You are on page 1of 134

Alfred Kuhse GmbH

TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 25.11.2013/ Comm. Edition

Operating Instruction Genset Control


Project :

Guangopolo II, 5301954

Client

MAN Diesel & TurboSE, Augsburg

Client Order No.:

4500859942 46D

Manufacturer:

Alfred Kuhse GmbH


D 21423 Winsen/Luhe
TEL
+49(0)4171 798-0 FAX -117
E-Mail kuhse@kuhse.de

Kuhse Comm. Number :

461180

Rev./ Date / Status

0 / 25.11.2013 / Comm. Edition

Document No. :

461180_Operation Instruction.doc

Mid voltage level:


Control Voltage:
Auxiliary Voltage:

13,8kV/46kV 60Hz
230V AC, 60Hz; 24 V DC
127/230V AC, 60Hz

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 1 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 25.11.2013/ Comm. Edition

Table of Contents:
Table of Contents: ............................................................................................................. 2
Revision History................................................................................................................. 7
1
Principle Front View ................................................................................................ 8
2
Principle Description............................................................................................. 10
2.1
2.2

3

Purpose ............................................................................................................................................... 10


Properties ............................................................................................................................................ 10

Functional Descriptions of Operation and Indication Elements ....................... 12

3.1
Switches and Push Buttons ................................................................................................................. 12
3.1.1 Selector Switch Operation Mode GCP/SCADA ............................................................................... 12
3.1.1.1 Purpose ............................................................................................................................................. 12
3.1.1.2 Properties .......................................................................................................................................... 12
3.1.2 Selector Switch Alternator Voltage ................................................................................................... 14
3.1.2.1 Purpose ............................................................................................................................................. 14
3.1.2.2 Properties .......................................................................................................................................... 14
3.1.3 Selector Switch Local Synchronization Manual/OFF/Automatic ...................................................... 15
3.1.3.1 Purpose ............................................................................................................................................. 15
3.1.3.2 Properties .......................................................................................................................................... 15
3.1.4 Control Switch Manual Setting Voltage, Power Factor Lower/0/Higher ........................................... 17
3.1.4.1 Purpose ............................................................................................................................................. 17
3.1.4.2 Properties .......................................................................................................................................... 17
3.1.5 Control Switch Manual Setting Speed, Frequency, Load Lower/0/Higher ....................................... 18
3.1.5.1 Purpose ............................................................................................................................................. 18
3.1.5.2 Properties .......................................................................................................................................... 18
3.1.6 Push Button Red Emergency Stop................................................................................................... 19
3.1.6.1 Purpose ............................................................................................................................................. 19
3.1.6.2 Properties .......................................................................................................................................... 19
3.1.7 Push Button Black Acknowledge/Reset ........................................................................................... 21
3.1.7.1 Purpose ............................................................................................................................................. 21
3.1.7.2 Properties .......................................................................................................................................... 21
3.1.8 Push Button Blue Lamp Test............................................................................................................ 22
3.1.8.1 Purpose ............................................................................................................................................. 22
3.1.8.2 Properties .......................................................................................................................................... 22
3.1.9 Push Button Green Alternator CB ON .............................................................................................. 23
3.1.9.1 Purpose ............................................................................................................................................. 23
3.1.9.2 Properties .......................................................................................................................................... 23
3.1.10 Push Button Red - Alternator CB OFF ................................................................................................ 25
3.1.10.1 Purpose ............................................................................................................................................. 25
3.1.10.2 Properties .......................................................................................................................................... 25
3.2
Indications ........................................................................................................................................... 27
3.2.1 Signaling Column ................................................................................................................................ 27
3.2.1.1 Purpose ............................................................................................................................................. 27
3.2.1.2 Properties .......................................................................................................................................... 27
3.2.2 LED Position Indicator Alternator Circuit Breaker ............................................................................ 29
3.2.2.1 Purpose ............................................................................................................................................. 29
3.2.2.2 Properties .......................................................................................................................................... 29
3.2.3 LED Position Indicator Alternator Earthing Switch ........................................................................... 30
3.2.3.1 Purpose ............................................................................................................................................. 30
3.2.3.2 Properties .......................................................................................................................................... 30
3.2.4 LED Position Indicator Alternator Neutral Earthing Switch .............................................................. 32
461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 2 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 25.11.2013/ Comm. Edition
3.2.4.1 Purpose ............................................................................................................................................. 32
3.2.4.2 Properties .......................................................................................................................................... 32
3.2.5 Voltmeter Alternator Voltage ............................................................................................................ 34
3.2.5.1 Purpose ............................................................................................................................................. 34
3.2.5.2 Properties .......................................................................................................................................... 34
3.2.6 Ammeter Alternator Current ............................................................................................................. 35
3.2.6.1 Purpose ............................................................................................................................................. 35
3.2.6.2 Properties .......................................................................................................................................... 35
3.2.7 Double Voltmeter Synchronization Voltage ...................................................................................... 36
3.2.7.1 Purpose ............................................................................................................................................. 36
3.2.7.2 Properties .......................................................................................................................................... 36
3.2.8 Double Frequency Meter Synchronization Frequency ..................................................................... 37
3.2.8.1 Purpose ............................................................................................................................................. 37
3.2.8.2 Properties .......................................................................................................................................... 37
3.2.9 Synchronoscope .................................................................................................................................. 38
3.2.9.1 Purpose ............................................................................................................................................. 38
3.2.9.2 Properties .......................................................................................................................................... 38
3.3
Units .................................................................................................................................................... 39
3.3.1 Automatic Synchronization Unit .......................................................................................................... 39
3.3.1.1 Purpose ............................................................................................................................................. 39
3.3.1.2 Properties .......................................................................................................................................... 39
3.3.2 Multifunctional Monitoring Unit (MMU) Siemens Sentron PAC3200 ................................................ 41
3.3.2.1 Purpose ............................................................................................................................................. 41
3.3.2.2 Properties .......................................................................................................................................... 41
3.3.2.3 Operation .......................................................................................................................................... 41
3.4
Visualization ........................................................................................................................................ 43
3.4.1 Panel PC ............................................................................................................................................. 43
3.4.1.1 Purpose ............................................................................................................................................. 43
3.4.1.2 Properties .......................................................................................................................................... 43
3.5
Alternator Protection ............................................................................................................................ 45
3.5.1 Alternator Prote ction Device ............................................................................................................... 45
3.5.1.1 Purpose ............................................................................................................................................. 45
3.5.1.2 Properties .......................................................................................................................................... 45

4

Operating Scenarios ............................................................................................. 47

5

Overview diagramms ............................................................................................ 55

6

Engine control functions ...................................................................................... 61

4.1
Synchronization of Circuit Breakers .................................................................................................... 47
4.1.1 Synchronization Principles .................................................................................................................. 47
4.1.2 Synchronization Operating Scenarios ................................................................................................. 48
4.1.2.1 Automatic Synchronization from GCP .............................................................................................. 48
4.1.2.2 Manual Synchronization from GCP .................................................................................................. 49
4.1.2.3 Automatic Synchronization from SCADA ......................................................................................... 50
4.1.2.4 Principle Control and Operating Philosophy Alternator Circuit Breaker and Excitation ................... 51
5.1
5.2
5.3
5.4
5.5
5.6
6.1
6.2
6.3
6.4
6.5

Overall Single line diagram ................................................................................................................. 55


Data structure GCP PLC ..................................................................................................................... 56
Protecion and measuring scheme GCP ............................................................................................. 57
Power Plant Operation modes ............................................................................................................ 58
Front View of Engine Control Panel +ECPx ........................................................................................ 59
Engine Auxiliary Panel +EAPx ............................................................................................................ 60
Push button of engine control at PC touch panel ................................................................................ 61
Start procedure of engine in GCP mode ............................................................................................. 61
Start procedure of engine in SCADA mode ........................................................................................ 63
Local Remote switch 1HZ1012 at engine ......................................................................................... 63
Generator Synchronisation .................................................................................................................. 64

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 3 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 25.11.2013/ Comm. Edition
6.5.1 Parameter list for Synchronisation Monitoring .................................................................................... 64
6.5.2 Generator circuit breaker monitoring ................................................................................................... 65
6.6
Load controller description .................................................................................................................. 66
6.6.1 Settings of load controller GCP ........................................................................................................... 66
6.6.2 Monitoring of control function .............................................................................................................. 67
6.7
Loading of Engine................................................................................................................................ 68
6.8
Limitations in load range by the PCU (power control unit) .................................................................. 69
6.8.1 Load reduction dependent on ambient air temperature. ..................................................................... 69
6.8.2 Load reduction because of too high exhaust gas temperature before turbine. ................................... 70
6.9
PCU Parameter list (example) ............................................................................................................. 71
6.10 Further load limitations ........................................................................................................................ 72
6.11 Exhaust Gas Temperature Monitoring ................................................................................................ 73
6.11.1 Functional Description ......................................................................................................................... 73
6.11.2 Exhaust gas temperature monitoring functions ................................................................................... 76
Monitoring maximal value at cylinder ............................................................................................................... 76
Monitoring mean value deviation at cylinder .................................................................................................... 76
Monitoring maximal value before turbo charger ............................................................................................... 77
Temperature value after turbo charger ............................................................................................................ 77
Reset 77
6.12 Charge air temperature control TC6180 with 01MJG32AA010-M01 (MOV003) ................................ 78
6.12.1 Parameter list charge air temperature control ..................................................................................... 79

CHATCO curve ................................................................................................................................. 80
6.12.2 Function of controller ........................................................................................................................... 80

Monitoring of the control valve .......................................................................................................... 80
6.12.3 Selection operating mode .................................................................................................................... 80
Monitoring of the control valve ..................................................................................................................... 80
6.12.4 Allumatic .............................................................................................................................................. 81
Operation Modes ............................................................................................................................................ 81
6.12.5 Calculating the dewpoint temperature in normal mode ....................................................................... 82
6.12.6 Calculating the dewpoint temperature in failure mode ........................................................................ 83
6.12.7 Achievement of the optimal charge air temperature ........................................................................... 83
Allumatic Mode ............................................................................................................................................... 83
CHATCO Mode................................................................................................................................................ 83
6.12.8 Alarms ................................................................................................................................................. 84
6.12.9 Emergency Stop .................................................................................................................................. 84
6.13 HT cooling water control valve 01MJG31AA010-M01 via TC3180 with MOV 002 ............................. 86
6.13.1 Parameter list HT cooling water controller .......................................................................................... 88

Monitoring of the control valve .......................................................................................................... 88
6.14 LT cooling water control valve 01MJG32AA025-M01 TC3202 with MOV004: ................................... 89
6.14.1 Parameter LT cooling water control .................................................................................................... 90
6.15 Slow turn .............................................................................................................................................. 90
6.15.1 Running sequence slow turn ............................................................................................................... 90
6.15.2 Parameter slow turn ............................................................................................................................ 91
6.15.3 Signal progression for direction of rotation recognition ....................................................................... 91
6.16 Ajdusting instruction of software PID-controller .................................................................................. 92
6.17 Splash oil ............................................................................................................................................. 93
6.17.1 General ................................................................................................................................................ 93
6.17.2 Subfunctions ........................................................................................................................................ 94
6.17.3 Monitoring Regarding Maximum Value Exceeding ............................................................................. 94
6.17.4 Monitoring Regarding Mean Value Deviation ...................................................................................... 94
6.17.5 Wire Break ........................................................................................................................................... 95
6.17.6 Not Plausible ....................................................................................................................................... 95
6.17.7 Monitoring active ............................................................................................................................... 95
6.17.8 TIMER (INTERGRATED) .................................................................................................................... 95
461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 4 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 25.11.2013/ Comm. Edition
6.18
6.19
6.20
6.20.1









6.20.2








6.21
6.21.1
6.21.2
6.21.3
6.21.4
6.21.5
6.21.6
6.21.7

7

Generator power factor controller ........................................................................................................ 96


Testing of shut down valve X-1SZV1012 ............................................................................................ 97
CONTROL OF INTAKE AIR SYSTEM ................................................................................................ 98
Charge Air Blow-off System (xxMJQ61BR010/14) ............................................................................. 98
Interfaces .......................................................................................................................................... 98
Malfunction ........................................................................................................................................ 99
Alarms ............................................................................................................................................... 99
Start requirements ............................................................................................................................ 99
Normal operation: manual local ........................................................................................................ 99
Normal operation: manual remote .................................................................................................... 99
Normal operation: automatic remote ................................................................................................ 99
Normal operation: automatic local .................................................................................................... 99
Parameters Intake Air System ........................................................................................................ 100
General intake air instrumentation .................................................................................................... 101
Interfaces ........................................................................................................................................ 101
Malfunction ...................................................................................................................................... 101
Alarms ............................................................................................................................................. 102
Start requirements .......................................................................................................................... 102
Normal operation: manual local ...................................................................................................... 102
Normal operation: manual remote .................................................................................................. 102
Normal operation: automatic remote .............................................................................................. 102
Normal operation: automatic local .................................................................................................. 102
Princip of auxiliaries Operation modes .............................................................................................. 103
Manual Local Mode Auxiliary Drives ................................................................................................. 104
Manual Remote Mode Auxiliary Drives ............................................................................................. 105
Automatic Remote Mode Auxiliary Drives ......................................................................................... 106
Automatic Local Mode Auxiliary Drives ............................................................................................. 107
Double pumps ................................................................................................................................... 108
Manual pump switching ..................................................................................................................... 109
Double Starter Pumps, Master Selection Philosophy ....................................................................... 109

LV ENGINE Auxiliaries Panel +EAPx ................................................................. 113

7.1
LV ENGINE Auxiliaries Panel +EAPx frontview ................................................................................ 114
7.2
Pre lubrication pump 01MJV21AP030-M01 (P007) on MOD006 ...................................................... 115
7.2.1 Start prelubrication ............................................................................................................................ 115

Parameter Start prelubrication ........................................................................................................ 116
7.2.2 Cooling down the engine in case of shutdown .................................................................................. 116
7.2.3 Parameter: Cooling down function .................................................................................................... 116
7.3
Generator heating 01MKA01AH010 (H100) ..................................................................................... 117
7.4
Cylinder Lubrication 01MKA01AH010 (1EM2470) ............................................................................ 118
7.4.1 Area of application ............................................................................................................................. 118
7.4.2 Vgele System .................................................................................................................................. 118
7.4.3 Process sequence: Cylinder lubrication ............................................................................................ 119

Manual operation "Cylinder lubrication ON" ................................................................................... 119

Manual operation "Running-in mode" ............................................................................................. 119

Automatic operation ........................................................................................................................ 119

Control response in the event of failure of the input signals ........................................................... 119

Parameter: Cylinder lubrication ...................................................................................................... 120
7.5
Nozzle cooling water module 01MJG34AC010 (MOD005) ............................................................... 121
7.5.1 Parameters Nozzle cooling water module X0PAB48AC001 (MOD005) ........................................... 121
7.6
Fuel oil module 01END56AP010 (MOD008), HFO / light fuel oil (LFO)-Operation .......................... 122
Diesel operation ............................................................................................................................................. 122
HFO operation ................................................................................................................................................ 122
7.7
HT cooling water preheating module 01MJG31AP020-M01 (P070 on MOD004) ............................ 124
461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 5 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 25.11.2013/ Comm. Edition
7.8
7.9
7.9.1
7.10
7.10.1
7.10.2
7.10.3
7.10.4
7.10.5
7.11
7.12

Lube oil separator module 01MJV22AT010 (MOD007 ..................................................................... 125


Lubrication oil valve xxMJV23AA202-Y01 on MOD057 (SOV 2303) ................................................ 126
Value Parameter Lubrication oil valve xxMJV23AA202-Y01 (SOV 2303) ........................................ 127
Power house ventilator 1 / 2 xxUMF15AN010-M01 / xxUMF15AN010-M02 .................................... 128
Normal operation automatic remote .................................................................................................. 128
Operation manual remote Powerhouse ventilation system ............................................................ 129
Operation manual local Powerhouse ventilation system................................................................ 130
Malfunctions ...................................................................................................................................... 131
Alarms ............................................................................................................................................... 132
DO Shut Off Valve Before Booster Module 01EGD53AA202-Y01 ................................................... 133
HFO Shut Off Valve Before Engine 01END56AA202-Y01 ............................................................... 133

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 6 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 25.11.2013/ Comm. Edition

5HYLVLRQ+LVWRU\
5HYLVLRQ

:ULWWHQ

&KHFNHG

'DWH

6WDWXV(GLWLRQ

5HPDUN



6WHOOPDQQ

:HL



)$7



6WHOOPDQQ

:HL



&RPPLVVLRQLQJ

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 7 of 134

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

PRINCIPLE FRONT VIEW



2013-07-17 Revision A in work

)XQFWLRQDO'HVFULSWLRQ*&3

8 (134)

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23

-310P1
-302P1
-322P1
-322P2
-322P3
-310S1
-316P1
-324A2
-210A1
-232S2
-232S3
-508S1
-234S2
-234S1
-232S4
-232S1
-250H4
-232S6
-232S5
-500F1
-250H6
-250H1
-250H2
-250H3
24 -250H5
100 -160M1.1
101 -160M1

Panel label
Voltmeter alternator voltage
Ammeter alternator current
Double voltmeter synchronization voltage
Double frequency meter synchronization frequency
Synchronoscope
Selector switch alternator voltage
Multifunctional monitoring unit (MMU)
Automatic synchronization unit
Panel PC
Push button blue lamp test
Push button black acknowledge/reset
Push button red emergency stop
Control switch manual setting voltage, power factor lower/0/higher
Control switch manual setting Speed, frequency, load lower/0/higher
Selector switch local synchronization manual/OFF/automatic
Selector switch operation mode GCP/SCADA
LED position indicator alternator circuit breaker
Push button green alternator CB ON
Push button red alternator CB OFF
Alternator protection device
LED position indicator alternator neutral earthing switch
Signaling column red = engine stopping/standstill
Signaling column yellow = genset alarm
Signaling column green = engine starting/running
LED position indicator alternator earthing switch
Top filter
Filter ventilator




'LPHQVLRQV

:LGWK

PP

+HLJKW

PP

'HSWK

PP

2013-07-17 Revision A in work

)XQFWLRQDO'HVFULSWLRQ*&3

9 (134)

PRINCIPLE DESCRIPTION

2.1

Purpose
7KH*&3 *HQVHW&RQWURO3DQHO FRQWUROVSURWHFWVDQGVXSHUYLVHVWKHJHQVHW
HQJLQHDQGDOWHUQDWRU DQGWKHLUDX[LOLDULHV

2.2

Properties
7KH*&3LVORFDWHGLQWKHFRQWUROURRP
7KLVSDQHOFRQVLVWVRIDIXOO\HQFORVHGPHWDOFDELQHWLQVWHHOIUDPH
FRQVWUXFWLRQ 5LWWDO76+[:['PP DUUDQJHGIRUIORRUPRXQWLQJ
ZLWKRXWDSOLQWKWRWDOO\FORVHGDQGDIURQWGRRUZLWKDUXEEHUJDVNHW7KH
GRRUOHYHULVNH\OHVV&DEOHVLQVHUWIURPWKHERWWRP7KHFRROLQJLVUHDOL]HG
E\DGRRUIDQDQGURRIPRXQWHGWRSILOWHU7KHSDQHOOLJKWZLWKVRFNHWRXWOHW
LVUDWHGIRUDSRZHUVXSSO\LQSXW$&97KHSDQHOSURWHFWLRQGHJUHHLV
,3WKHFRORU5$/7KHSDQHOKDVDVLJQDOLQJFROXPQRQWKHURRIZLWK
UHG\HOORZDQGJUHHQ/('HOHPHQWVVKRZLQJWKHJHQVHWVWDWXV HQJLQH
VWRSSLQJVWDQGVWLOOJHQVHWDODUPHQJLQHVWDUWUXQQLQJ 
7KHLQSXWSRZHUVXSSO\IRUFRQWUROLVSURYLGHGIURPDQ$&9836
GLVWULEXWLRQV\VWHPDQGWKH'&9LVSURGXFHGZLWKLQWKHSDQHOE\D
UHJXODWHGSRZHUVXSSO\XQLW$&9'&9$VHSDUDWHEXIIHUPRGXOH
IRU'&9SRZHUVXSSO\LVLQWHJUDWHGWRSURYLGHDFRQWLQXRXVSRZHUVXSSO\
IRUWKHWRXFKSDQHO3&DQG3/&LQFDVHRIDVKRUWLQWHUUXSWLRQ
7KH3/& 3URJUDPPDEOH/RJLF&RQWUROOHU LVD6LHPHQV6,0$7,&6\VWHP6
ZLWKDGHFHQWUDOL]HG,2SHULSKHU\(707KHGRRULVHTXLSSHGZLWKD
WRXFKSDQHO3&IRURSHUDWLRQVXSHUYLVLRQDQGPRQLWRULQJ7ZRRSHUDWLQJ
PRGHVDUHVHOHFWDEOHE\DVZLWFK*&3 ORFDO DQG6&$'$ UHPRWH 7KH
DOWHUQDWRUFLUFXLWEUHDNHUV\QFKURQL]DWLRQFDQEHGRQHZLWKDGRRUPRXQWHG
DXWRPDWLFV\QFKURQL]DWLRQGHYLFHRUPDQXDOO\ZLWKKLJKHUORZHUVZLWFKHVIRU
YROWDJHDQGIUHTXHQF\GRXEOHYROWDJHDQGIUHTXHQF\PHWHUVD/('
V\QFKURQRVFRSHDQGDQLQWHUQDOO\PRXQWHGV\QFKURQL]DWLRQFKHFNUHOD\7KH
VHOHFWLRQRIWKHORFDOV\QFKURQL]DWLRQPRGHLVSRVVLEOHZLWKDVZLWFKIRUORFDO
V\QFKURQL]DWLRQ
$QDORJLQVWUXPHQWVDUHDYROWPHWHUZLWKYROWDJHVZLWFKDQGDQDPPHWHU$
GRRUPRXQWHG008 0XOWLIXQFWLRQDO0RQLWRULQJ8QLW SURYLGHVDOOUHOHYDQW
HOHFWULFDOGDWDWRWKH3/&DQGPRQLWRUVWKHGDWDRQLWVHOI7ZRPHDVXULQJ
WUDQVGXFHUVIRUDFWLYHSRZHUDQGSRZHUIDFWRUFRQWURODUHSURYLGHG
7KHGRRULVHTXLSSHGZLWKDPLPLFGLDJUDPRIWKHDOWHUQDWRUSRVLWLRQ
LQGLFDWRUVIRUWKHFLUFXLWEUHDNHUWKHHDUWKLQJDQGQHXWUDOHDUWKLQJVZLWFK
DQGSXVKEXWWRQVIRUFLUFXLWEUHDNHUFORVLQJDQGRSHQLQJ7KHODPSWHVWDQG
WKHDFNQRZOHGJHUHVHWDUHUHDOL]HGE\GRRUPRXQWHGEXWWRQV
7KH(0(5*(1&<6723EXWWRQVWRSVWKHHQJLQHRSHQVWKHDOWHUQDWRUFLUFXLW
EUHDNHUVWRSVWKHJHQVHWDX[LOLDULHVDQGGHH[FLWHVWKHDOWHUQDWRU7KH
$OWHUQDWRUSURWHFWLRQLVUHDOL]HGE\DGLJLWDOPXOWLIXQFWLRQSURWHFWLRQUHOD\

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 10 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7KHLQWHUQDOEXVLVDFRSSHU3URILEXVFRQQHFWLQJWKH3/&WKH008DQGWKH
SURWHFWLRQUHOD\7KH*&3LVFRQQHFWHGWRWKHDOWHUQDWRUPHGLXPYROWDJH
VZLWFKJHDUDQGWKHQHXWUDOHDUWKLQJVZLWFKJHDUYLDDKDUGZLUHGFRQQHFWLRQ
7KHFRQQHFWLRQWRRWKHUJHQVHWUHODWHGSDQHOVDQGWRWKH&&3 &RPPRQ
&RQWURO3DQHO LVUDWHGIRU3URILEXVILEHURSWLFXVLQJ2/0V 2SWLFDO/LQN
0RGXOH IRUFRQWURODQGYLDKDUGZLUHGFRQQHFWLRQIRUVLJQDOVUHOHYDQWIRU
VDIHW\7KHFRQQHFWLRQWRWKHILUHILJKWLQJDQG%&3 %RLOHU&RQWURO3DQHO LV
UDWHGYLDDKDUGZLUHGFRQQHFWLRQIRUVLJQDOVUHOHYDQWIRUVDIHW\7KH
FRQQHFWLRQWRWKH6&$'$V\VWHPLVUHDOL]HGYLDDFRSSHU(WKHUQHW

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 11 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

3
FUNCTIONAL DESCRIPTIONS OF OPERATION AND INDICATION
ELEMENTS

3.1

Switches and Push Buttons

3.1.1

Selector Switch Operation Mode GCP/SCADA











3.1.1.1Purpose
7KH*&36&$'$VZLWFK  VHOHFWVIROORZLQJRSHUDWLRQPRGHV
*&3
6&$'$

3.1.1.2Properties
)%25%#&#UYKVEJ
7KH*&36&$'$VZLWFK  LVODWFKLQJ
7KHVHOHFWLRQVKRXOGDYRLGFRQWUDGLFWRU\RSHUDWRUDFWLYLWLHVDWGLIIHUHQW
ORFDWLRQV
,WDOVRVHOHFWVEHWZHHQWKH*&3ORDGPDQDJHPHQWDQGWKH&&3ORDG
PDQDJHPHQW7KDWPHDQVDQLQGLYLGXDOJHQVHWORDGPDQDJHPHQWDQGWKH
UHOHDVHRIUHPRWHWKHORDGPDQDJHPHQW &&3 
.QECNRQUKVKQPCVVJGGPIKPG
7KHUHLVDORFDOUHPRWHVZLWFKDWWKHHQJLQH,IWKLVVZLWFKLVLQORFDOSRVLWLRQ
WRVWDUWDQGVWRSIURP*&3DQG6&$'$LVQRWSRVVLEOH
(YHU\VZLWFKLQJZLOOEHUHFRUGHGLQ6&$'$DQGWKHSDQHO3&DVDQHYHQW
(YHU\VZLWFKLQJWDNHVWKHRSHQHGDOWHUQDWRUFLUFXLWEUHDNHU &% WRWKH
PDQXDOUHPRWHPRGH7KLVDYRLGVDVWDUWRIV\QFKURQL]DWLRQE\FKDQJLQJWKH
*&36&$'$PRGH
,IWKH&%LVFORVHGWKHVZLWFKLQJGRHVQWFKDQJHWKHPRGHRIWKH&%
(YHU\VZLWFKLQJWHUPLQDWHVDUXQQLQJV\QFKURQL]DWLRQSURFHVVRIWKH
DOWHUQDWRU
4GOQVG
)%2 RQUKVKQPCVVJGGPIKPG
,Q*&3SRVLWLRQDOOFRQWUROHOHPHQWVDWWKH*&3DQGWKHSDQHO3&  DUH
DFWLYHDQGRSHUDEOH
,Q6&$'$SRVLWLRQWKHRSHUDWLRQDWWKH*&3LVLQKLELWHGH[FHSWRIWKH
HPHUJHQF\VWRSEXWWRQ  

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 12 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
DFNQRZOHGJHUHVHWEXWWRQ  
DOVRWKHEXWWRQDWWKHSDQHO3&
ODPSWHVWEXWWRQ  
7KHHPHUJHQF\VWRSEXWWRQ  LVDOZD\VRSHUDEOHEHFDXVHRIVDIHW\
UHDVRQVLQGHSHQGHQWRIWKHVHOHFWLRQPRGH
$OOVWDWXVLQGLFDWRUVDUHLQGHSHQGHQWRIWKHVHOHFWRUSRVLWLRQRIWKH
*&36&$'$VZLWFK  
7KHIXQFWLRQRIWKHDOWHUQDWRUSURWHFWLRQGHYLFH  LVDOVRLQGHSHQGHQWRI
WKHSRVLWLRQRIWKH*&36&$'$VZLWFK  
,Q*&3SRVLWLRQWKHJHQVHWLVDOZD\VLQWKHORDGPDQDJHPHQW*&3DXWRPDWLF
PRGH
%\FKDQJLQJIURP*&3WR6&$'$WKHJHQVHWVWD\VLQORDGPDQDJHPHQW*&3
DXWRPDWLFPRGH ,QGLYLGXDOORDGVHWWLQJZLOOEHWDNHQRYHU 
7KHORDGPDQDJHPHQW&&3DXWRPDWLFPRGHPXVWEHVHOHFWHGE\WKH
RSHUDWRUDW6&$'$LIWKHJHQVHWSDUWLFLSDWHVDWWKHFRPPRQORDG
PDQDJHPHQW PRGHORDGPDQDJHPHQW&&3DXWRPDWLFPRGH 7KLVPRGHLV
RQO\DYDLODEOHLQWKH6&$'$PRGHDQGFDQRQO\EHVHOHFWHGDW6&$'$
:KHQFKDQJLQJIURPWKHSRVLWLRQ6&$'$WR*&3WKHJHQVHWFKDQJHV
LPPHGLDWHO\LQWRWKHPRGHORDGPDQDJHPHQW*&3DXWRPDWLFPRGH
/RDGPDQDJHPHQW*&3DXWRPDWLFPRGHPHDQVDQLQGLYLGXDOVHOHFWLRQRI
WKHORDGVHWSRLQWE\WKHRSHUDWRU
/RDGPDQDJHPHQW&&3DXWRPDWLFPRGHPHDQVDFRPPRQVHOHFWLRQRIWKH
ORDGVHWSRLQWVE\WKH&&33/&&RPPRQORDGPDQDJHPHQWLQFOXGHVORDG
VKDULQJSRZHUIDFWRUVKDULQJVWDUWVWRSV\QFKURQL]DWLRQDQGORDGVHWWLQJRI
JHQVHWV
)RUPRUHLQIRUPDWLRQVHHWKHFKDSWHU/RDG0DQDJHPHQW
Remarks:
$FKDQJHRIWKHVHOHFWLRQPRGHFDXVHVQRIXQGDPHQWDOFKDQJHRIWKH
HQJLQHHJWKHHQJLQHVWDUWUXQQLQJVWRSSLQJDQGVKXWGRZQ
([FHSWLRQ7KHV\QFKURQL]DWLRQLVWHUPLQDWHG
$FKDQJHEHWZHHQWKHHQJLQHORFDODQGUHPRWHRSHUDWLRQWHUPLQDWHVWKH
V\QFKURQL]DWLRQ
$FKDQJHEHWZHHQWKHFLUFXLWEUHDNHUORFDODQGUHPRWHRSHUDWLRQDWWKH09
VZLWFKJHDUWHUPLQDWHVWKHV\QFKURQL]DWLRQ

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 13 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.1.2

Selector Switch Alternator Voltage














3.1.2.1Purpose
7KHDOWHUQDWRUYROWDJHVZLWFK  VZLWFKHVWKHYROWDJHRIWKHDOWHUQDWRU
YROWDJHWUDQVIRUPHU 97 LQWKHDOWHUQDWRUPHGLXPYROWDJH 09 VZLWFKJHDU
SDQHODFFRUGLQJWRWKHVZLWFKSRVLWLRQ

3.1.2.2Properties
7KHDOWHUQDWRUYROWDJHVZLWFK  LVODWFKLQJ
<RXFDQVHOHFWIRXUSRVLWLRQV

2))
//
//
//

GHHQHUJL]HG
YROWDJHEHWZHHQSKDVHDQGRIWKHDOWHUQDWRU
YROWDJHEHWZHHQSKDVHDQGRIWKHDOWHUQDWRU
YROWDJHEHWZHHQSKDVHDQGRIWKHDOWHUQDWRU

7KHSRVLWLRQ2))HQDEOHVDYROWPHWHUH[FKDQJHGXULQJJHQVHWUXQQLQJ

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 14 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.1.3

Selector Switch Local Synchronization Manual/OFF/Automatic











3.1.3.1Purpose
7KHORFDOV\QFKURQL]DWLRQVZLWFK  VHOHFWVWKHPRGHV
PDQXDO
2))
DXWRPDWLF

3.1.3.2Properties
7KHORFDOV\QFKURQL]DWLRQVZLWFK  LVODWFKLQJ
7KHVHVHOHFWLRQVDUHRQO\HIIHFWLYHLIWKH*&36&$'$VZLWFK  LVLQ*&3
SRVLWLRQ,Q6&$'$SRVLWLRQJHQHUDOO\WKHDXWRPDWLFV\QFKURQL]DWLRQ
IXQFWLRQLVVHOHFWHGLQGHSHQGHQWRIWKHSRVLWLRQRIWKHORFDOV\QFKURQL]DWLRQ
VZLWFK  
,QWKH*&3PRGHHDFKVHOHFWLRQFDXVHVDQHYHQW

2))

,QWKLVSRVLWLRQQRORFDOV\QFKURQL]DWLRQKDSSHQVDQGDUXQQLQJ
V\QFKURQL]DWLRQLVDERUWHG

0DQXDO

3UHFRQGLWLRQ7KHHQJLQHUXQVWKHDOWHUQDWRUH[FLWDWLRQLVRQWKHVHOHFWRU
VZLWFKORFDOUHPRWHDWWKH09VZLWFKJHDULVLQUHPRWHSRVLWLRQ
,IWKHORFDOV\QFKURQL]DWLRQVZLWFK  LVLQPDQXDOSRVLWLRQWKH
DOWHUQDWRU&%LVPDQXDOUHPRWHPRGHDWWKHYLVXDOL]DWLRQ
V\QFKURQRVFRSH  GRXEOHYROWPHWHU  DQGGRXEOHIUHTXHQF\PHWHU  
DUHVZLWFKHGRQ
YROWDJHVDUHVZLWFKHGWRWKHV\QFKURFKHFNUHOD\
,IWKHDOWHUQDWRU&%LVLQPDQXDOUHPRWHPRGHWKHDOWHUQDWRU&%21EXWWRQ
 RUWKHVRIWEXWWRQDWWKHSDQHO3&PXVWEHSXVKHG7KLVVKDOODYRLGD
IDXOW\V\QFKURQL]DWLRQ,IWKHDOWHUQDWRU&%LVLQDXWRPDWLFUHPRWHPRGH
SXVKLQJWKHDOWHUQDWRU&%21EXWWRQ  LVQRWQHFHVVDU\
1RZWKHPDQXDOV\QFKURQL]DWLRQLVSRVVLEOHE\WKHYROWDJHDQGSRZHU
IDFWRUVZLWFK  DQGWKHVSHHGDQGIUHTXHQF\VZLWFK  ,IWKHIUHTXHQF\
DQGYROWDJHKDYHEHHQDGMXVWHGLQWRWKHUDQJHZKLFKLVVHWLQWKHV\QFKUR
FKHFNUHOD\WKHUHOD\FORVHVWKHDOWHUQDWRU&%
,IWKHDOWHUQDWRU&%LVFORVHGVXFFHVVIXOO\WKHV\QFKURQL]DWLRQZLOOEHILQLVKHG
DQGWKHV\QFKURQRVFRSH  GRXEOHYROWPHWHU  GRXEOHIUHTXHQF\PHWHU
 DQGWKHV\QFKURFKHFNUHOD\ZLOOEHVZLWFKHGRII7KHVHOHFWRUVZLWFKLV
QRZRXWRIIXQFWLRQ7KHV\QFKURQL]DWLRQWLPHLVQRWPRQLWRUHG

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 15 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

$XWRPDWLF

3UHFRQGLWLRQ7KHHQJLQHUXQVDQGDOWHUQDWRUH[FLWDWLRQLVRQ
,IWKHORFDOV\QFKURQL]DWLRQVZLWFK  LVLQDXWRPDWLFSRVLWLRQWKH
DOWHUQDWRU&%LVLQPDQXDOUHPRWHPRGHDWWKHYLVXDOL]DWLRQ
DOWHUQDWRU&%21EXWWRQ  RUWKHEXWWRQRQWKHSDQHO3&LVSXVKHG
V\QFKURQRVFRSH  GRXEOHYROWPHWHU  DQGGRXEOHIUHTXHQF\PHWHU  
DUHVZLWFKHGRQ
YROWDJHVDUHVZLWFKHGWRWKHV\QFKURFKHFNUHOD\DQGWKHDXWRPDWLF
V\QFKURQL]DWLRQXQLW
,IWKHDOWHUQDWRU&%LVLQDXWRPDWLFUHPRWHPRGHSXVKLQJDEXWWRQLVQRW
QHFHVVDU\
7KHDXWRPDWLFV\QFKURQL]DWLRQLVQRZSRVVLEOHE\WKHDXWRPDWLF
V\QFKURQL]DWLRQXQLW  7KLVXQLWSURYLGHVWKHV\QFKURQL]DWLRQE\PDWFKLQJ
WKHJHQVHWIUHTXHQF\DQGYROWDJH7KHDXWRPDWLFV\QFKURQL]DWLRQFDQEH
PRQLWRUHGE\WKHXQLWDQGE\WKHV\QFKURQRVFRSH  GRXEOHYROWPHWHU  
DQGGRXEOHIUHTXHQF\PHWHU  
,IIUHTXHQF\DQGYROWDJHDUHDXWRPDWLFDOO\DGMXVWHGWKHDOWHUQDWRU&%ZLOOEH
FORVHGE\WKHDXWRPDWLFV\QFKURQL]DWLRQXQLW,IWKHDOWHUQDWRU&%LVFORVHG
VXFFHVVIXOO\WKHV\QFKURQL]DWLRQZLOOEHILQLVKHG7KHDXWRPDWLF
V\QFKURQL]DWLRQWLPHLVPRQLWRUHGE\WKH3/&$QDODUPVLJQDOLVDQQRXQFHG
LIWKHDOWHUQDWRU&%FORVLQJE\V\QFKURQL]DWLRQLVUHTXHVWHGWKHVHOHFWHG
WLPH PLQXWHV KDVHODSVHGDQGWKHV\QFKURQL]DWLRQLVDERUWHG
,IWKHV\QFKURQL]DWLRQLVFDQFHOOHGWKHDOWHUQDWRU&%LVVHWWRWKHPDQXDO
UHPRWHPRGH

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 16 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.1.4

Control Switch Manual Setting Voltage, Power Factor Lower/0/Higher











3.1.4.1Purpose
7KHYROWDJHDQGSRZHUIDFWRUVZLWFK  VHWVWKH
YROWDJHGXULQJHQJLQHLGOHUXQZLWKH[FLWDWLRQ
YROWDJHRIJHQVHWGXULQJWKHPDQXDOV\QFKURQL]DWLRQSURFHVV
PDQXDOSRZHUIDFWRURUYROWDJHLIWKHDOWHUQDWRUFLUFXLWEUHDNHULVFORVHG

3.1.4.2Properties
7KHYROWDJHDQGSRZHUIDFWRUVZLWFK  LVQRQODWFKLQJ
7KHVZLWFKLVRQO\RSHUDWLRQDOLIWKH*&36&$'$VZLWFK  LVLQ*&3
SRVLWLRQDQGORFDOUHPRWHVZLWFKDWWKHHQJLQHLVLQUHPRWHSRVLWLRQ
7KLVVZLWFKLVRXWRIRSHUDWLRQ
GXULQJDQHQJLQHVWRSDQGHQJLQHVWDQGVWLOO
LQFDVHRIDQRQJRLQJV\QFKURQL]DWLRQSURFHVV PDQXDORUDXWRPDWLF RQ
WKHVDPH09EXVEDUOLNHWKHDOWHUQDWRU
GXULQJDQDXWRPDWLFV\QFKURQL]DWLRQ
,QLGOHUXQ WKHDOWHUQDWRUFLUFXLWEUHDNHULVRSHQHG WKHVZLWFKFKDQJHVWKH
YROWDJHGLUHFWO\WKURXJK3/&
,QWKHJULGSDUDOOHOPRGHRIWKHJHQVHWWKHVZLWFKFKDQJHVWKHSRZHUIDFWRU
VHWWLQJE\FKDQJLQJWKHVHWSRLQWRIWKHSRZHUIDFWRU
,QWKHLVODQGPRGHRIWKHJHQVHWWKHVZLWFKFKDQJHVWKHYROWDJHVHWWLQJ
:LWKRXWH[FLWDWLRQRIWKHDOWHUQDWRUWKLVVZLWFKLVRXWRIRSHUDWLRQ

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 17 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.1.5

Control Switch Manual Setting Speed, Frequency, Load Lower/0/Higher











3.1.5.1Purpose
7KHVSHHGDQGIUHTXHQF\VZLWFK  VHWVWKH

HQJLQHVSHHGGXULQJHQJLQHLGOHUXQZLWKRXWH[FLWDWLRQ
HQJLQHIUHTXHQF\GXULQJHQJLQHLGOHUXQZLWKH[FLWDWLRQ
IUHTXHQF\RIWKHJHQVHWGXULQJDPDQXDOV\QFKURQL]DWLRQSURFHVV
PDQXDODFWLYHORDGLIWKHDOWHUQDWRUFLUFXLWEUHDNHULVFORVHG

3.1.5.2Properties
7KHVSHHGDQGIUHTXHQF\VZLWFK  LVQRQODWFKLQJ
7KHVZLWFKLVRQO\RSHUDWLRQDOLIWKH*&36&$'$VZLWFK  LVLQ*&3
SRVLWLRQDQGORFDOUHPRWHVZLWFKDWWKHHQJLQHLVLQUHPRWHSRVLWLRQ
7KLVVZLWFKLVRXWRIRSHUDWLRQ
GXULQJDQHQJLQHVWRSDQGHQJLQHVWDQGVWLOO
LQFDVHRIDQRQJRLQJV\QFKURQL]DWLRQSURFHVV PDQXDORUDXWRPDWLF RQ
WKHVDPH09EXVEDUOLNHWKHDOWHUQDWRU
GXULQJDQDXWRPDWLFV\QFKURQL]DWLRQ
,QWKHLGOHUXQQLQJPRGH WKHDOWHUQDWRUFLUFXLWEUHDNHULVRSHQHG WKH
VZLWFKFKDQJHVWKHVSHHGDQGWKHIUHTXHQF\
,QLVODQGPRGHWKHVZLWFKFKDQJHVWKHIUHTXHQF\DQGORDGVHWWLQJ
,QJULGSDUDOOHOPRGH WKHDOWHUQDWRUFLUFXLWEUHDNHULVFORVHG WKHVZLWFK
FKDQJHVRQO\WKHVHWSRLQWRIWKHORDG VWHSVZLWKHDFKVZLWFKLQJ 

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 18 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.1.6

Push Button Red Emergency Stop






















3.1.6.1Purpose
7KHHPHUJHQF\VWRSEXWWRQ  

HIIHFWVDVKXWGRZQRIWKHHQJLQH
GLVDEOHVWKHUHOHDVHRIWKHJRYHUQRUIRUWKHHQJLQH
RSHQVWKHDOWHUQDWRUFLUFXLWEUHDNHU &% 
HIIHFWVWKHDOWHUQDWRUGHH[FLWDWLRQ
VWRSVWKHJHQVHWDX[LOLDULHV DOOGULYHV 
VZLWFKHVDOOJHQVHWDX[LOLDULHV DOOGULYHV ZKLFKDUHLQDXWRPDWLFUHPRWHWR
PDQXDOUHPRWHPRGH
VZLWFKHVWKHJHQVHWIURPWKHORDGPDQDJHPHQW&&3DXWRPDWLFPRGHWR
ORDGPDQDJHPHQW*&3DXWRPDWLFPRGH

3.1.6.2Properties
7KHHPHUJHQF\VWRSEXWWRQ  LVDOZD\VRSHUDEOHLQGHSHQGHQWRIWKH
RSHUDWLRQPRGH *&36&$'$VZLWFKDQGORFDOUHPRWHVZLWFKDWWKHHQJLQH 
7KHHPHUJHQF\VWRSEXWWRQ  

LVODWFKLQJ
ZLWKRXWNH\
LVFRXQWHUFORFNZLVHXQORFNLQJ
LVDUHGPXVKURRPEXWWRQZLWKD\HOORZVDIHW\FROODU
DJDLQVWRSHUDWLQJHUURU
WLWOHGE\DODEHOZLWKZKLWHFKDUDFWHUVRQUHGEDFNJURXQG
$IWHUXQORFNLQJWKHHPHUJHQF\VWRSEXWWRQ  WKHDFNQRZOHGJHUHVHW
EXWWRQ  RUEXWWRQDWWKHYLVXDOL]DWLRQPXVWEHSXVKHGWRH[LWWKH
HPHUJHQF\VWRSVWDWXV
,IWKHHPHUJHQF\VWRSLVDFWLYDWHGDQGWKHJHQVHWLVVHWWR6&$'$DQGWKH
ORDGPDQDJHPHQW&&3DXWRPDWLFPRGHWKHJHQVHWZLOOEHVHWWRWKHORDG
PDQDJHPHQW*&3DXWRPDWLFPRGH
$IWHUDUHVHWWKHRSHUDWRUPXVWFKDQJHWKHJHQVHWDW6&$'$WRWKHORDG
PDQDJHPHQW&&3DXWRPDWLFPRGHVRWKDWLWFDQSDUWLFLSDWHDJDLQDWWKH
FRPPRQORDGPDQDJHPHQW
$UHVHWDIWHUXQORDGLQJWKHHPHUJHQF\VWRSEXWWRQ  LVRQO\SRVVLEOHDIWHU
DQHQJLQHVWDQGVWLOODQGWLPH VHF 

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 19 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7KHHPHUJHQF\VWRSEXWWRQ  KDVVHSDUDWHFRQWDFWV
2QHFRQWDFW RSHQHGLISXVKHG LVSDUWRIWKH
HQJLQHVDIHW\FKDLQ
DOWHUQDWRU&%RSHQWULSORRS XQGHUYROWDJHFRLO 
HPHUJHQF\VWRSORRSRIWKHHQJLQHDX[LOLDU\GULYHV
2QHFRQWDFW FORVHGLISXVKHG WUDQVIHUVWKHSXVKLQJRIWKHHPHUJHQF\VWRS
EXWWRQ  DVDQDODUPWRWKH3/&
2QHFRQWDFW FORVHGLISXVKHG LVFRQQHFWHGWRWKHWULSSLQJFRLORIWKH
DOWHUQDWRUFXUUHQWEUHDNHU
7KH3/&
HIIHFWVDVKXWGRZQRIWKHHQJLQH
GLVDEOHVWKHUHOHDVHRIWKHJRYHUQRUIRUWKHHQJLQH
RSHQVWKHDOWHUQDWRUFLUFXLWEUHDNHU &% DQGVZLWFKHVWKH&%WRPDQXDO
UHPRWHPRGH
HIIHFWVDOWHUQDWRUGHH[FLWDWLRQ
DQGVZLWFKHVWKHH[FLWDWLRQUHOHDVHWRWKHPDQXDOUHPRWHPRGH
VWRSVWKHJHQVHWDX[LOLDULHV
VZLWFKHVDOOJHQVHWDX[LOLDULHV
ZKLFKDUHLQDXWRPDWLFUHPRWHWRPDQXDOUHPRWHPRGH
VZLWFKHVWKHJHQVHWIURPWKHORDGPDQDJHPHQW&&3DXWRPDWLFPRGHWR
WKHORDGPDQDJHPHQW*&3DXWRPDWLFPRGH

2SHUDWLQJ(UURU

$QDFFLGHQWDODFWLYDWLRQRIWKHHPHUJHQF\VWRSEXWWRQ  FDXVHVD
FRPSOHWHXQFRQWUROOHGVKXWGRZQRIWKHJHQVHW LPPHGLDWHGLVFKDUJHQR
SRVWOXEULFDWLRQQRSRVWFRROLQJ 

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 20 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.1.7

Push Button Black Acknowledge/Reset










3.1.7.1Purpose
7KHDFNQRZOHGJHUHVHWEXWWRQ  DFNQRZOHGJHV FRQILUPWKH
DODUPVKXWGRZQ DQGUHVHWV FOHDUVEORFNLQJDQGUHOHDVHV RI
DODUPVVKXWGRZQV

3.1.7.2Properties
7KHDFNQRZOHGJHUHVHWEXWWRQ  LVDOZD\VRSHUDWLRQDOLQGHSHQGHQWRIWKH
RSHUDWLRQPRGH *&36&$'$VZLWFKDQGORFDOUHPRWHVZLWFKDWWKHHQJLQH 
7KHDFNQRZOHGJHUHVHWEXWWRQ  LVQRQODWFKLQJ,WLVFRQQHFWHGWRWKH
3/&
,IWKHDODUPVKXWGRZQLVVWLOODFWLYHWKH\HOORZOLJKWDWWKHVLJQDOLQJFROXPQ
 FKDQJHVIURPIODVKLQJWRVWHDG\VWDWXV
2QWKHSDQHO3&WKHDODUPVKXWGRZQZLOOEHLQGLFDWHGDFNQRZOHGJHGLQWKH
GURSGRZQPHQXDFWLYHDODUPVDQGDUFKLYHWDEOH
7KHUHVHWRIWKHDODUPVKXWGRZQLVRQO\SRVVLEOHLIWKHDODUPVKXWGRZQLV
QRWDFWLYHDQ\PRUH,QWKLVFDVHWKH\HOORZOLJKWRIWKHVLJQDOLQJFROXPQ  
ZLOOEHVZLWFKHGRIILIQRIXUWKHUDODUPVKXWGRZQLVDFWLYH
2QWKHSDQHO3&WKHDODUPVKXWGRZQZLOOEHGHOHWHGLQDFWLYHDODUPVDQG
LQGLFDWHGDVJRQHLQWKHDUFKLYHWDEOH
7KHVDPHIXQFWLRQFDQEHUHDOL]HGE\FOLFNLQJWKHUHVHWEXWWRQDWWKHSDQHO
3&RUDWWKH6&$'$RSHUDWRUVWDWLRQLQGHSHQGHQWRIWKHRSHUDWLQJPRGH
*&36&$'$VZLWFKDQGORFDOUHPRWHVZLWFKDWWKHHQJLQH 

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 21 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.1.8

Push Button Blue Lamp Test










3.1.8.1Purpose
7KHODPSWHVWEXWWRQ  WHVWVWKHKRUQWKHLQGLFDWLRQODPSVDQG/('V

3.1.8.2Properties
7KHODPSWHVWEXWWRQ  LVDOZD\VRSHUDWLRQDOLQGHSHQGHQWRIWKH
RSHUDWLRQPRGH *&36&$'$VZLWFKDQGORFDOUHPRWHVZLWFKDWWKHHQJLQH 
7KHODPSWHVWEXWWRQ  LVQRQODWFKLQJ,WLVFRQQHFWHGWRWKH3/&
%\SXVKLQJWKHEXWWRQDOOLQGLFDWLRQODPSVRQWKH*&3DUHOLWIRUVHFRQGV
KROGLQJWKHEXWWRQGRHVQWNHHSWKHODPSV/('VOLWUHSHDWHGSXVKLQJ
ZLWKLQWKHVHFZLOOQRWH[WHQGWKHOLWWLPH

VLJQDOLQJFROXPQ  UHG\HOORZJUHHQ
DOWHUQDWRU&%LQGLFDWRU  
DOWHUQDWRUQHXWUDOHDUWKLQJVZLWFKLQGLFDWRU  
DOWHUQDWRUHDUWKLQJVZLWFKLQGLFDWRU  


Remark
,QSDQHOVZLWKRXWD&38WKHODPSWHVWLVRQO\SURYLGHGKDUGZLUHG
,QSDQHOVZLWKD&38WKHODPSWHVWLVRQO\SURYLGHGIRUVRIWZDUH

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 22 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.1.9

Push Button Green Alternator CB ON










3.1.9.1Purpose
7KHDOWHUQDWRU&%21EXWWRQ  LQLWLDOL]HVWKHORFDOV\QFKURQL]DWLRQ
SURFHGXUHWRFORVHWKHDOWHUQDWRUFLUFXLWEUHDNHU

3.1.9.2Properties
7KHDOWHUQDWRU&%21EXWWRQ  LVQRQODWFKLQJ
7KHDOWHUQDWRU&%21EXWWRQ  RQO\ZRUNVLIWKH*&36&$'$VZLWFK  LV
LQ*&3SRVLWLRQDQGWKHORFDOUHPRWHVZLWFKDWWKHDOWHUQDWRUSDQHORIWKH
09VZLWFKJHDULVLQUHPRWHSRVLWLRQ
,Q*&3PRGHSXVKLQJWKHDOWHUQDWRU&%21EXWWRQ  LVUHFRUGHGDVDQ
HYHQW
7KHDOWHUQDWRU&%21EXWWRQ  VWDUWVWKHORFDOV\QFKURQL]DWLRQSURFHVVLI
WKHORFDOV\QFKURQL]DWLRQVZLWFK  LVLQPDQXDORUDXWRPDWLFSRVLWLRQDQG
LIV\QFKURQL]DWLRQSUHFRQGLWLRQVDUHIXOILOOHGLHWKHHQJLQHVSHHGLV
DQGWKHH[FLWDWLRQLVRQ
)RUIXUWKHUGHWDLOVVHHWKHFKDSWHU6\QFKURQL]DWLRQRI&LUFXLW%UHDNHUV
7KHDOWHUQDWRU&%21EXWWRQ  LVZLWKRXWIXQFWLRQLIWKHORFDO
V\QFKURQL]DWLRQVZLWFK  LVLQ2))SRVLWLRQRUWKHDOWHUQDWRUFLUFXLWEUHDNHU
LVLQDXWRPDWLFUHPRWHPRGHRUWKH*&36&$'$VZLWFKLVLQ6&$'$SRVLWLRQ
3XVKLQJWKHDOWHUQDWRU&%21EXWWRQ  LVQRZKHUHVWRUHGDVDFRPPDQG
LIWKHORFDOV\QFKURQL]DWLRQVZLWFK  LVLQ2))SRVLWLRQRUWKH*&36&$'$
VZLWFK  LVLQ6&$'$SRVLWLRQ7KDWPHDQVWKDWDQ\SXVKLQJLVEORFNHGLI
WKHSUHFRQGLWLRQVDUHQRWIXOILOOHG,IWKHSUHFRQGLWLRQVDUHIXOILOOHGWKH
DOWHUQDWRU&%21EXWWRQ  PXVWEHSXVKHGDJDLQWRLQLWLDOL]HWKHORFDO
V\QFKURQL]DWLRQSURFHGXUH
3XVKLQJWKHDOWHUQDWRU&%21EXWWRQ  VZLWFKHVWKHDOWHUQDWRUYROWDJHWR
WKHGRXEOHYROWPHWHU  GRXEOHIUHTXHQF\PHWHU  V\QFKURQRVFRSH  
DQGLQWHUQDOPRXQWHGV\QFKURFKHFNUHOD\7KLVLVYDOLGIRUWKHPDQXDORU
DXWRPDWLFSRVLWLRQRIWKHORFDOV\QFKURQL]DWLRQVZLWFK  
)RUPDQXDOV\QFKURQL]DWLRQWKHORFDOV\QFKURQL]DWLRQVZLWFK  KDVWREH
LQPDQXDOSRVLWLRQ7KHUHE\WKHVZLWFKHVIRUPDQXDOYROWDJHDQGSRZHU
IDFWRUVZLWFK  DQGWKHVSHHGDQGIUHTXHQF\VZLWFK  DUHJHWWLQJ
DFWLYDWHGIRUYROWDJHDQGIUHTXHQF\DGMXVWPHQW
)RUDXWRPDWLFV\QFKURQL]DWLRQWKHORFDOV\QFKURQL]DWLRQVZLWFK  PXVWEH
LQDXWRPDWLFSRVLWLRQ7KHUHE\WKHV\QFKURQL]DWLRQZLOOEHFDUULHGRXWE\WKH
DXWRPDWLFV\QFKURQL]DWLRQXQLW  
3XVKLQJWKHDOWHUQDWRU&%21EXWWRQ  RQFHLVVXIILFLHQWWRLQLWLDWHWKH
FLUFXLWEUHDNHUFORVLQJLQPDQXDODQGDXWRPDWLFPRGH

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 23 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
,QPDQXDOSRVLWLRQRIWKHORFDOV\QFKURQL]DWLRQVZLWFK  WKHLQWHUQDO
PRXQWHGV\QFKURFKHFNUHOD\ZLWKLWVUHOHDVHFRQWDFWJLYHVWKHFRPPDQGWR
FORVHWKHFLUFXLWEUHDNHULIWKHV\QFKURQL]DWLRQFRQGLWLRQVDUHDFFRPSOLVKHG
,QDXWRPDWLFSRVLWLRQRIWKHORFDOV\QFKURQL]DWLRQVZLWFK  WKHDXWRPDWLF
V\QFKURQL]DWLRQXQLW  JLYHVWKHFRPPDQGWRFORVHWKHDOWHUQDWRUFLUFXLW
EUHDNHUEXWWKHLQWHUQDOPRXQWHGV\QFKURFKHFNUHOD\DFWVDVDEDFNXS
UHOHDVHZLQGRZ,WVUHOHDVHFRQWDFWPXVWEHDOVRFORVHG
'XULQJV\QFKURQL]DWLRQ DOWHUQDWRUFLUFXLWEUHDNHUFORVLQJSURFHGXUH WKH
DOWHUQDWRU&%LQGLFDWRU  VKRZVJUHHQIODVKLQJVWHDG\UHG
,IWKHSURFHGXUHLVVXFFHVVIXOO\FRPSOHWHGWKHDOWHUQDWRU&%LQGLFDWRU  
VKRZVVWHDG\JUHHQDQGUHGLVRII
7KHIXQFWLRQRIWKHDOWHUQDWRU&%21EXWWRQ  FDQEHFDQFHOOHGE\WKH
DOWHUQDWRU&%2))EXWWRQ  VZLWFKLQJWKHORFDOV\QFKURQL]DWLRQVZLWFK  
WR2))SRVLWLRQRUVZLWFKLQJWKH*&36&$'$VZLWFK  LQSRVLWLRQ6&$'$
7KHDXWRV\QFKURQL]DWLRQFDQDOVREHGRQHE\6&$'$LIWKH*&36&$'$
VZLWFK  LVLQSRVLWLRQ6&$'$0DQXDOV\QFKURQL]DWLRQLVRQO\SRVVLEOHLQ
*&3PRGH
5HPDUN
7KHV\QFKURQL]DWLRQLVDERUWHGZLWKDQH[FLWDWLRQIDLOXUH

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 24 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.1.10 Push Button Red - Alternator CB OFF










3.1.10.1

Purpose
7KHDOWHUQDWRU&%2))EXWWRQ  VZLWFKHVRIIWKHDOWHUQDWRUFLUFXLWEUHDNHU
,WDOVRFDQFHOVWKHFORVLQJV\QFKURQL]DWLRQSURFHGXUH7KLVIXQFWLRQDOLW\LV
DOVRJLYHQE\WKHFRUUHVSRQGLQJEXWWRQRQWKHSDQHO3&

3.1.10.2

Properties
7KHDOWHUQDWRU&%2))EXWWRQ  LVQRQODWFKLQJ
7KHDOWHUQDWRU&%2))EXWWRQ  RSHUDWHVRQO\LIWKH*&36&$'$VZLWFK
 LVLQ*&3SRVLWLRQDQGWKHORFDOUHPRWHVZLWFKDWWKH09VZLWFKJHDULV
LQUHPRWHSRVLWLRQ
6SHFLDOIXQFWLRQ,IWKH*&36&$'$VZLWFK  LVLQ*&3SRVLWLRQWKLVEXWWRQ
LVDOVRLQRSHUDWLRQLIWKHJHQVHWLVLQWKHHQJLQHORFDOPRGH
7KLVLVQRWSRVVLEOHE\WKHEXWWRQRQWKHSDQHO3&EHFDXVHDQRSHUDWLQJRQ
WKHSDQHO3&LVQRWSRVVLEOHIRUWKHDOWHUQDWRU&%LQHQJLQHORFDOPRGH
,QHQJLQHORFDOPRGHSXVKLQJWKHEXWWRQRSHQVWKHDOWHUQDWRU&%DQG
VZLWFKHVRIIWKHH[FLWDWLRQ
,Q*&3PRGHDQGORFDOPRGHSXVKLQJWKHDOWHUQDWRU&%2))EXWWRQ  LV
UHFRUGHGDVDQHYHQW
3XVKLQJWKLVEXWWRQDOZD\VVZLWFKHVWKHDOWHUQDWRU&%WRPDQXDOUHPRWH
PRGH WRDYRLGVWDUWLQJWKHV\QFKURQL]DWLRQ 
3XVKLQJWKHDOWHUQDWRU&%2))EXWWRQ  LVQRZKHUHVWRUHGDVDFRPPDQG
LIWKH*&36&$'$VZLWFK  LVLQ6&$'$SRVLWLRQ7KDWPHDQVWKDWDQ\
SXVKLQJLVEORFNHGLIWKHSUHFRQGLWLRQ *&36&$'$VZLWFK  LQ*&3
SRVLWLRQ LVQRWIXOILOOHG,IWKHSUHFRQGLWLRQLVIXOILOOHGWKHDOWHUQDWRU&%2))
EXWWRQ  PXVWEHSXVKHGWRVZLWFKRIIWKHDOWHUQDWRU&%DQGWRFDQFHOWKH
FORVLQJDQGV\QFKURQL]DWLRQSURFHGXUH
3XVKLQJWKHDOWHUQDWRU&%2))EXWWRQ  JLYHVDQRSHQSXOVHFRQWDFWWR
WKH3/&
,IWKHFLUFXLWEUHDNHUGRHVQRWRSHQE\SXVKLQJWKLVEXWWRQQREUHDNHU
IDLOXUHSURFHGXUH $16,%) LVLQLWLDOL]HGEXWDIDLOXUHLVDQQRXQFHG7KLVLV
DOVRYDOLGIRUWKHEXWWRQRQWKHSDQHO3&7RUHVHWWKHIDLOXUHWKH&%PXVW
EHRSHQHGDJDLQ
$WWHQWLRQ
3XVKLQJWKHDOWHUQDWRU&%2))EXWWRQ  RSHQVWKHFLUFXLWEUHDNHULQWKH
RSHUDWLRQPRGH*&3XQGHUIXOOUHVSRQVLELOLW\RIWKHRSHUDWRU7KLVLVDOVR
JLYHQE\WKHEXWWRQRQWKHSDQHO3&/RDGFRQGLWLRQVOLNHIXOOORDGUHMHFWLRQ
DUHQRWEORFNHG

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 25 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
5HPDUN
$ORDGGHFUHDVLQJE\DUDPSLVRQO\SURYLGHGED\DQHQJLQHVWRSSLQJ
SURFHGXUHQRWE\DQDOWHUQDWRU&%RSHQLQJFRPPDQG
,IWKHDOWHUQDWRUFLUFXLWEUHDNHULVRSHQHGWKHDOWHUQDWRU&%LQGLFDWRU  
VKRZVVWHDG\UHGDQGJUHHQRII

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 26 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.2

Indications

3.2.1

Signaling Column




















3.2.1.1Purpose
7KHVLJQDOLQJFROXPQ  VKRZVIROORZLQJVWDWXV
HQJLQHVWRSSLQJRUVWDQGVWLOO
JHQVHWDODUPV
HQJLQHVWDUWRUUXQQLQJ

3.2.1.2Properties
7KHVLJQDOLQJFROXPQ  LVDOZD\VRSHUDEOHLQGHSHQGHQWRIWKHRSHUDWLRQ
PRGH *&36&$'$VZLWFKDQGORFDOUHPRWHVZLWFKDWWKHHQJLQH 
5HG
IODVKLQJWKHHQJLQHVWRSV
DOVRZLWKORDGGHFUHDVLQJE\WKHVWRSSLQJSURFHGXUH
VWHDG\OLJKWWKHHQJLQHLVVWRSSHG
EHORZHQJLQHVWDQGVWLOOUSPWLPH V 
RIIWKHHQJLQHKDVDQLJQLWLRQVSHHG
UXQQLQJDQGQRWVWRSSLQJ
1RWH$UHGOLJKWLVQRDODUPDQGVKXWGRZQVLJQDO
<HOORZ
IODVKLQJHDFKQHZJHQVHWUHODWHGDODUPDQGVKXWGRZQ
VWHDG\OLJKWDFWLYHEXWDFNQRZOHGJHGDODUP
RIIQRDFWLYHDODUP
*UHHQ
IODVKLQJWKHHQJLQHVWDUWV
LQFOXGLQJVORZWXUQDQGSUHOXEULFDWLRQXQWLOLJQLWLRQVSHHG
VWHDG\OLJKWWKHHQJLQHUXQV
WKHVSHHGLVKLJKHUWKDQWKHLJQLWLRQVSHHG
RIIWKHHQJLQHVWRSVDQGIDLOVEHORZWKHLJQLWLRQVSHHGRUWKHSURFHGXUH
LVLQRSHUDWLRQZLWKWKHHQJLQHEHORZLJQLWLRQVSHHGDQGQRHQJLQHVWDUW

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 27 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

*HQHUDOO\WKHUHGRUWKHJUHHQOLJKWOLJKWVXS,IQRWWKH3/&PD\KDYHD
PDOIXQFWLRQ
3XVKWKHODPSWHVWEXWWRQ  WRWHVWWKHOLJKWVRIWKHVLJQDOLQJFROXPQ
 7KHOLJKWVZLOOOLJKWXSIRUVHFRQGV
5HPDUN7KLVFROXPQLVDOVRLQVWDOOHGRQWKH(&3 (QJLQH&RQWURO3DQHO DQG
*,3 *HQVHW,QWHUIDFH3DQHO 7KHLQGLFDWLRQVIRUDOOVLJQDOLQJFROXPQVDUH
LGHQWLFDO
7KHIODVKLQJRIDOOOLJKWVVKDOOEHLQWKHVDPHIUHTXHQF\DQGQRWDOWHUQDWLQJ

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 28 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.2.2

LED Position Indicator Alternator Circuit Breaker


..6%$&*6















































3.2.2.1Purpose
7KHDOWHUQDWRU&%LQGLFDWRU  VKRZVWKHSRVLWLRQRIWKHDOWHUQDWRUFLUFXLW
EUHDNHUDWWKHPHGLXPYROWDJH 09 VZLWFKJHDU

3.2.2.2Properties
VWHDG\JUHHQWKHDOWHUQDWRUFLUFXLWEUHDNHULVFORVHG 21 
VWHDG\UHGWKHDOWHUQDWRUFLUFXLWEUHDNHULVRSHQHG 2)) 
IODVKLQJJUHHQVWHDG\UHGGXULQJV\QFKURQL]DWLRQ
DOWHUQDWRUFLUFXLWEUHDNHUFORVLQJSURFHVV 
IODVKLQJUHGVWHDG\JUHHQGXULQJRSHQLQJ
DUHTXHVWRIWKHDOWHUQDWRUFLUFXLWEUHDNHU
IODVKLQJUHGDQGJUHHQXQGHILQHGSRVLWLRQ
RII QROLJKW 3/&IDXOW
'XULQJWKHODPSWHVWWKHUHGDQGJUHHQ/('VRIWKHDOWHUQDWRU&%LQGLFDWRU
 DUHOLWIRUVHFRQGV

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 29 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.2.3

LED Position Indicator Alternator Earthing Switch


..6%$&*6















































3.2.3.1Purpose
7KHDOWHUQDWRUHDUWKLQJVZLWFKLQGLFDWRU  VKRZVWKHSRVLWLRQRIWKH
DOWHUQDWRUHDUWKLQJVZLWFKDWWKHPHGLXPYROWDJH 09 VZLWFKJHDU

3.2.3.2Properties
VWHDG\JUHHQWKHDOWHUQDWRUHDUWKLQJVZLWFKLVFORVHG
VWHDG\UHGWKHDOWHUQDWRUHDUWKLQJVZLWFKLVRSHQHG
IODVKLQJUHGDQGJUHHQXQGHILQHGSRVLWLRQ
'XULQJWKHODPSWHVWWKHUHGDQGJUHHQ/('VRIWKHDOWHUQDWRUHDUWKLQJ
VZLWFKLQGLFDWRU  DUHOLWIRUVHFRQGV
7KHDOWHUQDWRUHDUWKLQJVZLWFKFDQRQO\EHFORVHGLIWKHDOWHUQDWRUFLUFXLW
EUHDNHULVRSHQHG6RWKHDOWHUQDWRU&%LQGLFDWRU  LVUHG,WLVDOVR
EORFNHGE\RQHORFNLQJVROHQRLGVZKLFKZLOOEHUHOHDVHGLIWKHUHLVQR
YROWDJHSUHVHQWDWWKHDOWHUQDWRU
7KHDOWHUQDWRUHDUWKLQJVZLWFKFDQRQO\EHVZLWFKHGPDQXDOO\DWWKH09
VZLWFKJHDU
7KHDOWHUQDWRUHDUWKLQJVZLWFKKDVWREHFORVHGIRUVDIHW\UHDVRQVGXULQJ
PDLQWHQDQFHZRUNDWWKH09VZLWFKJHDU

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 30 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
5HPDUN
,IWKHDOWHUQDWRUHDUWKLQJVZLWFKLVFORVHGWKHHQJLQHVWDUWLVEORFNHG

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 31 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.2.4

LED Position Indicator Alternator Neutral Earthing Switch


..6%$8*6















































3.2.4.1Purpose
7KHDOWHUQDWRUQHXWUDOHDUWKLQJVZLWFKLQGLFDWRU  VKRZVWKHSRVLWLRQRI
WKHDOWHUQDWRUQHXWUDOHDUWKLQJVZLWFK

3.2.4.2Properties
VWHDG\JUHHQWKHDOWHUQDWRUQHXWUDOHDUWKLQJVZLWFKLVFORVHG
VWHDG\UHGWKHDOWHUQDWRUQHXWUDOHDUWKLQJVZLWFKLVRSHQHG
UHGDQGJUHHQIODVKLQJXQGHILQHGSRVLWLRQ
:KHQFDUU\LQJRXWWKHODPSWHVWWKHUHGDQGJUHHQ/('VRIWKHDOWHUQDWRU
QHXWUDOHDUWKLQJVZLWFKLQGLFDWRU  DUHOLWIRUVHFRQGV
'HSHQGLQJRQWKHNLQGRIHQJLQHWRDOWHUQDWRUVDUHFRQQHFWHGWRRQH
09EXVEDUDQGWRRQHQHXWUDOHDUWKLQJVZLWFKJHDU
)RU09EXVEDURQHQHXWUDOHDUWKLQJUHVLVWRULVFRQVLGHUHG2QHQHXWUDO
HDUWKLQJVZLWFKKDVWREHFORVHGWRWKHUHVLVWRU0RUHWKDQRQHRUQRRQHLV
QRWDOORZHGIRUQRUPDORSHUDWLRQ
)RUPRUHLQIRUPDWLRQRIWKHDOWHUQDWRUQHXWUDOHDUWKLQJVZLWFKHVVHHWKH
&&3PDQXDO
5HPDUN
,QDXWRPDWLFPRGHWKHQHXWUDOHDUWKLQJVZLWFKLVFORVHGWRJHWKHUZLWKWKH

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 32 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
DOWHUQDWRUFLUFXLWEUHDNHUDQGWKHDOWHUQDWRULVWKHRQO\RUWKHILUVWRQHZKLFK
LVFRQQHFWHGWRWKH09EXVEDURUWKHQH[WLQWKHVHTXHQFH

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 33 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.2.5

Voltmeter Alternator Voltage









3.2.5.1Purpose
7KHYROWPHWHU  PHDVXUHVDQGGLVSOD\VWKHQRPLQDO09VZLWFKJHDUYROWDJH
RIWKHDOWHUQDWRU

3.2.5.2Properties
7KHYROWPHWHU  LVDQDQDORJPHDVXULQJW\SHFODVVZLWKDUHSODFHDEOH
VFDOH
7KHVFDOHUHDFKHVIURPWRWKHQRPLQDOYROWDJH 9 ZKLFKLV
DGDSWHGWRWKHFRUUHVSRQGLQJSURMHFW3URMHFWQRPLQDOYROWDJHLVN9DQG
WKHVFDOHRIWKHYROWPHWHULVWRN9
7KHVFDOHLVUHGPDUNHGDWWKHQRPLQDOYROWDJH

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 34 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.2.6

Ammeter Alternator Current



























3.2.6.1Purpose
7KHDPPHWHU  PHDVXUHVDQGGLVSOD\VWKHDOWHUQDWRUFXUUHQW / 

3.2.6.2Properties
7KHDPPHWHU  LVDFODVVDQDORJPHDVXULQJW\SHZLWKDUHSODFHDEOH
VFDOH
7KHVFDOHUHDFKHVIURPWRWKHQRPLQDO&7UDWLQJDFFRUGLQJWRWKH
FRUUHVSRQGLQJSURMHFWHJ$ZLWKDQH[FHHGLQJQRPLQDOUDQJH[&7
UDWLQJ
7KHVFDOHLVUHGPDUNHGDWWKHQRPLQDOFXUUHQW

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 35 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.2.7

Double Voltmeter Synchronization Voltage



























3.2.7.1Purpose
7KHGRXEOHYROWPHWHU  FRPSDUHVWKHEXVEDUYROWDJH $ ZLWKWKH
DOWHUQDWRUYROWDJH % GXULQJV\QFKURQL]DWLRQ

3.2.7.2Properties
7KHGRXEOHYROWPHWHU  LVDQDQDORJLQGLFDWLQJGHYLFHFODVV
7KHVFDOHUHDFKHVIURPWRQRPLQDOYROWDJH 9 ZKLFKKDVEHHQ
DGDSWHGWRWKHFRUUHVSRQGLQJSURMHFW3URMHFWQRPLQDOYROWDJHLVN9DQG
WKHVFDOHRIWKHYROWPHWHULVWRN9
7KHYROWDJHV // DUHVZLWFKHGWRWKHGRXEOHYROWPHWHU  GXULQJWKH
V\QFKURQL]DWLRQSURFHVV PDQXDORUDXWRPDWLF 
,IQRV\QFKURQL]DWLRQSURFHGXUHLVLQSURFHVVWKHGRXEOHYROWPHWHU  GRHV
QRWRSHUDWH

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 36 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.2.8

Double Frequency Meter Synchronization Frequency







3.2.8.1Purpose
7KHGRXEOHIUHTXHQF\PHWHU  FRPSDUHVWKHEXVEDUIUHTXHQF\ $ ZLWKWKH
DOWHUQDWRUIUHTXHQF\ % GXULQJV\QFKURQL]DWLRQ

3.2.8.2Properties
7KHGRXEOHIUHTXHQF\PHWHU  LVDQDQDORJIUHTXHQF\PHWHUZLWKD
YLEUDWLQJUHHGPRYHPHQWDQGWRQJXHV
7KHYROWDJHV // DUHVZLWFKHGWRWKHGRXEOHIUHTXHQF\PHWHU  GXULQJ
WKHV\QFKURQL]DWLRQSURFHVV PDQXDOO\RUDXWRPDWLFO\ 
7KHGRXEOHIUHTXHQF\PHWHU  RQO\RSHUDWHVLIWKHV\QFKURQL]DWLRQ
SURFHGXUHLVLQSURFHVV

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 37 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.2.9

Synchronoscope

























3.2.9.1Purpose
7KHV\QFKURQRVFRSH  FRPSDUHVWKHIUHTXHQF\DQGWKHSKDVHDQJOH
EHWZHHQDOWHUQDWRUDQGWKHEXVEDUGXULQJV\QFKURQL]DWLRQ

3.2.9.2Properties
7KHV\QFKURQRVFRSH  LQGLFDWHVWKHSKDVHDQJOHE\LOOXPLQDWHG/('V
RFORFNLVHTXLYDOHQWWRDSKDVHDQJOHRIGHJUHHV
7KHVSHHGRIWKH/('PRYHPHQWLQGLFDWHVGLIIHUHQWIUHTXHQFLHVEHWZHHQWKH
DOWHUQDWRUDQGWKHEXVEDU
'XULQJFORFNZLVHPRYHPHQWWKHDOWHUQDWRUIUHTXHQF\LVWRRKLJK'XULQJ
FRXQWHUFORFNZLVHPRYHPHQWWKHDOWHUQDWRUIUHTXHQF\LVWRRORZ
7KHUHTXLUHGSKDVHDQJOHRIGHJUHHVLVVKRZQE\DQLOOXPLQDWHG/('DW
RFORFNSRVLWLRQZLWKRXWPRYHPHQW
7KHYROWDJHV // DUHVZLWFKHGWRWKHV\QFKURQRVFRSH  GXULQJWKH
V\QFKURQL]DWLRQSURFHVV PDQXDORUDXWRPDWLF 
7KHV\QFKURQRVFRSH  LVQRWLQRSHUDWLRQLIQRV\QFKURQL]DWLRQSURFHGXUH
LVLQSURFHVV

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 38 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.3

Units

3.3.1

Automatic Synchronization Unit








3.3.1.1Purpose
7KHDXWRPDWLFV\QFKURQL]DWLRQXQLW  V\QFKURQL]HVDXWRPDWLFDOO\WKH
YROWDJHDQGWKHIUHTXHQF\RIWKHDOWHUQDWRUWRWKH09EXVEDUDQGJLYHV
FORVLQJFRPPDQGVWRWKHDOWHUQDWRUFLUFXLWEUHDNHU

3.3.1.2Properties
7KLVXQLWV\QFKURQL]HVWKHDOWHUQDWRUFLUFXLWEUHDNHUDXWRPDWLFDOO\WRWKH09
EXVEDU,WDOVRZRUNVZLWKDEODFNEXVEDUSKLORVRSK\7KHDOWHUQDWRUYROWDJH
DQGIUHTXHQF\PXVWEHLQSODXVLEOHOLPLWVDQG09EXVEDUZLWKRXWYROWDJH
7KLVXQLWLVDFWLYDWHGE\WKH*&3LIWKH

*&36&$'$VZLWFK  LVLQ*&3SRVLWLRQ
ORFDOV\QFKURQL]DWLRQVZLWFK  LVLQDXWRPDWLFSRVLWLRQ
H[FLWDWLRQLVRQ
HLWKHUWKHDOWHUQDWRU&%21EXWWRQ  
RUWKHEXWWRQRQWKHSDQHO3&LVSXVKHG
LIWKHDOWHUQDWRU&%LVLQPDQXDOPRGH 
RUWKHH[FLWDWLRQLVRQDQGWKHDOWHUQDWRU&%LVLQDXWRPDWLFUHPRWH
PRGH

,IWKH*&36&$'$VZLWFK  LVLQ6&$'$SRVLWLRQWKHDFWLYDWLRQRIWKHXQLW
LVJLYHQIURP6&$'$LQGHSHQGHQWRIWKHSRVLWLRQRIWKHORFDO
V\QFKURQL]DWLRQVZLWFK  
7KHDXWRPDWLFV\QFKURQL]DWLRQXQLW  JLYHVFRPPDQGV
WRWKHHQJLQH
WRGHFUHDVHRULQFUHDVHWKHHQJLQHVSHHGWRDOLJQWKHIUHTXHQF\DQG
WRWKHDXWRPDWLFYROWDJHUHJXODWLRQ $95 RIWKHDOWHUQDWRU
WRDOLJQWKHYROWDJH

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 39 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
,IWKHV\QFKURQL]DWLRQLVVXFFHVVIXOO\FRPSOHWHGWKHDXWRPDWLF
V\QFKURQL]DWLRQXQLW  VZLWFKHVRII,IWKHV\QFKURQL]DWLRQIDLOVWKHXQLWZLOO
DOVREHGHDFWLYDWHGDQGWKHV\QFKURQL]DWLRQPXVWEHVWDUWHGDJDLQ
7KHVXSHUYLVLRQDQGDERUWE\WKH3/&KDSSHQVDIWHUPLQXWHV

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 40 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.3.2

Multifunctional Monitoring Unit (MMU) Siemens Sentron PAC3200



























3.3.2.1Purpose
7KH008  PHDVXUHVUHFRUGVDQGPRQLWRUVHOHFWULFDOSDUDPHWHUVLQWKH
PHGLXPYROWDJH 09 VZLWFKJHDU

3.3.2.2Properties
7KH008  SURYLGHVDOOUHOHYDQWHOHFWULFDOGDWDYLD3URILEXVWRWKH3/&
,QFDVHRIPDOIXQFWLRQRIWKHPHDVXULQJWUDQVGXFHUVIRUDFWLYHSRZHUDQG
SRZHUIDFWRUWKH008  VXSSOLHVWKHVLJQDOVIRUWKH*&3DFWLYHSRZHUDQG
SRZHUIDFWRUPDQDJHPHQWDQGYLVXDOL]DWLRQ
7KHSURJUDPPLQJIXQFWLRQLVSDVVZRUGSURWHFWHG

3.3.2.3Operation
%\WKHIRXUIXQFWLRQNH\V)WR)WKHXVHUFDQ
QDYLJDWHWKURXJKWKHPHQXV
VHOHFWWKHPHDVXUHGYDOXHGLVSOD\V
GLVSOD\DQGHGLWWKHGHYLFHVHWWLQJV
)WR)PHDQV
)
FDQFHOVWKHODVWRSHUDWRUDFWLRQ
UHWXUQVIURPWKHGLVSOD\RIWKHGHYLFHVHWWLQJVWRWKHGLVSOD\RIWKHPHQX
)
PRYHVWKHVHOHFWLRQEDUXSZDUGV
)
PRYHVWKHVHOHFWLRQEDUGRZQZDUGV
)

FDOOVWKHPDLQPHQX



FDOOVWKHVHOHFWHGPHQXHQWU\



RSHQVWKHHGLWPRGHRIWKHGHYLFHVHWWLQJ

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 41 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7KHGLVSOD\LQGLFDWHVIROORZLQJYDOXHV

DFWLYHSRZHU
UHDFWLYHSRZHU
DSSDUHQWSRZHU
FXUUHQW/
FXUUHQW/
FXUUHQW/
YROWDJH//
YROWDJH//
YROWDJH//
SRZHUIDFWRU
IUHTXHQF\
DFWLYHHQHUJ\
UHDFWLYHHQHUJ\

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 42 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


3.4

Visualization

3.4.1

Panel PC




3.4.1.1Purpose
7KHSDQHO3&  PRQLWRUVVWRUDJHVDQGYLVXDOL]HVGDWDRIWKHJHQVHWDQG
DX[LOLDULHVDQQXQFLDWHVDODUPVDQGDOORZVWKHRSHUDWRUWRFRQWUROWKHJHQVHW
DQGDX[LOLDULHV

3.4.1.2Properties
,WLVDQLPSRUWDQWHOHPHQWIRUDQLQGHSHQGHQWDQGVWDQGDORQHRSHUDWLQJ
RSWLRQDQGLVDGGLWLRQDOWRWKH6&$'$V\VWHP
7KHSDQHO3&KDVDWRXFKVFUHHQ
7KHRSHUDWLQJLVSRVVLEOHLIWKH*&36&$'$VZLWFK  LVLQ*&3SRVLWLRQ
DQGWKHORFDOUHPRWHVZLWFKDWWKHHQJLQHLVLQUHPRWHSRVLWLRQ

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 43 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
0RQLWRULQJGDWDVWRUDJHDQGDODUPDQQXQFLDWLRQLVLQGHSHQGHQWRIWKH
SRVLWLRQRI*&36&$'$VZLWFK  DQGWKHORFDOUHPRWHVZLWFKDWWKH
HQJLQH
7KHUHVHWDQGKRUQRII WKHKRUQLQ&&3 IXQFWLRQIRUWKHLQGLYLGXDOJHQVHW
DODUPLVDOVRLQGHSHQGHQWRIWKHSRVLWLRQRIWKH*&36&$'$VZLWFK  
7KHRSHUDWLQJLVPHQXEDVHGDQGWKHSDQHO3&  ZLOOEHRSHUDWHGGLUHFWO\
E\WKHWRXFKLQJV\PEROVRQWKHVFUHHQ
7KHFRORUVRIV\PEROVDQGYDOXHVLQIRUPDERXWWKHVWDWXV
 JUHHQ UXQQLQJRUYDOXHRN
 
YDOYHRSHQHG
 \HOORZ IDXOW
 RUDQJH ORDGUHGXFWLRQ
 UHG
 

VWDQGVWLOORUVKXWGRZQ
YDOYHFORVHG

 JUH\

QRWDYDLODEOHQRWDQLPDWHG

7KHODWHVWWKUHHDODUPVDUHDQQXQFLDWHGLQWKHERWWRPOLQHV
)RUPRUHGHWDLOVVHHWKH6&$'$GRFXPHQWDWLRQ

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 44 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

3.5

Alternator Protection

3.5.1

Alternator Prote ction Device








3.5.1.1Purpose
7KHDOWHUQDWRUSURWHFWLRQGHYLFH  SURWHFWVWKHDOWHUQDWRUDQGWKHFDEOLQJ
IURPWKHDOWHUQDWRUWRWKH09EXVEDU
,WGHWHFWVDOOHOHFWULFDOIDXOWVLQWKH]RQHRILQIOXHQFHRIWKHDOWHUQDWRU

3.5.1.2Properties
7KHDOWHUQDWRUSURWHFWLRQGHYLFH  ZRUNVLQGHSHQGHQWO\RIWKHSRVLWLRQRI
WKH*&36&$'$VZLWFK  DQGWKHORFDOUHPRWHVZLWFKDWWKHHQJLQH
7KHDOWHUQDWRUSURWHFWLRQGHYLFH  LVDPXOWLIXQFWLRQDOSURWHFWLRQUHOD\
ZKLFKFRQVLVWVRIWKHDOWHUQDWRUSURWHFWLRQIXQFWLRQVGHILQHGLQWKH
SURWHFWLRQPDWUL[

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 45 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7KHPRVWFULWLFDOIDXOWVDUH
RYHUFXUUHQWVKRUWFLUFXLWFXUUHQW
HDUWKIDXOW
GLIIHUHQWLDOFXUUHQWIDXOW
7KHKDUGZLUHGUHOD\RXWSXWFRQWDFWVDUHSURJUDPPHGIRU

DOWHUQDWRU&%WULS LQDOWHUQDWRURSHQWULSORRS 
GHH[FLWDWLRQ WR3/&LQSXW 
HQJLQHVKXWGRZQ LQVDIHW\FKDLQ 
EUHDNHUIDLOXUH LQEUHDNHUORRSRI&&3 
UHOD\ZDWFKGRJ WR3/&ORRS 
&%WULS WR3/&LQSXW 
HQJLQHVKXWGRZQ WR3/&LQSXW 

)RUGHWDLOHGIDXOWLQIRUPDWLRQD3URILEXVLQWHUIDFHWRWKH3/&LVSURYLGHG
$WWKHIURQWDUHODEHOVZLWK/('V $ ZKLFKLQGLFDWHWKHDFWXDOWULSV
7KHDOWHUQDWRUSURWHFWLRQGHYLFH  LVHTXLSSHGZLWKDZDWFKGRJIXQFWLRQ
UHOD\RXWSXW 
,QFDVHRISURWHFWLRQUHOD\PDOIXQFWLRQWKH

DOWHUQDWRU&%ZLOOEHWULSSHG
DOWHUQDWRUGHH[FLWDWLRQZLOOEHDFWLYDWHG
LQKLELWHGV\QFKURQL]DWLRQZLOOEHDFWLYDWHG
HQJLQHZLOOEHVKXWGRZQ
DOWHUQDWRU&%ZLOOEHVZLWFKHGWRPDQXDOUHPRWH

7KH/('EXWWRQ % LVLQWHQGHGIRUWKHODPSWHVWDQGWKHUHVHWDIWHUDFOHDUHG
IDXOW,WLVQHFHVVDU\WRSXVKWKH/('EXWWRQ % WRUHVHWDQ\NLQGRIWULS
EHIRUHDUHVHWFDQEHJLYHQIURP*&3EXWWRQSDQHO3&RU6&$'$

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 46 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

OPERATING SCENARIOS

4.1

Synchronization of Circuit Breakers


7KHV\QFKURQL]DWLRQLQWKH*&3LVPHDQWIRU09FLUFXLWEUHDNHURIWKHJHQVHW
DOWHUQDWRU
*HQHUDOSULQFLSOHVDUH
7KH09FLUFXLWEUHDNHURIDQDOWHUQDWRUPXVWEHV\QFKURQL]HGIRUWKH
FRQQHFWLRQRIWKHDOWHUQDWRUWRRQHHQHUJL]HG09EXVEDU
7KHV\QFKURQL]DWLRQHTXLSPHQWDQGSURFHGXUHLVDOVRXVHGWRFORVHWKH
DOWHUQDWRU09FLUFXLWEUHDNHUWRWKHEODFN09EXVEDUWRHQHUJL]HWKLV
EXVEDULQFDVHRIEODFNVWDUWRIWKHSRZHUSODQW
:HXVHDOZD\VWKHWHUPFLUFXLWEUHDNHUV\QFKURQL]DWLRQ
7KHV\QFKURQL]DWLRQSURFHVVLVKDUGZDUHVXSHUYLVHGE\V\QFKURQL]DWLRQ
HTXLSPHQWDQG3/&VRIWZDUHVXSHUYLVHGIRUUHOHDVLQJDQGLQWHUORFNLQJ7KH
V\QFKURQL]DWLRQHTXLSPHQWLQFOXGHVDQDXWRPDWLFV\QFKURQL]DWLRQXQLWDQGD
V\QFKURFKHFNUHOD\
7KHDXWRPDWLFV\QFKURQL]DWLRQXQLWLVGRRUPRXQWHGWKHV\QFKURFKHFNUHOD\
LVPRXQWHGLQWHUQDOO\

4.1.1

Synchronization Principles
2QO\RQHV\QFKURQL]DWLRQSURFHVVLVSRVVLEOHDWWKHVDPHWLPH7KDW
DSSOLHVWRWUDQVIRUPHUV\QFKURQL]DWLRQLQWKH&&3DQGDOWHUQDWRU
V\QFKURQL]DWLRQLQWKH*&3
$FLUFXLWEUHDNHUFDQRQO\EHV\QFKURQL]HGLILWVEDFNLQGLFDWLRQ2SHQHG
LVDFWLYH
$FLUFXLWEUHDNHUFDQRQO\EHV\QFKURQL]HGLIWKHEDFNLQGLFDWLRQ
2SHQHGRIWKHFRUUHVSRQGLQJHDUWKLQJVZLWFKLVDFWLYH
$FLUFXLWEUHDNHUFDQQRWEHV\QFKURQL]HGLQFDVHRI&%IDLOXUHDODUPV
$FLUFXLWEUHDNHUFDQQRWEHV\QFKURQL]HGLIRQHYROWDJHWUDQVIRUPHU0&%
IURPWKHDOWHUQDWRURUIURPWKH09EXVEDULVRSHQHG
6\QFKURQL]DWLRQLVSRVVLEOHLIWKHYROWDJHDQGIUHTXHQF\OHYHOVDWERWK
VLGHVDUHZLWKLQWKHSUHGHILQHGUDQJHV
6\QFKURQL]DWLRQLVSRVVLEOHLIWKHYROWDJHDQGIUHTXHQF\OHYHOVDW
DOWHUQDWRUVLGHDUHZLWKLQWKHSUHGHILQHGUDQJHVDQG09EXVEDULVEODFN
6\QFKURQL]DWLRQLVQRWSRVVLEOHLIWKHDOWHUQDWRU09VLGHLVEODFN
6\QFKURQL]DWLRQLVQRWSRVVLEOHZLWKWKHDEVHQFHRIYROWDJHDWERWKVLGHV
RIWKHFLUFXLWEUHDNHU
)RUDOWHUQDWRUFLUFXLWEUHDNHUV\QFKURQL]DWLRQDOZD\VWKHIL[YROWDJHRIWKH
09EXVEDUPXVWEHVZLWFKHGWRWKHDXWRPDWLFV\QFKURQL]DWLRQXQLW
DQGRUWKHV\QFKURFKHFNUHOD\LQDGYDQFHWRWKHYDULDEOHYROWDJH
7KLVLVVHFXUHGE\KDUGZLUHGLQWHUORFNLQJDQGLQWHQGHGWR&%FORVLQJ
EHFDXVHRIWKHEODFNEXVEDUGHWHFWLRQRIWKH09EXVEDU
$VWDUWHGV\QFKURQL]DWLRQLVDOZD\VDERUWHG ZLWKRXWDODUP E\VZLWFKLQJ
IURP*&3PRGHWR6&$'$PRGHRUYLFHYHUVD
,Q*&3PRGHDVWDUWHGV\QFKURQL]DWLRQSURFHVVLVDOZD\VDERUWHG ZLWKRXW
DODUP E\VZLWFKLQJWKHORFDOV\QFKURQL]DWLRQVZLWFKWRDQRWKHUSRVLWLRQ

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 47 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
,Q6&$'$PRGHWKHORFDOV\QFKURQL]DWLRQVZLWFKLVRXWRIIXQFWLRQDQG
WKHDXWRPDWLFV\QFKURQL]DWLRQSURFHVVLVLQGHSHQGHQWRIWKHSRVLWLRQRI
WKHORFDOV\QFKURQL]DWLRQVZLWFKRUVZLWFKLQJRSHUDWLRQ
$XWRPDWLFV\QFKURQL]DWLRQWLPHLVPRQLWRUHGE\WKH3/&DQGDERUWHG
ZLWKDODUP DIWHUDGHIDXOWWLPHRIPLQXWHV
0DQXDOV\QFKURQL]DWLRQWLPHLVQRWPRQLWRUHG
7RHQDEOHDXWRPDWLFV\QFKURQL]DWLRQWKHWHUPLQDOV &%RSHQHG DQG
5HOHDVH%ODFNVWDUW RIWKHDXWRPDWLFV\QFKURQL]DWLRQXQLWVKDYHWREH
FRQQHFWHGWR'&9
7KHUHDUHWZRV\QFKURQL]DWLRQPRGHV
PDQXDOV\QFKURQL]DWLRQ
DXWRPDWLFV\QFKURQL]DWLRQ
,QWKH*&3RSHUDWLQJPRGHERWKV\QFKURQL]DWLRQPRGHVDUHSRVVLEOHDQG
PXVWEHVHOHFWHGZLWKWKHORFDOV\QFKURQL]DWLRQVZLWFK
,QWKH6&$'$RSHUDWLQJPRGHRQO\WKHDXWRPDWLFV\QFKURQL]DWLRQPRGHLV
SRVVLEOHLQGHSHQGHQWRIWKHSRVLWLRQRIWKHORFDOV\QFKURQL]DWLRQVZLWFK
7KHDXWRPDWLFV\QFKURQL]DWLRQLVGRQHE\WKHDXWRPDWLFV\QFKURQL]DWLRQXQLW
DQGDGGLWLRQDOO\VXSHUYLVHGE\WKHV\QFKURFKHFNUHOD\
0DQXDOV\QFKURQL]DWLRQLVRQO\VXSHUYLVHGE\WKHV\QFKURFKHFNUHOD\DQG
GRQHE\WKHORZHUKLJKHUVZLWFKHVIRUIUHTXHQF\DQGYROWDJH
7KHLQVWUXPHQWVDWWKH*&3GRRUWKHGRXEOHYROWPHWHUWKHGRXEOH
IUHTXHQF\PHWHUDQGWKHV\QFKURQRVFRSHDUHXVHGIRUERWKV\QFKURQL]DWLRQ
PRGHV
7KHSXOVHGKLJKHUORZHUVLJQDOVDUHVHQWWRGLJLWDO3/&LQSXWVLQWKH*&3
9LDGLJLWDO3/&RXWSXWVDQGUHOD\VLQWKH(&3RU*,3WKHSXOVHVDUHJLYHQWR
WKHHQJLQHVSHHGJRYHUQRU
WRGHFUHDVHRULQFUHDVHWKHHQJLQHVSHHGIRUDOLJQLQJWKHIUHTXHQF\
WKHDXWRPDWLFYROWDJHUHJXODWLRQ $95 RIWKHDOWHUQDWRUIRUDOLJQLQJWKH
YROWDJH

4.1.2

Synchronization Operating Scenarios

4.1.2.1 Automatic Synchronization from GCP


,QLWLDOVLWXDWLRQ7KHHQJLQHUXQVZLWKVSHHGKLJKHUWKDQQRPLQDOVSHHG
WKHH[FLWDWLRQLVUHOHDVHGDQGWKHYROWDJHDYDLODEOHWKHDOWHUQDWRUFLUFXLW
EUHDNHULVRSHQDQGLQPRGHUHPRWHPDQXDO
6HWWKH*&36&$'$VZLWFKLQ*&3SRVLWLRQDQG
VHWWKHORFDOV\QFKURQL]DWLRQVZLWFKLQDXWRPDWLFSRVLWLRQ
7KHDXWRPDWLFV\QFKURQL]DWLRQLVFRQWUROOHGE\WKHDXWRPDWLF
V\QFKURQL]DWLRQXQLWV7KHYROWDJHDQGIUHTXHQF\KLJKHUORZHUVZLWFKHVDUH
GHDFWLYDWHG

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 48 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7RVWDUWWKHV\QFKURQL]DWLRQSURFHVV
SXVKWKHJUHHQ21EXWWRQRIDFDSDEOH&%WRJLYHWKHVWDUWSXOVHRU
FOLFNWKH&%V\PERORQWKHVLQJOHOLQHGLDJUDPDWWKHSDQHO3&DQGFOLFN
WKH21EXWWRQLQWKHXVHUFRQWURORIWKH&%DQGFRQILUPWKHDFWLRQ
:KLOHWKHV\QFKURQL]DWLRQSURFHVVWKHJUHHQHOHPHQWRIWKHFLUFXLWEUHDNHU
SRVLWLRQLQGLFDWRULVIODVKLQJZKLOHWKHUHGHOHPHQWVKRZVVWHDG\UHG:KHQ
WKHV\QFKURQL]DWLRQLVFRPSOHWHGDQGWKHFLUFXLWEUHDNHUKDVEHHQFORVHG
WKHLQGLFDWRUZLOOEHVWHDG\JUHHQDQGUHGZLOOEHRII
'XULQJDXWRPDWLFV\QFKURQL]DWLRQWKHYROWDJHVDQGIUHTXHQF\DUHVZLWFKHG
WRWKHLQVWUXPHQWVDWWKH*&3IURQWGRRUZKLOHWKHYDOXHVDUHGLVSOD\HGRQ
WKHDXWRPDWLFV\QFKURQL]DWLRQXQLWDVZHOO
,QWKHDXWRPDWLFV\QFKURQL]DWLRQSURFHVVQRIXUWKHURSHUDWRUDFWLRQLV
QHFHVVDU\DQGWKHV\QFKURQL]DWLRQSURFHVVLVILQLVKHGLIWKH&%LVFORVHG
7RVWRSWKHUXQQLQJV\QFKURQL]DWLRQSURFHVV
SXVKWKHUHG2))EXWWRQRIWKHVHOHFWHG&%WRJLYHWKHVWRSSXOVHRU
FOLFNWKH&%V\PERORQWKHVLQJOHOLQHGLDJUDPDWWKHSDQHO3&DQG
FOLFNWKH2))EXWWRQLQWKHXVHUFRQWURORIWKH&%DQG
FRQILUPWKHDFWLRQRU
VHWWKHORFDOV\QFKURQL]DWLRQVZLWFKWR2))
,IWKHDXWRPDWLFV\QFKURQL]DWLRQXQLWGRHVQRWFRPSOHWHWKHV\QFKURQL]DWLRQ
ZLWKLQDWKUHHPLQXWHVSHULRGRIWLPHWKHSURFHVVZLOOEHDERUWHGZLWKDQ
DODUPE\3/&
$UHVWDUWRIV\QFKURQL]DWLRQLVRQO\SRVVLEOHDIWHUDQDODUPUHVHW

4.1.2.2Manual Synchronization from GCP


,QLWLDOVLWXDWLRQ7KHHQJLQHUXQVZLWKVSHHGKLJKHUWKDQQRPLQDOVSHHG
WKHH[FLWDWLRQLVUHOHDVHGDQGWKHYROWDJHDYDLODEOHWKHDOWHUQDWRUFLUFXLW
EUHDNHULVRSHQDQGLQPRGHUHPRWHPDQXDO
6HWWKH*&36&$'$VZLWFKLQ*&3SRVLWLRQDQG
VHWWKHORFDOV\QFKURQL]DWLRQVZLWFKLQPDQXDOSRVLWLRQ
$PDQXDOV\QFKURQL]DWLRQLVRQO\PRQLWRUHGE\WKHV\QFKURFKHFNUHOD\7KH
YROWDJHDQGIUHTXHQF\KLJKHUORZHUVZLWFKHVDUHDFWLYDWHG
7RVWDUWWKHV\QFKURQL]DWLRQSURFHVV
SXVKWKHJUHHQ21EXWWRQRIDFDSDEOH&%WRJLYHWKHVWDUWSXOVHRU
FOLFNWKH&%V\PERORQWKHVLQJOHOLQHGLDJUDPDWWKHSDQHO3&DQG
FOLFNWKH21EXWWRQLQWKHXVHUFRQWURORIWKH&%DQG
FRQILUPWKHDFWLRQ
7RDGMXVWYROWDJHDQGIUHTXHQF\
XVHWKHYROWDJHDQGIUHTXHQF\KLJKHUORZHUVZLWFKHVDQG
FKHFNWKHYDOXHVRQWKHGRXEOHYROWDJHDQGIUHTXHQF\PHWHUVDVZHOODV
WKHV\QFKURQRVFRSH
$GMXVWLQWKDWZD\WKDWWKHWXUQLQJRIWKH/('VRQWKHV\QFKURQRVFRSH
VORZO\PRYHWRRFORFN

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 49 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

,IWKHV\QFKURFKHFNUHOD\GHWHFWVWKHYROWDJHDQGIUHTXHQF\OHYHOVDVZHOODV
WKHGHOWDIUHTXHQF\GHOWDYROWDJHDQGSKDVHDQJOHZLWKLQWKHSUHGHILQHG
UDQJHVWKHV\QFKURFKHFNUHOD\ZLOOJLYHWKH21FRPPDQGE\FRQWDFWWRWKH
&%
,WLVQRWQHFHVVDU\WRSXVKWKHJUHHQ21EXWWRQRUWRFOLFNWKH&%V\PERO
RQWKHVLQJOHOLQHGLDJUDPDWWKHSDQHO3&DJDLQLIWKHV\QFKURQRVFRSHLV
FORVHWRRFORFNSRVLWLRQ
:KLOHWKHV\QFKURQL]DWLRQSURFHVVWKHJUHHQHOHPHQWRIWKHFLUFXLWEUHDNHU
SRVLWLRQLQGLFDWRULVIODVKLQJZKLOHWKHUHGHOHPHQWVKRZVVWHDG\UHG,IWKH
V\QFKURQL]DWLRQLVFRPSOHWHGDQGWKHFLUFXLWEUHDNHULVFORVHGWKHLQGLFDWRU
ZLOOEHVWHDG\JUHHQDQGUHGZLOOEHRII
'XULQJPDQXDOV\QFKURQL]DWLRQWKHYROWDJHVDQGIUHTXHQF\JHWVZLWFKHGWR
WKHLQVWUXPHQWVLQWKH*&3IURQWGRRU7KHYDOXHVDUHQRWGLVSOD\HGRQWKH
DXWRPDWLFV\QFKURQL]DWLRQXQLW
7RVWRSWKHUXQQLQJV\QFKURQL]DWLRQSURFHVV
SXVKWKHUHG2))EXWWRQRIWKHVHOHFWHG&%WRJLYHWKHVWRSSXOVHRU
FOLFNWKH&%V\PERORQWKHVLQJOHOLQHGLDJUDPDWWKHSDQHO3&DQG
FOLFNWKH2))EXWWRQLQWKHXVHUFRQWURORIWKH&%DQG
FOLFNWRFRQILUPWKHDFWLRQRU
VHWWKHORFDOV\QFKURQL]DWLRQVZLWFKWR2))
7KHPDQXDOV\QFKURQL]DWLRQLVQRWOLPLWHGLQWLPHEXWEHDZDUHWKDWQR
RWKHUV\QFKURQL]DWLRQSURFHVVFDQEHVWDUWHGLIRQHSURFHVVLVDOUHDG\
UXQQLQJ

4.1.2.3Automatic Synchronization from SCADA


6HWWKH*&36&$'$VZLWFKLQ6&$'$SRVLWLRQ
7KHSRVLWLRQRIWKHORFDOV\QFKURQL]DWLRQVZLWFKDWWKH*&3LVQRWUHOHYDQW
7KHDXWRPDWLFV\QFKURQL]DWLRQLVFRQWUROOHGE\WKHDXWRPDWLF
V\QFKURQL]DWLRQXQLWVWKHYROWDJHDQGIUHTXHQF\KLJKHUORZHUVZLWFKHVDUH
GHDFWLYDWHG
7RVWDUWWKHV\QFKURQL]DWLRQSURFHVV
FOLFNWKH&%V\PERORQWKHVLQJOHOLQHGLDJUDPDWWKH6&$'$RSHUDWRU
VWDWLRQDQG
FOLFNWKH21EXWWRQLQWKHXVHUFRQWURORIWKH&%DQG
FRQILUPWKHDFWLRQ
:KLOHWKHV\QFKURQL]DWLRQSURFHVVWKHJUHHQLQGLFDWRULQWKHV\PEROLV
IODVKLQJWKHUHGLQGLFDWRULQWKHV\PEROLVVWHDG\UHG,ILWLVFRPSOHWHGDQG
WKHFLUFXLWEUHDNHUKDVEHHQFORVHGWKHJUHHQLQGLFDWRUVKRZVDVWHDG\OLJKW
DQGWKHUHGLQGLFDWRULVRII
,QWKHDXWRPDWLFV\QFKURQL]DWLRQSURFHVVQRIXUWKHURSHUDWRUDFWLRQLV
QHFHVVDU\DQGWKHV\QFKURQL]DWLRQSURFHVVLVILQLVKHGZKHQWKH&%LVFORVHG 
7RVWRSWKHUXQQLQJV\QFKURQL]DWLRQSURFHVV
FOLFNWKH&%V\PERORQWKHVLQJOHOLQHGLDJUDPDWWKH6&$'$RSHUDWRU
VWDWLRQDQG
461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 50 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
FOLFNWKH2))EXWWRQLQWKHXVHUFRQWURORIWKH&%DQG
FRQILUPWKHDFWLRQ
,IWKHDXWRPDWLFV\QFKURQL]DWLRQXQLWGRHVQRWFRPSOHWHWKHV\QFKURQL]DWLRQ
ZLWKLQDWKUHHPLQXWHVSHULRGRIWLPHWKHSURFHVVZLOOEHDERUWHGZLWKDQ
DODUPE\3/&
$UHVWDUWRIV\QFKURQL]DWLRQLVRQO\SRVVLEOHDIWHUDUHVHWRIWKLVDODUP

4.1.2.4Principle Control and Operating Philosophy Alternator Circuit Breaker and


Excitation
2SHUDWLQJIURP*&3
6ZLWFKRSHUDWLRQPRGH*&36&$'$LQSRVLWLRQ*&3 

3UHFRQGLWLRQ
7KHORFDOUHPRWHVZLWFKDWWKHHQJLQHRU6D&R6LVLQ
UHPRWHPRGH
7KHORFDOUHPRWHVZLWFKDWWKHDOWHUQDWRU09FDELQHW
LVLQUHPRWHPRGH LIWKLVVZLWFKLVDYDLODEOH 


6LWXDWLRQ
*HQVHWVWDUWVHTXHQFH
7KHHQJLQHVWDUWVIURPWKHVWDUWLQJSLFWXUHDWWKH
*&3SDQHO3&
RU
*HQVHWUXQQLQJ
:LWKVSHHG!QRPLQDOVSHHGWKHUHOHDVHRI
H[FLWDWLRQLVVZLWFKHG21 FRQWDFWJLYHQWR$95 
3UHFRQGLWLRQ7KHUHOHDVHRIH[FLWDWLRQLVLQDXWRPDWLF
UHPRWHPRGH LQ3/& ,IWKHUHOHDVHRIH[FLWDWLRQLV
QRWLQDXWRPDWLFUHPRWHWKHVWDUWVHTXHQFHVWRSV
DQGKROGVRQ7KLVVWDWXVLVQRWOLPLWHGLQWLPH

%\UHOHDVHRIH[FLWDWLRQ21WKHVWDUWVHTXHQFH
VZLWFKHVRQWKHV\QFKURQL]DWLRQRIWKHDOWHUQDWRU
FLUFXLWEUHDNHU &% 
3UHFRQGLWLRQV7KH&%LVLQDXWRPDWLFUHPRWHPRGH
DQGORFDOV\QFKURQL]DWLRQVZLWFKLVLQDXWRPDWLF
V\QFKURQL]DWLRQRUPDQXDOV\QFKURQL]DWLRQSRVLWLRQ
,IWKH&%LVQRWLQDXWRPDWLFUHPRWHPRGHRUWKH
VHOHFWRUVZLWFKLVLQ2))SRVLWLRQWKHVWDUWVHTXHQFH
VWRSVDQGKROGVRQ7KLVVWDWXVLVQRWOLPLWHGLQWLPH
:LWKVHOHFWRUVZLWFKLQDXWRPDWLFV\QFKURQL]DWLRQ
SRVLWLRQWKHDXWRPDWLFV\QFKURQL]DWLRQZLOOEH
VZLWFKHGRQDQGDXWRPDWLFV\QFKURQL]DWLRQFORVHV
WKHDOWHUQDWRU&%RULIQRWVXFFHVVIXOWKH3/&
DERUWVWKHV\QFKURQL]DWLRQZLWKWKHV\QFKURQL]DWLRQ
IDLOXUHDODUPDIWHUPLQXWHV:LWKWKLVDODUPWKH
DOWHUQDWRU&%LVVZLWFKHGWRPDQXDOUHPRWHPRGH
$IWHUWKHUHVHWRIWKHDODUPWKHRSHUDWRUFDQVZLWFK
WKH&%WRWKHDXWRPDWLFUHPRWHPRGHRUXVHWKH
DOWHUQDWRU&%21EXWWRQRUWKHEXWWRQDWWKHSDQHO
3&WRVWDUWWKHV\QFKURQL]DWLRQDJDLQ VHHDOVREHORZ
&%LQPDQXDOUHPRWHPRGH 

%\ORFDOV\QFKURQL]DWLRQVZLWFKLQPDQXDOSRVLWLRQ
WKHPDQXDOV\QFKURQL]DWLRQZLOOEHVZLWFKHGRQDQG
WKHRSHUDWRUKDVWRGHFUHDVHRULQFUHDVHWKH
IUHTXHQF\DQGWKHYROWDJHXQWLOWKRVHDUHLQVLGH
WROHUDQFHDQGWKHV\QFKURFKHFNUHOD\FORVHVWKH&%,W
LVQRWQHFHVVDU\WRXVHWKHDOWHUQDWRU&%21EXWWRQ
RUWKHFRUUHVSRQGLQJEXWWRQRQWKHSDQHO3&$

2SHUDWLQJIURP6&$'$
6ZLWFKRSHUDWLRQPRGH*&36&$'$LQSRVLWLRQ6&$'$ 

3UHFRQGLWLRQ
7KHORFDOUHPRWHVZLWFKDWWKHHQJLQHRU6D&R6LVLQ
UHPRWHPRGH
7KHORFDOUHPRWHVZLWFKDWWKHDOWHUQDWRU09FDELQHW
LVLQUHPRWHPRGH LIWKLVVZLWFKLVDYDLODEOH 
6&$'$VXEPRGHORDGPDQDJHPHQW*&3DXWRPDWLF
PRGH

6LWXDWLRQ
*HQVHWVWDUWVHTXHQFH
7KHHQJLQHVWDUWVIURPWKHVWDUWLQJSLFWXUHDWWKH
6&$'$RSHUDWRUVWDWLRQ
RU
*HQVHWUXQQLQJ
:LWKVSHHG!QRPLQDOVSHHGWKHUHOHDVHRI
H[FLWDWLRQLVVZLWFKHG21 &RQWDFWJLYHQWR$95 
3UHFRQGLWLRQ7KHUHOHDVHRIH[FLWDWLRQLVLQDXWRPDWLF
UHPRWHPRGH LQ3/& ,IWKHUHOHDVHRIH[FLWDWLRQLV
QRWLQDXWRPDWLFUHPRWHWKHVWDUWVHTXHQFHVWRSV
DQGKROGVRQ7KLVVWDWXVLVQRWOLPLWHGLQWLPH

%\UHOHDVHRIH[FLWDWLRQ21WKHVWDUWVHTXHQFH
VZLWFKHVRQWKHDXWRPDWLFV\QFKURQL]DWLRQRIWKH
DOWHUQDWRUFLUFXLWEUHDNHU &% 
3UHFRQGLWLRQ7KH&%LVLQDXWRPDWLFUHPRWH,IWKH
&%LVQRWLQDXWRPDWLFUHPRWHPRGHWKHVWDUW
VHTXHQFHVWRSVDQGKROGVRQ7KLVVWDWXVLVQRW
OLPLWHGLQWLPH%\DXWRPDWLFV\QFKURQL]DWLRQ
VZLWFKHGRQWKHDXWRPDWLFV\QFKURQL]DWLRQFORVHV
WKHDOWHUQDWRU&%RULIQRWVXFFHVVIXOWKH3/&
DERUWVWKHV\QFKURQL]DWLRQZLWKWKHV\QFKURQL]DWLRQ
IDLOXUHDODUPDIWHUPLQXWHV%\WKLVDODUPWKH
DOWHUQDWRU&%LVVZLWFKHGWRWKHPDQXDOUHPRWH
PRGH
$IWHUWKHUHVHWRIWKHDODUPWKHRSHUDWRUFDQVZLWFK
WKH&%WRWKHDXWRPDWLFUHPRWHPRGHRUXVHWKHVRIW
SXVKEXWWRQDWWKH6&$'$2SHUDWRU6WDWLRQWRVWDUW
WKHV\QFKURQL]DWLRQDJDLQ VHHDOVREHORZ&%LQ
UHPRWHPDQXDOPRGH 
7KHDXWRPDWLFV\QFKURQL]DWLRQIURP6&$'$LV
LQGHSHQGHQWRIWKHVHOHFWRUVZLWFKORFDO
V\QFKURQL]DWLRQ



5HPDUN,QFDVHRI6&$'$VXEPRGHORDG
PDQDJHPHQW*&3DXWRPDWLFPRGH
$OOSULQFLSOHVDUHWKHVDPHH[FHSWRIWKHH[FLWDWLRQ
DQGWKHDOWHUQDWRU&%DUHVZLWFKHGWRWKHDXWRPDWLF

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 51 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
V\QFKURQL]DWLRQIDLOXUHDODUPLVQRWDYDLODEOHIRU
PDQXDOV\QFKURQL]DWLRQ





$OWHUQDWRU&%LQPDQXDOUHPRWHPRGHPHDQV
%\WKHDOWHUQDWRU&%21EXWWRQRUWKHFRUUHVSRQGLQJ
EXWWRQRQWKHSDQHO3&WKHDXWRPDWLF
V\QFKURQL]DWLRQZLOOEHVWDUWHGLIWKHORFDO
V\QFKURQL]DWLRQVZLWFKLVLQSRVLWLRQDXWRPDWLF,IWKH
ORFDOV\QFKURQL]DWLRQVZLWFKLVLQPDQXDOSRVLWLRQWKH
PDQXDOV\QFKURQL]DWLRQZLOOEHVWDUWHG
7KHVWDUWRIWKHDXWRPDWLFRUPDQXDOV\QFKURQL]DWLRQ
IURPWKH*&3GHSHQGVRIWKHSRVLWLRQRIWKHORFDO
V\QFKURQL]DWLRQVZLWFKLQ*&3,Q2))SRVLWLRQQR
V\QFKURQL]DWLRQLVVWDUWHG

$OWHUQDWRU&%2))&RPPDQG
7KH&%2))FRPPDQGFDQEHGRQHXQGHUIXOOORDG
ZLWKRXWORDGUHGXFWLRQ
7KH&%2))FRPPDQGZLWKWKHFRUUHVSRQGLQJEXWWRQ
DWWKHSDQHO3&LVRQO\SRVVLEOHLIWKH&%LVLQPDQXDO
UHPRWHSRVLWLRQ

6SHFLDOIXQFWLRQRI$/7(51$725&%2))SXVKEXWWRQ
7KHDOWHUQDWRU&%2))EXWWRQDOZD\VRSHUDWHVLIWKH
*&36&$'$VZLWFKLVLQ*&3SRVLWLRQ
7KDWPHDQVLWDOVRRSHQVWKH&%LIWKH&%LVLQ
DXWRPDWLFUHPRWHSRVLWLRQ,IWKH&%LVRSHQE\WKLV
EXWWRQLQDXWRPDWLFUHPRWHPRGHWKH&%LVVZLWFKHG
WRPDQXDOUHPRWHPRGHVRWKDWWKHDXWRPDWLFGRHV
QRWVWDUWWKHV\QFKURQL]DWLRQDJDLQDWRQFH
)XUWKHUPRUHWKLVEXWWRQLVDOVRLQRSHUDWLRQLIWKH
ORFDOUHPRWHVZLWFKDWWKHHQJLQHLVLQORFDOSRVLWLRQ
2WKHUZLVHLWZRXOGQRWEHSRVVLEOHWRRSHQWKH&%LQ
HQJLQHORFDOPRGHH[FHSWE\HPHUJHQF\VWRSRIWKH
JHQVHW
$ERUWRI6\QFKURQL]DWLRQWKHUHGSXVKEXWWRQDERUWV
WKHV\QFKURQL]DWLRQDOZD\VLIWKH*&36&$'$VZLWFK
LVLQ*&3SRVLWLRQ
7KHFRUUHVSRQGLQJEXWWRQDWWKH3DQHO3&RQO\
DERUWVWKHV\QFKURQL]DWLRQLIWKH&%LVLQPDQXDO
UHPRWHPRGH

*HQHUDOSULQFLSOHV
(DFK&%WULSFRPPDQGVZLWFKLQJ2))IDLOXUH
V\QFKURQL]DWLRQIDLOXUHDQGHPHUJHQF\VWRSVZLWFKHV
WKHPRGHRIWKHDOWHUQDWRU&%WRPDQXDOUHPRWH
PRGH
1RWXQWLOWKHUHVHWRIWKHIDLOXUHWKH&%FDQEH
VZLWFKHGWRDXWRPDWLFUHPRWHPRGH
,IWKHORFDOUHPRWHVZLWFKDWWKHHQJLQHLVLQORFDO
SRVLWLRQWKHH[FLWDWLRQDQGWKHDOWHUQDWRU&%DUH
VZLWFKHGWRPDQXDOUHPRWH
,QGLFDWLRQDW3DQHO3&0RGH1$
7KLVDYRLGVWKDWWKHH[FLWDWLRQZLOOEHVZLWFKHGRQ
DQGWKH&%ZLOOEHFORVHGDXWRPDWLFDOO\LIWKHHQJLQH
LVVWDUWHGIURPWKHORFDOPRGH7RVZLWFKRQWKH
H[FLWDWLRQDQGWRFORVHWKH&%WKHORFDOUHPRWH
VZLWFKDWWKHHQJLQHPXVWEHLQWKHUHPRWHPRGH
5HPDUNIRUHQJLQHLQORFDOPRGH,IWKHHQJLQHUXQV
ZLWKDFORVHG&%DQGWKHQVZLWFKHGWRWKHORFDO
PRGHWKHH[FLWDWLRQNHHSVVZLWFKHGRQDQGWKH&%
NHHSVFORVHGEXWKLJKHURUORZHUFRPPDQGVIURP

UHPRWHPRGHLIWKLVPRGHLVVHOHFWHG,QWKLVPRGH
WKH*&3VWDUWVWKHHQJLQHDFFRUGLQJWRFRPPRQORDG
UHTXLUHPHQWV





$OWHUQDWRU&%LQPDQXDOUHPRWHPRGHPHDQV
%\WKHFRUUHVSRQGLQJEXWWRQDWWKH6&$'$RSHUDWRU
VWDWLRQWKHDXWRPDWLFV\QFKURQL]DWLRQZLOOEHVWDUWHG
7KHVWDUWRIWKHDXWRPDWLFV\QFKURQL]DWLRQIURP
6&$'$LVLQGHSHQGHQWRIWKHORFDOV\QFKURQL]DWLRQ
VZLWFKDWWKH*&3






$OWHUQDWRU&%2))&RPPDQG
7KH&%2))FRPPDQGFDQEHGRQHXQGHUIXOOORDG
ZLWKRXWORDGUHGXFWLRQ
7KH&%2))FRPPDQGZLWKWKHFRUUHVSRQGLQJEXWWRQ
DWWKH6&$'$RSHUDWRUVWDWLRQLVRQO\SRVVLEOHLIWKH
&%LVLQPDQXDOUHPRWHPRGH
















$ERUWRI6\QFKURQL]DWLRQ7KHVRIWFRUUHVSRQGLQJ
EXWWRQDWWKHRSHUDWRUVWDWLRQ3&RQO\DERUWVWKH
V\QFKURQL]DWLRQLIWKH&%LVLQPDQXDOUHPRWHPRGH

*HQHUDOSULQFLSOHV
(DFK&%WULSFRPPDQGVZLWFKLQJ2))IDLOXUH
V\QFKURQL]DWLRQIDLOXUHDQGHPHUJHQF\VWRSVZLWFKHV
WKHPRGHRIWKHDOWHUQDWRU&%WRPDQXDOUHPRWH
1RWXQWLOWKHUHVHWRIWKHIDLOXUHWKH&%FDQEH
VZLWFKHGWRDXWRPDWLFUHPRWH
,IWKHORFDOUHPRWHVZLWFKDWWKHHQJLQHLVLQORFDO
SRVLWLRQWKHH[FLWDWLRQDQGWKHDOWHUQDWRU&%DUH
VZLWFKHGWRPDQXDOUHPRWHPRGH
,QGLFDWLRQDWRSHUDWRUVWDWLRQ0RGH1$
7KLVDYRLGVWKDWWKHH[FLWDWLRQZLOOEHVZLWFKHGRQ
DQGWKH&%ZLOOEHFORVHGDXWRPDWLFDOO\LIWKHHQJLQH
VWDUWHGIURPWKHORFDOPRGH7RVZLWFKRQWKH
H[FLWDWLRQDQGWRFORVHWKH&%WKHORFDOUHPRWHDW
WKHHQJLQHPXVWEHLQWKHUHPRWHPRGH
5HPDUNIRUHQJLQHLQORFDOPRGH,IWKHHQJLQHLV
UXQQLQJZLWKDFORVHG&%DQGWKHQVZLWFKHGWRWKH
ORFDOPRGHWKHH[FLWDWLRQNHHSVVZLWFKHGRQDQGWKH
&%NHHSVFORVHGEXWKLJKHURUORZHUFRPPDQGVIURP
WKHORFDOPRGHDWWKHHQJLQHDUHQRWSRVVLEOHZLWK

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 52 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
WKHORFDOPRGHDWWKHHQJLQHDUHQRWSRVVLEOHZLWK
FORVHG&%,QWKDWFDVHDQDODUPLVDQQXQFLDWHG
HQJLQHLQORFDORSHUDWLRQZLWKDOWHUQDWRU&%FORVHG


FORVHG&%,QWKDWFDVHDQDODUPLVDQQXQFLDWHG
(QJLQHLQORFDORSHUDWLRQZLWKDOWHUQDWRU&%FORVHG


461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 53 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition































































[[

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 54 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

OVERVIEW DIAGRAMMS

5.1

Overall Single line diagram

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 55 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Bangladesh, Katakhali
Rev./ Date / Status
F / 25.01.2013/ As Built Edition

5.2

Data structure GCP PLC

461180_Operating Instruction Genset Control Commissioning Edition.doc


134

Page 56 of

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

5.3

Protecion and measuring scheme GCP

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 57 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

5.4

Power Plant Operation modes

Grid voltage and frequency variation on the busbar shall not exceed normal +/- 5%.
Manual start order for each / of all gen.-sets.
Automatic synchronizing of alternators, mains feeder will synchronize by costumer.
Parallel operation of Power Plant with grid, with adjustable values of active and reactive
Load for each gen.-set.
In the event of grid failure during grid parallel operation, decoupling from the grid within an
extremely short time for safe operation of the power plant.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 58 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

5.5

Front View of Engine Control Panel +ECPx

This switchboard consists of 2 panels and stands in the engine hall. All the engine sensors are connected to this
switchboard and collected in a control device for sending via Profibus-DP cord to +GCPx and to +EAx panel.
The engine governor are incorporated in this panels and the generator regulator (AVR) is installed.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 59 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

5.6

Engine Auxiliary Panel +EAPx

This switchboard is delivery part of costumer, stands in the engine hall. All the engine auxiliaries are connected
to this switchboard and collected in a control device for sending via Profibus-DP cord to +GCPx.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 60 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

ENGINE CONTROL FUNCTIONS

6.1

Push button of engine control at PC touch panel

Blocking engine start


Release engine start
Start engine
Stop engine

Push button Blocking engine start:


By pressing this push button is the engine start blocked, no engine start is possible. It is active in all modes
(GCP, SCADA or Local mode).
Push button Release engine start:
By pressing this push button is the engine released for remote or local start depending of selected operation
mode GCP, SCADA or Local (at engine)
Push button Start engine:
This push button is released if the push button Release engine start is activated, operation mode GCP is
selected and the local switch at engine is in remote position. By pressing the engine will start automatically at
first the start conditions are requested and if they are fulfilled, pressing again causes the engine to be
started.
Push button Stop engine:
This push button is released in operation mode GCP and the local switch at engine is in remote position. By
pressing this push button the engine stopped automatically.
Function of selector switch 66S6 operation mode:
In position GCP, the genset can be requested using the Manual Start/Stop button from the PC677B and the
gen. CB contol push buttons on/off at the mimic diagram is relesed.
In position SCADA, the genset can be requested from the DCS system.

6.2

Start procedure of engine in GCP mode

By pressing the "Start" button the start conditions are requested.


The auxiliary drives for the start requirements are requested at the same time.
The following auxiliary drives are switched on:
(local mode),
1. Pre-lubrication oil pump X0MJV21AP030 (P007)
2. Release speed controller
3. Request fuel module
4. Test shut down valve X-1SZV 1012

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 61 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
The following conditions must be met for start release:
Prelubrication time of T = 1 minute expired. (Exception: Start prelubrication is not necessary, if the standstill
time is less than the adjustable time (Max. standstill time start prelubrication is required).
No shutdown fault active.
The turning gear not engaged. (FE46)
X-1PSH2170 lube oil pressure engine start release (0,3bar) dyn.
X-1PSH3170 cooling water pressure high (2bar), dyn.
No X-1SZV1012 emergency stop valve fault (FE102)
No Slow turn fault, purging necessary (FE148)
If the start-up conditions are met, this is displayed by the LED START RELEASE .
If the start conditions are fulfilled, pressing again causes the engine to be started.
The engine can be shut down by pressing STOP.
The start-up air valve (X-1SSV1011) is opened.
If the diesel engine does not attain the ignition speed, or START is not activated, the starter valve is closed.
If the diesel engine does attain the ignition speed, the LED START CONTROL go out and the following
auxiliary drives are selected:
1. Cylinder lubrication 1EM2470
cylinder lub. oil pump)
Once the engine is run-up, the excitation must be switched on manually.
When the nominal voltage and frequency are reached and the waiting time for load release has expired, the
generator protection circuit breaker can be switched on. In order to do this, press the push button GENERATOR
ON (button in the mimic diagram). The automatic unit then asks whether a generator or the mains coupling
circuit breaker is switched on. If the interlocking condition is met (no generator on and the mains coupling circuit
breaker is off), the generator circuit breaker is closed directly.
If the interlocking condition is not met, the automatic unit selects synchronisation. This selection is indicated by
the activation of synchronoscope and the flashing generator circuit breaker acknowledgement. The
synchronisation system establishes the synchronous condition and directly switches on the generator protection
circuit breaker (provided that the syn. selector switch is in the Automatic position)
After successfully closing of circuit breaker, the automatic unit turns the synchronisation off again. The genset
can only be loaded as settable limit value for manual operation. The automatic power controller is active,
loading is limited to the permissible value.
Pressing the push button GENERATOR CB OFF directly opens the generator circuit breaker.
The genset is switched off again by pressing of push button Stop.
The following genset auxiliary drives start a idle run time to cool down the engine.
1. Pre-lubrication oil pump P007

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 62 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.3

Start procedure of engine in SCADA mode

In position DCS the genset can be from the DCS system.


If the genset is requested (is displayed via LED START DEMAND), the start-up preconditions are selected
as in manual operation.
If the start-up preconditions are met (see Start procedure of engine in GCP mode), the genset will be
started.
If the engine is running, DCS must give the signal ALTERNATOR CB ON. Then the automatic unit selects
synchronisation. The synchronisation system establishes the synchronous conditions and directly switches on
the generator circuit breaker. The generator power controller (for the loading and unloading criteria please
refer to the description of the load controller) is now activated with the status signal Generator CB is on.
If the genset is deselected, the load of the generator will be automatically reduced. After this, the generator
circuit breaker is opened and the genset will be shutdown after an idle run time.

6.4

Local Remote switch 1HZ1012 at engine

This switch is used for commissioning. In local position is the Start pus button 1HOS1011 at engine
released. By first pressing the engine start preconditions are requested, after the start preconditions are
fulfilled the engine can start, after a second press the engine will start in idle mode.
-

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 63 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.5

Generator Synchronisation

The following functions can be preselected using the synchronisation selection switch 232S3:
1- Automatic
0- off
2- Manual
These selections are only available in GCP position. In SCADA position is generally the automatic synchronising
function selected independently of the position of synchronisation selection switch.
Position 0 off
In this position, no synchronisation selection takes place.
Position 1 - Automatic Synchronisation
In this position, the automatic synchronisation device SPM is switched on. The SPM now provides the
synchronism by modifying the engine speed. Once synchronisation is established, the SPM discontinues the
synchronisation command. The generator c.b. is directly closed by this switch on command. If the c.b. closed
successfully, the synchronisation is aborted. The automatic synchronisation can be monitored by the
synchronoscope.
(Adjustment of the SPM see separate description)
The synchronisation time is monitored. If the synchronisation is requested and the selected time has passed,
then this is displayed as fault signal.
Position 2 - Manual Synchronisation
In this position, the synchronoscope is switched on. Now, with the help of the speed adjustment push button, the
generator frequency must be manually adjusted to the bus bar frequency. Rough speed adjustment can be
made by comparing both frequencies (double frequency meter). If both frequencies are about the same, then
one can fine-tune by watching the synchronoscope. If the synchronoscope LEDs are still moving very slowly,
then no more adjustment command should be given. Now the connection can be made by hand.
If the generator c.b. closed successfully, then the synchronisation is aborted.
In order to avoid faulty synchronisation a synchr. check relay integrated in the LED synchronoscope. The green
LED at the top indicates the synchronisation release.
The speed adjustment push button in the +GCP panel is only released during the synchronisation.
The generator voltage is also compared with the mains voltage by the generator regulator. This control is carried
out in order to keep the switch-on peak as low as possible.
CAUTION
1. Please, ensure that before leaving the station, the selector switch for synchronisation is switched back to
Automatic.

6.5.1

Parameter list for Synchronisation Monitoring

Description

Synchronisation monitoring

Dimension

Basic setting

min:sec

02:00

461180_Operating Instruction Genset Control Commissioning Edition.doc

Setting after
taking into
operation

Page 64 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.5.2

Generator circuit breaker monitoring

Generator switch off fault


The fault signal comes up when the PLC wants to switch off the generator c.b. but fails to switch off after
command. When this message is displayed, and a stopping fault occurs, then the mains coupling c.b. is
switched off.
Generator switch on fault
The fault signal comes up when the PLC wants to close the generator c.b. but fails to close after command
and after a delay of one second.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 65 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.6

Load controller description

6.6.1

Settings of load controller GCP


Dimension

Basic setting

1
2

Page 1
Nominal value from CCP
Nominal value SCADA

%
%

Indication
100

3
4

Actual nominal value


Actual load (electrical)

%
%

Indication
Indication

5
6
7
8

Dead band
Proportional area Xp
Pulse length
max. pause

%
%
sec
sec

1
30
0,5
2.0

9
10
11

Gradient nominal value


Gradiant manual operation
Gradiant SCADA operation

%/s
%/s
%/s

1
1
0,5

12
13
14
15

Unloading value
Del. Load reg. Fault
Release load inc. after change fuel oil
Nominal load (electrical)

%
sec
sec
kW

10
300s
30
8370

16
17
18
19
20
21

%
%
%
%
%
%
%
kw

65
60
75%
70
70
70
97,5
8954

24
25
26
27
28
29
30
31
32
33
34
35

Max. load exh. Gas temp. red.


Max. load gen. winding temp. red.
Max. load turbocharger speed red.
Max. load splash oil monitoring
Max. load change fuel oil
Max. load fuel oil viscosity
El. efficiency
Nominal load (mechanical)
Page 2
Actual mechanical load
Exh. gas temp. load reduction
Hysteresis
Step width load dec/inc.
Load inc/dec period exh.
Lower load point (default)
Max. load (overload mont.)
Max. load (exh. gas temp.)
Max. load (air intake)
Max. load derating by speed (normal)
Max. load derating by speed (overload)
Max. load (lub. oil temp.)

%
C
C
%
s
%
%
%
%
%
%
%

Indication
560
5
1
120
90
Indication
Indication
Indication
100
100
100

36

Max. permitted load elec.

100

23

461180_Operating Instruction Genset Control Commissioning Edition.doc

see acceptance
certificate

Page 66 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
37

47

Min. load gen. set


Maximum allowed eng. Power
intake air temperature before TC
Set point 1 air temp. intake
Set point 1 load
Set point 2 air temp. intake
Set point 2 load
Set point 3 air temp. intake
Set point 3 load
Set point 4 air temp. intake
Set point 4 load
Set point 5 air temp. intake
Page 3
Set point 5 load

48
49
50
51
52

Load control warming up process


1 Warming up set point 1
2 Warming up period step 1
3 Warming up set point 2
4 Warming up period step 2
5 Warming up period step 3

%
s
%
s
s

5
180
30
0
240

53
54
55
56
57
58
59
60

Load increasing without preheating


1 Warming up set point 1
2 Warming up period step 1
3 Warming up set point 2
4 Warming up period step 2
5 Warming up period step 3
6 Warming up set point 3
7 Warming up period step 4
8 Warming up period step 5

%
s
%
s
s
%
s
s

5
60
30
480
0
3400
30
60

Start derating by underspeed (normal)


Gradient derating by underspeed (normal)
Start derating by underspeed (overload)
Gradient
derating
by
underspeed
(overload)
Start derating by overspeed (overload)
Gradient derating by overspeed (overload)

%
%
%
%

100
1
105
1

%
%

102,5
2,5

Lube oil temp. load red.


Hysteresis
Step width load dec/inc
Page 4
Load inc/dec period exh.
Lower load point (default)

C
C
%

70
3
2

s
%

5
85

38
39
40
41
42
43
44
45
46

61
62
63
64
65
66
67
68
69
70
71

6.6.2

40

C
%
C
%
C
%
C
%
C

15
100
20
100
21
99,5
30
95,2
40

90,4

to

Monitoring of control function

The load control failure signal arises when the actual value for the set time is beyond the dead zone.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 67 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.7

Loading of Engine

The loading of the engine will be done by curve Shortest possible continus loading (without Jet Assis)

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 68 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.8

Limitations in load range by the PCU (power control unit)

PCU is a Software-System, which limits the maximum power delivery of the engine dependant on
surrounding conditions:
Load reduction dependant on the ambient air temperature
Load reduction because of unacceptable mechanical overload and speed difference
Load reduction because of too high exhaust gas temperature before turbo charger
The permitted load calculated by the PCU always represents the mechanical load to the engine coupling.

6.8.1

Load reduction dependent on ambient air temperature.

The permitted long-term performance is defined by the compatible limit curve. This curve is established in
the form of support values (table). By fixing up to 5 temperature support values, the limit values for the longterm performance are interpolated each linearly.
The establishing of the actually permissible performance is made in direct dependence of the ambient air
temperature.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 69 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.8.2

Load reduction because of too high exhaust gas temperature before turbine.

In case of excess of a pre-set limit value (e.g. 550C), the permitted load is gradually reduced by steps of 1%
of the nominal load until the temperature limit value is undershot, taking into consideration a steady state
time of 2 minutes. In case the temperature falls lower than 5C (set value), the load can be released again in
1% steps until a limit value is reached after the point 1 or 2 of the permitted load.
REMARKS
All three-load reduction possibilities are always fundamentally calculated through. It is always the
lowest that sets the permitted engine load output.
The load reductions are limited to Pmin (specific to the plant limit value, or default value). As far as an
internal fault in the PCU leads to it, then no maximum permitted load is calculated any more (e.g.
Failure of the ambient temperature sensor), then the higher-ranking load control must reduce the
load of the engine to Pmin on safety grounds.
In order to render load reduction transparent to the client, the following information are visualised on a
display:
Results of the PCU calculation:
Display of the maximum permitted mechanical load because of load monitoring
Display of the maximum permitted load because of exhaust gas temperature
Display of the maximum permitted load because of ambient air temperature

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 70 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.9

PCU Parameter list (example)

Page 2
El. Efficiency
Nominal load (mechanical)
Act. Mechanical load
Period monitoring overload
Max. overload per period
Delay overload operation
Remaining time overload
Exh. Gas time load reduction
Hysteresis
Step with load dec/inc
Load inc/dec period exh.
Lower load point (default)
Max. load (overload monit.)
Max. load (exh. Gas temp.)
Max. load (air intake)
Max. permitted load elec.
Derating by speed (normal)
Derating by speed (overload)

Dimension

Basic setting

%
kW
%
min.
min.
sec
min.
C
C
%
min.:sec
%
%
%
%
%
%/%
%/%

97,3
8370
Display
0
20
20sec
Display
555
5
1
120sec
90
Display
Display
Display
Display
1
1

461180_Operating Instruction Genset Control Commissioning Edition.doc

see acceptance
certificate

Page 71 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.10 Further load limitations


Additionally to the PCU, the following events can lead to load limitations:

Fault signal from the monitoring of the exhaust gas temperature behind cylinder.
Max. load of gen. Overtemp.
X-1SZH1004A turbocharger speed max. load red.
X-1SZH1004B turbocharger speed max. load red.
X-1TAHHU001 generator winding overtemp. -A Red.
X-1TAHHV001 generator winding overtemp. -A Red.
X-1TAHHW001 generator winding overtemp. -A Red.

If one of the above named monitoring reacts, then the load is reduced to a pre-settable value (Lower load
point). Only when the corresponding fault signal is quitted, full load operation will be released.
A message Actual engine nominal load exceeded (FE111) is created from the error messages that cause a
reduction in power, see the error message bar or generally if an engine overload exists.
This message serves to warn the operator that the load must be reduced or another machine started as
quickly as possible.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 72 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.11 Exhaust Gas Temperature Monitoring


6.11.1 Functional Description
This control monitoring of the exhaust gas temperature is part of MAN Software.
Purpose of the herein described software module Exhaust Gas Temperature Monitoring is the monitoring
of the exhaust gas temperatures of a Diesel power plant engine. Always the software module must be
integrated into another software program.
The temperatures are measured by Type K sensors. This means that the exhaust gas temperatures are
monitored indirectly and digitally by software.
The monitoring process is always active, independently from the current operating state of the corresponding
engine (running or not running).

Image 1.0 shows an example of an exhaust gas temperature monitoring module within a SCADA
visualization.


























































461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 73 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition


































































































461180_Operating Instruction Genset Control Commissioning Edition.doc



Page 74 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition








461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 75 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.11.2 Exhaust gas temperature monitoring functions


Several sensors measure the current absolute value of the exhaust gas temperature constantly. Measuring
points exist at every cylinder of an engine and at the turbo charger. All measured values are analysed by the
PLC. Depending on the result of every analysis the PLC sends signals to other software modules, e.g. a
SCADA visualisation.

The exhaust gas temperature monitoring is divided into the following sub functions.

Monitoring maximal value at cylinder


Each sensor monitors the exceeding of the allowed maximal value.
The following criteria are monitored:

If the measured value exceeds a predefined first temperature limit, the alarm signal PRE ALRAM will be
generated and sent to the SCADA visualisation.

If the measured value exceeds a predefined second temperature limit, the signal ENGINE LOAD
REDUCTION will be sent from the PLC to the SCADA visualisation and other software modules within the
PLC.

Monitoring mean value deviation at cylinder


The PLC calculates a mean value of all temperature measuring sensors with status plausible -. Basis for
the calculated mean value are the present absolute values. Further on the PLC calculates for every sensor
the deviation of the absolute value from the mean value. This is necessary to prevent that the temperature at
a single measuring point deviates too much from the calculated mean value.

If the calculated deviation exceeds a first temperature limit, the alarm PRE ALARM MEAN SENSOR will be
generated and sent to the SCADA visualisation.

If the calculated deviation exceeds a second temperature limit, additionally the alarm ALARM MEAN
SENSOR is generated and sent to the SCADA visualisation. Optional the signal ENGINE LOAD
REDUCTION will be sent from the PLC to the SCADA visualisation and other software modules within the
PLC.

A second temperature limit is only active if the corresponding genset is running with a load of more than 60
% (default value). The default value can be changed.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 76 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

Monitoring maximal value before turbo charger


The exceeding of the allowed maximal value is monitored.
The following criteria are monitored:

If the measured value exceeds a predefined first temperature limit, the alarm signal PRE ALRAM will be
generated and sent to the SCADA visualization.

If the measured value exceeds a predefined second temperature limit the alarm signal ALARM SENSOR will
be sent from the PLC to the SCADA visualization. The signal ENGINE LOAD REDUCTION will be sent to the
SCADA visualization and other software modules within the PLC.

If the measured value exceeds a predefined third temperature limit, the signals OVERTEMPERATURE
SENSOR and ENGINE SHUTDOWN will be created and sent from the PLC to the SCADA visualization and
other software modules within the PLC.

Temperature value after turbo charger


At this measuring point no monitoring of the exhaust gas temperature takes place. But the measured
absolute value of the present exhaust gas temperature is sent to the SCADA visualization constantly.

Reset
All generated alarm signals are no longer active if the following conditions are given:

7KHSUHVHQWDEVROXWHYDOXHDWDPHDVXULQJSRLQWKDVIDOOHQEHORZWKHUHOHDVLQJWHPSHUDWXUHOLPLW
RQFHDJDLQ

$VRIWZDUHUHVHWZDVGRQH

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 77 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.12 Charge air temperature control TC6180 with 01MJG32AA010-M01 (MOV003)

AUTOMATIC LOCAL

MANUAL REMOTE

MANUAL LOCAL

AUTOMATIC REMOTE

Released operation modes:

Automatic functions:
With charge air temperature control, the fluid flow of LT cooling water via the charge air cooler is controlled.
The reference value for charge air temp. is a linear function of the ambient temperature, measured by the air
intake temperature of the engine.
The controller is released by a load limit high (list of GCP limit values) to prevent condensating in the charge
air cooler.
Manual functions:
In this function the valve can be controlled by push buttons in direction Open and Close

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 78 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.12.1 Parameter list charge air temperature control


act.
ambient
temperature
2TE6100
act. charge air temp. 2TE6180
act. nominal charge air temp.
calculated output

Unit
C

Basic setting
indication

End setting
indication

C
C
%

indication
indication
indication

indication
indication
indication

Nominal value preheating


Actual nominal value from ambient
temperature
Actual
nominal
value
from
Allumatic
Set point 1 ambient temperature
Set point 1 nominal value
Set point 2 ambient temperature
Set point 2 nominal value
Set point 3 ambient temperature
Set point 3 nominal value

C
C

85
indication

indication

C
C
C
C
C
C

16
42
28
56
48
42

Ambient air pressure


Charge air pressure before cyl.
1PT6100

mbar
mbar

1000
indication

Gain
Integration time
Dead zone
Minimum manipulated variable
Impulse time
Pause time

ms
%
%
ms
ms

3
1m
1
0
1s
5s

Action time control valve


act. valve position
Delay controller failure

sec
%
s

Pulse time minus


Pulse time plus

indication

461180_Operating Instruction Genset Control Commissioning Edition.doc

2m40s
indication
200
2
2

Page 79 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

CHATCO curve
Example, pls. look MAN requirements for the used engine

6.12.2 Function of controller

Monitoring of the control valve

The error message X-1TC6180 Chatco c.w. control fault is created, if the control value is recognised as
failed.

6.12.3 Selection operating mode


Following modes are selectable:
Automatic
Manual
Position Automatic:
In this position automatic control is released as described previously.
Position Manual:
This position is intended for service purposes. In this mode are to sets of push buttons selectabele:
Valve command Open and Close
Valve command Open and Close by pulses
Valve command Open and Close
By pressing the button Open, the valve goes in open position. By pressing the button Close, the valve goes
in close position.
Valve command Open and Close by pulses
By pressing the button Open, the valve goes one step in open position. By pressing the button Close, the
valve goes one step in close position.

Monitoring of the control valve


The error message 1TC6180 Chatco c.w. control fault is created, if the control value is recognised as
failed.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 80 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.12.4 Allumatic
Automatic Charge Air Control
AlLumatiC CHARGE AIR TEMPERATURE CONTROL
The requirement of the Allumatic-System is to control the charge air temperature regarding to its dewpoint,
i.e. to keep the charge air temperature as low as possible but still high enough so the air bonded water vapor
will not condensate.
The setpoint of the charge air temperature is the charge air dewpoint temperature before cylinder + 1C
(safety margin).
The lower the charge air temperature the lower is the NOx value and also the fuel oil consumption of an
engine.
The airbonded water vapor reduces the NOx value also.
In case of fault by the Allumatic system, a switch over to CHATCO (charge air control depending of the
ambient air temperature) is necessary.

Operation Modes
The operation modes of the Allumatic are Manual Remote and Automatic Remote
Manual Remote
This mode has to be selected at SCADA by soft touch buttons. With these the operator can move the valve
between the position A-AB (heat exchanger active cooled) and B-AB (heat exchanger bypassed).
Automatic Remote
The software controller is active with LT cooling water pump P025.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 81 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.12.5 Calculating the dewpoint temperature in normal mode


The dew point temperature signal of the intake air unit is available.
The relative humidity measured at 1/2/3HE6010 and the temperature measured at 1/2/3TE6010 at
the manifold of the intake air unit will be measured in CCP by 1/2/3TT6010 1/2/3HT6010.
These result for calculation of tdAns will be transferred to the GCP-PLC. Pls. see description of CCP
item Calculating the dew point temperature for charge air temperature control in genset PLC.
Ambient Air Pressure of 1100 mbar depends on the height of 27m above sea level..
Charge Air Pressure measured by1PT6180 an analog value of 4-20mA will be installed at each
engine.
Charge Air Temperature measured by 2TE6180A, a PT100 resistor will be installed at each engine.
With the help of these values the dewpoint temperature td before cylinder will be calculated.

tdAll =
Pvz
PAns
tdAll
tdAns

=
=
=
=

4102,99
p
ln p vZ
t dAns + 237 , 31 Ans
4102 , 99

charge air pressure before cylinder


charge air pressure before cylinder
dewpoint temperature before cylinder
released temperature before cylinder

237,431
4150 [mbar]
[mbar]
[C]
[C] from CCP

With the result of calculation the charge air temperature can be defined.
- Setpoint for charge air temperature = tdAll dewpoint temperature before Cylinder +1K

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 82 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.12.6 Calculating the dewpoint temperature in failure mode


The dewpoint temperature signal of the air intake unit is not available.
If the dewpoint temperature signal fails, (the analogue value of TT6010 is under 4mA or over 20mA) the
PLC has to switch over to CHATCO. In this mode the charge air temperature is controlled by a
programmed function of the ambient air temperature, measured by 1TE6000.

6.12.7 Achievement of the optimal charge air temperature


To reach the calculated charge air temperature, the valve MOV003 (1TCV6180) must be actuated to flow
through the heat exchanger or to bypass it.
By supplying the charge air cooler with cold water from the LT circuit, the charge air temperature will
decrease, depending on the water flow rate.

Allumatic Mode
The PLC moves the valve to position A-AB in case of temperature value at 2TE6180A is higher than
the dewpoint temperature value before the cylinder +1C
The PLC moves the valve to position B-AB in case of temperature value at 2TE6180A is lower than the
dewpoint value before the cylinder +1C.

CHATCO Mode
The PLC regulates the valve between position A-AB and B-AB regarding to the temperature value at
intake air temperature sensor 1TE6000.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 83 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.12.8 Alarms

wire break of 1TE6000; 1PT6180; 2TE6180A


Charge air temperature increase over 60C at engine load index >35%
Charge air temperature decrease under 40C
charge air temperature decrease below the dewpoint temperature before cylinder
Position indicator at MOV003 (1TCV6180) indicates Position Charge Air Cooler bypassed, but
the charge air temperature is more than 1C above the dewpoint temperature before cylinder.
Unit failure of TT6010

6.12.9 Emergency Stop

In case of emergency stop of the engines, the PLC forces the valve into position B-AB.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 84 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 85 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.13 HT cooling water control valve 01MJG31AA010-M01 via TC3180 with MOV 002

AUTOMATIC LOCAL

MANUAL REMOTE

MANUAL LOCAL

AUTOMATIC REMOTE

Released operation modes:

Automatic functions:
The use of this technically advanced control system is necessary as the temperature stabilisation of todays
increasingly complex cooling water systems can no longer be handled with simple means.
This description of HT temperature control applies to cooling water systems which are shown in the PID
diagram from MAN.

With this control system, the cooling water temperature behind the mixing point (in front of the engine with
PT100 sensor) is constantly controlled so that the temperature at the engine outlet (PT100 sensor 3TE3180)
corresponds to the reference value of the engine. The reference value at the mixing point is adapted
depending on the engine load calculated according the turbo charger speed.
The control system basically works in the same way as cascade control with a precalculation of the reference
value via disturbance signals for the internal control circuit (see sketch below).
This temperature controller is released by engine operations.
The inner control circuit controls the HT cooling water temperature in front of the engine and the charge air
cooler (at the mixing point, see value analogue values, (TE3165) HT c.w. temp. bef. P002 to a reference
value which it received from the precalculation of the reference value. This reference value is corrected by
the external control circuit (W1 = Wv + Y2).
The outer control circuit thus controls the HT cooling engine temperature after the engine.
Inner control circuit:
As the inner control circuit measures the temperature at the mixing point, temperature fluctuations are
quickly detected in the inflow (or backflow of the engine) and can be corrected immediately.
Outer control circuit:
The correction value of the outer control circuit is adjusted at regular time intervals (tC) . In detail, this
functions as follows:
After the time tC the correction value Y2 is changed by a fifth of the still existing deviation (Xd2) of the actual
value after engine (X2) of the reference value after engine (W2).
The correction time tC must be set so that is greater than the water circulation time of the system. It may not
be an integral multiple of the value. This is required in order to prevent the control circuit from becoming
unstable. The integration of the controller is thus gradual.
461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 86 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
The correction value is limited to Y2max so that the reference value W1, in case of control parameters which
are not set optimally, is not too far. This prevents instability of the control circuit. If larger corrections than
Y2max are required, the characteristic curve (temperature difference T between the mixing point and the
engine outlet is a function of the actual load of engine) is not set correctly for precalculation of the reference
value.
Precalculation of the reference value:
Precalculation of the reference value is used to be able to respond quickly to changes in load or changes in
the flow rate without having to wait for the considerable downtime of the control paths.
The precalculation of the reference value is carried out primarily with the actual load signal. The reference
value at the mixing point is calculated in advance from the reference value after the engine via a
characteristic curve determined (by measurement) during a trial run and on commissioning, which specified
the temperature difference T between the mixing point (in front of the engine and the charge air cooler)
and the engine outlet as a function of the actual load: Wv = W2 - T
If the characteristic curve is set more exactly, the overlaid (outer) control circuit only needs to correct minor
remaining deviations.
A sudden change in load results in a change in temperature with some delay due to the inertia of thermal
systems (heat transmission time tHT). For this reason, the actual load may not be directly processed as input
signals for control, but must first be delayed in time by means of a filter element.
On the other hand, the control must also be carried out in a short amount of time. This is necessary as the
cooling water requires a particular amount of time (tF) to flow from the mixing point to the charge air cooler.
With long pipes between the mixing point and the charge air cooler, the time set for the filter element is
somewhat reduced (tPT1 = tHT - tF).
This temperature controller is released by engine operations.
The temperature controller takes care of all the control tasks (controller 1, controller 2 and precalculation of
the reference value). It only requires the appropriate input signals to do this:
Actual value W1 at the mixing point (Pt100 resistance thermometer, see value eng. inlet cw. temp.)
Actual value W2 after engine (Pt100 resistance thermometer 3TE3180 cyl. c.w. temp. beh. Engine)
Actual load signal, calculated in the load controller
Actual turbo charger speed signal
Manual functions:
In this function the valve can be controlled by entering a set point in percentage Set point for manual
operation. The controller will move then to this set point.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 87 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.13.1 Parameter list HT cooling water controller


The parameters used in the description are listed here as examples:
ID Description
Unit
Basic setting
1 Nominal value temperature W2 (3TE3180)
C
2 Actual nominal value temp. W1
C
indication
3 Actual value HT temp. behind eng. 3TE3180
C
indication
4 Actual value HT temp. eng. inlet
C
indication
5 Set point for manual operation
%
6 Controller output
%
indication
7 Actual pos. temp. control valve
%
indication
8 Gain
9 Integration time
s
10 Dead zone
%
11 Minimum manipulated variable
%
12 Impulse time
ms
13 Pause time
ms
14 Actuator runtime
min
15 Delay controller failure
s
16 Delay time PT2 turbo speed
s
17 Limit offset Y2 behind endine
C
18 Interval for calculate Y2 offset
s
19 Offset Y2 per interval
%
20 Offset Y2
C
21 Turbo speed set point 1
rpm
22 Temperature difference 1
C
23 Turbo speed set point 2
rpm
24 Temperature difference 2
C
25 Turbo speed set point 3
rpm
26 Temperature difference 3
C
27 Turbo speed set point 4
rpm
28 Temperature difference 4
C
29 Turbo speed set point 5
rpm
30 Temperature difference 5
C
31 Actual temperature difference
C
32 Engine speed set point 1
rpm
33 Flow factor KF-1
34 Engine speed set point 2
rpm
35 Flow factor KF-2
36 Actual flow factor KF

Final setting
90
Calculated value
Actual value
Actual value
Actual setting
Calculated value
Actual value
-2
30
0,3
0
100
500
1,33
120
3
3
15
3
Calculated value
2500
2
4000
5,5
7500
10,5
9500
18
12000
28,5
Actual value
250
1
500
1
Actual value

Monitoring of the control valve

The error message 1TC3180 HT c.w. control valve fault is created, if a control value is recognised as
failed.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 88 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.14 LT cooling water control valve 01MJG32AA025-M01 TC3202 with MOV004:

AUTOMATIC LOCAL

MANUAL REMOTE

MANUAL LOCAL

AUTOMATIC REMOTE

Released operation modes:

The LT cooling water control is realised with a PI controller in PLC.


The actual value is provided by a PT100 measuring point TE 01MJG32CT220, the reference value is
defined in the controller by software.
The control parameters must be adjusted to the control path in situ.
Following modes are selectable:
Automatic
Fixed value
Position Automatic Remote:
In this position automatic control is released as described previously.
Position Manual Remote:
In this function the valve can be controlled by entering a set point in percentage Set point for manual
operation. The controller will move then to this set point.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 89 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.14.1 Parameter LT cooling water control


Nominal value preheating temp.
Actual nominal value
Actual value 01MJG32CT220
Manual operation
Controler output
1MOV004 position temp. control valve
Start value temperature
Warm up time
Idle run time
Gain
Integration time
Nominal value gradiant
Dead zone
Minimum manipulated variable
Impulse time
Pause time
Actuator run time
Delay controller failure

Unit
C
C
C
%
%
%
C
C
s

Basic setting

indication
indication
indication
26
38

s
%/s
s
%
s
s
s

End setting
32,0
Actual value
Actual value
Actual setpoint
Actual value
Actual value
25,0
50,0
10,0
-1,00
150
20
1
0
1,0
1,0
180
200,0

6.15 Slow turn


The slow turn function is designed for installations with several engines; it prevents liquid in the cylinder at
the start of the engine. This function runs principally like the control of the starting air at the starting process,
but over a more suitable pressure regulation valve with pressure reduction for slower engine speed.

6.15.1 Running sequence slow turn


This function is called for after the request for start and ending of the start pre-conditions, in case the
standstill period exceeded 4 hours.
The progression is as follows:
1. Switching off the speed regulator
2. Triggering both slow turn valves (in order to reduce the starting air pressure (30bar) to slow turn
pressure, which is low enough to ensure that in case there is liquid in the cylinder, the engine does
not turn anymore and to lock the main starting valve).
3. Start of the waiting time t1, in order to decrease the high pressure in the starting air present in the
pipes to slow turn pressure.
4. Exiting of the starting valve X-1SSV1011 (display slow turn in the illustration measuring points
eng.) The revolution counter starts (2,5 revolutions) and set the time function element t2 for the
monitoring of the revolution counter.
5. The revolution count ensues over two sensors, which supply their signals to the controls phaseshifted. This makes detection of speed as well as a direction of rotation possible.
The revolution counter is increased or decreased during the slow turn phase according to the
revolution direction.
6. Once the time function element t2 has run and the prescribed revolution count is not attained, there
is
an
irregularity
in
the
progression
of
the
slow
turn
function.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 90 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
The error signal slow turn error appears and the function slow turn is interrupted. The triggering of
the slow turn valves and of the starting valve are cancelled.
7. In case the prescribed number of revolutions is attained within a period of time t2, which is shorter
than the minimal set limit value Tmin, then a slow turn error signal and the function slow turn is
interrupted.
8. Otherwise, the proper start of the engine can follow. The slow turn valves are set back and the
speed regulator is released, the starting valve remains exited, ready for the following start. The time
counter for the standstill time of the engine is set back and the engine starts.

Remark: In case a slow turn has happened, the user must there and then manually remove the liquid from
the cylinders by turning the engine with the help of the turning gear with opened indicating taps. Blowing
through is not permitted. In case this is not carried out, a slow turn error will happen again automatically
when a new start is attempted. The program tries in every case to successfully end a slow turn procedure.

6.15.2 Parameter slow turn


Parameter
Slow turn air pressure
Revolution counter
Time function element t1 for pressure decrease
Time function element t2 slow turn monitoring
Minimum time Tmin for slow turn
Engine standstill time

Values
9-14 bar (according to engine), mechanically
adjustable
2,5U
2s
40s
15s
4h

6.15.3 Signal progression for direction of rotation recognition


The signal progression in case of forward rotation
X-5SE1000
X-1SE1000

Signal progression in case of backward rotation


X-5SE1000
X-1SE1000

The forward rotation always strokes the ascending flank of 1SE 1000 on a 1-signal of 5 SE 1000.
In a backward rotation, this would be the descending flank.
For the BACKWARDS rotation direction, this would be the descending flank.
Legend:
X-1SE1000 = revolution count sensor
X-5SE1000 = revolution count sensor for slow turn

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 91 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.16 Ajdusting instruction of software PID-controller


Pls. look at this file Simatic Standard PID Control_Stdpid_e.pdf in folder Operation instruction.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 92 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.17 Splash oil

6.17.1 General

The control system Splash-Oil temperature monitoring and supervision considered the
crank gear temperatures.
This system measures the temperatures of the splash oil which is collected on the insides
of the individual crankcase covers via collecting channels PT100 sensors. Than the crank
gear temperatures are monitored indirectly.
The supervision function is activated after engine turns higher than a defined speed or if
the mean temperature is over a defined value and remains active until engine standstill.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 93 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.17.2 Subfunctions
The SPLASH OIL temperature monitoring is divided into the following sub functions

6.17.3 Monitoring Regarding Maximum Value Exceeding


For each sensor the exceeding of the maximal value is supervised.
The following criteria are for supervision:
- If the measured value in the range of values, no alarm is generated
- Value under the pre alarm border the bar graph is green
- If the measured value exceeds the first temperature limit and elapsed a certain time
with 3 seconds, the alarm "Splash Oil Pre Alarm is generated.
- Value from the pre alarm border the bar graph is yellow
- If the measured value exceeds the second temperature limit and elapsed a certain time
with 3 seconds, additionally the alarm "Splash Oil Alarm is generated and the request
Engine load reduction is sent (Optional)
- Values from the alarm border the bar graph is red
- If the measured value exceeds the third temperature limit and elapsed a certain time
with 3 seconds, additionally to the previous two alarms "Over Temperature Alarm is
generated and the second request Engine Shutdown is sent
- Values from the max border the bar graph is red
- If the measured value in the range of values, the alarm is deleted

6.17.4 Monitoring Regarding Mean Value Deviation

In addition to the monitoring of the absolute value, the monitoring of the deviation of each
splash oil sensor from the mean value is also necessary to ensure that an overheating of
one sensor over the entire operating temperature range of the engine is recognized.
- If the measured value in the range of value, no alarm is generated
- Values under the pre alarm delta border the bar graph is green
- If the measured value exceeds the first temperature limit and elapsed a certain time
with 3 seconds, the alarm Pre Alarm Mean is generated
- Values from the pre alarm delta border the bar graph is yellow
- If the measured value exceeds the second temperature limit and elapsed a certain time with 3
seconds, additionally the alarm Alarm Mean Sensor is generated and the request Engine
load reduction is sent (Optional)
- Values from the alarm delta border the bar graph is red
- If the measured value exceeds the third temperature limit and elapsed a certain time
with 3 seconds, additionally to the previous two alarms Over Temperature Alarm
Mean Sensor is generated and the second request Automatic Engine Shutdown is
sent.
- Values from the max delta border the bar graph is red
- If the measured value in the range of values, the alarm is deleted

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 94 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.17.5 Wire Break


The temperature sensors are monitored of wire break. If more than half the temperature
sensors have a wire break, then the request Automatic Engine Shutdown is sent.
- If the temperature sensors has a wire break, the alarm Wire Break is generated in
the absolute bar graph and in the mean bar graph
- Value from the absolute bar graph is yellow, shows W/B and the value is 0
- Value from the mean bar graph is yellow, shows N/A and the value is 0
- If the temperature sensors has not a wire break, the alarm Wire Break is deleted


6.17.6 Not Plausible

The temperature sensor is monitored of sharp signal (Optional). If more than half the
temperature sensors are not plausible, then the request Automatic Engine Shutdown is
sent.
- If the value from temperature sensors jump within in a certain time, the alarm Not
Plausible is generated in the absolute bar graph and in the mean bar graph
- Values from the absolute bar graph are yellow, shows N/A and the value is 0
- Values from the mean bar graph are yellow and shows N/A and the value is 0
- If the value from the temperature sensor is constant and the value is nearly the
mean temp, than the alarm Not Plausible is deleted.


6.17.7 Monitoring active
The monitoring is active, when the engine speed greater than 200rpm and elapsed a
certain time with 16 seconds.
The monitoring is not active, when the engine speed less than 30rpm.

6.17.8 TIMER (INTERGRATED)


The program Splash Oil includes TON timer from the IEC.
Therefore, it is necessary to create a multi instance block SFB4.





461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 95 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.18 Generator power factor controller


In mains parallel operation, the load factor of the gen. is controlled to a defined reference value.
The control output AVR/PF mode must be set by software push button in position AVR/PF mode.
The following modes are selectable, by software:
Automatic
Manual
Automatic mode:
In idle mode and isolated operation, the generator voltage is controlled by the generator voltage controller.
In mains parallel operation, the load factor is controlled to a definable reference values, adjustable from SCADA
and PC 677B.
The enterable reference value is only permitted in the inductive range. The adjusting of power factor at the gen.
AVR will be done by the outputs AVR Volatge adjust + and AVR Volatge adjust - in panel +GCP.
On the generator voltage controller, in the generator terminal box, the generator voltage is set to a fixed static
value (approx. 4%). 4 %. static means 4% voltage deviation from generator idle mode to generator full load.
Parameter:
Nominal value cos phi
Actual nominal value reactive power
Actual value reactive power

Unit
MVAr
MVAr

Basic setting
12
12
indication

Dead band
Proportional range Xp
Pulse length
Max. pause

MVAr
MVAr
sec
sec

2
5
0.2
5.0

Gradient nominal value


Limitation nominal value by cos phi
Generator active power
Generator reactive power
Generator reactive power max. perm.
Generator apparent power
Generator cos-phi

Final setting

MVAr/s
0,85
MW
MVAr
MVAr
MVA

Indication
Indication
12,65
Indication
Indication

Indication
Indication
Indication
Indication

Manual mode:
In this position is the automatic power factor control out of work. The power can now change by selector
switch item 67S5 Voltage decrease or Voltage increase.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 96 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.19 Testing of shut down valve X-1SZV1012


Before the engine will start, the ttesting of shut down valve X-1SZV1012 is been done, as follow:
1. . Check of pressure switch 1PSH1012, it has to be activated. If no than comes the fault 111 X1SZV1012 emergency stop valve fault.
2. If item 1 is okay, de-energizing of X-1SZV1012 emergency stop valve
3. The pressure switch 1PSH1012 has to deactivated, if not the fault Fault 111 Engine Shutdown
Circuit Test Not Successful comes.
4. After the test is not okay, the start is blocked.
5. After the test is okay, the test relay will be checked, if it isnt okay the fault 108 Failure Engine
Shutdown Valve Test Relay will appears.
6. After the test is okay, the X-1SZV1012 emergency stop valve is energized and start released.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 97 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.20 CONTROL OF INTAKE AIR SYSTEM


6.20.1 Charge Air Blow-off System (xxMJQ61BR010/14)
The only active component of the blow-off system is the charge-air blow-off valve (xxMJQ62AA200) with
electrical drive.
Main components
KKS-Code
Reference document
Blow-off valve
xxMJQ62AA200
DRW 11.81031-0067
Blow-off valve feedback open
xxMJQ62CG100
DRW 11.81031-0067
Blow-off valve feedback closed
xxMJQ62CG120
DRW 11.81031-0067
Charge air blow-off valve:
The charge air blow-off valve (xxMJQ62AA200) is controlled by the Plant Control System. The controllable
electrical drive of the valve requires a 4-20 mA signal as command input. For a detailed interface
description please see section Interfaces below and refer to the DEUFRA Manual for the electrical drive of
type LE-10.
The sequence for the control of the valve shall be programmed in the following way:
Open valve after time delay of 10s,
IF
Intake air temperature xxMJQ61CT900 < 5C (hysteresis 1C)
AND
Charge air pressure > 2.3 bar (hysteresis for closing = - 0.3 bar)
OR (if charge air pressure not available)
Filling value > 75 % (hysteresis 5 %)

For malfunction check of charge air blow-off valve see section

Feedback of blow-off valve:


The blow-off valve is equipped with instrumentation for feedback of position OPEN and position CLOSED.
Valve and feedback shall be displayed in SCADA.

Interfaces

For a detailed interface description refer to the DEUFRA manual for the electrical drive of type LE-10.
Power Supply:
Power supply for the valve drive is 24V (DC).
Signals:
OPEN/CLOSED feedback is given as potential free contact.
461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 98 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

Malfunction
Malfunction check of charge air blow-off valve (xxMJQ62AA200):
After opening the charge air blow-off valve, the charge air pressure must decrease by 0.1 bar within
10 seconds, compared to the charge air pressure before opening the valve. Otherwise the charge air blowoff valve has a malfunction.
In case of malfunction of the valve an automatic load reduction of the engine shall be carried out and an
error message shall be displayed.

Alarms
The process control system does not create any alarms from the feedback signals of the blow-off valve.
Remote visualisation is only for indication of temperature.

Start requirements
Not applicable for blow-off system.

Normal operation: manual local


Not applicable for blow-off system.

Normal operation: manual remote


Not applicable for blow-off system.

Normal operation: automatic remote


Not applicable for blow-off system.

Normal operation: automatic local


Not applicable for blow-off system.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 99 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

Parameters Intake Air System


Code

Description of code

Range:

Value/
Setpoint:

Final
Value:

Input:
xxMJQ61CP900

Differential pressure filter

05.0 mbar

xxMJQ61CT900

Temperature intake air after filter

-50+400 C

xxMJQ62CG100

Feedback blow-off valve OPEN

on / off

xxMJQ62CG120

Feedback blow-off valve CLOSED

on / off

n.a.

Charge air pressure [bar]

n.a.

Engine Filling [%]

0 100 %

n.a.

Engine load [%]

0 100 %

... bar

See
Measuring
list
See
Measuring
list
See
Measuring
list
See
Measuring
list
See
Measuring
list
See
Measuring
list
See
Measuring
list

Parameter:

Output:
xxMJQ61CP900
xxMJQ61CP900

xxMJQ61CP900

Alarm high (warning)


Alarm high high (warning + load
reduction)
Alarm low (warning)

on / off

> 4.0 mbar

on / off

> 4.5 mbar

on / off

< 0.3 mbar


AND
engine load
> 60%

Please note, for high flexibility and fine-tuning all values shall be adjustable during commissioning. For later
improvements of the control, all operating cycles shall be logged (number of operating cycle, time and main
parameters) in a table for analysis.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 100 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.20.2 General intake air instrumentation


The intake air module is equipped with instrumentation to indicate temperature of the intake air and pressure
drop of the filter unit. Additionally, an emergency stop is available for modules that need to be entered for
maintenance.
Main components
Temperature Transmitter
Differential pressure transmitter
Maintenance Switch for engine stop

KKS-Code
xxMJQ61CT900
xxMJQ61CP900
n.a.

Reference document
DRW 11.81031-0067
DRW 11.81031-0067
n.a.

Intake air temperature:


The temperature element (XXMJQ61CT900) is of PT100 type and indicates the temperature of the intake
air after the air filter for the according engine. Connection type of the temperature element is 3-wire circuit.
Its value is shown on SCADA / Panel PC. Furthermore it serves as input for the control of the charge air
temperature control system (CHATCO). See functional description of cooling water system for more
information.
Differential pressure (pocket filter):
The pocket filter unit (xxMJQ61AT012) is equipped with a differential pressure transmitter (xxMJQ61CP900).
It provides an analogue signal (4-20 mA) for indication of the differential pressure of the filter. From this
signal, the plant control system shall create several alarms in order to indicate the condition of the pocket
filters. The alarms are defined in the section below.
Maintenance Switch
The maintenance switch ensures safe conditions during maintenance works inside the module. When
switched, it stops the running engine and/or blocks an engine restart.

Interfaces
For a detailed interface description see wiring diagram.
Power Supply:
Power supply for general instrumentation elements is 24V (DC).
Signals:
Analogue signals are provided as 420 mA signal.

Malfunction
No functional protection against malfunction. Wire-break detection is available.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 101 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

Alarms
The signals are transmitted to the plant control system, where they shall be processed in the following way:
Argument definition
KKS-Code
Range
Value
Action
If
diff. pressure
xxMJQ61CP900
< 0.3 mbar
low
show alarm L
AND
engine load
n.a.
> 60%
If
diff. pressure
xxMJQ61CP900
> 4.0 mbar
high
show alarm H
If
diff. pressure
xxMJQ61CP900
> 4.5 mbar
high high
show alarm HH,
load red. to 60 %
The process control system does not create any alarms from the temperature sensor. Remote visualisation
is only for indication of temperature.

Start requirements
Filters must be in position and good condition. Differential pressure must be below Alarm H.

Normal operation: manual local


Not applicable for dry filters.

Normal operation: manual remote


Not applicable for dry filters.

Normal operation: automatic remote


Not applicable for dry filters.

Normal operation: automatic local


Not applicable for dry filters.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 102 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.21 Princip of auxiliaries Operation modes

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 103 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.21.1 Manual Local Mode Auxiliary Drives

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 104 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.21.2 Manual Remote Mode Auxiliary Drives

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 105 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.21.3 Automatic Remote Mode Auxiliary Drives

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 106 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.21.4 Automatic Local Mode Auxiliary Drives

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 107 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.21.5 Double pumps

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 108 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

6.21.6 Manual pump switching

6.21.7 Double Starter Pumps, Master Selection Philosophy

Selection of master pump shall be possible in two modes activated for AUTO REMOTE:
1. Master pump selection by operator
2. Master pump selection by operating hours
The operator shall select between the two modes.
Location:
Panel PC at CCP (if selector switch at CCP is in CCP-position)
and from SCADA (if selector switch at CCP is in SCADA-position).
Double starter faceplate with two buttons select Operator Master Selection and Master
Selection by Operating Hours. Selected mode shall be indicated.
General:

THE PUMP WHICH IS RUNNING IS THE MASTER PUMP. IT IS NEVER THE STANDBY
PUMP WHICH IS RUNNING ALONE.
A pump which is disturbed cannot be selected as master.
If one or both pumps are disturbed no selection of mode for master selection or
master is possible.
Operating hours criteria:
Operating hours as the criteria for master shall only be considered for the next AUTO
start of the pumps, not during running pumps.
If pumps are in REMOTE MANUAL, the operator can between selection by operator or
by operating hours if pumps are running or standstill. The operator can change the
master only if both pumps are running or standstill.
Default by PLC Start: Pump 1 is master, master pump selection by operator.
Each selection causes an event.
Description:
Scenario 1:
Pumps standstill and in REMOTE AUTO.
Operator selects Master pump selection by operator (if not already selected)
Operator selects pump 1 as master. If automatic request start of one pump, pump 1 will start.
461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 109 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
or

or

Operator selects pump 2 as master. If automatic request start of one pump, pump 2 will start.

Scenario 2:
Pumps standstill and in REMOTE AUTO.
Operator selects Master pump selection by operating hours (if not already selected)
Pump 1 has less operating hours than pump 2. If automatic request start of one pump, pump
1 will start.
Pump 2 has less operating hours than pump 1. If automatic request start of one pump, pump
2 will start.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 110 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
Scenario 3:

or

or

Pump 1 is running in REMOTE AUTO.


Operator selects Master pump selection by operator (if not already selected)
Operator selects pump 2 as master. Pump 2 will start and with started pump 2, pump 1
stops.
Pump 2 is running in REMOTE AUTO.
Operator selects Master pump selection by operator (if not already selected)
Operator selects pump 1 as master. Pump 1 will start and with started pump 1, pump 2
stops.
Scenario 4:
Pump 1 is running in REMOTE AUTO.
Pump 1 failure and stop, master changes to pump 2 and pump 2 shall be started.
Pump 2 is running in REMOTE AUTO.
Pump 2 failure and stop, master changes to pump 1 and pump 1 shall be started.
Scenario 5:
Pump 1 or 2 is running in REMOTE AUTO.
Operator selects Master pump selection by operating hours (if not already selected)
During running pump mode selection is possible but has no effect on the operation of
pumps.

or

or
or

or

Scenario 6:
Pumps standstill and in REMOTE MANUAL or in LOCAL MANUAL
Selection of the master selection mode and the master pump shall be possible, but has no
influence in REMOTE MANUAL.
Operator starts pump 1. Pump 1 becomes or stays master.
Operator starts pump 2. Pump 2 becomes or stays master.
Scenario 7:
Pumps standstill and in REMOTE MANUAL or in LOCAL MANUAL
Operator starts pump 1. Pump 1 becomes or stays master.
Pump 1 failure and stop, master changes to pump 2 but no start of pump 2 (no AUTO)
Operator starts pump 2. Pump 2 becomes or stays master.
Pump 2 failure and stop, master changes to pump 1 but no start of pump 1 (no AUTO)
Operator starts pump 1 and 2. The first started pump becomes or stays master.
Master selection mode is not effected.
Scenario 8:
Pump 1 is running in REMOTE AUTO.
Operator selects MANUAL REMOTE and starts pump 2 and stops pump 1.
Pump 2 becomes master.
Pump 2 is running in REMOTE AUTO.
Operator selects MANUAL REMOTE and starts pump 1 and stops pump 2.
Pump 1 becomes master.
Master selection mode is not effected.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 111 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

or

Scenario 9:
Pump 1 is running in REMOTE MANUAL.
Operator selects REMOTE AUTO
Pump 1 keeps master independent from master selection mode (no changeover to lower
operating hours).
Pump 2 is running in REMOTE MANUAL.
Operator selects REMOTE AUTO
Pump 2 keeps master independent from master selection mode (no changeover to lower
operating hours).

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 112 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

LV ENGINE AUXILIARIES PANEL +EAPX

These panels contain the power components for the motor auxiliaries and the data interface to the
appropriate ECPx panel and stands in the mechanical annex.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 113 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7.1

LV ENGINE Auxiliaries Panel +EAPx frontview

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 114 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7.2

Pre lubrication pump 01MJV21AP030-M01 (P007) on MOD006

MANUAL REMOTE

MANUAL LOCAL

AUTOMATIC LOCAL

AUTOMATIC REMOTE

Released operation modes:

If the motor protective switch is triggered, the oil pump is switched off by the software and hardware. This
switching-off is shown as an error message on the display.
The oil pump has two functions:
1. Start prelubrication
2. Cooling down the engine in case of shut down
The following positions 1-2 are described in the selection switch AUTOMATIC Remote position!

7.2.1

Start prelubrication

Start prelubrication is used to supply the engine with lubricating oil before it is started in order to keep the
mechanical loading of the engine as low as possible Start prelubrication is switched on in the start-up
preconditions. (Start-up preconditions means that the corresponding auxiliary drives for a module start are
activated). A set prelubrication time then follows. After the specified prelubrication time has elapsed and the
system has built up the required prelubrication pressure, the start signal is issued.
Start prelubrication is not necessary, if the standstill time is less than the adjustable time (Max. standstill
time start prelubrication is required).
General:
If an emergency stop is activated or a pump fault, then the pump is switched off by software and hardware.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 115 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

Parameter Start prelubrication

Start prelubrication
Max.
standstill
time
start
prelubrication is required
X-1PSH2170 lube oil press.
release Start engine
Hysteresis

Dimension

Basic setting

sec
sec

60
1800

bar

0.3

bar

0.1

see acceptance
certificate

Caution: If the selection switch is in the "OFF" position, prelubrication cannot be carried out, and no start
command is issued.

7.2.2

Cooling down the engine in case of shutdown

In case of shutdown of the engine the oilpump will start for an adjustable time to remove the heat from the
engine.
General:
If an emergency stop is activated or a pump fault, then the pump is switched off by software and hardware.

7.2.3

Parameter: Cooling down function

Idle runtime by shutdown

Dimension

Basic setting

600

see acceptance
certificate

Manaul remote function:


In this position the pump is manual controlled by software push buttons on / off.
Manaul local function:
In this position the pump is manual controlled by hardware push buttons on / off at the switchboard.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 116 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7.3

Generator heating 01MKA01AH010 (H100)

AUTOMATIC LOCAL

MANUAL REMOTE

MANUAL LOCAL

AUTOMATIC REMOTE

Released operation modes:

Automatic function:
The generator heating is released, when the engine is not running
Manaul remote function:
In this position the heating is manual controlled by software push buttons on / off.
General:
If an emergency stop is activated, then the heating is switched off by software.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 117 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7.4

Cylinder Lubrication 01MKA01AH010 (1EM2470)

MANUAL REMOTE

MANUAL LOCAL

7.4.1

AUTOMATIC LOCAL

AUTOMATIC REMOTE

Released operation modes:

Area of application

To improve the running characteristics, lubricating oil is added to the individual pistons via special boreholes
in the cylinder sleeve.

7.4.2

Vgele System

In the Vgele system, a pump is used to suck lubricating oil from the pressurised engine oil line and feed it to
a block distributor. Through cyclical switching of different oil lines, the block distributor supplies all cylinders.
In Vtype engines, each cylinder bank has a separate system for cylinder lubrication, and both cylinder
lubrication systems are controlled in the same way. One outlet of the block distributor is equipped with a X1FE2470A/B proximity switch that checks the correct functioning (circulation of the block distributor). The
system is considered to be functioning correctly if the signal of the proximity switch changes its switching
status 1FAL2470A/B at least once in the time KSH0010.
The electric motor for cylinder lubrication is protected by a a motor protective switch. If the MCB trips, the
engine control unit receives an overload signal and cylinder lubrication is deactivated, in V-type engines both
the A and B sides are switched off.
There are three possible operating modes:
Manual operation: "Cylinder lubrication ON, for activating cylinder lubrication if the engine stops, for
example to enable lubrication when turning the engine.
Manual operation: "Running in mode, for activation of cylinder lubrication when starting the engine,
for example to start the engine after repair work.
Automatic operation, standard mode, which activates cylinder lubrication from an engine load greater
than X-2GT1022.
The status of cylinder lubrication can be called in the display.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 118 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7.4.3

Process sequence: Cylinder lubrication

Manual operation "Cylinder lubrication ON"

The function can be executed by the operator while the engine is stationary during maintenance work. This
function is automatically deactivated once the time KSH0300 has elapsed. The "Cylinder lubrication ON"
operating mode is not available when the engine is running.
If the function is activated again while it is already running, the time set in KSH0300 is reset and starts again
from the beginning.
If the engine is started while the function is active, the system switches to automatic mode (see section
7.14.6).

Manual operation "Running-in mode"

This function is used to ensure gentle running in of new components following repair, through permanent
lubrication. This function has no time limit and is reset by manually switching off. The "Run-in mode
operating mode can be selected when the engine is stationary and while it is running, but the control unit
does not activate lubrication until the engine is running.

Automatic operation

Automatic operation is the standard operating mode. This mode is always active if neither of the modes
"Cylinder lubrication ON" (only if the engine is running) or "Run-in mode is selected.
In automatic operation, cylinder lubrication is switched on as soon as the engine is running and the load
switching point X-8GSH1022 is exceeded. To prevent constant switching on and off if the engine is running
close to the load switching point, the system takes a hysteresis an delay (KSH0020) into account when
switching off lubrication.

Control response in the event of failure of the input signals

If the lubrication oil pressure signal fails, cylinder lubrication is not activated.
If the engine speed fails, manual operation "Run-in mode and automatic operation are not activated or
deactivated.
The manual operating mode "Cylinder lubrication ON is not affected by a fall in engine speed or an absence
of the engine speed signal.
If the load signal fails, cylinder lubrication is activated when the engine speed X-1SSH1000 is exceeded.
The manual operating modes are not affected by a failure of the load signal.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 119 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

Parameter: Cylinder lubrication

The parameters used in the description above (pressures, time monitoring) are shown here as examples:

Parameters

Sample values

KSH0010, Time element monitoring of block distributor circulation


KSH0020, Delay time for automatic cylinder lubrication on/off
KSH0300, Time restriction for manual operation
X-2GT1022, Threshold value of engine load for cylinder lubricator ON
Load hysteresis
X-1SSH1000, Engine speed, engine running
X-1SSL1000, Engine is stationary
X-2PSH2170, Minimum lubrication oil pressure before engine for cylinder
lubricators

10 s
20 s
300 s
50 %
5%
200 U/min
20 U/min
1 bar

Manual local function:


In this position the pump is manual controlled by hardware push buttons on / off at the switchboard.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 120 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7.5

Nozzle cooling water module 01MJG34AC010 (MOD005)

MANUAL REMOTE

MANUAL LOCAL

AUTOMATIC LOCAL

AUTOMATIC REMOTE

Released operation modes:

Automatic Remote function:


The nozzle cooling water module MOD005 is switched on with start conditions and during engine operation.
In case of normal stop of the engine the Nozzle cooling water module will stop too.
If the engine shuts down, the Nozzle cooling water module will stop after the idle run time.
Manual remote function:
In this position the pump is manual controlled by software push buttons on / off.
Generell:
If an emergency stop is activated, then the pump is switched off by software and Hardware.
Manual local function:
In this position the pump is manual controlled by hardware push buttons on / off at the switchboard at
MOD005.

7.5.1

Parameters Nozzle cooling water module X0PAB48AC001 (MOD005)

Page: Time parameter


Description of measuring point
Idle runtime by shutdown

Unit
m :s

Set value:

461180_Operating Instruction Genset Control Commissioning Edition.doc

End set value

Page 121 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7.6

Fuel oil module 01END56AP010 (MOD008), HFO / light fuel oil (LFO)-Operation

AUTOMATIC LOCAL

MANUAL REMOTE

MANUAL LOCAL

AUTOMATIC REMOTE

Released operation modes:

Preselection of the operating mode is made by means of a panel PC situated pushbutton or can be
preselected from SCADA.
On every fuel switchover an appropriate message is issued to point out the actions to be performed on the
fuel system by the operators staff (open and close cooling/heating valves on the fuel module). In addition,
the load is reduced to approx. 70% for approx. 10 minutes to prevent full-load operation with mixed fuel. The
parameters named above can be set.

Diesel operation
The diesel operating mode is used for start-up and as a backup procedure if the HFO conditions are not met.
If the fuel module is switched over to diesel operation from HFO operation, fuel excessive temperature
monitoring (TAH5070) is activated delayed.
If the alarm fuel excessive temperature TAH5070 is displayed for longer than a set time, the genset is shut
down.

HFO operation
Criteria for HFO switch off heavy fuel oil (HFO) operation
Viscosity, if the error message Viscosity high is issued, HFO operation is locked.
By selection of light fuel oil (LFO) operation
If the genset cannot be operated with HFO on account of the criteria mentioned above, the fuel module is
switched over to diesel operation immediately.
The following criteria must be met in order to be able to switch over from diesel oil operation to HFO
operation:
The locking criteria (see above) may not be present.
The HT cooling water temperature must exceed a set value.
The generator circuit breaker must be switched on and the genset must be operated at least with a set
min rating.
Temperature HFO in 3T022

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 122 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
Steam pressure in 1PTT032
If the criteria above are met, the fuel module is switched over to HFO operation.
During switchover monitoring of the fuel pressure (PAL5070) is deactivated for 3 seconds in order to
suppress the triggering of switchover-related pressure fluctuations.
In HFO operation the monitoring of excessive fuel temperature (TAH5070) is deactivated.
For switchover viscosity monitoring is suppressed for a set time in order to bridge control fluctuations. An
absolute viscosity limit, which is always monitored, is still active.
If the system is shut down on fault from HFO operation, the auxiliary drives which are relevant for HFO
operation are requested constantly and are not shut down after the set idle run time. If, however, the load on
the genset is reduced when it is operational and is deselected, diesel operation is activated as the first
action.

Manual remote function:


In this position the valves are manual controlled by software push buttons HFO / LFO.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 123 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7.7

HT cooling water preheating module 01MJG31AP020-M01 (P070 on MOD004)

MANUAL REMOTE

MANUAL LOCAL

AUTOMATIC LOCAL

AUTOMATIC REMOTE

Released operation modes:

Automatic Remote function:


The HT cooling water preheating module is switched on with start preconditions. If engine reached the
ignition speed, the HT cool.water preheating module is stopped.
If the engine stopped, the pump then switched on and runs in idle mode for the set time, so that the engine
can cool down.

Manual remote function:


In this position the module is manual controlled by software push buttons on / off.
Generell:
If an emergency stop is activated, then the pump is switched off by software and Hardware.
If the engine circuit breaker is triggered, the pump is switched off both in terms of software and hardware.
This is displayed as an error message on the display.

Manual local function:


In this position the module is manual controlled by hardware push buttons on / off at the switchboard.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 124 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7.8

Lube oil separator module 01MJV22AT010 (MOD007

MANUAL REMOTE

MANUAL LOCAL

AUTOMATIC LOCAL

AUTOMATIC REMOTE

Released operation modes:

Automatic Remote function:


The Lube oil separator module is switched on with start conditions and during operation of the engine.
Manual remote function:
In this position the module is manual controlled by software push buttons on / off.
Generell:
If an emergency stop is activated, then the module is switched off by software and Hardware.
When the failure signal of the lube oil separating unit continuously appears 3 times, or the failure signal of
the Lube oil separating unit lasts 10 Seconds each time the separator will be stopped too.
Manual local function:
In this position the module is manual controlled by hardware push buttons on / off at the switchboard.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 125 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7.9

Lubrication oil valve xxMJV23AA202-Y01 on MOD057 (SOV 2303)

AUTOMATIC LOCAL

MANUAL REMOTE

MANUAL LOCAL

AUTOMATIC REMOTE

Released operation modes

xxMJV21BB010 =T001
The lubrication oil valve is used to supply fresh oil to the engine.
The levels limits LSH T001 (max.) and LSL T001 (min.), 1LAL T001 (max.max) and 1LAL T001 (min.min)are
formed by the sensor 2PTT001 ore from 1PTT001.
The exceed of the limit value 1LALT001 (min.min) will cause the fault signal lub.oil level low.
The exceed of the limit value 1LALT001 (max.max) will cause the fault signal lub.oil level high, depending of
status of engine.
Operating elements by Software:
Control functions:
Closed
Automatic
Open
Position Automatic operation:
In this position automatic control is carried out, when the filling level 2LSL T001 (min.) is reached, the valve
is opened when the filling level 2LSH T001 (max) is reached the valve is closed. A request is given to the
lubricating oil refill pumps (P012), by opennig signal of valve SOV 2303.
Position Manual operation:
In this position manual control is carried out, by order from software push buttons open / close. A request is
given to the lubricating oil refill pumps (P012), by opennig signal of valve SOV 2303.

Close criteria of xxMJV23AA202-Y01 (SOV2303)


01MJV22CG120 (2GOS1CK2204) of valve 01MJV22 AA200 direction discaharge of three way
valve, between preh.mod. and. lube oil sep. 01MJV22AT010 (MOD007) in discarge pos. fault FE
436 Lube Oil 3-Way Valve Opened In Maintenance Tank Direction appears.
Emergency stop
1LAHH T001 (max.max.) operation/stand still
level 2LSH T001 (max)
WBZT001 Lub. oil service tank wire break -S
461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 126 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7.9.1

Value Parameter Lubrication oil valve xxMJV23AA202-Y01 (SOV 2303)

T001=xxMJV21BBQ10
Status:
Page : Limit values
Description of measuring point
1LAL T001 (min.min)
Hysteresis
1LAH T001 (max.max.) operation
Hysteresis
1LAH T001 (max.max.) stand still
Hysteresis
2LSL T001 (min.)
Hysteresis
2LSH T001 (max.)
Hysteresis

Unit
mbar
mbar
mbar
mbar
mbar
mbar
mbar
mbar
mbar
mbar

Set value:

461180_Operating Instruction Genset Control Commissioning Edition.doc

End set value:


34
1
52
1
62
1
40
1
44
1

Page 127 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7.10 Power house ventilator 1 / 2 xxUMF15AN010-M01 / xxUMF15AN010-M02


Due to the heat dissipation from the engine and alternator it is necessary for the corresponding engine
related powerhouse ventilation system to always work simultaneously with the engine. Otherwise the engine,
engine hall and possibly engine related equipment will quickly overheat. This will cause the engine to shut
down and might cause major damage.
Each engine is equipped with two powerhouse inlet ventilation units. Each of the two powerhouse inlet
ventilation units is equipped with pole switchable motors and has 2 stages. Stage 2 uses full RPMs while
stage 1 uses a reduced RPM level. This lowers the volume flow capacity to approx. 2/3.
Each air inlet duct of all powerhouse inlet ventilation units is equipped with two louvers. One for manual
direction adjustments and one motorised for electrical direction adjustment and automatic open/closed
operation.

MANUAL REMOTE

MANUAL LOCAL

AUTOMATIC LOCAL

AUTOMATIC REMOTE

Released operation modes:

7.10.1 Normal operation automatic remote


In this mode the control system controls the louver motors and fan motors.
The powerhouse inlet ventilation units will be started 5 min before the engine. For this the control system will
open the motorised louvers (01UMF15AA200/210) to allow air flow and activate the ventilation fans
(01UMF15AN011/013). This is necessary to remove any possible flammable gas residues that might have
accumulated inside the powerhouse.
Once the engine stops (regardless of which case) the ventilation system keeps running for another 15 min.
This ensures a proper cooling down phase while the after cooling down pump is in operation. After the
shutdown of the fans the air louvers (01UMF15AA200/210) move into closed position.
The motorised louvers are equipped with two limit switches. These allow a closed and a variable open signal
(to actuate the vertical flow direction).

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 128 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
Start procedure of powerhouse ventilation system:
Condition definition
KKS-Code
If
Start signal (engine)
xxMJA10AG010
Then
If
Fans signal
xxUMF15AN011/013
And
Air louvers
xxUMF15AA200/210
Then Air louvers
xxUMF15AA200/210
If
Air louver limit switches xxUMF15CG120/180
Then
Then
If
Then

fans
tdelay start engine
Engine
Engine
fans

xxUMF15AN011/013

If
Then
Then
Then

Stop signal (engine)


Engine
fans
tdelay stop fans

Then
Then
Then

Fans
01UMF15AN011/013
Air louvers
01UMF15AA200/210
Air louver limit switches 01UMF15CG100/160

xxMJA10AG010
xxMJA10AG010
xxUMF15AN011/013

xxMJA10AG010
xxMJA10AG010
xxUMF15AN011/013

range

value

action

Yes/No
Yes/No
Open/Closed
Open/Closed

available
available

Yes
Yes
To open
Open

On/Off
0...30min

On (stage 1)
5min
Release start requirement
Start
On (stage 2)

Start/Stop
On/Off

Start/Stop
On/Off
0...30min

15min

On/Off
Open/Closed
Open/Closed

Stop
On (stage 1)
Start
Off
To closed
Closed

With regard to a high availability there shall be also the possibility to receive release start requirement and
operate the engine for short terms if only one of the twin ventilation towers of the engine has the full
functionality for the correct operation. But this operation option should be only used in exceptional cases and
a prompt maintenance of the damaged ventilation unit is necessary. MAN Diesel & Turbo SE does not
recommend engine ventilating with only one ventilation unit and assumes no responsibility if the operator use
this option for continuous operation.
In case of two damaged ventilation units the related engine must not be in operation /must be stopped.
Please pay attention:
- in case of switching down from full speed (stage 2) to low speed (stage 1), a delay of ten (10) seconds
will be needed in order to enable the fan adequately slow down prior to connecting it to lower speed
- in case of switching up from low speed (stage 1) to full speed (stage 2) no delay is needed

7.10.2 Operation manual remote Powerhouse ventilation system


This mode has to be selected at GCP or SCADA. The operator can switch the Ventilation Fans
(01UMF15AN011/13) in manual remote.
When selected the operator can adjust the flow rate of air to the powerhouse as following:
- Switch engine hall ventilation fans to stage 1 or 2
- Switch on/off any number of engine hall ventilation fans
In this way it is possible to avoid overcooling in the powerhouse at low ambient air temperatures. The
symmetrical air flow to the engines has to be maintained.
Operation manual remote is not the recommend control mode of MAN Diesel & Turbo. MAN Diesel & Turbo
assumes no responsibility if the operator use the ventilation units in operation manual remote-mode.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 129 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7.10.3 Operation manual local Powerhouse ventilation system


In this position the pump is manual controlled by hardware push buttons on / off at the switchboard.
Operation manual local is not the recommend control mode of MAN Diesel & Turbo. MAN Diesel & Turbo
assumes no responsibility if the operator use the ventilation units in operation manual local-mode.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 130 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7.10.4 Malfunctions

Start conditions:
Argument definition
If
Air louvers
Then
Delay
If
Air louvers
limit switch
Then
Alarm

If
If
Then

Then

Air louvers
Delay
Air louvers l
limit switch
Alarm

Related fan of
faulty air louver

KKS
01UMF15AA200/210
01UMF15CG100/160

range
Open/Closed
0-5 min
Open/Closed

value
2 min

Action
To closed
Start
Not closed (S2 signal)
Initiated in control
system

01UMF15AA200/210
01UMF15CG100/180

Open/Closed
0-5 min
Open/Closed

2 min

To open
Start
Not Open (S3 signal)
Initiated in control
system

01UMF15AN011
or
01UMF15AN013

Blocked/Released

KKS
01UMF15CG100/160
or
01UMF15CG120/180

range
Open/Closed

Blocked

During operation
Argument definition
If
Air louvers
limit switch
Then

Alarm

And

Related fan of
faulty air louver

01UMF15AN011
or
01UMF15AN013

value

Action
Not open

Initiated in control
system
Off

On/Off

With regard to a high availability there shall be the possibility to operate the engine for short terms if only one
of the twin ventilation towers of the engine has the full functionality for the correct operation. But this
operation option should be only used in exceptional cases and a prompt maintenance of the damaged
ventilation unit is necessary. MAN Diesel & Turbo SE does not recommend engine ventilating with only one
ventilation unit and assumes no responsibility if the operator use this option for continuous operation and
ignore maintenance.
In case of faulty air louvers on both ventilation units the related engine must not be in operation /must be
stopped.
Failure on electrical motors
Argument definition
If
fans

And
If

Then

Fuse of motor
(stage 1)
Concerned
motor

Argument definition
If
fans

KKS
01UMF15AN011
and
01UMF15AN013
01UMF15AN011 M01
or
01UMF15AN013 M01
01UMF15AN011 M01
or
01UMF15AN013 M01
KKS
01UMF15AN011

range
On/Off

value

Action
On (stage 1)

Has tripped

Stage 1 / stage 2

range
On/Off

461180_Operating Instruction Genset Control Commissioning Edition.doc

Switch in stage 2

value

Action
On (stage 2)
Page 131 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
and
01UMF15AN013
And
If

Then

Fuse of motor
(stage 2)
Concerned
motor

01UMF15AN011 M01
or
01UMF15AN013 M01
01UMF15AN011 M01
or
01UMF15AN013 M01

Has tripped

Stage 1 / stage 2

Switch in stage 1

Please pay attention:


- when switching down from full speed (stage 2) to low speed (stage 1), a delay of ten (10) seconds will
be needed in order to enable the fan adequately slow down prior to connecting it to lower speed
- when switching up from low speed (stage 1) to full speed (stage 2) no delay is needed

In case of overheated bearings from electrical motors of the fans (01UMF15AN011/013) the EAP will receive
a signal. Following the EAP will stop the concerned electrical motor automatically.

7.10.5 Alarms
In case of high contamination of the air filters a differential pressure high alarm will be initiated. For this the
powerhouse inlet ventilation units are equipped with differential pressure transmitter.

If

Argument definition
Pressure switches

Then

Pre-Alarm

If

Pressure

Then

Alarm

KKS
01UMF15CP100
or
01UMF15CP200

range
50...500 Pa

value
250
Pa

Action
Above

Initiated in control
system
01UMF15CP101
or
01UMF15CP201

50...500 Pa

Above

300
Pa

Initiated in control
system

In case of pre-alarm due to high contamination the filter should be changed in the next time (time before the
other differential switch gives alarm). During the filter change procedure ensure that the associated inlet
ventilation unit is not running.

In case of alarm due to high contamination the filter should be changed as soon as possible. With differential
pressures of more than 300 Pa there is no guarantee to get the full required volume flow. During the filter
change procedure ensure that the associated inlet ventilation unit is not running.
In case of an alarm of the fire detection system, the inlet ventilation units have to shut down their
ventilation automatically.
Argument definition
If
Fire alarm
Then Fans

KKS-Code

range

01UMF15AN011/013

Start/Stop

value

461180_Operating Instruction Genset Control Commissioning Edition.doc

action
To stop

Page 132 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition

7.11 DO Shut Off Valve Before Booster Module 01EGD53AA202-Y01

AUTOMATIC LOCAL

MANUAL REMOTE

MANUAL LOCAL

AUTOMATIC REMOTE

Released operation modes:

Automatic Remote function:


In case of fire alarm signal by Profibus-DP from firefighting control panel, it will close.
Manual remote function:
In this position the valve is manual controlled by software push buttons on / off.
In case of fire alarm signal by Profibus-DP from firefighting control panel, it will close.

7.12 HFO Shut Off Valve Before Engine 01END56AA202-Y01

AUTOMATIC LOCAL

MANUAL REMOTE

MANUAL LOCAL

AUTOMATIC REMOTE

Released operation modes:

Automatic Remote function:


In case of fire alarm signal by Profibus-DP from firefighting control panel, it will close.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 133 of 134

Alfred Kuhse GmbH


TEL +49(0)4171 798-0 , FAX -117

Operating Instruction Genset Control


Project: Guangopolo II, 5301954
Rev./ Date / Status
0 / 10.09.2013/ Comm. Edition
Manual remote function:
In this position the valve is manual controlled by software push buttons on / off.
In case of fire alarm signal by Profibus-DP from firefighting control panel, it will close.

461180_Operating Instruction Genset Control Commissioning Edition.doc

Page 134 of 134