedtobeonraisedlevelnotexceeding2.5mts.
29.8.14. Oneachfloor,forsafetyandemergencyexit,provideescaperoutesandrefugeareas,asperNBC
29.8.15. Forpoorandmiddleclasspatients,10%ofthetotalnos.ofbedsshallbedesignatedand30%of
thedecidedratesshallbecharged.Thecompetentauthorityshallmonitortheimplementation.

29.9. SpecialPlanningProvisions(SPP)Where4.0orMoreFARIsGranted:
29.9.1. MinimumrequirementsoftheHospitalshallbeasunder;
1. 100beds
2. Twooperationtheatres,ICU,Codeblueroom
3. Designated Space for Teaching, Research & Library facilities, centralized sterilization facilities,
indoor pharmacy & dispensing pharmacy, Housekeeping facilities and Lenin room, Cafeteria /
Restaurant,Indoorcateringfacilities.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

203|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
4. CompulsoryHVAC(centralizedairconditions)systemsforICU,operationtheatres&othercritical
facilities.
5. DesignatedareaforGasmanifold&pipedsupplyofMedicalGas.
6. Staking,materialreceivingareas
7. Powerbackupforcriticalfacilities&onconventionalenergyuseshallonlybecompulsoryincase
noncriticalfacilities;
8. ThedesignshouldcomplywithWHOstandardsorequivalent
9. WastemanagementasperGSPCrules.

Annexure1
StructuralSafetyandService
1. StructuralDesign
The structural design of foundation, elements made of masonry, timber, plain concrete, reinforced
concrete, perstressed concrete and structure steel shall conform to the provisions of part VI Structural
Design Section1 Loads, Section2 Foundation, Section3 Wood, Section4 Masonry, Section5 Concrete,
Section6 Steel, National Building Code of India, taking into consideration the Indian Standard and
Guidelinesforhazardsafetyasgivenbelow:
a. ForEarthquakeProtection
i.

IS:18931894CriteriaforEarthquakeResistantDesignofStructures(FourthRevision).

ii. IS:139201993DuctileDetailingofReinforcedConcreteStructuresSubjectedtoSeismicForces
CodeofPractice.
iii. IS: 43261993 Earthquake Resistant Design and Construction of Building Code of Practice
(SecondRevision).
iv. IS:138281993improvingEarthquakeResistanceofLowStrengthMasonryBuildingsGuidelines.
v. IS:138271993improvingEarthquakeResistanceofEarthenBuildingsguidelines.
vi. IS:139351993RepairandSeismicStrengtheningofBuildingsGuidelines.
vii. Improving Earthquake Resistance of Buildings guidelines, by Expert Group, Government of
India, Ministry of Urban Affairs & Employment, published by Building Materials and technology
PromotionCouncil,1998.
b. ForCyclone/WindStormProtection.
i.

IS 875 (3)1987 Code of Practice for Design Loads (other than Earthquake) for Buildings and
Structures,Part3,WindLoads.

ii. ImprovingWind/CycloneResistanceofBuildingsGuideline,byExpertGroup,Governmentof
India, Ministry of Urban Affairs & Employment, published by Building Materials and technology
PromotionCouncil,1998.

Note:WhereveranIndianStandardIncluding those referredintheNational BuildingCodeorthe


NationalBuildingCodeisrefereed,thelatestversionofthesameshallbefollowed.

iii. In pursuance of the above a certificate as indicated in Form2(C) shall be submitted along with
buildingplans/drawingsandotherinformationscheduleannexedthereto.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

204|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
2. QualityControlRequirements
i.

The quality of all materials and workmanship shall conform to accepted standards and Indian
Standard Specifications and Codes as included in Part V Building Materials and Part VII
ConstructionalPracticesand Safety,NationalBuildingCodeofIndia.

ii. Allborrowpitsduginthecourseofconstructionandrepairofbuildings,embankmentsetc.shallbe
deepandconnectedwitheachotherintheformationofadraindirectedtowardsthelowestlevel
and properly stepped for discharge into a river, stream, channel or drain, and no person shall
createandisolatedborrowpitwhichislikely to cause accumulation of water that may breed
mosquitoes.
iii. Alternativematerials,methodofdesignandconstructionandtests:

TheprovisionsoftheRegulationsarenotintendedtopreventtheuseofanymaterialormethodof
designofconstructionnotspecificallyprescribedinthemprovidedanysuchalternativehasbeen
approved. Nothing of the provisions of these Regulations is intended to prevent the adoption or
architectureplanningandlayoutconceivedasanintegrateddevelopmentscheme.TheCompetent
authoritymayapproveanysuchalternativeifitconformstotheprovisionsoftherelevantpartsof
theNationalBuildingCode,regardingmaterial,design and construction, and the material,
method,orworkofferedis,forthepurposeintended,atlastequipmentto
that prescribed in
these Regulations in quality, strength, compatibility, effectiveness, fire and water resistance,
durabilityandsafety.
iv. Allbuildingsshallbeconstructedonaqualitycontrolrequirement.
v. In case of existing building under construction based on approved building permission, structural
safety requirements shall have to be observed. However, due to such structural works of
strengthening / retrofitting certain setbacks and margin get reduced, special permission may be
grantedoncasetocasebasis.
3. Tests
WheneverthereisinsufficientevidenceofcompliancewiththeprovisionsoftheRegulationsorevidence
that any material or method of design or construction does not conform to the requirement of the
Regulations,inordertosubstantiateclaimforalternativematerials,designormethodsofconstruction,the
Competentthesetests,shallbemadebyanapprovedagencyattheexpenseoftheownerasfollows:
i.

TESTMETHODS:TestmethodsshallbeasspecifiedbytheRegulationsforthematerialsordesign
or
construction in question. If there are no appropriate test methods specified in the
Regulations,theCompetentAuthorityshalldeterminethetestprocedure.Formethodsortestsfor
building materials, reference shall be made to the relevant Indian Standards as given in the
NationalBuildingCodeofIndiapublishedbytheBureauofIndianStandards.

ii. TEST RESULT TO BE PRESERVED: Copies of the result of all such tests shall be retained by the
competentAuthorityfornotlessthantwoyearsaftertheacceptanceofthealternativematerial.
Thetestingofthe materialsasperIndianStandardsshallbe carriedout bylaboratoriesapprovedbythe
competentauthorityonthisbehalf.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

205|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Thelaboratory/agencyshallworkoutinconstructionwiththeconstructionagencyatestingprogrammeof
materialssuchascement,steelandqualityofconcreteincludingitsmixing,layingandstrengthatsiteas
wellasinthelaboratory.
This should cover various stages of construction from foundation to completion as per Regulation. The
laboratoryshallmaintainadulyauthenticatedreportinaboundregister,copyofwhichwillsubmittedto
theconstructionagency,whichwillinturnforwardthetestingreporttothecompetentauthority.
4. StructuralStabilityandFireSafetyofExistingBuildings
i. TheCompetentAuthorityshallhavetheassessmentofstructuraland/orfiresafetyofanexisting
building / structure damaged / undamaged carried out at stipulated periodical intervals through
expert(s)chosenfromapanelofexpertsidentifiedbytheCompetentAuthority.

ii. Theowner/developer/occupantonadviceofsuchexpert(s)shallcarryoutsuchrepair/restoration
and strengthening / retrofitting of the building found necessary so as to comply with the safety
standardslaiddownintheNationalBuildingCodeandtheIndianStandardasspecified.
Incase,theowner/developer/occupantdonotcarryoutsuchaction,thecompetentauthorityor
anyagencyauthorizedbythecompetentauthoritymaycarryoutsuchactionatthecostofowner/
developer/occupant.

iii. TheCompetentAuthorityshallspecifytheperiodwithinwhichsuchcomplianceistobecarriedout.
iv. TheCompetentAuthoritymayalsodirecttheowner/developer/occupant,whetherthebuilding
couldbeoccupiedornotduringtheperiodofcompliance.
v. In case of existing building under construction based on approved building permission, structural
safety requirement shall have to be observed. However, due to such structural work of
strengthening/retrofittingifcertainsetbackandmargingetreduced,specialpermission.
Thestructuralsafetyofthebuildingshallberesponsibilityofthedeveloper.Thedevelopershall,athiscost,
getanauditoftheStructuralStabilityandSafetythroughindependentCompetentAuthorityoraStructural
expertofadequateexperienceandgoodreputationidentifiedandadvisedbythecompetentauthority.

Annexure2
RegulationforReuseofwater
1. Definitions
1.1. 'domestic waste water' means either water that is typically discharged from premises that are
usedsolely for residential activities or waste water of the same character discharged from
otherpremises.
1.2. 'greywater'meansinvolvingnonpotablewaterfromsinks,tubs,showersandwashing.
1.3. 'Pretreatment' means any processing of industrial waste or waste designed to reduce any
characteristicinwaste,beforedischargetothewastewatersystem.
1.4. 'premises'meanseither
a. Apropertywhichisheldunderaseparatecardoftitleorforwhichaseparatetitlecardmaybe
issuedandinrespecttowhichabuildingplanshavebeenormaybeissued,orabuildingwhich

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

206|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
isinpossessionasanindividualunitbyacrosslease,unittitleorcompanyleaseandforwhich
acertificateoftitleisavailable,or
b. Landheldinpublicownership,foraparticularpurpose,or
c. Separatelyassessedtolocalauthoritytaxes,individualunitwithinbuilding.
1.5 'Nonportablewatermeanstheuseofwaterfornoncontactuses,nondomesticconsumptionlike
carwashing,toiletflushing,gardening,constructionpurposes,landscaping,dripirrigationoftrees
/ shrubs, sub surface irrigation of lawns and recharge of ground water & uses is for bidden by
virtueofpowersvestedwithgovernment.
1.6 'Prohibitedindustrialwaste'meansaindustrialwastehavingphysicalandchemicalcharacteristics
inexcessasdecidedbyGPCB.
2. Applicability:
Reuseofwatershallbeprovidedincaseoffollowingcategoriesofbuilding.
2.1. Allnewbuildingsunderthefollowinguse
a) Anylowrise/highrisebuildinghavingnumberofunits10ormoreorhavingtotalbuiltuparea
morethan750sq.meters
b) HospitalandNursinghomes
c) Hotels,Lodgesandguesthouses
d) Hostelsofschools,Colleges,Trainingcentres.
e) Barracksofarmedforce,paramilitaryforcesandpolice
f) Individualresidentialbuildingshavingmorethan150sqmeterplintharea
g) FunctionalbuildingsofRailwaystationsandAirportlikewaitingrooms,retiringrooms,restroom,
inspectionbungalowsandcateringunits
h) Communitycentres,Banquethall,andbuildingsofsimilaruse
i) Commercialestablishmentshavingtotalbuiltupareaof2000sqmetersormore.
j) Allhazardous/waterpolluting/Chemicalindustries
Note:Incaseofcategoryofmentionedinb,c,g,h&jaboveitshallnotbemandatorytoprovidethe
assistedheatingsystem.
2.2. Exemptionscouldbeaccordedunderfollowingcircumstances,asdecidedbytheauthority;
a. in case the existing premises cannot permit the provision of additional overhead tank for the
purposeoftheuseoftreatedwater.
b. If, in the existing structure, there is no space for installation of treatment facility and collection
chamber.
c. Inexceptionalcasesduetodearthoflandorwaterloggedareasexempt(withtheapprovalfrom
competentauthority)fromprovidingfacilityforrecyclingthegreywater.
3. InstallationoftheSystemfortheReuseofwater
3.1. NewBuilding:Clearanceofplanfortheconstructionofnewbuildingsoftheaforesaidcategoriesshall
onlybegiveniftheyhaveaprovisioninthebuildingdesignitselffor:
3.1.1.

Every developer / builder shall provide with the provision of down take plumbing for grey
water,recyclingwaterplant,storageandreusefittinginpurplecolour.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

207|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
3.1.2.

Provideadditionalarrangementsforcarryingtheexcessgreywatertotheseweragesystem
mayalsobeprovided

3.1.3.

Nonuisanceoffoulgases/publichazardoranyotheraspectendangeringlife

3.1.4.

There shall not be crossconnection of fitting of the potable and not potable water at any
point. The recycled water system shall be maintained at a lower operating pressure that of
the portable water system. Precautions should be taken at the makeup connection to
preventcrosscontamination.

3.2. Oldbuildings:Incaseofadditionsandalterations,systemsfortheReuseofwatershallbeprovidedin
accordancetotheseregulations.
4. Qualityofwater,treatment&specification:
4.1. Thewaterqualityshallconformtostandardofnonportablewater.Therecycledwatershallbetested
onceinsixmonthsandresultsshallbemadeavailabletocompetentauthoritywheneverdemanded.
4.2. Everyexistingbuilding/residentialstructureshallprovidewiththeprovisionofrecycledwaterplant
andrelevantadequateseparateplumbingforgreywaterandreusefitting
4.3. Thetestingofwastesandthesubmissionoftheresultsshallbedoneinamannerinaccordancewith
thetermsandconditionsprescribedbytheMunicipalCommissionerortheGujaratpollutioncontrol
board/thecompetentauthority.
4.4. InstallationsforReuseofwatershallconformtorelevantcodesofpractices
5. GeneralProvisions:
5.1. Mandatorydisclosure:Anoccupier/ownerofpremisesshallinformthecompetentauthorityofany
changeinthequality,natureofthewastesdischargedfromhisplantorpremises,themanneroftheir
dischargeofwaterlikelytocausevariationsorviolationundertheseregulations.
5.2. Correctiveaction:Intheeventitisfoundanypersonviolatingtheprovisionsoftheseregulations,the
competent authority shall issue notice and after inquiry and personal hearing take necessary
correctiveaction.
5.3. Rebate:Thecompetentauthoritymaysatisfyitselfontheperformanceofrecyclingofthewaterand
thereaftercangiverebateonthetaxes/feesleviableforthedevelopment.Thecompetentauthority
maygivesuchrebateonthecapitalorrecurringrecoverieswhichthedeveloperisliabletopay.
5.4. DisputeResolution:Allthedisputesarisingintheenforcementofthisbytheserulesshallbereferred
to Municipal Commissioner who in turn will resolve the disputes in advise with his authorized
technicalofficeroranyexpertsandintimatetotheoccupier/builder/developer.Thedecisionofthe
competentauthoritywillbefinalandbindingontheoccupier.
5.5. ListofAuthorizedLaboratoriesshallbeasauthorizedbyGujaratStatePollutionControlboardorthe
MunicipalCorporation

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

208|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Annexure3
RegulationregardingInstallationsofsolarassistedwaterHeatingSystem.
1. Solarassistedwaterheatingsystemshallbeprovidedincaseoffollowingcategoriesofbuildings.
a. Hospital&NursingHomes.
b. Hotel's,LodgesandGuestHouses.
c. Hostelsofschools,colleges,trainingcentres.
d. Barracksofarmedforces,paramilitaryforcesandpolice.
e. Individualresidentialbuildingshavingmorethan150.00sqmtplintharea.
f.

Functional buildings of railways stations and airports like waiting rooms, retiring rooms,
restrooms,inspectionbungalowsandcateringunits.

g. Community centres, Banquet Hall, Barat Ghars, KalyanMandaps, and Buildings for similar
use.
Note: in case of category of mentioned in e above it shall not be mandatory to provide the solar
assistedheatingsystem.
2. Nonewbuildingsinthecategorymentionedin'1'aboveinwhichthereisasystemorinstallation
forsupplyinghotwatershallbebuiltunlessthesystemortheinstallationisalsohavinganauxiliary
solarassistedwaterheatingsystems.
Schedule
1. Definitions:
i

SolarAssistedWaterHeatingSystem : adevicetoheatwaterusingsolarenergyasheat
source.
ii Auxiliarybackup
: Electricallyoperatedorfuelfiredboilers/systemsto
heatwatercomingoutfromsolarwaterheating
systemtomeetrequirementofhotwater.
iii NewBuilding
: Suchbuildingofabovesaidcategoriesforwhich
constructionplanshavebeensubmittedtocompetent
authorityforclearance
iv ExistingBuilding
: Suchbuildingwhicharelicensedtoperformtheir
respectivebusiness.
2. InstallationofSolarWaterHeatingSystem
a) NewBuildings:Clearanceofplanfortheconstructionofnewbuildingsoftheaforesaidcategories
shallonlybegiveniftheyhaveaprovisioninthebuildingdesignitselfforaninsulatedpipelinefrom
the rooftop in the building to various distributions from the rooftop in the building to various
distributionpointswherehotwaterisrequired.Thebuildingmusthaveaprovisionforcontinuous
watersupplytothesolarwaterheatingsystem.Thebuildingshouldalsohaveopenspaceonthe
rooftop,whichreceivesdirectsunlight.Theloadbearingcapacityoftheroofshouldatleastbe50
kgpersqmt. Allnewbuildingsofabovesaidcategoriesmustcompleteinstallationofsolarwater
heatingsystemsbeforeobtainingnecessarylicensetocommencetheirbusiness.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

209|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
b) ExistingBuildings:InstallationofSolarAssistedWaterHeatingsystemintheexistingbuildingshall
bemademandatoryatthetimeofchangeofusetoabovesaidcategoryprovidedthereisasystem
orinstallationforsupplyinghotwater.
2.1 Capacity: The capacity of solar water heating system to be installed on the building of
differentcategoriesshallbedecidedinconsultationwiththelocalbodies.Therecommended
minimumcapacityshallnotbelessthan25litresperdayforeach bathroom and kitchen
subjecttotheconditionthatmaximumof50%ofthetotalroof areais provided with the
system.
2.2 Specification: Installation of solar Assisted Water Heating Systems shall conform to BIS
(Bureau of Indian Standards) specifications IS 12933. The solar collectors used in the system
shallhavetheBIScertificationmark.
2.3 AuxiliarySystem:Whereverhotwaterrequirementiscontinuous,auxiliaryheating
arrangementeitherwithelectricelementsoroilofadequatecapacitycanbe

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

210|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
30. SpecialRegulationsforHotel
30.1. ShortTitleExtentandCommencement

ShallbeapplicablewithinthejurisdictionofDSIRDAconstitutedunderGSIRAct2009andGTPUD
Act1976

30.2. Applicability

TheseRegulationsshallapplytoanyHotelBuildingsproposedundertheseregulations

30.3. Definition
a) ACT means the Gujarat Special Investment Region Act 2009 & Gujarat Town Planning & Urban
DevelopmentAct1976.
b) AppropriateAuthoritymeansauthorityasdefinedAct.
c) CompetentAuthoritymeansanyperson/personsorauthorityorauthorities;authorized,asthe
casemaybe,toperformsuchfunctionsasmaybespecifiedundertheseregulations.
d) Developermeansandincludeaowner/person/persons/registeredsociety/association/firm
/ joint ventures / institution / trusts entitled to make an application to develop any hospitality
project;
e) Escape Routes means any well ventilated corridor, staircase or other circulation space, or any
combination of the same having, provided at various levels or floors in the building as per
requirements in NBC and designed for the purpose of evacuation and by means of which, the
occupantscanreachtosafeplaceintheopenairatgroundlevel.
f)

Fireescapestairwaysandroutesmeansescaperoutes,providedatvariouslevelsorfloorsinthe
buildingasperrequirementsinNBC,anddesignedandplacedasadvisedandapprovedbythefire
officer;

g) FireOfficermeanstheChieffireofficeroftheCompetentAuthority;
h) GDCRmeanstheprevalentGeneralDevelopmentControlRegulationsapplicablefortherelevant
appropriateauthority.
i)

GuestDropOffCanopymeansthecanopyatthemainentrance.

j)

Hotel means any building or group of buildings under Single Management, in which sleeping
accommodation is provided, with or without dining facilities, activity relating to recreation,
entertainment, tourist shopping, lobby/lounge, restaurants, bar, shopping area, banquet /
conference halls, health club, dedicated business centre area, swimming pool, parking facilities
attachedfoodservices,restaurant.

k) RefugeAreameansanareadesiredandprovidedatvariouslevelsorfloorsinthebuildingasper
requirementsinNBC,toholdoccupantsduringafireoranyotheremergencyanddesignforsafety.
l)

Service Floor means a floor not exceeding 2.2mt height, which shall be buffer to take care of
structuraltransit,layingandtoopingoftheservicelines,andotherpurposes.

m) Atriummeansalargeopenspace,generallygivethebuildingafeelingofspaceandlight,often
severalstorieshighandhavingasoftroofing/glazedroofand/orroofingofanymaterialforsafety
fromweather,butnottogiveaspace/supportforanyactivitytocarriedaboveit.
n) Zone means the zone as designated in the prevalent sanctioned development plan of the
appropriateauthority.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

211|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
30.4. DutiesoftheDSIRDA:
a) Thecompetentauthorityshall;
i.

within 30 days from the receipt of the application, recommend to the apex authority to
approveorrefusetheproposal;

ii.

Part any proposal if forms a part of any notified water body or any area which the authority
decidesfornotbeingappropriatemayafteraninquirydenywithreasonsinwriting.

30.5. ProcedureforSecuringthePermission:
a) SubjecttotheprovisionsoftheseregulationsandGDCR,anydeveloperintendingtodevelopunder
theseregulationsshallapply,alongwiththerequireddocumentsanddrawingsasperGDCR,tothe
competentauthorityundersection26oftheAct,andthecompetentauthorityshallforwardwith
itsopiniontotheStateGovernment.
b) TheStateGovernmentshallundersection29(1)(ii)takedecisionandmakenecessaryorders.The
competentauthorityshallgrantpermissioninaccordancetosuchGovernmentorders.

30.6. PlanningProvisions
a) MinimumNos.ofroomsshallbeasunder;

PLOTAREA
a) Equaltoorabove5000&upto8000

ROOMS
100

b) Above8000&upto10000

150

c) Above10000

200

b) FloorAreaRatio:
i.

Irrespectiveofanyzone,maximumpermissibleFloorAreaRatio(FAR)shallbeasunder:

5
4
3

MAX
GROUND
COVERAGE
010%
Above1020%
Above2030%

MAX
HEIGHT*
(M)
150m
126m
32m

MINIMUMSETBACKS
(FRONTREARBOTH
SIDES)
10m8m6m6m
9m7m6m6m
8m6m6m6m

1500sqm

2.5

40%

20m

8m6m6m6m

1500sqm

40%

16m

8m6m6m6m

MINROAD
ROW(M)

MIN.PLOT
SIZE

MAX
FAR

55m&
above

5000sqm**

25m&
Below55
Below25m

** For Plot sizes of 5000 sqm and above In case of a building with podium and tower, a ground coverage of
maximum40%willbeallowedforamaximumheightupto8m,includingGorG+1whicheverisless.Theuppertypical
floorsabovepodiumwillhaveamaximumplanareaof10%.ThemaximumFARallowedinthiscasewillbe5.

ii.

ThepermissibleFARmentionedaboveshallbethesumoftheGlobalFARandPremiumFAR.The
GlobalFAR&PremiumFARshallbeasunder;
1. Global FAR (GFAR) means FAR which permitted irrespective of zone. Such GFAR shall be
higherof0.6ortheFARpermittedinrespectivezoneasperGDCR.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

212|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
2. Premium FAR means, FAR available on payment on such FAR shall be at 40% of land jantri
rates.
iii.

ForthecomputationoftheFARtheareausedforthefollowingshallbeexcluded.
1. Basement/otherfloorsusedfortheparking;
2. RefugearearequiredasperNBC;
3. Atrium,EntrancePorch/GuestDropOffCanopy;
4. Fireescapestairwaysandescaperoutes;
5. Servicefloor;
6. Rampsleadingtoparking;
7. Swimmingpoolonanyfloor
8. ControlroomforsecurityandFire.
9. SewerageTreatmentPlant/EffluentTreatmentPlant
10. Equipment/AirHandlingRooms(AHU)forairconditioningandventilation.

c) GuestdropoffCanopy/Porch/Liftforaccesstoparkingshallbepermittedatgroundlevelinthe
marginleaving3.5msidemarginsand9.0mfrontmarginoftheboundaryoftheplot.Theplinth
levelssuchGuestDropoffCanopy/Porchmayberaisedmaximumby2.5m.
d) Theescaperoutesandrefugeareas,shalldesignedinamannertoholdoccupantsduringafireor
terrorattackoranyotheremergencyuntilrescued.Therefugeareashallberegulatedasunder:
i. oneormorerefugespaces,notnecessarilybecontiguousbutconnectwithescaperoutes;
ii. Minimumareaof15sqm.Andaminimumwidthof3.0m.
iii. Atleastonerefugespacebeprovidedforevery6floororpartthereof;
iv. therefugeandtheescapeareashallbedesignedforsafetyoftheoccupants;
e) Marginsandbuiltuparea:
i. Margins

NotwithstandinganythingcontainedinGDCR,marginsshallberegulatedasunder;
1. Nothingexceptcabinandstructuresrelatedtosecuritymaybepermittedinthemargins;
2. Swimmingpoolshallbepermittedinthemarginalspaces.Howeversuchswimmingpoolshall:
a. Notbepermittedinthecirculationspacesforthevehicles;
b. In2.0mwideperipheryoftheplotandthebuildings.
ii.

BuiltupArea:
1. On all floors maximum up to 45% in case of lowrise building and 30% in case of Highrise
buildingshallbepermitted.
2. Areaundertheatriumshallnotbeconsideredwhilecalculatingthegroundcoverageandbuilt
upareaasperthefollowingconditions;
a. areaundertheatriumshallnotexceed40%ofthegroundcoverage;
b. nointermediatecoveredspacesatanyfloorshallbepermittedwithinatrium;
c. only elevators, reception centre, guest lounge, sitting and circulation lobbies shall be
permittedundertheatrium;

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

213|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
d. provisions for projection in GDCR shall apply mutatis mutandis to projections within the
atrium;
f)

Heightofbuilding:
i.

Totalheightofbuildingshallnotexceed150m
ii.

Additional height (AH) means height more than that permitted in GDCR. Such additional
height shall be permitted on payment. Such payment shall be calculated by multiplying the
totalfloorareaincludedintheadditionalheightby15%ofthelandjantrirates.

iii.

Incaseofplantrooms,banquets,ballrooms,restaurants,entrancecanopy/porch,entrance
lobby, basements, floor height more than that available in GDCR shall be permitted on
payment.Suchpaymentshallbecalculatedbymultiplyingthefloorareaforwhichadditional
heightisrequiredby15%ofthelandjantrirates.

g) Basements:
i.

Thefollowingmaybepermittedinbasements:

1. Parkingonmorethanonelevels;
2. Security cabins, substation, A.C. Plant room, generator room, boiler room, hotel laundry,
housekeeping,stores,lockersandrestroomforthereservestaff.Suchservicesshallonlybe
permittedonbasementat1stlevelbelowthegroundlevelonly.Theareaforsuchfacilityshall
notexceed20%ofthetotalbasementatthatlevel.
ii.

Basementmaybepermittedinthemarginalspacesleaving3.5mmarginfromtheboundaryof
buildingunitthe

h) Swimmingpool,CoolingTowers,CommunicationEquipments

i)

i.

Swimmingpoolshallbepermittedatanyfloor;

ii.

Cooling towers, Communication equipments shall be permitted on terraces. The developer


shall,athiscost,getanauditoftheStructuralStabilityandsafetyfromaStructuralexpertof
adequateexperienceandregisteredwiththecompetentauthority.

Parking,Movement&Mobilityshallberegulatedasunder
i.

Parking shall be permitted on any floor / basement at any level. Parking for physically
challengedpeopleshallhavetobeprovidedongroundlevel.

ii.

Ramp leading to parking place may be permitted in margins after leaving. Minimum 3.5 m
widemarginfromtheboundaryofthebuildingunit.

iii.

Minimumparkingequivalentto50%oftheconsumedFARshallbeprovided;

iv.

Theparkingmaybeprovidedinoneormorelotsandsuchlotsshallhavetobeprovidedwithin
thesamebuildingunit;

v.

Access for the private cars, cyclists, pedestrians, service vehicles, emergency vehicles and
publicutilityvehiclesshallbedesignedforsafetyandconvenience;

vi.

Accesspointsontopublicroadsbelocatedanddesignedinsuchamannersoastominimise
traffichazards,queuingonpublicroads.

vii.

10%oftheparkingprovidedshallbereservedfortaxistand.

viii.

Roomminimum25sqmareasshallbeprovidedfordriversalongwithWaterClosetandbath
facilities.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

214|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
30.7. StructureSafety
Structuresafetyshallbeprovidedaspertheprovisionsinannexure1

30.8. MiscellaneousProvisions
a) Lifts:TheplanninganddesignofliftshallbeinaccordancewithNationalBuildingCodeofIndia.
b) EcofriendlyPracticesfor,SewageTreatmentPlant&wastemanagementaswellasenergysaving
devicesshallbeadopted.
c) YogaCentreofminimum50sqmshouldprovided.
d) Provisionsreuseofwater(annexure2),solarwaterheating(annexure3)shallbeapplicable.
e) ThebuildingshallpreferablybedesignedasperEnergyConservationBuildingCode.
f)

For public safety, in consultation with a security expert, CCTV Cameras, Night vision devices,
Motion Sensors, Control room, Refuge Areas, escapes routes, etc. shall be included in building
planning&designandbeinstalledoncompletion

g) Desalinitycharge@5%ofthejantriratesforthe entirefloorspaceshallhavetobepaidtothe
competentauthorityatthetimeofissueofdevelopmentpermission.
h) Wherevernotmentioned,theprovisionGDCRshallapplymutatismutandis.
i)

Hotelunderthisprovisionshallbepermittedinanyzoneinthedevelopmentplan.Howeversuch
permissioncanbedeniedonaccountofsafety.

j)

Even after approval under these regulations, permissions from Airport Authority of India,
Department of Forest and Environment for EIA clearance, and all other relevant department, as
required,shallbemandatory.

k) The structural safety of the building shall be the responsibility of the developer. The developer
shall, at his cost, get an audit of the structural Stability and Safety through any independent
Competent Authority or a Structural expert of adequate experience and good reputation and
registeredtothecompetentauthority.
l)

FiresafetyprovisionshallbemadeinaccordancetoGDCR.

Annexure1
StructuralSafetyandService
1. StructuralDesign
The structural design of foundation, elements made of masonry, timber, plain concrete, reinforced
concrete, perstressed concrete and structure steel shall conform to the provisions of part VI Structural
Design Section1 Loads, Section2 Foundation, Section3 Wood, Section4 Masonry, Section5 Concrete,
Section6 Steel, National Building Code of India, taking into consideration the Indian Standard and
Guidelinesforhazardsafetyasgivenbelow:
a.

ForEarthquakeProtection
i.

IS:18931894CriteriaforEarthquakeResistantDesignofStructures(FourthRevision).

ii. IS:139201993DuctileDetailingofReinforcedConcreteStructuresSubjectedtoSeismicForces
CodeofPractice.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

215|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
iii. IS: 43261993 Earthquake Resistant Design and Construction of Building Code of Practice
(SecondRevision).
iv. IS:138281993improvingEarthquakeResistanceofLowStrengthMasonryBuildingsGuidelines.
v. IS:138271993improvingEarthquakeResistanceofEarthenBuildingsguidelines.
vi. IS:139351993RepairandSeismicStrengtheningofBuildingsGuidelines.
vii. Improving Earthquake Resistance of Buildings guidelines, by Expert Group, Government of
India, Ministry of Urban Affairs & Employment, published by Building Materials and technology
PromotionCouncil,1998.
b.

ForCyclone/WindStormProtection.
i.

IS 875 (3)1987 Code of Practice for Design Loads (other than Earthquake) for Buildings and
Structures,Part3,WindLoads.

ii. ImprovingWind/CycloneResistanceofBuildingsGuideline,byExpertGroup,Governmentof
India, Ministry of Urban Affairs & Employment, published by Building Materials and technology
PromotionCouncil,1998.

Note:WhereveranIndianStandardIncluding those referredintheNational BuildingCodeorthe


NationalBuildingCodeisrefereed,thelatestversionofthesameshallbefollowed.

iii. In pursuance of the above a certificate as indicated in Form2(C) shall be submitted along with
buildingplans/drawingsandotherinformationscheduleannexedthereto.

2. QualityControlRequirements
i.

The quality of all materials and workmanship shall conform to accepted standards and Indian
Standard Specifications and Codes as included in Part V Building Materials and Part VII
ConstructionalPracticesandSafety,NationalBuildingCodeofIndia.

ii. Allborrowpitsduginthecourseofconstructionandrepairofbuildings,embankmentsetc.shallbe
deepandconnectedwitheachotherintheformationofadraindirectedtowardsthelowestlevel
andproperlysteppedfordischargeintoariver,stream,channelordrain,andnopersonshallcreate
andisolatedborrowpitwhichislikelytocauseaccumulationofwaterthatmaybreedmosquitoes.
iii. Alternativematerials,methodofdesignandconstructionandtests:

TheprovisionsoftheRegulationsarenotintendedtopreventtheuseofanymaterialormethodof
designofconstructionnotspecificallyprescribedinthemprovidedanysuchalternativehasbeen
approved. Nothing of the provisions of these Regulations is intended to prevent the adoption or
architectureplanningandlayoutconceivedasanintegrateddevelopmentscheme.TheCompetent
authoritymayapproveanysuchalternativeifitconformstotheprovisionsoftherelevantpartsof
theNationalBuildingCode,regardingmaterial,design and construction, and the material,
method,orworkofferedis,forthepurposeintended,atlastequipmenttothatprescribedinthese
Regulations in quality, strength, compatibility, effectiveness, fire and water resistance, durability
andsafety.

iv. Allbuildingsshallbeconstructedonaqualitycontrolrequirement.
v. In case of existing building under construction based on approved building permission, structural
safety requirements shall have to be observed. However, due to such structural works of
strengthening / retrofitting certain setbacks and margin get reduced, special permission may be
grantedoncasetocasebasis.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

216|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
3. Tests:
WheneverthereisinsufficientevidenceofcompliancewiththeprovisionsoftheRegulationsorevidence
that any material or method of design or construction does not conform to the requirement of the
Regulations,inordertosubstantiateclaimforalternativematerials,designormethodsofconstruction,the
Competentthesetests,shallbemadebyanapprovedagencyattheexpenseoftheownerasfollows:
i.

TESTMETHODS:TestmethodsshallbeasspecifiedbytheRegulationsforthematerialsordesign
orconstructioninquestion.IftherearenoappropriatetestmethodsspecifiedintheRegulations,
the Competent Authority shall determine the test procedure. For methods or tests for building
materials, reference shall be made to the relevant Indian Standards as given in the National
BuildingCodeofIndiapublishedbytheBureauofIndianStandards.

ii. TEST RESULT TO BE PRESERVED: Copies of the result of all such tests shall be retained by the
competentAuthorityfornotlessthantwoyearsaftertheacceptanceofthealternativematerial.
ThetestingofthematerialsasperIndianStandardsshallbecarriedoutbylaboratoriesapproved
bythecompetentauthorityonthisbehalf.
The laboratory / agency shall work out in construction with the construction agency a testing
programmeofmaterialssuchascement,steelandqualityofconcreteincludingitsmixing,laying
andstrengthatsiteaswellasinthelaboratory.
ThisshouldcovervariousstagesofconstructionfromfoundationtocompletionasperRegulation.
Thelaboratoryshallmaintaina dulyauthenticated reportinaboundregister,copyofwhichwill
submitted to the construction agency, which will in turn forward the testing report to the
competentauthority.
4. StructuralStabilityandFireSafetyofExistingBuildings
i.

TheCompetentAuthorityshallhavetheassessmentofstructuraland/orfiresafetyofanexisting
building / structure damaged / undamaged carried out at stipulated periodical intervals through
expert(s)chosenfromapanelofexpertsidentifiedbytheCompetentAuthority.

ii. The owner / developer / occupant on advice of such expert(s) shall carryout such repair /
restoration and strengthening / retrofitting of the building found necessary so as to comply with
thesafetystandardslaiddownintheNationalBuildingCodeandtheIndianStandardasspecified.
Incase,theowner/developer/occupantdonotcarryoutsuchaction,thecompetentauthorityor
anyagencyauthorizedbythecompetentauthoritymaycarryoutsuchactionatthecostofowner/
developer/occupant.

iii. TheCompetentAuthorityshallspecifytheperiodwithinwhichsuchcomplianceistobecarriedout.
iv. TheCompetentAuthoritymayalsodirecttheowner/developer/occupant,whetherthebuilding
couldbeoccupiedornotduringtheperiodofcompliance.
v. In case of existing building under construction based on approved building permission, structural
safety requirement shall have to be observed. However, due to such structural work of
strengthening/retrofittingifcertainsetbackandmargingetreduced,specialpermission.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

217|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Annexure2
RegulationforReuseofwater
1. Definitions
1.1. 'Domestic waste water' means either water that is typically discharged from premises that are
usedsolely for residential activities or waste water of the same character discharged from
otherpremises.
1.2. 'Greywater'meansinvolvingnonpotablewaterfromsinks,tubs,showersandwashing.
1.3. 'Pretreatment' means any processing of industrial waste or waste designed to reduce any
characteristicinwaste,beforedischargetothewastewatersystem.
1.4. 'premises'meanseither
1.4.1. Apropertywhichisheldunderaseparatecardoftitleorforwhichaseparatetitlecardmay
beissuedandinrespecttowhichabuildingplanshavebeenormaybeissued,orabuilding
whichisinpossessionasanindividualunitbyacrosslease,unittitleorcompanyleaseand
forwhichacertificateoftitleisavailable,or
1.4.2. Landheldinpublicownership,foraparticularpurpose,or
1.4.3. Separatelyassessedtolocalauthoritytaxes,individualunitwithinbuilding.
1.5. 'Nonpotablewatermeanstheuseofwaterfornoncontactuses,nondomesticconsumptionlike
carwashing,toiletflushing,gardening,constructionpurposes,landscaping,dripirrigationoftrees
/shrubs,sub surfaceirrigation of lawns and recharge of ground water & uses is for bidden by
virtueofpowersvestedwithgovernment.
1.6. 'Prohibitedindustrialwaste'meansaindustrialwastehavingphysicalandchemicalcharacteristics
inexcessasdecidedbyGPCB.
2. Applicability:Reuseofwatershallbeprovidedincaseoffollowingcategoriesofbuilding.
2.1. Allnewbuildingsunderthefollowinguse
a. Anylowrise/highrisebuildinghavingnumberofunits10ormoreorhavingtotalbuiltuparea
morethan750sq.meters
b. HospitalandNursinghomes
c. Hotels,Lodgesandguesthouses
d. Hostelsofschools,Colleges,Trainingcentres.
e. Barracksofarmedforce,paramilitaryforcesandpolice
f. Individualresidentialbuildingshavingmorethan150sqmeterplintharea
g. Functional buildings of Railway stations and Airport like waiting rooms, retiring rooms, rest
room,inspectionbungalowsandcateringunits
h. Communitycentres,Banquethall,andbuildingsofsimilaruse
i. Commercialestablishmentshavingtotalbuiltupareaof2000sqmetresormore.
j. Allhazardous/waterpolluting/Chemicalindustries

Note:Incaseofcategoryofmentionedinb,c,g,h&jaboveitshallnotbemandatorytoprovide
theassistedheatingsystem.
2.2. Exemptionscouldbeaccordedunderfollowingcircumstances,asdecidedbytheauthority;
a. Incasetheexisting premisescannotpermit the provisionofadditionaloverheadtankfor the
purposeoftheuseoftreatedwater.
b. If,intheexistingstructure,thereisnospaceforinstallationoftreatmentfacilityandcollection
chamber.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

218|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
c. In exceptional cases due to dearth of land or water logged areas exempt (with the approval
fromcompetentauthority)fromprovidingfacilityforrecyclingthegreywater.
3. InstallationoftheSystemfortheReuseofwater
3.1 NewBuilding:Clearanceofplanfortheconstructionofnewbuildingsoftheaforesaidcategories
shallonlybegiveniftheyhaveaprovisioninthebuildingdesignitselffor:
3.1.1 Every developer / builder shall provide with the provision of down take plumbing for grey
water,recyclingwaterplant,storageandreusefittinginpurplecolour.
3.1.2 Provideadditionalarrangementsforcarryingtheexcessgreywatertotheseweragesystem
mayalsobeprovided
3.1.3 Nonuisanceoffoulgases/publichazardoranyotheraspectendangeringlife
3.1.4 There shall not be crossconnection of fitting of the potable and not potable water at any
point.Therecycledwatersystemshallbemaintainedataloweroperatingpressurethatof
the portable water system. Precautions should be taken at the makeup connection to
preventcrosscontamination.
3.2 Old buildings: In case of additions and alterations, systems for the Reuse of water shall be
providedinaccordancetotheseregulations.
4. Qualityofwater,treatment&specification:
4.1. Thewaterqualityshallconformtostandardofnonportablewater.Therecycledwatershallbe
testedonceinsixmonthsandresultsshallbemadeavailabletocompetentauthoritywhenever
demanded.
4.2. Every existing building / residential structure shall provide with the provision of recycled water
plantandrelevantadequateseparateplumbingforgreywaterandreusefitting
4.3. Thetestingofwastesandthesubmissionoftheresultsshallbedoneinamannerinaccordance
withthetermsandconditionsprescribedbytheMunicipalCommissionerortheGujaratpollution
controlboard/thecompetentauthority.
4.4. InstallationsforReuseofwatershallconformtorelevantcodesofpractices
5. GeneralProvisions:
5.1. Mandatorydisclosure:Anoccupier/ownerofpremisesshallinformthecompetentauthorityof
anychangeinthequality,natureofthewastesdischargedfromhisplantorpremises,themanner
oftheirdischargeofwaterlikelytocausevariationsorviolationundertheseregulations.
5.2. Correctiveaction:Intheeventitisfoundanypersonviolatingtheprovisionsoftheseregulations,
thecompetentauthorityshallissuenoticeandafterinquiryandpersonalhearingtakenecessary
correctiveaction.
5.3. Rebate:Thecompetentauthoritymaysatisfyitselfontheperformanceofrecyclingofthewater
andthereaftercangiverebateonthetaxes/feesleviableforthedevelopment.Thecompetent
authoritymaygivesuchrebateonthecapitalorrecurringrecoverieswhichthedeveloperisliable
topay.
5.4. Dispute Resolution: All the disputes arising in the enforcement of this by these rules shall be
referred to Municipal Commissioner who in turn will resolve the disputes in advice with his
authorizedtechnicalofficeroranyexpertsandintimatetotheoccupier/builder/developer.The
decisionofthecompetentauthoritywillbefinalandbindingontheoccupier.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

219|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
5.5. ListofAuthorizedLaboratoriesshallbeasauthorizedbyGujaratStatePollutionControlboardor
theMunicipalCorporation

Annexure3
RegulationregardingInstallationsofsolarassistedwaterHeatingSystem.
1. Solarassistedwaterheatingsystemshallbeprovidedincaseoffollowingcategoriesofbuildings.
a. Hospital&NursingHomes.
b. Hotels,LodgesandGuestHouses.
c. Hostelsofschools,colleges,trainingcentres.
d. Barracksofarmedforces,paramilitaryforcesandpolice.
e. Individualresidentialbuildingshavingmorethan150.00sqmplintharea.
f.

Functional buildings of railways stations and airports like waiting rooms, retiring rooms, rest
rooms,inspectionbungalowsandcateringunits.

g. Communitycentres,BanquetHall,BaratGhars,KalyanMandaps,andBuildingsforsimilaruse.

Note: in case of category of mentioned in e above it shall not be mandatory to provide the solar
assistedheatingsystem.
2. Nonewbuildingsinthecategorymentionedin'1'aboveinwhichthereisasystemorinstallationfor
supplyinghotwatershallbebuiltunlessthesystemortheinstallationisalsohavinganauxiliarysolar
assistedwaterheatingsystems.
Schedule
3. Definitions:
i

SolarAssistedWaterHeatingSystem : Adevicetoheatwaterusingsolarenergyasheat
source.
ii Auxiliarybackup
: Electricallyoperatedorfuelfiredboilers/systemsto
heatwatercomingoutfromsolarwaterheatingsystem
tomeetrequirementofhotwater.
iii NewBuilding
: Suchbuildingofabovesaidcategoriesforwhich
constructionplanshavebeensubmittedtocompetent
authorityforclearance
iv ExistingBuilding
: Suchbuildingwhicharelicensedtoperformtheir
respectivebusiness.
4. InstallationofSolarWaterHeatingSystem
a) NewBuildings:Clearanceofplanfortheconstructionofnewbuildingsoftheaforesaidcategories
shallonlybegiveniftheyhaveaprovisioninthebuildingdesignitselfforaninsulatedpipelinefrom
the rooftop in the building to various distributions from the rooftop in the building to various
distributionpointswherehotwaterisrequired.Thebuildingmusthaveaprovisionforcontinuous
watersupplytothesolarwaterheatingsystem.Thebuildingshouldalsohaveopenspaceonthe
rooftop,whichreceivesdirectsunlight.Theloadbearingcapacityoftheroofshouldatleastbe50

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

220|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
kgpersqmt. Allnewbuildingsofabovesaidcategoriesmustcompleteinstallationofsolarwater
heatingsystemsbeforeobtainingnecessarylicensetocommencetheirbusiness.
b) ExistingBuildings:InstallationofSolarAssistedWaterHeatingsystemintheexistingbuildingshall
bemademandatoryatthetimeofchangeofusetoabovesaidcategoryprovidedthereisasystem
orinstallationforsupplyinghotwater.
Capacity:Thecapacityofsolarwaterheatingsystemtobeinstalledonthebuildingofdifferent
categoriesshallbedecidedinconsultationwiththelocalbodies.Therecommendedminimum
capacityshallnotbelessthan25litres perdayforeachbathroomandkitchensubjectto the
conditionthatmaximumof50%ofthetotalroofareaisprovidedwiththesystem.
Specification:InstallationofsolarAssistedWaterHeatingSystemsshallconformtoBIS(Bureau
ofIndianStandards)specificationsIS12933.Thesolarcollectorsusedinthesystemshallhave
theBIScertificationmark.
Auxiliary System: Wherever hot water requirement is continuous, auxiliary heating
arrangementeitherwithelectricelementsoroilofadequatecapacitycanbe

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

221|P a g e

APPENDICES

DraftGeneralDevelopmentControlRegulations(DGDCR)
Appendices
AppendixA:ClassificationofIndustries
1. LISTOFINDUSTRIESUNDERREDCATEGORY
A. Industries identified by Ministry of Environment & Forests, Government of India as heavily
pollutingandcoveredunderCentralActionPlan.viz;
1. DistilleryincludingFermentationindustry
2. Sugar(excludingKhandsari)
3. Fertilizer
4. PulpandPaper(Papermanufacturingwithorwithoutpulping)
5. Chloralkali
6. Pharmaceuticals(Basic)(excludingformulation)
7. DyesandDyeintermediates
8. Pesticides(Technical)(excludingformulation)
9. Oilrefinery(MineraloilorPetrorefineries)
10. Tanneries
11. Petrochemicals(Manufactureofandnotmerelyuseofasrawmaterial)
12. Cement
13. Thermalpowerplants
14. IronandSteel(Involvingprocessingfromore/scrap/Integratedsteelplants)
15. Zincsmelter
16. Coppersmelter
17. Aluminiumsmelter
18. Tyresandtubes(excludingVulcanisation/Retreating/moulding)
19. Syntheticrubber
20. Glassandfibreglassproductionandprocessing
21. Industrialcarbonincludingelectrodesandgraphiteblocks,activatedcarbon,carbonblacketc
22. Paintsandvarnishes(excludingblending/mixing)
23. Pigmentsandintermediates
24. Syntheticresins
25. Petroleumproductsinvolvingstorage,transferorprocessing
26. Lubricatingoils,greasesorpetroleumbasedproducts
27. Syntheticfibresincludingrayon,tyrecord,polyesterfilamentyarn
28. Surgicalandmedicalproductsinvolvingprophylacticsandlatex
29. Syntheticdetergentandsoap
30. Photographicfilmsandchemicals
31. Chemical, petrochemical and electrochemical including manufacture of acids such as
SulphuricAcid,NitricAcid,PhosphoricAcidetc
32. Industrialorinorganicgases
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

222|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
33. Chlorates,perchloratesandperoxides
34. GlueandGelatine
35. Yarn and textile processing involving scouring, bleaching, dyeing, printing or any
effluent/emissiongeneratingprocess
36. Vegetableoilsincludingsolventextractedoils,hydrogenatedoils
37. Industryorprocessinvolvingmetaltreatmentorprocessessuchaspickling,surfacecoating,
paintbaking,paintstripping,heattreatment,phosphatingorfinishingetc
38. Industryorprocessinvolvingelectroplatingoperations
39. Asbestosandasbestosbasedindustries
40. Slaughterhousesandmeatprocessingunits
41. Fermentationindustryincludingmanufactureofyeast,beeretc
42. Steelandsteelproductsincludingcokeplantsinvolvinguseofanyoftheequipmentssuchas
blast furnaces, open hearth Furnace, induction furnace or arc furnace etc or any of the
operationsorprocessessuchasheattreatment,acidpickling,rollingorgalvanizingetc
43. Incinerationplant
44. Powergeneratingplants(excludingDGSets)
45. Limemanufacturing
46. Tobaccoproductsincludingcigarettesandtobaccoprocessing
47. Drycoalprocessing/Mineralprocessingindustrieslikeoresintering,palletisationetc
48. Phosphaterockprocessingplants
49. Cokemaking,coalliquefaction,coaltardistillationorfuelgasmaking
50. Phosphateanddetonators,fusesetc.
51. Explosiveincludingdetonators,etc
52. Firecrackers
53. Processesinvolvingchlorinatedhydrocarbon
54. Chlorine,fluorine,bromine,iodineandtheircompounds
55. Hydrocyanicacidanditsderivatives
56. Milkprocessinganddairyproducts(Integratedproject)
57. Industryorprocessinvolvingfoundryoperations
58. Potablealcohol(IMFL)byblendingordistillationofalcohol
59. Anodizing
60. Ceramic/refractoriness
61. Leadprocessingandbatteryreconditioning&manufacturingincludingleadsmelting
62. Hotmixplants
63. Hospitals
64. Miningandorebeneficiation
65. Miscellaneous

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

223|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
2. LISTOFINDUSTRIESORANGECATEGORY.
1. Manufactureofmirrorfromsheetglassandphotoframing
2. Cottonspinningandweaving
3. Automobileservicingandrepairsstations
4. Hotelsandrestaurants
5. Flourmills(excludingDomesticAattaChakki)
6. Maltedfood
7. Foodincludingfruitsandvegetableprocessing
8. Pulpingandfermentingofcoffeebeans
9. Instanttea/coffee,coffeeprocessing
10. Nonalcoholicbeverages(softdrinks)
11. Fragrancesandindustrialperfumes
12. Foodadditives,nutrientsandflavours
13. Fishprocessing
14. Organicnutrients
15. Surgicalandmedicalproductsnotinvolvingeffluent/emissiongeneratingprocesses
16. Laboratorywares
17. Wiredrawing(coldprocess)andbailingstraps
18. StoneCrushers
19. Laboratorychemicalsinvolvingdistillation,purificationprocess
20. Tyresandtubesvulcanisation,vulcanisation,retreadingmoulding
21. Pesticides/Insecticides/Fungicides/Herbicides/Agrochemicalformulation
22. NPKFertilizers/Granulation
23. Pharmaceuticalsformulations
24. Khandsarisugar
25. Pulverizingunits
26. Miscellaneous
3. LISTOFINDUSTRIESUNDERGREENCATEGORY.
Industries in Small Scale, Cottage/Village category suggested under notification of the State
Government/union territory for issuance simplified NOC/Consent from Pollution Control
Board/Pollutioncontrolcommittee,asthecasemaybe.
AllthoseindustriesorprocesseswhicharenotcoveredundertheRedand/orOrangecategory.
Anillustrativelistisprovided.
1. Washingofusedsandbyhydraulicdischarge
2. Aattachakkies
3. Ricemullors
4. Steepingandprocessingofgrains
5. Mineralisedwater
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

224|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
6. Dalmills
7. Bakeryproducts,biscuits,confectionery
8. Groundnutdecorticating(dry)
9. Supari(Betelnut)andmasalagrinding
10. Chillingplantsandcoldstorages
11. IcecreamorIcemaking
12. Tailoringandgarmentmaking
13. Cottonandwoollenhosiery
14. Apparelmaking
15. Handloomweaving
16. Shoelacemanufacturing
17. Goldandsilverthreadzariwork
18. Goldandsilversmithy
19. Leatherfootwearandleatherproductsexcludingtanningandhideprocessing
20. Musicalinstrumentsmanufacturing
21. Sportsgoods
22. Bambooandcaneproducts(onlydryoperations)
23. Cardboardorcorrugatedboxandpaperproducts(Paperorpulpmanufacturingexcluded)
24. Insulationandothercoatedpapers(Paperorpulpmanufacturingexcluded)
25. Scientificandmathematicalinstruments
26. Furniture(woodenandsteel)
27. Assemblyofdomesticelectricalappliances
28. Radioassembling
29. Fountainpens
30. Polythene,plasticandPVCgoodsthroughextrusion/moulding
31. Rope(cottonandplastic)
32. Carpetweaving
33. Assemblyofaircoolers,conditioners
34. Assemblyofbicycles,babycarriagesandothersmallnonmotorizedvehicles
35. Electronicsequipment(Assembly)
36. Toys
37. Watersofteninganddemineralisedplants
38. Paint(bymixingprocessonly)
39. Candles
40. Carpentry(excludingsawmill)
41. Oilginning/expelling(nohydrogenation/refining)
42. Jobbingandmachining
43. Manufactureofsteeltrunksandsuitcases
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

225|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
44. PaperpinsandUclips
45. Blockmakingforprinting
46. Opticalframes
47. Powerlooms/handlooms(withoutdyeing&bleaching)
48. Printingpress
49. Garmentsstitching,tailoring
50. Thermometermaking
51. Footwear(rubber)
52. Plasticprocessedgoods
53. Medicalandsurgicalinstruments
54. Electronicandelectricalgoods
55. Rubbergoodsindustry
56. Miscellaneous

1. Theindustrieswhichdonotfallinanyoftheabovementioned3categories,decisionwithregard
totheirclassificationwillbetakenbyacommitteeatHeadOfficelevelcomprisingoftheMember
SecretaryandtwoseniorofficersoftheBoard/committee.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

226|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
AppendixB:ProtectionofBuildings,StructuresandInfrastructuresinHazardProneAreas
A. ProtectionOfAreasFromEarthquakes
1. In those areas where there are no dangers of soil liquefaction or settlements or landslides, all
buildingstructuresandinfrastructuresshouldbedesignedusingtherelevantIndianStandardsas
providedintheBuildingRegulationsandtheNationalBuildingCode(NBC)
2. Soils subjected to liquefaction potential under earthquake shaking, can be improved by
compactiontodesiredrelativedensities,soastopreventthepossibilityofliquefaction.
3. Buildingsandstructurescouldbefoundedondeepbearingpilesgoingtononliquefiabledense
layers.
4. Steepslopescanbemademorestablebyterracingandconstructionofretainingwallsandbreast
walls,andbyensuringgooddrainageofwatersothatthesaturationofthehillslopeisavoided.
5. Anyotherappropriateengineeringinterventiontosavethebuildingstructuresorinfrastructure
fromthefuryoftheearthquake.
Note: The protective action given under (2) to (5) will usually involve large amount of costs and
shouldonlybeconsideredinthecaseoflargeandcostlystructures.Forordinarybuildingsthecostof
improvement of the sitewill usually be uneconomical, hence bad sites should be excluded by Land
UseZoning.
B.ProtectionfromCyclonicWindDamage
1. Buildings,structuresandinfrastructuresinthecycloneproneareasshouldbedesignedaccording
totheIndianStandardsandGuidelinesasprovidedintheRegulationsandtheNationalBuilding
Code(NBC).
2. Light utility structures used for electrical transmission and distribution, and towers for
communications, chimney stacks of industrial structures require special design considerations
againstthecyclonicwindpressures,suctionsanduplifts.
3. Incasethebuildings,structuresandinfrastructuresarefoundedonmarineclaydepositsitwillbe
advisable to adopt either underreamed piled foundations, or individual column footing with a
reinforcedconcretebeamlocatedattheleveloftheground,oracontinuousreinforcedconcrete
stripfooting.
4. Wherever,thetopsoilcouldbecomeslushyduetoflooding,thetoplayerof30cmdepthofsoil
should not be considered for providing lateral stability v. In storm surge prone areas, it will be
preferable to construct the community structures, like schools, cyclone shelters, etc. by raising
thelevelofthegroundprotectedbyprovisionofretainingwallsatsufficientdistanceawayfrom
the building, taken to such depth that no erosion takes place due to receding storm surge.
Alternatively,constructthecommunitystructuresonstiltswithnomasonryorbracinguptothe
probablemaximumsurgelevel.
C.ProtectionofAreasfromFloods
Thismayrequireoneormoreofthefollowingactions:
1. Construction of embankments against the water spills from the source of flooding like rivers,
largedrainetc.
DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

227|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
2. Constructionofhighenoughembankments/bundaroundtheplanningarea.
3. Raisingtheplanningareaabovethehighfloodlevel.
4. Construction/improvement of drainage paths to effectively drain the water from the planning
area.
5. Constructionofbuildingsandstructuresondeepfoundationsgoingbelowthedepthofscouror
onstiltswithdeepenoughfoundationsunderwater.
6. Floodproofingworkssuchasthefollowing:
ProvidingQuickDrainagefacility,consistingof

Revitalisation of secondary and primary drainage channels after establishing the drainage
blockagepoints;
Provisionofadditionalwaterways;
Clearingofcloggedcrossdrainageworks;
ProvidingHumanandAnimalSheltersforpopulationlivingwithinembankmentsintheform
ofraisedplatformoruseofavailablehighground.
7. Antierosionactionsinaffectedareas
8. Anyothersuitablemeasure.
Note:
1. Similarprotectionmethodscouldbeusedagainstfloodingcausedincycloneproneareasbyhigh
intensityrainsorbythestormsurge.
2. Theconceptoflandzoningshouldbekeptinmindforareaswhereprotectionworksaretaken
up to decide interse priority for location of structures considering possibility of failure of
protectionworksduringextremedisasterevents

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

228|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
AppendixC:GuidelineforDeterminationofIndustrialPlotSizes
TherangeofplotsizescorrespondingtoeachpriorityindustrialsectorsidentifiedfortheDSIRisgiven
inthetablebelow.Thismaybefollowedasaguidelinewhileplanninglargeindustrialareas.
TableC1:RangeofIndustrialPlotSizesbySector

Small(Less
than1ha)

Sector1:General
Manufacturing

Sector2:IT/ITES

Sector3:Electronic
includingHightech
Industries

Sector4:Automobile
andAutoAncillary

Sector5:AgroandFood
Processing

Sector6:Heaving
Engineering

Sector7:Metalsand
Metallurgicalproducts

Sector8:
Pharmaceuticaland
Biotech

PLOTSIZERANGE
Medium(1
Large(510
VeryLarge
5ha)
ha)
(1015ha)

Mega(Over
15ha)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

229|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
AppendixD:Forms
FormNo.C.
Applicationfordevelopmentpermissionundersection8,15ofGSIRAct,2009and27,34and49of
GTPUDAct,1976

To,
ChiefExecutiveOfficer,
DSIRDA

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

230|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

231|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

6.
7.

8.
9.
10.
11.

12.

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

232|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

233|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

234|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form C (a)

FormNo.C(a)
GujaratTownPlanningandUrbanDevelopmentAct,1976
ApplicationforpermissionofBrickkiln,MiningandQuarryingunderSection27

To,
ChiefExecutiveOfficer,
DSIRDA

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

235|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

236|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form 2(A)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

237|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form 2(B)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

238|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form 2(C)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

239|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form 2(d)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

240|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

241|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

242|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

243|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form 3

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

244|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

245|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form 4

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

246|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form D
FORMNO.D.
DEVELOPMENTPERMISSION

Permissionisherebygranted/refusedundersection29(1)(i)/29(1)(ii)/29(1)(iii),34,49(1)(b)of
theGujaratTownPlanningandUrbanDevelopmentAct,1976

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

247|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

ChiefExecutiveOfficer/Authorized,
DSIRDA

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

248|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form 6 (A)
FORM NO. 6 (A)
PROGRESS CERTIFICATE
PlinthStage/Incaseofbasementcastingofbasementslab
ReferenceNo.
OwnersName:
Location:
Submittedon:
Receivedon:

TheChiefExecutiveOfficer,
DSIRDA

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

249|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form 6 (B)
FORM NO. 6 (B)
PROGRESS CERTIFICATE FIRST STOREY
PlinthStage/Incaseofbasementcastingofbasementslab
ReferenceNo.
OwnersName:
Location:
Submittedon:
Receivedon:
TheChiefExecutiveOfficer,
DSIRDA

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

250|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form 6 (C)

TheChiefExecutiveOfficer,
DSIRDA

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

251|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form 6 (D)

TheChiefExecutiveOfficer,
DSIRDA

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

252|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form 7

TheChiefExecutiveOfficer,
DSIRDA

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

253|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form 8

TheChiefExecutiveOfficer,
DSIRDA

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

254|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form 9

ChiefExecutiveOfficer,
DSIRDA

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

255|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form 10

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

256|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)
Form 11

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

257|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

258|P a g e

DraftGeneralDevelopmentControlRegulations(DGDCR)

DholeraSpecialInvestmentRegionalDevelopmentAuthority,Gandhinagar
DSIRDA

259|P a g e