You are on page 1of 252

Productos para riego de jardines

Catlogo 2013

El uso inteligente del agua.

Nuevos productos

www.rainbird.com/newproducts

Presentacin de los nuevos productos de Rain Bird para el 2013


Cada nuevo producto para el 2013 demuestra la capacidad de Rain Bird para brindar soluciones de riego que mejoran la productividad y
rentabilidad al mismo tiempo que refuerzan el compromiso continuo de la empresa con El uso inteligente del agua. La informacin detallada
de los productos y sus especificaciones se pueden encontrar en las pginas indicadas.
Cuerpos de aspersores

Boquillas aspersoras

Aspersores serie
RD1800

Boquillas serie
R-VAN

Boquillas serie
HE-VAN (Actualmente

pgina 13

pgina 45

solo estn disponibles en


algunos mercados.)

Vlvulas

Programadores

Vlvulas serie HV

Controlador serie
ESP-Me

Controlador serie
ESP-RZX

pgina 122

pgina 121

pgina 92

Nuevos
productos
para 2012

pgina 38

Productos de drenaje

Estaciones de bombeo

Accesorios para rejillas, cuencas y drenaje

Estaciones de
bombeo serie LC

pgina 221

pgina 206

Riego de bajo volumen

Rels de arranque
de bombas PSR,
PSRP y PSRPL
pgina 213

Indicador de
funcionamiento
para sistemas
de riego por
goteo

Nuevos accesorios
y kits de control de
zona
desde pgina 196

pgina 183
p

Compromiso de Rain Bird para el ahorro de agua


Rain Bird se enorgullece de sus esfuerzos para apoyar los programas y tecnologas de ahorro de agua que conducen a medios ms eficientes
de suministrar agua a los jardines. Busque las etiquetas de certificacin Smart Approved y Water Sense en los productos de este catlogo.

Smart Approved WaterMark


es el programa australiano de
certificacin de ahorro de agua en exteriores para aquellos
productos y servicios que ayudan a reducir el uso del agua.
La certificacin del producto otorgada por Smart Approved
WaterMark es importante porque se obtiene tras evaluaciones
independientes realizadas por una organizacin respetada
en una regin que, debido a la escasez de agua, est prxima
a adoptar tecnologas de ahorro de agua. Para obtener ms
informacin sobre Smart Approved WaterMark, visite www.
rainbird.com/SAWM.

Rain Bird es un orgulloso socio de EPA WaterSense.


Qu significa la etiqueta WaterSense
La Agencia de Proteccin Ambiental de Estados Unidos desarroll
el programa WaterSense para que sea fcil para los clientes:
Reconocer los productos que permiten ahorrar agua a
travs de una etiqueta en aquellos productos que cumplen
con los requisitos de conservacin del agua.
Obtener acceso a innovaciones de ahorro de agua.
Comprender el valor de la eficiencia en el uso del agua.
Reducir el desgaste de los recursos hidrulicos.

El uso inteligente del agua.

Productos
con Smart
Approved
WaterMark

Introduccin

www.rainbird.com

Introduccin

Contenido

Boquillas aspersoras

22

Rotores

48

Impactos

80

Vlvulas

87
111

Controladores

119

Sistemas de control centralizado

142

Xerigation/Riego por goteo

161

Estaciones de bombeo

205

Productos de drenaje

221

Recursos

230

Referencia

233

Garantas

245

ndice

247

Rotores
Referencia

Accesorios

Impactos

Vlvulas

Cuerpos de aspersores

Accesorios

Programadores

Anatoma de un sistema de riego con agua no potable

Sistemas de control
centralizado

Xerigation

Anatoma de un sistema comercial con


aprovechamiento eficiente de agua

Bombas

Drenaje

Anatoma de un sistema residencial de riego eficiente

Boquillas aspersoras

portada interior

Recursos

Nuevos productos

Cuerpos de
aspersores

Contenido

El uso inteligente del agua.

Introduccin
Anatoma de un sistema residencial con
aprovechamiento eficiente de agua

Introduccin

Anatoma de un sistema
residencial con aprovechamiento
eficiente de agua*

Medidor de agua
CSPED

PENDIENTE

PORTN

Esta gua de diseo residencial resalta las soluciones de


productos y tecnologas de Rain Bird para lograr jardines en
buen estado con menos agua.

Aspersores
Regulacin de presin en el vstago

ENTRADA
PARA
AUTOS
NO
MI
CA

Mantiene una presin de agua ptima.


Cada reduccin de 5 psi (0.34 bares)
reduce el consumo de agua un 6-8%. Con
las boquillas de la serie U, VAN, HE-VAN
y MPR, si un sistema de 70 psi (4.8
bares) se reduce a los 30 psi (2 bares)
recomendados, se puede ahorrar ms de
un 50% de agua.1

CSPED

t "TQFSTPSFT134 SFHVMBSB
30 psi, 2 bares, con boquillas de las
series U, VAN, HE-VAN y MPR)
t "TQFSTPSFT4".134 QTJ

PENDIENTE

t "TQFSTPSFT4".134 SFHVMBSBQTJ 


bares, con boquillas giratorias)
t "TQFSTPSFT3%4".134 QTJ

t "TQFSTPSFT3%4".134 QTJ

Boquillas de alta eficacia


%JTUSJCVZFOFMBHVBDPONTVOJGPSNJEBEZFWJUBO
el rociado excesivo, lo cual se puede traducir en un
ahorro de agua superior al 30%.2
t #PRVJMMBTBTQFSTPSBT4FSJF6
t #PRVJMMBT)&7"/
t #PRVJMMBTBTQFSTPSBTSPUBUJWBT
t #PRVJMMBT37"/
Dispositivos de vlvula de retencin Seal-AMatic (SAM)
Evitan que el agua se drene fuera del sistema en el
aspersor inferior y evitan la erosin, el escurrimiento
y el golpe de ariete.
t "TQFSTPSFT4".

Controladores y sensores
Controladores automticos con
caractersticas de aprovechamiento eficiente del agua
Permiten al usuario final ajustar los ciclos de riego con
facilidad para adaptarse a diferentes terrenos
y a cambios estacionales o climatolgicos.

t "TQFSTPSFT4".134 QTJ

t $POUSPMBEPS&413;Y

t "TQFSTPSFT4".134 QTJ

t $POUSPMBEPS&41.F

t "TQFSTPSFT3%4".

t $POUSPMBEPSFTEFMBTFSJF&41-9

t "TQFSTPSFT3%4".134 QTJ

t $POUSPMBEPS4511MVT

t "TQFSTPSFT3%4".1 QTJ

Tecnologas de controladores inteligentes

Aspersores para agua no potable


Indicacin exclusiva de uso de agua no potable en
la cubierta.
t "TQFSTPSFT3%/1 QBSBBHVBOPQPUBCMF

*Todas las afirmaciones sobre el ahorro de agua suponen criterios adecuados


de diseo, instalacin y mantenimiento de los productos de riego. El ahorro
real puede variar de usuario a usuario segn el clima, las condiciones del lugar
y del sistema de riego, y las prcticas de riego previas.

Ajustan el riego segn las variables especficas del lugar. Los


controladores inteligentes pueden reducir el consumo de
agua hasta un 40% o ms.3

Riego de bajo volum


volumen
Dispositivos para riego directo a raz
Suministran agua de forma lenta y directa a la
raz de las plantas, utilizan un 30-50% menos
de agua que el riego por aspersin y evitan el
rociado excesivo y el escurrimiento. 5
t %JTQPTJUJWPTEFFNJTJOEFHPUFP

t 4JTUFNBEFDPOUSPM&414.5

t -OFBEFHPUFP9'

t $POUSPMBEPSNPEVMBS&41-9DPODBSUVDIP&5.BOBHFS

t 4FSJF3JFHPBSB[ 3PPU8BUFSJOH4FSJFT 384

Dispositivos de cierre automtico

Boquillas de alta eficacia

Cierre automtico del controlador cuando se detecta lluvia,


lo que se traduce en un ahorro de agua del 30-35%.4

%JTUSJCVZFOFMBHVBDPONTVOJGPSNJEBEZ
evitan el rociado excesivo, lo cual se puede
traducir en un ahorro de agua superior al 30%.2

t 4FOTPSEFMMVWJB34%
t 4FOTPSFTJOBMNCSJDPTEFMMVWJBZMMVWJBIFMBEBT83

t #PRVJMMBDVBESBEB42 BOUFSJPSNFOUF
denominada XPCN)

**Actualmente slo estn disponibles en algunos mercados.


El diseo del riego es slo una representacin grfica.
1-7

Para referencia, consulte la pg. 234

El uso inteligente del agua.

Introduccin

www.rainbird.com

Introduccin

Anatoma de un sistema residencial con


aprovechamiento eficiente de agua

GRAVILLA

CSPED

Rotores
Regulacin de presin en el
vstago

CASA

Evita la prdida de agua provocada


por una presin de agua desigual.
Cada reduccin de 5 psi (0.34
bares) reduce el consumo de agua
un 6-8%.1 El rotor de la serie 5000
PRS ha registrado un ahorro de
agua del 15-45%.6

PATIO

t 3PUPSFTEFMBTTFSJFT
Plus con PRS
t +VOUBTBSUJDVMBEBT54+134

PARED

PENDIENTE

Boquillas de alta eficacia


La tecnologa de la boquilla Rain
Curtain proporciona gotas
pesadas con un patrn constante
y uniforme, lo cual evita el rociado
excesivo y ahorra agua.
t -PTSPUPSFTEFMBTTFSJFTZ
5000
Dispositivos de vlvula de
retencin

CSPED

Evitan que el agua se drene fuera


del sistema en el aspersor inferior y
evitan la erosin y el escurrimiento.
t 3PUPSFTEFMBTTFSJFT4".Z
5000

Productos de drena
drenaje
El gran surtido de rejillas, cuencas y accesorios
de drenaje de Rain Bird se utilizan para para
administrar el exceso de agua que puede causar
dao estructural a la casa y destruir los jardines
que la rodean. Si lo desea, este exceso de agua
se puede controlar y recolectar para uso futuro
en riego.

El uso inteligente del agua.

Boquillas rotativas
Vlvulas
l l
Las vlvulas de Rain Bird proporcionan
caractersticas excelentes de filtracin para obtener
la mxima fiabilidad en diversos entornos.

t -BTCPRVJMMBTHJSBUPSJBTEF3BJO#JSE
necesitan un 60% menos de caudal
y consiguen un ahorro de agua de hasta
un 30%.2, 7
t -BCPRVJMMB37"/EF3BJO#JSEUJFOF
un bajo ndice de precipitacin, reduce
los deslaves as como la posibilidad de
erosin.

Introduccin
Anatoma de un sistema comercial con
aprovechamiento eficiente de agua

Introduccin

Anatoma de un sistema
comercial con aprovechamiento
eficiente de agua*
En esta gua de diseo comercial se destacan las soluciones tecnolgicas
y los productos de Rain Bird para tener un jardn saludable con menor
consumo de agua.

Aspersores
Regulacin de presin en el vstago
Mantiene una presin de agua ptima. Cada
reduccin de 5 psi (0.34 bares) reduce el
consumo de agua un 6-8%. Con las boquillas de
la serie U, VAN, HE-VAN y MPR, si un sistema de
70 psi (4.8 bares) se reduce a los 30 psi (2 bares)
recomendados, se puede ahorrar ms de un 50%
de agua.1
t "TQFSTPSFT134 SFHVMBSB
30 psi, 2 bares, con boquillas de las series
U, VAN, HE-VAN y MPR)
t "TQFSTPSFT4".134 QTJ

t "TQFSTPSFT4".134 SFHVMBSBQTJ 
3.1 bares, con boquillas giratorias)
t "TQFSTPSFT3%4".134 QTJ

t "TQFSTPSFT3%4".134 QTJ

Boquillas de alta eficacia


%JTUSJCVZFOFMBHVBDPONTVOJGPSNJEBEZ
evitan el rociado excesivo, lo cual se puede
traducir en un ahorro de agua superior al 30%.2
t #PRVJMMBTBTQFSTPSBT4FSJF6
t #PRVJMMBT)&7"/
t #PRVJMMBTBTQFSTPSBTSPUBUJWBT
t #PRVJMMBT37"/
Dispositivos de vlvula de retencin Seal-AMatic (SAM)
Evitan que el agua se drene fuera del sistema
en el aspersor inferior y evitan la erosin, el
escurrimiento y el golpe de ariete.
t "TQFSTPSFT4".
t "TQFSTPSFT4".134 QTJ

t "TQFSTPSFT4".134 QTJ

t "TQFSTPSFT3%4".
t "TQFSTPSFT3%4".134 QTJ

t "TQFSTPSFT3%4".1 QTJ

Aspersores para agua no potable

Si
Sistemas
d
de control
centralizado
Programacin automtica basada en ET
Ajusta los tiempos de riego teniendo
en cuenta la prdida de agua del suelo
por evaporacin y la prdida de agua
por transpiracin de las plantas, lo cual
garantiza que se utiliza la cantidad
correcta de agua sin regar en exceso
ni en defecto. El ajuste automtico
de los programas de riego basado en
MBFWBQPUSBOTQJSBDJO &5
SFEVDFFM
consumo de agua en un 30-50%.8

Indicacin exclusiva de uso de agua no potable


en la cubierta.

t .BYJDPN2

t "TQFSTPSFT3%/1 QBSBBHVBOPQPUBCMF

t *2W

t 4JUF$POUSPM

Gestin de caudal

**Actualmente slo estn disponibles en algunos mercados.


El diseo del riego es slo una representacin grfica.
1-7

Para referencia, consulte la pg. 234

Reducen la prdida de agua


al controlar los caudales en
tiempo real para ubicar y
aislar los caudales excesivos
provocados por tuberas rotas,
aspersores daados o vlvulas
rotas o que no funcionan.
t .BYJDPN2

Suministran agua de forma lenta y


directa a la raz de las plantas y utilizan un
30-50% menos de agua que el riego por
aspersin.5

t *2W
Sistema Cycle + Soak (de
ciclo/remojo)

t .BYJDPN2
t 4JUF$POUSPM

t .BYJDPN2

t *2W

t 4JUF$POUSPM
t *2W

Riego de bajo
l
volumen
Dispositivos para riego directo a raz

t 4JUF$POUSPM

Elimina el escurrimiento al
esparcir agua a velocidades
que el suelo puede absorber,
en terrenos como pendientes,
terrenos compactados y reas
con mal drenaje.

Optimiza el agua disponible y los intervalos


de riego, y gestiona la demanda de caudal
total en el suministro de agua de forma
automtica.

*Todas las afirmaciones sobre el ahorro de agua suponen criterios adecuados


de diseo, instalacin y mantenimiento de los productos de riego. El ahorro
real puede variar de usuario a usuario segn el clima, las condiciones del lugar
y del sistema de riego, y las prcticas de riego previas.

Control de caudal y deteccin


de fugas

t %JTQPTJUJWPTEFFNJTJOEFHPUFP
t -OFBEFHPUFP9'
t 4FSJF3JFHPBSB[ 3PPU8BUFSJOH4FSJFT 
RWS)
Boquillas de alta eficacia
%JTUSJCVZFOFMBHVBDPONTVOJGPSNJEBE
y evitan el rociado excesivo, lo cual se
puede traducir en un ahorro de agua
superior al 30%.2
t #PRVJMMBDVBESBEB42 BOUFSJPSNFOUF
denominada XPCN)

El uso inteligente del agua.

Introduccin

Introduccin

www.rainbird.com

Anatoma de un sistema comercial con


aprovechamiento eficiente de agua

Lnea de goteo
subterrnea
t -OFBEFHPUFPTVCUFSSOFB 4%*
QBSB
aplicaciones con csped y sin csped.
t -BUFDOPMPHB$PQQFS4IJFMEQSPUFHFBM
emisor frente a la invasin de races.
t &MSJFHP4%*QVFEFBMDBO[BSVOB
eficiencia del 90% y ahorrar hasta un
70% de agua.

Vlvulas
La regulacin de presin
para las vlvulas mantiene
una presin constante
del agua para evitar el
desperdicio de agua
causado por vapor y neblina
en el aspersor
t .EVMP134%JBM

Rotores
Regulacin de presin en el vstago

Controladores
l d
y sensores
Controladores automticos con
caractersticas de aprovechamiento eficiente del agua

Estaciones de bombeo
Amplifican la presin a los niveles adecuados.
Como la presin baja puede provocar un
rendimiento bajo y desigual de las boquillas,
con frecuencia los usuarios riegan en exceso
todo el jardn para que el agua llegue a los
lugares secos. Las bombas aumentan la
presin y evitan este problema.
t &TUBDJPOFTEFCPNCFPTFSJF-$
t &TUBDJPOFTEFCPNCFP-1
t &TUBDJPOFTEFCPNCFPEFMBTTFSJFT% %1
Z%19

Permiten al usuario final ajustar con facilidad los ciclos de riego


para adaptarse a diferentes jardines y a cambios estacionales o
climatolgicos.
t $POUSPMBEPSFTEFMBTFSJF&41-9.&
t $POUSPMBEPS&41.&
Tecnologas de controladores inteligentes
Ajustan el riego segn las variables especficas del lugar. Los
controladores inteligentes pueden reducir el consumo de agua hasta
un 40% o ms.3
t &5$-9$BSUVDIP&5.BOBHFS
t &414.5 $POUSPMNPEVMBSJOUFMJHFOUF

Dispositivos de cierre automtico

t &TUBDJPOFTEFCPNCFPEFVKPJOUFSNFEJP

Cierre automtico del controlador cuando se detecta lluvia, lo que se


traduce en un ahorro de agua del 30-35%.4

t &TUBDJPOFTEFCPNCFPEFSJFHPQSJODJQBM

t 4FOTPSEFMMVWJB34%

Evita la prdida de agua provocada por una presin


de agua desigual. Cada reduccin de 5 psi (0.34 bares)
reduce el consumo de agua un 6-8%.1 El rotor de la serie
5000 PRS ha registrado un ahorro de agua del 15-45%.6
t 3PUPSFTEFMBTFSJF1MVTDPO134
t +VOUBTBSUJDVMBEBT54+134
Boquillas de alta eficacia
La tecnologa de la boquilla Rain Curtain proporciona
gotas pesadas con un patrn constante y uniforme, lo
cual evita el rociado excesivo y ahorra agua.
t 5PEPTMPTSPUPSFTEF3BJO#JSE
Dispositivos de vlvula de retencin
Evitan que el agua se drene fuera del sistema en el
aspersor inferior y evitan la erosin y el escurrimiento.
t 5PEPTMPTSPUPSFTEF3BJO#JSE
Resistencia al vandalismo
Los rotores resistentes al vandalismo evitan las prdidas
de agua causadas por daos y abusos.
t 3PUPSFTEFMBTTFSJFTZ

t 4FOTPSFTJOBMNCSJDPTEFMMVWJBZMMVWJBIFMBEBT83

El uso inteligente del agua.

Introduccin
Anatoma de un sistema de riego con agua no potable

Introduccin

Anatoma de un sistema de
riego con agua no potable
En esta gua de diseo de agua no potable
se destacan las soluciones tecnolgicas y los
productos de Rain Bird para tener un jardn
saludable que utilice agua no potable.

Riego de bajo volumen


t -OFBEFHPUFP9'WJPMFUB
t 5BQBBTQFSTPSB1$WJPMFUB
t 5BQBEFESFOBKFWJPMFUBDPOBDDFTPSJP

Rotores
5BQBTWJPMFUBTQBSBSPUPSFT
t 
t 1MVT
t 
t 'BMDPO
t 
t ".BYJ1BX

Vlvulas
Vlvulas duraderas resistentes
al cloro y accesorios para
aplicaciones de reciclaje:
t 1&4#3
t &'#$1
t (#
t "DPQMBNJFOUPSQJEP
t 5BQBTQBSBDBKBTEFWMWVMBT

Suministro de agua
no potable
Hay varias fuentes posibles de
abastecimiento de agua. Las ms comunes
en instalaciones comerciales son:
t 3FDPMFDDJOEFBHVBEFMMVWJB
t 3FDPMFDDJOEFBHVBTQMVWJBMFT
t $POEFOTBDJOEFTJTUFNBTEF
climatizacin (HVAC)
t "HVBTHSJTFTQSPDFEFOUFTEFEVDIBT 
fregaderos y lavabos
t 0USBT

Productos de drenaje
El gran surtido de rejillas, cuencas y accesorios de drenaje de
alta resistencia de Rain Bird se utilizan para para administrar el
exceso de agua que puede causar dao a las estructuras del lugar
y destruir los jardines que lo rodean. Este exceso de agua se
puede controlar, recolectar y mezclar con el suministro de agua no
potable existente para uso futuro en riego.

El uso inteligente del agua.

Introduccin

Lnea de riego
por goteo
-OFBEFHPUFPTVCUFSSOFB 4%*
QBSB
aplicaciones con csped y sin csped,
disponible en violeta sobre negro para
designar sistemas de agua no potable.

Introduccin

www.rainbird.com

Anatoma de un sistema de riego con agua no potable

t -BUFDOPMPHB$PQQFS4IJFMEQSPUFHFBM
emisor frente a la invasin de races
t &MSJFHP4%*QVFEFBMDBO[BSVOB
eficiencia del 90% y ahorrar hasta un
70% de agua

Riego a
raz RWS
Rejilla violeta

Estaciones de bombeo
Las bombas proporcionan la cantidad adecuada de
agua presurizada al sistema de riego.
t
t
t
t
t

&TUBDJPOFTEFCPNCFPTFSJF-$
&TUBDJOEFCPNCFP-1
&TUBDJPOFTEFCPNCFPEFMBTTFSJFT% %1Z%19
&TUBDJPOFTEFCPNCFPEFVKPJOUFSNFEJP
&TUBDJPOFTEFCPNCFPTJOSJFHP

Aspersores
t "TQFSTPSFT3%/1 QBSB
agua no potable)
t 5BQBWJPMFUBQBSB
aspersores de la serie 1800

El diseo del riego es slo una representacin grfica.

El uso inteligente del agua.

Cuerpos de aspersores
Introduccin
Cuerpos de
aspersores
Cuerpos de
aspersores
Boquillas aspersoras
Rotores
Impactos

Las boquillas y los 1800 de Rain Bird son los


mejores del mercado en calidad, confiabilidad
y precio. Nos permiten ofrecer la mejor
garanta a los clientes porque confiamos en
la marca.

Vlvulas

Luis Enrique Ruano,


Bombas y Riegos Profesionales,
Guadalajara, Mxico

Accesorios

Productos principales

Programadores

Aplicaciones primarias
Csped

1802,
1803,
1804,
1806

1812

1800
PRS

1800
SAM

O
O

Pendientes

Sistemas de control
centralizado

Cubierta vegetal/Arbustos

Sistemas de alta presin


Sistemas de baja presin

reas de viento excesivo

1800
1800 SAM- US-200,
SAM-PRS PRS-45
US-400

O*

Xerigation

Agua no potable

1300/
PA-80
RD-04,
1400
PA-8S
RD-06
Burbujeadores PA-8S-NP
PA-8S-PRS

RD-12

RD1800
SAM

RD1800
SAMPRS

RD1800
SAMPRS-F

RD1800
SAMPRS-45-F

reas daadas/afectadas
por el vandalismo
O

Agua sucia

Bombas

*La vlvula de retencin opcional US-SAM se puede retroadaptar a todos los aspersores UNI-Sprays.

Sugerencias para ahorrar agua


Drenaje

t El regulador PRS incorporado patentado

Recursos

mantiene una presin operativa ptima y


restringe la prdida de agua hasta un 70%
en el caso de que se extraiga una boquilla
PRVFSFTVMUFEBBEB5BNCJOUFSNJOB
con el desperdicio de agua al eliminar la
nebulizacin y la neblina causadas por la
alta presin.

Referencia

t Los aspersores de la serie 1800 que


incluyen las vlvulas de retencin
Seal-A-Matic (SAM) ahorran agua, al
evitar las fugas en los aspersores ms
bajos y detienen el golpe de ariete
previniendo que el agua drene fuera
de la tubera despus del riego.

t -BFYDMVTJWBUFDOPMPHB'MPX4IJFME
proporciona una reduccin de hasta
el 90% de prdida de agua cuando se
retira una boquilla, lo cual previene
posibles escurrimientos inaceptables
y costosos.

El uso inteligente del agua.

Cuerpos de aspersores

1800 Serie
2", 3", 4", 6", 12" (5.1 cm; 7.6 cm; 10.2 cm; 15.2 cm; 30.5 cm)

Tornillo de reduccin del radio

Q El sello de limpieza integrado activado a presin se moldea dentro de la

Malla y boquilla MPR de plstico

cubierta y presenta una "jaula" plstica empotrada para proporcionar una


resistencia a la arenilla sin igual, la presin y el medio ambiente. Adems,
el diseo de la junta multifuncin activada por presin, asegura una junta
eficaz sin exceso de "prdida de agua", lo que permite que se instalen ms
aspersores en la misma vlvula

Cuerpos de
aspersores

www.rainbird.com/sprays

Serie 1800

Sello de limpieza integrado activado


a presin

Q El fuerte resorte de acero inoxidable proporciona una retraccin confiable


Resorte retrctil fuerte de acero inoxidable

del vstago

Q El mecanismo de trinquete de dos piezas en todos los modelos permite


alinear fcilmente el patrn de la boquilla y brinda una durabilidad
prolongada

Caractersticas
t&MDBVEBMDPOUSPMBEPDPOQSFDJTJOFOMBSFUSBDDJOFMJNJOBMBTVDJFEBEEFMB
unidad y asegura una buena retraccin del vstago en todo tipo de suelos.
 &MUBQOEFMJNQJF[BQSFJOTUBMBEP1PQ5PQ EFDPMPSOBSBOKB FWJUB
que las partculas de suciedad ms grandes que las aberturas de la malla
EFMGJMUSPEFMBCPRVJMMBFOUSFOEFTQVTEFMBMJNQJF[B'BDJMJUBMBJOTUBMBDJO
de la boquilla.

Entrada lateral en modelos 1806 y 1812*

t$POTUSVJEPDPOQJF[BTEFQMTUJDPSFTJTUFOUFTBMQBTPEFMUJFNQPZMPTSBZPT
ultravioleta y de acero inoxidable resistentes a la corrosin,
que garantizan una larga vida til del producto

Opcin de regulador de presin en el vstago PRS


patentado

t5PEPTMPTDPNQPOFOUFTEFMBTQFSTPSTFQVFEFOEFTNPOUBSEFTEFMB
parte superior sin herramientas especiales, lo que permite realizar la limpieza
y el mantenimiento de manera fcil y rpida

Anillo de ajuste de trinquete de dos piezas


(para una fcil alineacin del patrn de la boquilla
y durabilidad)

t-PTNPEFMPTZ RVFOPTFBO4".
QSFTFOUBOFOUSBEBMBUFSBMF
JOGFSJPS
t(BSBOUBDPNFSDJBMEFDJODPBPT

Rango operativo
t&TQBDJBNJFOUPEFBQJFT EFBN

Opcin de vlvula de retencin en el vstago SAM


Seal-A-Matic)

t1SFTJOEFBQTJ EFBCBSFT

Especificaciones
t1SEJEBEFBHVBHQNBQTJ CBSFT
PNT
de lo contrario 0.10 gpm (0.02 m3/h; 0.36 l/m)

Dimensiones y modelos
t 12&OUSBEBIFNCSBSPTDBEB/15 

t.PEFMPTZBMUVSB
- 1802: 4" (10.2 cm) de altura del cuerpo; 2" de altura del vstago retrctil (5.1
cm)
- 1803: 4 7 8" (12.4 cm) de altura del cuerpo; 3" de altura del vstago retrctil
(7.6 cm)
- 1804: 6" (15.2 cm) de altura del cuerpo; 4" de altura del vstago retrctil
(10.2 cm)
- 1806: 9 3 8" (23.8 cm) de altura del cuerpo; 6" de altura del vstago retrctil
(15.2 cm)
- 1812: 16" (40.6 cm) de altura del cuerpo; 12" de altura del vstago retrctil
(30.5 cm)
t%JNFUSPEFMBTVQFSGJDJFFYQVFTUB14" (5.7 cm)
* Las unidades 1806 y 1812-SAM, SAMPRS y SAM-PRS-45 no poseen entrada lateral.
** de 2.5 a 18 pies (75 cm a 5.5 m) con boquillas de aspersores Rain Bird estndar
(series SQ, MPR, VAN, U) de 13 a 24 pies (4 a 7.3 m) con boquillas giratorias Rain Bird

Serie 1800

Cmo especificar
1804
Altura del vstago retrctil
1802: 2" (5.1 cm) de altura del vstago retrctil
1803: 3" (7.6 cm) de altura del vstago retrctil
1804: 4" (10.2 cm) de altura del vstago retrctil
1806: 6" (15.2 cm) de altura del vstago retrctil
1812: 12" (30.5 cm) de altura del vstago retrctil
Modelo
Cuerpos de los aspersores 1800

El caudal controlado con precisin en la retraccin elimina la suciedad de la unidad y asegura un rendimiento confiable y una buena
retraccin del vstago en todo tipo de suelos.

El uso inteligente del agua.

Cuerpos de aspersores
Serie 1800

4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)


Cuerpos de
aspersores

Q Regulador de presin PRS incorporado en el vstago. Sin piezas que


instalar en el lugar. Ahorra tiempo y dinero
Q Mantiene la presin de salida constante en 30 psi (2.1 bares). Las boquillas
y los cuerpos de aspersores tienen mejor rendimiento a 30 psi (2.1 bares).
Asegura el rendimiento mximo de la boquilla y el cuerpo de aspersor,
incluso si varan las presiones de entrada. Mantiene la presin constante
independientemente de la boquilla que se use
Q 5 FSNJOBDPOMBOFCVMJ[BDJOZMBOFCMJOBDBVTBEBTQPSMBBMUBQSFTJO
%FUJFOFFMEFTQFSEJDJPEFBHVB"TFHVSBRVFTFSFBMJDFFMSJFHPOFDFTBSJP
en condiciones de alta presin o viento

Caractersticas
t3FTUSJOHFMBQSEJEBEFBHVBIBTUBFOVOTJMBCPRVJMMBTFTBMFPTFEBB
Ahorra agua y dinero. Reduce la posibilidad de accidentes y
daos a la propiedad. Recomendado para zonas afectadas por el vandalismo
t%JTFBEPQBSBVTBSDPOUPEBTMBTCPRVJMMBTQMTUJDBTEFBTQFSTPSFT3BJO#JSE
t5JFOFFTUBNQBEP134FOMBDVCJFSUBQBSBGBDJMJUBSMBJEFOUJGJDBDJOZFM
mantenimiento

ndice de caudal y presin de entrada: aspersores 1800 PRS


gpm l/m
3.5 13.2

3.0 11.4

15H Nz - no PRS

2.5 9.5

ndice de flujo

Serie 1800-PRS

15H Nz - with PRS


2.0 7.6

12H Nz - with PRS

12H Nz - no PRS
1.5 5.7

10H Nz - no PRS

10H Nz - with PRS

1.0 3.8

8H Nz - no PRS

8H Nz - with PRS

0.5 1.9

0.0 0.0
psi 15
bares 1.0

25
1.7

35
2.4

45
3.1

55
3.8

65
4.5

75
5.2

Presin de entrada

t(BSBOUBDPNFSDJBMEFDJODPBPT

Rango operativo
t&TQBDJBNJFOUPEFBQJFT EFBN

t1SFTJOEFBQTJ EFBCBSFT

Especificaciones
t3FHVMBMBQSFTJOEFMBCPRVJMMBBVOQSPNFEJPEFQTJ CBSFT
DPOQSFTJPOFT
de entrada de hasta 70 psi (4.8 bares) (ver grfico)

El regulador de presin en el
vstago patentado compensa
la presin alta o fluctuante
de agua para garantizar un
mximo rendimiento

t1SEJEBEFBHVBHQNBQTJ CBSFT
PNT
de lo contrario 0.10 gpm (0.02 m3/h; 0.36 l/m)
t*OTUBMBDJOFOUSBEBMBUFSBMPJOGFSJPS
t&ODMJNBTDPOUFNQFSBUVSBTCBKPDFSP OPTFSFDPNJFOEBMBJOTUBMBDJOEFMB
entrada lateral

Dimensiones
t 12" entradas hembras roscadas (15/21)
t"MUVSBEFMDVFSQP
- 1804 PRS: 6" (15.2 cm)
- 1806 PRS: 9 3 8" (23.8 cm)
- 1812 PRS: 16" (40.6 cm)
t%JNFUSPEFMBTVQFSGJDJFFYQVFTUB14" (5.7 cm)

Cmo especificar

Modelos
t134 DN
EFBMUVSBEFMWTUBHPSFUSDUJM

1804-PRS

t134 DN
EFBMUVSBEFMWTUBHPSFUSDUJM

Opcional

PRS: Regulacin de presin en el vstago

t134 DN
EFBMUVSBEFMWTUBHPSFUSDUJM

Altura del vstago retrctil


1804: 4" (10.2 cm) de altura del vstago retrctil
1806: 6" (15.2 cm) de altura del vstago retrctil
1812: 12" (30.5 cm) de altura del vstago
retrctil

1800-PRS
* de 2.5 a 18 pies con boquillas de aspersores Rain Bird estndares (series SQ, MPR, VAN, U);
de 13 a 24 pies con boquillas giratorias Rain Bird

Modelo
Cuerpos de los aspersores 1800

El regulador de presin patentado mantiene una presin de salida ptima para maximizar la eficiencia de la boquilla, evita el exceso de flujo
y el vaho. Cada reduccin de 5 psi (0.34 bares) reduce el consumo de agua en 6-8%. Utilizar aspersores con PRS puede resultar en un 50%
de ahorro en agua comparado con los aspersores que no incluyen regulacin de presin en las instalaciones en donde hay alta presin sin
considerar las fluctuaciones de las presiones de entrada.

10

El uso inteligente del agua.

Cuerpos de aspersores
Serie 1800

www.rainbird.com/sprays

Serie 1800-SAM
4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)
Cuerpos de
aspersores

Q Vlvula de retencin incorporada Seal-A-Matic (SAM). Elimina la necesidad


de vlvulas de retencin situadas debajo del aspersor. Sin piezas que instalar
en el lugar.
Q Atrapa el agua en los tubos laterales en los desniveles de hasta 14 pies
(4.2 m). Reduce el desgaste de los componentes del sistema al minimizar
el golpe de ariete durante el arranque
Q Resorte retrctil aun ms fuerte para adaptarse a los desniveles de hasta 14
pies (4.2 m). Uno de los resortes ms fuertes de la industria.

Caractersticas
t&WJUBFMESFOBKFEFMPTBTQFSTPSFTRVFFTUOFOOJWFMFTNTCBKPT%FUJFOFFM
desperdicio de agua. Evita daar el terreno por inundacin y/o erosin
t%JTFBEPQBSBVTBSDPOUPEBTMBTCPRVJMMBTQMTUJDBTEFBTQFSTPSFT3BJO#JSE
t5JFOFFTUBNQBEP4".FOMBDVCJFSUBQBSBGBDJMJUBSMBJEFOUJGJDBDJOZFM
mantenimiento
t(BSBOUBDPNFSDJBMEFDJODPBPT

Rango operativo

1800-SAM

t&TQBDJBNJFOUPEFBQJFT EFBN

t1SFTJOEFBQTJ EFBCBSFT

Especificaciones
t$BQBDJEBEEF4".SFUJFOFIBTUBQJFT N
EFMBTQFSTPSBQTJ CBSFT

t1SEJEBEFBHVBHQNBQTJ CBSFT
PNT
de lo contrario 0.50 gpm (0.11 m3/h; 1.80 l/m)

Dimensiones
t 12" entrada hembra roscada (15/21)
t"MUVSBEFMDVFSQP
- 1804-SAM: 6" (15.2 cm)
- 1806-SAM: 9 3 8" (23.8 cm)
- 1812-SAM: 16" (40.6 cm)
t%JNFUSPEFMBTVQFSGJDJFFYQVFTUB14" (5.7 cm)

Modelos

La vlvula de retencin
incorporada Seal-A-Matic
evita el drenaje de los
aspersores bajos, ideal para
usar en desniveles

t4". DN
EFBMUVSBEFMWTUBHPSFUSDUJM
t4". DN
EFBMUVSBEFMWTUBHPSFUSDUJM
t4". DN
EFBMUVSBEFMWTUBHPSFUSDUJM
* de 2.5 a 18 pies (75 cm a 5.5 m) con boquillas de aspersores Rain Bird estndar (series SQ,
MPR, VAN, U) de 13 a 24 pies (4 a 7.3 m) con boquillas giratorias Rain Bird

Cmo especificar
1804-SAM
opcional
SAM: Vlvula de retencin Seal-A-Matic
Altura del vstago retrctil
1804: 4" (10.2 cm) de altura del vstago retrctil
1806: 6" (15.2 cm) de altura del vstago retrctil
1812: 12" (30.5 cm) de altura del vstago
retrctil
Modelo
Cuerpos de los aspersores 1800

La vlvula de retencin incorporada Seal-A-Matic atrapa el agua en los tubos laterales y evita el drenaje de los aspersores a niveles ms bajos,
EFUFOJFOEPFMEFTQFSEJDJPEFBHVBZMPTEBPTDBVTBEPTQPSMBJOVOEBDJOZMBFSPTJO5BNCJOSFEVDFFMEFTHBTUFEFMPTDPNQPOFOUFTEFM
sistema al minimizar el golpe de ariete durante el arranque

El uso inteligente del agua.

11

Cuerpos de aspersores
Serie 1800

t"MUVSBEFMDVFSQP
1804-SAM-PRS: 6" (15.2 cm)
1806-SAM-PRS: 9 38" (23.8 cm)
1812-SAM-PRS: 16" (40.6 cm)

Serie 1800-SAM-PRS
4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)
Cuerpos de
aspersores

Caractersticas
t*ODPSQPSBUPEBTMBTDBSBDUFSTUJDBTEFMB4FSJF4".Z134
t4BUJTGBDFMBTOFDFTJEBEFTEFUPEBTMBTSFBTEFMPTBTQFSTPSFT 
independientemente de los desniveles o cambios de presin de agua
t5JFOFFTUBNQBEP4".134FOMBDVCJFSUBQBSBGBDJMJUBSMBJEFOUJGJDBDJOZFM
mantenimiento

Rango operativo

t%JNFUSPEFMBTVQFSGJDJFFYQVFTUB
214" (5.7 cm)

Modelos
t4".134
4" (10.2 cm) de altura del vstago
retrctil
t4".134
6" (15.2 cm) de altura del vstago
retrctil

t&TQBDJBNJFOUPEFBQJFT EFBN

t1SFTJOEFBQTJ EFBCBSFT

Especificaciones

t4".134
12" (30.5 cm) de altura del vstago
retrctil

t$BQBDJEBEEF4".SFUJFOFIBTUBQJFT N
EFMBTQFSTPS
6 psi (0.4 bares)
t1SEJEBEFBHVBHQNBQTJ CBSFT
PNT
de lo contrario 0.50 gpm (0.11 m3/h; 1.80 l/m)

Dimensiones
t 12" entrada hembra roscada (15/21)

El aspersor de primera
calidad incluye todas
las caractersticas
de la Series SAM
y PRS, y es ideal
independientemente
de la presin o la
elevacin

* de 2.5 a 18 pies (75 cm a 5.5 m) con boquillas de


aspersores Rain Bird estndares (series SQ, MPR,
VAN, U) de 13 a 24 pies (4 a 7.3 m) con boquillas
giratorias Rain Bird

SAM-PRS

Dimensiones

Serie 1800-SAM-P45

t&OUSBEBIFNCSBSPTDBEBEFw 

4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)

t"MUVSBEFMDVFSQP

Caractersticas
t$VCSFMBTOFDFTJEBEFTEFMBTBQMJDBDJPOFTEFMDVFSQPEFMPTBTQFSTPSFTRVF
utilizan boquillas giratorias, independientemente de los cambios en la elevacin
o en la presin del agua. Incorpora la caracterstica SAM de la serie 1800 y
regula la presin de la boquilla a 45 psi (3.1 bares)
t%JTFBdo para maximizar la eficiencia de la aplicacin cuando se utilizan
boquillas giratorias
t.BOUJFOFMBQSFTJOEFTBMJEBDPOTUBOUFFOQTJ CBSFT
BVORVFWBSF
la presin de entrada. Asegura el rendimiento mximo de la boquilla y el
cuerpo de aspersor, incluso si varan las presiones de entrada. Mantiene la
presin constante independientemente de la boquilla que se use
t5JFOFFTUBNQBEPi4".134wFOMBDVCJFSUBQBSBGBDJMJUBSMBJEFOUJGJDBDJOZ
el mantenimiento.
t(BSBOUBDPNFSDJBMEFDJODPBPT

- 1804-SAM-P45: 6 (15.2 cm)


- 1806-SAM-P45: 9 38" (23.8 cm)
- 1812-SAM-P45: 16 (40.6 cm)
t%JNFUSPEFMBTVQFSGJDJFFYQVFTUB
214" (5.7 cm)

Modelos
t4".1 DN
EFBMUVSB
del vstago retrctil
t4".1 DN
EFBMUVSB
del vstago retrctil

Cmo especificar

t4".1 DN
EFBMUVSB
del vstago retrctil

1804- SAM-P45
opcional
P45: regulador de presin en el
vstago de 45 psi (3.1 bares)

Rango operativo
t&TQBDJBNJFOUPEFBQJFT EFBN

* de 2.5 a 18 pies (75 cm a 5.5 m) con


boquillas de aspersores Rain Bird estndares
(series SQ, MPR, VAN, U); de 13 a 24 pies (4 a
7.3 m) con boquillas giratorias Rain Bird

t1SFTJOEFBQTJ EFBCBSFT

Especificaciones
t$BQBDJEBEEF4".SFUJFOFIBTUBQJFT N

del aspersor; a 6 psi (0.4 bares)
t1SEJEBEFBHVBHQNBQTJ CBSFT
PNT
de lo contrario 0.50 gpm (0.11 m3/h; 1.8 l/m)

12

SAM-P45

opcional
SAM: Vlvula de retencin
Seal-A-Matic
Altura del vstago retrctil
1804: 4" (10.2 cm) de altura del vstago retrctil
1806: 6" (15.2 cm) de altura del vstago retrctil
1812: 12" (30.5 cm) de altura del vstago
retrctil
Modelo
Cuerpos de los aspersores 1800
Nota: Especifique los cuerpos de los aspersores y las
boquillas por separado.

El uso inteligente del agua.

Cuerpos de aspersores

www.rainbird.com/sprays

4FSJF3%

4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)

NUEVO

Q %
 JTFBEPTQBSBVUJMJ[BSDPOUPEBTMBTCPRVJMMBTEFBTQFSTPSFTEFQMTUJDP
EF3BJO#JSECPRVJMMBTHJSBUPSJBT CPRVJMMBTTFSJF6 .13 7"/ )&7"/Z42
Q Partes resistentes a la corrosin en agua tratada y reciclada que contenga
cloro y otras sustancias qumicas.

Rango operativo
t&TQBDJBNJFOUPEFBQJFT EFBN

t1SFTJOde 15 a 100 psi (de 1 a 6.9 bares)

Especificaciones

Q El fuerte resorte de acero inoxidable proporciona una retraccin confiable


del vstago y es resistente a la corrosin.

t1SEJEBEFBHVB .PEFMPT4".EFBQTJ CBS


PNT
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)
Los dems modelos: de 0 a 10 psi (0.7 bar) o ms;
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)

Caractersticas

Dimensiones y modelos

t-BKVOUBMJNQJBEPSBQBUFOUBEBEFUSFTDVDIJMMBT JOUFHSBEBZBDUJWBEBB
presin, asegura una junta eficaz sin prdida de agua excesiva, lo cual
permite que se instalen ms aspersores en la misma vlvula. La junta
limpiadora de tres cuchillas equilibra con precisin la limpieza, la prdida
de agua y la proteccin contra suciedad, y optimiza el rendimiento y la
durabilidad de la elevacin y la retraccin. El caudal controlado con precisin
en la elevacin y la retraccin elimina la suciedad y garantiza la buena
retraccin del vstago en todo tipo de suelos.
t-BTDBWJEBEFTQBSBBUSBQBSTVDJFEBEFOMBCBTFEFMDVFSQPEFMBTQFSTPS
previenen la recirculacin de suciedad nociva durante el funcionamiento y
reducen el desgaste de la junta limpiadora y el vstago.
t&MNFDBOJTNPEFUSJORVFUFSFGPS[BEPQFSNJUFBMJOFBSFMQBUSOEFMBCPRVJMMB
fcilmente sin herramientas, resiste las sustancias qumicas del agua reciclada
y previene el desalineamiento del patrn con el tiempo.
t&MUBQOEFMJNQJF[BQSFJOTUBMBEP1PQ5PQFWJUBRVFJOHSFTFTVDJFEBE
despus de la limpieza y permite la instalacin fcil de la boquilla.
t$POTUSVJEPDPOQJF[BTEFQMTUJDPSFTJTUFOUFTBMQBTPEFMUJFNQPZMPTSBZPT
ultravioleta, y piezas de acero inoxidable resistentes a la corrosin, que
garantizan una larga vida til del producto.
t5PEPTMPTDPNQPOFOUFTEFMBTQFSTPSTFQVFEFOEFTNPOUBSEFTEFMBQBSUF
superior sin herramientas especiales, lo cual permite realizar la limpieza y el
mantenimiento del aspersor de manera fcil y rpida.
t&OUSBEBTMBUFSBMFTTMPFOMPTNPEFMPTRVFOPTPO4FBM".BUJD 4".

t(BSBOUBDPNFSDJBMEFDJODPBPT

t&OUSBEBIFNCSBSPTDBEB/15EFw DN
 

t.PEFMPTZBMUVSB

Cmo especificar
RD-XX - X - Boquilla
Boquilla
Para obtener ms informacin,
consulte las especificaciones de
las boquillas rotativas y las de las
TFSJFT6 .13 7"/ )&7"/Z42
Caractersticas opcionales
S: Vlvula de retencin Seal-A-Matic
P30: regulador de presin en el vstago de 30 psi
(2.1 bares)
P45: regulador de presin en el vstago de 45 psi
(3.1 bares)
FUFDOPMPHB'MPX4IJFME
NP: cubierta con indicacin de uso de agua no
potable
Modelo
RD-06: 6" (15 cm) de altura del vstago retrctil
RD-12: 12" (40 cm) de altura del vstago retrctil
Notas:
La caracterstica SAM est incluida en los modelos P45.
La tecnologa Flow-Shield est disponible solo en los
modelos P30 y P45.
Especifique las boquillas y los cuerpos de aspersores
por separado.

Cuerpos de
aspersores

Aspersores serie RD1800

 3%38" (24 cm) de altura del cuerpo; 6" de altura del vstago retrctil
(15.2 cm)
 3% DN
EFBMUVSBEFMDVFSQP DN
EFBMUVSBEFMWTUBHP
retrctil
t%JNFUSPEFMBTVQFSGJDJFFYQVFTUBw DN


Modelos
Modelos de 4"
3%/1
3%4
3%4/1
3%41

3%41'
3%41'/
3%41'
3%41'/

Modelos de 6"
3%
3%/1
3%4
3%4/1
3%41

3%41'
3%41'/
3%41'
3%41'/

Modelos de 12"
3%
3%/1
3%4
3%4/1
3%41

3%41'
3%41'/
3%41'
3%41'/

Serie RD1800

-BKVOUBMJNQJBEPSBEFUSFTDVDIJMMBTZMBTDBWJEBEFTQBSBBUSBQBSTVDJFEBEFOFMBTQFSTPSEFMBTFSJF3%TFDPNCJOBOQBSBQSFWFOJSFM
desperdicio y evitar que la unidad se atore durante la elevacin.

El uso inteligente del agua.

13

Cuerpos de aspersores
4FSJF3%

Cuerpos de
aspersores

Tecnologa Flow-Shield exclusiva

Flujo indicador de servicio

La tecnologa exclusiva
Flow-Shield proporciona
hasta un 90% de reduccin
en desperdicio de agua si la
boquilla se pierde o es
retirada y previene los altos
.
costos en gastos de reparacin por deslaves y erosin.

Si una boquilla es extrada del aspersor, la


tecnologa exclusiva Flow-Shield activa un chorro
de agua en pequea cantidad. Como resultado, el
funcionamiento se mantiene estable, se ahorra
agua y usted no tiene que esperar a que la
vegetacin empiece a morir para darse cuenta
que hay un problema.

Junta limpiadora patentada de triple hoja

Regulador de presin patentado


El regulador de presin
patentado del RD1800
aumenta la eciencia de la
boquilla hasta un 50% en
aplicaciones de alta presin.

El RD1800 incluye un sello de tres cuchillas. El


sello superior, limpia el vstago durante la
retraccin y previene que entren partculas de
suciedad externas. Durante la
operacin, el sello principal
se combina con la supercie
del vstago para eliminar las
fugas de agua. La tercera
cuchilla exclusiva funciona
Tercera nueva
hoja adicional
como otra lnea de defensa en
caso de que el sello principal se dae.

Resistente al agua tratada

Mecanismo de trinquete reforzado


El mecanismo de trinquete del RD1800 fue
diseado para facilitar el uso y la consistencia,
mantenindose en posicin a lo largo del
tiempo, soportando aos de exposicin al
cloro y una mayor resistencia a la suciedad.

Vlvula de retencin Seal-A-Matic (SAM)


Exclusiva de Rain Bird, la vlvula de retencin SAM
detiene hasta 14 pies de instalacin y evita que el agua
drene de los aspersores ms bajos, eliminando la
erosin, los escurrimientos y el golpe de ariete durante
el arranque del sistema.

14

La serie RD1800 se fabrica con EPDM y polister,


estos materiales son resistentes al agua tratada o
reciclada, resisten la degradacin causada por el
cloro en el agua reciclada asegurando una vida
mas larga.

Bolsas recolectoras
de suciedad
Cada vez que el sistema se
activa, las nicas y exclusivas
bolsas recolectoras de
suciedad del RD1800
detienen las partculas de
tierra - retirando la suciedad
de la circulacin interna para
prevenir daos a largo plazo.

El uso inteligente del agua.

Cuerpos de aspersores

Serie RD1800 SAM

Serie RD1800 SAM PRS

4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)

4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)

Q Vlvula de retencin incorporada Seal-A-Matic (SAM). Elimina la


necesidad de vlvulas de retencin situadas debajo del aspersor. Sin piezas
que instalar en el lugar.

Q *ODPSQPSBUPEBTMBTDBSBDUFSTUJDBTEFMBTTFSJFT3%4".Z134

Q Resorte retrctil ms fuerte para adaptarse a los desniveles de hasta 14


pies (4.2 m). Uno de los resortes ms fuertes de la industria.
Q&WJUBFMESFOBKFEFMPTBTQFSTPSFTRVFFTUOFOOJWFMFTNTCBKPT%FUJFOFFM
desperdicio de agua. Evita daos el terreno por inundacin y erosin.

Caractersticas
t*ODPSQPSBUPEBTMBTDBSBDUFSTUJDBTEFMBTFSJF3%
t*EFBMQBSBVTBSFOSFBTDPOEFTOJWFMFT
t3FUJFOFFMBHVBFOMPTUVCPTMBUFSBMFT MPDVBMSFEVDFFMEFTHBTUFEFMPT
componentes del sistema porque minimiza el golpe de ariete durante el
arranque.
t5JFOFFMTFMMP4".FOMBUBQBQBSBGBDJMJUBSMBJEFOUJGJDBDJOZFM
mantenimiento.

Rango operativo
t&TQBDJBNJFOUPEFBQJFT EFBN

t1SFTJOEFBQTJ EFBCBSFT

Especificaciones
t$BQBDJEBEEF4".SFUJFOFIBTUBQJFT N
EFMBTQFSTPSBQTJ CBS

t1SEJEBEFBHVBEFBQTJ CBS
PNT
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)
t/PUJFOFFOUSBEBMBUFSBM

Dimensiones y modelos
t&OUSBEBIFNCSBSPTDBEB/15EFw DN
 

Cuerpos de
aspersores

www.rainbird.com/sprays

4FSJF3%

Q Cubre las necesidades de todas las reas de los aspersores,


independientemente de los desniveles o cambios de presin de agua.
Q5JFOFFMTFMMP4".134FOMBUBQBQBSBGBDJMJUBSMBJEFOUJGJDBDJOZFM
mantenimiento.

Rango operativo
t&TQBDJBNJFOUPEFBQJFT EFBN

t1SFTJOEFBQTJ EFBCBSFT

Especificaciones
t1SEJEBEFBHVBEFBQTJ CBS
PNT
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)
t3FHVMBMBQSFTJOEFMBCPRVJMMBBVOQSPNFEJPEFQTJ CBSFT
DPO
presiones de entrada de hasta 100 psi (6.9 bares).
t/PUJFOFFOUSBEBMBUFSBM

Dimensiones y modelos
t&OUSBEBIFNCSBSPTDBEB/15EFw DN
 

t.PEFMPTZBMUVSB
 3%41 DN
EFBMUVSBEFMDVFSQP DN
EFBMUVSBEFM
vstago retrctil
 3%413/8 (23.8 cm) de altura del cuerpo; 6" de altura del vstago
retrctil (15.2 cm)
 3%41 DN
EFBMUVSBEFMDVFSQP DN
EFBMUVSBEFM
vstago retrctil
t%JNFUSPEFMBTVQFSGJDJFFYQVFTUBw DN


t.PEFMPTZBMUVSB
 3%4 DN
EFBMUVSBEFMDVFSQP DN
EFBMUVSBEFMWTUBHP
retrctil
 3%43/8 (23.8 cm) de altura del cuerpo; 6" de altura del vstago
retrctil (15.2 cm)
 3%4 DN
EFBMUVSBEFMDVFSQP DN
EFBMUVSBEFM
vstago retrctil

ndice de caudal y presin de entrada: aspersores RD1800 PRS


gpm l/m
3.5 13.2

t%JNFUSPEFMBTVQFSGJDJFFYQVFTUBw DN


3.0 11.4

15H Nz - no PRS

ndice de flujo

2.5 9.5

15H Nz - with PRS


2.0 7.7

12H Nz - with PRS

12H Nz - no PRS
1.5 5.7

10H Nz - no PRS

10H Nz - with PRS

1.0 3.8

8H Nz - no PRS

8H Nz - with PRS

0.5 1.9

0.0 0.0
psi 15
bares 1.0

25
1.7

35
2.4

45
3.1

55
3.8

65
4.5

75
5.2

Presin de entrada

-BFYDMVTJWBUFDOPMPHB'MPX4IJFMESFEVDFMBQSEJEBEFBHVBIBTUBFOVODVBOEPTFSFUJSBVOBCPRVJMMB

El uso inteligente del agua.

15

Cuerpos de aspersores
4FSJF3%

Serie RD1800 Flow-Shield


4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)
Cuerpos de
aspersores

Q%JTFBEPTQBSBBIPSSBSBHVBZQSFTFSWBSMBIJESVMJDBEFMTJTUFNBBGJOEF
mantener el correcto funcionamiento en toda la zona de riego. Brinda
proteccin contra la prdida de material vegetal y reduce la probabilidad
de incurrir en costosas multas a causa de escurrimientos excesivos cuando
se retira una boquilla.
Q & YDMVTJWBUFDOPMPHB'MPX4IJFMEJODPSQPSBEBFOFMWTUBHP4JOQJF[BTRVF
instalar en el lugar. Ahorra agua, material vegetal, tiempo y dinero.
Q Restringe la prdida de agua hasta en un 90% si se retira la boquilla de un
aspersor que no es PRS, y hasta en un 50% si se retira la boquilla de un
aspersor PRS.

Caractersticas
t*ODPSQPSBUPEBTMBTDBSBDUFSTUJDBTEFMBTTFSJFT3%4".Z134 ZBEFNT
- Reduce la posibilidad de accidentes y daos a la propiedad. Recomendado
para reas con alta presin y afectadas por el vandalismo.
- Proporciona chorro de agua vertical de bajo caudal visible desde una lnea
visual de ms de 200 pies (60 m) cuando se retira una boquilla. La altura
y el bajo caudal del chorro de agua vertical hace que el agua se disperse
mientras desciende, lo cual reduce los charcos y el escurrimiento
- El chorro de agua vertical de bajo caudal no supera los 2 gpm (0.45 m3/h;
0.13 l/s), incluso con presin de entrada variable.
- El chorro de agua vertical de bajo caudal reduce la probabilidad de pasar
por alto la extraccin de una boquilla, y el reemplazo de boquilla disminuye
la posibilidad de estrs del pasto y prdidas de material vegetal.
5JFOFFMTFMMP'FOMBUBQBQBSBGBDJMJUBSMBJEFOUJGJDBDJOZFM
mantenimiento.

Serie para aplicaciones de agua no potable


RD1800
4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)
Q Indicacin exclusiva de uso de agua no potable en la cubierta con junta
MJNQJBEPSBWJPMFUBEFUSFTDVDIJMMBT BEWFSUFODJBFOJOHMT %0/05%3*/, 
y en espaol, "NO BEBA", y smbolo internacional de no beber.
Q No requiere el uso de tapas violetas a presin que se pueden quitar durante
un acto de vandalismo.
Q No requiere el uso de llamativas cubiertas moldeadas violetas que delatan la
ubicacin de los aspersores.

Caractersticas
t-BTFSJF3%QBSBBQMJDBDJPOFTEFBHVBOPQPUBCMFPGSFDFUPEBTMBT
DBSBDUFSTUJDBTEFMBTTFSJFT4". 4".134Z4".134'MPX4IJFME
t1SPQPSDJPOBVOBBMUFSOBUJWBBMBTUBQBTBQSFTJOZMBTDVCJFSUBTNPMEFBEBT
violetas para identificar el uso de agua no potable.

Rango operativo
t&TQBDJBNJFOUPEFBQJFT EFBN

t1SFTJOEFBQTJ EFBCBSFT

Especificaciones
t$BQBDJEBEEF4".SFUJFOFIBTUBQJFT N
EFMBTQFSTPSBQTJ CBS

t1SEJEBEFBHVB .PEFMPT4".EFBQTJ CBS


PNT
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)
Los dems modelos: de 0 a 10 psi (0.7 bar) o ms;
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)

Rango operativo

Dimensiones y modelos

t&TQBDJBNJFOUPEFBQJFT EFBN

t1SFTJOEFBQTJ EFBCBSFT

t.PEFMPTZBMUVSB

Especificaciones
t$BQBDJEBEEF4".SFUJFOFIBTUBQJFT N
EFMBTQFSTPSBQTJ CBS

t1SEJEBEFBHVB .PEFMPT4".EFBQTJ CBS


PNT
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)
Los dems modelos: de 0 a 10 psi (0.7 bar) o ms;
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)

t&OUSBEBIFNCSBSPTDBEB/15EFw DN
 

 3%/1 3%4/1 3%41'/ 3%41'/ DN


EF
altura del cuerpo; 4" (10.2 cm) de altura del vstago retrctil
 3%/1 3%4/1 3%41'/ 3%41'/w DN

de altura del cuerpo; 6" (15.2 cm) de altura del vstago retrctil
 3%/1 3%4/1 3%41'/ 3%41'/ DN
EF
altura del cuerpo; 12" (30.5 cm) de altura del vstago retrctil
 %JNFUSPEFMBTVQFSGJDJFFYQVFTUBw DN


Dimensiones y modelos
t&OUSBEBIFNCSBSPTDBEB/15EFw DN
 

t.PEFMPTZBMUVSB
 3%41' 3%41' DN
EFBMUVSBEFMDVFSQP
4" (10.2 cm) de altura del vstago retrctil
 3%41' 3%41'3/8 (23.8 cm) de altura del cuerpo;
6" de altura del vstago retrctil (15.2 cm)
 3%41' 3%41' DN
EFBMUVSBEFMDVFSQP
12" (30.5 cm) de altura del vstago retrctil
t%JNFUSPEFMBTVQFSGJDJFFYQVFTUBw DN


Cubierta estndar

16

Cubierta para agua


no potable

El uso inteligente del agua.

Cuerpos de aspersores

www.rainbird.com/sprays

Serie UNI-Spray

Serie UNI-Spray

Modelos*
t64 DN
EFBMUVSBEFMWTUBHPSFUSDUJM

Q La junta limpiadora activada por presin evita tanto la prdida excesiva


como el desperdicio del agua. Evita que la suciedad ingrese con la
retraccin
Q El trinquete de vstago duradero permite una fcil y rpida alineacin del
patrn de la boquilla
Q La cubierta y el cuerpo resistentes brindan durabilidad en condiciones de
presin alta y sobrecarga

t647"/DPOWTUBHPSFUSDUJMEFEFBMUVSB DN
DPO7"/
t647"/DPOWTUBHPSFUSDUJMEFEFBMUVSB DN
DPO7"/

Cuerpos de
aspersores

2", 4" (5.1 cm, 10.2 cm)

t647"/DPOWTUBHPSFUSDUJMEFEFBMUVSB DN
DPO7"/
t647"/DPOWTUBHPSFUSDUJMEFEFBMUVSB DN
DPO7"/
t647"/DPOWTUBHPSFUSDUJMEFEFBMUVSB DN
DPO7"/
t647"/DPOWTUBHPSFUSDUJMEFEFBMUVSB DN
DPO7"/
t7MWVMBEFSFUFODJO644".6/*4QSBZJOTUBMBEBFOFMDBNQP
* UNI-Spray admite todas las boquillas Rain Bird

Caractersticas
t-BQFRVFBDVCJFSUBFYQVFTUBIBDFRVFMBVOJEBETFBQSDUJDBNFOUFJOWJTJCMF
y que el paisaje sea ms atractivo
t6/*4QSBZBENJUFUPEBTMBTCPRVJMMBTZBDDFTPSJPT3BJO#JSE,
lo que simplifica la administracin del inventario
- La malla y la boquilla VAN se pueden quitar fcilmente para limpiar
t-BTQJF[BTJOUFSOBTTFQVFEFOEFTNPOUBSEFTEFMBQBSUFTVQFSJPSEFMBTQFSTPS
para repararlas fcilmente
t-BWMWVMBEFSFUFODJOPQDJPOBMJOTUBMBCMFFOFMDBNQP4FBM".BUJD evita
el drenaje de los aspersores bajos de hasta 5 pies (1.5 m) de desnivel
t-PTNBUFSJBMFTEFQMTUJDPZBDFSPJOPYJEBCMFSFTJTUFOMBDPSSPTJO

Rango operativo (correspondiente a las opciones de boquilla


preinstalada)

Tornillo de reduccin del radio


Arco variable removible
boquilla y malla (VAN)

t&TQBDJBNJFOUP
- Serie 10 VAN: de 8 a 10 pies (de 2.4 a 3.0 m)
- Serie 12 VAN: de 10 a 12 pies (de 3.0 a 3.7 m)

Activada a presin,
junta limpiadora multifuncin

- Serie 15 VAN: de 12 a 15 pies (de 3.7 a 4.6 m)


- Serie 18 VAN VAN: de 14 a 18 pies (de 4.3 a 5.5 m)
t1SFTJOEFBQTJ EFBCBSFT

t1SFTJOQUJNBQTJ CBSFT

t3BOHPEFBSDPEFMBCPRVJMMBBKVTUBCMF

Tapa y cuerpo
de ABS
resistente

Especificaciones
t1SEJEBEFBHVBBQTJ CBSFT
PNT
de lo contrario 0.20 gpm (0.04 m3/h; 0.60 l/m)

Dimensiones
t 12&OUSBEBIFNCSBSPTDBEB/15 

t"MUVSBEFMDVFSQP
3

- US-200: 3 4" (9.5 cm)


- US-400: 5 78" (14.9 cm)
t%JNFUSPEFMBTVQFSGJDJFFYQVFTUB14" (3.2 cm)

Resorte retrctil fuerte de


acero inoxidable

UNI-Spray
Vlvula de retencin Seal-AMatic (US-SAM) opcional
Mecanismo de trinquete
de dos piezas

Cmo especificar
US - 4 - 15VAN
Serie de boquilla/patrn
Boquilla VAN con arco variable

Boquillas de arco variable


(10, 12, 15 o 18 pies)
se pueden encargar
preinstaladas

Cuerpo
2" (5.1 cm)
4" (10.2 cm)
Modelo
UNI-Spray

La junta limpiadora activada por presin reduce la prdida de agua durante el funcionamiento.

El uso inteligente del agua.

17

Cuerpos de aspersores
Accesorios de los aspersores

Cuerpos de
aspersores

Tapa 1800 NP

1800-EXT

PA-80

5BQBEFBTQFSTPSQBSBBHVB
no potable

Extensin de plstico

Adaptador de plstico

Caractersticas

Caractersticas

Caractersticas

t&TUSVDUVSBUFSNPQMTUJDBSFTJTUFOUFBMPTSBZPT
ultravioleta y de larga duracin

t"EBQUBMPTDVFSQPTEFBTQFSTPSFT
Rain Bird para utilizar los con
cualquier boquilla aspersora o
CVSCVKFBEPS'15EF DN

(15/21)

t%JTFBEBQBSBRVFMBTUBQBTEF
los cuerpos deaspersores de la
Serie 1800 tengan una excelente
retencin

t$BCFOFOUPEBTMBTCPRVJMMBTZMPTDVFSQPTEF
aspersores Rain Bird. Excepcin: No se pueden utilizar
con burbujeadores

t5BQBWJPMFUBEFQMTUJDPQBSB
identificar fcilmente un sistema
de agua
no potable

t&TUSVDUVSBUFSNPQMTUJDBGVFSUF 
resistente a los rayos ultravioleta

t4FJOTUBMBGDJMNFOUFTJOIFSSBNJFOUBT
t4FQVFEFSFJOTUBMBSTJOEBBSMBTSPTDBTTJ
accidentalmente deja de funcionar la tubera de
elevacin o el aspersor

t.BSDBEBDPOMBBEWFSUFODJB%P
/PU%SJOL `/PCFCB
FTDSJUBFO
ingls y en espaol.

t'DJMEFJOTUBMBSTJOOFDFTJEBEEF
herramientas

Dimensiones

t$BOUJEBENYJNBSFDPNFOEBEBEPTFYUFOTJPOFTQPS
cuerpo de aspersores

t4FQVFEFBKVTUBSBUPEBTMBTUBQBT
de los cuerpos de aspersores de la
Serie 1800

Modelo

t"MUVSB12" (3.8 cm); 0.8" (2.0 cm)


por encima de la cubierta 1800

t&95

Modelo
t1"

Modelo
t/1$"1

1800-EXT

PA-80

1800-NPCAP

PA-8S

PA-8S-NP

Adaptador de plstico para arbustos

Adaptador de plstico para arbustos para agua no potable

Caractersticas

Caractersticas
t"EBQUBCPRVJMMBT3BJO#JSEQBSBVUJMJ[BSDPOUVCFSBTEFFMFWBDJOSPTDBEBT
.1512" (15/21)
t"ENJUFNBMMBEFGJMUSPQSPUFDUPSBQSVFCBEFPCTUSVDDJPOFT4FSJF TF
enva con boquilla) y mallas de la Serie PCS
t&TUSVDUVSBEFQMTUJDPEVSBEFSBZOPDPSSPTJWB

Especificaciones

t"EBQUBEPSEFQMTUJDPWJPMFUBQBSBBSCVTUPTQBSBJEFOUJGJDBSGDJMNFOUFVOTJTUFNB
de agua
no potable
t
"EBQUBCPRVJMMBT3BJO#JSEQBSBVUJMJ[BSDPOUVCFSBTEFFMFWBDJO
SPTDBEBT.1512" (15/21)
t"ENJUFNBMMBEFGJMUSPQSPUFDUPSBQSVFCBEFPCTUSVDDJPOFT4FSJF TFFOWBDPO
boquilla) y mallas de la Serie PCS

t 12" entrada hembra roscada (15/21)

t&TUSVDUVSBEFQMTUJDPEVSBEFSBZOPDPSSPTJWB

t-BTSPTDBTTVQFSJPSFTGJOBTBENJUFOUPEBTMBTCPRVJMMBT3BJO#JSE

Especificaciones

Modelo

t 12" entrada hembra roscada (15/21)


t-BTSPTDBTTVQFSJPSFTGJOBTBENJUFOUPEBTMBTCPRVJMMBT3BJO#JSE

t1"4

Modelo
t1"4/1

PA-8S

18

PA-8S-NP

El uso inteligente del agua.

Cuerpos de aspersores

PA-8S-PRS

1800 PCS

Adaptador para arbustos con regulacin de presin

Mallas de compensacin de presin

Caractersticas

Q $PNQFOTB MBTWBSJBDJPOFTEFQSFTJO

t"EBQUBCPRVJMMBTQBSBVUJMJ[BSDPOUVCFSBTEFFMFWBDJOSPTDBEBT.1512"
(15/21)

Q Elimina la neblina y el desperdicio de agua causados por presiones altas

t3FHVMBEPSEFQSFTJO134QBUFOUBEPJODPSQPSBEPFOFMWTUBHP4JOQJF[BT
que instalar en el lugar. Ahorra tiempo y dinero

Q Las boquillas se pueden combinar con determinadas mallas para lograr un


alcance corto, patrones de radio reducido o burbujeadores montados al ras

- Mantiene la presin de salida constante en 30 psi (2.1 bares). Asegura el


rendimiento mximo del aspersor y la boquilla
 5FSNJOBDPOFMWBIPZMBOFCMJOBDBVTBEPTQPSMBBMUBQSFTJO&WJUBFM
desperdicio de agua y minimiza la responsabilidad
- Restringe la prdida de agua hasta en un 70% si la boquilla se sale o se
daa. Ahorra agua y dinero. Reduce la responsabilidad. Recomendado para
zonas afectadas por el vandalismo
t$BCFFOUPEBTMBTCPRVJMMBTEFQMTUJDP3BJO#JSE
t-BFTUSVDUVSBUFSNPQMTUJDBGVFSUFSFTJTUFMPTSBZPTVMUSBWJPMFUB
t(BSBOUBDPNFSDJBMEFDJODPBPT

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

t$BVEBMEFBHQN EFBN3h; de 0.06 a 15.0 l/m)

Caractersticas
t-BNBMMBEFHQN N3/h; 1.2 l/m) permite una mayor flexibilidad para
lograr patrones de radio de 6', y 7' (1.8 m, 2.1 m)
t$PEJGJDBEBTQPSDPMPSQBSBGBDJMJUBSTVJEFOUJGJDBDJO
tTFMBTDPOUPEBTMBTCPRVJMMBTEFQMTUJDPEFMB4FSJF .13 7"/ 4FSJF6
Strip y Burbujeadores)
t4FJOTUBMBGDJMNFOUFFOBQMJDBDJPOFTOVFWBTZSFUSPBEBQUBEBT4JNQMFNFOUF
cambie la malla estndar por la malla PCS
* Con un compensador de presin, la presin de salida se reducir, pero fluctuar a medida que
cambie la presin de entrada. Un compensador de presin no puede mantener la presin de salida a
un ndice constante. Un regulador de presin establece y mantiene una presin de salida constante de
30 psi (2.1 bares) siempre que la presin de entrada del aspersor sea mayor que 30 psi (2.1 bares)

Rango operativo
t$BVEBMEFBHQN EFBN3h; de 36 a 3.6 l/m)
t1SFTJOEFBQTJ EFBCBSFT

Especificaciones
t 12" entrada hembra roscada (15/21)
t-BTSPTDBTTVQFSJPSFTGJOBTBENJUFOUPEBTMBTCPRVJMMBT3BJO#JSE

Modelos
t1$4HQN N3/h; 0.6 l/m) - Marrn
t1$4HQN N3/h; 1.2 l/m) - Rosa

t"MUVSB 4" (13.3 cm)

t1$4HQN N3/h; 0.6 l/m) - Plateado

Modelo

t1$4HQN N3/h; 1.8 l/m) - Anaranjado

t1"4134

t1$4HQN N3/h; 2.4 l/m) - Negro


t1$4HQN N3/h; 3.6 l/m) - Blanco

Se recomienda combinar boquilla + PCS para lograr radios


de 4', 6' y 7' *
Boquilla

PCS

pie

metro

2'-5
2'-5
)'-5
)'-5
''-5
''-5

3PTB
OFHSP
3PTB
1MBUFBEP
OFHSP
#MBODP

h
h
h
h
h
h













Nota: Los datos de reduccin del radio fueron probados a 30 psi (1.5 bares). Los resultados
individuales pueden variar segn las condiciones del lugar

PA-8S-PRS
Mallas 1800 PCS

El uso inteligente del agua.

19

Cuerpos de
aspersores

www.rainbird.com/sprays

Accesorios para aspersores, mallas 1800 PCS

Cuerpos de aspersores
Mallas 1800 PCS

Rendimiento de 1800 PCS

VAN

Serie U

Cuerpos de
aspersores

Caudal (gpm)
m3/h (l/m)
Color
Distancia

62
65
U-8H
6'
62
65
U-10H
6'
62
65
U-12H
655
652
6'
62
65
U-15H
655
652
6'
 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

PCS-020
0.2
0.05 (60)
Marrn
pies
metros

6
4
4

(1.8)
(1.2)
(1.2)

7
5
5

(2.1)
(1.5)
(1.5)

5
4

(1.5)
(1.2)

6
4

(1.8)
(1.2)

2'

(0.6)

4
2

3'

1'

3'

La fuente negrita de color


verde indica la combinacin
de boquilla y malla
recomendada para lograr el
rendimiento del catlogo en
30 psi (2.1 bares)

20

PCS-025
0.25
0.06 (72)
Rosa
pies
metros

(1.2)
(0.6)

(0.9)

(0.3)
1'

(0.3)

2'

(0.6)

(0.9)

La fuente negrita de color azul


indica una combinacin de
boquilla y malla satisfactoria

PCS-030
0.3
0.07 (84)
Plateado
pies
metros

PCS-040
0.4
0.09 (108)
Anaranjado
pies
metros

1
10'
8
5

(0.3)
(3.1)
(2.4)
(1.5)

(0.9)

10'
6

(3.1)
(1.8)

7'
6'
3'

(2.1)
(1.8)
(0.9)

12'
8'
4'

(3.7)
(2.4)
(1.2)

6'

(1.8)

3'
11'

(0.9)
(3.4)

2'

(0.6)

3'

(0.9)

3'
2'
1'
1'
3'
2'
0.5'
0.5'
1'
0.5'

(0.9)
(0.6)
(0.3)
(0.3)
(0.9)
(0.6)
(0.2)
(0.2)
(0.3)
(0.2)

3'

(0.9)

4'
3'
2'
2'
6'
4'
1'
1'
3'
2'
0.5'
0.5'
5'
1'
1'
1'
10'
2'
1'
1'
5'
3'

(1.2)
(0.9)
(0.6)
(0.6)
(1.8)
(1.2)
(0.3)
(0.3)
(0.9)
(0.6)
(0.2)
(0.2)
(1.5)
(0.3)
(0.3)
(0.3)
(3.1)
(0.6)
(0.3)
(0.3)
(1.5)
(0.9)

2'
1'
0.5'
0.5'

(0.6)
(0.3)
(0.2)
(0.2)

0.5'
8'
1'
0.5'

(0.2)
(2.4)
(0.3)
(0.2)

2'
1'

(0.6)
(0.3)

0.5'

(0.2)

El color negro indica una combinacin


de boquilla y malla que proporciona una
reduccin de alcance de ms del 50 %. Con
estas combinaciones de boquilla y malla no se
garantiza un patrn de rociado uniforme, lo
que puede producir un efecto de burbuja

PCS-060
0.6
0.14 (144)
negro
pies
metros

(2.1)

8
4

(2.4)
(1.2)

12'
7'
6'
5'
6'
15'
10'
5'

(3.7)
(2.1)
(1.8)
(1.5)
(1.8)
(4.6)
(3.1)
(1.5)

4'

(1.2)

4'
4'
4'

(1.2)
(1.2)
(1.2)

6'
3'
3'
8'
4'
3'
3'
10'
5'
4'
4'
12'
5'
3'
3'
11'
6'

(1.8)
(0.9)
(0.9)
(2.4)
(1.2)
(0.9)
(0.9)
(3.1)
(1.5)
(1.2)
(1.2)
(3.7)
(1.5)
(0.9)
(0.9)
(3.4)
(1.8)

6'
3'
1'
1'

(1.8)
(0.9)
(0.3)
(0.3)

PCS-090
0.9
0.20 (216)
Blanco
pies
metros

9
9

(2.7)
(2.7)

11'
9'
8'
8'

(3.4)
(2.7)
(2.4)
(2.4)

13'
9'

(4.0)
(2.7)

6'

(1.8)

6'
6'

(1.8)
(1.8)

8'
5'
5'

(2.4)
(1.5)
(1.5)

7'
6'
6'

(2.1)
(1.8)
(1.8)

8'
6'
5'
15'
9'
6'

(2.4)
(1.8)
(1.5)
(4.6)
(2.7)
(1.8)

12'
5'
3'
3'

(3.7)
(1.5)
(0.9)
(0.9)

Nota: Las mallas se probaron a 50 psi (3.5 bares) durante 10 minutos antes de tomar
las mediciones de distancia. Las distancias pueden variar levemente con presiones ms
altas y tiempos de riego ms largos
Nota: Consulte las notaciones del catlogo para seleccionar la boquilla adecuada

El uso inteligente del agua.

Cuerpos de aspersores

www.rainbird.com/sprays

Mallas 1800 PCS

Strip

Burbujeador

MPR

Caudal (gpm)
m3/h (l/m)
Color
Distancia

2
5
5H
'
2
5
8H
'
2
5
10H
'
2
5
12H
55
52
'
2
5
15H
55
52
'
2#
5H-B
'#
$45#
445
$45
445
&45
15LCS
15RCS

PCS-020
0.2
0.05 (60)
Marrn
pies
metros

PCS-025
0.25
0.06 (72)
Rosa
pies
metros

5'

(1.5)

6'

(1.8)

8'
6'
5'

(2.4)
(1.8)
(1.5)

10'
6.5'
6'

(3.1)
(2.0)
(1.8)

6'
4'
3'

(1.8)
(1.2)
(0.9)

8'
5'
4'

(2.4)
(1.5)
(1.2)

3'
2'

(0.9)
(0.6)

7'
4'

3'

(0.9)

2'

(0.6)

1'

1' x 5'
1' x 5'

La fuente negrita de color


verde indica la combinacin
de boquilla y malla
recomendada para lograr el
rendimiento del catlogo en
30 psi (2.1 bares)

(0.3)

(0.3 x 1.5)
(0.3 x 1.5)

5'

(1.5)

7'
7'
2'
8'
9'
6'

(2.1)
(2.1)
(0.6)
(2.4)
(2.7)
(1.8)

(2.1)
(1.2)

8'
6'
4'
2'
2'

(2.4)
(1.8)
(1.2)
(0.6)
(0.6)

4'
2'

(1.2)
(0.6)

5'
5'
3'
1'

(1.5)
(1.5)
(0.9)
(0.3)

(0.9)

4'
1'

(1.2)
(0.3)

3'

(0.9)

1' x 7'
1' x 7'

La fuente negrita de color azul


indica una combinacin de
boquilla y malla satisfactoria

El uso inteligente del agua.

PCS-030
0.3
0.07 (84)
Plateado
pies
metros

(0.6)

(0.3 x 2.1)
(0.3 x 2.1)

3' x 12'
1' x 12'
1' x 12'

(0.9 x 3.7)
(0.3 x 3.7)
(0.3 x 3.7)

El color negro indica una combinacin


de boquilla y malla que proporciona una
reduccin de alcance de ms del 50 %. Con
estas combinaciones de boquilla y malla no se
garantiza un patrn de rociado uniforme, lo
que puede producir un efecto de burbuja

PCS-040
0.4
0.09 (108)
Anaranjado
pies
metros

8'
8'
3'
10'
10'
8'
1'
11'
10'
6'
4'
3'
2'
9'
7'
4'
2'

(2.4)
(2.4)
(0.9)
(3.1)
(3.1)
(2.4)
(0.3)
(3.4)
(3.1)
(1.8)
(1.2)
(0.9)
(0.6)
(2.7)
(2.1)
(1.2)
(0.6)

5'
2'
1'
5'

(1.5)
(0.6)
(0.3)
(1.5)

4' x 12'
2' x 10'
4' x 15'

(1.2 x 3.7)
(0.6 x 3.1)
(1.2 x 4.6)

PCS-060
0.6
0.14 (144)
negro
pies
metros

8'

(2.4)

10'
4'
12'
11'
10'
6'
6'
5'
12'
12'
7'
4'

(3.1)
(1.2)
(3.7)
(3.4)
(3.1)
(1.8)
(1.8)
(1.5)
(3.7)
(3.7)
(2.1)
(1.2)

5'
2'
4' x 24'
3' x 20'

PCS-090
0.9
0.20 (216)
Blanco
pies
metros

8'

(2.4)

12'
12'
9'
8'
7'
15'
14'
11'
8'
6'
4'

(3.7)
(3.7)
(2.7)
(2.4)
(2.1)
(4.6)
(4.3)
(3.4)
(2.4)
(1.8)
(1.2)

(1.5)
(0.6)

3'

(0.9)

(1.2 x 7.3)
(0.9 x 6.1)

7' x 12'
4' x 30'
4' x 26'

(2.1 x 3.7)
(1.2 x 9.1)
(1.2 x 7.9)

Nota: Las mallas se probaron a 50 psi (3.5 bares) durante 10 minutos antes de tomar
las mediciones de distancia. Las distancias pueden variar levemente con presiones ms
altas y tiempos de riego ms largos
Nota: Consulte las notaciones del catlogo para seleccionar la boquilla adecuada

21

Cuerpos de
aspersores

Rendimiento de 1800 PCS

Boquillas aspersoras
Introduccin
Cuerpos de
aspersores
Boquillas aspersoras
Rotores
Impactos
Vlvulas

La boquilla VAN es una compra estupenda.


Esta boquilla de Rain Bird se puede ajustar
completamente y se puede utilizar en
cualquier jardn con formas irregulares.
Marco Antonio Barocio,
Equipos y sistemas de irrigacin,
Guadalajara, Mxico

Accesorios

Productos principales
Programadores

Aplicaciones primarias

Sistemas de control
centralizado

Csped

MPR
Estndar
O

Aspersores fijos de ARCO


Boquillas SQ
Serie U
Estndar
Mejor
O

Aspersores variables de ARCO


VAN
HE-VAN
Estndar
Lo mejor
O

Pendientes
reas angostas

Boquillas rotativas
Rotativa
R-VAN
Estndar
Lo mejor
O

O
O

reas pequeas

Altamente eficiente

Viento excesivo

Canteros en paisajes

Xerigation

Alta presin
Bombas

Sugerencias para ahorrar agua


Drenaje

t Las boquillas Serie U son boquillas de

Recursos

doble orificio que realizan una mejor y


ms uniforme distribucin del agua. El
agua que sale de ambos orificios se
combina para formar un caudal de agua
continuo y elimina las zonas sin regar. As
se obtiene una cobertura ms uniforme
en toda el rea de riego.

Referencia

22

t Las boquillas HE-VAN son completamente


ajustables de 0 a 360 grados con una alta
uniformidad y eficiencia. Las boquillas HE-VAN
pueden reducir la cantidad de variaciones que
pueden ocurrir en casi cualquier tipo de
TJUVBDJOPSFUPFOFMUFSSFOP%JTQPOJCMFTFO
radios de 8 a 15, esta boquillas son altamente
eficientes y de mxima cobertura.

t Las boquillas rotativas proporcionan


una distribucin eficaz del agua a travs
de caudales rotativos que suministran el
agua de manera uniforme a un bajo
ndice de precipitacin, lo cual reduce
significativamente el escurrimiento y la
erosin.

El uso inteligente del agua.

Boquillas aspersoras

www.rainbird.com/sprays

Boquillas MPR

Boquillas plsticas MPR


Boquillas con rangos de precipitacin igualados
Q 5 PEPTMPTNPEFMPTEFMBTTFSJFT   ZDPOTVTEJGFSFOUFTPQDJPOFT
de distancia y patrones de riego incluyen rangos de precipitacion igualados
(MPR) para proporcionar una distribucin ms uniforme y flexibilidad en el
diseo.
Boquillas aspersoras

Q Las boquillas de la Serie 5 renen todos los requisitos para csped o arbustos
en reas pequeas
Q Las boquillas de la Serie 8 ahora cuentan con un caudal de agua ms bajo que
permite que haya ms aspersores por zona

Caractersticas
t-BTNBMMBTEFGJMUSPCMBODBTEFMB4FSJFEFwYw NNY
mm), que se envan junto con las boquillas, mantienen un ajuste del radio
exacto e impiden las obstrucciones(Las boquillas de las Series 5 y 8 se envan
con filtros de malla fina azul de 0.02" x 0.02" [0.5 mm x 0.5 mm])

Boquilla y malla MPR

t5PSOJMMPEFBKVTUFEFBDFSPJOPYJEBCMFQBSBBKVTUBSFMDBVEBMZFMSBEJP

Rango operativo
t&TQBDJBNJFOUPEFBQJFT EFBN

t1SFTJOEFBQTJ EFBCBSFT

t1SFTJOQUJNBQTJ CBSFT

* Rain Bird recomienda usar cuerpos de aspersores 1800 PRS para mantener un rendimiento ptimo de la
boquilla en situaciones de presin ms alta

Modelos
t4FSJF
t4FSJF#PRVJMMBTCVSCVKFBEPSBT
t4FSJF
t4FSJF'-5%JTFBEBQBSBBQMJDBDJPOFTEFUSBZFDUPSJBNTCBKB UBMFTDPNP
reas con viento
t4FSJF
t4FSJF
t4FSJF
t4FSJF4USJQ

Boquillas MPR de Rain Bird, el


estndar de la industria

Paquete de boquillas de sellado reutilizable


Caractersticas
t$NPEBTCPMTBTEFTFMMBEPSFVUJMJ[BCMF
t4FMMPEFTFHVSJEBE
t0SJGJDJPTQBSBDPMHBSZFYIJCJSGDJMNFOUF

Paquete de boquillas de
sellado reutilizable

El uso inteligente del agua.

23

Boquillas aspersoras
Boquillas MPR

Serie 5 MPR

Serie 5 MPR

Boquillas aspersoras

Trayectoria de 5 
Boquilla
Presin
psi
5F
15
20
25
30
5H
15
20
25
30
5Q
15
20
25
30


Radio
pies
3
4
4
5
3
4
4
5
3
4
4
5


Caudal
gpm
0.29
0.33
0.37
0.41
0.14
0.16
0.18
0.20
0.07
0.08
0.09
0.10

Q
Precip.
pulg./h
3.10
1.99
2.23
1.58
3.00
1.93
2.17
1.54
3.00
1.93
2.17
1.54

V
Precip.
pulg./h
3.58
2.29
2.57
1.83
3.46
2.22
2.50
1.78
3.46
2.22
2.50
1.78

Serie 8 MPR
Trayectoria de 10 
Boquilla
Presin
psi
8F
15
20
25
30
8H
15
20
25
30
8T
15
20
25
30
8Q
15
20
25
30

Trayectoria de 5 
Boquilla
Presin
bares
5F
1.0
1.5
2.0
2.1
5H
1.0
1.5
2.0
2.1
5Q
1.0
1.5
2.0
2.1

SIST. MTRICO

Radio
m
1.1
1.3
1.5
1.5
1.1
1.3
1.5
1.5
1.1
1.3
1.5
1.5

Serie 8 MPR

Radio
pies
5
6
7
8
5
6
7
8
5
6
7
8
5
6
7
8


Caudal
gpm
0.74
0.86
0.96
1.05
0.37
0.42
0.47
0.52
0.25
0.29
0.32
0.35
0.18
0.21
0.24
0.26

Q
Precip.
pulg./h
2.85
2.30
1.89
1.58
2.85
2.25
1.85
1.56
2.89
2.33
1.89
1.58
2.77
2.25
1.89
1.56

V
Precip.
pulg./h
3.29
2.66
2.18
1.82
3.29
2.59
2.13
1.81
3.34
2.69
2.18
1.82
3.20
2.59
2.18
1.81

Trayectoria de 10
Boquilla
Presin
bares
8F
1.0
1.5
2.0
2.1
8H
1.0
1.5
2.0
2.1
8T
1.0
1.5
2.0
2.1
8Q
1.0
1.5
2.0
2.1



Caudal Caudal
m3h l/m
0.06 1.1
0.08 1.4
0.09 1.6
0.09 1.6
0.03 0.5
0.04 0.7
0.04 0.7
0.05 0.9
0.02 0.4
0.02 0.4
0.02 0.4
0.02 0.4

Q
Precip.
mm/h
79
51
57
40
76
49
55
39
76
49
55
39

V
Precip.
mm/h
91
58
65
46
88
56
64
45
88
56
64
45

SIST. MTRICO

Radio
m
1.7
2.1
2.4
2.4
1.7
2.1
2.4
2.4
1.7
2.1
2.4
2.4
1.7
2.1
2.4
2.4



Caudal Caudal
m3h l/m
0.16 2.8
0.20 3.4
0.23 3.9
0.24 4.0
0.08 1.4
0.10 1.7
0.12 1.9
0.12 2.0
0.05 1.0
0.07 1.1
0.08 1.3
0.08 1.3
0.04 0.7
0.05 0.8
0.06 1.0
0.06 1.0

Q
Precip.
mm/h
72
58
48
40
72
57
47
40
73
59
48
40
70
57
48
40

V
Precip.
mm/h
84
68
55
46
84
66
54
46
85
68
55
46
81
66
55
46

Nota: Todas las boquillas MPR se probaron con vstagos retrctiles de 4" (10.2 cm)

Nota: Especifique el cuerpo del aspersor y las boquillas por separado.

Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.

Nota: No se recomienda una reduccin del radio que supere el 25% del alcance normal de la
boquilla

VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro


Los datos de rendimiento se tomaron en condiciones de cero viento.

24

El uso inteligente del agua.

Boquillas aspersoras

www.rainbird.com/sprays

Serie 10 MPR
Trayectoria de 15 
Boquilla
Presin
psi
10F
15
20
25
30
10F
15
20
25
30
10T
15
20
25
30
10Q
15
20
25
30

Serie 10 MPR

Radio
pies
7
8
9
10
7
8
9
10
7
8
9
10
7
8
9
10


Caudal
gpm
1.16
1.30
1.44
1.58
0.58
0.65
0.72
0.79
0.39
0.43
0.48
0.53
0.29
0.33
0.36
0.39

Q
Precip.
pulg./h
2.28
1.96
1.71
1.52
2.28
1.96
1.71
1.52
2.28
1.96
1.71
1.52
2.28
1.96
1.71
1.52

V
Precip.
pulg./h
2.63
2.26
1.98
1.75
2.63
2.26
1.98
1.75
2.63
2.26
1.98
1.75
2.63
2.26
1.98
1.75

Serie 12 MPR
Trayectoria de 30 
Boquilla
Presin
psi
12F
15
20
25
30
12TQ
15
20
25
30
12H
15
20
25
30
12T
15
20
25
30
12Q
15
20
25
30

Trayectoria de 15
Boquilla
Presin
bares
10F
1.0
1.5
2.0
2.1
10F
1.0
1.5
2.0
2.1
10T
1.0
1.5
2.0
2.1
10Q
1.0
1.5
2.0
2.1

SIST. MTRICO

Radio
m
2.1
2.4
3.0
3.1
2.1
2.4
3.0
3.1
2.1
2.4
3.0
3.1
2.1
2.4
3.0
3.1

Serie 12 MPR

Radio
pies
9
10
11
12
9
10
11
12
9
10
11
12
9
10
11
12
9
10
11
12


Caudal
gpm
1.80
2.10
2.40
2.60
1.35
1.58
1.80
1.95
0.90
1.05
1.20
1.30
0.60
0.70
0.80
0.87
0.45
0.53
0.60
0.65

Q
Precip.
pulg./h
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74

V
Precip.
pulg./h
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01

Trayectoria de 30
Boquilla
Presin
bares
12F
1.0
1.5
2.0
2.1
12TQ
1.0
1.5
2.0
2.1
12H
1.0
1.5
2.0
2.1
12T
1.0
1.5
2.0
2.1
12Q
1.0
1.5
2.0
2.1



Caudal Caudal
m3h l/m
0.26 4.2
0.29 4.8
0.35 6.0
0.36 6.0
0.13 2.4
0.14 2.4
0.18 3.0
0.18 3.0
0.09 1.2
0.10 1.8
0.12 1.8
0.12 1.8
0.06 1.2
0.07 1.2
0.09 1.2
0.09 1.2

Q
Precip.
mm/h
58
50
39
37
58
50
39
37
58
50
39
37
58
50
39
37

V
Precip.
mm/h
67
58
45
43
67
58
45
43
67
58
45
43
67
58
45
43

SIST. MTRICO

Radio
m
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7



Caudal Caudal
m3h l/m
0.40 6.8
0.48 8.3
0.59 9.7
0.60 9.8
0.30 5.1
0.36 6.3
0.45 7.3
0.45 7.4
0.20 3.4
0.24 4.2
0.30 4.9
0.30 4.9
0.13 2.3
0.16 2.8
0.20 3.2
0.20 3.3
0.10 1.7
0.12 2.1
0.15 2.4
0.15 2.5

Q
Precip.
mm/h
55
47
46
44
55
47
46
44
55
47
46
44
55
47
46
44
55
47
46
44

V
Precip.
mm/h
63
54
53
51
63
54
53
51
63
54
53
51
63
54
53
51
63
54
53
51

Nota: Todas las boquillas MPR se probaron con vstagos retrctiles de 4" (10.2 cm)
Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Los datos de rendimiento se tomaron en condiciones de cero viento.

El uso inteligente del agua.

25

Boquillas aspersoras

Boquillas MPR

Boquillas aspersoras
Boquillas MPR

Serie 15 MPR

Boquillas aspersoras

Trayectoria de 30 
Boquilla
Presin
psi
15F
15
20
25
30
15TQ
15
20
25
30
15H
15
20
25
30
15T
15
20
25
30
15Q
15
20
25
30

Serie 15 MPR

Radio
pies
11
12
14
15
11
12
14
15
11
12
14
15
11
12
14
15
11
12
14
15


Caudal
gpm
2.60
3.00
3.30
3.70
1.95
2.25
2.48
2.78
1.30
1.50
1.65
1.85
0.87
1.00
1.10
1.23
0.65
0.75
0.82
0.92

Q
Precip.
pulg./h
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58

V
Precip.
pulg./h
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83

Trayectoria de 30
Boquilla
Presin
bares
15F
1.0
1.5
2.0
2.1
15TQ
1.0
1.5
2.0
2.1
15H
1.0
1.5
2.0
2.1
15T
1.0
1.5
2.0
2.1
15Q
1.0
1.5
2.0
2.1

SIST. MTRICO

Radio
m
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6



Caudal Caudal
m3h l/m
0.60 9.8
0.72 11.8
0.84 13.7
0.84 14.0
0.45 7.4
0.54 8.8
0.63 10.3
0.63 10.5
0.30 4.9
0.36 5.9
0.42 6.8
0.42 7.0
0.20 3.3
0.24 3.9
0.28 4.6
0.28 4.7
0.15 2.5
0.18 2.9
0.21 3.4
0.21 3.5

Q
Precip.
mm/h
52
47
41
40
52
47
41
40
52
47
41
40
52
47
41
40
52
47
41
40

V
Precip.
mm/h
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46

Nota: Todas las boquillas MPR se probaron con vstagos retrctiles de 4" (10.2 cm)

Nota: Especifique el cuerpo del aspersor y las boquillas por separado.

Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.

Nota: No se recomienda una reduccin del radio que supere el 25% del alcance normal de la
boquilla

VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro


Los datos de rendimiento se tomaron en condiciones de cero viento.

Boquillas burbujeadoras MPR Serie 5


Trayectoria de 0
Boquilla
Presin
psi
5F-B
15
20
25
30
5H-B
15
20
25
30
5Q-B
15
20
25
30
5CST-B
15
20
25
30

Radio
pies
5
5
5
5
5
5
5
5
5
5
5
5
5
5
5
5

Boquillas burbujeadoras MPR Serie 5


Caudal
gpm
1.50
1.50
1.50
1.50
1.00
1.00
1.00
1.00
0.50
0.50
0.50
0.50
0.50
0.50
0.50
0.50

Trayectoria de 0
Boquilla
Presin
bares
5F-B
1.0
1.5
2.0
2.1
5H-B
1.0
1.5
2.0
2.1
5Q-B
1.0
1.5
2.0
2.1
5CST-B
1.0
1.5
2.0
2.1

Radio
m
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5

SIST. MTRICO
Caudal
m3h
0.35
0.35
0.35
0.35
0.23
0.23
0.23
0.23
0.12
0.12
0.12
0.12
0.12
0.12
0.12
0.12

Caudal
l/m
5.7
5.7
5.7
5.7
3.8
3.8
3.8
3.8
1.9
1.9
1.9
1.9
1.9
1.9
1.9
1.9

Nota: Indica radio ajustado a las psi mostradas


Nota: Caudal en el radio ajustado de 5 pies (1.5 m)

26

El uso inteligente del agua.

Boquillas aspersoras

www.rainbird.com/sprays

Serie 15 Strip

Serie 15 Strip

Trayectoria de 30
Boquilla
Presin
psi
15EST
15
20
25
30
15CST
15
20
25
30
15RCS
15
20
25
30
15LCS
15
20
25
30
15SST
15
20
25
30
9SST
15
20
25
30

ancho x largo
pies
4 x 13
4 x 14
4 x 14
4 x 15
4 x 26
4 x 28
4 x 28
4 x 30
3 x 11
3 x 12
4 x 14
4 x 15
3 x 11
3 x 12
4 x 14
4 x 15
4 x 26
4 x 28
4 x 28
4 x 30
9 x 15
9 x 16
9 x 18
9 x 18

A = Ancho del patrn de cobertura

L = Longitud del patrn de cobertura

Caudal
gpm
0.45
0.50
0.56
0.61
0.89
1.00
1.11
1.21
0.35
0.40
0.45
0.49
0.35
0.40
0.45
0.49
0.89
1.00
1.11
1.21
1.34
1.47
1.60
1.73

Trayectoria de 30
Boquilla
Presin
bares
15EST
1.0
1.5
2.0
2.1
15CST
1.0
1.5
2.0
2.1
15RCS
1.0
1.5
2.0
2.1
15LCS
1.0
1.5
2.0
2.1
15SST
1.0
1.5
2.0
2.1
9SST
1.0
1.5
2.0
2.1

SIST. MTRICO
ancho x largo
m
1.2 x 4.0
1.2 x 4.3
1.2 x 4.3
1.2 x 4.6
1.2 x 7.9
1.2 x 8.5
1.2 x 8.5
1.2 x 9.2
0.8 x 3.2
1.0 x 3.9
1.2 x 4.5
1.2 x 4.6
0.8 x 3.2
1.0 x 3.9
1.2 x 4.5
1.2 x 4.6
1.2 x 7.9
1.2 x 8.5
1.2 x 8.5
1.2 x 9.2
2.7 x 4.6
2.7 x 4.9
2.7 x 5.5
2.7 x 5.5

Caudal
m3h
0.10
0.11
0.13
0.14
0.20
0.23
0.25
0.27
0.08
0.09
0.11
0.11
0.08
0.09
0.11
0.11
0.20
0.23
0.25
0.27
0.30
0.33
0.36
0.39

Caudal
l/m
1.7
2.0
2.3
2.3
3.4
4.0
4.5
4.6
1.3
1.6
1.8
1.9
1.3
1.6
1.8
1.9
3.4
4.0
4.5
4.6
5.1
5.8
6.5
6.5

Boquillas aspersoras

Boquillas MPR

Los datos de rendimiento se tomaron en condiciones de cero viento.

Nota: Especifique el cuerpo del aspersor y las boquillas por separado.


Nota: No se recomienda una reduccin del radio que supere el 25% del alcance normal
de la boquilla

Serie 8 FLT MPR


Trayectoria de 5 
Boquilla
Presin
psi
8H-FLT
15
20
25
30
8Q-FLT
15
20
25
30

Serie 8 FLT MPR



Radio
pies
6
7
7
8
6
7
7
8


Caudal
gpm
0.56
0.65
0.72
0.79
0.28
0.32
0.36
0.39

Q
Precip.
pulg./h
3.36
2.91
2.60
2.38
3.32
2.87
2.57
2.35

V
Precip.
pulg./h
3.88
3.36
3.01
2.75
3.83
3.32
2.97
2.71

Trayectoria de 5 
Boquilla
Presin
bares
8H-FLT
1.0
1.5
2.0
2.1
8Q-FLT
1.0
1.5
2.0
2.1

SIST. MTRICO

Radio
m
1.7
2.1
2.4
2.4
1.7
2.1
2.4
2.4


Caudal
m3h
0.12
0.15
0.18
0.18
0.06
0.07
0.09
0.09


Caudal
l/m
2.1
2.6
2.9
3.0
1.1
1.3
1.4
1.5

Q
Precip.
mm/h
87
71
62
60
86
71
61
60

V
Precip.
mm/h
101
82
71
70
100
81
71
69

Nota: Todas las boquillas MPR se probaron con vstagos retrctiles de 4" (10.2 cm)

Nota: Especifique el cuerpo del aspersor y las boquillas por separado.

Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.

Nota: No se recomienda una reduccin del radio que supere el 25% del alcance normal de la
boquilla

VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro


Los datos de rendimiento se tomaron en condiciones de cero viento.

El uso inteligente del agua.

27

Boquillas aspersoras
#PRVJMMBT42

Boquillas de patrn cuadrado, serie SQ


La solucin de rociado de bajo volumen ms precisa y eficiente
para el riego de reas pequeas con plantas poco espaciadas
Q El patrn de rociado cuadrado y la compensacin de presin ofrecen
mayor eficiencia y control, y as se reducen el rociado excesivo y las
probabilidades de dao a la propiedad y situaciones riesgosas
Boquillas aspersoras

Q Las exclusivas capacidades de extremo a extremo para aplicaciones sin


csped reducen la cantidad de boquillas necesarias, lo cual disminuye los
costos y reduce el tiempo de instalacin drsticamente
Q %JTFPFJOTUBMBDJOTJNQMJGJDBEPTDPOMBGMFYJCJMJEBEEFMBTBQMJDBDJPOFT
una boquilla alcanza 2.5' 4' (0.8 m 1.2 m) y se puede utilizar en una
variedad de cuerpos de aspersores y tuberas de elevacin
Boquilla SQ instalada en la tubera
de elevacin de PolyFlex con
adaptador de boquilla

Q Cumple con los requisitos del sistema de microrriego por menos del ndice
de caudal de 26 gph (98.4 l/h) a 30 psi (2 bares)

Caractersticas
t&MQBUSOEFSPDJBEPDVBESBEPDPODPCFSUVSBEFFYUSFNPBFYUSFNPMF
permite hacer diseos e instalaciones fcilmente en espacios pequeos
t&MEJTFPEFDPNQFOTBDJOEFQSFTJOCSJOEBVODBVEBMVOJGPSNFTPCSFFM
rango de presin
t%JTQPOJCMFFONPEFMPTQBUSPOFTEFVODVBSUP NFEJPZDPNQMFUPDPO
ndice de caudal proporcional a la superficie a regar
- Rendimiento virtual que no produce neblina desde 20 psi (1.4 bares) a 50
psi (3.4 bares)

Boquillas SQ con mallas

 %PTEJTUBODJBTEFBMDBODFFODBEBCPRVJMMB$POVOTJNQMFDMJDTFBKVTUBB
2.5 o 4 (0.8 m 1.2 m)

Una boquilla... Dos alcances


Con slo girar la boquilla hacia el siguiente
QVOUPEFCMPRVFPQSFGJKBEP MBCPRVJMMB42
de Rain Bird se ajusta de un alcance de 2.5
pies (0.8 m) a un alcance de 4 pies (1.2 m). Es
como tener dos boquillas en una.

- Se envan con filtro de malla azul (0.02 x 0.02 [0.5 mm x 0.5 mm]) para
mantener una distancia de caudal precisa y evitar obstrucciones
t$PNQBUJCMFDPOUPEBTMBTUVCFSBTEFFMFWBDJO4QSBZT 9FSJ1PQT FM
OVFWPBEBQUBEPSEFUVCFSBEFFMFWBDJOEF1PMZ'MFY 6/*4QSBZZUVCFSBT
de elevacin SCH 80

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

Se puede usar con


-B#PRVJMMB42FTVOBTPMVDJOJEFBMQBSBEJWFSTBTSFBTEJGDJMFTEFEJTFBS 
gracias a su compatibilidad con los productos de riego populares.

tOEJDFTEFDBVEBM ZHQI ZMI

t'JMUSBDJOSFRVFSJEBNBMMB

Modelos
t42253#PRVJMMB42 QBUSOEFVODVBSUP
t42)-'#PRVJMMB42 QBUSOEFNFEJP
t42'6-#PRVJMMB42 QBUSODPNQMFUP
t42"%1"EBQUBEPSEFCPRVJMMB42DPOUVCFSBEFFMFWBDJOEFw 
DN
EF1PMZ'MFY
t42"%1"EBQUBEPSEFCPRVJMMB42DPOUVCFSBEFFMFWBDJOEFw 
DN
EF1PMZ'MFY
t42"%1TMPFMBEBQUBEPS42EFUVCFSBEFFMFWBDJOEF1PMZ'MFY
* Nota: se necesita un adaptador para arbustos de plstico PA-8S (consulte la pgina 18) cuando se
utiliza una boquilla serie SQ montada en una tubera de elevacin SCH 80.

Cabezales
aspersores
serie 1800

Xeri-Pop
Cuerpos de
difusores

Polyflex Programacin 80
Tuberas de
Tuberas de
elevacin
elevacin

-BTCPRVJMMBTTFSJF42CSJOEBOVOQSFDJTPQBUSOEFSJFHPDVBESBEPZVOBDPMPDBDJOFGJDB[EFMBHVBDPODPNQFOTBDJOEFQSFTJO MPRVFEBDPNP
resultado hasta un 65% en ahorro de agua. Son ideales para canteros estrechos, islas de estacionamientos y divisores de caminos, carreteras y calles.

28

El uso inteligente del agua.

Boquillas aspersoras

www.rainbird.com/sprays

#PRVJMMBT42

Rendimiento de la boquilla SQ

Rendimiento de la boquilla SQ
Alcance de 2.5 pies (0.76 m) a una altura de 6" (15.2 cm) sobre el terreno
Presin
psi

20
30
40
50
20
30
40
50
20
30
40
50

2.5
2.5
3.0
3.0
2.5
2.5
3.0
3.0
2.5
2.5
3.0
3.0

Alcance de 0.8 m a una altura de 0.15 m sobre el nivel del terreno

Caudal
gph

Caudal
gpm

ndice de precip.
sin superposicin
pulg./h

6.4
7.4
7.4
7.4
10.2
12.2
13.7
13.7
20.0
24.2
27.3
27.3

0.11
0.12
0.12
0.12
0.17
0.20
0.23
0.23
0.33
0.40
0.46
0.46

1.64
1.90
1.32
1.32
1.31
1.57
1.22
1.22
1.28
1.55
1.22
1.22

Alcance de 2.5 pies (121.92 cm) a una altura de 6" (15.2 cm) sobre el terreno
Boquilla

Presin
psi

20
30
40
50
20
30
40
50
20
30
40
50

4.0
4.0
4.5
4.5
4.0
4.0
4.5
4.5
4.0
4.0
4.5
4.5

Alcance
Presin
bares

Radio
m.

Caudal
l/h

Caudal
l/m

ndice de precip.
sin superposicin
mm/h

1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4

0.8
0.8
0.9
0.9
0.8
0.8
0.9
0.9
0.8
0.8
0.9
0.9

24
28
28
28
39
46
52
52
76
92
103
103

0.40
0.47
0.47
0.47
0.65
0.77
0.87
0.87
1.27
1.53
1.72
1.72

42
48
34
34
33
40
31
31
33
39
31
31

Rendimiento de la boquilla SQ

Rendimiento de la boquilla SQ
Alcance
Radio
pies

Boquilla

Caudal
gph

Caudal
gpm

ndice de precip.
sin superposicin
pulg./h

6.4
7.4
7.4
7.4
10.2
12.2
13.7
13.7
20.0
24.2
27.3
27.3

0.11
0.12
0.12
0.12
0.17
0.20
0.23
0.23
0.33
0.40
0.46
0.46

0.64
0.74
0.59
0.59
0.51
0.61
0.54
0.54
0.50
0.61
0.54
0.54

Boquillas aspersoras

Boquilla

Alcance
Radio
pies

SIST. MTRICO

SIST. MTRICO

Alcance de 1.2 m a una altura de 0.15 m sobre el nivel del terreno


Boquilla

Alcance
Presin
bares

Radio
m.

Caudal
l/h

Caudal
l/m

ndice de precip.
sin superposicin
mm/h

1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4

1.2
1.2
1.4
1.4
1.2
1.2
1.4
1.4
1.2
1.2
1.4
1.4

24
28
28
28
39
46
52
52
76
92
103
103

0.40
0.47
0.47
0.47
0.65
0.77
0.87
0.87
1.27
1.53
1.72
1.72

16
19
15
15
13
16
14
14
13
15
14
14

Los datos de rendimiento se tomaron en condiciones de cero viento.

Rendimiento de la boquilla SQ
Modelo de medio

SIST. MTRICO

Modelo completo
Flow Rate (gph)

Modelo de un cuarto

28
24
20
16
12
8
4
0

Full

Half
Quarter

0 10

20

30

40

Pressure (psi)

50

60

105.98
90.84
75.70
60.56
45.42
30.28
15.14
0

Full

Flow Rate (l/h)

Boquillas SQ

Half
Quarter

1.0

2.0

2.5

Pressure (bar)

3.5

4.0

5'
4'
4'

2.5'
2.5'
4'

2.5'

5'

5'

8'
8'

8'

El uso inteligente del agua.

29

Boquillas aspersoras
Boquillas Serie U

Modelos

Boquillas plsticas Serie U


Boquillas aspersoras de doble orificio que usan un 30% menos de agua

t62CPRVJMMBEFQBUSOEFVODVBSUPEFDSDVMPEFQJFT N

Q Orificio adicional para riego cercano al cabezal. Minimiza las reas secas

t65CPRVJMMBEFQBUSOEFVOUFSDJPEFDSDVMPEFQJFT N

t6)CPRVJMMBEFQBUSOTFNJDJSDVMBSEFQJFT N

alrededor de los aspersores

Q Coeficiente de la uniformidad del riego bajo para lograr un riego eficaz.

t6'CPRVJMMBEFQBUSOCPRVJMMBEFQBUSOEFDSDVMPDPNQMFUPEFQJFT N

t62CPRVJMMBEFQBUSOEFVODVBSUPEFDSDVMPEFQJFT N

Usa hasta un 30% menos de agua2


Boquillas aspersoras

Q ndice de precipitacin ajustado entre disposiciones y caudal ajustado


(gpm, m3/h and l/m) e ndices de precipitacin con boquillas MPR de
Rain Bird

t65CPRVJMMBEFQBUSOEFVOUFSDJPEFDSDVMPEFQJFT N

t6)CPRVJMMBEFQBUSOTFNJDJSDVMBSEFQJFT N

t6'CPRVJMMBEFQBUSOCPRVJMMBEFQBUSOEFDSDVMPDPNQMFUPEFQJFT N

t62CPRVJMMBEFQBUSOEFVODVBSUPEFDSDVMPEFQJFT N

Caractersticas

t65CPRVJMMBEFQBUSOEFVOUFSDJPEFDSDVMPEFQJFT N

t-B4FSJF6PGSFDFVOBGBNJMJBDPNQMFUBEFCPRVJMMBT MPDVBMCSJOEBNBZPS
flexibilidad

t6)CPRVJMMBEFQBUSOTFNJDJSDVMBSEFQJFT N

t&MGJMUSPEFNBMMBGJOBQSPUFHFFMPSJGJDJPJOGFSJPSEFMBTQBSUDVMBTEFTVDJFEBE

t655CPRVJMMBEFQBUSOEFEPTUFSDJPTEFDSDVMPEFQJFT N

t5PSOJMMPEFBKVTUFEFBDFSPJOPYJEBCMFQBSBBKVTUBSFMDBVEBMZFMSBEJP

t652CPRVJMMBEFQBUSOEFUSFTDVBSUPTEFDSDVMPEFQJFT N

t(BSBOUBDPNFSDJBMEFDJODPBPT

t6'CPRVJMMBEFQBUSOCPRVJMMBEFQBUSOEFDSDVMPDPNQMFUPEFQJFT N

t$PNQBUJCMFDPOUPEPTMPTDVFSQPTEFBTQFSTPSFTZBEBQUBEPSFTQBSBBSCVTUPT
de Rain Bird

t65CPRVJMMBEFQBUSOEFVOUFSDJPEFDSDVMPEFQJFT N

Cuando se instalan boquillas con doble orificio Serie U en lugar de boquillas estndar en todos los
cuerpos de aspersores de la zona. Los resultados pueden variar de acuerdo con las condiciones
especficas del sitio como el espaciamiento de los aspersores, el viento, la temperatura, el tipo de suelo
y csped
El coeficiente de programacin (SC) mide la eficacia de los aspersores. El SC mide cunto ms necesita
regar TODA el rea para que las secciones ms secas reciban suficiente agua. Cuanto ms bajo es el SC,
mejor es la distribucin del agua que hace el aspersor.

t62CPRVJMMBEFQBUSOEFVODVBSUPEFDSDVMPEFQJFT N

t6)CPRVJMMBEFQBUSOTFNJDJSDVMBSEFQJFT N

t655CPRVJMMBEFQBUSOEFEPTUFSDJPTEFDSDVMPEFQJFT N

t652CPRVJMMBEFQBUSOEFUSFTDVBSUPTEFDSDVMPEFQJFT N

t6'CPRVJMMBEFQBUSOCPRVJMMBEFQBUSOEFDSDVMPDPNQMFUPEFQJFT N

Rango operativo
t&TQBDJBNJFOUPEFBQJFT EFBN

t1SFTJOEFBQTJ EFBCBSFT

Enfrentando a la competencia

t1SFTJOQUJNBQTJ CBSFT
3
3

Rain Bird recomienda usar Cuerpos de aspersores 1800 PRS para mantener el rendimiento ptimo
de la boquilla en situaciones de presin ms alta

Serie U patentada
Como el agua sale de ambos orificios, se genera un coeficiente de la uniformidad del riego ms
bajo. Este eficaz diseo preserva el agua, ahorra dinero y reduce el desperdicio

Competidor A

Boquillas Serie U

Competidor B

Cmo especificar
U12H

Rango de radio
8: 243.84 cm (2.4 m)
12: 365.76 cm (3.7 m)
15: 457.20 cm (4.6 m)
Modelo
Boquillas Serie U

Patrn
'$PNQMFUB
H: Media
26ODVBSUP
56OUFSDJP
55%PTUFSDJPT
525SFTDVBSUPT

Las boquillas de la Serie U de Rain


Bird producen patrones de rociado
de dos orificios para formar un caudal
de agua continuo. El resultado es que
no quedan lugares sin regar y se cubre
toda el rea de riego de un modo ms
uniforme*
* Basado en pruebas realizadas en el Centro de
Investigaciones de Productos Rain Bird. Pruebas
realizadas en boquillas de crculo parcial de
Rain Bird y de los principales competidores

Las boquillas de los Competidores A y B no proporcionan riego un cercano al cabezal eficaz y,


por lo tanto, necesitan un coeficiente de la uniformidad del riego ms alto

Boquilla Serie U con malla

Como el agua sale de ambos orificios, se genera un coeficiente de la uniformidad del riego ms bajo. Este eficaz diseo preserva el agua,
ahorra dinero y reduce el desperdicio.

30

El uso inteligente del agua.

Boquillas aspersoras

www.rainbird.com/sprays

Serie U8
Trayectoria de 10 
Boquilla
Presin
psi
U-8F
15
20
25
30
U8H
15
20
25
30
U8T
15
20
25
30
U8Q
15
20
25
30

Serie U8

Radio
pies
5
6
7
8
5
6
7
8
5
6
7
8
5
6
7
8


Caudal
gpm
0.74
0.86
0.96
1.05
0.37
0.42
0.47
0.52
0.25
0.29
0.32
0.35
0.18
0.21
0.24
0.26

Q
Precip.
pulg./h
2.85
2.30
1.89
1.58
2.85
2.25
1.85
1.58
2.89
2.33
1.89
1.58
2.77
2.25
1.89
1.58

V
Precip.
pulg./h
3.29
2.66
2.18
1.83
3.29
2.59
2.13
1.83
3.34
2.69
2.18
1.83
3.20
2.59
2.18
1.83

Serie U10
Trayectoria de 12 
Boquilla
Presin
psi
U-10F
15
20
25
30
U-10H
15
20
25
30
U-10T
15
20
25
30
U-10Q
15
20
25
30

Trayectoria de 10
Boquilla
Presin
bares
U-8F
1.0
1.5
2.0
2.1
U-8H
1.0
1.5
2.0
2.1
U-8T
1.0
1.5
2.0
2.1
U-8Q
1.0
1.5
2.0
2.1

SIST. MTRICO

Radio
m
1.7
2.1
2.4
2.4
1.7
2.1
2.4
2.4
1.7
2.1
2.4
2.4
1.7
2.1
2.4
2.4

Serie U10

Radio
pies
7
8
9
10
7
8
9
10
7
8
9
10
7
8
9
10


Caudal
gpm
1.16
1.34
1.50
1.64
0.58
0.67
0.75
0.82
0.39
0.45
0.50
0.55
0.29
0.33
0.37
0.41

Q
Precip.
pulg./h
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58

V
Precip.
pulg./h
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83

Trayectoria de 12
Boquilla
Presin
bares
U-10F
1.0
1.5
2.0
2.1
U-10H
1.0
1.5
2.0
2.1
U-10T
1.0
1.5
2.0
2.1
U-10Q
1.0
1.5
2.0
2.1



Q
Caudal Caudal Precip.
m3h l/m
mm/h
0.16 2.8
72
0.20 3.4
58
0.23 3.9
48
0.24 4.0
40
0.08 1.4
72
0.10 1.7
57
0.12 1.9
47
0.12 2.0
40
0.05 0.9
73
0.07 1.1
59
0.08 1.3
48
0.08 1.3
40
0.04 0.7
70
0.05 0.8
57
0.06 1.0
48
0.06 1.0
40

V
Precip.
mm/h
84
68
55
46
84
66
54
46
85
68
55
46
81
66
55
46

SIST. MTRICO

Radio
m
2.1
2.6
3.0
3.1
2.1
2.6
3.0
3.1
2.1
2.6
3.0
3.1
2.1
2.6
3.0
3.1



Q
Caudal Caudal Precip.
m3h l/m
mm/h
0.26 4.4
52
0.30 5.3
47
0.34 6.1
41
0.37 6.2
40
0.13 2.2
52
0.15 2.6
47
0.17 3.1
41
0.19 3.1
40
0.09 1.5
52
0.10 1.8
47
0.11 2.0
41
0.12 2.1
40
0.07 1.1
52
0.08 1.3
47
0.08 1.5
41
0.09 1.6
40

V
Precip.
mm/h
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46

Nota: Todas las boquillas Serie U se probaron con vstagos retrctiles de 4" (10.2 cm)
Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
V Patrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Los datos de rendimiento se tomaron en condiciones de cero viento.
Radio se refiere al espaciamiento recomendado del producto. Los radios reales en el arco pueden variar

El uso inteligente del agua.

31

Boquillas aspersoras

Boquillas Serie U

Boquillas aspersoras
Boquillas Serie U

Serie U12

Boquillas aspersoras

Trayectoria de 23 
Boquilla
Presin
psi
U-12F
15
20
25
30
U-12TQ
15
20
25
30
U-12TT
15
20
25
30
U-12H
15
20
25
30
U-12T
15
20
25
30
U-12Q
15
20
25
30

Serie U12

Radio
pies
9
10
11
12
9
10
11
12
9
10
11
12
9
10
11
12
9
10
11
12
9
10
11
12


Caudal
gpm
1.80
2.10
2.40
2.60
1.35
1.58
1.80
1.95
1.20
1.40
1.60
1.74
0.90
1.05
1.20
1.30
0.60
0.70
0.80
0.87
0.45
0.53
0.60
0.65

Q
Precip.
pulg./h
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74

V
Precip.
pulg./h
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01

Trayectoria de 23
Boquilla
Presin
bares
U-12F
1.0
1.5
2.0
2.1
U-12TQ
1.0
1.5
2.0
2.1
U-12TT
1.0
1.5
2.0
2.1
U-12H
1.0
1.5
2.0
2.1
U-12T
1.0
1.5
2.0
2.1
U-12Q
1.0
1.5
2.0
2.1

SIST. MTRICO

Radio
m
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7



Q
Caudal Caudal Precip.
m3h l/m
mm/h
0.40 6.8
55
0.48 8.3
47
0.59 9.7
46
0.60 9.8
44
0.30 5.1
55
0.36 6.3
47
0.45 7.3
46
0.45 7.4
44
0.26 4.5
55
0.32 5.6
47
0.40 6.5
46
0.40 6.6
44
0.20 3.4
55
0.24 4.2
47
0.30 4.8
46
0.30 4.9
44
0.13 2.3
55
0.16 2.8
47
0.20 3.2
46
0.20 3.3
44
0.10 1.7
55
0.12 2.1
47
0.15 2.4
46
0.15 2.5
44

V
Precip.
mm/h
63
54
53
51
63
54
53
51
63
54
53
51
63
54
53
51
63
54
53
51
63
54
53
51

Nota: Todas las boquillas Serie U se probaron con vstagos retrctiles de 4" (10.2 cm)
Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
V Patrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Los datos de rendimiento se tomaron en condiciones de cero viento.
Radio se refiere al espaciamiento recomendado del producto. Los radios reales en el arco pueden variar

Boquillas Serie U

32

El uso inteligente del agua.

Boquillas aspersoras

www.rainbird.com/sprays

Serie U15

Serie U15

Trayectoria de 23 
Boquilla
Presin
psi
U-15F
15
20
25
30
U-15TQ
15
20
25
30
U-15TT
15
20
25
30
U-15H
15
20
25
30
U-15T
15
20
25
30
U-15Q
15
20
25
30


Radio
pies
11
12
14
15
11
12
14
15
11
12
14
15
11
12
14
15
11
12
14
15
11
12
14
15


Caudal
gpm
2.60
3.00
3.30
3.70
1.95
2.25
2.48
2.78
1.74
2.01
2.21
2.48
1.30
1.50
1.65
1.85
0.87
1.00
1.10
1.23
0.65
0.75
0.82
0.92

Q
Precip.
pulg./h
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58

V
Precip.
pulg./h
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83

Trayectoria de 23
Boquilla
Presin
bares
U-15F
1.0
1.5
2.0
2.1
U-15TQ
1.0
1.5
2.0
2.1
U-15TT
1.0
1.5
2.0
2.1
U-15H
1.0
1.5
2.0
2.1
U-15T
1.0
1.5
2.0
2.1
U-15Q
1.0
1.5
2.0
2.1

SIST. MTRICO

Radio
m
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6



Q
Caudal Caudal Precip.
m3h l/m
mm/h
0.60 9.8
52
0.72 11.8 47
0.84 13.7 41
0.84 14.0 40
0.45 7.4
52
0.54 8.8
47
0.63 10.3 41
0.63 10.5 40
0.40 6.6
52
0.48 7.9
47
0.55 9.2
41
0.56 9.4
40
0.30 4.9
52
0.36 5.9
47
0.42 6.9
41
0.42 7.0
40
0.20 3.3
52
0.24 3.9
47
0.28 4.6
41
0.28 4.7
40
0.15 2.5
52
0.18 2.9
47
0.21 3.4
41
0.21 3.5
40

V
Precip.
mm/h
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46

Nota: Todas las boquillas Serie U se probaron con vstagos retrctiles de 4" (10.2 cm)
Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
V Patrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Los datos de rendimiento se tomaron en condiciones de cero viento.
Radio se refiere al espaciamiento recomendado del producto. Los radios reales en el arco pueden variar

Las boquillas Serie U ofrecen una mejor y ms uniforme distribucin del agua. El agua que sale de ambos
orificios se combina para formar un caudal de agua continuo. Evita que queden zonas sin regar y logra
una cobertura ms uniforme en toda el rea de riego

El uso inteligente del agua.

33

Boquillas aspersoras

Boquillas Serie U

Boquillas aspersoras
Boquillas serie Van

Boquillas serie VAN

Serie 4 VAN

Boquillas de arco variable

Q 'DJMBKVTUFEFMBSDPEFBFOMB4FSJFT  Z


7"/EFBFOMBT4FSJFT Z7"/

Q El simple giro del collarn central aumenta o disminuye el ajuste del arco
Boquillas aspersoras

Q Las Series 12, 15, y 18-VAN tienen ndices de precipitacin ajustados con
 las boquillas MPR Rain Bird
Caractersticas
t-BSBOVSBEFMUPSOJMMPFWJUBFMEFTHBTUFEFMEFTUPSOJMMBEPS
t/PSFRVJFSFIFSSBNJFOUBTFTQFDJBMFT
t5PSOJMMPEFBKVTUFEFBDFSPJOPYJEBCMFQBSBBKVTUBSFMDBVEBMZFMSBEJP
t*OEJDBEPSUDUJMEFMFYUSFNPJ[RVJFSEP
t*EFBMQBSBSFHBSSFBTEFGPSNBJSSFHVMBS
t4FFOWBODPOGJMUSPEFNBMMBB[VM Y
QBSBNBOUFOFSVOBKVTUFEF
radio preciso y evitar obstrucciones

Rango operativo
t3BEJP
4-VAN: de 3 a 4 pies (de 0.9 a 1.2 m)
6-VAN: de 4 a 6 pies (de 1.2 a 1.8 m)
8-VAN: de 6 a 8 pies (de 1.8 a 2.4 m)
10-VAN: de 8 a 10 pies (de 2.4 a 3.0 m)
12-VAN: de 10 a 12 pies (de 3.0 a 3.7 m)
15-VAN: de 12 a 15 pies (de 3.7 a 4.6 m)
18-VAN: de 14 a 18 pies (de 4.3 a 5.5 m)
t1SFTJOEFBQTJ EFBCBSFT

t1SFTJOQUJNBQTJ CBSFT

* Estos rangos estn basados en la presin adecuada de las boquillas
** Rain Bird recomienda usar cuerpos de aspersores 1800 PRS para mantener un rendimiento ptimo de
la boquilla en situaciones de presin ms alta

Modelos
t7"/
t7"/
t7"/
t7"/
t7"/
t7"/
t7"/

Boquilla serie VAN

Trayectoria de 0 
Boquilla
Presin
psi
Arco 330
15
20
25
30
Arco 270
15
20
25
30
Arco 180
15
20
25
30
Arco 90
15
20
25
30


Radio
pies
3
3
4
4
3
3
4
4
3
3
4
4
3
3
4
4


Caudal
gpm
0.62
0.70
0.80
0.88
0.52
0.58
0.66
0.73
0.32
0.37
0.41
0.45
0.21
0.24
0.26
0.29

Q
Precip.
pulg./h
7.23
8.17
5.25
5.78
7.42
8.27
5.29
5.86
6.84
7.91
4.93
5.41
8.98
10.27
6.26
6.98

Serie 4 VAN
Trayectoria de 0 
Boquilla
Presin
bares
Arco 330
1.0
1.5
2.0
2.1
Arco 270
1.0
1.5
2.0
2.1
Arco 180
1.0
1.5
2.0
2.1
Arco 90
1.0
1.5
2.0
2.1

V
Precip.
pulg./h
8.35
9.43
6.06
6.67
8.57
9.55
6.11
6.77
7.90
9.13
5.69
6.25
10.37
11.86
7.23
8.06

SIST. MTRICO

Radio
m
0.9
1.0
1.2
1.2
0.9
1.0
1.2
1.2
0.9
1.0
1.2
1.2
0.9
1.0
1.2
1.2



Q
Caudal Caudal Precip.
m3h l/m
mm/h
0.14 2.3
189
0.17 2.8
183
0.20 3.3
152
0.20 3.3
152
0.12 2.0
198
0.14 2.3
187
0.16 2.7
148
0.17 2.8
157
0.07 1.2
173
0.09 1.5
180
0.10 1.7
139
0.10 1.7
139
0.05 0.8
247
0.06 0.9
240
0.06 1.1
167
0.07 1.1
194

V
Precip.
mm/h
218
215
176
176
229
216
171
181
200
208
161
161
285
277
193
224

Nota: Puede ser necesario girar el tornillo de reduccin del radio para lograr el radio y
el caudal del catlogo cuando el arco establecido es menor que el arco mximo.
Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
V Patrn de distribucin triangular basado en un alcance del 50% del dimetro.
Los datos de rendimiento se tomaron en condiciones de cero viento.

Fcil de ajustar

34

El uso inteligente del agua.

Boquillas aspersoras

www.rainbird.com/sprays

Serie 6 VAN
Trayectoria de 0 
Boquilla
Presin
psi
Arco 330
15
20
25
30
Arco 270
15
20
25
30
Arco 180
15
20
25
30
Arco 90
15
20
25
30

Serie 6 VAN

Radio
pies
4
5
5
6
4
5
5
6
4
5
5
6
4
5
5
6


Caudal
gpm
0.85
0.96
1.09
1.20
0.79
0.88
1.00
1.10
0.42
0.49
0.55
0.60
0.26
0.30
0.34
0.37

Q
Precip.
pulg./h
5.58
4.03
4.58
3.50
6.34
4.52
5.13
3.92
5.05
3.77
4.24
3.21
6.26
4.62
5.24
3.96

V
Precip.
pulg./h
6.44
4.65
5.29
4.04
7.32
5.22
5.92
4.53
5.83
4.35
4.90
3.71
7.23
5.33
6.05
4.57

Serie 8 VAN
Trayectoria de 5 
Boquilla
Presin
psi
Arco 330
15
20
25
30
Arco 270
15
20
25
30
Arco 180
15
20
25
30
Arco 90
15
20
25
30

Trayectoria de 0 
Boquilla
Presin
bares
Arco 330
1.0
1.5
2.0
2.1
Arco 270
1.0
1.5
2.0
2.1
Arco 180
1.0
1.5
2.0
2.1
Arco 90
1.0
1.5
2.0
2.1

SIST. MTRICO

Radio
m
1.2
1.5
1.8
1.8
1.2
1.5
1.8
1.8
1.2
1.5
1.8
1.8
1.2
1.5
1.8
1.8

Serie 8 VAN

Radio
pies
6
7
7
8
6
7
7
8
6
7
7
8
6
7
7
8


Caudal
gpm
1.21
1.36
1.55
1.70
1.11
1.24
1.41
1.55
0.84
0.97
1.09
1.19
0.51
0.59
0.66
0.72

Q
Precip.
pulg./h
3.53
2.91
3.32
2.79
3.95
3.24
3.69
3.10
4.49
3.81
4.28
3.58
5.46
4.64
5.19
4.33

V
Precip.
pulg./h
4.07
3.36
3.83
3.22
4.55
3.74
4.25
3.58
5.18
4.40
4.94
4.13
6.29
5.35
5.98
5.00

Trayectoria de 5 
Boquilla
Presin
bares
Arco 330
1.0
1.5
2.0
2.1
Arco 270
1.0
1.5
2.0
2.1
Arco 180
1.0
1.5
2.0
2.1
Arco 90
1.0
1.5
2.0
2.1



Q
Caudal Caudal Precip.
m3h l/m
mm/h
0.19 3.2
144
0.23 3.8
112
0.27 4.5
91
0.27 4.5
91
0.18 3.0
167
0.21 3.5
124
0.24 4.1
99
0.25 4.2
103
0.10 1.6
139
0.11 1.9
98
0.13 2.2
80
0.14 2.3
86
0.06 1.0
167
0.07 1.2
124
0.08 1.4
99
0.08 1.4
99

V
Precip.
mm/h
166
129
105
105
193
143
114
119
161
113
92
99
193
143
114
114

SIST. MTRICO

Radio
m
1.8
2.1
2.3
2.4
1.8
2.1
2.3
2.4
1.8
2.1
2.3
2.4
1.8
2.1
2.3
2.4



Q
Caudal Caudal Precip.
m3h l/m
mm/h
0.27 4.6
91
0.32 5.4
79
0.38 6.3
78
0.39 6.4
74
0.25 4.2
103
0.30 4.9
91
0.34 5.8
86
0.35 5.9
81
0.19 3.2
117
0.23 3.8
104
0.26 4.4
98
0.27 4.5
94
0.12 1.9
148
0.14 2.3
127
0.16 2.7
121
0.16 2.7
111

V
Precip.
mm/h
105
91
90
86
119
105
99
94
135
120
113
109
171
147
140
128

Nota: Puede ser necesario girar el tornillo de reduccin del radio para lograr el radio y
el caudal del catlogo cuando el arco establecido es menor que el arco mximo.
Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
V Patrn de distribucin triangular basado en un alcance del 50% del dimetro.
Los datos de rendimiento se tomaron en condiciones de cero viento.

El uso inteligente del agua.

35

Boquillas aspersoras

Boquillas serie Van

Boquillas aspersoras
Boquillas serie Van

Serie 10 VAN

Boquillas aspersoras

Trayectoria de 10 
Boquilla
Presin
psi
Arco 360
15
20
25
30
Arco 270
15
20
25
30
Arco 180
15
20
25
30
Arco 90
15
20
25
30

Serie 10 VAN

Radio
pies
7
8
9
10
7
8
9
10
7
8
9
10
7
8
9
10


Caudal
gpm
1.93
2.32
2.52
2.60
1.45
1.75
1.89
2.10
0.97
1.20
1.26
1.45
0.48
0.58
0.63
0.75

Q
Precip.
pulg./h
3.80
3.50
3.00
2.50
3.80
3.50
3.00
2.70
3.80
3.50
3.00
2.80
3.80
3.50
3.00
2.90

V
Precip.
pulg./h
4.39
4.04
3.46
2.89
4.39
4.04
3.46
3.12
4.39
4.04
3.46
3.23
4.39
4.04
3.46
3.35

Serie 12 VAN
Trayectoria de 15 
Boquilla
Presin
psi
Arco 360
15
20
25
30
Arco 270
15
20
25
30
Arco 180
15
20
25
30
Arco 90
15
20
25
30

Trayectoria de 10
Boquilla
Presin
bares
Arco 360
1.0
1.5
2.0
2.1
Arco 270
1.0
1.5
2.0
2.1
Arco 180
1.0
1.5
2.0
2.1
Arco 90
1.0
1.5
2.0
2.1

SIST. MTRICO

Radio
m
2.1
2.4
2.7
3.1
2.1
2.4
2.7
3.1
2.1
2.4
2.7
3.1
2.1
2.4
2.7
3.1

Serie 12 VAN

Radio
pies
9
10
11
12
9
10
11
12
9
10
11
12
9
10
11
12


Caudal
gpm
1.56
1.86
2.12
2.36
1.17
1.39
1.59
1.77
0.78
0.93
1.06
1.18
0.39
0.46
0.53
0.59

Q
Precip.
pulg./h
1.86
1.79
1.68
1.58
1.86
1.79
1.68
1.58
1.86
1.79
1.68
1.58
1.86
1.79
1.68
1.58

V
Precip.
pulg./h
2.14
2.06
1.95
1.82
2.14
2.06
1.94
1.82
2.14
2.06
1.95
1.82
2.14
2.06
1.95
1.82

Trayectoria de 15
Boquilla
Presin
bares
Arco 360
1.0
1.5
2.0
2.1
Arco 270
1.0
1.5
2.0
2.1
Arco 180
1.0
1.5
2.0
2.1
Arco 90
1.0
1.5
2.0
2.1



Q
Caudal Caudal Precip.
m3h l/m
mm/h
0.44 7.3
96
0.53 9.0
89
0.57 9.8
76
0.59 9.8
63
0.33 5.5
96
0.4
6.8
89
0.43 7.8
76
0.48 7.9
68
0.22 3.7
96
0.27 4.6
89
0.29 5.3
76
0.33 5.5
71
0.11 1.8
96
0.13 2.3
89
0.14 2.7
76
0.17 2.8
73

V
Precip.
mm/h
111
103
88
73
111
103
88
79
111
103
88
82
111
103
88
85

SIST. MTRICO

Radio
m
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7



Q
Caudal Caudal Precip.
m3h l/m
mm/h
0.35 5.80 48
0.44 7.37 43
0.52 8.75 41
0.54 9.02 40
0.26 4.35 48
0.33 5.53 43
0.39 6.56 41
0.41 6.76 40
0.17 2.90 48
0.22 3.69 43
0.26 4.37 41
0.27 4.51 40
0.09 1.45 48
0.11 1.84 43
0.13 2.19 41
0.14 2.25 40

V
Precip.
mm/h
55
50
47
46
55
50
47
46
55
50
47
46
55
50
47
46

Nota: Puede ser necesario girar el tornillo de reduccin del radio para lograr el radio y
el caudal del catlogo cuando el arco establecido es menor que el arco mximo.
Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
V Patrn de distribucin triangular basado en un alcance del 50% del dimetro.
Los datos de rendimiento se tomaron en condiciones de cero viento.

36

El uso inteligente del agua.

Boquillas aspersoras

www.rainbird.com/sprays

Serie 15 VAN
Trayectoria de 23 
Boquilla
Presin
psi
Arco 360
15
20
25
30
Arco 270
15
20
25
30
Arco 180
15
20
25
30
Arco 90
15
20
25
30

Serie 15 VAN

Radio
pies
11
12
14
15
11
12
14
15
11
12
14
15
11
12
14
15


Caudal
gpm
2.60
3.00
3.30
3.70
1.95
2.25
2.48
2.78
1.30
1.50
1.65
1.85
0.65
0.75
0.82
0.92

Q
Precip.
pulg./h
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58

V
Precip.
pulg./h
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83

Serie 18 VAN
Trayectoria de 26 
Boquilla
Presin
psi
Arco 360
15
20
25
30
Arco 270
15
20
25
30
Arco 180
15
20
25
30
Arco 90
15
20
25
30

Trayectoria de 23
Boquilla
Presin
bares
Arco 360
1.0
1.5
2.0
2.1
Arco 270
1.0
1.5
2.0
2.1
Arco 180
1.0
1.5
2.0
2.1
Arco 90
1.0
1.5
2.0
2.1

SIST. MTRICO

Radio
m
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6

Serie 18 VAN

Radio
pies
14
15
17
18
14
15
17
18
14
15
17
18
14
15
17
18


Caudal
gpm
4.21
4.70
4.86
5.32
3.16
3.52
3.65
3.99
2.11
2.35
2.43
2.66
1.05
1.17
1.22
1.33

Q
Precip.
pulg./h
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58

V
Precip.
pulg./h
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83

Trayectoria de 26
Boquilla
Presin
bares
Arco 360
1.0
1.5
2.0
2.1
Arco 270
1.0
1.5
2.0
2.1
Arco 180
1.0
1.5
2.0
2.1
Arco 90
1.0
1.5
2.0
2.1



Q
Caudal Caudal Precip.
m3h l/m
mm/h
0.60 9.8
52
0.72 11.8 47
0.84 13.7 41
0.84 14.0 40
0.45 7.4
52
0.54 8.8
47
0.63 10.3 41
0.63 10.5 40
0.30 4.9
52
0.36 5.9
47
0.42 6.9
41
0.42 7.0
40
0.15 2.5
52
0.18 2.9
47
0.21 3.4
41
0.21 3.5
40

V
Precip.
mm/h
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46

SIST. MTRICO

Radio
m
4.3
4.8
5.4
5.5
4.3
4.8
5.4
5.5
4.3
4.8
5.4
5.5
4.3
4.8
5.4
5.5



Q
Caudal Caudal Precip.
m3h l/m
mm/h
0.96 15.9 52
1.07 18.0 47
1.20 19.8 41
1.21 20.1 40
0.72 12.0 52
0.80 13.5 47
0.90 14.8 41
0.91 15.1 40
0.48 8.0
52
0.54 9.0
47
0.60 9.9
41
0.61 10.1 40
0.24 4.0
52
0.27 4.5
47
0.30 5.0
41
0.30 5.0
40

V
Precip.
mm/h
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46

Nota: Puede ser necesario girar el tornillo de reduccin del radio para lograr el radio y
el caudal del catlogo cuando el arco establecido es menor que el arco mximo.
Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
V Patrn de distribucin triangular basado en un alcance del 50% del dimetro.
Los datos de rendimiento se tomaron en condiciones de cero viento.

El uso inteligente del agua.

37

Boquillas aspersoras

Boquillas serie Van

Boquillas aspersoras
Boquillas serie HE-VAN

Boquillas serie HE-VAN


Boquillas aspersoras de arco variable y alta eficiencia

NUEVO

Q'DJMBKVTUFEFMBSDPEFBDPOVOTJNQMFHJSPEFMDPMMBSODFOUSBMQBSB
aumentar o disminuir el ajuste del arco.

Q La caracterstica del ExactEdge, le ayuda a ajustar el arco de manera ms


Boquillas aspersoras

eficaz. Al girar la boquilla para ajustar el arco al patrn deseado, sentir un


tope que indica el borde exacto de riego asegurando siempre la mxima
consistencia.

Q La tecnologa de control de caudal, con patente en trmite, brinda un riego


Disponible en los
populares modelos de
12 y 15 (3.66 m y 4.57 m)

a corta distancia superior y cobertura uniforme en todo el patrn.

Caractersticas
t$IPSSPTNTFTQFTPTZHPUBTEFBHVBNTHSBOEFTQBSBVOBNBZPSSFTJTUFODJB
al viento.
tOEJDFTEFQSFDJQJUBDJOBKVTUBEPTDPOMBTCPRVJMMBTEFMBTTFSJFT.13Z6EF
Rain Bird.
t%FGMFDUPSTVQFSJPSSFTJTUFOUFRVFNJOJNJ[BFMEBPBMBCPRVJMMBQSPEVDJEPQPS
el desgaste normal.
t/PTFSFRVJFSFOIFSSBNJFOUBTFTQFDJBMFT
t5PSOJMMPEFBKVTUFEFBDFSPJOPYJEBCMFQBSBBKVTUBSFMSBEJPZFMDBVEBM FMSBEJP
puede reducirse hasta un 25%.
t4FFOWBODPOGJMUSPEFNBMMBB[VM Y
QBSBNBOUFOFSVOBKVTUFEF
radio preciso y evitar obstrucciones.

Ahora disponible en los


modelos de 8 y 10 (2.44
m y 3.05 m)

t$BCFFOUPEPTMPTBTQFSTPSFTEFMBTTFSJFTZ6/*4QSBZEF3BJO#JSEZ
adaptadores para arbustos de Rain Bird.

Clasificacin de eficiencia de las boquillas HE-VAN de Rain


Bird1
t-BTCPRVJMMBT)&7"/EF3BJO#JSECSJOEBOVOBVOJGPSNJEBEFOMBEJTUSJCVDJO
QSPNFEJP %6-2, del 70%, un 40% mejor que las boquillas aspersoras comunes
de arco variable.
t-BTCPRVJMMBT)&7"/EF3BJO#JSECSJOEBOVODPFGJDJFOUFEFSFOEJNJFOUP
1.6, un 35% ms bajo que el de las boquillas difusoras comunes de arco
variable.

Rango operativo
t3BEJP2
- HE-VAN-08: de 6 a 8 pies (de 1.8 a 0.4 cm)
- HE-VAN-10: de 8 a 10 pies (de 2.4 a 3.0 m)
- HE-VAN-12: de 9 a 12 pies (de 2.7 a 3.7 m)
- HE-VAN-15: de 12 a 15 pies (de 3.7 a 4.6 m)
t1SFTJOEFBQTJ EFBCBSFT

t1SFTJOQUJNBQTJ CBSFT
3

Modelos

Cmo especificar
HE-VAN-15
Rango de radio
15: 457.20 cm (4.6 m)

t)&7"/
t)&7"/
t)&7"/
t)&7"/
1

Caracterstica
VAN: Arco variable
Modelo
Boquilla de alta eficiencia

2
3

38

Uniformidad en la distribucin (DULQ): En el riego, la DU es una medida de la uniformidad del


agua aplicada en el rea regada. La DULQ se calcula tomando el volumen del cuarto inferior de las
mediciones del depsito de captacin y dividindolo por el volumen promedio de todas las mediciones
del depsito de captacin. Coeficiente de programacin (SC): el SC la una medida de la cantidad de
tiempo que se debe regar una zona para proporcionarle agua suficiente a su punto ms seco.
Estos rangos estn basados en la presin adecuada de las boquillas.
Rain Bird recomienda usar cuerpos de aspersores 1800 PRS para mantener el rendimiento ptimo de la
boquilla en situaciones de presin ms alta.

El uso inteligente del agua.

Boquillas aspersoras

www.rainbird.com/sprays

HE-VAN serie 8

HE-VAN serie 8
Trayectoria de 24 
Boquilla
Presin
psi
Arco 360
15
20
25
30
Arco 270
15
20
25
30
Arco 180
15
20
25
30
Arco 90
15
20
25
30


Radio
pies
5
6
7
8
5
6
7
8
5
6
7
8
5
6
7
8


Caudal
gpm
0.83
0.96
1.07
1.17
0.62
0.72
0.80
0.88
0.41
0.48
0.53
0.59
0.21
0.24
0.27
0.29

Q
Precip.
pulg./h
3.19
2.56
2.10
1.76
3.19
2.56
2.10
1.76
3.19
2.56
2.10
1.76
3.19
2.56
2.10
1.76

V
Precip.
pulg./h
3.68
2.95
2.42
2.03
3.68
2.95
2.42
2.03
3.68
2.95
2.42
2.03
3.68
2.95
2.42
2.03


Radio
m
1.52
1.83
2.13
2.44
1.52
1.83
2.13
2.44
1.52
1.83
2.13
2.44
1.52
1.83
2.13
2.44

HE-VAN serie 10

HE-VAN serie 10
Trayectoria de 27 
Boquilla
Presin
psi
Arco 360
15
20
25
30
Arco 270
15
20
25
30
Arco 180
15
20
25
30
Arco 90
15
20
25
30

Trayectoria de 24
Boquilla
Presin
bares
Arco 360
1.03
1.38
1.72
2.07
Arco 270
1.03
1.38
1.72
2.07
Arco 180
1.03
1.38
1.72
2.07
Arco 90
1.03
1.38
1.72
2.07

SIST. MTRICO


Radio
pies
7
8
9
10
7
8
9
10
7
8
9
10
7
8
9
10


Caudal
gpm
1.26
1.46
1.63
1.78
0.95
1.09
1.22
1.34
0.63
0.73
0.81
0.89
0.32
0.36
0.41
0.45

Q
Precip.
pulg./h
2.48
2.19
1.94
1.72
2.48
2.19
1.94
1.72
2.48
2.19
1.94
1.72
2.48
2.19
1.94
1.72

V
Precip.
pulg./h
2.86
2.53
2.24
1.98
2.86
2.53
2.24
1.98
2.86
2.53
2.24
1.98
2.86
2.53
2.24
1.98

Trayectoria de 27
Boquilla
Presin
bares
Arco 360
1.03
1.38
1.72
2.07
Arco 270
1.03
1.38
1.72
2.07
Arco 180
1.03
1.38
1.72
2.07
Arco 90
1.03
1.38
1.72
2.07



Q
Caudal Caudal Precip.
m3h l/m
mm/h
0.19 3.14 82
0.22 3.62 66
0.25 4.05 54
0.27 4.43 45
0.14 2.35 82
0.16 2.72 66
0.18 3.04 54
0.20 3.33 45
0.10 1.57 82
0.11 1.81 66
0.12 2.02 54
0.13 2.22 45
0.05 0.78 82
0.05 0.91 66
0.06 1.01 54
0.07 1.11 45

V
Precip.
mm/h
95
76
62
52
95
76
62
52
95
76
62
52
95
76
62
52

SIST. MTRICO

Radio
m
2.13
2.44
2.74
3.05
2.13
2.44
2.74
3.05
2.13
2.44
2.74
3.05
2.13
2.44
2.74
3.05



Q
Caudal Caudal Precip.
m3h l/m
mm/h
0.29 4.78 64
0.34 5.52 56
0.37 6.17 50
0.41 6.76 44
0.22 3.59 64
0.25 4.14 56
0.28 4.63 50
0.31 5.07 44
0.15 2.39 64
0.17 2.76 56
0.19 3.09 50
0.21 3.38 44
0.07 1.20 64
0.08 1.38 56
0.09 1.54 50
0.10 1.69 44

V
Precip.
mm/h
74
65
57
51
74
65
57
51
74
65
57
51
74
65
57
51

Nota: Puede ser necesario girar el tornillo de reduccin del radio para lograr el radio y
el caudal del catlogo cuando el arco establecido es menor que el arco mximo.
Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
V Patrn de distribucin triangular basado en un alcance del 50% del dimetro.
Los datos de rendimiento se tomaron en condiciones de cero viento.

El uso inteligente del agua.

39

Boquillas aspersoras

Boquillas serie HE-VAN

Boquillas aspersoras
Boquillas serie HE-VAN

HE-VAN serie 12

HE-VAN serie 12

Boquillas aspersoras

Trayectoria de 23 
Boquilla
Presin
psi
Arco 360
15
20
25
30
Arco 270
15
20
25
30
Arco 180
15
20
25
30
Arco 90
15
20
25
30


Radio
pies
9
10
11
12
9
10
11
12
9
10
11
12
9
10
11
12


Caudal
gpm
1.67
1.93
2.16
2.37
1.25
1.45
1.62
1.77
0.84
0.97
1.08
1.18
0.42
0.48
0.54
0.59

Q
Precip.
pulg./h
1.99
1.86
1.72
1.58
1.99
1.86
1.72
1.58
1.99
1.86
1.72
1.58
1.99
1.86
1.72
1.58

V
Precip.
pulg./h
2.30
2.15
1.99
1.83
2.30
2.15
1.99
1.83
2.30
2.15
1.99
1.83
2.30
2.15
1.99
1.83

Trayectoria de 23
Boquilla
Presin
bares
Arco 360
1.0
1.4
1.7
2.1
Arco 270
1.0
1.4
1.7
2.1
Arco 180
1.0
1.4
1.7
2.1
Arco 90
1.0
1.4
1.7
2.1

SIST. MTRICO

Radio
m
2.7
3.0
3.4
3.7
2.7
3.0
3.4
3.7
2.7
3.0
3.4
3.7
2.7
3.0
3.4
3.7



Q
Caudal Caudal Precip.
m3h l/m
mm/h
0.38 6.33 50.5
0.44 7.31 47.3
0.49 8.18 43.7
0.54 8.96 40.2
0.28 4.75 50.5
0.33 5.48 47.3
0.37 6.16 43.7
0.40 6.72 40.2
0.19 3.17 50.5
0.22 3.66 47.3
0.25 4.09 43.7
0.27 4.48 40.2
0.09 1.58 50.5
0.11 1.83 47.3
0.12 2.04 43.7
0.13 2.24 40.2

V
Precip.
mm/h
58.3
54.6
50.4
46.4
58.3
54.6
50.4
46.4
58.3
54.6
50.4
46.4
58.3
54.6
50.4
46.4

Nota: Puede ser necesario girar el tornillo de reduccin del radio para lograr el radio y
el caudal del catlogo cuando el arco establecido es menor que el arco mximo.
Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
V Patrn de distribucin triangular basado en un alcance del 50% del dimetro.
Los datos de rendimiento se tomaron en condiciones de cero viento.

40

El uso inteligente del agua.

Boquillas aspersoras

www.rainbird.com/sprays

HE-VAN serie 15

HE-VAN serie 15
Trayectoria de 25 
Boquilla
Presin
psi
Arco 360
15
20
25
30
Arco 270
15
20
25
30
Arco 180
15
20
25
30
Arco 90
15
20
25
30


Radio
pies
11
12
14
15
11
12
14
15
11
12
14
15
11
12
14
15


Caudal
gpm
2.62
3.02
3.38
3.70
1.96
2.27
2.53
2.78
1.31
1.51
1.69
1.85
0.65
0.76
0.84
0.93

Q
Precip.
pulg./h
2.08
2.02
1.66
1.58
2.08
2.02
1.66
1.58
2.08
2.02
1.66
1.58
2.08
2.02
1.66
1.58

V
Precip.
pulg./h
2.40
2.33
1.92
1.83
2.40
2.33
1.92
1.83
2.40
2.33
1.92
1.83
2.40
2.33
1.92
1.83

Trayectoria de 25
Boquilla
Presin
bares
Arco 360
1.0
1.4
1.7
2.1
Arco 270
1.0
1.4
1.7
2.1
Arco 180
1.0
1.4
1.7
2.1
Arco 90
1.0
1.4
1.7
2.1

SIST. MTRICO

Radio
m
3.4
3.7
4.3
4.6
3.4
3.7
4.3
4.6
3.4
3.7
4.3
4.6
3.4
3.7
4.3
4.6



Q
Caudal Caudal Precip.
m3h l/m
mm/h
0.59 9.91 52.9
0.69 11.44 51.3
0.77 12.79 42.2
0.84 14.01 40.2
0.45 7.43 52.9
0.51 8.58 51.3
0.58 9.59 42.2
0.63 10.51 40.2
0.30 4.95 52.9
0.34 5.72 51.3
0.38 6.39 42.2
0.42 7.00 40.2
0.15 2.48 52.9
0.17 2.86 51.3
0.19 3.20 42.2
0.21 3.50 40.2

V
Precip.
mm/h
61.1
59.3
48.7
46.5
61.1
59.3
48.7
46.5
61.1
59.3
48.7
46.5
61.1
59.3
48.7
46.5

Nota: Puede ser necesario girar el tornillo de reduccin del radio para lograr el radio y
el caudal del catlogo cuando el arco establecido es menor que el arco mximo.
Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
V Patrn de distribucin triangular basado en un alcance del 50% del dimetro.
Los datos de rendimiento se tomaron en condiciones de cero viento.

El uso inteligente del agua.

41

Boquillas aspersoras

Boquillas serie HE-VAN

Boquillas aspersoras
Boquillas rotativas

Boquillas giratorias
ndice de precipitacin de 0.60 pulg./h (15.2 mm/h)
en un rango de 13 a 24 pies (4 a 7.3 m)

Q El bajo ndice de precipitacin de 0.60 pulg./hr (15.2 mm/hr) reduce el


escurrimiento y la erosin

Q Con aproximadamente un 60% menos de caudal que las boquillas


Boquillas aspersoras

aspersoras, las boquillas rotativas permiten la instalacin de ms


aspersores por zona, lo cual reduce la complejidad y el costo de todo el
sistema

Q Las boquillas rotativas de caudales mltiples distribuyen el agua de forma


uniforme en todo el rango de radio de 13' a 24' (4 a 7.3 m)

Durabilidad
- El collarn de goma mantiene fuera las partculas de suciedad grandes y
permite que las ms pequeas salgan fcilmente para mantener el deflector
limpio y sin suciedad.
- El tamao del filtro de malla evita que grandes cantidades de suciedad entren
en la boquilla por el aspersor
- Garanta comercial de tres aos

Rango operativo
t3BOHPEFQSFTJOEFBQTJ EFBCBSFT

t&TQBDJBNJFOUPEFBQJFT EFNBN

- Por encima del espaciamiento en base a condiciones sin viento

Caractersticas

Modelos

Una boquilla aspersora con rendimiento Rain Curtain

t)BZTFJTQBUSPOFTEJGFSFOUFTEJTQPOJCMFTFOEPTSBOHPTEFSBEJP 

- Gotas de gran tamao para un rendimiento constante.

- de 13' a 18' (de 4.0m a 5.5m)

- Riego cercano al cabezal eficaz.

- de 17' a 24' (de 5.2 m a 7.3 m)

 %JTUSJCVDJOVOJGPSNFTPCSFUPEPFMSBEJP

* Radio se refiere al espaciamiento recomendado para alcanzar el ndice de precipitacin ptimo y


la uniformidad de la distribucin con el espaciamiento entre aspersor y aspersor

Instalacin y mantenimiento
 %JTFBEBQBSBTFSVUJMJ[BEBFODVFSQPTEFBTQFSTPSFT3BJO#JSE
 5BQPOFTEFSFEVDDJOEFMSBEJPDPEJGJDBEPTQPSDPMPSQBSBGBDJMJUBSTV
identificacin
 5PSOJMMPEFBDFSPJOPYJEBCMFQBSBMBSFEVDDJOEFMSBEJP RVFQFSNJUF
reducirlo a 13' (4 m) en el modelo R13-18 y a 17' (5.1 m) en el modelo
R17-24 segn las diversas necesidades del terreno

Completa

Media

Tres cuartos

Un tercio

Dos tercios

Un cuarto

Soluciones de diseo
- ndices de precipitacin ajustados a los radios y al patrn, que simplifican el
proceso de diseo
- El ndice de precipitacin se ajusta a las boquillas para rotores Serie 5000 y
5000 Plus MPR de Rain Bird, lo cual permite diseos de riego MPR de 13' a
35' (de 4 m a 10.67 m) (consulte la pgina 61)
- Mantiene un rendimiento altamente eficiente en todo el rango de presin
de 20 a 55 psi (1.4 a 3.8 bares), sin causar nebulizacin cuando la presin
es alta
- Utilizar junto con los aspersores 1800-SAM-P45 para lograr el mximo
rendimiento de la boquilla (consultar pgina 12 para obtener ms
informacin)

Con boquillas aspersoras


convencionales

Con
Boquillas rotativas

Cmo especificar
R13-18Q

Rango de radio
13'-18' (de 4.0 a 5.5 m)
17'-24' (de 5.2 a 7.3 m)

Patrn
'$PNQMFUP
525SFTDVBSUPT
55%PTUFSDJPT
).FEJP
55FSDJP
2$VBSUP

t 5PUBMEFHQN MNJO

t 4FSFRVJFSFO[POBT

t 5PUBMEFHQN MNJO

t 4FSFRVJFSFO[POBT

Modelo
ajustable R-VAN
Nota: Especifique las boquillas y los cuerpos de aspersores por
separado. En suelos arenosos, se recomienda la instalacin en
cuerpos de aspersores 1800- SAM de Rain Bird.

La boquilla rotativa proporciona una distribucin eficaz del agua a travs de caudales rotativos que suministran el agua de manera uniforme
a un bajo ndice de precipitacin, lo cual reduce significativamente el escurrimiento y la erosin

42

El uso inteligente del agua.

Boquillas aspersoras

www.rainbird.com/sprays

Serie R13-18 (Negro)



Arco
R13-18F

R13-18TQ

R13-18TT

R13-18H

R13-18T

R13-18Q


Presin
psi
20
25
30
3
335
440
45
4
550
55
5
20
2
25
2
30
3
35
3
40
4
45
4
50
5
555
20
2
225
330
35
3
440
45
4
50
5
555
20
2
225
30
3
35
3
440
445
50
5
55
5
220
25
2
30
3
335
440
45
4
550
555
220
225
30
3
335
440
45
4
50
5
555

Serie R13-18 (Negro)



Radio*
pies
13
14
16
16
17
18
18
18
13
14
16
16
17
18
18
18
13
14
16
16
17
18
18
18
13
14
16
16
17
18
18
18
13
14
16
16
17
18
18
18
13
14
16
16
17
18
18
18


Caudal
gpm
1.31
1.46
1.60
1.73
1.85
1.96
2.07
2.17
0.98
1.10
1.20
1.30
1.39
1.47
1.55
1.62
0.87
0.97
1.07
1.15
1.23
1.31
1.38
1.44
0.65
0.73
0.80
0.86
0.92
0.98
1.03
1.08
0.44
0.49
0.53
0.58
0.62
0.65
0.69
0.72
0.33
0.37
0.40
0.43
0.46
0.49
0.52
0.54

Q
Precip.
pulg./h
0.75
0.67
0.61
0.61
0.61
0.61
0.61
0.61
0.75
0.67
0.61
0.61
0.61
0.61
0.61
0.61
0.75
0.67
0.61
0.61
0.61
0.61
0.61
0.61
0.75
0.67
0.61
0.61
0.61
0.61
0.61
0.61
0.75
0.67
0.61
0.61
0.61
0.61
0.61
0.61
0.75
0.67
0.61
0.61
0.61
0.61
0.61
0.61

V
Precip.
pulg./h
0.86
0.77
0.70
0.70
0.70
0.70
0.70
0.70
0.86
0.77
0.70
0.70
0.70
0.70
0.70
0.70
0.86
0.77
0.70
0.70
0.70
0.70
0.70
0.70
0.86
0.77
0.70
0.70
0.70
0.70
0.70
0.70
0.86
0.77
0.70
0.70
0.70
0.70
0.70
0.70
0.86
0.77
0.70
0.70
0.70
0.70
0.70
0.70

Nota: Las boquillas rotativas fueron probadas con vstagos retrctiles de 4 pulgadas (10.2 cm).
Los datos de rendimiento se tomaron en condiciones de cero viento.
* Radio se refiere al espaciamiento recomendado para alcanzar el ndice de precipitacin ptimo y
la uniformidad de la distribucin con el espaciamiento entre aspersor y aspersor
Q Patrn de distribucin cuadrado sobre la base de un alcance del 50% de dimetro
V Patrn de distribucin triangular sobre la base de un alcance del 50% de dimetro

El uso inteligente del agua.


Arco
R13-18F

R13-18TQ

R13-18TT

R13-18H

R13-18T

R13-18Q


Presin
bares
1.4
1.7
22.1
22.4
22.8
33.1
33.4
33.8
1.4
1
1.7
1
22.1
22.4
22.8
33.1
33.4
3.8
3
11.4
11.7
22.1
22.4
22.8
33.1
33.4
33.8
1.4
1
1.7
1
2.1
2
22.4
22.8
33.1
33.4
33.8
11.4
11.7
22.1
22.4
22.8
33.1
33.4
33.8
1.4
1
1.7
1
2.1
2
22.4
22.8
33.1
33.4
33.8

SIST. MTRICO



Radio* Caudal
m
l/m
4.0
4.95
4.3
5.53
4.8
6.06
5.0
6.54
5.2
6.99
5.4
7.42
5.5
7.82
5.6
8.20
4.0
3.71
4.3
4.15
4.8
4.54
5.0
4.91
5.2
5.25
5.4
5.56
5.5
5.86
5.6
6.15
4.0
3.30
4.3
3.69
4.8
4.04
5.0
4.36
5.2
4.66
5.4
4.95
5.5
5.21
5.6
5.47
4.0
2.47
4.3
2.76
4.8
3.03
5.0
3.27
5.2
3.50
5.4
3.71
5.5
3.91
5.6
4.10
4.0
1.65
4.3
1.84
4.8
2.02
5.0
2.18
5.2
2.33
5.4
2.47
5.5
2.61
5.6
2.73
4.0
1.24
4.3
1.38
4.8
1.51
5.0
1.64
5.2
1.75
5.4
1.85
5.5
1.95
5.6
2.05

Q
Precip.
mm/h
19
18
15
15
15
15
15
15
19
18
15
15
15
15
15
15
19
18
15
15
15
15
15
15
19
18
15
15
15
15
15
15
19
18
15
15
15
15
15
15
19
18
15
15
15
15
15
15

V
Precip.
mm/h
22
21
18
18
18
18
18
18
22
21
18
18
18
18
18
18
22
21
18
18
18
18
18
18
22
21
18
18
18
18
18
18
22
21
18
18
18
18
18
18
22
21
18
18
18
18
18
18

No se recomiendan aplicaciones de una sola hilera


No reducir el radio a menos de 13' (4.0 m) en el modelo R13-18 y a menos de 17' (5.2 m)
en el modelo R17-24
En suelos arenosos, se recomienda la instalacin en cuerpos de aspersores 1800- SAM de Rain Bird.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE; ASABE S398.1. El texto
completo de la Declaracin de Certificacin de Prueba ASABE se encuentra en la pgina 234.

43

Boquillas aspersoras

Boquillas rotativas

Boquillas aspersoras
Boquillas rotativas

Serie R17-24 (Amarillo)


Arco
R17-24F
Boquillas aspersoras

R17-24TQ

R17-24TT

R17-24H

R17-24T

R17-24Q

Presin
psi
20
25
30
35
40
45
50
55
20
25
30
35
40
45
50
55
20
25
30
35
40
45
50
55
20
25
30
35
40
45
50
55
20
25
30
35
40
45
50
55
20
25
30
35
40
45
50
55

Serie R17-24 (Amarillo)


Radio*
pies
17
19
21
22
23
23
24
24
17
19
21
22
23
23
24
24
17
19
21
22
23
23
24
24
17
19
21
22
23
23
24
24
17
19
21
22
23
23
24
24
17
19
21
22
23
23
24
24

Caudal
gpm
2.45
2.74
3.00
3.24
3.46
3.67
3.87
4.06
1.84
2.05
2.25
2.43
2.60
2.76
2.90
3.05
1.63
1.83
2.00
2.16
2.31
2.45
2.58
2.71
1.22
1.37
1.50
1.62
1.73
1.84
1.94
2.03
0.82
0.91
1.00
1.08
1.15
1.22
1.29
1.35
0.61
0.68
0.75
0.81
0.87
0.92
0.97
1.02

Q
Precip.
pulg./h
0.79
0.71
0.65
0.65
0.65
0.65
0.65
0.65
0.79
0.71
0.65
0.65
0.65
0.65
0.65
0.65
0.79
0.71
0.65
0.65
0.65
0.65
0.65
0.65
0.79
0.71
0.65
0.65
0.65
0.65
0.65
0.65
0.79
0.71
0.65
0.65
0.65
0.65
0.65
0.65
0.79
0.71
0.65
0.65
0.65
0.65
0.65
0.65

V
Precip.
pulg./h
0.92
0.82
0.75
0.75
0.75
0.75
0.75
0.75
0.92
0.82
0.75
0.75
0.75
0.75
0.75
0.75
0.92
0.82
0.75
0.75
0.75
0.75
0.75
0.75
0.92
0.82
0.75
0.75
0.75
0.75
0.75
0.75
0.92
0.82
0.75
0.75
0.75
0.75
0.75
0.75
0.92
0.82
0.75
0.75
0.75
0.75
0.75
0.75

Nota: Las boquillas rotativas fueron probadas con vstagos retrctiles de 4 pulgadas (10.2 cm).
Los datos de rendimiento se tomaron en condiciones de cero viento.
* Radio se refiere al espaciamiento recomendado para alcanzar el ndice de precipitacin ptimo y
la uniformidad de la distribucin con el espaciamiento entre aspersor y aspersor
Q Patrn de distribucin cuadrado sobre la base de un alcance del 50% de dimetro
V Patrn de distribucin triangular sobre la base de un alcance del 50% de dimetro

44

Arco
R17-24F

R17-24TQ

R17-24TT

R17-24H

R17-24T

R17-24Q

Presin
bares
1.4
1.7
2.1
2.4
2.8
3.1
3.4
3.8
1.4
1.7
2.1
2.4
2.8
3.1
3.4
3.8
1.4
1.7
2.1
2.4
2.8
3.1
3.4
3.8
1.4
1.7
2.1
2.4
2.8
3.1
3.4
3.8
1.4
1.7
2.1
2.4
2.8
3.1
3.4
3.8
1.4
1.7
2.1
2.4
2.8
3.1
3.4
3.8

SIST. MTRICO
Radio*
m
5.2
5.8
6.4
6.7
6.9
7.1
7.3
7.4
5.2
5.8
6.4
6.7
6.9
7.1
7.3
7.4
5.2
5.8
6.4
6.7
6.9
7.1
7.3
7.4
5.2
5.8
6.4
6.7
6.9
7.1
7.3
7.4
5.2
5.8
6.4
6.7
6.9
7.1
7.3
7.4
5.2
5.8
6.4
6.7
6.9
7.1
7.3
7.4

Caudal
l/m
9.27
10.37
11.36
12.26
13.10
13.89
14.65
15.37
6.95
7.78
7.57
8.18
8.74
10.43
11.00
11.53
6.18
6.91
7.57
8.18
8.74
9.27
9.77
10.25
4.62
5.19
5.68
6.17
6.55
6.97
7.34
7.68
3.09
3.46
3.79
4.09
4.37
4.64
4.89
5.13
2.31
2.57
2.84
3.07
3.29
3.48
3.67
3.86

Q
Precip.
mm/h
20
18
16
16
16
16
16
16
20
18
16
16
16
16
16
16
20
18
16
16
16
16
16
16
20
18
16
16
16
16
16
16
20
18
16
16
16
16
16
16
20
18
16
16
16
16
16
16

V
Precip.
mm/h
23
21
19
19
19
19
19
19
23
21
19
19
19
19
19
19
23
21
19
19
19
19
19
19
23
21
19
19
19
19
19
19
23
21
19
19
19
19
19
19
23
21
19
19
19
19
19
19

No se recomiendan aplicaciones de una sola hilera


No reducir el radio a menos de 13' (4.0 m) en el modelo R13-18 y a menos de 17' (5.2 m)
en el modelo R17-24
En suelos arenosos, se recomienda la instalacin en cuerpos de aspersores 1800- SAM de Rain Bird.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE; ASABE S398.1. El texto
completo de la Declaracin de Certificacin de Prueba ASABE se encuentra en la pgina 234.

El uso inteligente del agua.

Boquillas aspersoras

www.rainbird.com/sprays

Boquillas serie R-VAN

Boquillas serie R-VAN

NUEVO

Las boquillas giratorias con arco variable le permiten ajustar


rpidamente el arco y el radio a mano

Q Arco y radio ajustables a mano: no se requiere ninguna herramienta


especial.

Q Un bajo ndice de precipitacin reduce los charcos y la posibilidad de


Boquillas aspersoras

erosin.

Q Una alta uniformidad, chorros gruesos resistentes al viento y gotas de agua


ms grandes garantizan un rendimiento eficiente, aun en condiciones
adversas.

Caractersticas
t"SDPBKVTUBCMFEFB
t$VCSFQFSPEPTEFSJFHPFYJHFOUFTMPTQUJNPTOEJDFTEFQSFDJQJUBDJO
de la R-VAN logran el equilibrio perfecto entre el ndice de aplicacin y de
penetracin
t&TUODPEJGJDBEBTQPSDPMPSQBSBJEFOUJGJDBSFMNPEFMP37"/GDJMNFOUF
t4PODPNQBUJCMFTDPOUPEPTMPTNPEFMPTEFDVFSQPTEFBTQFSTPSFTEF
Rain Bird y con una gran variedad de tuberas de elevacin y adaptadores.
t$VBOEPTFJOTUBMBOKVOUPDPOSPUPSFTEFMBTFSJFRVFJODMVZFOCPRVJMMBT
de precipitacin igualada, permiten crear diseos de riego MPR desde 13a
35 (de 4.0 m a 10.7 m).
Boquilla serie R-VAN

t(BSBOUBDPNFSDJBMEFUSFTBPT

Rango operativo
t3BOHPEFQSFTJOEFBQTJ EFBCBSFT

t3BOHPEFQSFTJOPQFSBUJWBSFDPNFOEBEBQTJ CBSFT

t&TQBDJBNJFOUPEFB EFBN

t"KVTUFTFMBSDPZFMSBEJPTFEFCFOBKVTUBSNJFOUSBTDPSSFFMBHVB

Modelos
tR-VAN1318
%FGMFDUPSSPUBUJWPOFHSP
- Radio de 13 a 18 (de 4.0 a 5.5 m)
- Arco de 45 a 270
tR-VAN1724
%FGMFDUPSSPUBUJWPBNBSJMMP
- Radio de 17 a 24 (de 5.2 a 7.3 m)
- Arco de 45 a 270

Ajuste de Arco

Ajuste de Radio

Notas:
t
t
t
t

/PTFSFDPNJFOEBOBQMJDBDJPOFTEFVOBTPMBIJMFSB
/PTFSFDPNJFOEBRVFFMSBEJPPQFSFQPSEFCBKPEFMSBEJPNOJNP QPSNPEFMP

&OTVFMPTBSFOPTPT TFSFDPNJFOEBMBJOTUBMBDJOEFDVFSQPTEFBTQFSTPSFT4".1EF3BJO#JSE
%BUPTEFSFOEJNJFOUPEFSJWBEPTEFQSVFCBTRVFDVNQMFODPOMBTOPSNBT"4"#&"4"#&4&MUFYUP
completo de la Declaracin de Certificacin de Prueba ASABE se encuentra en la seccin "Boquillas
rotativas" de la pgina 234.

Cmo especificar
R-VAN 1318
Rango de radio
1318: de 13' a 18' (de 4.0 a 5.5 m)
1724: de 17' a 24' (de 5.2 a 7.3 m)

Modelo
Boquilla rotativa ajustable R-VAN

El uso inteligente del agua.

45

Boquillas aspersoras
Boquillas serie R-VAN

R-VAN 1318 (Negro)

R-VAN 1318 (Negro)



Boquilla
Arco 270
270
Boquillas aspersoras

Arco 180

Arco 90


Presin
psi
220
225
330
335
440
445
550
555
220
225
330
335
440
445
550
555
220
225
330
335
440
445
550
555


Radio
pies
13
14
16
16
17
18
18
18
13
14
16
16
17
18
18
18
13
14
16
16
17
18
18
18


Caudal
gpm
0.95
1.12
1.26
1.35
1.42
1.51
1.57
1.62
0.75
0.83
0.85
0.91
0.98
1.01
1.07
1.09
0.37
0.39
0.42
0.47
0.50
0.50
0.54
0.58

Q
Precip.
pulg./h
0.72
0.69
0.65
0.64
0.63
0.60
0.60
0.60
0.72
0.69
0.65
0.64
0.63
0.60
0.60
0.60
0.72
0.69
0.65
0.64
0.63
0.60
0.60
0.60

V
Precip.
pulg./h
0.83
0.80
0.75
0.74
0.73
0.69
0.69
0.69
0.83
0.80
0.75
0.74
0.73
0.69
0.69
0.69
0.83
0.80
0.75
0.74
0.73
0.69
0.69
0.69

Arco 270

Arco 180

Arco 90


Presin
psi
20
225
330
335
440
445
550
555
220
225
330
335
440
445
550
555
220
225
330
335
440
445
50
55

Arco 270
270

Arco 180

Arco 90


Presin
bares
1.4
1
1.7
1
2.1
2
2.4
2
2.8
2
3.1
3
3.4
3
3.8
3
1.4
1
1.7
1
2.1
2
2.4
2
2.8
2
3.1
3
3.4
3
3.8
3
1.4
1
1.7
1
2.1
2
2.4
2
2.8
2
3.1
3
3.4
3
3.8
3


Radio
m
4.0
4.3
4.9
4.9
5.2
5.5
5.5
5.5
4.0
4.3
4.9
4.9
5.2
5.5
5.5
5.5
4.0
4.3
4.9
4.9
5.2
5.5
5.5
5.5


Caudal
l/m
3.60
4.24
4.77
5.11
5.38
5.72
5.94
6.13
2.84
3.14
3.22
3.44
3.71
3.82
4.05
4.13
1.40
1.48
1.59
1.78
1.89
1.89
2.04
2.20

R-VAN 1724 (Amarillo)

R-VAN 1724 (Amarillo)



Boquilla


Boquilla

SIST. MTRICO


Radio
pies
17
19
21
22
23
24
24
24
17
19
21
22
23
24
24
24
17
19
21
22
23
24
24
24


Caudal
gpm
1.77
1.99
2.26
2.39
2.55
2.73
2.76
2.80
1.24
1.30
1.41
1.55
1.69
1.83
1.91
1.98
0.59
0.67
0.73
0.78
0.85
0.91
0.98
1.05

Q
Precip.
pulg./h
0.76
0.72
0.70
0.66
0.63
0.61
0.61
0.61
0.76
0.72
0.70
0.66
0.63
0.61
0.61
0.61
0.76
0.72
0.70
0.66
0.63
0.61
0.61
0.61

V
Precip.
pulg./h
0.88
0.83
0.81
0.76
0.73
0.70
0.70
0.70
0.88
0.83
0.81
0.76
0.73
0.70
0.70
0.70
0.88
0.83
0.81
0.76
0.73
0.70
0.70
0.70

Nota: "Radio" se refiere al espaciamiento recomendado para alcanzar el ndice de precipitacin


ptimo y uniformidad en la distribucin con el espaciamiento entre aspersores.


Boquilla
Arco 270

Arco 180

Arco 90


Presin
bares
1.4
1.7
1
2.1
2
2.4
2
2.8
2
3.1
3
3
3.4
3
3.8
1.4
1
1
1.7
2
2.1
2.4
2
2
2.8
3
3.1
3.4
3
3
3.8
1
1.4
1.7
1
2
2.1
2.4
2
2.8
2
3.1
3
3.4
3.8

Q
Precip.
mm/h
18
18
17
16
16
15
15
15
18
18
17
16
16
15
15
15
18
18
17
16
16
15
15
15

V
Precip.
mm/h
21
20
19
19
18
18
18
18
21
20
19
19
18
18
18
18
21
20
19
19
18
18
18
18

SIST. MTRICO

Radio
m
5.2
5.8
6.4
6.7
7.0
7.3
7.3
7.3
5.2
5.8
6.4
6.7
7.0
7.3
7.3
7.3
5.2
5.8
6.4
6.7
7.0
7.3
7.3
7.3


Caudal
l/m
6.70
7.53
8.56
9.05
9.65
10.33
10.45
10.60
4.69
4.92
5.34
5.87
6.40
6.93
7.23
7.50
2.23
2.54
2.76
2.95
3.22
3.44
3.71
3.97

Q
Precip.
mm/h
19
18
18
17
16
15
15
15
19
18
18
17
16
15
15
15
19
18
18
17
16
15
15
15

V
Precip.
mm/h
22
21
21
19
18
18
18
18
22
21
21
19
18
18
18
18
22
21
21
19
18
18
18
18

Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.


V Patrn de distribucin triangular basado en un alcance del 50% del dimetro.

Los datos de rendimiento se tomaron en condiciones de cero viento.

46

El uso inteligente del agua.

Boquillas aspersoras

1300A-F

Serie 1400

Burbujeador ajustable de crculo completo

Burbujeadores de crculo completo con compensacin de presin

Caractersticas

Caractersticas

t$BVEBMUPUBMNFOUFBKVTUBCMF

t-PTOEJDFTEFDBVEBMCBKPTQFSNJUFORVFFMBHVBTFBCTPSCBTFHOTFB
necesario. Reducen la erosin

t4FFOWBDPONBMMBEFGJMUSPEFFOUSBEB4312" (1.3 cm) (15/21) para


proporcionar una fcil instalacin y resistencia a las partculas de suciedad
t'VODJPOBDPOVOBNQMJPSBOHPEFQSFTJPOFT

t.BOUJFOFVODBVEBMDPOTJTUFOUFBQSFTJPOFTFOUSFZQTJ
(de 1.4 a 6.2 bares).

t&TUSVDUVSBOPDPSSPTJWBEFQMTUJDPZBDFSPJOPYJEBCMFTEFMBSHBWJEBUJM

t&MDBVEBMOPTFQVFEFBKVTUBSQBSBMPHSBSVOBNBZPSSFTJTUFODJBBMWBOEBMJTNP

t(BSBOUBDPNFSDJBMEFDJODPBPT

t/PFTOFDFTBSJPBKVTUBSMP

Rango operativo

t&TUSVDUVSBEFQMTUJDPZHPNBSFTJTUFOUFBMBDPSSPTJOQBSBMPHSBSVOBMBSHB
vida til
t(BSBOUBDPNFSDJBMEFDJODPBPT

t$BVEBMEFBHQN EFBMN


t4FFOWBDPONBMMBEFGJMUSP4312" (1.3 cm) (15/21) para proporcionar una


fcil instalacin y resistencia a las partculas de suciedad

t&TQBDJBNJFOUPEFBQJFT EFBN

t1SFTJOEFBQTJ EFBCBSFT

t1BUSOEFHPUFPFOMPTNPEFMPTZQBUSOEFDPOPFOMPTNPEFMPT
1404 y 1408

Dimensiones
t&OUSBEBIFNCSBSPTDBEBEFc 


Rango operativo

t"MUVSB DN

t$BVEBMEFBHQN EFBMN

t%JNFUSPTVQFSJPS DN

t&TQBDJBNJFOUPEFBQJFT EFBN

t1SFTJOEFBQTJ EFBCBSFT

Modelo
t"'

Dimensiones
t&OUSBEB12" entrada hembra roscada (15/21)
t"MUVSB DN

t%JNFUSPTVQFSJPS DN

1300A-F

1300A-F

Boquilla Presin Caudal


psi
gpm
F
10
1.0

Boquilla Presin
bares
F
0.7

20
30
40
50
60

1.4
1.7
1.9
2.1
2.3

1.0
1.5
2.0
2.5
3.0
3.5
4.0
4.1

SIST. MTRICO
Radio
m3h

0.23
0.26
0.30
0.34
0.39
0.43
0.48
0.52
0.53

Caudal
l/m

3.6
4.2
4.8
5.4
6.0
7.2
7.8
8.4
8.4

Modelos
tHQN N3h; 0.9 l/m); crculo completo, patrn de goteo
tHQN N3h; 1.8 l/m); crculo completo, patrn de goteo
tHQN N3h; 3.6 l/m); crculo completo, patrn de cono
tHQN N3h; 7.2 l/m); crculo completo, patrn de cono

Serie 1400

1300A-F

El uso inteligente del agua.

47

Boquillas aspersoras

www.rainbird.com/sprays

Burbujeadores

Rotores
Introduccin
Cuerpos de
aspersores
Boquillas aspersoras
Rotores
Impactos

"Una vez que mis clientes verdaderamente


notan la diferencia que hacen las boquillas
Rain Curtain, solo se conformarn con
los rotores Rain Bird. Realmente me han
ayudado a desarrollar mi empresa".

Vlvulas

Dennis Hoffman
Grasshopper Irrigation, Inc.

Productos principales

Rotor de
cubierta cerrada

Rotores de cubierta cerrada

Accesorios

Aplicaciones primarias
Csped de 15' a 30' (4.6 m a 9.14 m)

Programadores

Csped de 25' a 50' (7.6 a 15.2 m)


Csped de ms de 50' (15.2 m)
Uso residencial

Sistemas de control
centralizado

Uso comercial
reas propensas a vandalismo/daos
Pendientes
Cubierta vegetal/Arbustos

Xerigation

Campos deportivos
Regulador de presin

5000
Serie

5505
Serie

8005
Serie

Falcon 6504
Serie

2045A Maxi-Paw
Serie

t
t
tt

tt
tt
tt
t
tt
t

tt
tt
tt
t
t
tt
t

tt
tt
t
tt
tt

tt
t
t
tt
t

t
tt
t

t
t

reas de viento excesivo


Csped ms alto
Agua no potable

Bombas

3504
Serie

t
t

Sugerencias para ahorrar agua


Drenaje

t La tecnologa de las boquillas

Recursos

Rain Curtain es la opcin


estndar en cuanto al
rendimiento de las boquillas para
el ahorro de agua. El rendimiento
de Rain Curtain est disponible
en todos los rotores Rain Bird.

t Los rotores Serie 5000 con PRS


reducirn el desperdicio de agua de un
15% a un 45%. Al eliminar la variacin
de presin o el exceso de presurizacin,
ahorrar agua y obtendr un csped
ms verde.

t 5PEPTMPTSPUPSFTDPOWMWVMBTEF
retencin Seal-a-Matic (SAM) evitan
el drenaje de los aspersores que estn
en los niveles ms bajos, detienen el
desperdicio de agua y eliminan el
dao del terreno causado por las
inundaciones o la erosin.

Referencia

48

El uso inteligente del agua.

Rotores

www.rainbird.com/rotors

Informacin general

Una familia completa que facilita su trabajo.

La tapa violeta indica


el uso de agua no potable

Ranuras para ajustar el


arco de riego izquierdo o
derecho
Torreta reforzada con
bronce

Vstago retrctil de acero


inoxidable para una mayor

Ranura para ajustar el


arco de riego a crculo
completo/parcial

Rotores

Tapa color caf Versin


de alta velocidad para la
eliminacin de polvo

Ranura Side Pry

proteccin contra el vandalismo

Dispositivo deinterrupcin
de caudal con tapa verde
Ranura de ajuste del arco
Ranura de ajuste del radio

Indicador PRS/SAM para


identificar rpidamente

Portaboquilla de
radio corto
serie 5500

Boquillas Rain
Curtain serie
5500

Boquillas Rain
Curtain series
6504 y 8005

Portaboquilla serie 3500 que


incluye seis boquillas Rain Curtain

Portaboquilla serie 5000 que


incluye cuatro boquillas Rain Curtain de
ngulo bajo y ocho boquillas de ngulo
estndar

El uso inteligente del agua.

ROTORTOOL Dos
heramientas en una sola unidad,
destornillador plano y gancho
para el vstago a la vez

Juntas articuladas de las series


TSJ y TSJ-PRS que conectan rotores
o vlvulas de acoplamiento rpido a las
tuberas laterales

49

Radio del rotor del cuadro de alcance y

Rotores
Informacin general

regulacin de presin

Ya sea que se utilicen para


aplicaciones residenciales
o comerciales, los rotores
Rain Bird lo cubren todo.

3500
de 15' a 35'
(de 4.6 m a 10.7 m)

Serie 3500

Rotores

Los rotores de Rain Bird


establecen la pauta de durabilidad
e incluyen caractersticas que
garantizan un rendimiento
confiable. Existe un rotor de
Rain Bird para cada aplicacin:
para baja presin y pendientes
pronunciadas, en reas de
viento excesivo, con agua no
potable e incluso en reas
donde el vandalismo podra
ser un problema. Opte por los
rotores de Rain Bird para lograr el
propsito que desee y obtenga
los resultados esperados.

Serie 5000

de 0.37 a 0.83 pulg./h


(de 9 a 22 mm/h)

de 0.20 a 1.01 pulg./h


(de 5 a 26 mm/h)

de 25 a 55 psi
(de 1.7 a 3.8 bares)

de 25 a 65 psi
(de 1.7 a 4.5 bares)

de 0.54 a 4.6 gpm


(de 1.8 a 17.4 l/m)
(de 0.12 a 1.04 m3/h)

de 0.73 a 9.63 gpm


(de 4.2 a 36.6 l/m)
(de 0.17 a 2.19 m3/h)

4" (10.2 cm)

Adaptador para
arbustos: 4" (10.2 cm)
6" (15.2 cm)
12" (30.5 cm)
Adaptador para
arbustos: 7 3/4"
(19.7cm)
4": 7 3/8" (18.5 cm)
6": 9 5/8" (24.5 cm)
12": 16 7/8" (42.9 cm)

Arbusto: 7" (17.8 cm)


4": 6.6" (16.8 cm)
w/15 


 
/15

Caractersticas estndar

Caractersticas estndar

t El portaboquilla incorporado de seis


boquillas Rain Curtain ofrece un
rendimiento superior.

t Embrague deslizante para encontrar el borde


izquierdo.

t Para ajustar el arco por la parte superior


del aspersor solo se requiere un
destornillador plano

t Boquillas Rain Curtain.

t 5PSOJMMPEFBKVTUFEFMSBEJP RVFQFSNJUF
una reduccin del radio de hasta un 25%
sin cambiar de boquillas.
t 'VODJOEFWFSJDBDJOSQJEBEFMBSDP
BWBODFSQJEP 2VJDLDIFDLBSDGBTU
forward)
t 'JMUSPEFNBMMBGDJMEFRVJUBS
t +VOUBMJNQJBEPSBNVMUJGVODJOEFEPCMF
accin protege el mecanismo interno
de la suciedad y garantiza una buena
elevacin y retraccin del vstago
t Garanta comercial de tres aos.

t Boquillas de ngulo estndar y ngulo bajo


(incluidas).
t Garanta de cinco aos.

Opciones
t Dispositivo de interrupcin de caudal Plus
(PL). "El de la tapa verde". Reduce el tiempo
de inactividad en las tareas limpiando y
pulverizando los rotores sin tener que caminar
hasta los controladores o las vlvulas.
t PRS (R) DPOUFDOPMPHB'MPX0QUJNJ[FS&M
regulador de presin de 45 psi reduce el costo
de las facturas de agua, proporciona el caudal
exacto para cada rotor, equilibra las lneas
laterales y elimina la nebulizacin y la neblina.

Opciones

t Vlvula de retencin Seal-A-Matic.

t Vlvulas de retencin SAM Seal-A-Matic


que previenen la erosin y el drenaje de
los aspersores bajos.

t Vstago retrctil de acero inoxidable SS


que ayuda a impedir el vandalismo en reas
pblicas con csped (disponible en los
modelos de 4 y 6 pulgadas).

t Tapa violeta (NP) que facilita la


identificacin de los sistemas para agua
no potable.

50

t Puerto autolimpiante.

t Tapa violeta (NP) para sistemas de agua no


potable.

El uso inteligente del agua.

Tecnologa de boquillas Rain Curtain

Rotores
Informacin general

www.rainbird.com/rotors

5000

5505

6504

8005

de 25' a 50'
(de 6.1 m a 15.2 m)

de 17' a 55'
(de 5.2 m a 16.8 m)

de 39' a 65'
(de 11.9 m a 19.8 m)

de 39' a 81'
(de 11.9 m a 24.7 m)

Falcon 6504
Serie

de 0.21 a 1.48 pulg./h


(de 6.3 a 33.8 mm/h)

Serie 8005
de 0.48 a 1.23 pulg./h
(de 12 a 31 mm/h)

de 0.37 a 1.14 pulg./h


(de 9 a 29 mm/h)

de 40 a 90 psi
(de 2.8 a 6.2 bares)

de 50 a 100 psi
(de 3.5 a 6.9 bares)

de 30 a 90 psi
(de 2.1 a 6.2 bares)

de 1.2 a 15.5 gpm


(de 4.5 a 58.9 l/m)
(de 0.32 a 3.52 m3/h)

de 3.8 a 36.3 gpm


(de 14.4 a 137.4 l/m)
(de 0.86 a 8.24 m3/h)

de 2.9 a 21.7 gpm


(de 10.8 a 82.2 l/m)
(de 0.66 a 4.93 m3/h)

5" (12.7 cm)

5" (12.7 cm)


4" (10.2 cm)

 DN

1018" (25.7 cm)


 DN

 
/15

/15P#41EF
(2.5 cm) (26/34)

/15P#41EF
(2.5 cm) (26/34)

Caractersticas estndar

Caractersticas estndar

Caractersticas estndar

t Resistente al vandalismo

t Vstago de trinquete igual que los cuerpos


de aspersores estndar.

t Resistente al vandalismo

t 5PSSFUBSFGPS[BEBDPOCSPODFQBSB
aumentar la durabilidad ante los golpes
laterales.
t 5SBOTNJTJOBOUJEFTHBTUFOPFYUSBCMF
t Memoria de arco

t Boquillas Rain Curtain de tres puertos,


codificadas por color para un riego ptimo
de largo y mediano alcance y cercano al
cabezal.

t Crculo completo y parcial en un solo


cabezal.

t 'DJMBKVTUFEFMBSDP NPEFMPEFDSDVMP
parcial) desde la parte superior del rotor de
B

t Ajuste independiente de los arcos de


cobertura derecho e izquierdo.

t Vlvula de retencin Seal-A-Matic.

t Vlvula de retencin Seal-A-Matic.


t Boquillas Rain Curtain.

t Esttor autoajustable que no requiere


reemplazo al cambiar las boquillas

t Garanta de cinco aos.

t Resorte retrctil de acero inoxidable y


gran resistencia que garantiza una buena
retraccin

Opciones

t Garanta de cinco aos.

t Vstago retrctil de acero inoxidable SS


que ayuda a impedir el vandalismo en
reas pblicas con csped.

Opciones

t Tapa violeta (NP) para sistemas de agua


no potable.

t Vstago retrctil de acero inoxidable SS que


ayuda a impedir el vandalismo en reas
pblicas con csped.
t Tapa violeta (NP) para sistemas de agua no
potable.
t Versin de alta velocidad (HS) con tapa
color caf para la eliminacin de polvo.

t 5PSSFUBSFGPS[BEBDPOCSPODFQBSB
aumentar la durabilidad ante los golpes
laterales.
t 5SBOTNJTJOBOUJEFTHBTUFOPFYUSBCMF
t Memoria de arco
t Crculo completo y parcial en un solo
cabezal.
t Ajuste independiente de cobertura
izquierda y derecha.
t Vlvula de retencin Seal-A-Matic.
t Boquillas Rain Curtain de tres puertos,
codificadas por color para un riego ptimo
de largo y mediano alcance y cercano al
cabezal.
t Garanta de cinco aos.

Opciones
t Vstago retrctil de acero inoxidable SS
que ayuda a impedir el vandalismo en
reas pblicas con csped.
t Tapa violeta (NP) para sistemas de agua
no potable.

Consulte la pgina 75 de referencia para intercambiar boquillas correctamente al reemplazar rotores de la competencia por los rotores de Rain Bird.

El uso inteligente del agua.

51

Rotores

Serie 5505

Rotores
Serie 3504

Serie 3504

Opciones

'DJMEFVTBS EJGDJMEFTVQFSBS

t5BQBWJPMFUBRVFGBDJMJUBMBJEFOUJGJDBDJOEFMPTTJTUFNBTQBSBBHVBOPQPUBCMF
t7MWVMBEFSFUFODJO4FBM".BUJD (SAM) que
retiene hasta 7 pies (2.1 m) de cambio de elevacin,
para evitar el encharcamiento y la erosin provocados por el drenaje de los
aspersores bajos

Q Csped ms verde con menos agua: las boquillas Rain Curtain ofrecen un
rendimiento superior
Q Vstago retrctil de altura real de 4" (10.2 cm), medido desde la tapa hasta
la boquilla
Q Confiabilidad: garanta comercial de tres aos

Caractersticas

Rotores

t5FDOPMPHBEFCPRVJMMBT3BJO$VSUBJO
- El accesorio portaboquilla de seis boquillas Rain Curtain ofrece:
t (PUBTEFHSBOUBNBPQBSBVOSFOEJNJFOUPDPOTUBOUF
t 3JFHPDFSDBOPBMDBCF[BMFGJDB[
t %JTUSJCVDJOVOJGPSNFTPCSFUPEPFMSBEJP
t*OTUBMBDJOZNBOUFOJNJFOUP
- Para ajustar el arco por la parte superior del aspersor solo se requiere un
destornillador plano
 5PSOJMMPEFBKVTUFEFMSBEJP RVFQFSNJUFVOBSFEVDDJOEFMSBEJPEF
hasta un 25% sin cambiar de boquillas
 'VODJOEFWFSJGJDBDJOSQJEBEFMBSDPBWBODFSQJEP 2VJDLDIFDLBSDGBTU
forward)
- Estator autoajustable que no requiere reemplazo al
cambiar las boquillas
- Malla de filtro fcil de quitar
 'VODJOEFFYUSBDDJOEFMBCPRVJMMB
t4PMVDJPOFTEFEJTFP
- El rotor Serie 3504 se encuentra disponible en los modelos con
adaptador para arbustos, de 4 (10.2 cm) y SAM.
- La tapa de goma y el tornillo de ajuste del arco de limpieza automtica
reduce la intrusin de suciedad y mejora la confiabilidad
 3PUBDJOEFMBSDPEFDSDVMPQBSDJBMEFBZSPUBDJOJOWFSTB
de crculo completo en la misma unidad
t%VSBCJMJEBE
 %JTFPEFFOHSBOBKFEFUSBOTNJTJOMVCSJDBEPDPOBHVBQBSBVO
funcionamiento duradero y confiable
 +VOUBMJNQJBEPSBNVMUJGVODJOEFFTUBORVFJEBE EFEPCMFBDDJO RVF
protege el mecanismo interno de la suciedad y garantiza una buena
elevacin y retraccin del vstago

Rango operativo
tOEJDFEFQSFDJQJUBDJOEFBQVMHBEBTQPSIPSB EFBNNI

t3BEJPEFBQJFT EFBDN

t&MSBEJPQVFEFSFEVDJSTFIBTUBVODPOFMUPSOJMMPEFSFEVDDJOEFMSBEJP
t1SFTJOEFBQTJ EFBCBSFT

tOEJDFEFGMVKPEFBHQN EFBMN

Especificaciones
t&OUSBEBIFNCSBSPTDBEBJOGFSJPS/15EF1/2 (1.3 cm)
t"KVTUFEFDSDVMPDPNQMFUPZEFDSDVMPQBSDJBMEFB

Dimensiones
t"MUVSBEFMWTUBHPSFUSDUJM DN

t"MUVSBUPUBMEFMDVFSQP"SCVTUP DN
 DN

t%JNFUSPEFMBTVQFSGJDJFFYQVFTUB DN

Nota: la altura del vstago retrctil se mide desde la tapa hasta la boquilla. La altura total
del cuerpo no se mide con el vstago elevado

Modelos
Las unidades de crculo parcial (PC) son ajustables desde 40 a 360 grados.
t1$
t1$4".
t1$4"./1
t44".

Cmo especificar
3504 - S - PC - SAM - NP
Opciones
44".
/15BQBQBSBBHVB
no potable
Rotacin
Crculo parcial
Modelo
Adaptador para arbustos

Modelo
Modelo Vstago retrctil de 4" (10.2 cm) Serie 3500

3504-PC

Como todos lo rotores Rain Bird, los rotores Serie 3500 utilizan la tecnologa de boquillas Rain Curtain para brindar los resultados esperados,
al mismo tiempo que administran inteligentemente el agua.

52

El uso inteligente del agua.

Rotores

www.rainbird.com/rotors

Serie 3504

Presin
psi

Boquilla

25

0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0

35

45

55

Radio
pies
15
20
23
27
29
31
17
21
23
27
31
33
17
21
24
27
31
35
18
22
24
28
32
35

Caudal
gpm
0.54
0.77
1.06
1.40
2.17
2.97
0.67
0.92
1.28
1.69
2.60
3.58
0.77
1.06
1.48
1.93
3.00
4.13
0.85
1.18
1.65
2.15
3.25
4.60

Q
Precip.
pulg./h
0.46
0.37
0.39
0.37
0.50
0.59
0.45
0.40
0.47
0.45
0.52
0.63
0.51
0.46
0.49
0.51
0.60
0.65
0.51
0.47
0.55
0.53
0.61
0.72

V
Precip.
pulg./h
0.53
0.43
0.45
0.43
0.57
0.69
0.52
0.46
0.54
0.52
0.60
0.73
0.59
0.53
0.57
0.59
0.69
0.75
0.58
0.54
0.64
0.61
0.71
0.83

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.

Presin
bares
1.7

2.0

2.5

3.0

3.5

Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.


VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE; ASABE
S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se encuentra
en la pgina 234.

El uso inteligente del agua.

3.8

Boquilla
0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0

Radio
m
4.6
6.1
7.0
8.2
8.8
9.4
4.8
6.2
7.0
8.2
9.1
9.7
5.2
6.4
7.0
8.2
9.4
10.1
5.2
6.4
7.3
8.2
9.4
10.6
5.4
6.6
7.3
8.4
9.6
10.7
5.5
6.7
7.3
8.5
9.8
10.7

Caudal
m3h
0.12
0.17
0.24
0.32
0.49
0.67
0.13
0.19
0.26
0.34
0.53
0.73
0.16
0.21
0.30
0.39
0.60
0.83
0.17
0.24
0.33
0.43
0.67
0.92
0.19
0.26
0.36
0.47
0.71
1.00
0.19
0.27
0.37
0.49
0.74
1.04

Caudal
l/m
2.04
2.91
4.01
5.30
8.21
11.24
2.24
3.14
4.35
5.74
8.87
12.17
2.58
3.55
4.94
6.51
10.03
13.82
2.86
3.93
5.49
7.17
11.13
15.32
3.09
4.27
5.97
7.79
11.90
16.66
3.22
4.47
6.25
8.14
12.30
17.41

Q
Precip.
mm/h
12
9
10
9
13
15
12
10
11
10
13
16
12
10
12
12
13
16
13
12
12
13
15
16
13
12
13
13
15
18
13
12
14
13
16
18

V
Precip.
mm/h
14
11
11
11
15
17
13
11
12
12
15
18
13
12
14
13
16
19
15
13
14
15
17
19
15
14
15
15
18
20
15
14
16
15
18
21

53

Rotores

Rendimiento de las boquillas de la serie 3504 SIST. MTRICO

Rendimiento de las boquillas de la serie 3504

Rotores
Serie 5000

Serie 5000
Rendimiento inigualable para aplicaciones residenciales y
comerciales pequeas

Q Csped ms verde con menos agua: las boquillas Rain Curtain ofrecen un
rendimiento superior

Q Mucho ms ahorro de agua con regulacin de presin en el vstago


opcional (PRS)

Q Instalacin ms rpida con ndice de precipitacin ajustado al utilizar el


conjunto de boquillas MPR (ver pgina 61)

Caractersticas
Rotores

t5FDOPMPHBEFCPRVJMMBT3BJO$VSUBJO
- Boquillas Rain Curtain estndar en todos los rotores Serie 5000
t (PUBTEFHSBOUBNBPQBSBVOBNBZPSSFTJTUFODJBBMWJFOUP
t 3JFHPDFSDBOPBMDBCF[BMFGJDB[
t %JTUSJCVDJOVOJGPSNFTPCSFUPEPFMSBEJP
- Portaboquilla que incluye cuatro boquillas de ngulo bajo (ngulo de
trayectoria de 10) y ocho boquillas de ngulo estndar Rain Curtain
(ngulo de trayectoria de 25) que proporciona una distancia de alcance de
25 a 50 pies (7.6 a 15.2 m)
- Boquillas autoalineantes
t*OTUBMBDJOZNBOUFOJNJFOUP
- Mecanismo de embrague de deslizamiento para un rpido ajuste durante
la instalacin
- Mantenimiento ms rpido con un nuevo tornillo de ajuste del arco de
limpieza automtica
- La serie 5000 Plus cuenta con un interruptor de flujo para detener el flujo
de agua de un aspersor en particular mientras el sistema todava est
funcionando.
- Para ajustar el arco por la parte superior del aspersor solo se requiere un
destornillador plano
 5PSOJMMPEFBKVTUFEFMSBEJP RVFQFSNJUFVOBSFEVDDJOEFMSBEJPEFIBTUB
un 25% sin cambiar de boquillas.
t4PMVDJPOFTEFEJTFP
- Serie 5000 en 4", 6" y 12" (10.2 cm, 15.2 cm y 30.5 cm) disponible con
adaptador para arbustos o en acero inoxidable
- Modelos de la serie 5000 de 4 y 6 pulgadas disponibles en
acero inoxidable
- Conjunto galardonado de boquillas MPR que simplifica el diseo y la
instalacin al proporcionar ndices de precipitacin ajustados de 25' a 35'
(de 7.6 a 10.7 m)
 5BQBEFHPNBFTUOEBSQBSBNBZPSQSPUFDDJO-BTFSJFDVFOUBDPO
una tapa verde mientras que la serie 5000 posee una tapa negra
 3PUBDJOEFMBSDPEFDSDVMPQBSDJBMEFBZSPUBDJOJOWFSTBEF
DSDVMPDPNQMFUPFOMBNJTNBVOJEBE 5BNCJOFTUEJTQPOJCMFMBVOJEBE
nicamente con crculo completo no reversible)
- Vstago retrctil de 4 (10.2 cm), 6 (15.2 cm) y 12 (30.5 cm) reales, medidos
desde la tapa hasta la boquilla
t%VSBCJMJEBE
- Ensamble de tapa de goma de gran resistencia para mayor durabilidad en
aplicaciones residenciales o comerciales
- Resorte retrctil de gran resistencia que garantiza una buena retraccin

- Sello limpiador de mltiples funciones activado a presin, que protege


el mecanismo interno de la suciedad y garantiza una buena elevacin y
retraccin del vstago.
- Empaques y sellos adicionales para brindar mayor proteccin en el agua
"arenosa"
- Garanta comercial de cinco aos.
t0QDJPOFT
 5VCFSBEFFMFWBDJOEFBDFSPJOPYJEBCMFRVFBZVEBBJNQFEJSFMWBOEBMJTNP
en reas pblicas con csped de (nicamente en 4" y 6" [10.2 cm y 15.2 cm]).
- Boquilla Rain Curtain preinstalada en las combinaciones ms populares de la
Serie 5000 y de boquillas
- Vlvula de retencin Seal-A-Matic (SAM), que retiene hasta 7 pies (2.1 m) de
cambio de elevacin, para evitar el encharcamiento y
la erosin provocados por el drenaje de los aspersores bajos
 5BQBWJPMFUBRVFGBDJMJUBMBJEFOUJGJDBDJOEFMPTTJTUFNBTQBSBBHVBOPQPUBCMF

12"
6"
4"
Adaptador
para
arbustos

Se incluyen boquillas de ngulo bajo


de 10 y boquillas estndar de 25

Todas las boquillas estn


numeradas en galones
por minuto

Vista frontal

{%FTFBMPHSBSMBDPNCJOBDJOEFSJFHPNTFGJDJFOUF 4FMFDDJPOFMPTSPUPSFT4FSJFDPOCPRVJMMBT4". 134Z.13:BTFBRVFDPOGFFOMBTCPRVJMMBT


Rain Curtain para obtener un riego eficiente o en las boquillas MPR para garantizar ndices de precipitacin ajustados, los rotores de la serie 5000 brindan
soluciones que administran el agua de manera inteligente.

54

El uso inteligente del agua.

Rotores

www.rainbird.com/rotors

Serie 5000

La confiabilidad y el rendimiento de la serie 5000 tambin son disponibles con estas excelentes caractersticas.
Plus (PL)

PRS (R)

SAM

APAGADOR DE FLUJO

REGULACIN DE PRESIN

VLVULA DE RETENCIN

Encendido

Sin PRS

Sin SAM

Apagado

Con PRS

Con SAM

& "" 


%$
!!
& ""%"
!"#'#"
!
& "!" "
!  % " %

PRS con tecnologa Flow Optimizer


&  #"$ !"
%"$! )   
&  "#
$a
&
"" !")"
!'

Rotores

Con tapa verde

& # " " 


% ' 
   $  
"  !"!"
 !" !"( 
! ""' 
"#.

Cmo especificar
Modelo

Caractersticas estndar

Caractersticas opcionales

Opciones de boquilla

Arbustos 5000

Identificador del borde izquierdo


con embrague deslizante.
8 boquillas estndar de 25 grados
4 boquillas de ngulo bajo de 10 grados
Orificio de la boquilla con muesca
Crculo parcial (PC)
$SDVMPDPNQMFUP '$

PL
R
%
NP
SS

Boquilla
1.5
2.0
3.0
4.0

5004
5006
5012

Cierre por flujo "Plus"


Regulacin de presin PRS
Vlvula de retencin SAM
No potable
Elevador de acero inoxidable

Los rotores con boquilla preinstalada


solo estn disponibles en determinados
modelos.

Ejemplos
5000PCS

Arbusto, crculo parcial con vlvula de retencin

5004PC2.0

Vstago retrctil de 4", crculo parcial, con boquilla 2.0

5006PCPLRS

Vstago retrctil de 6", crculo parcial, con interruptor de caudal, regulacin de presin y vlvula de retencin

El uso inteligente del agua.

55

Rotores
Serie 5000

Serie 5000 (cont.)


Rango operativo
tOEJDFEFQSFDJQJUBDJOEFBQVMHBEBTQPSIPSB EFBNNI

t3BEJPEFBQJFT EFBDN

t&MSBEJPQVFEFSFEVDJSTFIBTUBVODPOFMUPSOJMMPEFSFEVDDJOEFMSBEJP
t1SFTJOEFBQTJ EFBCBSFT

t5BTBEFDBVEBMEFBHQN EFBMN

Rendimiento de las boquillas Rain Curtain


de ngulo estndar con PRS de la serie 5000
Presin
psi

Boquilla

25

1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0

Especificaciones
t&OUSBEBIFNCSBSPTDBEBJOGFSJPS/1534" (20/27)
t"KVTUFJOWFSTPEFDSDVMPDPNQMFUPZEFDSDVMPQBSDJBMEFB
t"KVTUFEFDSDVMPDPNQMFUPEFOJDBNFOUF
Rotores

Dimensiones

35

t"MUVSBEFMWTUBHPSFUSDUJM"EBQUBEPSQBSBBSCVTUPT DN
 
cm); 12" (30.5 cm)
t"MUVSBUPUBMEFMDVFSQP"EBQUBEPSQBSBBSCVTUPT34" (19.7cm) 4": 7 38" (18.5
cm); 6": 9 58" (24.5 cm); 12": 16 78" (42.9 cm)
t%JNFUSPEFMBTVQFSGJDJFFYQVFTUB58" (4.1 cm)
Nota:la altura del vstago retrctil se mide desde la tapa hasta la boquilla. La altura total
del cuerpo no se mide con el vstago elevado.

Caracterstica opcional de PRS


t&MSFHVMBEPSEFQSFTJOFOFMWTUBHP 134
SFEVDF
EXCLUSIVO!
la presin operativa a 45 psi (3.1 bares) para
IN 5000 PLUS
lograr un rendimiento ptimo de la boquilla
t&M134BIPSSBBHVB
- Porque elimina las variaciones de presin del
espaciamiento entre aspersor y aspersor.
- Porque elimina la nebulizacin causada por la alta presin.
- Mejorando la uniformidad de la distribucin de la boquilla al hacerla
funcionar a una presin ptima
t1SFTJOEFBQTJ EFBCBSFT

45

55

Modelos
Las unidades de crculo parcial (PC) son ajustables desde 40 a 360 grados.
-BTVOJEBEFTEFDSDVMPDPNQMFUP '$
TPOEFHSBEPTOJDBNFOUF
t 1$P'$
 4".
 3

t 1$P'$

t 1$P'$

t41- 1$P'$
 4".
 3
 /1
FTUOEBSDPO4".
t1- 1$P'$
 4".
 3
 /1
 44

t1- 1$P'$
 4".
 3
 /1
 44

t1- 1$P'$
 4".
 3
 /1

Nota: Varios modelos estn disponibles con una boquilla 2.0 o 3.0 preinstalada.
Las versiones NP y SS son estndar e incluyen un SAM. R = PRS

65

Radio
pies
33
35
35
36
37
39
39
36
34
36
37
38
40
41
43
43
35
37
37
40
42
45
46
47
35
37
37
40
42
45
47
50
34
35
37
40
42
45
48
50

Caudal
gpm
1.12
1.50
1.81
2.26
2.91
3.72
4.25
5.90
1.35
1.81
2.17
2.71
3.50
4.47
5.23
7.06
1.54
2.07
2.51
3.09
4.01
5.09
6.01
8.03
1.71
2.30
2.76
3.47
4.44
5.66
6.63
8.86
1.86
2.52
3.01
3.78
4.83
6.16
7.22
9.63

Q
Precip.
pulg./h
0.20
0.24
0.28
0.34
0.41
0.47
0.54
0.88
0.22
0.27
0.31
0.36
0.42
0.51
0.54
0.74
0.24
0.29
0.35
0.37
0.44
0.48
0.55
0.70
0.27
0.32
0.39
0.42
0.48
0.54
0.58
0.68
0.31
0.40
0.42
0.45
0.53
0.59
0.60
0.74

V
Precip.
pulg./h
0.23
0.27
0.33
0.39
0.47
0.54
0.62
1.01
0.26
0.31
0.35
0.42
0.49
0.59
0.63
0.85
0.28
0.34
0.41
0.43
0.51
0.56
0.63
0.81
0.31
0.37
0.45
0.48
0.56
0.62
0.67
0.79
0.36
0.46
0.49
0.53
0.61
0.68
0.70
0.86

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.


Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

56

El uso inteligente del agua.

Rotores

Rendimiento de las boquillas Rain Curtain


de ngulo estndar con PRS de la serie 5000
Presin
bares

Boquilla

1.7

1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0

2.0

2.5

3.0

Radio Caudal Caudal


m
m3h l/m
10.10 0.25 4.2
10.70 0.34 5.4
10.70 0.41 6.6
11.00 0.51 8.4
11.3
0.66 10.8
11.90 0.84 13.8
11.90 0.97 16.2
11.00 1.34 22.2
10.20 0.28 4.8
10.80 0.36 6.0
10.90 0.44 7.2
11.20 0.55 9.0
11.6
0.71 12.0
12.10 0.91 15.0
12.40 1.05 17.4
11.80 1.45 24.0
10.40 0.31 5.4
11.00 0.41 6.6
11.30 0.50 8.4
11.20 0.62 10.2
12.3
0.81 13.2
12.70 1.03 17.4
13.20 1.21 20.4
13.30 1.63 27.0
10.60 0.34 6.0
11.20 0.45 7.8
11.30 0.56 9.6
12.10 0.69 11.4
12.7
0.89 15.0
13.50 1.13 18.6
13.90 1.34 22.2
14.10 1.79 30.0

Q
Precip.
mm/h
5
6
7
8
10
12
14
22
5
6
7
9
11
12
14
21
6
7
8
9
11
13
14
19
6
7
9
9
11
12
14
18

V
Precip.
mm/h
6
7
8
10
12
14
16
26
6
7
9
10
12
14
16
24
7
8
9
11
13
15
16
21
7
8
10
11
13
14
16
21

Presin
bares

Boquilla

3.5

1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0

4.0

4.5

SIST. MTRICO
Q
V
Radio Caudal Caudal Precip. Precip.
m
m3h l/m
mm/h mm/h
10.70 0.37 6.0
7
8
11.30 0.49 8.4
8
9
11.30 0.60 10.2 9
11
12.20 0.74 12.6 10
12
12.8
0.97 16.2 12
14
13.70 1.23 20.4 13
15
14.20 1.45 24.0 14
17
14.90 1.93 32.4 18
20
10.60 0.40 6.6
7
8
11.10 0.52 9.0
8
10
11.30 0.64 10.8 10
12
12.20 0.80 13.2 11
12
12.8
1.04 17.4 13
15
13.70 1.32 22.2 14
16
14.90 1.55 25.8 15
17
15.20 2.06 34.2 18
21
10.40 0.42 7.2
8
9
10.70 0.55 9.0
10
11
11.30 0.68 11.4 11
12
12.20 0.84 13.8 11
13
12.8
1.10 18.0 13
15
13.70 1.40 23.4 15
17
14.60 1.64 28.2 15
18
15.20 2.19 36.6 19
22

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.


Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

El uso inteligente del agua.

57

Rotores

www.rainbird.com/rotors

Serie 5000

Rotores
Serie 5000

Rendimiento de las boquillas de


ngulo bajo de la serie 5000
Presin
psi

Boquilla

25

1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA

35
Rotores

45

55

65

Radio
pies
25
27
29
29
28
30
31
33
29
31
32
35
29
31
33
36
29
31
33
36

Rendimiento delas boquillas de


ngulo bajo de la serie 5000
Caudal
gpm
0.76
1.15
1.47
2.23
0.92
1.38
1.77
2.68
1.05
1.58
2.02
3.07
1.17
1.76
2.24
3.41
1.27
1.92
2.45
3.72

Q
Precip.
pulg./h
0.23
0.30
0.34
0.51
0.23
0.30
0.35
0.47
0.24
0.32
0.38
0.48
0.27
0.35
0.40
0.51
0.29
0.38
0.43
0.55

V
Precip.
pulg./h
0.27
0.35
0.39
0.59
0.26
0.34
0.41
0.55
0.28
0.37
0.44
0.56
0.31
0.41
0.46
0.58
0.34
0.44
0.50
0.64

Presin
bares
1.7

2.0

2.5

3.0

3.5

4.0
Los ndices de precipitacin se basan en un funcionamiento en semicrculo.
Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Datos de rendimiento obtenidos en condiciones de cero viento.

4.5

Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

Boquilla
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA

SIST. MTRICO

Radio Caudal Caudal


m
m3h l/m
7.60
0.17 3.0
8.20
0.26 4.2
8.80
0.33 5.4
8.80
0.51 8.4
8.00
0.18 3.0
8.60
0.28 4.8
9.10
0.36 6.0
9.30
0.55 9.0
8.60
0.20 3.6
9.20
0.32 5.4
9.50
0.41 6.6
10.10 0.62 10.2
8.80
0.22 3.6
9.40
0.35 6.0
9.70
0.45 7.8
10.60 0.68 11.4
8.80
0.24 4.2
9.40
0.38 6.6
9.90
0.49 8.4
10.80 0.74 12.6
8.80
0.26 4.2
9.40
0.41 6.6
10.10 0.52 9.0
11.00 0.80 13.2
8.80
0.27 4.8
9.40
0.44 7.2
10.10 0.56 9.0
11.00 0.84 13.8

Q
Precip.
mm/h
6
8
9
13
6
8
9
13
5
8
9
12
6
8
10
12
6
9
10
13
7
9
10
13
7
10
11
14

V
Precip.
mm/h
7
9
10
15
6
9
10
15
6
9
10
14
7
9
11
14
7
10
11
15
8
11
12
15
8
11
13
16

Boquillas Rain Curtain: con una ingeniera que ofrece una cobertura superior en todo el rango de radio.
Las boquillas Rain Curtain producen gotas de agua ms grandes que son mucho
menos susceptibles al viento y minimizan enormemente la neblina y la evaporacin
causada por el aire. Esto garantiza que la cantidad correcta de agua se dirija hacia
donde sea necesario, para ahorrar tiempo, dinero y agua.
El riego cercano al cabezal suave y efectivo elimina las zonas secas alrededor
del rotor, y la uniformidad en la distribucin compensa las diversas condiciones
ambientales para garantizar resultados de csped verde.

58

El uso inteligente del agua.

Serie 5000

Rendimiento de las boquillas Rain Curtain de ngulo


estndar con PRS de la serie 5000
Q
V
Presin
Boquilla
Radio Caudal Precip. Precip.
psi
pies
gpm
pulg./h pulg./h
25
1.5
33
1.12
0.2
0.23
2.0
35
1.5
0.24
0.27
2.5
35
1.81
0.28
0.33
3.0
36
2.26
0.34
0.39
4.0
37
2.91
0.41
0.47
5.0
39
3.72
0.47
0.54
6.0
39
4.25
0.54
0.62
8.0
36
5.9
0.88
1.01
35
1.5
34
1.35
0.22
0.26
2.0
36
1.81
0.27
0.31
2.5
37
2.17
0.31
0.35
3.0
38
2.71
0.36
0.41
4.0
40
3.5
0.42
0.49
5.0
41
4.47
0.51
0.59
6.0
43
5.23
0.54
0.63
8.0
43
7.06
0.74
0.85
45
1.5
35
1.54
0.24
0.28
2.0
37
2.07
0.29
0.34
2.5
37
2.51
0.35
0.41
3.0
40
3.09
0.37
0.43
4.0
42
4.01
0.44
0.51
5.0
45
5.09
0.48
0.56
6.0
46
6.01
0.55
0.63
8.0
47
8.03
0.7
0.81
55 75
1.5
35
1.59
0.25
0.29
2.0
37
2.14
0.3
0.35
2.5
37
2.6
0.37
0.42
3.0
40
3.2
0.39
0.44
4.0
42
4.15
0.45
0.52
5.0
45
5.27
0.5
0.58
6.0
46
6.22
0.57
0.65
8.0
47
8.31
0.72
0.84
Los ndices de precipitacin se basan en un funcionamiento en semicrculo.
Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

www.rainbird.com/rotors

Rendimiento de las boquillas Rain Curtain de


ngulo estndar con PRS de la serie 5000
SISTEMA MTRICO
Q
V
Presin
Boquilla Radio Caudal Caudal Precip. Precip.
bares
m
m3h l/m
mm/h mm/h
1.7
1.5
10.1
0.25 4.20 5
6
2.0
10.7
0.34 5.40 6
7
2.5
10.7
0.41 6.60 7
8
3.0
11.0
0.51 8.40 8
10
4.0
11.3
0.66 10.80 10
12
5.0
11.9
0.84 13.80 12
14
6.0
11.9
0.97 16.20 14
16
8.0
11.0
1.34 22.20 22
26
2.0
1.5
10.2
0.28 4.80 5
6
2.0
10.8
0.36 6.00 6
7
2.5
10.9
0.44 7.20 7
9
3.0
11.2
0.55 9.00 9
10
4.0
11.6
0.71 12.00 11
12
5.0
12.1
0.91 15.00 12
14
6.0
12.4
1.05 17.40 14
16
8.0
11.8
1.45 24.00 21
24
2.5
1.5
10.4
0.31 5.40 6
7
2.0
11.0
0.41 6.60 7
8
2.5
11.3
0.50 8.40 8
9
3.0
11.2
0.62 10.20 9
11
4.0
12.3
0.81 13.20 11
13
5.0
12.7
1.03 17.40 13
15
6.0
13.2
1.21 20.40 14
16
8.0
13.3
1.63 27.00 19
21
3.0
1.5
10.6
0.34 6.00 6
7
2.0
11.2
0.45 7.80 7
8
2.5
11.3
0.56 9.60 9
10
3.0
12.1
0.69 11.40 9
11
4.0
12.7
0.89 16.80 11
13
5.0
13.5
1.13 18.60 12
14
6.0
13.9
1.34 22.20 14
16
8.0
14.1
1.79 30.00 18
21
3.5 5.2
1.5
10.6
0.35 6.00 6
7
2.0
11.2
0.47 7.80 8
9
2.5
11.3
0.58 10.20 9
11
3.0
12.1
0.71 12.00 10
11
4.0
12.7
0.92 15.60 12
13
5.0
13.5
1.17 19.20 13
15
6.0
13.9
1.39 22.80 14
17
8.0
14.1
1.85 31.20 18
21

*En este clculo prudente, el sistema ahorra un total de


401 253 litros en un terreno con una presin de entrada
de 5.17 BAR y un riego de 4 das por semana, 40 semanas
por ao. El sistema tiene 15 rotores 5000 PRS de Rain Bird,
cada uno con una boquilla de 3 gpm, y 20 aspersores
1800 PRS de Rain Bird, cada uno con una boquilla 15H.
Los rotores funcionan 30 minutos por da, mientras que los
aspersores funcionan 15 minutos por da.

El uso inteligente del agua.

59

Rotores

Rotores

Rotores
Serie 5000

Rendimiento de las boquillas de


ngulo bajo Serie 5000 PRS
Presin
psi

Boquilla

25

1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA

35

55 75

Q
Caudal Precip.
gpm
pulg./h
0.76
0.22
1.15
0.3
1.47
0.34
2.23
0.51
0.92
0.21
1.38
0.3
1.77
0.35
2.68
0.47
1.05
0.23
1.58
0.32
2.02
0.38
3.07
0.48
1.09
0.25
1.64
0.33
2.09
0.39
3.18
0.5

Radio
pies
25
27
29
29
28
30
31
33
29
31
32
35
29
31
32
35

V
Precip.
pulg./h
0.26
0.35
0.39
0.59
0.25
0.34
0.41
0.55
0.26
0.37
0.44
0.56
0.29
0.38
0.45
0.58

Presin
bares

Boquilla

1.7

1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA

2.0

2.5

3.0

3.5 5.2

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.


Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Datos de rendimiento obtenidos en condiciones de cero viento.

Radio
m
7.6
8.2
8.8
8.8
8.0
8.6
9.1
9.3
8.6
9.2
9.5
10.1
8.8
9.4
9.7
10.6
8.8
9.4
9.7
10.6

SIST. MTRICO

Caudal
m3h
0.17
0.26
0.33
0.51
0.18
0.28
0.36
0.55
0.20
0.32
0.41
0.62
0.22
0.35
0.45
0.68
0.23
0.36
0.47
0.70

Caudal
l/m
3.00
4.20
5.40
8.40
3.00
4.80
6.00
9.00
3.60
5.40
6.60
10.20
3.60
6.00
7.80
11.40
3.60
6.00
7.80
12.00

Q
Precip.
mm/h
6
8
9
13
6
8
9
13
5
8
9
12
6
8
10
12
6
8
10
13

V
Precip.
mm/h
7
9
10
15
6
9
10
15
6
9
10
14
7
9
11
14
7
10
12
15

Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

ndice de caudal y presin de entrada: boquillas Rain Curtain

Cunta agua puede ahorrar por minuto utilizando los rotores


5000 PRS de Rain Bird con tecnologa Flow Optimizer?

12.0
11.0

8.0 RC - no PRS

9.0

8.0 RC - with PRS

8.0
7.0
6.0

5.0 RC - no PRS

5.0 RC - with PRS

5.0
4.0

3.0 RC - no PRS

3.0

3.0 RC - with PRS

2.0 RC - no PRS

2.0

2.0 RC - with PRS

1.0
0.0
15

20

25

30

35

40

45

50

55

Presin de entrada (psi)

60

60

65

70

75

Caudal total de la zona en GPM

10.0

ndice de caudal (gpm)

Rotores

45

Rendimiento de las boquillas de


ngulo bajo Serie 5000 PRS

Caudal
GPM
6
8
10
12
14
16
18
20
22
24
26
28
30

45

50

55

60

65

70

75

80

0
0.33
0.66
0.96
1.25
1.54
1.81
2.06
0
0.43
0.85
1.24
1.62
1.98
2.33
2.67
0
0.55
1.07
1.57
2.05
2.52
2.96
3.39
0
0.66
1.27
1.86
2.43
2.97
3.50
4.01
0
0.77
1.49
2.18
2.84
3.48
4.10
4.70
0
0.87
1.69
2.48
3.24
3.97
4.67
5.35
0
0.98
1.90
2.79
3.64
4.46
5.25
6.01
0
1.10
2.12
3.10
4.05
4.96
5.83
6.68
0
1.21
2.33
3.42
4.46
5.47
6.44
7.37
0
1.30
2.54
3.72
4.85
5.94
7.00
8.01
0
1.41
2.76
4.04
5.27
6.45
7.60
8.70
0
1.53
2.96
4.34
5.66
6.93
8.16
9.35
0
1.63
3.17
4.65
6.07
7.43
8.74
10.02
Total de galones de agua ahorrados por minuto
durante el tiempo de riesgo
Ej: A 70 psi, una zona con 20 gpm de caudal ahorrara
4.96 galones (18.78 litros) por minuto con 5000 PRS

El uso inteligente del agua.

Rotores

www.rainbird.com/rotors

Boquillas Serie 5000 MPR

Boquillas Serie 5000 MPR

Boquilla

Q Csped ms verde con menos agua: las boquillas Rain Curtain ofrecen un
Un cuarto

rendimiento superior

Q %JTFPGMFYJCMFDPOVOOEJDFEFQSFDJQJUBDJORVFTFBKVTUBFOUSFMPT
conjuntos y con la boquilla rotativa

Q Codificacin por color segn el radio para una fcil identificacin


Tercio

Caractersticas
t5SFTQPSUBCPRVJMMBTDPOSBEJPTEFh hZh N N N

t$BEBVOBDPOUJFOFVOBCPRVJMMB2 
5 
) 
Z' 

t/PTFSFRVJFSFOQMBDBTGJKBTQBSBMPTBSDPT
t$PNQBUJCMFDPOFMSPUPSEFMBTFSJF
t-BUFDOPMPHBEFCPRVJMMBT3BJO$VSUBJOPGSFDF
- Gotas de gran tamao para un rendimiento constante
- Riego eficaz cercano al cabezal
 %JTUSJCVDJOVOJGPSNFTPCSFUPEPFMSBEJP
tOEJDFEFQSFDJQJUBDJOEFQVMHI NNI
RVFSFEVDF
el escurrimiento y la erosin
t#PRVJMMBTGDJMFTEFJOTFSUBSZRVJUBS
t1PSUBCPRVJMMBTBQJMBCMFTQBSBVOBMNBDFOBNJFOUPDPOWFOJFOUF
tOEJDFEFQSFDJQJUBDJORVFTFBKVTUBBMBCPRVJMMBSPUBUJWB3BJO#JSE DPOTVMUF
la pgina 42

Medio

Completa

Presin
psi
25
35
45
55
65
25
35
45
55
65
25
35
45
55
65
25
35
45
55
65

Radio
pies
23
24
25
25
25
23
24
25
25
25
23
24
25
25
25
23
24
25
25
25

Caudal
gpm
0.74
0.88
1.00
1.11
1.21
1.00
1.21
1.38
1.53
1.67
1.44
1.73
1.98
2.21
2.41
2.78
3.34
3.82
4.25
4.63

Q
Precip.
pulg./h
0.54
0.59
0.62
0.68
0.75
0.55
0.61
0.64
0.71
0.77
0.52
0.58
0.61
0.68
0.74
0.51
0.56
0.59
0.65
0.71

V
Precip.
pulg./h
0.62
0.68
0.71
0.79
0.86
0.63
0.70
0.74
0.82
0.89
0.61
0.67
0.70
0.79
0.86
0.58
0.64
0.68
0.76
0.82

Modelos
t.13QPSUBCPRVJMMBQBSBVOSBEJPEFQJFT N

DPOBDDFTPSJPTEFCPRVJMMBT2 5 ) '
t.13QPSUBCPRVJMMBQBSBVOSBEJPEFQJFT N

DPOBDDFTPSJPTEFCPRVJMMBT2 5 ) '
t.13QPSUBCPRVJMMBQBSBVOSBEJPEFQJFT N

DPOBDDFTPSJPTEFCPRVJMMBT2 5 ) '

5000-MPR-25 (Rojo)
Presin
bares

Boquilla

Un cuarto

1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5

Tercio

Medio

Cmo especificar
5000 - MPR - 25 - Q

Modelo
Rotor

Patrn
2$VBSUP
55FSDJP
).FEJP
'$PNQMFUP

Completa

Rango de radio
25'
30'
35'

Boquilla
ndice de precipitacin ajustado

SISTEMA MTRICO
Radio
m
7.0
7.3
7.6
7.6
7.6
7.0
7.3
7.6
7.6
7.6
7.0
7.3
7.6
7.6
7.6
7.0
7.3
7.6
7.6
7.6

Caudal
m3h
0.17
0.20
0.23
0.25
0.27
0.23
0.27
0.31
0.35
0.38
0.33
0.39
0.45
0.50
0.55
0.63
0.76
0.87
0.97
1.05

Caudal
l/m
3.0
3.6
3.6
4.2
4.8
3.6
4.8
5.4
6.0
6.6
5.4
6.6
7.2
8.4
9.0
10.8
12.6
14.4
16.2
17.4

Q
Precip.
mm/h
13.7
14.9
15.6
17.4
18.9
13.9
15.4
16.2
18.0
19.6
13.3
14.7
15.5
17.3
18.9
12.8
14.2
14.9
16.6
18.1

V
Precip.
mm/h
15.8
17.3
18.1
20.1
21.9
16.0
17.8
18.7
20.7
22.6
15.4
17.0
17.9
20.0
21.8
14.8
16.4
17.3
19.2
20.9

Boquillas Serie 5000 MPR


Las boquillas Serie 5000 MPR brindan ndices de precipitacin ajustados dentro y entre un radio de 25' a 35' (de 7.6 m a 10.7 m).
Esto elimina los riesgos del exceso o falta de riego.

El uso inteligente del agua.

61

Rotores

5000-MPR-25 (Rojo)

Inspeccin e instalacin ms rpida con ndice de precipitacin ajustado


codificado por colores de 25' a 35' (de 7.6 a 10.7 m)

Rotores
Boquillas Serie 5000 MPR

5000-MPR-30 (Verde)
Boquilla
Un cuarto

Tercio
Rotores

Medio

Completa

Presin
psi
25
35
45
55
65
25
35
45
55
65
25
35
45
55
65
25
35
45
55
65

5000-MPR-30 (Verde)
Radio
pies
29
30
30
30
30
29
30
30
30
30
29
30
30
30
30
29
30
30
30
30

Q
Caudal Precip.
gpm
pulg./h
1.03
0.47
1.23
0.53
1.40
0.60
1.56
0.67
1.69
0.72
1.34
0.46
1.62
0.52
1.85
0.59
2.06
0.66
2.24
0.72
2.15
0.49
2.59
0.55
2.96
0.63
3.30
0.71
3.60
0.77
4.24
0.49
5.08
0.54
5.78
0.62
6.39
0.68
6.92
0.74

V
Precip.
pulg./h
0.54
0.61
0.69
0.77
0.83
0.53
0.60
0.69
0.76
0.83
0.57
0.64
0.73
0.82
0.89
0.56
0.63
0.71
0.79
0.85

Radio
pies
32
34
35
35
35
32
34
35
35
35
32
34
35
35
35
32
34
35
35
35

Q
Caudal Precip.
gpm
pulg./h
1.40
0.53
1.67
0.56
1.92
0.60
2.13
0.67
2.31
0.73
1.77
0.50
2.15
0.54
2.46
0.58
2.74
0.65
2.99
0.70
2.75
0.52
3.33
0.55
3.81
0.60
4.23
0.66
4.62
0.73
5.36
0.50
6.62
0.55
7.58
0.60
8.43
0.66
9.18
0.72

V
Precip.
pulg./h
0.61
0.64
0.70
0.77
0.84
0.58
0.62
0.67
0.75
0.81
0.60
0.64
0.69
0.77
0.84
0.58
0.64
0.69
0.76
0.83

5000-MPR-35 (Beige)
Boquilla
Un cuarto

Tercio

Medio

Completa

Presin
psi
25
35
45
55
65
25
35
45
55
65
25
35
45
55
65
25
35
45
55
65

Presin
bares

Boquilla

Un cuarto

1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5

Tercio

Medio

Completa

SISTEMA MTRICO
Radio
m
8.8
9.1
9.1
9.1
9.1
8.8
9.1
9.1
9.1
9.1
8.8
9.1
9.1
9.1
9.1
8.8
9.1
9.1
9.1
9.1

Caudal
m3h
0.23
0.28
0.32
0.35
0.38
0.30
0.37
0.42
0.47
0.51
0.49
0.59
0.67
0.75
0.82
0.96
1.15
1.31
1.45
1.57

5000-MPR-35 (Beige)
Presin
bares

Boquilla

Un cuarto

1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5

Tercio

Medio

Completa

Caudal
l/m
3.6
4.8
5.4
6.0
6.6
4.8
6.0
7.2
7.8
8.4
8.4
9.6
11.4
12.6
13.8
16.2
19.2
21.6
24.0
26.4

Q
Precip.
mm/h
12.0
13.4
15.2
17.0
18.4
11.7
13.2
15.1
16.8
18.3
12.5
14.1
16.1
17.9
19.6
12.3
13.8
15.7
17.4
18.8

V
Precip.
mm/h
13.8
15.4
17.6
19.6
21.2
13.5
15.2
17.4
19.4
21.1
14.4
16.2
18.6
20.7
22.6
14.2
15.9
18.1
20.0
21.7

SISTEMA MTRICO
Radio
m
9.8
10.4
10.7
10.7
10.7
9.8
10.4
10.7
10.7
10.7
9.8
10.4
10.7
10.7
10.7
9.8
10.4
10.7
10.7
10.7

Caudal
m3h
0.32
0.38
0.44
0.48
0.52
0.40
0.49
0.56
0.62
0.68
0.62
0.76
0.87
0.96
1.05
1.22
1.50
1.72
1.91
2.09

Caudal
l/m
5.4
6.6
7.2
7.8
9.0
6.6
8.4
9.6
10.2
11.4
10.2
12.6
14.4
16.2
17.4
20.4
25.2
28.8
31.8
34.8

Q
Precip.
mm/h
13.4
14.1
15.3
17.0
18.4
12.7
13.6
14.7
16.4
17.9
13.1
14.1
15.2
16.9
18.4
12.8
14.0
15.1
16.8
18.3

V
Precip.
mm/h
15.4
16.3
17.7
19.6
21.3
14.6
15.8
17.0
18.9
20.7
15.2
16.3
17.6
19.5
21.3
14.8
16.2
17.5
19.4
21.2

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.

Datos de rendimiento obtenidos en condiciones de cero viento.

Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.

Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro

62

El uso inteligente del agua.

Rotores

www.rainbird.com/rotors

Serie 5500

Serie 5500

Rango operativo

Proteja su csped con rotores de alto rendimiento y resistentes al abuso y al


vandalismo de entre 17' y 55' (5.1 m y 24.7 m)

t3BEJPEFBQJFT EFBN

tOEJDFEFQSFDJQJUBDJOEFBQVMHI EFBNNI

t1SFTJOEFBQTJ EFBCBSFT

t$BVEBMEFBHQN EFBN3/h; de 4.52 a 58.88 l/m)

rendimiento superior

Q Ahorre tiempo y gastos en repuestos con esta familia de rotores


resistentes al abuso y al vandalismo

Q Costos de inventario ms bajos con un funcionamiento continuo de crculo


completo de 360 y crculo parcial en un aspersor

Caractersticas
t5FDOPMPHBEFCPRVJMMBT3BJO$VSUBJO
- Boquillas Rain Curtain codificadas por color para una distribucin y un riego
cercano al cabezal ptimos, lo que permite mayor uniformidad.
- Las boquillas son intercambiables desde la parte frontal sin necesidad de
herramientas especiales
t3FTJTUFODJBBMBCVTPZBMWBOEBMJTNP
- Memory Arc regresa el rotor a sus parmetros de arco originales
- El mecanismo motriz antidesgaste evita los daos por vandalismo y los
ocasionados por los equipos
 5PSSFUBEFCPRVJMMBSFGPS[BEBDPOMBUOQBSBRVFMBDPOFYJODPOFMWTUBHP
de elevacin soporte los daos del impacto lateral
- Modelo de tubera de elevacin de acero inoxidable opcional que ayuda a
impedir el vandalismo en reas pblicas con csped
t*OTUBMBDJOZNBOUFOJNJFOUP
 %FTFOHBODIFTMBUFSBMFT EFSFDIPFJ[RVJFSEP
RVFTFBKVTUBO
independientemente para facilitar la instalacin sin necesidad de girar la
cubierta ni de aflojar la conexin de la tubera
 'DJMBKVTUFEFMBSDPFOINFEPPFOTFDPVTBOEPTPMBNFOUFVO
destornillador de cabeza plana a travs de la parte superior del rotor desde
DSDVMPQBSDJBMEFBPFODSDVMPDPNQMFUPOPJOWFSTPEF
- Reduce los requisitos de inventario con un funcionamiento continuo de
crculo completo y crculo parcial en una unidad
- Estator autoajustable que permite reemplazar las boquillas sin necesidad de
realizar otros ajustes
t4PMVDJPOFTEFEJTFPZTFHVSJEBE
 %JTQPTJUJWPEFSFUFODJOUVCFSBEFFMFWBDJO4FBM".BUJD 4".
FTUOEBS
para ayudar a evitar el drenaje de los aspersores bajos
 5BQBEFHPNBOFHSBFTUOEBS
 5BQBWJPMFUBPQDJPOBMRVFGBDJMJUBMBJEFOUJGJDBDJOEFMPTTJTUFNBTQBSBBHVBOP
potable
 %JNFUSPFYQVFTUPQFRVFPRVFSFEVDFMBQPTJCJMJEBEEFMFTJPOFTFOSFBT
de juego
t%VSBCJMJEBE
- La junta limpiadora redundante reduce las partes pegadas y las fugas
- Garanta comercial de cinco aos.
- Engranaje de transmisin lubricado con agua
- Resorte retrctil de gran resistencia que garantiza una buena retraccin

Especificaciones
t&OUSBEBIFNCSBSPTDBEB/15EFw DN
 

t%JTQPTJUJWPEFSFUFODJO4".RVFSFUJFOFIBTUBQJFT N
EFBTQFSTPS
t#PRVJMMBT3BJO$VSUBJO OBSBOKB
 SPKP
 OFHSP
 BNBSJMMP

(celeste), 8.0 (verde oscuro), 10.0 (gris), 12.0 (beige) y portaboquilla de corto
alcance 18s, 22s, 26s, 30s (aqua)
t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMBEF

Dimensiones
t%JNFUSPFYQVFTUP DN

t%JNFUSPUPUBM DN

t"MUVSBUPUBM  DN

t"MUVSBEFMWTUBHPSFUSDUJM  DN

Modelos
t&OUSBEBIFNCSBSPTDBEB/15EFw DN
 WTUBHPEFFMFWBDJOEF
plstico de 5" [30.5 cm])
t44&OUSBEBIFNCSBSPTDBEB/15EFw DN
 WTUBHPEFFMFWBDJO
cubierto de acero inoxidable de 5" [12.7 cm])

Cmo especificar
5505 - SS - NP - 06
Modelo
Serie 5505

Tamao de
la boquilla
06
Caracterstica opcional
5BQBEFHPNB
para agua no potable
Caracterstica opcional
Vstago de acero inoxidable

5505

Con el rendimiento y las caractersticas de resistencia al abuso y al vandalismo de la boquilla Rain Curtain, esta familia de rotores garantiza que
el agua se dirija hacia donde corresponde.

El uso inteligente del agua.

63

Rotores

Q Csped ms verde con menos agua: las boquillas Rain Curtain ofrecen un

Rotores
Serie 5505

Rendimiento de las boquillas Serie 5505


Presin
psi
30

40
Rotores

50

60

70

80

90

64

tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt

Boquilla
2
3
4
5
6
8
2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12
10
12

Radio
pies
33
35
37
37
39
39
37
39
41
41
45
45
41
39
37
41
43
45
47
49
47
45
37
41
45
47
47
51
51
51
39
43
45
47
47
53
53
53
39
43
45
47
49
53
55
55
55
55

Q
Caudal Precip.
gpm
pulg./h
1.2
0.21
2.3
0.36
2.4
0.34
2.6
0.37
4.2
0.53
5.3
0.67
1.6
0.23
2.7
0.34
2.9
0.33
3.5
0.40
4.8
0.46
6.4
0.61
7.5
0.86
10.1
1.28
1.7
0.24
3.0
0.34
3.3
0.34
3.8
0.36
5.4
0.47
7.3
0.59
8.9
0.78
11.1
1.06
1.9
0.27
3.3
0.38
3.6
0.34
4.8
0.42
6.0
0.52
8.2
0.61
9.7
0.72
12.3
0.91
2.1
0.27
3.5
0.36
3.9
0.37
5.1
0.44
6.5
0.57
8.8
0.60
11.1
0.76
13.5
0.93
2.3
0.29
3.8
0.40
4.2
0.40
5.5
0.48
7.0
0.56
9.5
0.65
12.1
0.77
14.4
0.92
13.1
0.83
15.5
0.99

Rendimiento de las boquillas de radio corto Serie 5505


V
Precip.
pulg./h
0.25
0.42
0.39
0.42
0.61
0.77
0.26
0.39
0.38
0.46
0.53
0.70
0.99
1.48
0.28
0.40
0.40
0.42
0.54
0.68
0.90
1.22
0.31
0.44
0.40
0.48
0.60
0.70
0.83
1.05
0.31
0.42
0.43
0.51
0.65
0.70
0.88
1.07
0.34
0.46
0.46
0.55
0.65
0.75
0.89
1.06
0.96
1.14

Presin
psi

Boquilla

30

18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S

40

50

60

70

80

Radio
pies
17
19
25
25
19
21
25
29
21
23
29
31
23
25
29
33
23
25
29
35
25
27
29
35

Caudal
gpm
1.4
1.4
1.4
1.7
1.5
1.6
1.9
1.8
1.8
1.8
2.1
2.0
2.0
2.0
2.4
2.2
2.2
2.3
2.8
2.8
2.4
2.5
3.1
3.1

Q
Precip.
pulg./h
0.93
0.75
0.43
0.52
0.80
0.70
0.59
0.41
0.79
0.66
0.48
0.40
0.73
0.62
0.55
0.39
0.80
0.71
0.64
0.44
0.74
0.66
0.71
0.49

V
Precip.
pulg./h
1.08
0.86
0.50
0.60
0.92
0.81
0.68
0.48
0.91
0.76
0.56
0.46
0.84
0.71
0.63
0.45
0.92
0.82
0.74
0.51
0.85
0.76
0.82
0.56

Boquillas de radio corto Serie 5505

El uso inteligente del agua.

Rotores

www.rainbird.com/rotors

Serie 5505

Presin
bares
2.1

2.5

3.0

3.5

4.0

tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt

Boquilla
2
3
4
5
6
8
2
3
4
5
6
8
2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12

Radio
m
10.1
10.7
11.3
11.3
11.3
10.1
10.8
11.4
12.0
12.0
12.4
11.2
11.3
12.1
12.7
12.9
13.3
12.3
13.1
12.5
11.3
12.5
13.2
13.8
13.8
13.2
14.4
13.9
11.3
12.5
13.6
14.2
14.2
13.6
15.3
15.2

Caudal
m3h
0.32
0.52
0.59
0.73
0.86
1.23
0.35
0.58
0.66
0.81
0.96
1.37
0.38
0.64
0.74
0.90
1.07
1.53
1.74
2.30
0.41
0.69
0.80
0.98
1.17
1.67
1.83
2.54
0.45
0.75
0.85
1.05
1.25
1.80
2.12
2.74

Q
V
Caudal Precip. Precip.
l/m
mm/h mm/h
4.54 6.3
7.3
8.71 9.2
10.6
9.08 9.3
10.7
9.84 11.4 13.2
15.90 13.6 15.7
20.06 24.2 28.0
5.49 5.9
6.8
9.65 8.9
10.2
10.27 9.1
10.5
11.97 11.2 12.9
17.32 12.5 14.4
22.67 21.8 25.2
6.19 6.0
6.9
10.62 8.7
10.0
11.51 9.1
10.5
13.65 10.8 12.5
18.97 12.1 13.9
25.42 20.1 23.2
30.25 20.1 23.2
39.56 29.3 33.8
6.49 6.5
7.5
11.44 8.8
10.2
12.58 9.2
10.7
14.67 10.4 12.0
20.61 12.3 14.2
27.89 19.3 22.3
33.92 17.6 20.3
42.36 26.5 30.6
7.04 7.0
8.1
12.27 9.7
11.2
13.40 9.2
10.6
17.42 10.4 12.0
22.26 12.4 14.3
30.36 19.5 22.5
36.11 18.1 20.9
45.65 23.8 27.4

SISTEMA MTRICO
Presin
bares
4.5

5.0

5.5

6.0
6.2

Boquilla

tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt

2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12
10
12
10
12

Radio
m
11.6
12.8
13.7
14.3
14.3
14.0
15.9
15.9
11.9
13.1
13.7
14.3
14.5
14.5
16.3
16.3
11.9
13.1
13.7
14.3
14.9
14.9
16.8
16.8
16.8
16.8
16.8
16.8

Caudal
m3h
0.48
0.80
0.90
1.12
1.33
1.92
2.38
2.94
0.51
0.83
0.95
1.18
1.41
2.04
2.60
3.12
0.52
0.88
1.00
1.25
1.47
2.15
2.74
3.27
2.91
3.45
2.98
3.52

Q
V
Caudal Precip. Precip.
l/m
mm/h mm/h
7.59 7.1
8.2
12.89 9.7
11.2
14.22 9.6
11.0
18.77 10.9 12.6
23.71 13.0 15.0
32.23 19.5 22.5
39.51 18.9 21.9
48.95 23.3 26.9
8.14 7.2
8.3
13.53 9.7
11.2
15.05 10.1 11.6
19.69 11.5 13.3
25.08 13.4 15.5
33.98 19.4 22.5
42.97 19.5 22.5
51.96 23.4 27.1
8.69 7.4
8.5
14.36 10.3 11.9
15.87 10.6 12.2
20.78 12.2 14.0
26.45 13.2 15.3
35.90 19.3 22.3
45.71 19.6 22.6
54.43 23.3 26.9
48.46 20.7 23.9
57.43 24.5 28.3
49.58 21.2 24.4
58.66 25.1 28.9

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.


Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

El uso inteligente del agua.

65

Rotores

Rendimiento de las boquillas Serie 5505

Rotores
Serie 5505

Rendimiento de las boquillas de radio


corto Serie 5505
Presin
bares
2.1

2.5
Rotores

3.0

3.5

4.0

4.5

5.0

5.5

Boquilla
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S

Radio
m
5.2
5.8
7.6
7.6
5.6
6.2
7.6
8.4
6.0
6.6
8.0
9.1
6.4
7.1
8.8
9.5
6.9
7.5
8.8
9.9
7.0
7.6
8.8
10.4
7.2
7.8
8.8
10.7
7.6
8.2
8.8
10.7

Caudal
m3h
0.32
0.32
0.32
0.39
0.33
0.35
0.39
0.40
0.36
0.38
0.45
0.42
0.41
0.41
0.48
0.46
0.45
0.45
0.53
0.49
0.49
0.49
0.59
0.57
0.53
0.53
0.65
0.65
0.57
0.57
0.70
0.70

SIST. MTRICO

Caudal
l/m
5.3
5.3
5.3
6.4
5.5
5.8
6.5
6.7
6.1
6.3
7.5
7.1
6.9
6.9
8.0
7.6
7.4
7.4
8.9
8.2
8.2
8.2
9.9
9.5
8.9
8.9
10.9
10.9
9.4
9.4
11.7
11.7

Q
Precip.
mm/h
23.7
19.0
11.0
13.3
21.5
18.2
13.4
11.4
20.2
17.3
13.8
10.4
19.8
16.6
12.3
10.2
18.8
15.8
13.6
9.9
19.9
16.9
15.2
10.6
20.8
17.7
16.7
11.5
19.6
16.8
18.0
12.3

V
Precip.
mm/h
27.3
21.9
12.6
15.4
24.8
21.0
15.5
13.2
23.3
20.0
16.0
12.0
22.9
19.1
14.3
11.7
21.7
18.3
15.7
11.5
23.0
19.5
17.5
12.2
24.0
20.4
19.3
13.3
22.6
19.4
20.8
14.3

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.


Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

Vista transversal (Serie 5500)

Boquillas Serie 5505

66

El uso inteligente del agua.

Rotores

www.rainbird.com/rotors

4FSJF'BMDPO

Serie Falcon 6504


Confiable y econmico

Q Csped ms verde con menos agua: las boquillas Rain Curtain ofrecen un
rendimiento superior

Q Ajuste e instalacin rpidos con vstago de trinquete


Q La solucin perfecta para un riego rpido en canchas de tenis de arcilla o
campos de deportes interiores con csped con la versin de alta velocidad
opcional (rotacin completa en aproximadamente un minuto)

Caractersticas
Rotores

t5FDOPMPHBEFCPRVJMMBT3BJO$VSUBJO
- Boquillas Rain Curtain codificadas por color con orificios
mltiples para un riego ptimo de largo alcance, de mediano alcance y
cercano al cabezal, que logran mayor uniformidad
- Las boquillas son intercambiables desde la parte frontal sin necesidad de
herramientas especiales
t*OTUBMBDJOZNBOUFOJNJFOUP
- Vstago de trinquete que acelera la instalacin
 'DJMBKVTUFEFMBSDP NPEFMPEFDSDVMPQBSDJBM
EFTEFMBQBSUFTVQFSJPSEFM
SPUPSEFB
- Estator autoajustable que no requiere reemplazo al
cambiar las boquillas
 5PSOJMMPEFBKVTUFEFMSBEJP RVFQFSNJUFVOBSFEVDDJOEFMSBEJPEFIBTUB
un 25% sin cambiar las boquillas
 -PTSPUPSFT'BMDPOTFQVFEFOTPMJDJUBSBMBGCSJDBFODBOUJEBEFTQPSDBKBT
con boquillas preinstaladas como pedido especial
t4PMVDJPOFTEFEJTFP
- Vstago retrctil de acero inoxidable opcional que ayuda a impedir el
vandalismo en reas pblicas con csped
 %JTQPTJUJWPEFSFUFODJOEFTNPOUBCMF4FBM".BUJD 4".
RVFFWJUBFM
encharcamiento y la erosin provocados por el drenaje de los aspersores
bajos
 5BQBEFHPNBOFHSBFTUOEBSPUBQBEFHPNBWJPMFUBPQDJPOBMQBSBBHVB
no potable
 %JNFUSPFYQVFTUPQFRVFPEF DN
RVFSFEVDFMBQPTJCJMJEBEEF
lesiones en reas de juego
- Opcin de alta velocidad para la colocacin de inyecciones en campos
interiores o control de polvo
- Altura del vstago retrctil de 4" (10.2 cm) para que la lnea central de la
boquilla corte el csped ms alto
t%VSBCJMJEBE
- Garanta comercial de cinco aos.
- Engranaje de transmisin lubricado con agua para una rotacin duradera y
confiable
- Resorte retrctil de acero inoxidable y gran resistencia que garantiza una
buena retraccin
 +VOUBMJNQJBEPSBQBUFOUBEBBDUJWBEBBQSFTJODPOWTUBHPDOJDPEF
elevacin en modelos de plstico y de acero inoxidable que protegen el
mecanismo interno de la suciedad y garantizan una buena elevacin y
retraccin
- Engranajes de desenganche de acero inoxidable que garantizan
durabilidad a largo plazo

Falcon 6504
Vista transversal

Cmo especificar
NP
o bien,

F4- PC- SS- HS- 16- P


Caracterstica
opcional
Elevador de
de acero
inoxidable
Rotacin
Crculo parcial

Falcon 6504

El uso inteligente del agua.

Modelo
''BMDPO

Caracterstica
opcional
Boquilla
Boquilla
Tamao de la
boquilla
16

Caractersticas
opcionales
5BQBEFHPNBQBSBBHVBOP
potable o bien, Rotor de
alta velocidad

Nota: Para aplicaciones fuera de EE.UU., es necesario


especificar si el tipo de rosca debe ser NPT o BSP.

67

Rotores
4FSJF'BMDPO

Serie Falcon 6504 (cont.)

Rendimiento de las boquillas Falcon 6504

Rango operativo
tOEJDFEFQSFDJQJUBDJOEFBQVMHBEBTQPSIPSB EFBNNI

t3BEJPEFBQJFT EFBN

t1SFTJOEFBQTJ EFBCBSFT

t$BVEBMEFBHQN EFBN3h; de 10.8 a 82.2 l/m)

Presin
psi

Boquilla

30

4
6
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
18

40
Especificaciones

Rotores

t&OUSBEBIFNCSBSPTDBEB/15P#41EF DN
 

t%JTQPTJUJWPEFSFUFODJO4".RVFSFUJFOFIBTUBQJFT N
EFDBNCJPEF
elevacin
t#PRVJMMBT3BJO$VSUBJO OFHSP
 DFMFTUF
 WFSEFPTDVSP
 HSJT

(beige), 14 (verde claro), 16 (marrn oscuro), 18 (azul oscuro)
t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMBEF

Dimensiones

50

t"MUVSBUPUBM DN

t"MUVSBEFMWTUBHPSFUSDUJM DN

t%JNFUSPEFMBTVQFSGJDJFFYQVFTUB DN

Nota: La altura del vstago retrctil se mide desde la tapa hasta el centro de la boquilla. La
altura total del cuerpo no se mide con el vstago elevado.

Modelos
t''$$SDVMPDPNQMFUP
t'1$$SDVMPQBSDJBM
t''$/1$SDVMPDPNQMFUP UBQBQBSBBHVBOPQPUBCMF
t'1$/1$SDVMPQBSDJBM UBQBQBSBBHVBOPQPUBCMF
t''$44$SDVMPDPNQMFUP BDFSPJOPYJEBCMF
t'1$44$SDVMPQBSDJBM BDFSPJOPYJEBCMF
t''$44)4$SDVMPDPNQMFUP BDFSPJOPYJEBCMF SPUBDJOEFBMUBWFMPDJEBE
t'1$44)4$SDVMPQBSDJBM BDFSPJOPYJEBCMF SPUBDJOEFBMUBWFMPDJEBE
t''$44/1$SDVMPDPNQMFUP BDFSPJOPYJEBCMF UBQBQBSBBHVBOPQPUBCMF
t'1$44/1$SDVMPQBSDJBM BDFSPJOPYJEBCMF UBQBQBSBBHVBOPQPUBCMF

60

70

Nota:Todos los modelos se encuentran disponibles con roscas BSP

80

90

tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
t

Radio
pies
39
43
41
45
49
51
53
55
55
59
41
49
51
53
55
59
61
59
41
47
51
55
57
61
63
63
41
49
51
57
59
61
63
65
43
49
53
55
61
61
63
65
65

Caudal
gpm
2.9
4.2
3.3
4.9
6.6
8.1
9.7
11.3
12.6
13.7
3.7
5.5
7.4
9.1
11.0
12.7
14.3
15.4
4.0
6.0
8.2
10.0
12.2
14.0
15.7
17.1
4.4
6.3
8.9
10.8
13.2
15.2
16.9
18.3
4.6
6.9
9.4
11.6
14.0
16.2
18.1
19.6
21.7

Q
Precip.
pulg./h
0.37
0.44
0.38
0.47
0.53
0.60
0.66
0.72
0.80
0.76
0.42
0.44
0.55
0.62
0.70
0.70
0.74
0.85
0.46
0.52
0.61
0.64
0.72
0.72
0.76
0.83
0.50
0.51
0.66
0.64
0.73
0.79
0.82
0.83
0.48
0.55
0.64
0.74
0.72
0.84
0.88
0.89
0.99

V
Precip.
pulg./h
0.42
0.50
0.44
0.54
0.61
0.69
0.77
0.83
0.93
0.87
0.49
0.51
0.63
0.72
0.81
0.81
0.85
0.98
0.53
0.60
0.70
0.73
0.83
0.84
0.88
0.96
0.58
0.58
0.76
0.74
0.84
0.91
0.95
0.96
0.55
0.64
0.74
0.85
0.84
0.97
1.01
1.03
1.14

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.


Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

68

El uso inteligente del agua.

Rotores

www.rainbird.com/rotors

4FSJF'BMDPO

Presin
bares
2.1
2.5

3.0

3.5

4.0

tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt

Boquilla
4
6
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18

Radio
m
11.9
13.1
12.3
13.5
14.9
15.5
16.2
16.8
16.8
18.0
12.5
14.1
15.1
15.8
16.4
17.2
17.4
18.0
12.5
14.9
15.5
16.2
16.8
18.0
18.6
18.1
12.5
14.4
15.5
16.6
17.3
18.5
19.1
19.0

Caudal
m3h
0.66
0.95
0.72
1.05
1.50
1.84
2.20
2.57
2.86
3.11
0.78
1.16
1.56
1.92
2.31
2.68
3.00
3.25
0.85
1.26
1.69
2.08
2.52
2.91
3.27
3.53
0.89
1.34
1.83
2.23
2.72
3.12
3.50
3.81

Caudal
l/m
10.98
15.90
11.92
17.56
25.20
30.60
36.60
42.60
47.40
51.60
13.02
19.34
26.04
31.99
38.44
44.63
49.95
54.11
14.09
20.96
28.24
34.70
41.98
48.45
54.53
58.78
14.91
22.33
30.44
37.17
45.28
52.01
58.37
63.45

SISTEMA MTRICO
Q
Precip.
mm/h
9
11
10
12
13
15
17
18
20
19
10
12
14
15
17
18
20
20
11
11
14
16
18
18
19
22
11
13
15
16
18
18
19
21

V
Precip.
mm/h
11
13
11
13
16
18
19
21
24
22
12
13
16
18
20
21
23
23
13
13
16
18
21
21
22
25
13
15
17
19
21
21
22
24

Presin
bares
4.5

5.0

5.5

6.0
6.2

Boquilla

tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt

4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
18
18

Radio
m
12.5
14.6
15.5
17.1
17.7
18.6
19.2
19.5
12.7
14.9
15.7
17.2
18.1
18.6
19.2
19.8
13.1
14.9
16.1
16.8
18.6
18.6
19.2
19.8
19.8
19.8

Caudal
m3h
0.96
1.40
1.95
2.37
2.89
3.32
3.71
4.03
1.01
1.47
2.05
2.50
3.04
3.51
3.91
4.23
1.04
1.56
2.13
2.63
3.18
3.67
4.10
4.44
4.79
4.93

Caudal
l/m
15.94
23.33
32.43
39.44
48.17
55.38
61.82
67.12
16.84
24.50
34.16
41.64
50.72
58.49
65.11
70.51
17.39
25.79
35.54
43.84
52.92
61.23
68.40
74.07
79.77
82.13

Q
Precip.
mm/h
12
13
16
16
18
19
20
21
13
13
17
17
19
20
21
22
12
14
16
19
18
21
22
23
24
25

V
Precip.
mm/h
14
15
19
19
21
22
23
24
15
15
19
19
21
23
24
25
14
16
19
22
21
25
26
26
28
29

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.


Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

El uso inteligente del agua.

69

Rotores

Rendimiento de las boquillas Falcon 6504

Rotores
4FSJF'BMDPO

Rendimiento de alta velocidad de las boquillas Falcon 6504


Presin
psi
30
40

Rotores

50

60

tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt

Boquilla
4
6
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18

Radio
pies
37
39
41
43
47
47
49
53
51
53
41
45
49
49
53
53
53
55
41
45
47
49
53
53
55
59

Caudal
gpm
3.0
4.3
3.5
6.0
6.6
8.1
9.9
11.4
12.6
13.9
3.7
5.6
7.5
9.2
11.2
12.9
14.3
15.6
4.2
6.2
8.3
10.2
12.4
14.2
15.7
17.2

Q
Precip.
pulg./h
0.42
0.54
0.40
0.62
0.58
0.71
0.79
0.78
0.93
0.95
0.42
0.53
0.60
0.74
0.77
0.88
0.98
0.99
0.48
0.59
0.72
0.82
0.85
0.97
1.00
0.95

V
Precip.
pulg./h
0.49
0.63
0.46
0.72
0.66
0.82
0.92
0.90
1.08
1.10
0.49
0.62
0.69
0.85
0.89
1.02
1.13
1.15
0.56
0.68
0.84
0.94
0.98
1.12
1.15
1.10

Presin
psi
70

80

90

Boquilla

tt
tt
tt
tt
tt
tt
tt
tt
t

4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
18

Radio
pies
41
43
49
51
55
53
57
59
39
43
51
49
55
53
59
59
61

Caudal
gpm
4.6
6.7
9.0
11.1
13.5
15.3
17.1
18.6
4.9
7.1
9.7
11.9
14.4
16.5
18.4
20.0
21.3

Q
Precip.
pulg./h
0.53
0.70
0.72
0.82
0.86
1.05
1.01
1.03
0.62
0.74
0.72
0.95
0.92
1.13
1.02
1.11
1.10

V
Precip.
pulg./h
0.61
0.81
0.83
0.95
0.99
1.21
1.17
1.19
0.72
0.85
0.83
1.10
1.06
1.31
1.18
1.28
1.27

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.


Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

Falcon 6504
de alta velocidad

70

El uso inteligente del agua.

Rotores

www.rainbird.com/rotors

4FSJF'BMDPO

Presin
bares
2.1
2.5

3.0

3.5

4.0

tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt

Boquilla
4
6
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18

Radio
m
11.3
11.9
12.0
12.7
14.2
14.2
14.8
16.0
15.4
16.0
12.5
13.3
14.5
14.5
15.4
16.2
15.8
16.4
12.5
13.7
14.9
14.9
16.2
16.2
16.2
16.9
12.5
13.7
14.4
14.9
16.2
16.2
16.6
17.7

Caudal
m3h
0.68
0.98
0.75
1.22
1.49
1.83
2.24
2.58
2.85
3.15
0.81
1.33
1.57
1.93
2.35
2.71
3.00
3.29
0.85
1.28
1.72
2.11
2.56
2.95
3.27
3.57
0.93
1.38
1.85
2.27
2.76
3.17
3.50
3.83

Caudal
l/m
11.35
15.90
12.54
20.16
25.20
30.60
37.20
43.20
47.40
52.80
13.51
22.18
26.18
32.12
39.20
48.09
49.95
54.87
14.15
21.37
28.62
35.11
42.74
49.20
54.53
59.51
15.52
23.02
30.81
37.86
46.03
52.77
58.37
63.90

Q
Precip.
mm/h
11
14
10
15
15
18
20
20
24
24
10
15
15
18
20
21
24
25
11
14
16
19
20
23
25
25
12
15
18
20
21
24
25
24

V
Precip.
mm/h
12
16
12
18
17
21
24
23
28
28
12
17
17
21
23
24
28
28
13
16
18
22
23
26
29
29
14
17
21
24
24
28
29
28

SISTEMA MTRICO
Presin
bares
4.5

5.0

5.5

6.0
6.2

tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt

Boquilla
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
18
18

Radio
m
12.5
13.4
14.6
15.3
16.5
16.2
17.1
18.0
12.3
13.1
15.1
15.4
16.8
16.2
17.5
18.0
11.9
13.1
15.5
14.9
16.8
16.2
18.0
18.0
18.4
18.6

Caudal
m3h
1.00
1.48
1.97
2.42
2.95
3.36
3.73
4.07
1.06
1.56
2.08
2.57
3.12
3.54
3.96
4.30
1.11
1.61
2.20
2.70
3.27
3.74
4.17
4.53
4.75
4.84

Caudal
l/m
16.69
24.46
32.81
40.40
49.13
55.94
62.22
67.89
17.70
25.74
34.73
42.78
51.96
59.06
65.96
71.74
18.52
26.84
36.65
44.97
54.43
62.35
69.53
75.58
79.16
80.62

Q
Precip.
mm/h
13
16
18
21
22
26
26
25
14
18
18
22
22
27
26
27
16
19
18
24
23
29
26
28
28
28

V
Precip.
mm/h
15
19
21
24
25
30
30
29
16
21
21
25
26
31
30
31
18
22
21
28
27
33
30
32
32
32

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.


Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

El uso inteligente del agua.

71

Rotores

Rendimiento de alta velocidad de las boquillas Falcon 6504

Rotores
Serie 8005

Serie 8005
Proteja su csped con rotores de alto rendimiento y resistentes al abuso y al
vandalismo de entre 39' y 81' (5.1 m y 24.7 m)

Q Csped ms verde con menos agua: las boquillas Rain Curtain ofrecen un
rendimiento superior

Q Ahorre tiempo y gastos en repuestos con esta familia de rotores


resistentes al abuso y al vandalismo

Q Costos de inventario ms bajos con un funcionamiento continuo de crculo


completo de 360 y crculo parcial en un aspersor

Caractersticas
Rotores

t5FDOPMPHBEFCPRVJMMBT3BJO$VSUBJO
- Boquillas Rain Curtain codificadas por color para una distribucin y un riego
cercano al cabezal ptimos, lo que permite mayor uniformidad.
- Las boquillas son intercambiables desde la parte frontal sin necesidad de
herramientas especiales
t3FTJTUFODJBBMBCVTPZBMWBOEBMJTNP
- Memory Arc regresa el rotor a sus parmetros de arco originales
- El mecanismo motriz antidesgaste evita los daos por vandalismo y los
ocasionados por los equipos
 5PSSFUBEFCPRVJMMBSFGPS[BEBDPOMBUOQBSBRVFMBDPOFYJODPOFMWTUBHP
de elevacin soporte los daos del impacto lateral
- Modelo de tubera de elevacin de acero inoxidable opcional que ayuda a
impedir el vandalismo en reas pblicas con csped
t*OTUBMBDJOZNBOUFOJNJFOUP
 %FTFOHBODIFTMBUFSBMFT EFSFDIPFJ[RVJFSEP
RVFTFBKVTUBO
independientemente para facilitar la instalacin sin necesidad de girar la
cubierta ni de aflojar la conexin de la tubera
 'DJMBKVTUFEFMBSDPFOINFEPPFOTFDPVTBOEPTPMBNFOUFVO
destornillador de cabeza plana a travs de la parte superior del rotor desde
DSDVMPQBSDJBMEFBPFODSDVMPDPNQMFUPOPJOWFSTPEF
- Reduce los requisitos de inventario con un funcionamiento continuo de
crculo completo y crculo parcial en una unidad
- Estator autoajustable que permite reemplazar las boquillas sin necesidad de
realizar otros ajustes
t4PMVDJPOFTEFEJTFPZTFHVSJEBE
 %JTQPTJUJWPEFSFUFODJOUVCFSBEFFMFWBDJO4FBM".BUJD 4".
FTUOEBS
para ayudar a evitar el drenaje de los aspersores bajos
 5BQBEFHPNBOFHSBFTUOEBS
 5BQBWJPMFUBPQDJPOBMRVFGBDJMJUBMBJEFOUJGJDBDJOEFMPTTJTUFNBTQBSBBHVBOP
potable
 %JNFUSPFYQVFTUPQFRVFPRVFSFEVDFMBQPTJCJMJEBEEFMFTJPOFTFOSFBT
de juego

 5BQBEFHPNBDPODTQFEBSUJGJDJBMPQDJPOBMQBSBHBSBOUJ[BSMBTFHVSJEBEEF
los jugadores en las aplicaciones de campos de deportes
t%VSBCJMJEBE
- La junta limpiadora redundante reduce las partes pegadas y las fugas
- Garanta comercial de cinco aos.
- Engranaje de transmisin lubricado con agua
- Resorte retrctil de gran resistencia que garantiza una buena retraccin

Rango operativo
-

Radio: de 39 a 81 pies (de 11.9 a 24.7 m)


ndice de precipitacin: de 0.48 a 1.23 pulgadas por hora (de 12 a 31 mm/h)
Presin: de 50 a 100 psi (de 3.5 a 6.9 bares)
Caudal: de 3.8 a 36.3 gpm (de 0.86 a 8.24 m3/h; de 14.4 a 137.4 l/m)

Nota: Los flujos de rango del 7005 y el 8005 se combinan en el rotor del 8005

Especificaciones
t&OUSBEBIFNCSBSPTDBEB/15P#41EF DN
 

t%JTQPTJUJWPEFSFUFODJO4".RVFSFUJFOFIBTUBQJFT N
EFBTQFSTPS
t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMBEF
t#PRVJMMBT3BJO$VSUBJO04 (negro), 06 (celeste), 08 (verde oscuro),
10 (gris), 12 (beige), 14 (verde claro), 16 (marrn oscuro),
18 (azul oscuro), 20 (rojo), 22 (amarillo), 24 (naranja), 26 (blanco)

Dimensiones
t%JNFUSPFYQVFTUP DN

t%JNFUSPUPUBM  DN

t"MUVSBUPUBM   DN

t"MUVSBEFMWTUBHPSFUSDUJM  DN

Modelos
t&OUSBEBIFNCSBSPTDBEB/15EF DN
 WTUBHPEFFMFWBDJOEF
plstico)
t44&OUSBEBIFNCSBSPTDBEB/15
B /15
(vstago de elevacin cubierto de acero
cero
inoxidable de 5" [12.7 cm])
t5BQBWJPMFUBPQDJPOBMRVFGBDJMJUBMB
identificacin de los sistemas para agua
gua
no potable
t5BQBDPODTQFEBSUJGJDJBMPQDJPOBM
Nota: Todos los modelos se encuentran disponibles
sponibles
con roscas BSP
** Nota: La altura del vstago retrctil se mide
desde la tapa hasta el orificio principal de la
a
boquilla. La altura total del cuerpo no se mide
ide con el
vstago elevado.

Cmo especificar
8005 - SS - NP - 16
Modelo
Serie 8005

Tamao de
la boquilla
16
Caracterstica opcional
5BQBEFHPNB
para agua no potable
Caracterstica opcional
Vstago de acero inoxidable

Nota: Para aplicaciones fuera de EE.UU., es necesario


especificar si el tipo de rosca debe ser NPT o BSP.

8005

72

El uso inteligente del agua.

Rotores

www.rainbird.com/rotors

Serie 8005

Presin
psi
50

60

70

80

Boquilla

tt
tt
tt
tt
tt
t
tt
tt
tt
tt
tt
t
tt
tt
tt
tt
tt
t
tt
tt
tt
tt
tt
t

04
06
08
10
12
14
16
18
20
22
24
26
04
06
08
10
12
14
16
18
20
22
24
26
04
06
08
10
12
14
16
18
20
22
24
26
04
06
08
10
12
14
16
18
20
22
24
26

Radio
pies
39
45
49
53
57
59
61
63
65
65
63
65
39
45
49
53
59
61
65
65
67
71
69
73
39
45
49
55
59
63
67
67
71
73
75
75
39
45
49
55
61
63
67
69
71
75
77
79

Caudal
gpm
3.8
5.6
6.6
9.3
11.1
12.6
14.3
16.1
18.6
20.7
22.3
24.3
3.8
6.1
8.4
10.1
12.0
14.3
15.9
17.8
20.1
23.2
24.7
26.7
4.7
6.7
9.0
11.1
13.2
15.3
17.2
19.3
22.0
25.2
27.0
29.4
5.0
7.1
9.8
11.8
14.2
16.4
18.6
20.9
23.9
27.3
29.2
31.5

Q
Precip.
pulg./h
0.48
0.53
0.53
0.64
0.66
0.70
0.74
0.78
0.85
0.94
1.08
1.11
0.48
0.58
0.67
0.69
0.66
0.74
0.72
0.81
0.86
0.89
1.00
0.96
0.60
0.64
0.72
0.71
0.73
0.74
0.74
0.83
0.84
0.91
0.92
1.01
0.63
0.68
0.79
0.75
0.73
0.80
0.80
0.85
0.91
0.93
0.95
0.97

V
Precip.
pulg./h
0.56
0.62
0.61
0.74
0.76
0.81
0.85
0.90
0.98
1.09
1.25
1.28
0.56
0.67
0.78
0.80
0.77
0.85
0.84
0.94
1.00
1.02
1.15
1.11
0.69
0.74
0.83
0.82
0.84
0.86
0.85
0.96
0.97
1.05
1.07
1.16
0.73
0.78
0.91
0.87
0.85
0.92
0.92
0.98
1.05
1.08
1.10
1.12

Presin
psi
90

100

Boquilla

tt
tt
tt
t
tt
t

12
14
16
18
20
22
24
26
20
22
24
26

Caudal
gpm
14.7
17.9
20.0
22.2
25.3
29.1
31.0
33.7
26.8
30.7
32.8
36.3

Q
Precip.
pulg./h
0.76
0.82
0.81
0.85
0.91
1.00
0.96
1.04
0.85
1.00
1.01
1.07

V
Precip.
pulg./h
0.88
0.94
0.93
0.98
1.06
1.15
1.10
1.20
0.97
1.15
1.17
1.23

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.


Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

Vista transversal
(Serie 8005)

El uso inteligente del agua.

Radio
pies
61
65
69
71
73
75
79
79
75
77
79
81

Tapa con csped para


el modelo 8005

73

Rotores

Rendimiento de las boquillas Serie 8005

Rotores
Serie 8005

Rendimiento de las boquillas Serie 8005


Presin
bares
3.5

Rotores

4.0

4.5

5.0

tt
tt
tt
tt
tt
t
tt
tt
tt
tt
tt
t
tt
tt
tt
tt
tt
t
tt
tt
tt
tt
tt
t

Boquilla
4
6
8
10
12
14
16
18
20
22
24
26
4
6
8
10
12
14
16
18
20
22
24
26
4
6
8
10
12
14
16
18
20
22
24
26
4
6
8
10
12
14
16
18
20
22
24
26

Radio
m
11.9
13.7
14.9
16.1
17.5
18.0
18.7
19.2
19.9
20.0
19.3
20.0
11.9
13.7
14.9
16.3
17.7
18.5
19.6
19.7
20.3
21.3
20.7
21.8
11.9
13.7
14.9
16.5
18.0
18.9
20.1
20.1
21.1
22.0
22.0
22.6
11.9
13.7
14.9
16.7
18.3
19.2
20.4
20.6
21.6
22.4
23.0
23.2

Caudal
m3h
0.86
1.28
1.59
2.10
2.52
2.89
3.28
3.69
4.25
5.08
5.11
5.57
0.93
1.37
1.75
2.30
2.70
3.17
3.54
3.97
4.50
5.23
5.50
6.01
1.00
1.45
1.92
2.40
2.87
3.37
3.77
4.22
4.79
5.51
5.88
6.42
1.06
1.54
2.09
2.50
3.05
3.54
3.99
4.47
5.11
5.84
6.26
6.80

Caudal
l/m
14.38
21.34
25.50
35.43
42.27
48.18
54.59
61.43
70.83
79.07
85.10
92.67
14.38
22.71
30.44
37.63
44.74
52.85
58.98
66.10
74.95
85.94
91.69
99.26
16.18
24.28
32.99
40.22
47.81
56.12
62.77
70.36
79.87
91.80
98.08
106.44
18.08
25.74
34.83
42.68
50.92
58.96
66.44
74.58
85.08
97.39
104.29
113.28

SISTEMA MTRICO
Q
Precip.
mm/h
12
14
14
16
16
18
19
20
21
25
27
28
13
15
16
17
17
19
18
20
22
23
26
25
14
15
17
18
18
19
19
21
22
23
24
25
15
16
19
18
18
19
19
21
22
23
24
25

V
Precip.
mm/h
14
16
16
19
19
21
22
23
25
29
32
32
15
17
18
20
20
21
21
24
25
27
30
29
16
18
20
20
20
22
22
24
25
26
28
29
17
19
22
21
21
22
22
24
25
27
27
29

Presin
bares
5.5

6.0

6.2

6.5

6.9

tt
tt
tt
tt
tt
t
tt
tt
tt
t
tt
tt
tt
tt
t

Boquilla
4
6
8
10
12
14
16
18
20
22
24
26
12
14
16
18
20
22
24
26
14
16
18
20
22
24
26
20
22
24
26

Radio
m
11.9
13.7
14.9
16.8
18.5
19.2
20.4
21.0
21.6
22.8
23.5
24.1
18.6
19.6
20.9
21.5
22.1
22.9
23.9
24.1
19.8
21.0
21.7
22.5
23.4
24.1
24.3
22.9
23.5
24.1
24.7

Caudal
m3h
1.13
1.62
2.25
2.70
3.23
3.72
4.22
4.74
5.42
6.19
6.62
7.14
3.30
3.96
4.45
4.95
5.65
6.71
6.92
7.50
4.06
4.54
5.04
5.89
6.84
7.22
7.91
6.09
6.97
7.45
8.24

Caudal
l/m
18.90
26.84
37.02
44.60
53.66
61.98
70.28
78.97
90.30
103.15
110.33
119.05
55.07
66.06
74.12
82.56
94.18
108.12
115.31
125.08
67.75
75.70
84.02
98.19
112.73
120.25
131.76
101.43
116.19
124.14
137.39

Q
Precip.
mm/h
16
17
20
19
19
20
20
21
23
24
24
25
19
21
20
21
23
26
24
26
21
21
21
23
25
25
27
23
25
26
27

V
Precip.
mm/h
18
20
23
22
22
23
23
25
27
28
28
28
22
24
24
25
27
30
28
30
24
24
25
27
29
29
31
27
29
30
31

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.


Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

Boquillas Rain Curtain 8005

74

El uso inteligente del agua.

Rotores

www.rainbird.com/rotors

Gua de boquillas de repuesto Rain Curtain

Gua de referencia cruzada para boquillas Rain Curtain

Gua de referencia cruzada para boquillas Rain Curtain

Hunter vs. Rain Bird

Toro vs. Rain Bird

Si est
reemplazando:
PGP
1
2
3
4
5
6
7
8
9
10
11
12

Utilice esta boquilla Rain Bird


Por flujo
Por radio
Serie 5000
Serie 5000
1.5
1.5
2.0
2.0
2.5
2.5
3.0
3.0
4.0
4.0
5.0
5.0
8.0
6.0
8.0
8.0

Hunter vs. Rain Bird Rotores de 3/4" (1.9 cm)


Si est
reemplazando:
I-20
0.5 SR
1.0 SR
2.0 SR
0.75 SR
1.5 SR
3.0 SR
1.0
1.5
2.0
3.0
3.5
4.0
6.0
8.0

Utilice esta boquilla Rain Bird


Por flujo
Por radio
Serie 5000
5500
Serie 5000
5500
18S
18S
18S
18S
22S
22S
22S
26S
22S
1.5
1.5
30S
1.5
1.5
2
30S
2.0
2.0
2
2
2.5
2.5
3
2
3.0
3.0
4
3
4.0
4.0
5
3
5.0
5.0
6
4
6.0
6.0
8
8

Hunter vs. Rain Bird Rotores de 1" (2.5 cm)


Si est
reemplazando:
I-25
4
5
7
8
10
13
15
18
20
23
25
28
I-40
40
41
42
43
44
45
I-35
9
12
15
18
21
24
27
30

Utilice esta boquilla Rain Bird


Por flujo
Por radio
6504
8005
6504
8005
4
4
4
4
6
6
6
6
8
8
6
8
10
10
8
8
12
12
10
10
12
12
12
12
14
14
14
12
16
16
16
14
18
18
18
14
22
16
24
20
26
22
6504
8005
6504
8005
8
8
6
8
12
12
10
10
12
12
10
12
16
16
14
14
18
20
18
16
22
20
6504
8005
6504
8005
8
8
8
8
12
12
10
10
14
14
12
12
16
16
14
14
18
18
14
14
22
16
16
24
16
16
26
20

El uso inteligente del agua.

Toro vs. Rain Bird Rotores de 3/4" (1.9 cm)


Si est
reemplazando:
Super 800
0.5
0.75
1.0
2.0
2.5
3.0
4.0
6.0
8.0

Utilice esta boquilla Rain Bird


Por flujo
Por radio
Serie 5000
Serie 5000
1.5
1.5
2.5
2.0
3.0
2.5
4.0
2.5
5.0
3.0
6.0
4.0
8.0
5.0

Rotores

Hunter vs. Rain Bird Rotores de 3/4" (1.9 cm)

Toro vs. Rain Bird Rotores de 3/4" (1.9 cm)


Si est
reemplazando:
TR50
1.0
1.5
2.0
3.0
4.5
6.0
7.5
9.0

Utilice esta boquilla Rain Bird


Por flujo
Por radio
Serie 5000
5505
Serie 5000
5505
1.5
1.5
2
2
2.0
2.0
2
3
3.0
3.0
3
3
4.0
4.0
5
3
5.0
4.0
6
4
6.0
4.0
8
4
8.0
5.0
10
4

Toro vs. Rain Bird Rotores de 1" (2.5 cm)


Si est
reemplazando:
Toro 2001
9
12
15
18
24
TR70
7
9
12
16
20
24
27
Toro 640
40
41
42
43
44

Utilice esta boquilla Rain Bird


Por flujo
Por radio
6504
8005
6504
8005
10
10
10
10
12
12
12
12
16
16
14
14
18
20
18
16
22
20
6504
8005
6504
8005
8
8
6
8
8
8
8
12
12
10
10
16
16
14
12
20
14
14
20
16
14
20
18
16
6504
8005
6504
8005
8
8
8
10
10
12
10
10
14
14
12
12
16
16
14
14
18
20
16
14

75

Rotores
2045A Maxi-Paw

2045A Maxi-Paw

Rango operativo

Aplicaciones con agua sucia: espaciamiento de hasta 45 pies (13.7 m)

tOEJDFEFQSFDJQJUBDJOEFBQVMHBEBTQPSIPSB EFBNNI

t&TQBDJBNJFOUPEFBQJFT EFBN

tOEJDFEFGMVKPEFBHQN EFBN3/h; de 0.6 a 31.2 l/m)


t3BEJPEFBQJFT EFBN

t1SFTJOEFBQTJ BCBSFT

Q 'MFYJCJMJEBEGMVKPEJSFDUPQBSBBQMJDBDJPOFTDPOBHVBTVDJB
Q Confiabilidad: transmisin de impacto probada
Q Rendimiento: cinco boquillas MPR codificadas por color intercambiables

Caractersticas

Especificaciones

Rotores

t$PNCJOBDJOEFFOUSBEBIFNCSBJOGFSJPSEF12" (15/21) o 34" (20/27)


t*OTUBMBDJOZNBOUFOJNJFOUP
t 12" (15/21) entrada hembra lateral
- No se requieren herramientas para cambiar las boquillas
t#PRVJMMBT SPKP
 OFHSP
 B[VM
 BNBSJMMP
 CFJHF

- Se puede hacer el mantenimiento desde la parte superior de la cubierta


t#PRVJMMBTEFOHVMPCBKP-" OFHSP
-" BNBSJMMP
 PQDJPOBM

t4PMVDJPOFTEFEJTFP
t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMBEF
 %PTCPRVJMMBTEFOHVMPCBKP -"
JOUFSDBNCJBCMFT PQDJPOBMFT

t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMBEFOHVMPCBKPEF
- Brazo con doble peso para una rotacin ms lenta y una distancia de
t/PTFSFDPNJFOEBMBJOTUBMBDJOEFMBFOUSBEBMBUFSBMFODMJNBTDPOUFNQFSBUVSB
alcance aumentada
bajo cero
- Resorte de brazo ajustable para lograr un funcionamiento a baja presin y
bajo consumo de agua
Dimensiones
 'VODJPOBNJFOUPBCBKBQSFTJOZCBKPDPOTVNPEFBHVBRVFBIPSSBFOFSHB
t"MUVSBUPUBM310" (23.6 cm)
 $SDVMPDPNQMFUPPBSDPBKVTUBCMFEFB
t%JNFUSPTVQFSJPS DN

 $IPSSPUVCVMBSEFQSFDJTJO 1+

Modelos
- Alfiler del aspersor para controlar la distancia
t".BYJ1BX
 1BMBODB'1QBSBGVODJPOBNJFOUPEFDSDVMPDPNQMFUPPDSDVMPQBSDJBM
- Combinacin de entrada inferior de 1/2 (1.3 cm) (15/21) o 3/4 (1.9 cm) (20/27) t".BYJ1BX4".
t".BYJ1BX4"./1
t%VSBCJMJEBE
- Cubierta de plstico de gran resistencia con diseo nervado reforzado y slido
Boquillas disponibles
 %FTFOHBODIFJOUFSOPEFMJNQJF[BBVUPNUJDBDPOQBMBODBJOUFSJPSNFKPSBEB
t5SBZFDUPSJBFTUOEBS    
- Potente accin inversa
tOHVMPCBKP-" -"
- Cojinete cubierto para mayor durabilidad
 +VOUBMJNQJBEPSBNVMUJGVODJOBDUJWBEBBQSFTJO
- Entrada con malla de filtro

Opciones
t4FBM".BUJD (SAM) interno que evita el encharcamiento y
la erosin provocados por el drenaje de los aspersores bajos, y
ahorra agua (retiene 10 [3.1 m] o aspersor)
t5BQBWJPMFUBRVFGBDJMJUBMBJEFOUJGJDBDJOEFMPTTJTUFNBTQBSBBHVBOPQPUBCMF
2045A Maxi-Paw

Llave Maxi-Paw
t1BSBSFUJSBSFMFOTBNCMFJOUFSOPEFMBDVCJFSUB

Cmo especificar
2045A- SAM-10- LA

Modelo
t

Caracterstica
opcional
ngulo bajo
Boquilla
Tamao de la boquilla
10
Caracterstica opcional
SAM
Modelo
2045A Maxi-Paw

42064

Con su flujo de agua directo y pocas partes movibles, el Maxi-Paw brinda una distribucin de agua superior en las condiciones
de agua ms difciles.

76

El uso inteligente del agua.

Rotores

Rendimiento de Maxi-Paw
Presin
psi
25

35

45

55

60

tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
t

Boquilla
06
07 LA
07
08
10 LA
10
12
06
07 LA
07
08
10 LA
10
12
06
07 LA
07
08
10 LA
10
12
06
07 LA
07
08
10 LA
10
12
06
07 LA
07
08
10 LA
10
12

Radio
pies
22
32
35
25
38
39
37
23
37
38
29
41
42
38
25
39
40
31
42
44
38
25
41
41
32
43
45
38
25
41
42
32
44
45

Rendimiento de Maxi-Paw
Q
Caudal Precip.
gpm
pulg./h
1.5
0.60
2.2
0.41
2.8
0.44
3.4
1.05
4.2
0.56
5.5
0.70
2.0
0.28
1.9
0.69
2.7
0.38
3.3
0.44
4.0
0.92
4.8
0.55
6.3
0.69
2.3
0.31
2.1
0.65
3.0
0.38
3.7
0.45
4.5
0.90
5.4
0.59
7.1
0.71
2.5
0.33
2.3
0.71
3.3
0.38
4.1
0.47
5.0
0.94
6.0
0.62
7.9
0.75
2.6
0.35
2.4
0.74
3.5
0.40
4.2
0.46
5.4
1.02
6.4
0.64
8.4
0.80

V
Precip.
pulg./h
0.69
0.48
0.51
1.21
0.65
0.80
0.32
0.80
0.44
0.51
1.06
0.64
0.79
0.35
0.75
0.44
0.51
1.04
0.68
0.82
0.39
0.82
0.44
0.54
1.09
0.72
0.87
0.40
0.85
0.46
0.53
1.17
0.74
0.92

Presin
bares
2.0

2.5

3.0

3.5

4.0

Boquilla

tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
t

6
07 LA
7
8
10 LA
10
12
6
07 LA
7
8
10 LA
10
12
6
07 LA
7
8
10 LA
10
12
6
07 LA
7
8
10 LA
10
12
6
07 LA
7
8
10 LA
10
12

Radio
m
6.8
10.4
11.0
8.1
11.9
12.3
11.3
7.1
11.4
11.7
8.9
12.5
12.9
11.5
7.5
11.8
12.1
9.4
12.8
13.3
11.6
7.6
12.2
12.4
9.6
13.0
13.6
11.6
7.6
12.5
12.7
9.8
13.3
13.7

SIST. MTRICO
Q
V
Caudal Caudal Precip. Precip.
m3h l/m
mm/h mm/h
0.38 6.0
16
19
0.55 9.0
10
12
0.68 11.4 11
13
0.83 13.8 25
29
1.01 16.8 14
16
1.32 22.2 18
20
0.46 7.8
7
8
0.44 7.2
17
20
0.62 10.2 10
11
0.76 12.6 11
13
0.92 15.6 23
27
1.11 18.6 14
16
1.45 24.0 18
20
0.51 8.4
8
9
0.47 7.8
17
19
0.67 11.4 10
11
0.83 13.8 11
13
1.01 16.8 23
27
1.21 20.4 15
17
1.59 26.4 18
21
0.55 9.0
8
9
0.50 8.4
17
20
0.72 12.0 10
11
0.89 15.0 12
13
1.09 18.0 23
27
1.30 21.6 15
18
1.72 28.8 19
21
0.58 9.6
9
10
0.54 9.0
18
21
0.78 13.2 10
11
0.94 15.6 12
14
1.19 19.8 25
29
1.42 23.4 16
19
1.86 31.2 20
23

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.

Datos de rendimiento obtenidos en condiciones de cero viento.

Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.

Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro

Boquillas 2045A Maxi-Paw

El uso inteligente del agua.

77

Rotores

www.rainbird.com/rotors

2045A Maxi-Paw

Rotores
4FSJFT54+:54+134

Series TSJ Y TSJ-PRS


+VOUBTBSUJDVMBEBTRVFDPOFDUBOWMWVMBTEFBDPQMBNJFOUPSQJEPP
SPUPSFTEFw DN
Zw DN
BMBTUVCFSBTMBUFSBMFT

Q El diseo patentado de codo curvado minimiza la turbulencia y la prdida


de presin mientras que maximiza el rendimiento del rotor

t"MUPOEJDFEFQSFTJOPQFSBUJWB QTJCBS
QFSGFDUPQBSBTVVTPFO
condiciones de presin constante
t&OUSBEBEFMMBWFEJTQPOJCMFFOKVOUBTBSUJDVMBEBTEF DN

t$POTVMUFMBTUBCMBTQBSBWFSMBDPNQBSBDJOEFQSEJEBEFQSFTJOZMB
regulacin de la presin

Q Sin ngulos internos filosos (como tienen algunos competidores)

Informacin sobre la aplicacin de TSJ-PRS

Q Sin obstrucciones internas (como tienen algunos competidores)

t/PTFSFDPNJFOEBVUJMJ[BS54+134FOTJTUFNBTEPOEFMBQSFTJOEFMBTMOFBT
laterales sea igual o menor que la presin de regulacin nominal, dado que
el descenso incrementado de la presin puede afectar desfavorablemente su
rendimiento.
t1BSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF 3BJO#JSESFDPNJFOEBRVFMPT
ndices de flujo en la lnea de suministro no superen los 5 pies/s (1.5 m/s).
&MNPEFMP54+134OPUJFOFDPNPQSPQTJUPGVODJPOBSDPNPEJTQPTJUJWPEF
prevencin de "golpes de ariete".
t/PDPOUJFOFQJF[BTRVFSFRVJFSBONBOUFOJNJFOUPEFMVTVBSJP&MSFTPSUF
interno est bajo compresin. No abra la unidad PRS bajo ninguna
circunstancia.

Caractersticas

Rotores

t6OJEBEFTQSFFOTBNCMBEBTRVFBIPSSBOUJFNQPZSFEVDFOMPTDPTUPTEF
instalacin
t&YDFMFOUFJOUFHSJEBEFTUSVDUVSBMEFCJEPBMEJTFPEFDPEPDVSWBEPRVF
reduce los costos asociados con las fallas por fatiga
t&OUSBEBTSPTDBEBTEFHSBOUBNBP FNQVBEVSBTFYUSBHSBOEFTZSFUFOFT
grandes bien visibles que simplifican la torsin manual
t&MFNQBRVFEPCMFQBUFOUBEPCSJOEBNBZPSQSPUFDDJOBOUFQSEJEBTZ
mantiene las roscas libres de suciedad durante la instalacin
t-BWFOUJMBDJOEFBMJWJPEFQSFTJOCBKBFWJUBRVFMBQSFTJOTFBDVNVMF
entre el empaque principal y el secundario cuando la junta articulada est
ensamblada en agua, lo que elimina los empaques fundidos
t$POTUSVJEPDPO17$SHJEP5JQP*QBSBCSJOEBSNBZPSEVSBDJO DMBTJGJDBDJO
#EFMBDFMEB RVFDVNQMFDPOMBOPSNB"45.%5PEBTMBTSPTDBT
EF/15 DMBWJKBTZMMBWFTTPOEF17$4DIFEVMFTFHOMBTOPSNBT"45.
%Z%

Caractersticas nicas de TSJ-PRS


t.BOUJFOFVOBQSFTJODPOTUBOUFZVOJGPSNFFOFMSPUPSJOEFQFOEJFOUFNFOUF
de la boquilla usada:
QTJ CBSFT
QBSBKVOUBTBSUJDVMBEBTEFw DN

- 70 psi (4.8 bares) para juntas articuladas de 1 (2.5 cm)


t1FSNJUFRVFMPTSPUPSFTEFDBEB[POBGVODJPOFOBVOBNJTNBQSFTJO MPDVBM
mejora la coherencia y el rendimiento de todo el sistema
t3FEVDFMBOFCVMJ[BDJOZPUSPTQSPCMFNBTEFSFOEJNJFOUPPDBTJPOBEPTQPSMB
alta presin
t-BDBSDBTBEFMSFHVMBEPSFTUDPOTUSVJEBDPO17$RVFDPJODJEFDPOMB
clasificacin de alta presin de la junta articulada para csped Rain Bird y
supera la clasificacin de presin de los rotores
t&MEJBGSBHNBFTUDPOTUSVJEPDPOVOBUFMBSFGPS[BEBDPOFMBTUNFSP
para una mayor vida til
t&MGJMUSPQPSPTPCSJOEBVOBSFGFSFODJBBUNPTGSJDBTJOQFSNJUJSRVFJOHSFTF
contaminacin, lo que permite que el sistema se pueda enterrar
en cualquier tipo de suelo

Modelos
t54+w DN
EFMPOHJUVE KVOUBBSUJDVMBEB.Y./15EF
3
/4 (1.9 cm) (20/27)
t54+ DN
EFMPOHJUVE KVOUBBSUJDVMBEB.Y./15EF
1" (2.5 cm) (26/34)
t54+ DN
EFMPOHJUVE KVOUBBSUJDVMBEB.Y./15EF
1" (2.5 cm) (26/34)
t54+1343/4 (1.9 cm) con regulador de presin de 45 psi (3.1 bares), 12
DN
EFMPOHJUVE FOUSBEBZTBMJEB.Y./15EF3/4 (1.9 cm) (20/27)
t54+134KVOUBBSUJDVMBEBEF DN
DPOSFHVMBEPSEFQSFTJOEF
QTJ CBSFT
w DN
EFMPOHJUVE FOUSBEBZTBMJEB.Y./15EF
1" (2.5 cm) (26/34)

Rango operativo
tOEJDFEFQSFTJOQTJB' CBSFTB$

TFHO"45.%

- Probado sin prdidas por 60 minutos a 790 psi (54.5 bares)


- Probado sin prdidas durante una corta exposicin a 1000 psi
(68.9 bares)
t1SEJEBEFQSFTJOEFKVOUBTEFQTJBHQN CBSBMT

t1SEJEBEFQSFTJOEFKVOUBTEFQTJBHQNQTJBHQN CBS
a 1.1 l/s; 0.2 bar a 1.5 l/s)
t'MVKPNYJNPEF54+134HQN MT

TSJ-075-PRS, TSJ-100-PRS

TSJ-12075, TSJ-12,
TSJ-18

-BTFSJF54+134DPOTFSWBFMBHVBSFEVDJFOEPMBOFCVMJ[BDJOZPUSPTQSPCMFNBTEFSFOEJNJFOUPPDBTJPOBEPTQPSMPTTJTUFNBTEFBMUBQSFTJO

78

El uso inteligente del agua.

Rotores

www.rainbird.com/rotors

4FSJFT54+:54+134

TSJ-100-PRS

70
60
50

TSJ-075-PRS

40
30
20
20 30

40

50

60

70

80

90 100 110 120 130 140 150

Presin de entrada de la junta articulada (psi)

SIST. MTRICO

5.5
TSJ-100-PRS

4.8
4.1
3.5

TSJ-075-PRS

2.8
2.1
1.4
1.4 2.1 2.8 3.5 4.1 4.8 5.5 6.2 6.9 7.6 8.3 9.0 9.7 10.3

Presin de entrada de la junta articulada (bares)

Rotores

Salida de la junta articulada (entrada del rotor)


Presin (psi)

80

Salida de la junta articulada (entrada del rotor)


Presin (bares)

Regulacin de presin de TSJ-PRS

Regulacin de presin de TSJ-PRS

Especificaciones de las juntas articuladas


Nmero de modelo
EE.UU.

54+
54+
54+
54+134
54+134

Longitud
4*45.53*$0

12"
12"
18"
12"
12"

HOLDUPTOOL
(herramienta de
sostn) con nivel de
burbuja
Caractersticas
t-BDPNCJOBDJOFOUSFMBIFSSBNJFOUB
de sostn y el nivel de burbuja
permite una instalacin adecuada y
ms fcil
t'VODJPOBDPOMBT4FSJFT  
'BMDPO 6504 y 8005

30.5 cm
30.5 cm
45.7 cm
30.5 cm
30.5 cm

EE.UU.

Entrada
4*45.53*$0

.
1" M
1" M
.
1" M

20/27 M
26/34 M
26/34 M
20/27 M
26/34 M

EE.UU.

.
1" M
1" M
.
1" M

Salida
4*45.53*$0

20/27 M
26/34 M
26/34 M
20/27 M
26/34 M

Rosca

Regulacin de presin
EE.UU.
4*45.53*$0

/15
/15
/15
/15
/15

n/c
n/c
n/c
45 psi
70 psi

n/c
n/c
n/c
45 psi
70 psi

ROTORTOOL

Calculadores de ahorro de agua en lnea

Caractersticas

Rain Bird posee varios calculadores en lnea disponibles que lo ayudarn a


mostrarles a los clientes los porcentajes de ahorro de agua potenciales que se
obtienen al usar los rotores y las boquillas de riego eficiente Rain Bird:
t3PUPSFT4FSJFZ1MVT134
t#PRVJMMBTQBSBSPUPS4FSJFZ1MVT.13
t+VOUBTBSUJDVMBEBT54+134

t%FTUPSOJMMBEPSEFDBCF[BQMBOBZ
herramienta para jalar y sostener el
vstago en una misma unidad

Modelo
t30503500-

HOLDUPTOOL

El uso inteligente del agua.

Disponibilidad
www.rainbird.com/calculators

ROTORTOOL

79

Impactos
Introduccin
Cuerpos de
aspersores
Boquillas aspersoras
Rotores
Impactos
Vlvulas

Rain Bird lanz el primer aspersor de


impacto en el mercado en 1933 (Patente
N. 1,997,901), y as dio comienzo a la era
de las tcnicas de irrigacin modernas. Este
compromiso con el diseo de aspersores de
impacto superiores y eficientes es tan fuerte
hoy como lo fue hace 80 aos y se hace
evidente en cada producto que ofrecemos.

Accesorios

Productos principales

Programadores

Aplicaciones primarias
Pendientes

Sistemas de control
centralizado

Cubierta vegetal/Arbustos
Sistemas de baja presin
reas de viento excesivo
Aguas residuales

2045-PJ
Maxi-Bird

20ADJB

25BPJ-ADJ

35A-TNT

65PJADJ-TNT

tt
tt
t

tt
tt
t

tt
tt
t

tt
t

tt
t

Xerigation
Bombas

Sugerencias para ahorrar agua


Drenaje

t Los aspersores de impacto Rain Bird se


Recursos

disearon para satisfacer los requisitos


exigentes de la irrigacin agrcola. Estos
productos han probado ser tolerantes a la
arenilla y resistentes al agua dura.

t Los modelos de crculo completo y crculo

t Una gran seleccin de boquillas, que

parcial incluyen mecanismos motrices que


se han refinado para proporcionar el
funcionamiento ms confiable y eficaz
que se ofrece actualmente en la industria.

se utilizan en un amplio rango de


presin, le garantiza que podr
encontrar un aspersor especialmente
diseado para sus necesidades.

Referencia

80

El uso inteligente del agua.

Impactos
1+.BYJ#JSE

www.rainbird.com/impacts

2045-PJ Maxi-Bird
Cabezal de impacto 1/2" (1.3 cm) (15/21) para montaje sobre tubera de
elevacin utilizado para aplicaciones sobre el terreno en pendientes y reas
grandes
Q 'MFYJCJMJEBEDBVEBMEJSFDUPQBSBVOSFOEJNJFOUPTVQFSJPSFO
agua sucia
Q Confiabilidad: transmisin de impacto probada
Q Rendimiento: cinco boquillas con ndices de precipitacin ajustados (MPR) y
dos boquillas de ngulo bajo (LA)

Caractersticas
t#SB[PDPOEPCMFQFTPQBSBVOBSPUBDJONTMFOUBZVOBNBZPS
distancia de alcance. Potente accin inversa

Impactos

t3FTPSUFEFCSB[PBKVTUBCMFQBSBMPHSBSVOGVODJPOBNJFOUPBCBKBQSFTJOZCBKP
consumo de agua
t5VCPEFDIPSSPEFQSFDJTJO 1+) que minimiza las salpicaduras laterales
t#PRVJMMBTJOUFSDBNCJBCMFTEFNPOUBKFEFCBZPOFUB DPEJGJDBEBTQPSDPMPSFT
- No se requieren herramientas para cambiar las boquillas
t1BMBODB'1RVFQFSNJUFFMGVODJPOBNJFOUPEFDSDVMPQBSDJBMPDPNQMFUP EF
B

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

2045-PJ-08 Maxi-Bird

t$BVEBMEFBHQN EFBN3h; de 5.4 a 31.8 l/m)


t3BEJPEFBQJFT EFBN

tOEJDFEFQSFDJQJUBDJOEFBQVMHBEBTQPSIPSB EFBNNI

Especificaciones
t#PRVJMMBTEFFOUSBEBNBDIPSPTDBEBEF1/2" (1.3 cm) (15/21)
t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMBQBSBMBTCPRVJMMBT   Z
tQBSB-"Z-"
t#PRVJMMBTEFOHVMPEFUSBZFDUPSJBFTUOEBS SPKP
 OFHSP
 B[VM

10 (amarillo); 12 (beige)
t#PRVJMMBTEFOHVMPCBKP -"
-"OFHSP-"BNBSJMMP PQDJPOBM

Modelo
t1+.BYJ#JSE

2045-PJ-08 Boquillas

El uso inteligente del agua.

81

Impactos
1+.BYJ#JSE

Rendimiento del 2045-PJ-08 Maxi-Bird


Presin
psi
25



35


Impactos

45



55



60



Boquilla

tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
t

06
07 LA
07
 
10 LA
10
12
06
07 LA
07
 
10 LA
10
12
06
07 LA
07
 
10 LA
10
12
06
07 LA
07
 
10 LA
10
12
06
07 LA
07
 
10 LA
10
12

Radio
pies
22
32

25
38
39
37
23
37

29
41
42
38
25
39

31
42
44
38
25
41

32
43
45
38
25
41

32
44
45

Caudal
gpm
1.5
2.2

3.4
4.2
5.5
2.0
1.9
2.7

4.0
4.8
6.3
2.3
2.1
3.0

4.5
5.4
7.1
2.5
2.3
3.3

5.0
6.0
7.9
2.6
2.4
3.5

5.4
6.4
8.4

Rendimiento del 2045-PJ-08 Maxi-Bird SISTEMA MTRICO


Q
Precip.
pulg./h
0.60
0.41

1.05
0.56
0.70
0.28
0.69
0.38

0.92
0.55
0.69
0.31
0.65
0.38

0.90
0.59
0.71
0.33
0.71
0.38

0.94
0.62
0.75
0.35
0.74
0.40

1.02
0.64
0.80

V
Precip.
pulg./h
0.69
0.48

1.21
0.65
0.80
0.32
0.80
0.44

1.06
0.64
0.79
0.35
0.75
0.44

1.04
0.68
0.82
0.39
0.82
0.44

1.09
0.72
0.87
0.40
0.85
0.46

1.17
0.74
0.92

Presin
bares
2.0



2.5



3.0



3.5



4.0



Boquilla

ttt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt

6
07 LA
7
 
10 LA
10
12
6
07 LA
7
 
10 LA
10
12
6
07 LA
7
 
10 LA
10
12
6
07 LA
7
 
10 LA
10
12
6
07 LA
7
 
10 LA
10
12

Radio
m
6.8
10.4

8.1
11.9
12.3
11.3
7.1
11.4

8.9
12.5
12.9
11.5
7.5
11.8

9.4
12.8
13.3
11.6
7.6
12.2

9.6
13.0
13.6
11.6
7.6
12.5

9.8
13.3
13.7

Caudal Caudal
m3h l/m
0.38 6.0
0.55 9.0
 
0.83 13.8
1.01 16.8
1.32 22.2
0.46 7.8
0.44 7.2
0.62 10.2
 
0.92 15.6
1.11 18.6
1.45 24.0
0.51 8.4
0.47 7.8
0.67 11.4
 
1.01 16.8
1.21 20.4
1.59 26.4
0.55 9.0
0.50 8.4
0.72 12.0
 
1.09 18.0
1.30 21.6
1.72 28.8
0.58 9.6
0.54 9.0
0.78 13.2
 
1.19 19.8
1.42 23.4
1.86 31.2

Q
Precip.
mm/h
16
10

25
14
18
7
17
10

23
14
18
8
17
10

23
15
18
8
17
10

23
15
19
9
18
10

25
16
20

V
Precip.
mm/h
19
12

29
16
20
8
20
11

27
16
20
9
19
11

27
17
21
9
20
11

27
18
21
10
21
11

29
19
23

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.


Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Tamao de la boquilla estndar
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se
encuentra en la pgina 234.

82

El uso inteligente del agua.

Impactos

www.rainbird.com/impacts

"%+#

Cabezal de impacto 1/2" (1.3 cm) (15/21) para montaje sobre tubera de
elevacin utilizado en aplicaciones de pendientes o reas sin csped

Q 'MFYJCJMJEBEDBVEBMEJSFDUPQBSBVOSFOEJNJFOUPTVQFSJPSFOBHVBTVDJB
Q Confiabilidad: transmisin de impacto probada
Q %VSBCJMJEBE FTUSVDUVSBEFMBUOSFTJTUFOUF

Rendimiento del modelo 20ADJB


Presin
psi

Boquilla

30

08
09
 
08
09
 
08
09
 
08
09
 
08
09
 


40

Caractersticas
t"MGJMFSEFMBTQFSTPSQBSBDPOUSPMEFEJTUBODJBRVFQFSNJUFVOBSFEVDDJOEFM
radio de hasta un 25% sin cambiar las boquillas


50

Rango operativo



tOEJDFEFQSFDJQJUBDJOEFBQVMHBEBTQPSIPSB EFBNNI

60

t3BEJPEFBQJFT EFBN

t1SFTJOEFBQTJ EFBCBSFT

t$BVEBMEFBHQN EFBN3h; de 9.0 a 22.2 l/m)


70



Especificaciones

Radio
pies
38
39

39
40

40
41

40
41

40
41


Caudal
gpm
2.4
3.1

2.9
3.6

3.2
4.0

3.6
4.4

3.9
4.8


Q
Precip.
pulg./h
0.16
0.20

0.18
0.22

0.19
0.23

0.22
0.25

0.23
0.27


V
Precip.
pulg./h
0.18
0.23

0.21
0.25

0.22
0.26

0.25
0.29

0.27
0.32


t&OUSBEBNBDIPSPTDBEBEF1/2" (1.3 cm) (15/21)


t1BSBMBCPRVJMMBBMBQSFTJOEFGVODJPOBNJFOUPOPSNBM FMQVOUPEFDBVEBM
ms alto es 7 pies (2.1 m) por encima de la boquilla
t#PRVJMMBT  

Modelo
t"%+#

Rendimiento del modelo 20ADJB


Presin
bares

Boquilla

2.1

8
9
 
8
9
 
8
9
 
8
9
 
8
9
 
8
9
 
8
9
 


2.5


3.0


3.5


4.0


4.5


4.8



Radio
m
11.6
11.9

11.8
12.1

11.9
12.2

12.0
12.3

12.1
12.4

12.2
12.5

12.2
12.5


SISTEMA MTRICO

Caudal Caudal
m3h l/m
0.54 9.0
0.70 12.0
 
0.61 10.2
0.77 12.6
 
0.67 11.4
0.84 13.8
 
0.73 12.0
0.91 15.0
 
0.79 13.2
0.98 16.2
 
0.85 14.4
1.05 17.4
 
0.89 15.0
1.09 18.0
 

Q
Precip.
mm/h
4
5

4
5

5
6

5
6

5
6

6
7

6
7


V
Precip.
mm/h
5
6

5
6

5
7

6
7

6
7

7
8

7
8


Los ndices de precipitacin se basan en un funcionamiento en semicrculo.


Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro

20ADJB

Tamao de la boquilla estndar


La distribucin ptima del agua se alcanza a una presin de 40 a 50 psi (de 2.8 a 3.5 bares)
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE; ASABE
S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se encuentra en
la pgina 234.

El uso inteligente del agua.

83

Impactos

20ADJB

Impactos
4FSJF#1+"%+

Serie 25BPJ-ADJ

Rendimiento de la Serie 25BPJ-ADJ

Cabezal de impacto 1/2" (1.3 cm) (15/21) para montaje sobre tubera de
elevacin utilizado en aplicaciones de pendientes o reas grandes sin csped

Q 'MFYJCJMJEBEDBVEBMEJSFDUPQBSBVOSFOEJNJFOUPTVQFSJPSFO
agua sucia

Presin
psi

Boquilla

30

09
 
09
 
09
 



Q Confiabilidad: transmisin de impacto probada

40

Q %VSBCJMJEBEFTUSVDUVSBEFMBUO CSPODFZBDFSPJOPYJEBCMFSFTJTUFOUF
Cuerpo y brazo de bronce, ensamble de palanca de acero inoxidable, funda
y niple de cojinete de latn. Eje de articulacin, resorte del brazo,
resorte de palanca y collarines de friccin de acero inoxidable


50



Caractersticas

Radio
pies
38

39

40


Caudal
gpm
3.1

3.6

4.0


Rendimiento de la Serie 25BPJ-ADJ

t1BMBODB'1RVFQFSNJUFFMGVODJPOBNJFOUPFODSDVMPQBSDJBMPDPNQMFUP
"KVTUBCMFEFB
Impactos

t$IPSSPUVCVMBSEFQSFDJTJO 1+
FONFUBMGVOEJEPRVFNJOJNJ[BMBT
salpicaduras laterales

Presin
bares

Boquilla

2.1

9
 
9
 
9
 
9
 



Rango operativo
tOEJDFEFQSFDJQJUBDJOEFBQVMHBEBTQPSIPSB EFBNNI

2.5



t3BEJPEFBQJFT EFBN

3.0

t1SFTJOEFBQTJ EFBCBSFT



t$BVEBMEFBHQN EFBN3h; de 12.0 a 19.2 l/m)

3.5


Especificaciones

Radio
m
11.6

11.8

12.0

12.2


Q
Precip.
pulg./h
0.41

0.46

0.48


V
Precip.
pulg./h
0.48

0.53

0.56


SIST. MTRICO

Caudal Caudal
m3h l/m
0.70 12.0
 
0.77 12.6
 
0.85 13.8
 
0.91 15.0
 

Q
Precip.
mm/h
10

11

12

12


V
Precip.
mm/h
12

13

14

14


Los ndices de precipitacin se basan en un funcionamiento en semicrculo.

t&OUSBEBNBDIPSPTDBEBEF1/2" (1.3 cm) (15/21)

Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.

t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMB

VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro

t#PRVJMMBT 

Tamao de la boquilla estndar


La distribucin ptima del agua se alcanza a una presin de 40 a 50 psi (de 2.8 a 3.5 bares)

Modelos

Datos de rendimiento obtenidos en condiciones de cero viento.

t#1+'1"%+

Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE; ASABE
S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se encuentra
en la pgina 234.

t#1+'1"%+%"
t#1+'1"%+%"5/5
t#1+&TQFDJBM
25BPJ-FP-ADJ
Boquilla de latn con alfiler del aspersor
de acero inoxidable montado en puente y
paleta tipo barril a prueba de obstrucciones.
El alfiler del aspersor permite una reduccin
del radio de hasta un 25% sin necesidad de
cambiar las boquillas

25BPJ-ADJ-DA-TNT
*HVBMRVFFMNPEFMP#1+'1"%+%" 
DPODPKJOFUF5/5

Cmo especificar
25BPJ-ADJ- 09
Boquilla
09
Modelo
#1+'1"%+

84

25BPJ Especial
*HVBMRVFFMNPEFMP#1+'1"%+%"
5/5 DPODPMMBSJOFTEFGSJDDJOBQSVFCB
de golpes y palanca fija y ajustada para
operar nicamente en crculo parcial

25BPJ-FP-ADJ-DA
*HVBMRVFFMNPEFMP#1+'1"%+ 
DPOBMFUB%"QBSBDPOUSPMEFEJTUBODJB
montada en puente

El uso inteligente del agua.

Impactos

www.rainbird.com/impacts

4FSJF"5/5

Serie 35A-TNT
Q 'MFYJCJMJEBEDBVEBMEJSFDUPQBSBVOSFOEJNJFOUPTVQFSJPSFOBHVBTVDJB
Q Confiabilidad: transmisin de impacto probada
Q %VSBCJMJEBEFTUSVDUVSBEFMBUOZBDFSPJOPYJEBCMFSFTJTUFOUF

Rendimiento de la Serie 35A-TNT


Presin
psi

Boquilla

30

10
11
 
10
11
 
10
11
 
10
11
 


40



Caractersticas

50

t$PKJOFUF5/5EFMBSHBEVSBDJO
t1BMBODB'1RVFQFSNJUFFMGVODJPOBNJFOUPFODSDVMPQBSDJBMPDPNQMFUP
"KVTUBCMFEFB


60

t$IPSSPUVCVMBSEFQSFDJTJO 1+
RVFNJOJNJ[BMBTTBMQJDBEVSBTMBUFSBMFT
t"MGJMFSEFMBTQFSTPSQBSBDPOUSPMBSMBEJTUBODJBZBMFUBQBSBDPOUSPMEFEJTUBODJB
%"EFBDFSPJOPYJEBCMFRVFQFSNJUFOVOBSFEVDDJOEFMSBEJPEFIBTUBVO
sin cambiar las boquillas



Radio
pies
42
43

44
45

45
47

46
48


Caudal
gpm
3.9
4.6

4.5
5.4

5.0
6.0

5.4
6.6


Rendimiento de la Serie 35A-TNT

Q
Precip.
pulg./h
0.43
0.48

0.45
0.51

0.48
0.52

0.49
0.55


SISTEMA MTRICO

Rango operativo
tOEJDFEFQSFDJQJUBDJOEFBQVMHBEBTQPSIPSB EFBNNI

Boquilla

t3BEJPEFBQJFT EFBN

Presin
bares

t1SFTJOEFBQTJ EFBCBSFT

2.1

10
11
 
10
11
 
10
11
 
10
11
 
10
11
 
10
11
 

t$BVEBMEFBHQN EFBN3h; de 15.0 a 29.4 l/m)


2.5

Especificaciones
3

t&OUSBEBNBDIPSPTDBEBEF /4" (1.3 cm) (20/27)



t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMB

3.0

Modelos



t"5/5

3.5

t""%+5/5



t"1+%"5/5

4.0

t"1+"%+5/5


35A-PJDA-TNT
*HVBMRVFFMNPEFMP"5/5 
con tubo de chorro de precisin
1+
ZBMFUBQBSBDPOUSPMEF
EJTUBODJB %"

4.1



Radio
m
12.8
13.1

13.1
13.5

13.4
13.9

13.7
14.3

14.0
14.6

14.0
14.6


V
Precip.
pulg./h
0.49
0.55

0.52
0.59

0.55
0.60

0.57
0.64


Caudal Caudal
m3h l/m
0.89 15.0
1.04 17.4
 
0.97 16.2
1.15 19.2
 
1.05 17.4
1.26 21.0
 
1.13 18.6
1.37 22.8
 
1.21 20.4
1.48 24.6
 
1.23 20.4
1.50 25.2
 

Q
Precip.
mm/h
11
12

11
13

12
13

12
13

12
14

12
14


V
Precip.
mm/h
12
14

13
15

13
15

14
16

14
16

14
16


Los ndices de precipitacin se basan en un funcionamiento en semicrculo.


Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Tamao de la boquilla estndar
La distribucin ptima del agua se alcanza a una presin de 40 a 50 psi (de 2.8 a 3.5 bares)
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE; ASABE S398.1. El
texto completo de la Declaracin de Certificacin de Prueba ASABE se encuentra en la pgina 234.

35A-TNT
Cojinete macho de 3/4" (1.9 cm) (20/27).
$PKJOFUF5/5OJDBNFOUF$VFSQPZCSB[PEF
MBUOGVOEJEP'VOEBZOJQMFEFDPKJOFUFEF
latn. Resorte del brazo, resorte de palanca y
collarines de palanca de acero inoxidable. La
palanca de acero inoxidable se puede
fijar para un funcionamiento de crculo
completo o parcial

El uso inteligente del agua.

Cmo especificar
35A-PJADJ-TNT- 10
35A-PJADJ-TNT
*HVBMRVFFMNPEFMP"5/5 DPO
alfiler del aspersor con control de
EJTUBODJB "%+
ZUVCPEFDIPSSPEF
QSFDJTJO 1+

Boquilla
10

35A-ADJ-TNT
*HVBMRVFFMNPEFMP"5/5
con alfiler del aspersor para controlar
MBEJTUBODJB "%+

Modelo
"1+"%+5/5

85

Impactos

Cabezal de impacto de 3/4" (1.9 cm) (20/27) para montaje sobre tubera de
elevacin utilizado en aplicaciones de pendientes o reas grandes sin csped

Impactos
4FSJF"5/5

65PJADJ-TNT
Cabezal de impacto de 1" (2.5 cm) (26/34) para montaje sobre tubera de
elevacin utilizado en aplicaciones de pendientes o reas grandes sin csped

Q 'MFYJCJMJEBEDBVEBMEJSFDUPQBSBVOSFOEJNJFOUPTVQFSJPSFOBHVBTVDJB
Q Confiabilidad: transmisin de impacto probada
Q %VSBCJMJEBEFTUSVDUVSBEFMBUOZBDFSPJOPYJEBCMFSFTJTUFOUF

Rendimiento de la Serie 65PJADJ-TNT


Presin
psi

Boquilla

50
60
70
80

16
16
16
16

Radio
pies
57
58
63
65

Caudal
gpm
12.9
14.2
15.4
16.5

Q
Precip.
pulg./h
0.76
0.81
0.75
0.75

V
Precip.
pulg./h
0.88
0.94
0.86
0.87

Caractersticas
t$PKJOFUF5/5EFMBSHBEVSBDJO

Rendimiento de la Serie 65PJADJ-TNT SISTEMA MTRICO

t1BMBODB'1RVFQFSNJUFFMGVODJPOBNJFOUPFODSDVMPQBSDJBMPDPNQMFUP
"KVTUBCMFEFB
t$IPSSPUVCVMBSEFQSFDJTJO 1+
RVFNJOJNJ[BMBTTBMQJDBEVSBTMBUFSBMFT
t"MGJMFSEFMBTQFSTPSQBSBDPOUSPMBSMBEJTUBODJBEFBDFSPJOPYJEBCMFRVFQFSNJUF
una reduccin del radio de hasta un 25% sin cambiar las boquillas
Impactos

Rango operativo
tOEJDFEFQSFDJQJUBDJOEFBQVMHBEBTQPSIPSB EFBNNI

t3BEJPEFBQJFT EFBN

t1SFTJOEFBQTJ EFBCBSFT

t$BVEBMEFBHQN EFBN3h; de 48.6 a 62.4 l/m)

Especificaciones
t&OUSBEBIFNCSBSPTDBEB/15P#41EF DN
 

t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMB

Modelo

Presin
bares

Boquilla

3.5
4.0
4.5
5.0
5.5

16
16
16
16
16

Radio
m
17.4
17.9
18.5
19.2
19.8

Caudal Caudal
m3h l/m
2.93 48.6
3.16 52.8
3.35 55.8
3.55 59.4
3.75 62.4

Q
Precip.
mm/h
19
20
19
19
19

V
Precip.
mm/h
22
23
23
22
22

Los ndices de precipitacin se basan en un funcionamiento en semicrculo.


Q Patrn de distribucin cuadrado basado en un alcance del 50% de dimetro.
VPatrn de distribucin triangular sobre la base de un alcance del 50% de dimetro
Tamao de la boquilla estndar
La distribucin ptima del agua se alcanza a una presin de 40 a 50 psi (de 2.8 a 3.5 bares)
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE; ASABE
S398.1. El texto completo de la Declaracin de Certificacin de Prueba ASABE se encuentra
en la pgina 234.

t1+"%+5/5
t1+"%+5/5#41.PEFMP#41

Cmo especificar
65PJADJ-TNT

65PJADJ-TBT

Boquilla
16
Modelo
1+"%+5/5

86

El uso inteligente del agua.

Rotores

Boquillas aspersoras

Cuerpos de
aspersores

Introduccin

Vlvulas

Impactos

"Instal otras vlvulas, pero la confiabilidad


no era como la de las vlvulas DV de Rain
Bird. Es por eso que durante los ltimos 15
aos instal solo vlvulas DV, porque no voy
a arriesgar mi reputacin por nada".

Vlvulas

Joe DiBlasi,
Directivo JKJ Lawn Sprinkler Inc.

Productos principales

Entrada inferior
Caudal bajo

JTV

I/E

I/E

I/E

z
z
z

%7"

%7'"

JTVF

HV

PGA

PEB

PESB/PESB-R

QC

I/E

I/E

I/E

I/E

I/E

z
z

z
z

z
z

z
z

z
z

z
z

z
z

z
z
z
z
z

z
z
z
z

z
z

z
z
z
z

z
z

Sitios que requieren latn

BPES

Agua no potable

BPE

I/E

Agua sucia

EFB-CP

$PNQBUJCMFDPO134%JBM

Sitios que requieren plstico

GB

Compatible con el sistema


decodificador

Accesorios

ASVF

Programadores

I/E

Control de caudal

DVF

Sistemas de control
centralizado

Purga manual

DV

Xerigation

Aplicaciones primarias

Bombas

t%7%7'EJTQPOJCMFTFOMBTDPOGJHVSBDJPOFTEFHMPCP EFOHVMP EFFOUSBEBTMJTBTZNBDIPYDPOFDUPSEFQVOUB


t1BSBVODBVEBMJOGFSJPSBHQN N3IMT
JOTUBMFVOGJMUSP3#:EFDPSSJFOUFBTDFOEFOUFt*&JOUFSOPFYUFSOP
t+57+57'EJTQPOJCMFTFOMBTDPOGJHVSBDJPOFTEFHMPCP EFFOUSBEBTMJTBTZNBDIPYDPOFDUPSEFQVOUB
t-BTWMWVMBT1&4#3 (#Z&'#$1FTUOFTQFDGJDBNFOUFEJTFBEBTDPODPNQPOFOUFTSFTJTUFOUFTBMDMPSPQBSBMBTBQMJDBDJPOFTEFBHVBSFDJDMBEB

Drenaje

Sugerencias para ahorrar agua

El uso inteligente del agua.

t Las vlvulas de Rain Bird


proporcionan caractersticas
de filtracin excelentes para
obtener la mxima fiabilidad
en entornos muy diversos.

t Las vlvulas de agua reciclada


1&4#3 (#Z&'#$1CSJOEBOVO
funcionamiento confiable en todas las
condiciones de agua. Los diafragmas
de las vlvulas estn compuestos de
&1%. VONBUFSJBMEFHPNBRVFFT
resistente al cloro y a los qumicos.

Recursos

para regular la presin de salida de


la vlvula, independientemente de
las fluctuaciones de la presin de
entrada. Ayuda a garantizar la presin
ptima en el aspersor.

Referencia

t 134%JBMFTVONFEJPFYDFMFOUF

87

Vlvulas para contratistas


4FSJF%7

Especificaciones elctricas

Serie DV
Q %JTFPEFDBVEBMQJMPUPDPOEPCMFGJMUSBDJOQBSBVOBNYJNB
confiabilidad

t4PMFOPJEFEF7$"B)[ DJDMPTTFH

t$PSSJFOUFEFFOUSBEB" 7"
B)[
t$PSSJFOUFEFSFUFODJO" 7"
B)[
t3FTJTUFODJBEFMBCPCJOBEFBPINJPT

Q %JBGSBHNBDPOQSFTJOCBMBODFBEBEFMBSHBEVSBDJO

Dimensiones

Q Solenoide encapsulado de baja potencia que ahorra energa, con


mbolo cautivo y filtro de solenoide con malla 90 (200 micrones)

t"MUVSB12" (11.4 cm)


t"MUVSB OHVMP
12" (14 cm)
t-BSHP38" (11.1 cm)
t-BSHP OHVMP
34" (9.5 cm)
t-BSHP .#
34" (14.6 cm)
t"ODIP13" (8.4 cm)

Vlvulas residenciales de plstico de /4", 1" (1.9 cm, 2.5 cm)


(20/27, 26/34)

Caractersticas

Vlvulas

t1VSHBFYUFSOBQBSBMJNQJBSFMTJTUFNBNBOVBMNFOUFZRVJUBSMBTQBSUDVMBT
de suciedad durante la instalacin y la puesta en marcha del sistema
t1VSHBJOUFSOBQBSBVOBPQFSBDJONBOVBMFOTFDP
t%JBGSBHNB#VOB/DPOGJMUSPEFBHVBQJMPUPDPONBMMB NJDSPOFT

de limpieza automtica y resorte cautivo
t'VODJPOBFOBQMJDBDJPOFTEFDBVEBMCBKPZSJFHPQPSHPUFP
DVBOEPFMGJMUSP3#:FTUJOTUBMBEPBHVBTBSSJCB6OBPQDJOQBSBMBT
aplicaciones de caudal bajo (3 gpm o menos; 0.68 m3/h; 11.4 l/m) es usar
VOBWMWVMBQBSBDBVEBMCBKP-'7 DPOTVMUFMBQHJOB
PFM
kit de control de zona para riego por goteo (consulte la pgina 191)
t5PSOJMMPTEFDBCF[B1IJMMJQTDVBESBEBEFBDFSPJOPYJEBCMFEF1/4" (3.2 cm)
t(BSBOUBDPNFSDJBMEFDJODPBPT

Opciones
t$POGJHVSBDJOEFFOUSBEBTMJTBTQBSBJOTUBMBDJPOFTEFCBKPDPTUPDPO
uniones cementadas
t$POGJHVSBDJONBDIPYDPOFDUPSEFQVOUBQBSBJOTUBMBDJODPOUVCPEF
polietileno
t$POGJHVSBDJOEFOHVMPQBSBJOTUBMBDJPOFTGMFYJCMFT FTQFDJBMNFOUF
cuando los conductos secundarios son profundos
t"ENJUFTPMFOPJEFEFFOHBODIFQBSBVUJMJ[BSDPOMPTDPOUSPMBEPSFTEF
Rain Bird que funcionan a pilas

Modelos
t%734 
/15
t%7IFNCSBYIFNCSB/15EF DN
 

t%744FOUSBEBTMJTBTEF DN
 

t%7"IFNCSBYIFNCSB/15EF DN
 

t%7.#NBDIPYDPOFDUPSEFQVOUBEF DN
 

*Disponible con roscas BSP


Recomendaciones
1.Rain Bird recomienda que los ndices de caudal que producen velocidad de descarga en la lnea
EFTVNJOJTUSPOPTVQFSFOMPTQJFTT NT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
2. Las vlvulas de la serie DV y las otras vlvulas de uso residencial de Rain Bird no se pueden
utilizar con mdulos reguladores de presin PRS.
3. No se recomienda su uso con sistemas de dos cables.

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

t$BVEBMEFMBWMWVMB%7EFBHQN EFBN3h; de 0.76 a


83.3 l/m).
t$BVEBMEFMBWMWVMB%7EFBHQN EFBN3h; de 0.76
a 151.4 l/m).
t5FNQFSBUVSBEFMBHVBIBTUB' $

t5FNQFSBUVSBBNCJFOUFIBTUB' $

075-DV

100-DV

Cmo especificar
100 - DV - MB
Configuracin opcional:
MB: Macho x conector
de punta
A: ngulo
SS: entradas lisas
Modelo
%7WMWVMBEFDPOUSPMSFNPUP
ASV: vlvula antisifn
Tamao
075: 34" (20/27);
100: 1" (26/34)
Aqu se especifica una vlvula 100-DV; macho x conector de
QVOUBEF DN
 
DPODPOUSPMEFMDBVEBMNota:
para aplicaciones fuera de EE.UU., es necesario especificar si
el tipo de rosca debe ser NPT o BSP (slo 1" [2.5 cm]).

100-DV-MB

88

100-DV-A

100-DV-SS

El uso inteligente del agua.

Vlvulas para contratistas

www.rainbird.com/valves

4FSJF%7'

Serie DVF

Prdida de presin de las vlvulas DV y DVF (psi)

Vlvulas residenciales de plstico, de 1" (2.5 cm) (26/34) con control de caudal

Q Vlvula de riego econmico para aplicaciones residenciales y


comerciales livianas en donde se requiere control de caudal

Q *ODPSQPSBUPEBTMBTDBSBDUFSTUJDBTEFMBTWMWVMBTTFSJF%7
Q Sintonizacin del sistema un 60% ms fcil con control de caudal
de direccin asistida, un exclusivo mecanismo asistido por presin,
patentado y fcil de accionar

Q La manija de control de caudal es extrable para evitar el vandalismo

Caudal
gpm
1
3
5
10
20
30
40

075-DV
3
4" psi
3.2
3.9
4.2
5.0
7.7
-

100-DV/100-DVF
1" psi
3.3
3.6
3.8
3.8
5.1
6.4
8.6

Rango operativo

Especificaciones elctricas
t4PMFOPJEFEF7$"B)[ DJDMPTTFH

t$PSSJFOUFEFFOUSBEB" 7"
B)[
t$PSSJFOUFEFSFUFODJO" 7"
B)[
t3FTJTUFODJBEFMBCPCJOBEFBPINJPT

Prdida de presin de las vlvulas DV y DVF (bares) SIST. MTRICO


Caudal
m3h
0.23
0.60
1.20
3.60
4.50
6.00
9.00

l/m
4
10
20
60
75
100
150

075-DV
4" bares
0.22
0.26
0.29
0.45
0.53
-

100-DV/100-DVF
1" bar
0.23
0.24
0.26
0.32
0.35
0.41
0.59

Dimensiones

Prdida de presin de las vlvulas 100-DV/DVF de ngulo, MxB (psi)

t"MUVSB35" (14.2 cm)


t"MUVSB OHVMP
18" (15.5 cm)
t-BSHP38" (11.1 cm)
t-BSHP OHVMP
34" (9.5 cm)
t-BSHP .#
34" (14.6 cm)
t"ODIP13" (8.4 cm)

Caudal
gpm
1
3
5
10
20
30
40

Vista transversal de una


vlvula DVF

Modelos
t%7'IFNCSBYIFNCSB/15EF DN
 

t%7'44FOUSBEBTMJTBTEF DN
 

t%7'"/15EF DN
 

t%7'.#NBDIPYDPOFDUPSEFQVOUBEF
1" (2.5 cm) (26/34)
*Disponible con roscas BSP

100-DVF

Recomendaciones
1.Rain Bird recomienda que los ndices de caudal que
QSPEVDFOWFMPDJEBEEFEFTDBSHBFOMBMOFBEFTVNJOJTUSPOPTVQFSFOMPTQJFTT 
NT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
2. Las vlvulas de la serie DV y las otras vlvulas de uso residencial de Rain Bird no se
pueden utilizar con mdulos reguladores de presin PRS.
3. No se recomienda su uso con sistemas de dos cables.

ngulo
1" psi
2.8
3.0
3.2
3.9
4.3
5.4
8.2

Macho x conector de punta


1" psi
2.5
2.9
3.0
3.1
4.3
7.4
12.7

Prdida de presin de las vlvulas 100-DV/DVF de ngulo, MxB (bares) SIST. MTRICO
Caudal
m3/h
0.23
0.60
1.20
3.60
4.50
6.00
9.00

l/m
4
10
20
60
75
100
150

ngulo
1" bar
0.19
0.20
0.22
0.28
0.30
0.35
0.56

Macho x conector de punta


1" bar
0.17
0.19
0.21
0.26
0.30
0.44
0.86

Nota: consulte la seccin Xerigation (pgina 200) para


PCUFOFSEBUPTTPCSFQSEJEBEFDBVEBMEFMGJMUSP3#:
Nota: para caudales superiores a 30 gpm (6.81 m3I 
MN
OPTFSFDPNJFOEBOMBTWMWVMBT%7%7'
macho x conector de punta

100-DVF-SS

100-DVF-A

100-DVF-MB

El uso inteligente del agua.

89

Vlvulas

t1SFTJOEFBQTJ EFBCBSFT

t$BVEBMEFMBWMWVMB%7'EFBHQN EFBN3h; de
0.76 a 151.40 l/m)
t5FNQFSBUVSBEFMBHVBIBTUB' $

t5FNQFSBUVSBBNCJFOUFIBTUB' $

Vlvulas para contratistas


4FSJF"47'

Serie ASVF
Vlvulas residenciales con vacuo regulador de recaudal de 3/4", 1"
(1.9 cm, 2.5 cm) (20/27, 26/34)

Q $PNCJOBDJODPOGJBCMFEFWMWVMB%7'ZWMWVMBWBDVPSFHVMBEPSBFO
una unidad

Q Homologado por I.A.P. M.O. y A.S.S.E


Q Homologado en ciudad de Los ngeles y por la Asociacin de Normas
Canadienses (CSA, por sus siglas en ingls)

Caractersticas

Prdida de presin de la vlvula ASVF (psi)


Caudal
gpm
1
3
5
10
20
30
40

075-ASVF
3
4" psi
2.8
3.4
3.8
4.6
6.5
-

100-ASVF
1" psi
2.9
3.1
3.3
3.9
5.0
7.8
13.4

t*ODPSQPSBUPEBTMBTDBSBDUFSTUJDBTEFMBTWMWVMBTEFMBTTFSJFT%7Z%7'

Rango operativo

Vlvulas

t1SFTJOEFBQTJ EFBCBSFT

t$BVEBMEFMBWMWVMB"47'EFBHQN EFBN3h; de 0.76


a 83.3 l/m). Una opcin para las aplicaciones de caudal bajo (3 gpm o
menos; 0.68 m3IMN
FTVTBSVOBWMWVMBQBSBDBVEBMCBKP-'7
100/075 (consulte la pgina 193) o el kit de control de zona para riego
por goteo (consulte la pgina 191)
t$BVEBMEFMBWMWVMB"47'EFBHQN EFBN3h; de
0.76 a 151.42 l/m)
t5FNQFSBUVSBEFMBHVBIBTUB' $

t5FNQFSBUVSBBNCJFOUFIBTUB' $

Especificaciones

Prdida de presin de la vlvula ASVF (bares) SIST. MTRICO


Caudal
m3h
0.23
0.6
1.2
3.6
4.5
6.0
9.0

l/m
3.8
10
20
60
75
100
150

075-ASVF
3
4" bares
0.19
0.23
0.26
0.39
0.45
-

100-ASVF
1" bar
0.20
0.21
0.23
0.31
0.34
0.47
0.91

* Consulte la seccin Xerigation (pgina 200) para obtener datos sobre prdida de caudal
EFMGJMUSP3#:3BJO#JSESFDPNJFOEBRVFMPTOEJDFTEFDBVEBMFOMBMOFBEFTVNJOJTUSPOP
TVQFSFOMPTQJFTTFH NT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF

t4PMFOPJEFEF7$"B)[ DJDMPTTFH

t$PSSJFOUFEFFOUSBEB" 7"
B)[
t$PSSJFOUFEFSFUFODJO" 7"
B)[
t3FTJTUFODJBEFMBCPCJOBEFBPINJPT

Cdigos
t&MBOUJTJGOEFCFJOTUBMBSTFBMNFOPTB DN
QPSFODJNBEFMQVOUP
ms alto de agua en el tubo y los aspersores que abastece
t/JOHVOBWMWVMBQVFEFDPMPDBSTFBHVBTBCBKPEFMBWMWVMBBOUJTJGO
t-BTWMWVMBTBOUJTJGOOPEFCFOGVODJPOBSDPOUJOVBNFOUFEVSBOUFNT
de doce (12) horas
t$POTVMUFDVMFTTPOMPTDEJHPTMPDBMFT

Dimensiones
t"MUVSB14" (15.8 cm)
t-BSHP110" (15.5 cm)
t"ODIP15" (8.1 cm)
t%JNFOTJOEFMBMOFBDFOUSBM FOUSBEBTBMJEB

Modelos
t"47'34" (20/27)
t"47' 

Vista transversal de
una vlvula ASVF

Modelos disponibles con roscas NPT solamente


No se recomienda su uso con sistemas
de dos cables.

100-ASVF

90

El uso inteligente del agua.

Vlvulas para contratistas

www.rainbird.com/valves

4FSJFT+57Z+57'

Vlvula "Jar Top" Series JTV y JTVF

Prdida de presin de las vlvulas Jar Top (psi)

1" (26/34) Versatilidad, Valor, Conveniencia

Q La tapa roscada facilita la extraccin sin tornillos


Q Admite solenoide de enganche para utilizar con los
controladores de Rain Bird que funcionan a pilas

Caractersticas
Confiabilidad
t%JBGSBHNBDPOQSFTJOCBMBODFBEBEFMBSHBEVSBDJO
t%JBGSBHNB#VOB/DPOGJMUSPEFBHVBQJMPUPDPONBMMB NJDSPOFT

de limpieza automtica y resorte de acero inoxidable
t4PMFOPJEFFODBQTVMBEPEFCBKBQPUFODJBRVFBIPSSBFOFSHB
con mbolo cautivo
Versatilidad
t%JTQPOJCMFFOWBSJPTUJQPTEFBDDFTPSJPT
t1VSHBFYUFSOBQBSBMJNQJBSFMTJTUFNBNBOVBMNFOUFZRVJUBSMBTQBSUDVMBT
de suciedad durante la instalacin y la puesta en marcha del sistema
t1VSHBJOUFSOBQBSBVOBPQFSBDJONBOVBMFOTFDP
t%JTQPOJCMFDPOMBGVODJOPQDJPOBMEFDPOUSPMEFDBVEBM TPMP#41

Facilidad de reparacin
t3FQBSBDJOTJODPNQMJDBDJPOFTDPOQPDBTQJF[BT
t%JBGSBHNBSFNPWJCMFQBSBVONBOUFOJNJFOUPTJOFTGVFS[P

Caudal
gpm
1
3
5
10
15
20
30

JTV/JTVF
psi
3.0
3.4
3.8
4.5
5.6
6.9
9.7

Macho x conector de punta


psi
3.8
4.2
4.4
4.6
4.7
5.5
9.8

Prdida de presin de las vlvulas Jar Top (bares) SIST. MTRICO


Caudal
m3/h
0.23
0.6
1.2
3.6
4.5
6.0
6.8

l/m
3.8
10
20
60
75
100
114

JTV/JTVF
bares
0.20
0.23
0.27
0.40
0.49
0.60
0.67

Macho x conector de punta


bares
0.27
0.29
0.30
0.34
0.41
0.57
0.67

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

t$BVEBMEFBHQN EFBN3h; de 0.95 a 113.6 l/m)


t5FNQFSBUVSBTEFGVODJPOBNJFOUPUFNQFSBUVSBEFMBHVBIBTUB' 
$
UFNQFSBUVSBBNCJFOUFIBTUB' $

t'VODJPOBFOBQMJDBDJPOFTEFDBVEBMCBKPZ9FSJHBUJPODVBOEPFMGJMUSP
3#:TFJOTUBMBBHVBTBSSJCB

100-JTV

Especificaciones elctricas
t4PMFOPJEFEF7$"B)[ DJDMPTTFH

t$PSSJFOUFEFFOUSBEB" 7"
B)[
t$PSSJFOUFEFSFUFODJO" 7"
B)[
t3FTJTUFODJBEFMBCPCJOBPINJPT

100-JTV-SS

Dimensiones
t"MUVSB DN

t-BSHP DN

t-BSHP .Y#
 DN

t"ODIP 18" (7.9 cm)

Modelos
t+57IFNCSBYIFNCSBSPTDBEBEF DN
 

t+5744FOUSBEBTMJTBTEF DN
 

100-JTV-MB
t+57.#NBDIPYDPOFDUPSEFQVOUBEF DN
 

t+57'#41IFNCSBYIFNCSBEF DN
 
DPODPOUSPMEF
DBVEBM
*Disponible con roscas BSP
** Nota importante: BSP es la nica opcin de rosca disponible con control de caudal
No se recomienda su uso con sistemas de dos cables.

El uso inteligente del agua.

Cmo especificar
100 - JTVF - SS
Configuracin opcional:
SS: entradas lisas
MM: macho x macho
MB: Macho x conector
de punta
Modelo
+57WMWVMB+BS5PQ
+57'WMWVMB+BS5PQDPODPOUSPM
de caudal

Tamao
100: 1" (26/34)

Nota: para aplicaciones fuera de EE.UU., es


necesario especificar si el tipo de rosca debe ser NPT
o BSP (slo 1" [2.5 cm]).

91

Vlvulas

Q Caudal piloto con doble filtracin para una mxima confiabilidad

Vlvulas para contratistas


Serie HV

Serie HV

NUEVO

Vlvulas residenciales de plstico, de 1" (2.5 cm) (26/34)


3FOEJNJFOUPTVQFSJPS%VSBCJMJEBEJODPNQBSBCMF

Q El diafragma excntrico permite un cierre suave y reduce el golpe


de ariete

Q %JTFPDPNQBDUP SBEJPEFHJSPEF DN


QBSBJOTUBMBDJPOFT
estrechas

Q Herramientas a elegir para abrir la vlvula (destornillador de dado,


destornillador Phillips, destornillador plano)

Prdida de presin de la vlvula HV (psi)


1" HV
(psi)
1.57
2.07
2.38
3.33
4.59
6.14
8.23

Caudal
(gpm)
1
3
5
10
20
30
40

1" HV-MB
(psi)
1.73
2.03
2.25
2.80
4.45
7.85
13.68

Caractersticas
t$POGJBCJMJEBE
- Cuerpo de polipropileno con fibra de vidrio para una mayor resistencia
 %JTFPEFDBVEBMJOWFSTP OPSNBMNFOUFDFSSBEP
- Reparacin sin complicaciones con pocas piezas
 %JBGSBHNB#VOB/oDPONBMMB NJDSPOFT
EFMJNQJF[B
automtica, filtro piloto de agua y resorte de acero inoxidable.
Vlvulas

t7FSTBUJMJEBE
 'VODJPOBFOBQMJDBDJPOFTEFGMVKPCBKPZ9FSJHBUJPODVBOEPFMGJMUSP
3#:TFJOTUBMBDPODPSSJFOUFBTDFOEFOUF
- Purga externa para limpiar el sistema manualmente y quitar las
partculas de suciedad durante la instalacin y el arranque del sistema
- Purga interna para una operacin manual en seco
t'BDJMJEBEEFSFQBSBDJO
 5PSOJMMPTDBVUJWPTEFNMUJQMFTDPOFYJPOFTQBSBGBDJMJUBSFM
mantenimiento
- Acceso rpido al diafragma con solo cuatro tornillos
- Poste de localizacin de diafragma para un servicio confiable

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

tEFBHQN EFBN3/h; 0.01 a 1.89 l/s); para caudales por


debajo de 3 gph (0.68 m3/h; 0.19 l/s) o cualquier aplicacin Xerigation,
VTFVOGJMUSP3#:.9EFDPSSJFOUFBTDFOEFOUF
t5FNQFSBUVSBEFMBHVBIBTUB' $

t5FNQFSBUVSBBNCJFOUFIBTUB' $

Prdida de presin de la vlvula HV (psi) SISTEMA MTRICO


Caudal
(m/h)
0.25
0.75
1.00
2.00
5.00
7.50
9.10

Caudal
(l/s)
0.06
0.21
0.28
0.56
1.39
2.08
2.52

1" HV
(bares)
0.11
0.14
0.16
0.23
0.32
0.42
0.57

1" HV-MB
(bares)
0.12
0.14
0.16
0.19
0.31
0.54
0.94

* Consulte la seccin Xerigation (pgina 200) para obtener datos sobre prdida de caudal
EFMGJMUSP3#:3BJO#JSESFDPNJFOEBRVFMPTOEJDFTEFDBVEBMFOMBMOFBEFTVNJOJTUSP
OPTVQFSFOMPTQJFTTFH NT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF

Modelos
t)7/15IFNCSBYIFNCSB/15EF DN
 

t)744FOUSBEBTMJTBTEF DN
 

t)7.#NBDIPYDPOFDUPSEFQVOUBEF DN
 

t)7'IFNCSBYIFNCSB/15EF DN
 

t)7'44FOUSBEBTMJTBTEF DN
 

*Disponible con roscas BSP

Especificaciones elctricas
t4PMFOPJEFEF7$"B)[
t$PSSJFOUFEFFOUSBEBNYJNB"B);
t$PSSJFOUFEFSFUFODJO"B);
t3FTJTUFODJBEFMBCPCJOBEFB0INJPT

100 HVF-SS

Cmo especificar
100 - HV - SS

Dimensiones
t"MUVSB DN

t-BSHP DN

t"MUVSB .#
 DN

t-BSHP .#
 DN

t"ODIP DN

100-HV-MB

Configuracin opcional:
SS: entradas lisas
MB: Macho x conector
de punta

Modelo
HV: vlvula de mayor valor
)7'WMWVMBEFNBZPSWBMPSDPO
control de caudal
Tamao
100: 1" (26/34)

100HV

Nota: para aplicaciones fuera de EE.UU., es


necesario especificar si el tipo de rosca debe ser NPT
o BSP (slo 1" [2.5 cm]).

100-HV-SS

92

El uso inteligente del agua.

Vlvulas para contratistas

www.rainbird.com/valves

Calibre de los cables de las vlvulas residenciales

Calibre de los cables de las vlvulas residenciales


Vlvulas VA de 4.6 VA (DV / JTV) - Pies equivalentes a la
longitud del circuito
Presin de agua en la vlvula de 80 psi (5.5 bares)

Presin de agua en la vlvula de 125 psi (8.6 bares)

comn
Calibre del cable

18

comn
Calibre del cable

18

18
16
14
12

3000
3680
4290
4800

18
16
14
12

1400
1720
2000
2240

4700
5850
6840

7570
9300

12050

Calibre del cable de control


16
14
12

2200
2730
3190

3530
4340

Presin de agua en la vlvula de 100 psi (6.9 bares)

Presin de agua en la vlvula de 150 psi (10.4 bares)

comn
Calibre del cable

18

comn
Calibre del cable

18

18
16
14
12

2300
2820
3290
3680

18
16
14
12

600
730
860
960

Calibre del cable de control


16
14
12

3660
4490
5240

5800
7130

9420

5620

Calibre del cable de control


16
14
12

950
1170
1370

1510
1860

Vlvulas

Calibre del cable de control


16
14
12

2410

Vlvulas VA de 4.6 VA (HV) - Pies equivalentes a la longitud


del circuito
Presin de agua en la vlvula de 80 psi (5.5 bares)

Presin de agua en la vlvula de 125 psi (8.6 bares)

comn
Calibre del cable

18

comn
Calibre del cable

18

18
16
14
12

3100
3900
4500
5100

18
16
14
12

2400
3000
3500
4000

Calibre del cable de control


16
14
12

5000
6200
7200

8000
9900

12800

Calibre del cable de control


16
14
12

3900
4800
5600

6300
7700

Presin de agua en la vlvula de 100 psi (6.9 bares)

Presin de agua en la vlvula de 150 psi (10.4 bares)

comn
Calibre del cable

18

comn
Calibre del cable

18

18
16
14
12

2800
3400
4000
4500

18
16
14
12

2000
2400
2900
3200

Calibre del cable de control


16
14
12

4500
5500
6400

7100
8800

11300

10000

Calibre del cable de control


16
14
12

3200
3900
4600

5100
6200

8100

Para calcular el calibre de los cables de las vlvulas comerciales de Rain Bird, consulte la pgina 109
El uso inteligente del agua.

93

Vlvulas
Serie PGA

Serie PGA
1", 1Vlvulas plsticas de globo/ngulo de 1/2", 2" (2.5 cm, 3.8 cm, 5.1
cm) (26/34, 40/49, 50/60)

Q Vlvula plstica de globo/ngulo para aplicaciones residenciales


o comerciales livianas. La serie PGA ofrece versatilidad a un precio
conveniente
Vista transversal de
una vlvula PGA

Q %JBGSBHNBSFGPS[BEPDPOUFMBQBSBVOBNBZPSEVSBCJMJEBE
Q Nylon con fibra de vidrio y PVC

Caractersticas

Vlvulas

t$POGJHVSBDJOEFHMPCPZEFOHVMPQBSBMPHSBSGMFYJCJMJEBEFO
el diseo y la instalacin
t$JFSSFMFOUPQBSBFWJUBSFMHPMQFEFBSJFUFZFMQPTUFSJPS
dao del sistema
t4PMFOPJEFEFVOBQJF[BDPONCPMPDBVUJWPZSFTPSUFQBSBVOB
reparacin fcil. Evita la prdida de piezas durante el servicio en terreno
t.BOJKBFSHPONJDBTJOFMFWBDJOQBSBDPOUSPMBSFMDBVEBMEFBHVBTFHO
sea necesario
t1VSHBNBOVBMJOUFSOBRVFBDDJPOBMBWMWVMBTJORVFFMBHVBFOUSFFOMB
caja de vlvulas. Permite el ajuste del regulador de presin sin encender
la vlvula en el controlador
t%JTFPEFDBVEBMIBDJBEFMBOUF OPSNBMNFOUFDFSSBEP

Opciones
t1VFEFVUJMJ[BSTFDPOFMNEVMPSFHVMBEPSEFQSFTJODPO134%JBM 
instalado en campo, para garantizar un rendimiento ptimo del aspersor.
Regula hasta 100 psi (6.9 bares)
t.BOJKBTEFDPOUSPMEFDBVEBMDPMPSWJPMFUBQBSBVOBGDJMJEFOUJGJDBDJOEF
los sistemas de agua no potable
- PGA-NP-HAN1 (para vlvulas de 1" y 11/2" [2.5 cm y 3.8 cm])
- PGA-NP-HAN2 (para vlvulas de 2" [5 cm])
t"ENJUFFMTPMFOPJEFEFFOHBODIFQBSBVUJMJ[BSDPOMPTDPOUSPMBEPSFTEF
hasta 150 psi (10.4 bares) de Rain Bird que funcionan a pilas
t$PNQBUJCMFDPOEFDPEJGJDBEPSFT&41-9%

Rango operativo

150-PGA

Cmo especificar
100 - PGA - PRS-D
Modelo
Caracterstica
PGA
opcional
134%JBMNEVMP
Tamao
regulador de presin
100: 1" (26/34)
(se debe encargar por
1
150: 1 2" (40/49)
separado)
200: 2" (50/60)

t1SFTJOEFBQTJ EFBCBSFT

t134%JBMSFHVMBIBTUBQTJ CBSFT

t$BVEBMEFBHQN EFBN3h; de 7.8 a 568 l/m)


t$BVEBMDPO134%JBMEFBHQN EFBN3h; de 19.2 a
568 l/m)
t5FNQFSBUVSBEFMBHVBIBTUB' $
DPOTVMUFMBUBCMB
t5FNQFSBUVSBBNCJFOUFIBTUB' $

Especificaciones elctricas
t4PMFOPJEFEF7$"B)[ DJDMPTTFH

t$PSSJFOUFEFFOUSBEB" 7"
B)[
t$PSSJFOUFEFSFUFODJO" 7"
B)[
t3FTJTUFODJBEFMBCPCJOBPINJPT

Nota: la vlvula y el mdulo PRS-Dial se deben


encargar por separado. Para aplicaciones fuera de
EE.UU., es necesario especificar si el tipo de rosca
debe ser NPT o BSP.

94

El uso inteligente del agua.

Vlvulas

www.rainbird.com/valves

Serie PGA

Dimensiones
Modelo
t1("
t1("
t1("

Altura
 14" (18.4 cm)
 DN

 DN


Longitud
5 12" (14.0 cm)
 34" (17.2 cm)
 34" (19.7 cm)

Ancho
3 14" (8.3 cm)
3 12" (8.9 cm)
5" (12.7 cm)

Nota: PRS-Dial agrega 2" (5.1 cm) a la altura de la vlvula

Modelos
t1(" 

t1(" 12" (40/49)


t1(" 

Roscas BSP disponibles; especifique al hacer el pedido


Recomendaciones
1. Rain Bird recomienda que los ndices de caudal en la lnea de suministro no superen
MPTQJFTTFH NT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
2. Para caudales inferiores a 5 gpm (1.14 mIMNJO
3BJO#JSESFDPNJFOEBFMVTPEF
filtracin ascendente para evitar que se acumule suciedad debajo del diafragma

Prdida de presin de las vlvulas serie PGA (psi)


Caudal
gpm

100PGA
Globo
1"
5.1
5.5
5.9
6.0
6.4
7.0
-

1
5
10
20
30
40
50
75
100
125
150

100PGA
ngulo
1"
4.3
5.0
5.5
5.6
5.5
7.5
-

150PGA
Globo
112"
1.9
3.2
4.8
11.1
19.2
-

150PGA
ngulo
112"
1.3
2.0
3.0
6.5
11.7
-

200PGA
Globo
2"
1.2
1.5
3.0
5.5
8.6
12.0

200PGA
ngulo
2"
1.0
0.9
1.7
3.0
4.8
6.5

3. Para caudales inferiores a 10 gpm (2.27 m3IMN


3BJO#JSESFDPNJFOEBHJSBSQPS
completo el vstago del control de caudal dos veces desde la posicin totalmente abierta

Caudal Caudal 100- 100- 150- 150- 200- 200m3h I/m


PGA PGA PGA PGA PGA PGA
Globo ngulo Globo ngulo Globo ngulo

ndice de temperatura de la serie PGA


Temperatura del agua
 '
 '
 '
 '
 '

Presin continua
QTJ
QTJ
QTJ
QTJ
QTJ

ndice de temperatura de la serie PGA


Temperatura del agua
23 C
27 C
32 C
38 C
43 C

2.5 cm 2.5 cm 3.8 cm 3.8 cm 5.1 cm 5.1 cm

SIST. MTRICO

Presin continua
10.4 bares
9.1 bares
7.7 bares
6.4 bares
5.2 bares

El uso inteligente del agua.

0.23
0.6
1.2
3
6
9
12
15
18
21
24
27
30
34

3.8
10
20
50
100
150
200
250
300
350
400
450
500
568

0.35
0.36
0.38
0.41
0.43
0.48
-

0.30
0.32
0.35
0.38
0.38
0.51
-

0.10
0.22
0.38
0.61
0.86
1.16
-

0.07
0.14
0.23
0.36
0.51
0.70
-

0.08
0.12
0.17
0.24
0.33
0.43
0.54
0.66
0.83

0.07
0.07
0.10
0.13
0.18
0.23
0.30
0.36
0.45

Notas
1. Los valores de prdida se calcularon con el control de caudal totalmente abierto
2. PRS-Dial est recomendado slo para reas con sombra

95

Vlvulas

Prdida de presin de las vlvulas serie PGA (bares) SIST. MTRICO

Vlvulas
Series PEB y PESB

Series PEB y PESB


1", 1Vlvulas industriales de plstico de 1/2", 2" (2.5 cm, 3.8 cm, 5.1 cm)
(26/34, 40/49, 50/60)

Q Vlvula construida de nylon con fibra de vidrio de larga duracin para

Vista transversal de
una vlvula PEB

VOSFOEJNJFOUPSFTJTUFOUFZVOBNBZPSWJEBUJM5BDIVFMBTEFBDFSP
inoxidable moldeadas en el cuerpo que resisten el dao de la rosca

Q Cierre lento para evitar el golpe de ariete y el posterior dao


del sistema

Q %JBGSBHNBSFGPS[BEPDPOUFMBQBSBVOBNBZPSEVSBCJMJEBE

Caractersticas

Vlvulas

Vista transversal de
una vlvula PESB

t'VODJOEFDBVEBMCBKPQBSBVOBNQMJPSBOHPEFBQMJDBDJPOFT
t%FQVSBEPSEFQMTUJDPFOMBWMWVMB1&4#RVFSBTQBMBNBMMBEFBDFSP
inoxidable para limpiar y eliminar la arenilla y el material vegetal. Impide
la acumulacin de partculas de suciedad y la posterior obstruccin del
sistema
t4PMFOPJEFEFVOBQJF[BDPONCPMPDBVUJWPZSFTPSUFQBSBVOB
reparacin fcil. Evita la prdida de piezas durante el servicio en terreno
t.BOJKBEFDPOUSPMEFDBVEBMRVFSFHVMBFMDBVEBMEFBHVBTFHOTFB
necesario
t1VSHBNBOVBMJOUFSOBRVFBDDJPOBMBWMWVMBTJORVFFMBHVBFOUSFFOMB
caja de vlvulas. Permite el ajuste del regulador de presin sin encender
la vlvula en el controlador
t1VSHBNBOVBMFYUFSOBRVFQFSNJUFMJNQJBSMBTQBSUDVMBTEFTVDJFEBEEFM
sistema. Recomendada para la puesta en marcha del sistema y despus
de las reparaciones.
t%JTFPEFDBVEBMIBDJBEFMBOUF OPSNBMNFOUFDFSSBEP
t$POGJHVSBDJOEFHMPCP

Opciones
t1VFEFVUJMJ[BSTFDPOFMNEVMPSFHVMBEPSEFQSFTJODPO134%JBM 
instalado en campo, para garantizar un rendimiento ptimo del aspersor.
Regula hasta 100 psi (6.9 bares)
t.BOJKBTEFDPOUSPMEFDBVEBMDPMPSWJPMFUBQBSBVOBGDJMJEFOUJGJDBDJOEF
los sistemas de agua no potable (se venden por separado)
- PEB-NP-HAN1(1" [2.5 cm])
- PEB-NP-HAN2 (11/2" y 2" [3.8 cm y 5.1 cm])
t"ENJUFFMTPMFOPJEFEFFOHBODIFQBSBVUJMJ[BSDPOMPTDPOUSPMBEPSFTEF
hasta 150 psi (10.4 bares) de Rain Bird que funcionan a pilas
t$PNQBUJCMFDPOEFDPEJGJDBEPSFT&41-9%

Cmo especificar

200-PEB

200-PESB

100 - PEB - PRS-D


Modelo
PEB
Tamao
100: 1" (26/34)
150: 112" (40/49)
200: 2" (50/60)

Caracterstica
opcional
134%JBMNEVMP
regulador de presin
(se debe encargar por
separado)

Nota: la vlvula y el mdulo PRS-Dial se deben


encargar por separado. Para aplicaciones fuera de
EE.UU., es necesario especificar si el tipo de rosca
debe ser NPT o BSP.

96

El uso inteligente del agua.

Vlvulas

www.rainbird.com/valves

Series PEB y PESB

t1SFTJOEFBQTJ EFBCBSFT

t134%JBMSFHVMBIBTUBQTJ CBSFT

t$BVEBMEFBHQN EFBN3h; de 1.2 a 757 l/m)


t$BVEBMDPO134%JBMEFBHQN EFBN3h; de 19.2 a
757 l/m)
t5FNQFSBUVSBEFMBHVBIBTUB' $

t5FNQFSBUVSBBNCJFOUFIBTUB' $

Especificaciones elctricas
t4PMFOPJEFEF7$"B)[ DJDMPTTFH

t$PSSJFOUFEFFOUSBEB" 7"
B)[
t$PSSJFOUFEFSFUFODJO" 7"
B)[
t3FTJTUFODJBEFMBCPCJOBPINJPT

Dimensiones
Modelo
t1&#Z1&4#
t1&#Z1&4#
t1&#Z1&4#

Altura
12" (16.5 cm)
 DN

 DN


Longitud
4" (10.2 cm)
 DN

 DN


Ancho
4" (10.2 cm)
 DN

 DN

Nota: la opcin con PRS-Dial agrega 2" (5.1 cm) a la altura de la vlvula

Prdida de presin de las vlvulas de las series PEB y PESB (psi)


Caudal
gpm
0.25
0.5
1
5
10
20
30
40
50
75
100
125
150
175
200

100-PEB
1"
0.8
1.0
1.3
1.7
1.8
2.9
5.6
10.0
15.6
-

150-PEB
112"
3.9
3.6
3.5
3.6
5.4
9.6
14.6
21.2
-

200-PEB
2"
4.8
4.5
5.2
8.2
11.8
15.5
19.5
Vlvulas

Rango operativo

Prdida de presin de las vlvulas de


las seriesPEB y PESB (bares)

SIST. MTRICO

Modelos
t1&#Z1&4# 

t1&#Z1&4#12" (40/49)
t1&#Z1&4# 

Roscas BSP disponibles; especifique al hacer el pedido


Recomendaciones
1. Rain Bird recomienda que los ndices de caudal en la lnea de suministro no superen
MPTQJFTTFH NT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
2. Para caudales inferiores a 5 gpm (1.14 mIMNJO
3BJO#JSESFDPNJFOEBFMVTPEF
filtracin ascendente para evitar que se acumule suciedad debajo del diafragma
3. Para caudales inferiores a 10 gpm (2.27 m3IMN
3BJO#JSESFDPNJFOEBHJSBSQPS
completo el vstago del control de caudal dos veces desde la posicin totalmente abierta
4. Para las aplicaciones con PRS-Dial, Rain Bird recomienda la instalacin de una vlvula
maestra reguladora de presin o un regulador de presin en lnea cuando la presin de
entrada supera los 100 psi (6.9 bares)

Caudal
m3h
0.06
0.3
0.6
1.2
3
6
9
12
15
18
21
24
27
30
33
36
39
42
45

Caudal
l/m
1
5
10
20
50
100
150
200
250
300
350
400
450
500
550
600
650
700
757

100-PEB
2.5 cm
0.06
0.09
0.10
0.12
0.15
0.32
0.68
-

150-PEB
3.8 cm
0.26
0.24
0.26
0.33
0.42
0.57
0.74
0.92
1.14
1.38
-

200-PEB
5.1 cm
0.33
0.32
0.32
0.34
0.41
0.51
0.64
0.77
0.90
1.04
1.18
1.34

Notas
1. Los valores de prdida se calcularon con el control de caudal totalmente abierto
2. PRS-Dial est recomendado slo para reas con sombra

El uso inteligente del agua.

97

Vlvulas
Serie PESB-R

Vlvulas serie PESB-R


1", 1Vlvulas durables resistentes al cloro para aplicaciones con agua
reciclada, de 1/2", 2" (2.5, 3.8 y 5.1 cm) (26/34, 40/49, 50/60)

Q 'VODJPOBNJFOUPDPOGJBCMFJODMVTPFOBHVBDPONVDIPDMPSP-PT
EJBGSBHNBTEFMBTWMWVMBTFTUODPNQVFTUPTEF&1%. VONBUFSJBMEF
goma que es resistente al cloro y a los qumicos

Q Vlvula construida de nylon con fibra de vidrio de larga duracin para


un rendimiento resistente y una mayor vida til a una presin de 200
psi (13.8 bares)

Q %JTFPEFTPMFOPJEFEFVOBQJF[BDPONCPMPDBVUJWPZSFTPSUFQBSB
una reparacin fcil. Evita la prdida de piezas durante la reparacin
in situ

Caractersticas

Vlvulas

Vista transversal de
una vlvula PESB-R

t-PTLJUTEFDPOWFSTJO1&4#3UBNCJOFTUOEJTQPOJCMFTQBSBDPOWFSUJS
vlvulas PEB y PESB existentes en vlvulas para agua reciclada. El
kit incluye manija NP, etiquetas, ensamble del diafragma, raspador y
rondana a presin
t5BDIVFMBTEFBDFSPJOPYJEBCMFNPMEFBEBTFOFMDVFSQP-BUBQBTFQVFEF
colocar y retirar fcilmente sin daar las roscas
t-BQVSHBFYUFSOBQSPUFHFMPTDBOBMFTEFEFTBHFEFMTPMFOPJEFEFMB
suciedad cuando se limpia el sistema.
t-BQVSHBJOUFSOBBDDJPOBMBWMWVMBTJOQFSNJUJSRVFFOUSFBHVBFOMB
caja de vlvulas y permite ajustar el regulador de presin sin tener que
conectar primero la vlvula del controlador
t'VODJOEFDBVEBMCBKP HQNN3/h; 1.2 l/m) para un amplio
rango de aplicaciones
t$JFSSFMFOUPQBSBFWJUBSFMHPMQFEFBSJFUFZFMQPTUFSJPS
dao del sistema
t&MNFDBOJTNPEFQVSBEPSSBTQBMBNBMMBEFBDFSPJOPYJEBCMFQBSBMJNQJBS
y eliminar la arenilla y el material vegetal
t.BOJKBEFDPOUSPMEFDBVEBMFTUOEBSDPMPSWJPMFUBFOMBTWMWVMBTTFSJF
PESB-R

150-PESB-R

Cmo especificar
100 - PESBR - PRS-D
Modelo
PESB-R:
depurador
modelo
Tamao
100: 1" (26/34)
150: 112" (40/49)
200: 2" (50/60)

Caracterstica
opcional
134%JBMNEVMP
regulador de
presin (se debe
encargar por
separado)

Nota: la vlvula y el mdulo PRS-Dial se deben


encargar por separado.

98

El uso inteligente del agua.

Vlvulas

www.rainbird.com/valves

Serie PESB-R

t1VFEFVUJMJ[BSTFDPOFMNEVMPSFHVMBEPSEFQSFTJODPO134%JBM PQDJPOBM
e instalado en campo, para garantizar un rendimiento ptimo del aspersor
t"ENJUFFMTPMFOPJEFEFFOHBODIFQBSBVUJMJ[BSDPOMPTDPOUSPMBEPSFTEF
hasta 150 psi (10.4 bares) de Rain Bird que funcionan a pilas
t$PNQBUJCMFDPOEFDPEJGJDBEPSFT&41-9%

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

t$BVEBMEFBHQN EFBN3h; de 1.2 a 757 l/m)


t$BVEBMDPO134%JBMEFBHQN EFBN3h; de 19.2 a
757 l/m)
t5FNQFSBUVSBIBTUB' $

Especificaciones elctricas
t"MJNFOUBDJOTPMFOPJEFEF7$"BDJDMPT
t$PSSJFOUFEFFOUSBEB" 7"
B)[
t$PSSJFOUFEFSFUFODJO" 7"
B)[
t3FTJTUFODJBEFMBCPCJOBPINJPT

Dimensiones
Modelo Altura
t1&4#3
t1&4#3
t1&4#3

Longitud
12" (16.5 cm)
 DN

 DN


Ancho
4" (10.2 cm)
 DN

 DN


Prdida de presin de las vlvulas serie PESB-R (psi)


Caudal
gpm
0.25
0.5
1
5
10
20
30
40
50
75
100
125
150
175
200

100-PESB-R
1"
1.6
3.0
1.8
2.9
2.9
2.6
5.8
10.2
16.0
-

150-PESB-R
112"
3.5
3.1
2.3
2.1
4.3
7.5
11.9
17.0
-

Prdida de presin de las vlvulas


serie PESB-R (bares)
4" (10.2 cm)
 DN

 DN

Nota: la opcin con PRS-Dial agrega 2" (5.1 cm) a la altura de la vlvula

Modelos
t1&4#3 

t1&4#312" (40/49)
t1&4#3 

t1&4#38,,JUEFDPOWFSTJOEF DN
 

t1&4#38,,JUEFDPOWFSTJOEF12" (3.8 cm) (40/49)


t1&4#38,,JUEFDPOWFSTJOEF DN
 

Roscas BSP disponibles; especifique al hacer el pedido


Recomendaciones
1. Rain Bird recomienda que los ndices de caudal en la lnea de suministro no superen
MPTQJFTTFH NT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
2. Para caudales inferiores a 5 gpm (1.14 mIMNJO
3BJO#JSESFDPNJFOEBFMVTPEF
filtracin ascendente para evitar que se acumule suciedad debajo del diafragma
3. Para caudales inferiores a 10 gpm (2.27 m3IMN
3BJO#JSESFDPNJFOEBHJSBSQPS
completo el vstago del control de caudal dos veces desde la posicin totalmente abierta

Caudal
m3/h
0.06
0.3
0.6
1.2
3
6
9
12
15
18
21
24
27
30
33
36
39
42
45

Caudal
l/m
1
5
10
20
50
100
150
200
250
300
350
400
450
500
550
600
650
700
757

100-PESB-R
2.5 cm
0.11
0.13
0.15
0.20
0.19
0.32
0.69
-

200-PESB-R
2"
3.7
3.3
4.7
8.6
12.6
14.8
18.9

SIST. MTRICO

150-PESB-R
3.8 cm
0.22
0.16
0.16
0.24
0.33
0.45
0.59
0.75
0.91
1.10
-

200-PESB-R
5.1 cm
0.25
0.24
0.25
0.30
0.38
0.53
0.67
0.82
0.92
1.00
1.13
1.30

Notas
1. Los valores de prdida se calcularon con el control de caudal totalmente abierto
2. PRS-Dial est recomendado slo para reas con sombra

El uso inteligente del agua.

99

Vlvulas

Opciones

Vlvulas
Serie GB

Vlvulas de latn Serie GB


1", 114", 112", 2" (26/34, 33/42, 40/49, 50/60)

Q Estructura resistente de latn rojo para mayor durabilidad


Q %JBGSBHNBEVSBEFSPZSFGPS[BEPDPOUFMBQBSBNBZPSEVSBCJMJEBE 
incluso en condiciones extremas
Vista transversal
de GB

Q %JTFPEFDBVEBMJOWFSTP OPSNBMNFOUFDFSSBEP RVFHBSBOUJ[BRVFMB


vlvula se cerrar si se produce una rotura o desgarro en el diafragma.
Evita inundaciones, desperdicio de agua y el dao del terreno

Caractersticas

Vlvulas

t$JFSSFMFOUPQBSBFWJUBSFMHPMQFEFBSJFUFZFMQPTUFSJPS
dao del sistema
t4PMFOPJEFEFVOBQJF[BDPONCPMPDBVUJWPZSFTPSUFQBSBVOB
reparacin fcil. Evita la prdida de piezas durante el servicio en terreno
t.BOJKBEFDPOUSPMEFDBVEBMRVFSFHVMBFMDBVEBMEFBHVBTFHOTFB
necesario
t1VSHBNBOVBMJOUFSOBRVFBDDJPOBMBWMWVMBTJORVFFMBHVBFOUSFFOMB
caja de vlvulas. Permite el ajuste del regulador de presin sin encender
el controlador
t1VSHBNBOVBMFYUFSOBRVFQFSNJUFMJNQJBSMBTQBSUDVMBTEFTVDJFEBE
del sistema. Recomendada para la puesta en marcha del sistema y otras
reparaciones
t$POGJHVSBDJOEFHMPCP
tAptas para agua reciclada: ahora todos los modelos tienen diafragmas
&1%.ZQJF[BTSFTJTUFOUFTBMDMPSPDPNPQBSUFEFMFRVJQPFTUOEBS
t5BQBEFNBOJKBWJPMFUBQBSBJEFOUJGJDBSFMBHVBOPQPUBCMF

Opciones
t1VFEFVUJMJ[BSTFDPOFMNEVMPSFHVMBEPSEFQSFTJODPO134%JBM 
instalado en campo, para garantizar un rendimiento ptimo del aspersor.
Regula hasta 100 psi (6.9 bares)
t"ENJUFFMTPMFOPJEFEFFOHBODIFQBSBVUJMJ[BSDPOMPTDPOUSPMBEPSFTEF
hasta 150 psi (10.4 bares) de Rain Bird que funcionan a pilas
t$PNQBUJCMFDPOEFDPEJGJDBEPSFT&41-9%

5BQBEFNBOJKBWJPMFUB
para identificar el
agua no potable

Cmo especificar
100 - GB - PRS-D
Modelo
GB
Tamao
100: 1" (26/34)
 

 

200: 2" (50/60)

Caracterstica
opcional
134%JBMNEVMP
regulador de presin
(se debe encargar por
separado)

150-GB

Nota: la vlvula y el mdulo PRS-Dial se deben


encargar por separado.

100

El uso inteligente del agua.

Vlvulas

www.rainbird.com/valves

Serie GB

t1SFTJOEFBQTJ EFBCBSFT

t134%JBMSFHVMBIBTUBQTJ CBSFT

t$BVEBMDPOTJO134%JBMEFBHQN HBMPOFTQPSNJOVUPEFB
45.40 m3h; de 19.2 a 757 l/m)
t5FNQFSBUVSBEFMBHVBIBTUB' $

t5FNQFSBUVSBBNCJFOUFIBTUB' $

Especificaciones elctricas
t4PMFOPJEFEF7$"B)[ DJDMPTTFH

t$PSSJFOUFEFFOUSBEB" 7"
B)[
t$PSSJFOUFEFSFUFODJO" 7"
B)[
t3FTJTUFODJBEFMBCPCJOBPINJPT

Dimensiones
Modelo Altura
t(#
 DN

t(#
34" (14.6 cm)
t(#
12" (16.5 cm)
t(#
 DN


Longitud
12" (11.4 cm)
5" (12.7 cm)
512" (14 cm)
34" (17.1 cm)

Ancho
214" (5.7 cm)
3" (7.6 cm)
4" (10, 2 cm)
514" (13.3 cm)

Nota: la opcin con PRS-Dial agrega 2" (5.1 cm) a la altura de la vlvula

Modelos
t(# 

t(#14" (33/42)
t(#12" (40/49)
t(# 

Roscas BSP no disponibles


Recomendaciones
1. Rain Bird recomienda que los ndices de caudal en la lnea de suministro no superen
MPTQJFTTFH NT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
2. Para caudales inferiores a 5 gpm (1.14 mIMNJO
3BJO#JSESFDPNJFOEBFMVTPEF
filtracin ascendente para evitar que se acumule suciedad debajo del diafragma
3. Para caudales inferiores a 10 gpm (2.27 m3IMN
3BJO#JSESFDPNJFOEBHJSBS
por completo el vstago del control de caudal dos veces desde la posicin totalmente
abierta
* Funcionamiento confiable incluso en agua con mucho cloro. Los diafragmas de las
vlvulas estn compuestos de EPDM, un material de goma que es resistente al cloro y a
los qumicos

Prdida de presin de la vlvula de la Serie GB (psi)


Caudal
gpm
5
10
15
20
30
40
50
60
80
100
120
140
160
180
200

100-GB
1"
0.4
0.8
1.2
2.1
5.0
8.2
13.0
-

125-GB
114"
1.4
2.3
4.1
6.8
9.8
16.5
-

150-GB
112"
2.3
2.9
2.0
3.3
4.6
7.5
11.8
16.6
-

Prdida de presin de la vlvula


de la Serie GB (bares)
Caudal
m3h
1
3
6
9
12
15
18
21
24
27
30
33
36
39
42
45

Caudal
l/m
19
50
100
150
200
250
300
350
400
450
500
550
600
650
700
757

100-GB
2.5 cm
0.03
0.07
0.27
0.56
-

125-GB
3.8 cm
0.14
0.28
0.53
0.82
1.12
-

200-GB
2"
0.6
0.7
0.9
1.1
1.7
2.6
3.9
5.9
7.8
10.0
12.4
15.1

SIST. MTRICO
150-GB
3.8 cm
0.19
0.14
0.25
0.38
0.51
0.70
0.91
1.13
-

200-GB
5.1 cm
0.05
0.06
0.09
0.14
0.18
0.24
0.31
0.40
0.49
0.58
0.68
0.79
0.90
1.04

Notas
1. Los valores de prdida se calcularon con el control de caudal totalmente abierto
2. PRS-Dial est recomendado slo para reas con sombra

El uso inteligente del agua.

101

Vlvulas

Rango operativo

Vlvulas
4FSJF&'#$1

Vlvulas de latn Serie EFB-CP


1", 114", 112", 2" (26/34, 33/42, 40/49, 50/60)

Q 3FOEJNJFOUPDPOGJBCMFJODMVTPFOVTPTDPOBHVBTVDJB'JMUSPEF
limpieza automtica que resiste la acumulacin de partculas de
suciedad

Q Estructura resistente de latn rojo para mayor durabilidad


Q Los diafragmas duraderos reforzados con tela estn compuestos
EF&1%. VONBUFSJBMEFHPNBRVFFTSFTJTUFOUFBMDMPSPZBMPT
productos qumicos

Caractersticas

Vlvulas

Vista transversal de
EFB-CP

t%JTFPEFDBVEBMJOWFSTP OPSNBMNFOUFDFSSBEP RVFHBSBOUJ[BRVFMB


vlvula se cerrar si se produce una rotura o desgarro en el diafragma.
Evita inundaciones, desperdicio de agua y el dao del terreno
t$JFSSFMFOUPQBSBFWJUBSFMHPMQFEFBSJFUFZFMQPTUFSJPSEBPEFM
sistema
t4PMFOPJEFEFVOBQJF[BDPONCPMPDBVUJWPZSFTPSUFQBSBVOB
reparacin fcil. Evita la prdida de piezas durante el servicio en terreno
t.BOJKBEFDPOUSPMEFDBVEBMRVFSFHVMBFMDBVEBMEFBHVBTFHOTFB
necesario
t1VSHBNBOVBMJOUFSOBRVFBDDJPOBMBWMWVMBTJORVFFMBHVBFOUSFFOMB
caja de vlvulas. Permite el ajuste del regulador de presin sin encender
el controlador
t1VSHBNBOVBMFYUFSOBRVFQFSNJUFMJNQJBSMBTQBSUDVMBTEFTVDJFEBE
del sistema. Recomendada para la puesta en marcha del sistema y otras
reparaciones
t.BMMBEFGJMUSPEFMJNQJF[BBVUPNUJDBZBQSVFCBEFDPOUBNJOBDJO 
que resiste la acumulacin de partculas de suciedad. El caudal de agua
limpia continuamente la malla y quita
las partculas de suciedad antes de que se acumulen y obstruyan el filtro
t$POGJHVSBDJOEFHMPCP
tAptas para agua reciclada: ahora todos los modelos tienen diafragmas
&1%.ZQJF[BTSFTJTUFOUFTBMDMPSPDPNPQBSUFEFMFRVJQPFTUOEBS
t5BQBEFNBOJKBWJPMFUBQBSBJEFOUJGJDBSFMBHVBOPQPUBCMF

5BQBEFNBOJKBWJPMFUB
para identificar el
agua no potable

Cmo especificar
100 - EFB-CP - PRS-D
Modelo
&'#$1
Tamao
100: 1"
125: 114"
150: 112"
200: 2"

Caracterstica
opcional
134%JBMNEVMP
regulador de
presin (se debe
encargar por
separado)

125-EFB-CP

Nota: la vlvula y el mdulo PRS-Dial


se deben encargar por separado.

102

El uso inteligente del agua.

Vlvulas

www.rainbird.com/valves

4FSJF&'#$1

Prdida de presin de la vlvula de la serie EFB-CP (psi)


Opciones
t1VFEFVUJMJ[BSTFDPOFMNEVMPSFHVMBEPSEFQSFTJODPO134%JBM 
instalado en campo, para garantizar un rendimiento ptimo del aspersor.
Regula hasta 100 psi (6.9 bares)
t4PMFOPJEFEFFOHBODIFQBSBVUJMJ[BSDPOMPTDPOUSPMBEPSFT
de hasta 150 psi (10.4 bares) de Rain Bird que funcionan a pilas
t$PNQBUJCMFDPOEFDPEJGJDBEPSFT&41-9%

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

t134%JBMSFHVMBIBTUBQTJ CBSFT

t$BVEBMDPOTJO134%JBMEFBHQN HBMPOFTQPSNJOVUPEFB
45.40 m3h;
de 19.2 a 757 l/m)
t5FNQFSBUVSBEFMBHVBIBTUB' $

t5FNQFSBUVSBBNCJFOUFIBTUB' $

t4PMFOPJEFEF7$"B)[ DJDMPTTFH

t$PSSJFOUFEFFOUSBEB" 7"
B)[
t$PSSJFOUFEFSFUFODJO" 7"
B)[
t3FTJTUFODJBEFMBCPCJOBPINJPT

Longitud
 DN

34" (14.6 cm)
12" (16.5 cm)
 DN


Ancho
12" (11.4 cm)
5" (12.7 cm)
512" (14 cm)
34" (17.1 cm)

314" (8.3 cm)


314" (8.3 cm)
412" (11.4 cm)
534" (14.6 cm)

Nota: la opcin con PRS-Dial agrega 2" (5.1 cm) a la altura de la vlvula

Modelos
t&'#$1 

t&'#$114" (33/42)
t&'#$112 

t&'#$1 

* Roscas BSP disponibles; especifique al hacer el pedido
Recomendaciones
1. Rain Bird recomienda que los ndices de caudal en la lnea de suministro no superen
MPTQJFTTFH NT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
2. Para caudales inferiores a 5 gpm (1.14 mIMNJO
3BJO#JSESFDPNJFOEBFMVTPEF
filtracin ascendente para evitar que se acumule suciedad debajo del diafragma
3. Para caudales inferiores a 10 gpm (2.27 m3IMN
3BJO#JSESFDPNJFOEB
girar por completo el vstago del control de caudal dos veces desde la posicin
totalmente abierta

El uso inteligente del agua.

125
EFB-CP
114

150
EFB-CP
112"

200
EFB-CP
2"

5
10
15
20
30
40
50
60
80
100
120
140
160
180
200

0.2
0.7
1.2
2.1
5
8.2
13
-

1.4
2.3
4.1
6.8
9.8
16.5
-

2.3
2.9
2
3.3
4.6
7.5
11.8
16.6
-

0.5
0.6
0.8
1.1
1.8
2.4
3.8
5.9
7.8
10
12.5
15.8

Prdida de presin de la vlvula


de la serie EFB-CP (bares)

Dimensiones
Modelo Altura
t&'#$1
t&'#$1
t&'#$1
t&'#$1

100
EFB-CP
1"

Vlvulas

Especificaciones elctricas

Caudal
gpm

SIST. MTRICO

Caudal
m3/h

Caudal
l/m

100
EFB-CP
2.5 cm

125
EFB-CP
3.2 cm

150
EFB-CP
3.8 cm

200
EFB-CP
5.1 cm

1
3
6
9
12
15
18
21
24
27
30
33
36
39
42
45

19
50
100
150
200
250
300
350
400
450
500
550
600
650
700
757

0.01
0.07
0.27
0.56
-

0.14
0.28
0.53
0.82
1.12
-

0.19
0.14
0.25
0.38
0.51
0.70
0.91
1.13
-

0.04
0.05
0.09
0.14
0.16
0.23
0.30
0.40
0.49
0.58
0.68
0.79
0.92
1.09

Notas
1. Los valores de prdida se calcularon con el control de caudal totalmente abierto
2. Mdulo PRS-Dial recomendado para todos los ndices de caudal

103

Vlvulas
Vlvulas 300-BPE y 300-BPES

Vlvulas de latn 300-BPE/300-BPES

Prdida de presin de las vlvulas BPE y BPES de 3" (7.6 cm) (psi)

3" (80/90)

Q El cuerpo de latn y la tapa de nylon con fibra de vidrio que equipan


estas vlvulas son confiables y permiten soportar aumentos extremos
de presin, aguas residuales y obstrucciones de partculas de
suciedad. Para brindar proteccin adicional, el modelo BPES est
equipado con un mecanismo depurador patentado
que combate la suciedad y las partculas de forma activa

Q Exclusiva estructura hbrida que cuenta con un cuerpo de latn rojo


duradero y una tapa de nylon con fibra de vidrio de larga duracin a
un precio conveniente

Q %JBGSBHNBEVSBEFSPZSFGPS[BEPDPOUFMBQBSBVOBNBZPSWJEBUJM

Caractersticas

Vlvulas

t$JFSSFMFOUPQBSBFWJUBSFMHPMQFEFBSJFUFZFMQPTUFSJPS
dao del sistema
tSlo para BPES: depurador de nylon patentado que raspa la malla
de acero inoxidable para limpiar y eliminar la arenilla y el material
vegetal. Impide la acumulacin de partculas de suciedad y la posterior
obstruccin del sistema
t$POGJHVSBDJOEFHMPCPZEFOHVMPQBSBMPHSBSGMFYJCJMJEBE
en el diseo y la instalacin
t%JTFPEFDBVEBMIBDJBEFMBOUF OPSNBMNFOUFDFSSBEP
t4PMFOPJEFSFTJTUFOUFRVFQSPQPSDJPOBVOSFOEJNJFOUPDPOGJBCMFBVO
durante el funcionamiento constante
t.BOJKBEFDPOUSPMEFDBVEBMRVFSFHVMBFMDBVEBMEFBHVBTFHO
sea necesario e incorpora un casquillo roscado de latn para mayor
durabilidad
t1VSHBNBOVBMFYUFSOBRVFQFSNJUFMJNQJBSMBTQBSUDVMBTEFTVDJFEBEEFM
sistema. Recomendada para la puesta en marcha y las reparaciones del
sistema
t'VODJPOBNJFOUPEFBMUBFGJDJFODJBDPOQSEJEBEFQSFTJO
extremadamente baja

Opciones
t1VFEFVUJMJ[BSTFDPOFMNEVMPSFHVMBEPSEFQSFTJODPO134%JBM
instalado en campo para garantizar un rendimiento ptimo del aspersor.
Regula hasta 100 psi (6.9 bares)
t.BOJKBEFDPOUSPMEFDBVEBMDPMPSWJPMFUBQBSBBQMJDBDJPOFTEFBHVBOP
potable. (BPE-NP-HAN)
t"ENJUFFMTPMFOPJEFEFFOHBODIFQBSBVUJMJ[BSDPOMPTDPOUSPMBEPSFTEF
hasta 150 psi (10.4 bares) de Rain Bird que funcionan a pilas
t$PNQBUJCMFDPOEFDPEJGJDBEPSFT&41-9%

Cmo especificar

Globo

ngulo

6.6
5.1
3.2
1.8
1.8
2.0
2.2
2.7
4.0
4.9

6.8
5.9
3.5
1.8
2.1
2.1
2.0
2.5
3.4
4.5

Prdida de presin de las vlvulas BPE y BPES


de 3" (7.6 cm) (bares)
Caudal
m3h
13.6
24
36
48
60
68

Caudal
l/m
227
400
600
800
1000
1136

SIST. MTRICO

Globo

ngulo

0.46
0.19
0.14
0.21
0.29
0.34

0.47
0.21
0.14
0.19
0.26
0.31

Notas
1. Los valores de prdida se calcularon con el control de caudal totalmente abierto
2. Mdulo PRS-Dial recomendado para todos los ndices de caudal

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

t134%JBMSFHVMBIBTUBQTJ CBSFT

t$BVEBMDPOTJO134%JBMEFBHQN
(de 13.62 a 68.10 m3h; de 227 a 1136 l/m)
t5FNQFSBUVSBIBTUB' $

Especificaciones elctricas
t4PMFOPJEFEF7$"B)[ DJDMPTTFH

t$PSSJFOUFEFFOUSBEB" 7"
B)[
t$PSSJFOUFEFSFUFODJO" 7"
B)[
t3FTJTUFODJBEFMBCPCJOBPINJPT OPNJOBM

Vista transversal de
una vlvula BIES

Dimensiones
Modelo
t

Altura
58" (34.61 cm)

Longitud
8" (20.32 cm)

Ancho
7" (17.78 cm)

Modelos
t#1& 

t#1&4 

300 - BPE - PRS-D


Modelo Caracterstica opcional
BPE
134%JBMNEVMP
regulador de presin
(se debe encargar por
Tamao
separado)
3" (80/90)

Roscas BSP disponibles; especifique al hacer el pedido


Recomendaciones
1. Rain Bird recomienda que los ndices de caudal en la lnea de suministro no superen
MPTQJFTTFH NT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF

Nota: la vlvula y el mdulo PRS-Dial se deben


encargar por separado. Para aplicaciones fuera de
EE.UU., es necesario especificar si el tipo de rosca debe
ser NPT o BSP.

1BSBDBVEBMFTJOGFSJPSFTBHQN NIMNJO
3BJO#JSESFDPNJFOEBFMVTPEF
filtracin ascendente para evitar que se acumule suciedad debajo del diafragma.

300-BPES

104

Caudal
gpm
60
80
100
120
140
160
180
200
250
300

1BSBDBVEBMFTJOGFSJPSFTBHQN NIMN
3BJO#JSESFDPNJFOEBHJSBSQPS
completo el vstago del control de caudal dos veces desde la posicin totalmente abierta.

El uso inteligente del agua.

Vlvulas

www.rainbird.com/valves

134%JBM

Mdulo regulador de presin

Q &M134%JBMFTVONFEJPFYDFMFOUFQBSBSFHVMBSMBQSFTJOEFTBMJEBEF
la vlvula, independientemente de las fluctuaciones de la presin de
entrada. La escala visible permite un ajuste rpido y fcil. El regulador
puede utilizarse con todas las vlvulas Rain Bird de las Series PGA, PEB,
1&4# 1&4#3 (# &'#$1 #1&Z#1&4

Q Regula y mantiene una presin de salida constante de entre 15 y 100


psi (de 1.04 a 6.9 bares) dentro de 3 psi (0.21 beres)

Q Perilla de ajuste con retenes que permite ajustar los parmetros a


incrementos de 1/3 psi (0.02 beres). Cartucho de disco que permite que
la instalacin y el ajuste se realicen de forma sencilla, rpida y precisa

Caractersticas
t.BZPSDBQBDJEBEQBSBSFEVDJSMPTQJDPTEFQSFTJORVFEJTNJOVZFFM
golpe de ariete
t%JTFPFSHPONJDPDPOUBQBIFSNUJDBRVFBZVEBBFWJUBSFMWBOEBMJTNP
t$BSUVDIPEFEJTDPBQSVFCBEFBHVBRVFFMJNJOBFMFNQBBNJFOUPZMB
impregnacin
t$BSUVDIPEFEJTDPRVFTFSFUSPBEBQUBBUPEBTMBTVOJEBEFT134#
existentes
t7MWVMB4DISBEFSRVFDPOFDUBMBNBOHVFSBEFMNBONFUSPTPMJDJUBSQPS
separado
t'DJMJOTUBMBDJOFODBNQP-BTSPTDBTEFM134%JBMTFFODVFOUSBOEFCBKP
del solenoide y el adaptador
t/ZMPODPOGJCSBEFWJESJPSFTJTUFOUFBMBDPSSPTJOZEFSFOEJNJFOUP
resistente

Rangos de caudal de la vlvula*


Modelo

gpm

m3/h

l/m

100-PGA
150-PGA
200-PGA
100-PEB
150-PEB
200-PEB
100-PESB/PESB-R
150-PESB/PESB-R
200-PESB/PESB-R
100-GB
125-GB
150-GB
200-GB
&'#$1
&'#$1
&'#$1
&'#$1
300-BPE
300-BPES

5-40
30-100
40-150
5-50
20-150
75-200
5-50
20-150
75-200
5-50
20-80
20-120
20-200
5-50
20-80
20-120
20-200
60-300
60-300

1.14-9.08
6.81-22.70
9.08-34.05
1.14-11.35
4.54-34.05
17.03-45.40
1.14-11.35
4.54-34.05
17.03-45.40
1.14-11.35
4.54-18.16
4.54-31.78
4.54-45.40
1.14-11.35
4.54-18.16
4.54-31.78
4.54-45.40
13.62-68.10
13.62-68.10

19.2-151
113-378
151-568
19.2-189
76-568
284-757
19.2-189
76-568
284-757
19.2-189
76-302
76-529
76-757
19.2-189
76-302
76-529
76-757
227-1136
227-1136

Vlvulas

PRS-Dial

* Estos son los rangos de caudal de las vlvulas. PRS-Dial regula slo hasta 100 psi (6.9 bares)

Rango operativo
t1SFTJO)BTUBQTJ CBSFT

t3FHVMBDJOEFBQTJ EFBCBSFT

t1SFDJTJOQTJ CFSFT

t$BVEBMDPOTVMUFMBUBCMB

PRS-Dial

* Aunque el regulador PRS puede soportar presiones de hasta 200 psi (13.8 bares), la
regulacin precisa de presin se puede mantener slo hasta 100 psi (6.9 bares)

Modelo
t134%

Informacin sobre el uso


t1BSBMPHSBSVOGVODJPOBNJFOUPDPSSFDUP TFSFRVJFSFRVFMBQSFTJOEF
entrada sea por lo menos 15 psi (1.04 beres) ms alta que la presin de
salida deseada
t1BSBMBTSFBTDPOQSFTJONVZBMUBPUFSSFOPTEFTOJWFMBEPT JOTUBMF
aspersores con vstagos reguladores de presin PRS y/o vlvulas de
retencin SAM
t$VBOEPMBQSFTJOEFFOUSBEBTVQFSBMPTQTJ CBSFT
TFSFRVJFSFMB
utilizacin de una vlvula maestra reguladora de presin o un regulador
de presin dentro de la lnea
t3BJO#JSEOPSFDPNJFOEBVUJMJ[BSFMNEVMPSFHVMBEPSEFQSFTJO
para aplicaciones cuyos rangos de caudal estn fuera de los lmites
recomendados
t3BJO#JSESFDPNJFOEBRVFMPTOEJDFTEFDBVEBMFOMBMOFBEFTVNJOJTUSP
no superen los 7.5 pies/seg. (2.29 m/s) para reducir los efectos del golpe
de ariete
t1BSBDBVEBMFTJOGFSJPSFTBHQN 3/h; 37.8 l/m), Rain Bird recomienda
girar por completo el vstago del control de caudal dos veces desde la
posicin totalmente abierta

El uso inteligente del agua.

Vista transversal
de PRS-Dial

Vlvula 300-BPE con


instalacin de PRS-Dial

Nota: La vlvula y el
mdulo PRS-Dial se
deben ordenar por
separado

GB con instalacin
de PRS-Dial

Vlvula 150-PESB-R con


instalacin de PRS-Dial

105

Vlvulas
Vlvulas de acoplamiento rpido

Vlvulas de acoplamiento rpido

Prdida de presin de las vlvulas de acoplamiento rpido (psi)

Q Vlvulas de latn y acoplamiento rpido con resistencia industrial para un

Caudal

3-RC

gpm

3
4"
1.8
4.7
7.2
-

conveniente acceso de agua en sistemas de agua potable y no potable

Q Estructura resistente de latn rojo para mayor durabilidad y un


rendimiento confiable

Q 'VODJPOBNJFOUPDPOGJBCMFDPOVOGVFSUFSFTPSUFEFBDFSPJOPYJEBCMF
resistente a la corrosin

Caractersticas
t5BQBEFTFHVSJEBEPQDJPOBMFOMPTNPEFMPT%-3$ -3$ -3$ 
%/1 /1Z/1 VTFMBDMBWFQBSBEFTCMPRVFBS
5BQBEFNFUBM
slo en el modelo 7
t%JTFPEFDVFSQPEFVOBTPMBQJF[B FOMPTNPEFMPT3$ 3$Z

t%JTFPEFDVFSQPEFEPTQJF[BTQBSBVOBSFQBSBDJOGDJM NPEFMPT
%3$ -3$ 3$ %/1Z/1

t'VFSUFSFTPSUFEFBDFSPJOPYJEBCMFSFTJTUFOUFBMBDPSSPTJORVFFWJUBMBT
fugas
t5BQBUFSNPQMTUJDBQBSBQSPMPOHBSMBEVSBCJMJEBE
t-BTUBQBTEFMPTNPEFMPT%/1 /1Z/1UJFOFOMBBEWFSUFODJB
i%P/PU%SJOL/0#&#"FOJOHMTZFTQBPM

10
15
20
30
40
50
60
70
80
100
125

33-DRC
33-DLRC
33-DNP
3
4"
2
4.3
7.6
-

Vlvulas

Dimensiones (altura)
t3$14" (10.8 cm)
t%3$38" (11.1 cm)
t%-3$58" (11.7 cm)

t3$ DN

t-3$ DN

t3$12" (14.0 cm)


t-3$: 512" (14 cm)

t: 534" (14.6 cm)


t%/1: 438" (11.1 cm)
t/1: 6" (15.2 cm)
t/1: 512" (14 cm)

Modelos
t3$UBQBEFHPNBEF DN
 
DVFSQPEFQJF[B
t%3$BHBSSBEFSBEFTFHVSJEBEDPOEPCMFHVBEF DN
 

tapa de goma, cuerpo de 2 piezas
t%-3$BHBSSBEFSBEFTFHVSJEBEDPOEPCMFHVBEF DN
 

tapa de goma, cuerpo de 2 piezas
t3$UBQBEFHPNBEF DN
 
DVFSQPEFQJF[B
t-3$UBQBEFTFHVSJEBEEFHPNBEF DN
 
DVFSQPEF
pieza
t3$UBQBEFHPNBEF DN
 
DVFSQPEFQJF[B
t-3$UBQBEFTFHVSJEBEEFHPNBEF DN
 
DVFSQPEFQJF[B
tUBQBEFNFUBMEF DN
 
DVFSQPEFQJF[B
t3$#41UBQBEFHPNBEF DN
 
DVFSQPEFQJF[B DPO
roscas BSP
t-3$#41UBQBEFTFHVSJEBEEFHPNBEF DN
 

cuerpo de 1 pieza, con roscas BSP
t%/1UBQBEFTFHVSJEBEEFHPNBWJPMFUBQBSBBHVBOPQPUBCMFEF
(1.9 cm) (20/27), cuerpo de 2 piezas
t/1UBQBEFTFHVSJEBEEFHPNBWJPMFUBQBSBBHVBOPQPUBCMFEF 
cm) (26/34), cuerpo de 2 pieza
t/1UBQBEFTFHVSJEBEEFHPNBWJPMFUBQBSBBHVBOPQPUBCMFEF 
cm) (26/34), cuerpo de 1 pieza
Nota: para aplicaciones fuera de EE.UU., es necesario especificar si el tipo de rosca debe
ser NPT o BSP

106

5-RC
5-LRC
5-NP
1"

2.2
4.4
11.5
-

4.1
7.3
11
15.7
21.5
-

112"
1.7
2.5
3.6
4.9
8.4
14

Prdida de presin de las vlvulas de acoplamiento rpido (bares) SIST. MTRICO


Caudal

3-RC

m3h

l/m

1.9 cm

33-DRC
33-DLRC
33-DNP
1.9 cm

2.3
4
5
6
7
8
9
10
12
14
16
22
28

38
67
83
100
117
133
150
167
200
233
267
367
473

0.12
0.41
0.57
-

0.12
0.42
0.62
-

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

t$BVEBMEFBHQN EFBN3h; de 37.8 a 473 l/m)


t$BVEBMEFMBTWMWVMBT%/1 /1Z/1EFBHQN EFBN3h;
de 37.8 a 265 l/m)

44-RC
44-LRC
44-NP
1"

Vista transversal
de una vlvula de
acoplamiento rpido

44-RC
44-LRC
44-NP
2.5 cm

5-RC
5-LRC
5-NP
2.5 cm

7
3.8 cm

0.23
0.40
0.62
0.83
-

0.30
0.40
0.50
0.61
0.85
1.15
1.50
-

0.13
0.18
0.25
0.54
0.97

Vlvulas de
acoplamiento rpido

El uso inteligente del agua.

Vlvulas

www.rainbird.com/valves

Accesorios para vlvulas

Llaves de vlvulas

Llaves de vlvulas correspondientes

Llaves de acoplamiento rpido

Caractersticas

Vlvula
t"EBQUBMBTSPTDBTFOMBQBSUFTVQFSJPSEFMBWMWVMBEFBDPQMBNJFOUPSQJEP 3$
para proporcionar acceso al agua
%3$/1
3$/1
Modelos
3$/1

t%,34" (20/27)
t, 

t, 

t,12 

Llave
%,
%,
,
,
,

Roscas superiores para tuberas


Macho
Hembra
3
1
4"
2"
3
1
4"
2"
3

4"


12"
1144%4R

Llaves de vlvulas correspondientes

* Disponible con roscas BSP;


especifique al hacer el pedido

Llave
%,
%,
,
,
,

Roscas superiores para tuberas


Macho
Hembra










Vlvulas

Vlvula
3$
%3$/1
3$/1
3$/1


SIST. MTRICO

55-K-1

Serie SH

Llave para tapa de seguridad

%JTQPTJUJWPHJSBUPSJPQBSBNBOHVFSB

Caractersticas

Caractersticas
t'JKBMBNBOHVFSBEFBHVBBMBMMBWFEFMBWMWVMBEFBDPQMBNJFOUPSQJEP
t(JSBIBTUB
t1FSNJUFKBMBSMBNBOHVFSBFODVBMRVJFSEJSFDDJO
t&WJUBFMEBPEFMBNBOHVFSB

t"CSFZDJFSSBMBUBQBEFTFHVSJEBEPQDJPOBMFOMBTWMWVMBTEF
acoplamiento rpido
t"DDJPOBFMDJFSSFEFDPNQSFTJOEFMNBSDBEPSEFWMWVMB
t$PNQBUJCMFDPOMPTNPEFMPT%-3$ %/1 -3$ /1 -3$
y 5-NP

Especificaciones

Modelo

t4)SPTDBIFNCSBEFUVCPEF3/4" (1.9 cm) (20/27) x rosca macho para


manguera de 3/4" (1.9 cm) (20/27)
t4)SPTDBIFNCSBEFUVCPEF DN
 
YSPTDBNBDIPQBSB
manguera de 3/4" (1.9 cm) (20/27)
t4)SPTDBIFNCSBEFUVCPEF DN
 
YSPTDBNBDIPQBSB
manguera de 1" (2.5 cm) (26/34)
t4)SPTDBIFNCSBEFUVCPEF1/2" (1.3 cm) (40/49) por rosca macho para
manguera de 1" (2.5 cm) (26/34)

t-MBWFEFUBQB

Modelos
t4)
t4)
t4)
t4)
*Disponible con roscas BSP

El uso inteligente del agua.

SH-0

2049

107

Vlvulas
Accesorios para vlvulas

SPLICE-1

Ensamble de manija violeta para vlvula

Empalme de cables

Caractersticas

Caractersticas
t&NQBMNFSQJEPZDPOGJBCMF
t-BDBSDBTBOFHSBSFTJTUFOUFBMPTSBZPTVMUSBWJPMFUBTWJFOFMMFOBEFHSBTB
de litio no txica

t.BOJKBWJPMFUBEFDPOUSPMEFDBVEBMRVFJEFOUJGJDBMBWMWVMB
como parte del sistema de agua no potable
t'DJMJOTUBMBDJOFODBNQP
t5BNBPTEJTQPOJCMFTQBSBUPEBTMBTWMWVMBTDPNFSDJBMFTEF3BJO#JSE

Especificaciones

Modelos

t&NQBMNBDBCMFTEFDPOUSPMFMDUSJDPEFCBKPWPMUBKF7NYJNP
t'JKBDBCMFTEFIBTUB
- 5 #18, #20 #22 AWG
- 4 #16 AWG
- 2 #14 AWG

t1("/1)"/ QBSBWMWVMBT1("EFZ1/2" [2.5 cm y 3.8 cm])


t1("/1)"/ QBSBWMWVMBT1("EF<DN>

t1&#/1)"/ QBSBWMWVMBT1&#1&4#EF<DN>

t1&#/1)"/ QBSBWMWVMBT1&#1&4#EF1/2" y 2" [3.8 cm y 5.1 cm])


t#1&/1)"/ QBSBWMWVMBT#1&#1&4EF<DN>

Modelo
t41-*$&

Vlvulas

PEB-NP-HAN PGA-NP-HAN

BPE-NP-HAN

SPLICE-1

108

El uso inteligente del agua.

Vlvulas

www.rainbird.com/valves

Calibre de los cables de las vlvulas comerciales: 50 Hz

Clculo del calibre del cable de las vlvulas de solenoide de 24 VCA 50 Hz


Vlvula de 9.8 VA (EZ) con transformadores de 26.5 V - Pies equivalentes del circuito
Q

t t

comn
Calibre del cable

Calibre del cable de control


18
16
14

12

10

18
16
14
12
10
8
6
4

2800
3400
4000
4500
4800
5100
5300
5400

11300
13900
16200
18100
19500

18000
22100
25700
28800

4400
5500
6400
7100
7700
8100
8400

7100
8700
10200
11400
12300
13000

Presin de agua en la vlvula de 100 psi (6.9 bares)


comn
Calibre del cable

Calibre del cable de control


18
16
14

18
16
14
12
10
8
6
4

2600
3200
3800
4200
4500
4800
4900
5100

4200
5100
6000
6700
7200
7600
7900

6700
8200
9600
10700
11600
12200

12

10600
13100
15200
17000
18400

10

Presin de agua en la vlvula de 125 psi (8.6 bares)

10

10200
12600
14700
16400
17700

16300
20000
23300
26100

6400
7900
9200
10300
11200
11800

Presin de agua en la vlvula de 150 psi (10.4 bares)

12

10

18
16
14
12
10
8
6
4

2400
3000
3500
3900
4200
4400
4600
4700

9900
12100
14100
15800
17100

15700
19300
22500
25200

3900
4800
5600
6200
6700
7100
7300

6200
7600
8900
10000
10700
11300

Presin de agua en la vlvula de 200 psi (13.8 bares)


comn
Calibre del cable

Calibre del cable de control


18
16
14

18
16
14
12
10
8
6
4

1800
2200
2600
2900
3200
3300
3500
3500

2900
3600
4200
4700
5100
5300
5500

4700
5800
6700
7500
8100
8600

El uso inteligente del agua.

12

7400
9200
10700
11900
12900

11900
14600
17000
19000

t t

25900
31700
37100

40900
50300

t t

25000
30500
35800

39300
48400

18900
23100
27000

63000

%FUFSNJOFMBEJTUBODJBSFBM BMPMBSHPEFMBFYUFOTJOEFM
cable, desde el controlador hasta la primera vlvula de un
circuito y entre cada vlvula subsiguiente de un circuito
EFWBSJBTWMWVMBT DPNPTFNVFTUSBFOMB'JHVSB" QHJOB
93). Ejemplo: (solenoide de dos vatios, transformador
de 26.5 V a 50Hz y 150 psi de presin de agua en las
vlvulas).

Paso 2
Calcule la longitud del circuito equivalente para cada
circuito de vlvula en el controlador. (Consulte el cuadro
de la izquierda.)

t t

29800
36600

Paso 3
Seleccin del tamao del cable comn: con la mayor
longitud equivalente ya calculada, vaya a la tabla de
vlvulas correspondiente para seleccionar un cable
comn y un cable de control que tengan el tamao ms
similar posible (el tamao del cable comn siempre debe
ser igual o mayor que el tamao del cable de control). En
FMFKFNQMPBOUFSJPS FMDJSDVJUPQBSBMBFTUBDJO/UJFOF
la longitud equivalente ms larga, 7000 pies (2134 m). En
la tabla (para este ejemplo, utilice la tabla para 150 psi
de presin de agua en la vlvula y un transformador de
26.5 V), seleccione una combinacin de cables de calibre
14 y 12. Seleccione un cable comn como cable calibre
%BEPRVFEFCFVUJMJ[BSTFVOTPMPDBCMFDPNOQBSB
todas las vlvulas en el controlador, usted ha establecido
el calibre del cable comn para dicho controlador como
cable calibre 12.

65400

t t

67800

Paso 1

42400
52200

10

72100

t t

t t

Calibre del cable de control


18
16
14

comn
Calibre del cable

26900
32900
38500

t t

12

2500
3100
3600
4100
4400
4600
4800
4900

4000
5000
5800
6500
7000
7400
7600

45000
55400

18
16
14
12
10
8
6
4

28600
35000
40900

Calibre del cable de control


18
16
14

t t

16900
20800
24200
27100

t t

comn
Calibre del cable

Paso 4
Clculo del calibre de los cables de control del circuito: a
partir de la lectura de la fila del calibre del cable comn
seleccionado en el Paso 3 (calibre 12), proceda con la
seleccin del calibre de cada cable de control de la tabla
utilizando la longitud equivalente calculada para cada
circuito.
Estacin N 1:-POHJUVEFRVJWBMFOUFWMWVMBY
QJFT N
QJFT N

Seleccione un cable de control calibre 18
Estacin N 2:-POHJUVEFRVJWBMFOUF WMWVMBY
QJFT<N>
  WMWVMBTYQJFT<N>

pies (1524 m) Seleccione un cable de control calibre 16
Estacin N 3:-POHJUVEFRVJWBMFOUF WMWVMBY
pies [152 m]) + (2 vlvulas x 1000 pies [305 m]) + (3
WMWVMBTYQJFT<N>
QJFT N

Seleccione un cable de control calibre 14

47600

109

Vlvulas

Presin de agua en la vlvula de 80 psi (5.5 bares)

Procedimiento para calcular el


calibre de los cables de la vlvula

Vlvulas
Calibre de los cables de las vlvulas comerciales: 60 Hz

Clculo del calibre del cable de las vlvulas de solenoide de 24 VCA 60Hz
Vlvula de 9.8 VA (EZ) con transformadores de 26.5 V - Pies equivalentes del circuito
Presin de agua en la vlvula de 80 psi (5.5 bares)

t t

comn
Calibre del cable

Calibre del cable de control


18
16
14

12

10

18
16
14
12
10
8
6
4

2300
2800
3300
3700
4000
4200
4400
4500

9400
11500
13500
15000
16300

15000
18400
21400
24000

3700
4500
5300
5900
6400
6700
7000

5900
7200
8500
9500
10200
10800

Presin de agua en la vlvula de 100 psi (6.9 bares)

Vlvulas

comn
Calibre del cable

Calibre del cable de control


18
16
14

18
16
14
12
10
8
6
4

2100
2500
3000
3300
3600
3800
3900
4000

3300
4100
4700
5300
5700
6000
6200

5300
6500
7600
8500
9100
9600

12

8400
10300
12000
13400
14500

10

Presin de agua en la vlvula de 125 psi (8.6 bares)

10

7400
9100
10600
11900
12800

11800
14500
16900
18900

4600
5700
6700
7500
8100
8500

Presin de agua en la vlvula de 150 psi (10.4 bares)

12

10

18
16
14
12
10
8
6
4

1600
2000
2300
2600
2800
3000
3100
3200

6600
8200
9500
10600
11500

10600
13000
15200
17000

2600
3200
3700
4200
4500
4800
4900

4200
5100
6000
6700
7200
7600

Presin de agua en la vlvula de 200 psi (13.8 bares)


comn
Calibre del cable

Calibre del cable de control


18
16
14

18
16
14
12
10
8
6
4

1300
1600
1900
2100
2300
2400
2500
2500

110

2100
2600
3000
3400
3600
3800
3900

3300
4100
4800
5400
5800
6100

12

5300
6500
7600
8500
9200

t t

18700
22900
26900

29600
36400

t t

16800
20600
24100

26600
32700

13500
16500
19400

42500

t t

21300
26200

Paso 1
%FUFSNJOFMBEJTUBODJBSFBM BMPMBSHPEFMBFYUFOTJOEFM
cable, desde el controlador hasta la primera vlvula de un
circuito y entre cada vlvula subsiguiente de un circuito
EFWBSJBTWMWVMBT DPNPTFNVFTUSBFOMB'JHVSB" QHJOB
93). Ejemplo: (solenoide de dos vatios, transformador
de 26.5 V a 60 Hz y 150 psi de presin de agua en las
vlvulas).

Paso 2
Calcule la longitud del circuito equivalente para cada
circuito de vlvula en el controlador. (Consulte el cuadro
de la izquierda.)

Paso 3
Seleccin del tamao del cable comn: con la mayor
longitud equivalente ya calculada, vaya a la tabla de
vlvulas correspondiente para seleccionar un cable
comn y un cable de control que tengan el tamao ms
similar posible (el tamao del cable comn siempre debe
ser igual o mayor que el tamao del cable de control). En
FMFKFNQMPBOUFSJPS FMDJSDVJUPQBSBMBFTUBDJO/UJFOF
la longitud equivalente ms larga, 7000 pies (2134 m). En
la tabla (para este ejemplo, utilice la tabla para 150 psi
de presin de agua en la vlvula y un transformador de
26.5 V), seleccione una combinacin de cables de calibre
12 y 10. Seleccione un cable comn como cable calibre
%BEPRVFEFCFVUJMJ[BSTFVOTPMPDBCMFDPNOQBSB
todas las vlvulas en el controlador, usted ha establecido
el calibre del cable comn para dicho controlador como
cable calibre 10.

47300

53700

t t

8500
10400
12100
13600

33500
41300

10

60000

t t

t t

Calibre del cable de control


18
16
14

comn
Calibre del cable

21300
26000
30500

t t

12

1800
2200
2600
2900
3200
3300
3400
3500

2900
3600
4200
4700
5000
5300
5500

37500
46100

18
16
14
12
10
8
6
4

23800
29100
34000

Calibre del cable de control


18
16
14

t t

13400
16400
19100
21400

t t

comn
Calibre del cable

Procedimiento para calcular el


calibre de los cables de la vlvula

Paso 4
Clculo del calibre de los cables de control del circuito: a
partir de la lectura de la fila del calibre del cable comn
seleccionado en el Paso 3 (calibre 10), proceda con la
seleccin del calibre de cada cable de control de la tabla
utilizando la longitud equivalente calculada para cada
circuito.
Estacin N 1:-POHJUVEFRVJWBMFOUFWMWVMBY
QJFT N
QJFT N
4FMFDDJPOFVODBCMFEF
control calibre 18
Estacin N 2:-POHJUVEFRVJWBMFOUF WMWVMBY
QJFT<N>
  WMWVMBTYQJFT<N>

pies (1524 m) Seleccione un cable de control calibre 14
Estacin N 3:-POHJUVEFRVJWBMFOUF WMWVMBY
pies [152 m]) + (2 vlvulas x 1000 pies [305 m]) + (3
WMWVMBTYQJFT<N>
QJFT N

Seleccione un cable de control calibre 12

34100

El uso inteligente del agua.

Impactos

Rotores

Boquillas aspersoras

Cuerpos de
aspersores

Introduccin

Cuerpos de difusores
Accesorios

Programadores

Accesorios

Vlvulas

En proyectos anteriores, instal un


tubo de plstico con aproximadamente
una docena de orificios perforados a mano
y un burbujeador retroadaptado, pero
nunca estuve totalmente satisfecho con
este mtodo de 'hgalo usted mismo'. En
un trabajo reciente necesitbamos sembrar
200 plntulas de roble blanco en un sitio
de 20 acres y utilizamos el RWS de Rain
Bird. Un ao despus de haberlos sembrado,
los rboles muestran una vitalidad
extremadamente buena. Si busca vitalidad
a largo plazo y rboles sanos, esta es una
excelente herramienta".
Greg Houck

Bombas

Xerigation

Sistemas de control
centralizado

Ad Land Venture

Drenaje

Sugerencias para ahorrar agua


Serie de riego de races

El uso inteligente del agua.

t Solucin de la ms alta eficacia para el


riego de los rboles: uniformidad de
emisin de hasta un 95% con mnimas
prdidas por viento, evaporacin o
control de borde.

t Las zonas de riego subterrneas

Recursos

para la distribucin de agua en las


zonas de races de los rboles y
arbustos que los burbujeadores
sobre el terreno.

especficas del RWS reducen el


estrs de los rboles y arbustos
causado por las estrictas
restricciones de riego del csped.

Referencia

t El RWS posee mayor eficiencia

111

Accesorios
Ensambles flexibles

Serie SA
Los ensambles flexibles conectan los aspersores a los tubos laterales
Q Alternativa de calidad para los accesorios de tuberas flexibles y de
 conectores de punta espiralados ensamblados de forma local que no
posean garanta del fabricante
Q Un completo rango de productos permite una variedad de soluciones
 paisajsticas
Q Los accesorios de alta ingeniera y los aspersores complementarios
 inspiran confianza en la especificacin del producto
Sistema exclusivo de Rain Bird que ofrece:
montajes flexibles y aspersores

Especificaciones
El rango operativo de los Montajes flexibles de Rain Bird alcanza o supera el
SBOHPPQFSBUJWPEFMBNBZPSBEFMPTBTQFSTPSFTEF
DN
ZEFMPTSPUPSFTEF DN

t1SFTJOPQFSBUJWBIBTUBQTJ CBSFT

t1SFTJOEFEFTDBSHBIBTUBQTJ CBSFT

t5FNQFSBUVSBIBTUB' $

t$BVEBMNYJNPHQN MT

t-BQSEJEBEFQSFTJOBHQN MT
FTEFQTJ CBSFT

Accesorios

Cmo especificar
SA 12 5050
Entrada/salida
Y DNYDN

Y DNYDN

Y DNYDN

Y DNYDN

Longitud
18"
12"
6"

Serie SA

Modelo
Ensamble flexible

Especificaciones de los ensambles flexibles de la Serie SA


Nmero de modelo

SA-6050
SA-65075
SA-125050
SA-125075
SA-127575
SA-185050

112

Nmero de pieza

A48030
A48055
A48035
A48045
A48050
A48065

Longitud
EE.UU.

4*45.53*$0

Entrada
EE.UU.

4*45.53*$0

Salida
EE.UU.

4*45.53*$0

6"
6"
12"
12"
12"
18"

15.2 cm
15.2 cm
30.5 cm
30.5 cm
30.5 cm
45.7 cm








1.3 cm
1.3 cm
1.3 cm
1.3 cm
1.9 cm
1.3 cm








1.3 cm
1.9 cm
1.3 cm
1.9 cm
1.9 cm
1.3 cm

El uso inteligente del agua.

Accesorios

www.rainbird.com/accessories

5VCFSBGMFYJCMFZDPOFDUPSFTEFQVOUBFTQJSBMBEPT

Tubera flexible serie SPX


La tubera flexible con conectores de punta espiralados ofrece un
ensamble flexible para aspersores y rotores

Caractersticas y beneficios
t419'-&9
 'MFYJCJMJEBETVQFSJPSRVFQFSNJUFRVFMBTUVCFSBTTFFOSVUFO
eficientemente en paisajes rocosos, terrazas y terrenos desnivelados para
convertir el diseo paisajstico en realidad
- Superficie texturada que logra que el producto sea ms fcil de manipular,
lo cual contribuye a mejorar la eficiencia de la mano de obra, en especial
bajo condiciones de humedad
 )BTUBVONTGMFYJCMFRVFMBTUVCFSBTGMFYJCMFTEFMBDPNQFUFODJB

Hasta un 30% ms flexible


que la competencia

- Resistente a torcimientos
- Instalacin rpida y fcil que reduce los costos de material y mano de obra
- Se instala rpidamente. As, queda tiempo para realizar instalaciones
adicionales del sistema y se generan oportunidades de aumento de
ingresos
* Basado en pruebas realizadas en el Centro de Investigaciones de Productos Rain Bird.
Pruebas realizadas en tuberas flexibles de Rain Bird y de los principales competidores

Especificaciones
t%JNFUSPJOUFSOP DN

t1SFTJOPQFSBUJWBIBTUBQTJ CBSFT

Accesorios

t5FNQFSBUVSBIBTUB' $

Modelos
t419'-&9#PCJOBEFh N

SPX-FLEX100

Conectores de punta en espiral de la Serie SB


Un producto natural, complemento de la tubera flexible de la Serie SPX

Caractersticas y beneficios
t-PTBDDFTPSJPTFTUOGBCSJDBEPTDPONBUFSJBMBDFUBMSFTJTUFOUFQBSBRVFMB
conexin de la tubera flexible sea rpida y fcil
t'DJMJOTFSDJOHJSBUPSJBOPTFOFDFTJUBOBCSB[BEFSBTOJQFHBNFOUPQBSBMB
instalacin
t#PSEFSFTJTUFOUFEFMDPOFDUPSEFQVOUBRVFQFSNJUFVOBDPOFYJOTFHVSB
con menor probabilidad de fugas
t"NQMJBWBSJFEBEEFGPSNBTZUBNBPTRVFQFSNJUFORVFFMDPOUSBUJTUBFMJKB
los mejores accesorios para la aplicacin
SB-CPLG

SBA-050

SBFE-050

SBE-075

t-BMPOHJUVEFYUFOEJEBZFMCPSEFSFTJTUFOUFEFMDPOFDUPSEFQVOUBFWJUBOMBT
explosiones, y as se reduce la probabilidad de que tenga que volver a llamar
al contratista

Especificaciones
t1SFTJOPQFSBUJWBIBTUBQTJ CBSFT

t5FNQFSBUVSBIBTUB' $

Modelos
t4#&./15EF DN
YDPEPDPODPOFDUPSEFQVOUBEF DN

t4#&#./15EF DN
YDPEPDPODPOFDUPSEFQVOUBEF 

paquete al por mayor
t4#&./15EF DN
YDPEPDPODPOFDUPSEFQVOUBEF DN

t4#&#./15EF DN
YDPEPDPODPOFDUPSEFQVOUBEF 
cm); paquete al por mayor
t4#"./15EF DN
YBEBQUBEPSEFMDPOFDUPSEFQVOUBEF DN

t4#"./15EF DN
YBEBQUBEPSEFMDPOFDUPSEFQVOUBEF DN

t4#5&&DPOFDUPSEFQVOUBEF DN
YDPOFDUPSEFQVOUBEFY
DPOFDUPSEFQVOUBFO5EF DN

t4#$1-(DPOFDUPSEFQVOUBEF DN
YBDPQMFEFDPOFDUPSEFQVOUBEF
 DN

t4#'&'/15EF DN
YDPEPDPODPOFDUPSEFQVOUBEF DN


SB-NPT-TEE

SBE-050

SB-TEE

El uso inteligente del agua.

SBA-075

t4#/155&&./15EF DN
YDPOFDUPSEFQVOUBEF DN
Y
DPOFDUPSEFQVOUBFTQJSBMBEPEF DN

113

Accesorios
Riego de races

Serie RWS
La Serie de riego de races promueve el crecimiento profundo de las races y
el desarrollo saludable de los rboles
Q La aireacin y el riego subterrneos evitan el impacto causado por el trasplante
 de los rboles y arbustos
Q El riego y la aireacin de las races profundas subterrneas garantizan la salud
 de los rboles y promueven un crecimiento acelerado
Q Solucin de la ms alta eficacia para el riego de los rboles: uniformidad de
 emisin de hasta un 95% con viento, evaporacin o prdidas de control de
extremos mnimos

Caractersticas y beneficios
t#VSCVKFBEPSTVCUFSSOFPEJTFBEPFTUUJDBNFOUFQBSBDPOUSJCVJSBMB
apariencia natural del paisaje
t-BSFKJMMBDPOMMBWFFOFMHSBEJFOUFTJSWFDPNPPCTUDVMPTJBMHVJFOJOUFOUB
daar algn componente
t "ZVEBBFWJUBSFMDSFDJNJFOUPTVQFSGJDJBMEFMBTSBDFTZFMEBPEFMPTQBJTBKFT
rocosos
t&TUUJDBNFOUFBUSBDUJWPQPSEFCBKPEFMBJOTUBMBDJOEFMHSBEJFOUF
t6OJEBEFTBSNBEBTEFGCSJDBFJOEFQFOEJFOUFTQBSBVOBDPOGJBCJMJEBE
garantizada
t7BSJFEBEEFNPEFMPTEJTQPOJCMFTRVFTFBEBQUBOBMBGMFYJCJMJEBEEFMEJTFP
Para el modelo RWS:
Accesorios

- Cubierta de retencin de 4" (10.2 cm) y rejilla con llave resistente al


vandalismo que se encuentra en la parte superior de un tubo de malla
semi-rgido de 36" (91.4 cm)
RWS-B-1401
RWS-M-B-1401

- Ensambles flexibles instalados de fbrica (excluido el RWS-BGX) con


burbujeador 1401 (0.25 gpm; 1.2 l/min), 1402 (0.5 gpm; 1.8 l/min) o 1404
(1.00 gpm; 3.6 l/min) en una tubera de elevacin fija que facilita la conexin
a las lneas laterales
'VOEBPQDJPOBM JEFBMQBSBVUJMJ[BSFOFMTVFMPBSFOPTP

RWS-S-B-1401

Para el RWS - Mini:


- Cubierta de retencin de 4" (10.2 cm) y rejilla con llave resistente al
vandalismo que se encuentra en la parte superior de un tubo de malla
semi-rgido de 18" (91.4 cm)
$PEPDPODPOFDUPSEFQVOUBFTQJSBMBEPEF DN
JOTUBMBEPEFGCSJDB 
con un burbujeador 1401 o 1402 que facilita la conexin a las lneas laterales
'VOEBQBSBTVFMPTBSFOPTPTPQDJPOBM JEFBMQBSBVUJMJ[BSFOTVFMPTDPOUJFSSB
fina
Para el RWS - Suplementario:
- Cubierta base y cubierta a presin de 2" (5.1 cm) que contienen un tubo de
malla semi-rgido de 10" (25.4 cm)
$PEPDPODPOFDUPSEFQVOUBFTQJSBMBEPEF DN
JOTUBMBEPEFGCSJDB 
con un burbujeador 1401 que facilita la conexin a las lneas laterales
- El tamao adecuado para los arbustos

Funda del RWS


Diseado para adaptarse a
las unidades del RWS y RWSMini. Ideal para utilizar en
suelos con tierra fina; para
evitar que la tierra se infiltre
en el recipiente del RWS

Collarn integrado y sujetador


para rejilla con llave del RWS

114

El uso inteligente del agua.

Accesorios

www.rainbird.com/accessories

Riego de races

Dimensiones
t3JFHPEFSBDFTEJNFUSPEFw DN
Yw DN
EFMPOHJUVE
t3JFHPEFSBDFTo.JOJEJNFUSPEFw DN
Yw DN
EFMPOHJUVE
t3JFHPEFSBDFTo4VQMFNFOUBSJPEJNFUSPEFw DN
Yw DN
EFMPOHJUVE

Modelos/Especificaciones
Modelo

Burbujeador

Vlvula de
retencin

Ensamble flexible
c/entrada M NPT de "
(1.3 cm) (15/21)

Codo con conector de punta


espiralado c/entrada M NPT
de " (1.3 cm) (15/21)



 (18")












Riego de races (con rejilla con llave de 4" [10.2 cm] resistente al vandalismo)
RWS

*EFBMQBSBUVCFSBEFHPUFPEFiP
equipos suministrados por el cliente

RWS-B-C-1401
RWS-B-1401
RWS-B-X-1401
RWS-B-C-1402
RWS-B-1402
RWS-B-C-1404

0.25 gpm (1.2 l/m)


0.25 gpm (1.2 l/m)
0.25 gpm (1.2 l/m)
0.50 gpm (1.8 l/m)
0.50 gpm (1.8 l/m)
1.00 gpm (3.6 l/m)

RWS-M

*EFBMQBSBUVCFSBEFHPUFPEFiP
equipos suministrados por el cliente

RWS-M-B-C-1401
RWS-M-B-1401
RWS-M-B-C-1402
RWS-M-B-1402

0.25 gpm (1.2 l/m)


0.25 gpm (1.2 l/m)
0.50 gpm (1.8 l/m)
0.50 gpm (1.8 l/m)

Accesorios

Riego de races - Mini (con rejilla con llave de 4" [10.2 cm] resistente al vandalismo)

Riego de races - Suplementario (con cubierta base y cubierta a presin de 2" [5.1 cm])
RWS-S-B-C-1401
RWS-S-B-1401

0.25 gpm (1.2 l/m)


0.25 gpm (1.2 l/m)

FUNDA DEL RWS (Funda para suelos arenosos para riego de races) (6 por bolsa)
'6/%"%&-384 'VOEBEFSJFHPEFSBDFT

3&+*--"131%&-384 3FKJMMBWJPMFUBEFMB4FSJFEFSJFHPEFSBDFTQBSB384Z384.JOJ

Instale el producto
alineado con nivel
de terminacin

El oxgeno y la
circulacin del
agua promueven el
crecimiento saludable
de las plantas
Coloque las
unidades
espaciadas de
manera uniforme
alrededor del
cepelln

El uso inteligente del agua.

Cmo especificar
RWS - x - x - x - xxxx
Modelo de
burbujeador
1401
1402
1404
Caracterstica
C: Vlvula de retencin
Burbujeador
B: Burbujeador preinstalado
Otro tamao
M: Mini-RWS (4" [10.2 cm] x 18" [45.7 cm])
S: RWS-Suplementario (2" [5.1 cm] x
10" [25.4 cm] )
Modelo
Serie de riego de races RWS

115

Accesorios
Cajas de vlvulas

Una variedad de tamaos y formas de cajas de vlvulas que facilitan la


eleccin de la caja adecuada para el trabajo. Cuerpo negro y tapas negras
totalmente fabricadas con materiales reciclados

Las tapas ciegas para


pernos impiden el acceso
a insectos y plagas cuando
no se utilicen pernos

Los lados corrugados


mantienen la integridad
estructural con cargas pesadas
Las tapas con bordes
biselados evitan los
daos ocasionados
por los aparatos
p
p
para
p
csped

Ranura de acceso
para pala para
quitar fcilmente
la tapa

Cajas de vlvulas Serie VB


Las cajas de vlvulas ofrecen una resistencia de caja superior para una
mejor proteccin de las vlvulas
Q Pestaa ancha con estructura corrugada que ofrece una resistencia de caja
superior para una mejor proteccin de las vlvulas
Q Ranura de acceso para pala exclusiva que ofrece una mejor accesibilidad
para hacer mantenimiento
Q Las tapas sin orificios reducen el peligro por abejas, araas y serpientes
Q .BUFSJBMFTFDPMHJDPTDFSUJGJDBEPTQPS-&&% UPUBMNFOUFGBCSJDBEPTDPO
materiales reciclados (cajas negras solamente)

Caractersticas y beneficios
Estas caractersticas se aplican a las cajas de vlvulas Estndar, Jumbo, Super
Jumbo, Maxi Jumbo y Redonda de 7 y 10" :
t&YDMVTJWBTUBQBTDJFHBTQBSBQFSOPTEJTFBEBTFOMBTUBQBTRVFNBOUJFOFOBMPT
insectos y plagas fuera de la caja
t"DDFTPQBSBQBMBFOFMDVFSQPRVFQFSNJUFRVJUBSMBUBQBGDJMNFOUF
t4VKFUBEPSFTQBSBUBQBTDJFHBTRVFTPTUJFOFOEFNBOFSBTFHVSBMBTUBQBTDJFHBT
quitadas por encima de los tubos, lo que mantiene la suciedad fuera durante el
relleno
t#PSEFTEFMBUBQBCJTFMBEPTRVFBZVEBOBFWJUBSMPTEBPTPDBTJPOBEPTQPS
aparatos para csped
Accesorios

La caracterstica de
enganche
bloquea dos cajas
juntas cuando
estn ajustadas
por la parte inferior
para instalaciones
profundas

Los sujetadores para


tapas ciegas, una vez
quitadas las tapas,
las mantienen en
su lugar durante el
relleno

Tapas ciegas
en los cuatro
lados

La pestaa
ancha estabiliza
la caja, elimina
la necesidad de
ladrillos y ofrece
una resistencia
de carga lateral
mejorada

t1BSUFJOGFSJPSDPOUSBCBRVFQFSNJUFVOJSMBTDBKBTEFGPSNBTFHVSBQBSB
instalaciones profundas
tSFBEFTFBMJ[BDJOEFMBUBQBRVFQSPQPSDJPOBVOBVCJDBDJOFTQFDGJDBQBSB
identificacin

Dimensiones y caractersticas adicionales por modelo


SERIE RECTANGULAR ESTNDAR (VB-STD)
t %JNFOTJPOFT-Y"OY"M DN-YDN"OYDN"M

t%PTUBQBTDJFHBTHSBOEFTZDFOUSBMFTDPOFTQBDJPQBSBUVCPTDPOVOEJNFUSPEF
IBTUB DN
ZPODFUBQBTDJFHBTDPOFTQBDJPQBSBUVCPTDPOVOEJNFUSPEF
hasta 2" (5.0 cm)
t7#45%DVFSQPOFHSPZUBQBWFSEF
t7#45%1DVFSQPOFHSPZUBQBWJPMFUBDPOBEWFSUFODJBCJMJOHFEFOPQPUBCMF
t7#45%#DVFSQPOFHSPTPMBNFOUF
t7#45%-UBQBWFSEF

Todas las cajas excepto la


Redonda de 6" (15.2 cm) se
unen de forma segura

t7#45%1-UBQBWJPMFUBDPOBEWFSUFODJBCJMJOHFEFOPQPUBCMF
t7#45%#,-UBQBOFHSB
t7#45%)DVFSQPOFHSPZUBQBWFSEFDPOQFSOPEFTFHVSJEBEEFDBCF[B
hexagonal
%JNFOTJPOFTEFFYUFOTJOFTUOEBSEF-Y"OY"M
(50.8 cm L x 37.5 cm An x 17.1 cm Al)
Parte inferior con traba para
instalaciones profundas

t7#45%&95FYUFOTJOFTUOEBSEFDPODVFSQPOFHSPZUBQBWFSEF
t7#45%&95#FYUFOTJOFTUOEBSEFDPODVFSQPOFHSPTPMBNFOUF

Idioma y smbolo
internacional de no potable

116

El uso inteligente del agua.

Accesorios

www.rainbird.com/accessories

Cajas de vlvulas

SERIE RECTANGULAR JUMBO (VB - JMB)

SERIE RECTANGULAR SUPER JUMBO (VB - SPR)

t %JNFOTJPOFT-Y"OY"M DN-YDN"OYDN"M

t %JNFOTJPOFT-Y"OY"M DN-YDN"OYDN"M

t%PTUBQBTDJFHBTHSBOEFTZDFOUSBMFTDPOFTQBDJPQBSBUVCPTDPOVOEJNFUSPEF
IBTUB DN
 -BTFYUFOTJPOFTOPUJFOFOUBQBTDJFHBT

t7#+.#DVFSQPOFHSPZUBQBWFSEF

t$BUPSDFUBQBTDJFHBTDPOFTQBDJPQBSBUVCPTDPOVOEJNFUSPEFIBTUB DN

t*ODMVZFEPTQFSOPTZBCSB[BEFSBTEFBDFSPJOPYJEBCMFRVFBKVTUBOMBUBQBBMDVFSQPEF
forma segura

t7#+.#1DVFSQPOFHSPZUBQBWJPMFUBDPOBEWFSUFODJBCJMJOHFEFOPQPUBCMF

t7#413)DVFSQPOFHSPZUBQBWFSEFDPOQFSOPTEFTFHVSJEBEEFDBCF[BIFYBHPOBM

t7#+.##DVFSQPOFHSPTPMBNFOUF

t7#413-UBQBWFSEF

t7#+.#-UBQBWFSEF

t7#4131-UBQBWJPMFUB"EFDVBEBTPMPQBSBDBKBTEFWMWVMBT7#413DPOMBT
dimensiones siguientes: 33.1" L x 23.8" An x 15.0" Al (84.1 cm L x 60.5 cm An x
38.1 cm Al)

t7#+.#1-UBQBWJPMFUBDPOBEWFSUFODJBCJMJOHFEFOPQPUBCMF
t7#+.##,-UBQBOFHSB
t7#+.#)DVFSQPOFHSPZUBQBWFSEFDPOQFSOPEFTFHVSJEBEEFDBCF[B
hexagonal

SERIE RECTANGULAR MAXI JUMBO (VB - MAX)


t %JNFOTJPOFT-Y"OY"M DN-YDN"OYDN"M

t %JNFOTJPOFTEFFYUFOTJO+VNCPEF-Y"OY"M
(62.0 cm L x 45.5 cm An x 17.1 cm Al)
t7#+.#&95FYUFOTJO+VNCPEFDPODVFSQPOFHSPZUBQBWFSEF
t7#+.#&95#FYUFOTJO+VNCPEFDPODVFSQPOFHSPTPMBNFOUF

t%JFDJPDIPUBQBTDJFHBTDPOFTQBDJPQBSBUVCPTDPOVOEJNFUSPEFIBTUB DN

t*ODMVZFEPTQFSOPTZBCSB[BEFSBTEFBDFSPJOPYJEBCMFRVFBKVTUBOMBUBQBBMDVFSQPEF
forma segura
t7#."9)DVFSQPOFHSPZUBQBWFSEFDPOQFSOPTEFTFHVSJEBEEFDBCF[B
hexagonal
t7#."9-UBQBWFSEF
t7#."91-UBQBWJPMFUB"EFDVBEBTPMPQBSBDBKBTEFWMWVMBT7#."9DPOMBT
dimensiones siguientes: 40.3" L x 27.1" An x 18.0" Al (102.4 cm L x 68.8 cm An x
45.7 cm Al)

Accesorios

t7#."9#DVFSQPOFHSPTPMBNFOUF

VB-SPR-PL

VB-MAX-PL

VB-STD

VB-10RND

VB-JMB

VB-7RND

El uso inteligente del agua.

VB-6RND

VB-SPR

VB-STD-6
6EXT

VB-MAX

Tapas de cajas de vlvulas: verde,


violeta (para indicar agua no
potable), negro

117

Accesorios
Cajas de vlvulas Serie VB, vlvulas de drenaje

Cajas de vlvulas Serie VB (cont.)


SERIE REDONDA DE 10" (25.4 cm) (VB-10RND)

SERIE REDONDA DE 6" (15.2 cm) (VB-6RND)

t %JNFOTJPOFTEJNTVQY"MYEJNJOG
(26.0 cm x 25.4 cm x 34.9 cm)

t %JNFOTJPOFTEJNTVQY"MYEJNJOG DNYDNYDN

t$VBUSPUBQBTDJFHBTJHVBMNFOUFFTQBDJBEBTDPOFTQBDJPQBSBUVCPTDPOVO
dimetro de hasta 2" (5.0 cm). (Las extensiones no tienen tapas ciegas)

t%PTBCFSUVSBTMBUFSBMFTQSFNPMEFBEBTDPOFTQBDJPQBSBUVCPTDPOVOEJNFUSPEF
hasta 2" (5.0 cm)
t7#3/%DVFSQPWFSEFZUBQBWFSEF

t7#3/%DVFSQPOFHSPZUBQBWFSEF

RESISTENTE AL VANDALISMO

t7#3/%#DVFSQPOFHSPTPMBNFOUF

SISTEMAS DE SEGURIDAD

t7#3/%-UBQBWFSEF

t7#-0$,)QFSOPEFDBCF[BIFYBHPOBMEF38" x 214" (1.0 x 5.7 cm), rondana y


abrazadera

t7#3/%1-UBQBWJPMFUBDPOBEWFSUFODJBCJMJOHFEFOPQPUBCMF
t7#3/%#,-UBQBOFHSB
t7#3/%)DVFSQPOFHSPZUBQBWFSEFDPOQFSOPEFTFHVSJEBEEFDBCF[B
hexagonal

t7#-0$,1QFSOPEFDBCF[BQFOUBHPOBMEF38" x 214" (1.0 x 5.7 cm), rondana y


abrazadera

SERIE REDONDA DE 7" (17.8 cm) (VB-7RND)


t %JNFOTJPOFTEJNTVQY"MYEJNJOG
(16.3 cm x 22.9 cm x 24.9 cm)
t%PTBCFSUVSBTMBUFSBMFTQSFNPMEFBEBTDPOFTQBDJPQBSBUVCPTDPOVOEJNFUSPEF
hasta 2" (5.0 cm)
t7#3/%DVFSQPOFHSPZUBQBWFSEF
t7#3/%1DVFSQPOFHSPZUBQBWJPMFUB
t7#3/%#,DVFSQPOFHSPZUBQBOFHSB

Accesorios

Tapas para cajas de


vlvulas color violeta para
identificar sistemas de
riego de agua no potable

16A-FDV / 16A-FDV-075

Especificaciones

Las vlvulas de drenaje vacan las lneas laterales despus de cada ciclo de
riego para reducir el dao ocasionado por las temperaturas bajo cero

t1SFTJOIBTUBQTJ CBSFT

t$BVEBMOEJDFNYJNPEFHNQ N3/h; 0.06 l/s) antes del sellado

Caractersticas y beneficios

t1SFTJOEFBQFSUVSBQSPNFEJPDVBOEPFTUJOTUBMBEBWFSUJDBMNFOUFQTJ
(0.2 bares)

t7BDBMBTMOFBTEFBHVBFOGPSNBBVUPNUJDBQBSBFWJUBSFMDPOHFMBNJFOUP
t$VCJFSUBTEFQMTUJDPQFSGPSBEBTRVFFMJNJOBOMBTQBSUDVMBTHSBOEFT

t1SFTJOEFDJFSSFQSPNFEJPDVBOEPFTUJOTUBMBEBWFSUJDBMNFOUFQTJ
(0.4 bares)

t"MNPIBEJMMBEFEJTQFSTJORVFGJMUSBMBTQBSUDVMBTQFRVFBT

t%JNFUSP DN
-POHJUVE DN

Modelos
t"'%7FOUSBEBNBDIPSPTDBEBEF DN
 

t"'%7FOUSBEBNBDIPSPTDBEBEF DN
 

16A-FDV

118

El uso inteligente del agua.

www.rainbird.com/controllers

Impactos

Rotores

Boquillas aspersoras

Cuerpos de
aspersores

Introduccin

Controladores

Accesorios

Vlvulas

El ESP-Me es una adquisicin importante para la


familia de controladores de riego de Rain Bird. Una
mayor capacidad de expansin de estaciones
permite mayor flexibilidad al elegir un controlador
para sistemas residenciales ms grandes o sistemas
comerciales ms pequeos. La programacin de este
controlador no es ms complicada que la del ESPModular. Todas las funciones son fciles de encontrar y
comprender. La actualizacin de Smart Panel tambin
puede ser una buena opcin para las necesidades de
conservacin del agua.

Programadores

Michael Thompson,
Contratista certificado de sistemas de riego

Xerigation

Sistemas de control
centralizado

Gerente de servicio de riego


Michael Hatcher & Associates
Memphis, TN

optimizar realizando ajustes diarios de los


horarios de riego para ajustarlo de forma
adecuada, segn las condiciones
NFUFPSPMHJDBTEFMNPNFOUP5PEPTMPT
controladores de la serie ESP-LX pueden
actualizarse fcilmente para que incluyan
la funcin inteligente de control de riego
por evapotranspiracin basada en
condiciones meteorolgicas o en la
humedad del suelo agregando el
DBSUVDIP&5.BOBHFSEF3BJO#JSE

t 5PEPTMPTDPOUSPMBEPSFT3BJO#JSETJNQMJGJDBO
la conservacin por medio de una variedad
de funciones flexibles de programacin. Con
solo presionar un botn, el controlador ESPMe puede restaurar un horario de riego
previamente guardado del programa
i$POUSBDUPS%FGBVMUw QSFEFUFSNJOBEPQPSFM
contratista), y la funcin de Restauracin con
retraso programable del controlador serie
ESP-LX permite volver automticamente a
los horarios de riego tpicos despus de un
perodo de tiempo configurado por el
usuario

Drenaje

t El ahorro de agua tambin se puede

Referencia

Adjust) est disponible en todos los


controladores de Rain Bird que funcionan
con corriente alterna, para que los
usuarios puedan ajustar fcilmente los
horarios de riego segn los cambiantes
requisitos del riego paisajstico por
temporada. Los controladores de la serie
ESP-LX tambin cuentan con una funcin
de ajuste estacional mensual automtico
que contribuye al ahorro de agua por
medio de ajustes automticos que se
realizan todos los meses del ao.

Recursos

t La funcin de ajuste estacional (Seasonal

Bombas

Sugerencias para ahorrar agua

El uso inteligente del agua.

119

Controladores
Productos principales

Productos principales
Aplicaciones primarias

ESP-RZX

Programadores

O
Uso residencial
Uso comercial liviano
Uso comercial/industrial
Tipo de controlador
O
Hbrido
%FFTUBEPTMJEP
Controlado con pilas
O
Ubicacin interior
O
Ubicacin exterior
Caractersticas
Estaciones (mximo)
8
Programas (mximo)
8
Cronometraje de las estaciones (mximo)
240 min
Nmero de arranques por programa (mximo)
48
O
Proteccin contra descargas
O
230 VCA opcional
O
Arranque de vlvula maestra/bomba
O
Water Budgeting (control del porcentaje de riego)
O
Interruptor de programas/zonas individuales
Retraso de riego por lluvia
O
Programable con pila
O
5FSNJOBMFTEFTFOTPSFT JOEJDBEPSEFFTUBEPZBOVMBDJO
Retraso de tiempo entre estaciones (mximo)
O
%FUFDDJOEFDBVEBM
Operacin simultnea de varias estaciones
Sistema Cycle + Soak (de ciclo/remojo)
Programas superpuestos
O
Encendido y apagado manual
O
Compatible con control remoto
Pruebas de diagnstico
O
%JBHOTUJDPEFDPSUBDJSDVJUPT
Programacin fuera de caja de vlvulas
Sumergible (mximo)
Resistente al vandalismo y a los golpes
Solenoide de limpieza automtica
Indicador de pila baja
Guardar / restaurar programas
Encendido/apagado de vlvula maestra por estacin
Calculador de tiempo total de riego por programa
O
Invalidacin del sensor de lluvia por estacin
Horario de programacin
O
7 das a la semana
Ciclos fijos de 2, 3 o 5 das
Ciclos variables de 1 a 7 das
O
Ciclos variables de 1 a 31 das
Ciclos variables de 1 a 99 das
O
Ciclos de das pares/impares
%BTJNQBSFTFYDFQUPFMEBEFDBEBNFT
O
365 das del ao
Apagado por da de evento
Compatibilidad con el sistema de control centralizado
Se puede actualizar a Maxicom2 y SiteControl
4FQVFEFBDUVBMJ[BSB*2
Gabinete
O
Para interior, de plstico
O
Para exterior, de plstico
Para exterior, de metal con recubrimiento de pintura en polvo
Pedestal de acero inoxidable
Pedestal de metal con recubrimiento de pintura en polvo
Tornillera/Accesorios
%FDPEJGJDBEPSFTEFEPTIJMPTZBDDFTPSJPT
O
Sensor de lluvia
Sensor de caudal
BSUVDIP&5.BOBHFS
1 Con la funcin de control del porcentaje de riego, se puede extender el cronometraje

120

Modular ESP

ESP-Me

ESP-SMT

ESP-LXME

ESP-LXMEF

ESP-LXD

TBOS

O
O
O

13
3
6 h1
4

22
4
6 h1
6

13
13
en base al clima
/%

48
4
12 h1
8

48
4
12 h1
8

200
4
12 h1
8

O

O2

O2

O2

O
O

O6
O

O6
O

O6
O

9h

9h

9h

0 - 10 min.

0 - 10 min.

0 - 10 min.

4
3
12 h
8

3.3 pies (1 m)
O
O
O

O
O

O
O

O
O

O
O

O
O

2 Programable por estacin

3 No compatible con los controladores Rain Bird a control remoto

4 Se puede seleccionar para cada programa y por mes

El uso inteligente del agua.

Controladores

www.rainbird.com/controllers

$POUSPMBEPSTFSJF&413;9

Controlador serie ESP-RZX

NUEVO

Controlador para interiores o exteriores de 4, 6, 8 estaciones


fijas de nivel contratista para uso residencial

Especificaciones de operacin
t5JFNQPTEFFTUBDJOBNJO
t"KVTUFFTUBDJPOBMB 
t1SPHSBNBDJOJOEFQFOEJFOUFQPS[POB

Q Las funciones de programacin flexibles hacen que el controlador sea ideal


para una amplia variedad de aplicaciones, entre las que se incluyen los
sistemas de riego residenciales y comerciales sencillos

tIPSBSJPTEFJOJDJPQPS[POB
t-PTDJDMPTEFEBEFMQSPHSBNBTPOEBTEFMBTFNBOBQFSTPOBMJ[BEPT JNQBSFT 
pares y fechas cclicas

Q La programacin basada en zonas permite que cada vlvula se programe


de forma independiente; y hace innecesaria la explicacin al usuario final
de cmo "programar", lo que elimina prcticamente todas las llamadas de
servicio tcnico

Especificaciones elctricas

Q -BHSBOQBOUBMMB-$%NVFTUSBUPEBTMBTQSPHSBNBDJPOFTQBSBDBEB[POBBM
mismo tiempo

t&OUSBEBSFRVFSJEB7$" )[
modelos internacionales: 230 VCA 10%, 50 Hz

Caractersticas

t3FTQBMEPEFFOFSHBQJMBT"""NBOUJFOFOMBGFDIBZMBIPSB NJFOUSBTRVF
la memoria no voltil mantiene la programacin

t;POB1"35*$6-"3NBOFKBEBFOGPSNBNBOVBM
t50%"4MBT[POBTNBOFKBEBTFOGPSNBNBOVBM

t4BMJEB7$"N"

t3FRVJFSFOJDBNFOUFEPTUPSOJMMPTEFNPOUBKF
t6OBHVBQBSBDPOEVDUPTEFiPwQFSNJUFMBJOTUBMBDJOQSPGFTJPOBMEF
cables de terreno en la caja
t(SBOQBOUBMMB-$%DPOJOUFSGB[EFVTVBSJPEFGDJMOBWFHBDJO
t&OUSBEBEFTFOTPSNFUFPSPMHJDPDPOJOWBMJEBDJO
t$JSDVJUPEFJOJDJPEFWMWVMBNBFTUSBCPNCB
t.FNPSJBEFQSPHSBNBOPWPMUJM BPT

t1SPHSBNBCMFDPOBMJNFOUBDJOBQJMB

Funciones de programacin
t1SPHSBNBDJOCBTBEBFO[POBTQFSNJUFUFOFSQSPHSBNBTJOEFQFOEJFOUFT
asignados para cada zona. (Los tiempos el funcionamiento, horarios de inicio
y das de riego se personalizan para cada zona)
t$POUSBDUPS3BQJE1SPHSBNNJOHDPQJBBVUPNUJDBNFOUFMPTIPSBSJPT
de inicio y los das de riego de la zona 1 al resto de las zonas durante la
configuracin inicial
tIPSBSJPTEFJOJDJPJOEFQFOEJFOUFTQPS[POB
tPQDJPOFTEFEBTEFSJFHPQPS[POB%BTQFSTPOBMJ[BEPTFOMBTFNBOB EBT
IMPARES del calendario, das PARES del calendario, cclico (cada 1 14 das)

Certificaciones
t6- D6- $& $5JDL '$$1BSUF *OEVTUSZ$BOBEB*$&4 *3".4.BSL *OEJB
452$ *TSBFM 4** 4"4""SBCJB4BVEJUB 4"#44VEGSJDB

Dimensiones
t"ODIPDN QVMH

t"MUVSBDN QVMH

t'POEPDN QVMH

Modelos
Modelos para interiores

Modelos para exteriores

t3;9J7FTUBDJPOFT 7

t3;97FTUBDJPOFT 7

t3;9J7FTUBDJPOFT 7

t3;97FTUBDJPOFT 7

t3;9J7FTUBDJPOFT 7

t3;97FTUBDJPOFT 7

t3;9J7FTUBDJPOFT 7

t3;97FTUBDJPOFT 7

t3;9J7FTUBDJPOFT 7

t3;97FTUBDJPOFT 7

t3;9J7FTUBDJPOFT 7

t3;97FTUBDJPOFT 7

Modelos para interiores


en Argentina

Modelos para exteriores


en Australia

t3;9J"3(FTUBDJPOFT 7

t3;9"64FTUBDJPOFT "64

t3JFHVFNBOVBMNFOUF50%"4MBT[POBTP6/"40-"TFHOMBEFNBOEB

t3;9J"3(FTUBDJPOFT 7

t3;9"64FTUBDJPOFT "64

Funciones avanzadas

t3;9J"3(FTUBDJPOFT 7

t3;9"64FTUBDJPOFT "64

t$PSUBDJSDVJUPTFMFDUSOJDPEFEJBHOTUJDPT
t$POUSBDUPS3BQJE1SPHSBNNJOHZi$PQJBSMB[POBQSFWJBwQFSNJUFOVOB
configuracin inicial ms rpida
t(VBSEBSSFTUBVSBSQSPHSBNBEF$POUSBDUPS%FGBVMU
t*OWBMJEBDJOEFMTFOTPSEFMMVWJB

Hardware del controlador


t$BKBEFQMTUJDPQBSBNPOUBSFOMBQBSFE
t6OJEBEFTEF VFTUBDJPOFT
tQJMBT"""QBSBSFTQBMEPEFMBGFDIBZMBIPSB JODMVJEBT

ESP-RZX para
interiores

El uso inteligente del agua.

121

Programadores

t-BTFODJMMBJOUFSGB[EFVTVBSJPFTGDJMEFFYQMJDBSZNVFTUSBMBGVODJOEFDBEB
controlador en una sola pantalla

Controladores
Serie ESP-Me

Controladores de la serie ESP-Me

NUEVO

El controlador modular favorito de Amrica, el ESP-Modular, tiene un


diseo completamente nuevo y un conjunto de funciones mejorado
para ofrecer a los contratistas la solucin de controladores de riego ms
flexible de la industria. El controlador ESP-Me admite hasta 22 estaciones, 4
programas y 6 horarios de inicio.

Q Capacidad para 4 a 22 estaciones


Q La fijacin de horarios segn programa permite que haya 4 programas
individuales con 6 horarios de inicio independientes por programa para 24
horarios de inicio en total

Q %JBHOTUJDPBWBO[BEPZEFUFDDJODPSUBDPOBMFSUB-&%
Q Calculador de tiempo total de riego por programa

Especificaciones elctricas
t&OUSBEBSFRVFSJEB7$" )[
(modelos internacionales: 230/240 VCA 10%, 50/60 Hz)
t7MWVMBNBFTUSB3FMEFBSSBORVFEFCPNCBT
t7PMUBKFPQFSBUJWP7$")[
t&OUSBEBEFCPCJOBNY7"
t3FUFODJOEFCPCJOBNY7"
- Consumo de energa cuando est inactivo/apagado: 0.06 A a 120 VCA
t/PTFSFRVJFSFSFTQBMEPEFFOFSHB-BNFNPSJBOPWPMUJMHVBSEB
permanentemente la programacin actual y una batera de litio con vida
til de 10 aos mantiene la fecha y la hora de los controladores durante los
cortes de energa.

Certificaciones

Caractersticas

t6- D6- $& $4" $5JDL '$$1BSUFC 8&&& 4.BSL *1

t(SBOQBOUBMMB-$%DPOJOUFSGB[EFVTVBSJPEFGDJMOBWFHBDJO

Dimensiones

t&OUSBEBEFTFOTPSEFMMVWJBDPODBQBDJEBEEFJOWBMJEBDJO
t$JSDVJUPEFJOJDJPEFWMWVMBNBFTUSBCPNCB

t"ODIP4%4R (27.2 cm)

t.FNPSJBEFBMNBDFOBNJFOUPOPWPMUJM BPT

t"MUVSB4%4R (19.5 cm)

t1SPHSBNBCMFEFGPSNBSFNPUBDPOCBUFSBEF7 OPJODMVJEB

t1SPGVOEJEBE4%4R (11.2 cm)

t0QDJPOFTEFQSPHSBNBDJOEFSJFHP4FHOMPTEBTEFMBTFNBOB EBT
IMPARES del calendario, das PARES del calendario, cclico (cada 1 30 das)
t(VBSEBSSFTUBVSBSQSPHSBNBTHVBSEBEPTEF$POUSBDUPS%FGBVMU
t*OWBMJEBDJOEFMTFOTPSEFMMVWJBQPSFTUBDJO
t$BMDVMBEPSEFUJFNQPUPUBMEFSJFHPQPSQSPHSBNB
t3JFHPNBOVBMDPOVOTPMPCPUO
Programadores

t3FUSBTFFMSJFHPIBTUBQPSEBT TFBQMJDBOJDBNFOUFBMBTFTUBDJPOFTRVF
no estn configuradas para ignorar el sensor de lluvia)
t0QDJOEFSJFHPNBOVBMQPSQSPHSBNBPFTUBDJO

Modelos en Norteamrica (120 VCA)


t.PEFMPTCBTFEFMDPOUSPMBEPS
- ESP4MEI: modelo para interiores de 4 estaciones
 &41.&NPEFMPQBSBFYUFSJPSFTEFFTUBDJPOFT
t.EVMPT
- ESPSM3: mdulo de 3 estaciones
- ESPSM6: mdulo de 6 estaciones (compatible nicamente con los
controladores de la serie ESP-Me)

t"KVTUFFTUBDJPOBMBQMJDBEPBUPEPTMPTQSPHSBNBTPBQSPHSBNBTQBSUJDVMBSFT

Accesorios

t5JFNQPEFFTQFSBBKVTUBCMFFOUSFMBTWMWVMBT FMWBMPSQSFEFUFSNJOBEPFT

t$"#-&'-&9*#-&%&$0/&9*/: cable flexible de conexin aprobado por UL

t&ODFOEJEPBQBHBEPEFWMWVMBNBFTUSBQPSFTUBDJO
*Tambin disponible en modelos de 230 VCA y 240 VCA

Especificaciones de operacin
t$SPOPNFUSBKFEFFTUBDJPOFT%FNJOVUPBIPSBT
t"KVTUFFTUBDJPOBMB
t5FNQFSBUVSBPQFSBUJWBNY '

Controlador y mdulos
de la serie ESP-Me

La funcin de calculador de tiempo total de funcionamiento ESP-Me le dice cul es el tiempo total de riego por programa para cumplir con
cualquier restriccin de riego para ahorro de agua, al permitir que el tiempo total de funcionamiento se determine antes del riego.

122

El uso inteligente del agua.

Controladores

www.rainbird.com/controllers

Serie modular ESP

Controlador para interiores o exteriores de 4 a 13 estaciones para uso


residencial y comercial pequeo

Q Modularidad: empieza con el controlador base de 4 estaciones y


se expande fcilmente a 13. Minimiza el inventario y mantiene siempre a
mano el conteo correcto de las estaciones

Q Calidad: confiabilidad incorporada; diseado con partes duraderas, mayor


proteccin contra descargas y tolerancia a temperaturas elevadas

Q Programacin estilo ESP fcil de usar: sencillo de configurar,


con prueba de horario y aprobado para uso domstico, para que usted
pueda continuar con su labor ms rpido que nunca

Caractersticas
t&MQSPHSBNB$POUSBDUPS%FGBVMU (predeterminado por el contratista) le
permite al contratista guardar su propio programa predeterminado y
recuperarlo con solo presionar un botn. Apto para recargar fcilmente un
horario que ha sido alterado por un usuario o para reemplazar un horario
temporal para nuevas semillas o csped
t-B"VYJMJBSZ4UBUJPO (estacin 13) puede configurarse para derivar un sensor
activo para permitir el riego aunque las estaciones estn deshabilitadas o
pueden establecerse como una estacin normal. Ideal para riego de patios
cubiertos o sistemas que no requieren riego como iluminacin de paisajismo
o fuentes
t%BQSPHSBNBCMFTJOSJFHPRVFQFSNJUFBMVTVBSJPDPOGJHVSBSDVBMRVJFSEBEF
la semana como da sin riego en cualquier programa u horario, facilitando el
cumplimiento de las restricciones de riego y dems requisitos, tales como el
cuidado o mantenimiento semanal del csped
t(MPCBMTFBTPOBMBEKVTU BKVTUFHMPCBMQPSUFNQPSBEB
 EFB
RVF
permite al usuario alterar el tiempo de riego de todas las vlvulas de cada
programa para satisfacer las necesidades cambiantes de cada temporada
t5FSNJOBMFTEFTFOTPSFTEFEJDBEPTRVFQFSNJUFOBMVTVBSJP
conectar fcilmente un sensor al controlador para lograr la mxima eficiencia
EFSJFHP6OBMV[ -&%
ZVONFOTBKFFOMBQBOUBMMBEFDSJTUBMMRVJEPJOEJDBO
cundo un sensor est activo
t*OUFSSVQUPSEFCZQBTTEFMTFOTPSRVFQFSNJUFBMVTVBSJPBOVMBSVOTFOTPS
activo
t$JSDVJUPEFBSSBORVFEFWMWVMBNBFTUSBCPNCB QSPHSBNBCMFQPSFTUBDJO 
que permite el funcionamiento de la bomba conectada, segn sea necesario
t3FUSBTPEFUJFNQPFOUSFFTUBDJPOFTRVFQSPWFFUJFNQPBEJDJPOBMFOUSF[POBT
para la recuperacin de agua de pozo o el cierre lento de las vlvulas
t-BGVODJO&OIBODFE%JBHOPTUJD'FFECBDL (Reaccin de diagnstico
mejorado) avisa al usuario cul es el problema cuando el riego se suspende
a causa de un sensor activado, estaciones en cortocircuito o errores de
programacin con una luz de advertencia y un mensaje en la pantalla de
cristal lquido
t%JBHOTUJDPEFDPSUBDJSDVJUPTTJOGVTJCMFTRVFJEFOUJGJDBVOBFTUBDJODPO
problemas en las vlvulas o en el cableado y contina con el riego de las
estaciones que estn en funcionamiento
t5FSNJOBMEFQSVFCBQBSBMBWMWVMBRVFQFSNJUFBMJOTUBMBEPSQSPCBSMPT
cables de la vlvula durante la instalacin, a fin de determinar a qu vlvula
est conectado cada cable
t$BMFOEBSJPEFEBTRVFDPOUFNQMBBPTCJTJFTUPTZHBSBOUJ[BFMSJFHP
exacto en das pares e impares
t.FNPSJBOPWPMUJMRVFNBOUJFOFFMIPSBSJPEFSJFHPJOEFGJOJEBNFOUF
durante un corte de energa

t1JMBEFMJUJPEFBPTEFEVSBDJORVFNBOUJFOFMBGFDIBZIPSBEVSBOUFVOB
vida acumulada de cinco aos durante los cortes de energa

Especificaciones de operacin
t$BOUJEBEEFQSPHSBNBTJOEFQFOEJFOUFT
t"SSBORVFTBVUPNUJDPTQPSQSPHSBNB FOUPUBM
t$SPOPNFUSBKFEFFTUBDJPOFTBIPSBTQBSBUPEBTMBTFTUBDJPOFT
t)PSBSJPTEFQSPHSBNBDJOJOEFQFOEJFOUFT
- personalizado (riego por da de la semana)
- Impar (riego en los das impares excepto el da 31 y el 29 de febrero si es
ao bisiesto)
- Par (riego en los das pares del mes)
- Cclico (de 1 a 31 das: riego entre una vez al da y una vez cada 31 das)

Especificaciones elctricas
t&OUSBEBSFRVFSJEB7$" )[7$" )[7$"
10%, 50 Hz
t4BMJEB7$""
t4PQPSUFEF7.3FMEFJOJDJPEFCPNCBT#PCJOBNYFO7"Z#PCJOBNY
mantiene 5VA
t1SPUFDDJODPOUSBEFTDBSHBT-BFOUSBEBQSJODJQBMUJFOFEPTWBSJTUPSFTEF
xido metlico (MOV, por sus siglas en ingls) incorporados para proteger
los circuitos. La salida tiene 2 varistores de xido metlico incorporados para
cada estacin de vlvulas
t3FTQBMEPEFFOFSHB1JMBEFCPUOEFMJUJPRVFNBOUJFOFMBIPSBZMBGFDIB 
mientras que la memoria no voltil mantiene la programacin
t$BQBDJEBEEFFTUBDJOEFWMWVMBTNMUJQMFT)BTUBEPTWMWVMBTTPMFOPJEFT
de 24 VCA, 7 VA por estacin, ms una vlvula maestra

Dimensiones
t"ODIP DN
"MUVSB DN
'POEP DN

Modelos en Norteamrica (120 VCA)

Programadores

Serie modular ESP

t.PEFMPTCBTFEFMDPOUSPMBEPS
- ESP-4Mi: modelo para interiores de 4 estaciones
- ESP-4M: modelo para exteriores de 4 estaciones
t.EVMPT
- ESPSM3: mdulo de expansin de 3 estaciones

Accesorios
t$"#-&'-&9*#-&%&$0/&9*/: cable flexible de conexin aprobado por UL

Modular ESP

5SFTQSPHSBNBTJOEFQFOEJFOUFTDPOUSJCVZFOBMBIPSSPEFBHVB MPDVBMQFSNJUFVOBGDJMQSPHSBNBDJOEFIPSBSJPTEFSJFHPOJDPTQBSBEJWFSTBT
aplicaciones paisajsticas.

El uso inteligente del agua.

123

Controladores
4JTUFNBEFDPOUSPMNPEVMBSJOUFMJHFOUF&414.5

Caractersticas

Sistema de control modular


inteligente ESP-SMT

t1SPQPSDJPOBHFOFSBMNFOUFVOBIPSSPEFBHVBEFMBMNTRVFMPT
controladores tradicionales basados en la hora

Sistema de control modular inteligente de 4 a 13 estaciones


para uso residencial y comercial liviano
&M&414.5JOUFHSBUFDOPMPHBVTBEBQPSMPTNFKPSFTDBNQPTEFHPMGEVSBOUF
dcadas y la agrupa en un controlador fcil de usar

Q &M&414.5FTFMQSJNFSDPOUSPMBEPSEFVOGBCSJDBOUFEFVOBMOFB
completa de riego que obtiene la etiqueta WaterSense de la Environmental
Protection Agency (EPA, Agencia de Proteccin Ambiental)

Q %BUPTEFQSFDJQJUBDJPOFTFOFMTJUJPFM&414.5SFDPHFMBJOGPSNBDJOEF
las cantidades de precipitaciones en el sitio y usa esta informacin para
recalcular el tiempo funcionamiento de cada zona

Q %BUPTNFUFPSPMHJDPTIJTUSJDPTMBNFNPSJBJOUFSOBEFM&414.5DPOUJFOF
ms de 8 aos de datos meteorolgicos histricos. Estos datos, junto con
la informacin de precipitaciones y temperatura se utilizan para ajustar los
tiempos de funcionamiento de riego a diario.

Q 3FEVDDJOEFMBFTDPSSFOUBMBGVODJO&414.5$ZDMFBOE4PBLQFSNJUF
al controlador ajustar los tiempos de funcionamiento de la zona segn las
condiciones del suelo y la inclinacin para reducir/eliminar la escorrenta
de agua

El dial de diez posiciones


simplifica la programacin

Las posiciones de configuracin


codificadas por color promueven
la facilidad de uso

t&M&414.5BIPSSBBHVBBMIBDFSBKVTUFTFOUJFNQPSFBMEFMQSPHSBNBEF
SJFHPTPCSFMBBTFEFVOWBMPSEFFWBQPUSBOTQJSBDJO &5
EFSFGFSFODJBRVF
se determina mediante los parmetros meteorolgicos recolectados por el
sensor meteorolgico en el sitio
t&MTFOTPSEFMMVWJBEFMCBMEFNJEFMBDBOUJEBEEFMMVWJBDBEBZFMUJFNQPEF
duracin de la lluvia para registrar la lluvia utilizable y evitar el riego excesivo
t&MFRVJMJCSJPEFIVNFEBEEFMTVFMPEFDBEB[POBTFNBOUJFOFFOFMOJWFM
ptimo usando el mtodo comprobado de programacin de riego de
NYJNPDPOTVNPQFSNJUJEP ."% QPSMBTTJHMBTFOJOHMT

t&MQFSPEPEFDSFDJNJFOUPQPSTFQBSBEPQFSNJUFBMVTVBSJPDPOGJHVSBSVO
programa inicial por horarios para establecer las plantas para una cantidad
de das preestablecidos. Una vez que termina este perodo, la zona vuelve
automticamente a una programacin basada en el clima
t-BTVTQFOTJOEFMBMMVWJBFTUBDUJWBEBDVBOEPFMCBMEFEFNFEJDJOEFMMVWJB
ha alcanzado el umbral de lluvia establecido por el usuario, lo que evita el
riego durante la lluvia
t&MQSPHSBNBBVUPNUJDP$ZDMFBOE4PBLEFUFSNJOBEPQPSFMUJQPEFTVFMPZ
el grado de inclinacin evita la escorrenta de la superficie

La pantalla grande con


iluminacin de fondo
permite su lectura fcil

Programadores

El programa
predeterminado
por el
contratista que
ahorra tiempo
almacena y
recupera los
ajustes deseados

ESP-SMT con 3 mdulos de


expansin instalados para
13 estaciones en total
Botones de navegacin
convenientes que
permiten una
programacin rpida
y sencilla

El cable de
comunicacin
conecta el panel y
el sensor a travs
de terminales de
conexin rpida

Los botones en
ingls y espaol
ofrecen cambio
de idioma con
un solo toque

El soporte de montaje
ajustable y resistente
permite una nivelacin
sencilla

Texto en ingls

Texto en espaol

El diseo ergonmico
permite la programacin
remota
Malla extrable
para impedir el
paso de basura

El protector solar
resguarda el sensor de
temperatura del calor
reflexivo

Mdulos de expansin
de 3 estaciones
sustituibles en caliente

El contenedor removible
mide los niveles de
precipitacin y brinda la
funcin de interruptor
por lluvia

La funcin de
madurez de la
planta asegura
el riego efectivo
de la vegetacin
establecida y
recientemente
plantada

La etiqueta WaterSense de la EPA certifica que este controlador es cuando menos un 20% ms eficiente que otros controladores, sin sacrificar
el rendimiento.

124

El uso inteligente del agua.

Controladores

www.rainbird.com/controllers

4JTUFNBEFDPOUSPMNPEVMBSJOUFMJHFOUF&414.5

t&MQSPHSBNB$POUSBDUPS%FGBVMUQFSNJUFRVFFMDPOUSBUJTUBHVBSEFFM
programa predeterminado en la memoria del controlador y este se recupera
fcilmente con solo tocar un botn si el propietario ha alterado el programa
original del contratista

Especificaciones elctricas

t%BPTZSFTQPOTBCJMJEBESFEVDJEPTEFMPTDPNQPOFOUFTEFMTJTUFNBEFSJFHP
ZBRVFFMDPOUSPMBEPS&414.5JOUFSSVNQFFMSJFHPEVSBOUFIFMBEBTFOFM
lugar

t1SPUFDDJODPOUSBEFTDBSHBT-BFOUSBEBQSJODJQBMUJFOFEPTWBSJTUPSFTEF
xido metlico (MOV, por sus siglas en ingls) incorporados para proteger
los circuitos. El costado de la salida tiene 2 varistores de xido metlico
incorporados para cada estacin de vlvulas

t1JMBEFMJUJPJOUFHSBMRVFNBOUJFOFMBGFDIBZIPSBBDUVBMFTEVSBOUFVOBWJEB
acumulada de cinco aos durante los cortes de energa
t3FUSBTPEFUJFNQPFOUSFFTUBDJPOFTRVFQSPWFFUJFNQPBEJDJPOBMFOUSF[POBT
para la recuperacin de agua de pozo o el cierre lento de las vlvulas
t$JSDVJUPEFBSSBORVFEFWMWVMBNBFTUSBCPNCB QSPHSBNBCMFQPSFTUBDJO 
que permite el funcionamiento de la bomba conectada, segn sea necesario
t$BEB[POBTFQVFEFDPOGJHVSBSQBSBSFDPOPDFSPJHOPSBSMPTBKVTUFTEFMCBMEF
de lluvia basculante. Es ideal para regar plantas que estn ubicadas en un
patio cubierto o para funciones que no necesitan riego, como la iluminacin
paisajstica

t3FTQBMEPEFFOFSHB1JMBEFCPUOEFMJUJPRVFNBOUJFOFMBIPSBZMBGFDIB 
mientras que la memoria no voltil mantiene la programacin
t$BQBDJEBEEFFTUBDJOEFWMWVMBTNMUJQMFT)BTUBEPTWMWVMBTTPMFOPJEFT
de 24 VCA, 7 VA por estacin, ms una vlvula maestra

Dimensiones
t$POUSPMBEPS
- Ancho: 10.7" (27.2 cm)
- Altura: 7.7" (19.5 cm)
- Profundidad: 4.4" (11.2 cm)
t4FOTPS(parte transversal ms larga)
- Ancho: 6.0" (15.2 cm)

t%JBHOTUJDPEFDPSUBDJSDVJUPTTJOGVTJCMFTRVFJEFOUJGJDBVOB[POBDPO
problemas de cortocircuitos en el cableado y contina con el riego de las
zonas en funcionamiento mientras identifica la zona con fallas

- Largo: 8.8" (22.4 cm)


- Altura: 5.9" (15.0 cm)

t5FSNJOBMEFQSVFCBQBSBMBWMWVMBRVFQFSNJUFBMJOTUBMBEPSQSPCBSMPTDBCMFT
de la vlvula durante la instalacin, a fin de determinar el cable de la vlvula
que corresponde a cada zona

t4PQPSUFEFNPOUBKF
- Extensin mxima: 7.0" (17.8 cm)

t4FBDUVBMJ[BGDJMNFOUFEFVONPEFMPCBTFEFFTUBDJPOFTBVOPEF
estaciones agregando mdulos de expansin de 3 estaciones sustituibles en
caliente sin desconectar la energa hacia el controlador

Modelos

t-BQBOUBMMBHSGJDBEFNBUSJ[EFQVOUPTSFUSPJMVNJOBEBFTGDJMEFMFFSFO
reas con iluminacin tenue. El texto de gran tamao facilita la lectura y
puede cambiarse de ingls a espaol con solo tocar el botn English/Spanish
(Ingls/espaol) ubicado en la parte delantera del controlador
t(BCJOFUFFTQBDJPTPEFHSBOSFTJTUFODJBDPODBKBEFFNQBMNFT NPEFMPQBSB
exteriores) que proporciona un amplio espacio para el cableado. Modelo
para exterior provisto de un gabinete con llave

t.PEFMPTEFDPOUSPMEFTJTUFNBCBTF(incluye controlador ESP-SMT y


sensor meteorolgico)
 &414.5JFTUBDJPOFT QBSBJOUFSJPSFT  7

 &414.5FTUBDJPOFT QBSBFYUFSJPSFT  7

Programadores

t-BNFNPSJBOPWPMUJMNBOUJFOFMBDPOGJHVSBDJOEFMDPOUSPMBEPSFOGPSNB
indefinida incluso durante un corte de energa prolongado

t&OUSBEBSFRVFSJEB7$"  )[


t4BMJEB7$" "

t.PEFMPQBSBBDUVBMJ[BDJO(incluye panel controlador ESP-SMT y sensor


meteorolgico)
 &414.561(LJUQBSBBDUVBMJ[BSDPOUSPMBEPSFTNPEVMBSFT&41
t.EVMPT
- ESPSM3: mdulo de expansin de 3 estaciones
* Para expandir hasta a 13 estaciones, use los mdulos de expansin de tres estaciones ESPSM3
** Aplica a los controladores ESP-M fabricados despus de abril de 2005
Nota: todos los modelos de ESP-SMT vienen con soporte ajustable resistente y 25 pies (7.62 m)
de cable de comunicacin no enterrado para montar y cablear el sensor meteorolgico

El panel del controlador se ajusta al chasis del ESP modular para actualizar fcilmente
&OTFHVOEPT BDUVBMJDFVODPOUSPMBEPS&41NPEVMBSBMTJTUFNBEFDPOUSPMJOUFMJHFOUF&414.5DPOTPMPDBNCJBSMPTQBOFMFT

El uso inteligente del agua.

125

Controladores
Controlador ESP-LXME

Controlador ESP-LXME
Controladores comerciales con capacidad de 8 a 48 estaciones

Q Simple - Programacin ESP extremadamente fcil


Q .PEVMBS'DJMNFOUFFYQBOEJCMFEFPFTUBDJPOFTBFTUBDJPOFTDPO
mdulos de 4-, 8- y 12- estaciones

Q Posibilidad de actualizacin a Controlador inteligente o Control centralizado


Caractersticas
t(SBOQBOUBMMB-$%DPOJOUFSGB[EFVTVBSJPEFGDJMOBWFHBDJOBUSBWTEF
teclas programables
t.EVMPTTVTUJUVJCMFTiFODBMJFOUFw TJOOFDFTJEBEEFBQBHBSMBBMJNFOUBDJO
del controlador para aadir/extraer mdulos
t-BOVNFSBDJOEJONJDBEFMBTFTUBDJPOFTFMJNJOBFSSPSFTFOMBOVNFSBDJO
de las estaciones
t&OUSBEBEFTFOTPSNFUFPSPMHJDPDPODPONVUBEPSEFJOWBMJEBDJO
t$JSDVJUPEFJOJDJPEFWMWVMBNBFTUSBCPNCB
tJEJPNBTTFMFDDJPOBCMFTQPSFMVTVBSJP
Controlador ESP-LXME

t.FNPSJBEFQSPHSBNBOPWPMUJM BPT

t1SPUFDDJODPOUSBTPCSFUFOTJPOFTFTUOEBSEFL7
t&MQBOFMGSPOUBMFTFYUSBCMFZQSPHSBNBCMFDPOBMJNFOUBDJOBQJMB
t4FQVFEFBDUVBMJ[BSBMDPOUSPMDFOUSBM*2W DPOTVMUFMBQHJOB

Caractersticas de administracin de agua


t'MPX4NBSU.PEVMFPQDJPOBMDPOVUJMJEBEEFBERVJTJDJOEFDBVEBMZ
totalizador de uso de caudal
Programadores

t1SPUFDDJO'MP8BUDIQBSBTJUVBDJPOFTEFBMUPZCBKPDBVEBMDPOSFBDDJPOFT
definidas por el usuario
t'MP.BOBHFSNBOFKBMBEFNBOEBIJESVMJDB IBDJFOEPVTPDPNQMFUPEFM
agua disponible para reducir el tiempo total de riego
t4JNVM4UBUJPOTQSPHSBNBCMFTQBSBQFSNJUJSFMGVODJPOBNJFOUPTJNVMUOFPEF
hasta 5 estaciones
Mdulos de 4, 8 y 12 estaciones

t4FDVFODJBEFFTUBDJPOFTQPSONFSPEFFTUBDJOPQPSQSJPSJEBEFTEF
estaciones
t*OUFSWBMPTEFSJFHPQPSQSPHSBNBFJOUFSWBMPEFSJFHPNBOVBMEFMBWMWVMB
maestra
t$ZDMF 4PBLFODBEBFTUBDJO
t3FUSBTPEFSJFHPQPSMMVWJB
t%BJOBDUJWPEFMDBMFOEBSJPEFEBT
t%FNPSBQSPHSBNBCMFEFFTUBDJPOFTQPSQSPHSBNB
t7MWVMBNBFTUSBOPSNBMNFOUFBCJFSUBPDFSSBEBQSPHSBNBCMFQPSFTUBDJO
t4FOTPSNFUFPSPMHJDPQSPHSBNBCMFQPSFTUBDJOQBSBFWJUBSPEFUFOFSFM
riego
t"KVTUFFTUBDJPOBMEFQSPHSBNB
t"KVTUFFTUBDJPOBMNFOTVBMHMPCBM

-BGVODJOEF3FTUBVSBDJODPOSFUSBTPQSPHSBNBCMF$POUSBDUPS%FGBVMU3FHSFTBEFNBOFSBBVUPNUJDBBVOQSPHSBNBOPSNBMEFSJFHP
despus de completar el riego intenso sobre semillas y csped nuevo. No requiere datos del usuario.

126

El uso inteligente del agua.

Controladores

www.rainbird.com/controllers

Controlador ESP-LXME

Funciones de diagnstico

Modelos

t-V[EFBMBSNBDPOMFOUFFOMBDBKBFYUFSOB

t.PEFMPTCBTFEFMDPOUSPMBEPS

t$PSUBDJSDVJUPTFMFDUSOJDPEFEJBHOTUJDPT

- ESP8LXME: 8 estaciones, 120 VAC

t3FTVNFOZSFWJTJOEFMQSPHSBNB

- ESP12LXME: 12 estaciones, 120 VAC

t1SPHSBNBEFQSVFCBEFWBSJBCMFT

- I8LXME: 8 estaciones, para mercados internacionales, 230 VCA

t1SVFCBEFDBCMFBEPEFFTUBDJPOFT3"45&3

- I12LXME: 12 estaciones, para mercados internacionales, 230 VCA

Especificaciones de operacin

- I8LXMEEU: 8 estaciones para Europa, 230 VCA

t$SPOPNFUSBKFEFFTUBDJPOFTEFNJOBIPSBT

- I12LXMEEU: 12 estaciones para Europa, 230 VCA

t"KVTUFFTUBDJPOBMEFB UJFNQPNYJNPEFGVODJPOBNJFOUPEFMB
estacin de 16 horas)

- I8LXMEAU: 8 estaciones para Australia, 240 VCA

t-PTQSPHSBNBT"#$%QVFEFOTVQFSQPOFSTF
tIPSBTEFJOJDJPQPSQSPHSBNB
t-PTDJDMPTEFEBEFMQSPHSBNBTPOEBTEFMBTFNBOBQFSTPOBMJ[BEPT 
impares, impares menos el 31, pares y fechas cclicas
t&TUBDJO QSPHSBNBZQSPHSBNBEFQSVFCBNBOVBMFT

Especificaciones elctricas
t&OUSBEBSFRVFSJEB7$" )[ NPEFMPTJOUFSOBDJPOBMFT7$"
10%, 50 Hz; (modelos australianos: 240 VCA 10%,50 Hz)
t4BMJEB7$""

- I12LXMEAU: 12 estaciones para Australia, 240 VCA


t.PEFMPTDPOEFUFDDJOEFDBVEBM
 &41-9.&'FTUBDJPOFT 7"$
 &41-9.&'FTUBDJPOFT 7"$
 *-9.&'FTUBDJPOFT QBSBNFSDBEPTJOUFSOBDJPOBMFT 7$"
 *-9.&'FTUBDJPOFT QBSBNFSDBEPTJOUFSOBDJPOBMFT 7$"
 *-9.&&6'FTUBDJPOFTQBSB&VSPQB 7$"
 *-9.&&6'FTUBDJPOFTQBSB&VSPQB 7$"
 *-9.&"6'FTUBDJPOFTQBSB"VTUSBMJB 7$"
 *-9.&"6'FTUBDJPOFTQBSB"VTUSBMJB 7$"

t3FTQBMEPEFFOFSHB1JMBEFCPUOEFMJUJPRVFNBOUJFOFMBIPSBZMBGFDIB 
mientras que la memoria no voltil mantiene la programacin

Mdulos

t$BQBDJEBEEFWMWVMBTNMUJQMFT6ONYJNPEFDJODPWMWVMBTTPMFOPJEFTEF
24 VCA, 7VA funcionando simultneamente incluida la vlvula maestra, dos
vlvulas solenoides por estacin como mximo

t&41-9.4..EVMPEFFTUBDJPOFT
t41-9.4..EVMPEFFTUBDJPOFT

t$FSUJGJDBDJPOFT

t'4.-9.&.EVMPEF'MVKPJOUFMJHFOUF

t&41-9.4..EVMPEFFTUBDJPOFT

Programadores

tQSPHSBNBTJOEFQFOEJFOUFT "#$%

6- D6- $& $4" $5JDL '$$1BSUF

Dimensiones
t"ODIPQVMH DN

t"MUVSBQVMHT DN

t1SPGVOEJEBEQVMH DN

Accesorios opcionales
t-*.3,JU,JUEFDPOUSPMSFNPUP-*.3QBSB$POUSPMBEPSFT3BJO#JSE
(ver pgina 133)
t-9..(BCJOFUFEFNFUBMDPOSFDVCSJNJFOUPEFQJOUVSBFOQPMWPQBSB
controlador modular ESP-LX (ver pgina 140)
t-9..1&%(BCJOFUFEFNFUBMDPOSFDVCSJNJFOUPEFQJOUVSBFOQPMWPQBSB
controlador modular ESP-LX (ver pgina 140)
t&5$-9$BSUVDIP&5.BOBHFS WFSQHJOB

t$BSUVDIPEF$PNVOJDBDJO*2 WFSQHJOB

t1BSBPCUFOFSNTJOGPSNBDJOTPCSFMPTTFOTPSFTEFDBVEBMTFSJF'4EF
Rain Bird, consulte la pgina 135

Controlador
ESP-LXME en
gabinete de metal
LXMM opcional

Pedestal de metal
LXMMPED opcional

El uso inteligente del agua.

127

Controladores
$POUSPMBEPS&41-9%DPOEFDPEJGJDBEPS

Controlador ESP-LXD con decodificador


Controlador comercial con decodificador de dos cables
con capacidad para 50 a 200 estaciones

Q Simple: utiliza la misma programacin extra simple que otros controladores


ESP-LX

Q 'MFYJCMFoGDJMNFOUFFYQBOTJCMFEFBFTUBDJPOFTDPNQBUJCMFDPO
5 vlvulas maestras, 5 sensores de caudal, 4 sensores meteorolgicos y
diversos complementos para actualizaciones

Q 5FDOPMPHBDPNQSPCBEBVUJMJ[BMPTNJTNPTEFDPEJGJDBEPSFTEFEPTIJMPT
'%563'RVFMPTQSPHSBNBEPSFT.%$Z.%$ DPONTEFNFEJPNJMMO
de decodificadores instalados en todo el mundo en los ltimos 20 aos

Q 4FQVFEFBDUVBMJ[BSBMDPOUSPMDFOUSBM*2W DPOTVMUFMBQHJOB
Caractersticas
t&41JOUVJUJWPEF3BJO#JSE 1SPHSBNBDJOFYUSBTJNQMF

- Utiliza la misma interfaz de programacin que otros programadores ESP


de Rain Bird
Controlador ESP-LXD
con decodificador

- Seis idiomas seleccionables por el usuario, que incluyen alemn, espaol,


francs, ingls, italiano y portugus
 %JBHOTUJDPTEFEPTIJMPTQBSBTJNQMJGJDBSZBHJMJ[BSMBSFTPMVDJOEF
problemas
- Cuatro programas independientes con capacidad de superposicin
t$POUSPMGMFYJCMF
- Caja espaciosa con ocho conexiones para un mximo de ocho canales de
dos cables (todos gestionados como un nico canal de dos cables)
- Caja de plstico para exteriores resistente a radiacin UV, con posibilidad
de montaje en pared

Programadores

 6UJMJ[BFMNJTNPIBSEXBSFEFEFDPEJGJDBDJORVFMPTTJTUFNBT.%$
.%$Z4JUF$POUSPM-PTEFDPEJGJDBEPSFTDPNQBUJCMFTTPO'%563' 
'%563' '%563' '%563'Z'%563' DPNPBT
UBNCJOMPTEFDPEJGJDBEPSFTEFTFOTPS4%563'ZMPTQSPUFDUPSFTEF
sobretensin de la lnea LSP-1 (consulte la pgina 130)

Mdulo
ESPLXD-SM75

- Las direcciones precodificadas del decodificador eliminan la confusin


asociada a las direcciones de decodificador definidas por el usuario; nuevo
sistema de introduccin de direcciones del decodificador por escner de
DEJHPEFCBSSBTDPOFMDBSUVDIP1#$-9%PQDJPOBM
- Los sistemas SimulStations ajustables por el usuario en los niveles
de programa y programador permiten controlar el funcionamiento
simultneo de las estaciones
- Secuencia de estaciones por nmero de estacin o por prioridad de
estacin
Mdulo
ESPLXD-M50

Cmo especificar
ESP-LXD - SM75
Controlador

Mdulos y cartuchos

&41-9%
120V Exterior

SM75: Mdulo de
expansin de 75
estaciones

*&41-9%
230V Internacional
*&41-9%&6
230V Europeo
*&41-9%"7
Australiano
240V Australiano

128

1#$-9%$BSUVDIPTEF
copia de seguridad de
programa (ver pgina
siguiente)

 &M&41-9%FTDPNQBUJCMFDPOFMDPOUSPMSFNPUP-*.3
- El programador incluye 50 estaciones; ampliable hasta 200 si se aaden
oNEVMPTEFFYQBOTJOEFFTUBDJPOFT&41-9%4. DBEBNEVMPEF
expansin de estaciones aade 75 estaciones adicionales)
t(FTUJOZBIPSSPEFMBHVB
- Cycle+Soak en cada estacin
 3FUBSEPQPSMMVWJBZ%BEFMDBMFOEBSJPTJOSJFHP
- Retardo de la estacin programable para cada programa
- Ajuste estacional mensual y a nivel de programa
- Hasta 5 inicios de bombas / vlvulas maestras programables por estacin y
adems hasta 5 sensores de caudal
- Hasta 4 sensores meteorolgicos programables por estacin

El uso inteligente del agua.

Controladores

www.rainbird.com/controllers

$POUSPMBEPS&41-9%DPOEFDPEJGJDBEPS

t(FTUJOEFDBVEBM
 'MP.BOBHFSQBSBMBHFTUJOEFMBDBQBDJEBEIJESVMJDBEFTVTJTUFNB OP
requiere sensores de caudal)
 'MP8BUDIQBSB4&&' 4FFLBOE&MJNJOBUF&YDFTTJWF'MPX EFUFDDJOZ
FMJNJOBDJOEFDBVEBMFYDFTJWP
Z4&-' 4FFLBOE&MJNJOBUF-PX'MPX 
deteccin y eliminacin de caudal bajo) para diagnstico automtico y
gestin de caudal bajo y roturas en la lnea principal
- Las funciones de aprendizaje de caudal y de caudal introducido por el
usuario son compatibles con el aprendizaje automtico y las tasas de
caudal estimadas por el usuario
- Registro de caudal para el ahorro y el control del consumo de agua
- Admite mediciones de caudal en el sistema ingls (GPM) y mtrico (LPM,
LPS, M3/seg.)

Dimensiones, especificaciones elctricas y certificaciones


t%JNFOTJPOFT "OY"MY'
wYwYw YYDN

t7PMUBKFEFFOUSBEBSFRVFSJEP7$"  )[NPEFMPT


internacionales 230 VCA +/- 10%, 50 Hz; modelos australianos 240 VCA +/10%, 50 Hz
t$FSUJGJDBDJPOFT6- $& $6- $5JDL
t6OBCBUFSBEFMJUJPUJQPCPUOZVOBNFNPSJBOPWPMUJMNBOUJFOFOMBGFDIB 
la hora y la programacin
t$BQBDJEBEQBSBWMWVMBTNMUJQMFTIBTUBWMWVMBTEFMTPMFOPJEFQPS
FTUBDJO TFSFRVJFSFOEFDPEJGJDBEPSFT'%P'%
DPOGVODJPOBNJFOUP
simultneo ajustable por el usuario de hasta ocho vlvulas y/o vlvulas
maestras

Cartucho PBC-LXD de respaldo de


programacin para ESP-LXD
Proporciona funciones de respaldo de programa y lectura de cdigo
EFCBSSBTQBSBFMDPOUSPMBEPS&41-9%

Caractersticas del kit de actualizacin


t1SPQPSDJPOBIBTUBDPQJBTEFSFTQBMEPDPNQMFUBT JODMVZFOEPUPEPT
los programas, informacin de caudal y direcciones de decodificadores
(permite archivar fcilmente 8 programadores diferentes); se tarda
normalmente dos minutos o menos en restaurar toda la informacin
t4FBDPQMBBMBQBSUFQPTUFSJPSEFMQBOFMGSPOUBMEFM&41-9%TFJOTUBMB
sin necesidad de herramientas; no necesita cajas ni cableado externo
adicionales
t&MLJUJODMVZFVODBCMFQBSBMBDPOFYJOEFMMQJ[MFDUPSEFDEJHP
de barras (lpiz no incluido), que le permite introducir rpidamente
EJSFDDJPOFTEFMPTEFDPEJGJDBEPSFTFOFMQSPHSBNBEPS&41-9%EVSBOUF
la instalacin para ahorrarle tiempo

Modelo
t1#$-9% GVODJPOBDPOUPEBTMBTWFSTJPOFTEFMQSPHSBNBEPS&41-9%

Modelo

Programadores

t&41-9%FTUBDJPOFT 7"$
t*&41-9%FTUBDJPOFT QBSBNFSDBEPTJOUFSOBDJPOBMFT 7$"
t*&41-9%&6FTUBDJPOFTQBSB&VSPQB 7$"
t*&41-9%"6FTUBDJPOFTQBSB"VTUSBMJB 7$"

Accesorios opcionales
t&41-9%4.NEVMPEFFTUBDJPOFTQBSB&41-9%
t1#$-9%$BSUVDIPEFSFTQBMEPEFQSPHSBNBQBSB&41-9%
t-*.3,*5&RVJQPEFDPOUSPMSFNPUP-*.3QBSBDPOUSPMBEPSFT3BJO#JSE
(consulte la pg. 133)
t'%563'EFDPEJGJDBEPSFTEFEPTDBCMFT DPOTVMUFMBQH

t4%563'EFDPEJGJDBEPSEFTFOTPSEFEPTDBCMFT DPOTVMUFMBQH

t-41563'QSPUFDDJODPOUSBTPCSFDBSHBTEFMOFBEFEPTDBCMFT DPOTVMUFMB
pg. 136)
t%16VOJEBEEFQSPHSBNBDJOEFEFDPEJGJDBEPSEFEPTDBCMFT DPOTVMUF
la pg. 136)
t-9..BSNBSJPNFUMJDPDPOSFWFTUJNJFOUPEFQJOUVSBFOQPMWPQBSB
controladores de la serie ESP-LX (consulte la pg. 136)
t-9..1&%QFEFTUBMNFUMJDPDPOSFWFTUJNJFOUPEFQJOUVSBFOQPMWPQBSB
controladores de la serie ESP-LX (consulte la pg. 140)
t&5$-9DBSUVDIP&5.BOBHFS para controladores de la serie ESP-LX
(consulte la pgina 132)
t*2/$$DBSUVDIPEFDPNVOJDBDJPOFTEFSFEQBSBDPOUSPMBEPSFTEFMBTFSJF
ESP-LX (consulte la pgina 146)
t1BSBPCUFOFSNTJOGPSNBDJOTPCSFMPTTFOTPSFTEFDBVEBMTFSJF'4EF3BJO
Bird, consulte la pgina 135

Cartucho PBC-LXD

Los decodificadores FD-TURF incluyen etiquetas adhesivas de direccin de cdigo de


barras

Lpiz lector de cdigo de barras no incluido, se vende por separado; se recomienda el


modelo Unitech MS100-2 (www.ute.com)

El uso inteligente del agua.

129

Sistemas de control centralizado


%FDPEJGJDBEPSFTEFEPTDBCMFT'%563'

Decodificadores de dos cables FD-TURF


%FDPEJGJDBEPSFT&41-9%Z4JUF$POUSPMRVFBENJUFO  EJSFDDJPOFT
de decodificadores

Q Instalacin, expansin y actualizacin fciles y redituables entre los


TJTUFNBT&41-9%ZP4JUF$POUSPM

Q Se instala fuera del alcance de la vista y cuenta con proteccin contra los
factores climticos y el vandalismo

Q Permite caractersticas avanzadas de sensor y diagnstico


Especificaciones de operacin
Seleccione diferentes decodificadores de dos cables para operar una, dos,
cuatro o seis vlvulas. Cinco opciones de decodificador diferentes le permiten
elegir la cantidad precisa de control de irrigacin paisajstica que necesita.

Decodificadores
 %FDPEJGJDBEPSEFDBNQP'%563'FOJOUFSGB[DPOMBMOFBEFTFBMZ
una vlvula
Decodificadores

 %FDPEJGJDBEPSEFDBNQP'%563'FOJOUFSGB[DPOMBMOFBEFTFBMZ
una vlvula o un par de vlvulas
 %FDPEJGJDBEPSEFDBNQP'%563'FOJOUFSGB[DPOMBMOFBEFTFBMZ
vlvulas o
2 pares de vlvulas
 %FDPEJGJDBEPSEFDBNQP'%563'FOJOUFSGB[DPOMBMOFBEFTFBMZ
hasta 4 vlvulas individuales
 %FDPEJGJDBEPSEFDBNQP'%563'FOJOUFSGB[DPOMBMOFBEFTFBMZ
hasta 6 vlvulas individuales
 1SPUFDDJODPOUSBEFTDBSHBTEFMBMOFB-41563'

Programadores

 %FDPEJGJDBEPSEFTFOTPSFOJOUFSGB[4%563'DPOMBMOFBEFTFBMZ
decodificadores anlogos o digitales
- Rel de inicio de bombas. Utilice el decodificador de campo como interfaz
entre el rel de la bomba y la lnea de dos cables
t1PUFODJBEFTBMJEBAjustable desde el controlador; valores de corriente de
entrada y de retencin ajustables desde el controlador.
t&ODBQTVMBDJO5PUBMNFOUFBQSVFCBEFBHVB
t%JSFDDJOPrecodificada desde la fbrica (es decir, sin interruptores)
t&OUSBEBFMDUSJDB
- Voltaje nominal: 34 Vpp (24 V CA) desde la lnea de dos cables
- Voltaje mnimo: 21 Vpp (15V AC)
t$PSSJFOUFBVYJMJBS'%563' '%563'N"'%563' 
'%563'Z'%563'N"
t.POUBKFEn caja de vlvulas (recomendado) o para enterrar

Cmo especificar
FD - 101 - TURF
Aplicacin
563'QBSB&41-9%
o SiteControl
Tipo de decodificador
OJDBEJSFDDJO TPMFOPJEF

OJDBEJSFDDJO IBTUBTPMFOPJEFT

%JSFDDJOEVBM IBTUBTPMFOPJEFT

401: Cuatro direcciones (hasta 4


solenoides)
601: Seis direcciones (hasta 6 solenoides)

t$POTVNPEFFOFSHB
 '%563'N" JOBDUJWP
N" QPSTPMFOPJEFBDUJWP

 '%563'N" JOBDUJWP
N" QPSTPMFOPJEFBDUJWP

 '%563'N" JOBDUJWP
N" QPSTPMFOPJEFBDUJWP

 '%563'N" JOBDUJWP
N" QPSTPMFOPJEFBDUJWP

 '%563'N" JOBDUJWP
N" QPSTPMFOPJEFBDUJWP

Modelo
'%%FDPEJGJDBEPSEFDBNQP

130

El uso inteligente del agua.

Sistemas de control centralizado

www.rainbird.com/controllers

%FDPEJGJDBEPSFTEFEPTDBCMFT'%563' %16

 '%563'-BSHPQVMH NN
%JNFUSPQVMH NN

t'VTJCMFEFFOUSBEB '%563'Z'%563'TPMBNFOUF
300 a 500 mA,
trmico

 '%563'-BSHPQVMH NN
%JNFUSPQVMH NN

t&OUSBEBFMDUSJDB

 '%563'-BSHPQVMH NN
%JNFUSPQVMH NN

- Voltaje mximo: 36 Vpp

 '%563'-BSHPQVMH NN
%JNFUSPQVMH NN

- Carga mxima:

 '%563'-BSHPQVMH NN
%JNFUSPQVMH NN

t4PMFOPJEFT
 '%563'DPODPOUSPMJOEJWJEVBM
 '%563'PTJNVMUOFBNFOUF
 '%563'%FBTJNVMUOFBNFOUF
 '%563'%FBDPODPOUSPMJOEJWJEVBM
 '%563'%FBDPODPOUSPMJOEJWJEVBM
t$BCMFT
 '%563'"[VMQBSBDBCMF CMBODPQBSBTPMFOPJEF
 '%563'"[VMQBSBDBCMF CMBODPQBSBTPMFOPJEF
 '%563'"[VMQBSBDBCMF CMBODPZNBSSOQBSBTPMFOPJEFT
 '%563'"[VMQBSBDBCMF DPEJGJDBEPTQPSDPMPSQBSBTPMFOPJEFT
 '%563'"[VMQBSBDBCMF DPEJGJDBEPTQPSDPMPSQBSBTPMFOPJEFT
t1SPUFDDJODPOUSBEFTDBSHBT4FSFRVJFSFVOPEFMPTTJHVJFOUFTDBEB
pies a lo largo del trazado de dos cables (40 V; 1.5 kW transil)
- Proteccin contra descargas de la lnea LSP-1
 '%563'DPOQSPUFDDJODPOUSBEFTDBSHBTJODPSQPSBEB
 '%563'DPOQSPUFDDJODPOUSBEFTDBSHBTJODPSQPSBEB
Nota: Se requiere una resistencia a tierra mnima de 10 ohmios en el controlador y en
cada protector de sobretensin

t '%563'TPMFOPJEF3BJO#JSE VOPQPSEJSFDDJO

t '%563'TPMFOPJEFT3BJO#JSE EPTQPSEJSFDDJO

t '%563'TPMFOPJEFT3BJO#JSE EPTQPSEJSFDDJO

t '%563'TPMFOPJEFT3BJO#JSE VOPQPSEJSFDDJO

t '%563'TPMFOPJEFT3BJO#JSE VOPQPSEJSFDDJO

t5FOEJEPTEFDBCMFNYJNPT
- Calibre 14
t &TUSFMMBLN
t #VDMFLN
t$BCMFTEFMEFDPEJGJDBEPSTPMFOPJEF
t 3FTJTUFODJBFMDUSJDB.YJNPEFPINJPT
t%JTUBODJBNYJNBEFDPEJGJDBEPSTPMFOPJEFT
t -POHJUVEEFMDBCMFQJFT DBMJCSF
t$BCMFBEP."9*$BCMFEF6'DPOEPCMFFOWBJOBEP
t&OUPSOP
t 3BOHPEFUSBCBKP%F'B' EF$B$

t 3BOHPEFBMNBDFOBNJFOUP%F'B' EF$B$

t )VNFEBE
Nota:3BJO#JSESFDPNJFOEBVUJMJ[BSDPOFDUPSFTBQSVFCBEFBHVB.%#3%#:QBSB
todas las conexiones.
Nota: los decodificadores serie FD no son compatibles con vlvulas de uso residencial
como las vlvulas HV, DV, DVF, ASVF, JTV y JTVF de Rain Bird.

Unidad de programacin del decodificador


DPU-210
1BSBEFDPEJGJDBEPSFTEFEPTDBCMFT'%5VSG&41-9% .%$.%$Z
SiteControl
t-BVOJEBEEFQSPHSBNBDJOEFMEFDPEJGJDBEPSQSVFCBZWFSJGJDBFM
GVODJPOBNJFOUPEFMPTEFDPEJGJDBEPSFTEFDBNQP&41-9% .%$.%$P
4JUF$POUSPMEFMBTFSJF'%5BNCJOQFSNJUFSFQSPHSBNBSMBTEJSFDDJPOFTEFM
decodificador para obtener la mxima flexibilidad de instalacin en el sitio

DPU-210

El uso inteligente del agua.

131

Programadores

t%JNFOTJPOFT

Controladores
$BSUVDIP&5.BOBHFS

Cartucho ET Manager

Modelos

Actualiza cualquier controlador serie ESP-LX a un controlador


de riego de evapotranspiracin o basado en condiciones
meteorolgicas

t&5.3.,TPQPSUFQBSBBOUFOBSFNPUBQBSBFM&5$-9

Caractersticas
Beneficios del ahorro de agua
 &MDBSUVDIP&5.BOBHFSBIPSSBBHVBNFEJBOUFMBSFBMJ[BDJOEFBKVTUFTFO
tiempo real en los horarios de riego segn la informacin meteorolgica por
hora

t&5$-9$BSUVDIP&5.BOBHFSQBSBDPOUSPMBEPSFT-9
t&5.3(NFEJEPSEFMMVWJBCBTDVMBOUF
t&5.14TPGUXBSFEFQSPHSBNBDJOEF&5.BOBHFS
* Permite que la antena se monte remotamente para lograr una mejor recepcin de la
seal. El ET Manager posee una antena incorporada, pero los sitios que tienen una
seal de localizacin dbil pueden necesitar una antena externa

Para solicitar ms informacin llame a la lnea directa de


ET Manager: 1-877-351-6588

- Ahorro de agua del 20% al 50% sobre el control de riego


tradicional basado en horarios
 .JEFMPTDVBUSPDPNQPOFOUFTDMBWFEF&5SBEJBDJOTPMBS IVNFEBE
relativa, viento y temperatura, ms las precipitaciones efectivas
- Ajusta los tiempos de riego del programa y la frecuencia de riego
- Se mantienen cuatro equilibrios de humedad separados, uno para cada
programa o hidrozona, para regar varios tipos de plantas de forma
eficiente (por ejemplo: csped, arbustos, rboles, plantas anuales, etc.)
Fcil instalacin
- Se instala en segundos sin herramientas en los controladores serie ESP-LX,
se introduce en un espacio dedicado en la parte trasera del panel frontal
del controlador
- La antena se monta en el manguito NPS
- El asistente de configuracin gua al usuario hacia todos los parmetros
clave de configuracin
Menos riesgos
Programadores

 'VODJOEFJOUFSSVQDJOQPSUFNQFSBUVSBNOJNBQBSBFWJUBSFMSJFHP
durante condiciones de temperatura bajo cero,
lo que reduce los riesgos asociados con el congelamiento de senderos
Caractersticas adicionales de ETC-LX
 &MDBSUVDIP&5.BOBHFSVUJMJ[BMBTFBM8FBUIFS3FBDI
- Elimina la necesidad de trasladarse a los sitios del controlador para realizar
ajustes o cambios de programacin, lo cual contribuye al ahorro significativo
de mano de obra
 $BCMFQMBOPRVFDPOFDUBFMDBSUVDIP&5$-9BMDPOUSPMBEPS
- El cable de la antena se conecta al conector a presin
 -BTMVDFT-&%EFFTUBEPNVFTUSBOFMFTUBEPBDUVBMEFMBTDPNVOJDBDJPOFT
 &MFRVJQP&5$-9JODMVZFFMDBSUVDIP&5.BOBHFS BOUFOBSFDFQUPSB 
NBOVBMZ$%EFSFDVSTPTEF&5.BOBHFSRVFMFBZVEBSBQSPHSBNBSMPT
tiempos de riego segn los parmetros paisajsticos

Cartucho ET Manager
para ETC-LX

Especificaciones de operacin
t&MDPOUSPMBEPS-9TVNJOJTUSBMBFOFSHBFMDUSJDB
t3BOHPEFUFNQFSBUVSBPQFSBUJWBEF'B' $Z$
 UFNQFSBUVSB
PQFSBUJWBEFSFDFQDJOEFSBEJPEF'B'<EF$B$>

t$BCMFNFEJEPSEFMMVWJBCBTDVMBOUFoAWG

132

El uso inteligente del agua.

Controladores

www.rainbird.com/controllers

$POUSPM3FNPUPQBSBSJFHPEF+BSEJOFT -*.3

Control remoto para riego y mantenimiento


de jardines (LIMR)
El sistema remoto. Vuelve a nacer.
El sistema de riego de jardines y mantenimiento remoto (LIMR) de
Rain Bird fue diseado para brindar facilidad de uso, rendimiento y
confiabilidad. Cada una de las funciones de que dispone le ahorrar tiempo
y dinero en el mantenimiento del sistema de riego eficiente de Rain Bird y
la alineacin de cabezales. Utilizar menos agua para hacer ms. Eso s es un
uso inteligente del agua.
Riego remoto compatible con todos los nuevos controladores modulares
&41.&Z&413;9 &414.5 &41-9 &41-9 &41-9.& &41-9.&' &41
-9%Z&41-9

Q Instale de manera permanente el cable de conexin rpida para conectar


rpidamente un receptor cuando visite un lugar de trabajo

Q En aplicaciones comerciales, monte permanentemente un receptor y


conctelo fcilmente con su transmisor porttil

Q Puede operar simultneamente varios receptores con el mismo transmisor


porttil

Especificaciones
t3BOHPPQFSBUJWPIBTUBNJMMBT LN
FOMOFBWJTVBM
t$PNVOJDBDJOCJEJSFDDJPOBMNFEJBOUFSBEJPTEF.)[DPODFSUJGJDBDJOEF
'$$
t$POSFDPOPDJNJFOUP6t$BQBDJEBEEF[POBTEFB
t5JQPEFQJMBQJMBT"""BMDBMJOBT
t4FQVFEFOBTJHOBSOPNCSFTQFSTPOBMJ[BEPTBSFDFQUPSFTQBSBGBDJMJUBSMB
identificacin
t$BEBDPOUSPMSFNPUPQPSUUJMQVFEFDPOUSPMBSTJNVMUOFBNFOUF
receptores

Dimensiones
t,*5w DN
"MYw DN
"OYw DN
'
t59w DN
"MYw DN
"OYw DN
'
t39w DN
"MYw DN
"OYw DN
'

Modelos (EE.UU. y Canad solamente)


t-*.3,*5JODMVZF59 39 2$ 2$ QJMBTZVONBMFUOEFUSBOTQPSUFEF
plstico resistente.
t-*.359USBOTNJTPS

Caractersticas
t*OUFSGB[TFODJMMBDPOJOTUSVDDJPOFTFOQBOUBMMBGDJMFTEFTFHVJS DPNP
- Ejecutar una prueba del sistema

t-*.339SFDFQUPS
t-*.32$DPOFDUPSSQJEPEFQBUJMMBT QJFTEFMPOHJUVE DN

t-*.32$DPOFDUPSSQJEPEFQBUJMMBT QJFTEFMPOHJUVE N

- Activar una zona

t-*.32$DPOFDUPSSQJEPEFQBUJMMBT QJFTEFMPOHJUVE DN

- Ejecute un programa (nicamente controladores de 6 patillas)

t-*.32$DPOFDUPSSQJEPEFQBUJMMBT QJFTEFMPOHJUVE N

- Acceso a cualquier zona tan solo ingresando el nmero


Programadores

t"IPSSFUJFNQPZEJOFSPNBOUFOJFOEPFMGVODJPOBNJFOUPEFMTJTUFNB
Rain Bird y la alineacin de cabezales eficientemente
t&MNBOUFOJNJFOUPEFMGVODJPOBNJFOUPEFMTJTUFNB3BJO#JSEZMBBMJOFBDJOEF
cabezales es ms fcil y rpida que nunca, porque ya no tiene que caminar al
controlador para activar o desactivar zonas
t6OBOJDBQFSTPOBQVFEFBDUJWBS[POBT BQBHBSTJTUFNBTZFGFDUVBSPUSBT
tareas de adaptacin a invierno o mantenimiento, reduciendo los costos de
la actividad
t*OTUBMFFMSFDFQUPSFOTFHVOEPTDPOVOBTPMBNBOPZDPOUSPMFIBTUB
zonas
t"DDFEBBDVBMRVJFS[POBUBOTPMPJOHSFTBOEPFMONFSP/PFTOFDFTBSJP
desplazarse por las zonas en orden consecutivo
t&KFDVUFVOBQSVFCBEFMTJTUFNB FTQFDJGJDBOEPDVOUPTNJOVUPT DPORV
zona empezar y con cul finalizar
t-BDPNVOJDBDJOCJEJSFDDJPOBMFOUSFFMDPOUSPMSFNPUPZFMDPOUSPMBEPS
permite que la informacin de la actividad remota se muestre en el
dispositivo porttil
t4FQVFEFOBTJHOBSOPNCSFTQFSTPOBMJ[BEPTBSFDFQUPSFTQBSB
facilitar la identificacin. Cada control remoto porttil puede controlar
simultneamente 128 receptores
t3BOHPPQFSBUJWPEFIBTUBNJMMBT LN
FOMOFBWJTVBM
- El rango real vara segn el terreno y los obstculos que bloquean la
visibilidad. Los obstculos como edificios y paredes, as como la potencia
de las seales de interferencia, pueden afectar el rango.
Control remoto para riego y
mantenimiento de jardines (LIMR)

El uso inteligente del agua.

133

Controladores
5#04

TBOS

t-BQJMBEVSBVOBPFODBTPEFTFSVOBQJMBBMDBMJOBEF7EFQSJNFSBDBMJEBE

Controlador para uso comercial, controlado con pilas

t$VCJFSUBBQSVFCBEFBHVB DPODMBTJGJDBDJO*1 RVFQFSNJUFVOBPQFSBDJO


confiable bajo el agua

Q -BMOFBEFDPOUSPMBEPSFTTVCUFSSOFPT5#04DPOUSPMBEPTDPOQJMBTQFSNJUF

t%JNFOTJPOFT34 x 518 x 2 pulg. (9.5 x 13.0 x 5.3 cm)

el uso de riego automtico cuando hay interrupcin de la energa CA

Q El estuche resistente, la instalacin de la caja de vlvulas interna y la


separacin del transmisor del mdulo de control impiden el vandalismo y
el sabotaje de sus programas

Q El estuche a prueba de agua, con clasificacin IP-68, garantiza la operacin


confiable bajo el agua y protege su inversin

Caractersticas
t*EFBMQBSBBQMJDBDJPOFTDPNFSDJBMFT JODMVJEPTQBSRVFTNVOJDJQBMFT QSPZFDUPT
paisajsticos en calles y autopistas y proyectos de construccin
t$POWFOJFOUFPQDJOUFNQPSBMQBSBQSPQPSDJPOBSSJFHPJOJOUFSSVNQJEP
mientras se realizan reparaciones a un sistema que funciona con energa CA

t1FTPPO[BT H

t&YUFOTJONYJNBEFDBCMFTFOUSFFMNEVMPZFMTPMFOPJEF
Calibre del cable
18 AWG (0.75 mm2)
16 AWG (1.5 mm2)
14 AWG (2.5 mm2)

Distancia mxima
32 pies (10 m)
50 pies (15 m)
80 pies (24 m)

t"QSPCBEPQPS$5JDL

Transmisor de campo TBOS


t5SBOTNJTPSEFDBNQPSFRVFSJEPQBSBMBQSPHSBNBDJOEFMNEVMPEFDPOUSPM
t%JNFOTJPOFT12 x 712 x 178 pulg. (9.0 x 19.0 x 4.5 cm)
t1FTPPO[BT H

t$BMFOEBSJPEFEBT DPOUFNQMBBPTCJTJFTUPT

t5FNQFSBUVSBEFGVODJPOBNJFOUPEF'B' EF$B$

t3FMPKDPOWJTVBMJ[BDJO".1.PEFIPSBT

t"QSPCBEPQPS$5JDL

t5JFNQPEFSJFHPEFNJOVUPBIPSBTFOJODSFNFOUPTEFNJOVUP

Solenoide de enganche encapsulado TBOS

t1SPHSBNBDJOCTJDB NPEPFTUOEBS
RVFJODMVZFQSPHSBNBT
independientes en un ciclo de programas de 7 das

t4FTVNJOJTUSBOEPTDBCMFTDBMJCSF NN2): 23.6 pulg. (60 cm) de largo

t$JDMPTBEJDJPOBMFT NPEPUVSCP
DPODJDMPTEFQSPHSBNBTQBSBEBTQBSFT 
impares, impares sin riego los das 31 y de 1 a 6 das, que proporcionan
mxima flexibilidad
tIPSBSJPTEFBSSBORVFQPSQSPHSBNBBMEB
t*OEJDBEPSEFQJMBCBKBRVFBWJTBFMFTUBEPEFMBTQJMBTFOFMUSBOTNJTPSEF
DBNQP5#04
Programadores

t0QFSBDJOEFFTUBDJPOFTJOEFQFOEJFOUFTRVFQFSNJUFIPSBSJPTEFBSSBORVF
simultneos o secuenciales basados en la capacidad hidrulica del sistema
t&MUSBOTNJTPSEFDBNQP5#04DVFOUBDPOVOBQBOUBMMBHSBOEFEFDSJTUBM
MRVJEP -$%
DPODPOPTEFGVODJPOFTGDJMFTEFFOUFOEFS$BEBGVODJOFTU
sealada con un smbolo fcil de comprender
t&MUFDMBEPEFUFDMBTFNJUFVOiCJQwDBEBWF[RVFTFQSFTJPOBVOBUFDMB BT TF
logra una programacin rpida y segura
t6OUSBOTNJTPSEFDBNQP5#04QSPHSBNBVOONFSPJMJNJUBEPEFNEVMPT
EFDPOUSPM5#04
t5SBOTNJTPSEFDBNQPZNEVMPEFDPOUSPMDPODPOFDUPSFTQUJDPTFYUFSOPT
para una fcil conexin

t$PNQBUJCMFDPOWMWVMBT3BJO#JSETFSJF%7 %7' "47' 1(" 1&# 1&4# (# 


&'#$1 #1&Z#1&4
t1SFTJOPQFSBUJWBNYJNBEFQTJ CBSFT

t%JNFOTJPOFT38" x 238" x 112" (4.0 cm x 6.0 cm x 4.2 cm)

Adaptadores de solenoide TBOS


t'DJMEFJOTUBMBS
t"EBQUBEPSOFHSPQBSBWMWVMBTEFQMTUJDPRVFQFSNJUFFMVTPEFMTPMFOPJEFEF
FOHBODIFFODBQTVMBEP5#04DPOEFUFSNJOBEBTWMWVMBT*SSJUSPM )BSEJF3JDIFM

y Buckner
t"EBQUBEPSNBSSOQBSBWMWVMBTEFMBUORVFQFSNJUFFMVTPEFMTPMFOPJEF
EFFOHBODIFFODBQTVMBEP5#04DPOEFUFSNJOBEPTBDDJPOBEPSFTEFWMWVMBT
Champion y Superior

Modelos
t5#04'564USBOTNJTPSEFDBNQP
t5#04$.64NEVMPEFDPOUSPMEF
1 estaciones

t&TQPTJCMFUSBOTNJUJSJOGPSNBDJOBVOTJFMNEVMPTFFODVFOUSBCBKPBHVB

t5#04$.64NEVMPEFDPOUSPMEF
2 estaciones

t4PMFOPJEFEFFOHBODIFFODBQTVMBEP5#04DPNQBUJCMFDPOUPEBTMBTWMWVMBT
EFMBT4FSJFT%7 %7' "47' 1(" 1&# 1&4# (# &'#$1 #1&Z#1&4EF3BJO#JSE

t5#04$.64NEVMPEFDPOUSPMEF
4 estaciones

t-PTBEBQUBEPSFTEFTPMFOPJEF5#04TFBEBQUBOBMTPMFOPJEFEFFOHBODIF
encapsulado para ser utilizados en aplicaciones de retroadaptacin
con determinadas vlvulas Irritrol (Hardie/Richdel) y Buckner, o con
accionadores de vlvulas Champion y Superior

t5#04140-TPMFOPJEFEFFOHBODIF
encapsulado

Mdulo de control TBOS

t5#04"%"1#BEBQUBEPSEF
solenoide para
vlvulas de latn

t%JTQPOJCMFFONPEFMPTEF ZFTUBDJPOFT
t0QFSBVOBWMWVMBQPSFTUBDJO

t5#04"%"11BEBQUBEPSEF
solenoide para vlvulas de plstico

Mdulo de control y
transmisor de campo TBOS

t$SPOPNFUSBKFEFFTUBDJPOFTNJOVUPBIPSBTFOJODSFNFOUPTEFNJOVUP
con un calendario de 365 das. Las estaciones se asignan a un nico programa
t-BDPOFYJOQBSBTFOTPSBDUJWPBENJUFFMTFOTPSEFMMVWJB34%#&Y
de Rain Bird
t0QFSBDPOTPMPVOBQJMBBMDBMJOBEF7 TFSFDPNJFOEB&OFSHJ[FS y
%VSBDFMM) tipo 6AM6 (estndar internacional) o 6LR61 (estndar europeo):
pila no incluida

134

Solenoides de enganche
encapsulado TBOS y
adaptadores de solenoide

El uso inteligente del agua.

Accesorios para controladores


Sensores de flujo y transmisores

www.rainbird.com/controllers

Sensores de flujo y transmisores


Maxicom2 4JUF$POUSPM &41-9%P*2

Caractersticas (sensores)
t4FODJMMPEJTFPEFJNQVMTPSEFTFJTQBMFUBT
t%JTFBEPQBSBBQMJDBDJPOFTFYUFSJPSFTPTVCUFSSOFBT
t%JTQPOJCMFFOFTUSVDUVSBEF17$ MBUOPBDFSPJOPYJEBCMF
t7FSTJPOFTQSFJOTUBMBEBTFOi5wPDPOJOTFSDJPOFTTVTQFOEJEBT

Caractersticas (transmisores)
t%JTFPDPOGJBCMFEFFTUBEPTMJEP EJTQPOJCMFDPOPTJOQBOUBMMBEFDSJTUBM
MRVJEP -$%

t%JTFPGDJMEFQSPHSBNBSDPOUSPMBEPQPSNFOT
t1SPHSBNBCMFEFTEFVOBDPNQVUBEPSB 15 OJDBNFOUFFOTJTUFNBT
.BYJDPNZ4JUF$POUSPM OPTFSFRVJFSFQBSB&41-9.&'P&41-9%

t0QFSBDPO."9*-JOL y sistemas de satlites de los cables


(conexin con cables)
t.POUBEPFODBKB/&."PQDJPOBM OJDBNFOUFFO15

Especificaciones de operacin (sensores)


t1SFDJTJO FTDBMBDPNQMFUB

tOEJDFEFGMVKPQJFT NFUSPT
QPSTFHVOEP EFQFOEJFOEPEFM
modelo
t1SFTJOQTJ CBSFT
B$ '
 NY
FOMPTNPEFMPTEFNFUBM
QTJ CBSFT
B$ '
 NY
FOMPTNPEFMPTEFQMTUJDP

Sensores de flujo
Programadores

t5FNQFSBUVSB$ '
 NY
FONPEFMPTEFNFUBM 
 NY
FO
modelos de plstico

Especificaciones operativas (transmisores)


t&OUSBEBSFRVFSJEB

 7$$7$"FO15
 7$" 7$"SFD
FO15
 7$"7$$FO15
t4BMJEB4BMJEBEFQVMTP
t5FNQFSBUVSBEFGVODJPOBNJFOUP%F'B' EF$B$

t6OJEBEFT6OJEBEFTOBDJPOBMFTFJOUFSOBDJPOBMFTEJTQPOJCMFTFO15

Dimensiones
t15YY NNYNYNN

t15YY NNYNNYNN

t'41YY NNYNNYNN

t'41YY NNYNNYNN

t'41YY NNYNNYNN

t'41YY NNYNNYNN

t'41YY NNYNNYNN

t'41YY NNYNNYNN

t'41YY NNYNNYNN

Transmisores de sensor de flujo


y Accesorios

t'4#YY NNYNNYNN

t'4#YY NNYNNYNN

t'4#YY NNYNNYNN

t'4#Y EJNFUSP
 NNYNN EJNFUSP

t'444Y EJNFUSP
 NNYNN EJNFUSP

El uso inteligente del agua.

135

Accesorios para controladores


Sensores de flujo y transmisores

Sensores de flujo y transmisores (cont.)


Configuracin
t Para sistemas de satlite de dos cables (conexin con cables)
(Maxicom2 y SiteControl), el sensor de flujo se instala con un
transmisor de pulsos y unEFDPEJGJDBEPSEFQVMTPTEF3BJO#JSE %&$16--3

t Para sistemas de satlite con radio de enlace (Maxicom2 y


SiteControl), el sensor de flujo se instala con un transmisor de pulsos (no
se requiere decodificador de pulsos)
t Para sistemas de satlite ESP-SITE (Maxicom2), el sensor de flujo se
instala con un transmisor de pulsos (no se requiere decodificador)
t Para sistemas decodificadores SiteControl, el sensor de flujo se
JOTUBMBDPOVOEFDPEJGJDBEPSEFTFOTPSFTEFEPTDBCMFT 4%563'

t Para sistemas decodificadores ESP-LXD, el sensor de flujo se instala


DPOVOEFDPEJGJDBEPSEFTFOTPSFTEFEPTDBCMFT 4%563'

Accesorios
151834611BMJNFOUBDJOEFMUSBOTNJTPSEFQVMTPT
/&."$"#DBKB/&."QBSB15
'4463(&,*5LJUEFQSPUFDDJODPOUSBEFTDBSHBTEFMTFOTPSEFDBVEBM
%&$16--3EFDPEJGJDBEPSEFQVMTPTQBSBTBUMJUFTEFEPTDBCMFT
4%563'EFDPEJGJDBEPSEFTFOTPSFTQBSBTJTUFNBTEFDPEJGJDBEPSFT
'4.-9.&NEVMPJOUFMJHFOUFEFDBVEBMQBSBDPOUSPMBEPSFTTFSJF&41-9.&

Rango operativo sugerido para sensores de flujo Rain Bird


La tabla que aparece a continuacin indica el rango de flujo sugerido para los
sensores de flujo Rain Bird. Los sensores Rain Bird funcionan tanto por debajo
como por encima del ndice de flujo indicado. Sin embargo, las prcticas correctas
del diseo determinan el uso de este rango para obtener un mejor rendimiento.
Los sensores se deben dimensionar para el flujo y no para el tamao de la tubera.

tPara sistemas ESP-LXMEF, el sensor de flujo se instala en el


NEVMPJOUFMJHFOUFEFDBVEBM'4.-9.&
t4FSFDPNJFOEBMBQSPUFDDJODPOUSBEFTDBSHBT '4463(&,*5
FOMPTTJTUFNBT
Maxicom y SiteControl: una en el transmisor de pulsos y, si la extensin del
cable es mayor a 50 (15.24 m), una en el sensor de caudal. La proteccin
DPOUSBEFTDBSHBT'4463(&,*5OPFTDPNQBUJCMFDPOMPTDPOUSPMBEPSFT&41
-9.&'Z&41-9%

Modelos
Latn en T
t'4#TFOTPSEFDBVEBMEFMBUOFO5EFw NN

t'4#TFOTPSEFDBVEBMEFMBUOFO5EF DN

t'4#TFOTPSEFDBVEBMEFMBUOFO5EFw DN

Programadores

Plstico en T
t'41TFOTPSEFDBVEBMEF17$FO5EFw DN

t'41TFOTPSEFDBVEBMEF17$FO5EFw NN

Modelo

'41
'41
'41
'41
'41
'41
'41
'4#
'4#
'4#
'4#
'444

Rango operativo
Rango operativo
sugerido
sugerido
(galones por minuto) (litros por minuto)

1.9 - 18.9
3.3 - 33.2
5.4 - 53.9
5 - 100
10 - 200
20 - 300
40 - 500
2 - 40
2 - 82.6
4.9 - 294

7.2 - 71.7
12.6 - 125.8
20.4 - 204
18 - 378
36 - 756
78 - 1134
150 - 1890
6 - 150
6.3 - 313
18.5 - 1112

Rango operativo
sugerido
(Metros cbicos / Hora)

0.43 - 4.3
0.75 - 7.5
1.2 - 12.2
1.1 - 22.7
2.3 - 45.4
4.5 - 68.1
9.1 - 113.6
0.5 - 9
0.4 - 18.7
1.1 - 66.7

%FQFOEFEFMUJQPZFMUBNBPEFMBUVCFSBDPOTVMUF
MBTFTQFDJDBDJPOFTUDOJDBTEFMPTTFOTPSFTEFDBVEBM %'

t'41TFOTPSEFDBVEBMEF17$FO5EFw NN

t'41TFOTPSEFDBVEBMEF17$FO5EF DN

t'41TFOTPSEFDBVEBMEF17$FO5EFw DN

t'41TFOTPSEFDBVEBMEF17$FO5EFw NN

t'41TFOTPSEFDBVEBMEF17$FO5EFw DN

Accesorios de insercin
t'444BDDFTPSJPEFJOTFSDJOEFBDFSPJOPYJEBCMFEFwZNT
t'4#BDDFTPSJPEFJOTFSDJOEFMBUOEFwZNT
t'45*/4&35BDDFTPSJPEFJOTFSDJOEFSFQVFTUPQBSBTFOTPSFTFO5
Transmisores de pulsos (no son necesarios con los controladores LX)
t15USBOTNJTPSEFQVMTPT TJOQBOUBMMB
t15USBOTNJTPSEFQVMTPT QBOUBMMB-$%
t1548TPGUXBSFEFQSPHSBNBDJOEFMUSBOTNJTPSEFQVMTPT15

136

El uso inteligente del agua.

Accesorios para controladores

www.rainbird.com/controllers

Sensores de lluvia y heladas inalmbricos Serie WR2

Sensores de lluvia y
heladas inalmbricos serie WR2
Mucho ms que ahorro de agua.
Los sensores de lluvia y heladas se estn convirtiendo en componentes
necesarios para los sistemas de riego de la actualidad. Rain Bird dise
el nuevo sensor WR2 para superar los estndares. Este sensor dispone de
caractersticas revolucionarias que ahorran tiempo, mejoran el rendimiento
del sistema y aumentan su reputacin como experto en la gestin de agua.
La transmisin fiable de la seal y otras innovaciones proporcionan una
respuesta excelente a la lluvia y a las bajas temperaturas, mientras que la
facilidad de uso de las funciones reduce a la mitad el tiempo de instalacin
y programacin. Elija los niveles de lluvia preestablecidos y ahorre hasta un
35% de agua a la vez que aumenta la suntuosidad y belleza de los jardines.

Q Este producto de alta calidad ha sido diseado para sistemas de riego


 residenciales y comerciales a 24 VCA, ahorra agua y aumenta la vida til
del sistema de riego al detectar automticamente las precipitaciones e
interrumpir el riego cuando llueve lo suficiente o las temperaturas son
demasiado bajas
Sensores de lluvia y heladas
inalmbricos Serie WR2

Q La interfaz del controlador es muy intuitiva y utiliza iconos, lo que simplifica


 la programacin
Q Un sistema de antena mejorado proporciona una fiabilidad excelente a la
 seal, que supera la mayora de las obstrucciones de la lnea visual
Caractersticas y beneficios
t&MJOEJDBEPSEFJOUFOTJEBEEFMBTFBMQFSNJUFMBDPOGJHVSBDJOQPSQBSUFEF
una persona, reduciendo el tiempo de instalacin

t-BMHJDBEFQSPHSBNBDJOQVFEFTVTQFOEFSFMSJFHPNFEJBOUFMBGVODJO
de desconexin rpida o cuando la cantidad de lluvia supere el nivel
preestablecido
t&MTFOTPSEFMMVWJBZIFMBEBTJOBMNCSJDPTVTQFOEFSFMSJFHPDVBOEPFM
sistema alcance un nivel de temperatura mnima preestablecido
t-BTVTUJUVDJOEFMBCBUFSBFTVOBPQFSBDJONVZTJNQMFRVFOPSFRVJFSF
herramientas ni desmontar el sensor
t&MTPQPSUFEFMTFOTPSBVUPOJWFMBOUFTFJOTUBMBGDJMNFOUFTPCSFTVQFSGJDJFT
planas o canalones de lluvia

Programadores

t$NPEPBKVTUFZDPOUSPMEFMBDPOGJHVSBDJOEFMMVWJBPIFMBEBTFOMBJOUFSGB[
del controlador.
El slido soporte
autonivelante
mantiene la
orientacin del
sensor de lluvia

La sustitucin de la
batera no requiere
herramientas

t-BTBOUFOBTFTUOPDVMUBTFOFMJOUFSJPSEFMBTVOJEBEFT QBSBNFKPSBSFM
aspecto visual y la dureza del producto

Antenas internas
robustas para
mejorar la esttica

Especificaciones elctricas
t"QMJDBDJOBEFDVBEBQBSBVTPDPODPOUSPMBEPSFTEF7$"EF3BJO#JSEZEF
competidores (con o sin bomba de arranque / vlvula maestra)
t$BQBDJEBEFMDUSJDBBEFDVBEBQBSBVTBSIBTUBTFJTTPMFOPJEFTEF7$"7"
y una vlvula maestra o bomba de arranque que no exceda de 53 VA
t$BCMFEFMBJOUFSGB[EFMDPOUSPMBEPSBMBSHBEPSEFw DN
EFMPOHJUVE 
calibre 22 (0.64 mm), resistente a la radiacin UV

Cmo especificar

t$FSUJGJDBDJPOFT6- D6- $& $5JDLZ8&&&

WR2 - RC

t5SBOTDFQUPSFTEFSBEJPEFEPTWBTEFFTQFDUSPBNQMJPBQSPCBEPTQPSMB'$$
como Clase B

Modelo

Norteamrica (916 MHz)

WR2

RC: combo lluvia


3'$DPNCPMMVWJBIFMBEBT
RS: sensor de lluvia solamente
3'4TFOTPSEFMMVWJBIFMBEB
solamente
3'*JOUFSGB[EFMDPOUSPMBEPSEF
lluvia / heladas solamente

t%JTUBODJBEFUSBOTNJTJOEFMBTFBMEF N
FOMOFBWJTVBM
t%VSBDJOEFMBQJMBIBTUBBPTFODPOEJDJPOFTEFVTPOPSNBMFT
t1SPUFDDJODPOUSBTPCSFDBSHBTSBZPTEF,7

El uso inteligente del agua.

137

Accesorios para controladores


Sensores de lluvia y heladas inalmbricos Serie WR2

Sensores de flujo y transmisores (cont.)

Modelos
t833$DPNCPMMVWJB

Propiedades mecnicas

t833'$DPNCPMMVWJBIFMBEBT

t7BMPSFTEFMMVWJBBKVTUBCMFTEFwBw EFBNN

t7BMPSFTEFUFNQFSBUVSBCBKBBKVTUBCMFTEF'B' EFB$

t5SFTNPEPTEFSJFHPTFMFDDJPOBCMFT1SPHSBNBEP 3JFHPDBODFMBEPEVSBOUF
72 horas, Ignorar el sensor durante 72 horas

t8334TFOTPSEFMMVWJBTPMBNFOUF
t833'4TFOTPSEFMMVWJBIFMBEBTPMBNFOUF
t833'*JOUFSGB[EFMDPOUSPMBEPSEFMMVWJBIFMBEBTTPMBNFOUF

t6OJEBEFTEFQPMNFSPEFBMUBDBMJEBE SFTJTUFOUFBMPTSBZPT67ZBMB
intemperie

Piezas de sustitucin o repuesto

t-BGVODJOEFEFTDPOFYJOSQJEBTVTQFOEFFMDJDMPEFSJFHPBDUJWPFO
aproximadamente dos minutos

t%JTDPEFNPOUBKFQBSB834

t1JMBQBSB834

Dimensiones
t*OUFSGB[EFMDPOUSPMBEPS83
- Ancho: 3.1 (7.9 cm)
- Largo: 6.8 (17.2 cm)
- Profundidad: 1.7 (4.3 cm)
%JTUBODJBFOUSFPSJGJDJPTEFNPOUBKF DN

t$POKVOUPEFMTFOTPS83
- Largo del sensor: 5.8 (14.7 cm)
- Largo del soporte de unin: 4.6 (11.7 cm)
%JTUBODJBFOUSFPSJGJDJPTEFNPOUBKF DN

 %FTQMB[BNJFOUPIPSJ[POUBM TPQPSUF CSB[PEFCPMBGJKP


w DN

Programadores

Paso 1

Programe en segundos

138

Paso 2

Determine la mejor
ubicacin del sensor

Paso 3

Instale el sensor
fcilmente con el
soporte de montaje

El uso inteligente del agua.

Accesorios para controladores


4FOTPSFTEFMMVWJB34%#&Y34%$&Y

www.rainbird.com/controllers

RSD-BEx / RSD-CEx
Sensor de lluvia

Caractersticas y beneficios
t&MBQBHBEPBVUPNUJDPQPSMMVWJBFWJUBFMSJFHPFYDFTJWPDBVTBEPQPSMBT
precipitaciones naturales
t&MEJTFPSFTJTUFOUFZDPOGJBCMFSFEVDFMBQSPCBCJMJEBEEFRVFTFSFBMJDFO
llamadas por disconformidad del servicio

La bisagra de enganche
mantiene la alineacin

t-PTEJTDPTTFOTPSFTEFIVNFEBEGVODJPOBOFOVOBWBSJFEBEEFDMJNBT
t-PTEJGFSFOUFTNPOUBKFTEFMTFOTPSMPHSBOWFMPDJEBEZGMFYJCJMJEBEFOFMMVHBS
de trabajo
t-BCJTBHSBEFFOHBODIFNBOUJFOFMBBMJOFBDJO

Propiedades mecnicas
t.MUJQMFTQBSNFUSPTEFQSFDJQJUBDJOEFTEFcwIBTUBw EFBNN

rpidos y fciles de ajustar con solo girar el disco de seleccin
t"OJMMPEFWFOUJMBDJOBKVTUBCMFQBSBDPOUSPMBSFMUJFNQPEFTFDBEP

RSD-BEx

t$VFSQPEFQPMNFSPEFBMUBDBMJEBE SFTJTUFOUFBMPTSBZPT67ZBMBJOUFNQFSJF
t%JTQPOJCMFFOWFSTJOEFNOTVMBSFTJTUFOUF FMNPEFMP34%#&YJODMVZF
mnsula de aluminio de enganche de 5 [12.7 cm]) o versin de conductos
34%$&Y
QBSBVOBJOTUBMBDJOQSPMJKBZQSPGFTJPOBM

Especificaciones elctricas
t"QMJDBDJOBQUPQBSBDJSDVJUPTEFDPOUSPMEF7$"EFCBKPWPMUBKFZDJSDVJUPT
EFSFMEFBSSBORVFEFCPNCBEF7$"
t&TQFDJGJDBDJPOFTFMDUSJDBTEFMJOUFSSVQUPS"B7$"
t$BQBDJEBEFTQFDJGJDBDJPOFTFMDUSJDBTBQUBTQBSBVTPDPOIBTUBEJF[WMWVMBT
solenoides de 24 VCA, 7 VA por estacin, ms una vlvula maestra
Programadores

t$BCMFDBCMFEFFYUFOTJOSFTJTUFOUFBMPTSBZPT67EFEPTDPOEVDUPSFT 
de 25 (7.6 m) de largo, N 20
t"QSPCBEPQPS6- D6- $&Z$5JDL
* No se recomienda su uso con circuitos o dispositivos para arranques de bomba o para rels de
arranque de bomba de alto voltaje.

Dimensiones
t34%#&Y
- Longitud general: 6.5" (16.5 cm)
- Altura total: 5.4" (13.7 cm)
- Patrn de orificios de la mnsula: 1.25" (3.2 cm)
t34%$&Y

RSD-CEx

- Longitud general: 3" (7.6 cm)


- Altura total: 2.75" (7 cm)

Modelos
t34%#&YTFOTPSEFMMVWJBDNOTVMBEFFOHBODIF DBCMFEFFYUFOTJO
t34%$&YTFOTPSEFMMVWJBDBEBQUBEPSSPTDBEP DBCMFEFFYUFOTJO

Cmo especificar
RSD-BEx
Cable de extensin
25' (7.6 m) de largo
Montaje
BE: soporte de metal
CE: versin de conductos
Modelo
34%EJTQPTJUJWPTFOTPSEFMMVWJB

El uso inteligente del agua.

139

Accesorios para controladores


Rain Check, pedestales de controladores

Dimensiones

Rain Check

t-BSHPwNYJNP DN

Apagado automtico por lluvia

t"MUVSBNYJNP DN

Caractersticas
t4POEBTTFOTPSBTEFBDFSPJOPYJEBCMFBKVTUBCMFTRVFCSJOEBOMBGMFYJCJMJEBEEF
activar el apagado por lluvia con tan solo 1/8 (3.2 mm) de precipitacin
t&MBHVBFOMBDPMFDUPSBEFMMVWJBTFFWBQPSBNTSQJEBNFOUFRVFMB
humedad del suelo para permitir el riego si es necesario

t"ODIP12" mximo (6.4 cm)

Modelo
t3BJO$IFDL

t&MEJTFPFMFDUSOJDPFMJNJOBMPTNJDSPJOUFSSVQUPSFTZMPTEJTDPTEF
absorcin de agua que pueden oxidarse o desgastarse
t$POTUSVJEPFOQMTUJDPSFTJTUFOUFBMPTSBZPT67QBSBBVNFOUBS
su vida operativa en ambientes adversos
t'VODJPOBDPOQSDUJDBNFOUFUPEPTMPTDPOUSPMBEPSFTEF7$"QBSBVOB
mxima versatilidad

Especificaciones
t&OUSBEBSFRVFSJEBTFDPOFDUBBMDBCMFDPNOEFMBWMWVMB
t'VTJCMF"
t$PMFDUPSBFYUSBCMFQBSBQPEFSMJNQJBSMB
t$BQBDJEBEEFWMWVMBTNMUJQMFTIBTUBUSFTWMWVMBTTPMFOPJEFTEF7$"QPS
estacin
t/PSFDPNFOEBEPQBSBVTPDPOSFMTEFBSSBORVFEFCPNCBT
de accin directa (interruptor para cortar el caudal)
t/PFTDPNQBUJCMFDPODPOUSPMBEPSFTEFMBTFSJF&41.FZ&413;9

Rain Check

Programadores

Pedestales de controlador
1FEFTUBMFTQBSBTFSJFT&41.$ &41-9 &414"5Z$$6

Caractersticas
t*ODMVZFUPEPTMPTQFSOPT MBTUVFSDBTZMBTSPOEBOBTOFDFTBSJPTQBSBFMNPOUBKF

Especificaciones
t.BUFSJBMBDFSPSFDVCJFSUPEFQJOUVSBFOQPMWP
t$POFYJOQBSBFMDBCMFBEPEFMUFSSFOPFOFMDPOUSPMBEPS
El PED-DD16 se muestra con
el ESP-12 SAT-2W

Dimensiones
Ancho

Fondo

t1&%%%

Modelo Altura

 DN


 DN


 DN

t-9..1&%

 DN


 DN


 DN


t-9..

7 8 DN




 DN


 DN

Modelo
t1&%%%1FEFTUBMQBSB&414"5 &414*5&Z$$6
t-9..HBCJOFUFEFNFUBMQBSBDPOUSPMBEPSFTTFSJF41-9
t-9..1&%QFEFTUBMEFNFUBMQBSBDPOUSPMBEPSFTTFSJF&41-9
* Nota: los armarios y pedestales de metal no son estndar para los controladores de la
serie ESP-LX y deben adquirirse por separado. Con LXMMPPD se requiere LXMM.

El LXMMPED se muestra
con el ESP-LXME en el
gabinete de metal LXMM

140

El uso inteligente del agua.

Accesorios para controladores

www.rainbird.com/controllers

Accesorios, tablas de uso de energa

Conector de cables serie DB

Cable flexible de conexin

Conector de cables roscado para instalacin subterrnea con alivio de


tensin

Caractersticas

Caractersticas y beneficios

t5SFTDBCMFTDPOEVDUPSFTUSFO[BEPTDBMJCSF

tQJFT N
EFMBSHP

t$POFDUPSEFVOBTPMBQJF[BGDJMEFVTBS

t5JQPEFDPOFDUPSNPMEFBEPEFHSBEPT/FNB1

t"MJWJPEFUFOTJOQBSBBTFHVSBSRVFMPTDBCMFTFTUOTFHVSPTZOPTF
desconecten

t$PMPSHSJT

t$FSUJGJDBDJO6-%EFBQUJUVEQBSBFOUFSSBS

Modelo

t&MTFMMBEPEFTJMJDPOBBQSVFCBEFBHVBQSPUFHFDPOUSBMBDPSSPTJO

t1*(5"*-

Especificaciones
t1BSBDBCMFTEFDBMJCSFB
t6TPFODPOFYJPOFTEF7$"B7$"

Modelo
t%#58$

Conector de cables serie DB

PIGTAIL

Programadores

Resumen de uso de energa del controlador de Rain Bird (con una vlvula maestra)

STP Plus

ESP-Modular

ESP-SMT

Serie ESP-LX
7.26 W

Energa auxiliar del controlador

0.86 W

2.62 W

8

Energa usada por la vlvula maestra

4.5 W

4.5 W

4.5 W

5.0 W

Energa usada para cada vlvula activa

3.40 W

3.75 W

3.75 W

3.75 W

* Controlador con sensor acoplado

ZONA
1

a) Energa de la vlvula maestra de la tabla (si es aplicable)

10
Vatios

b) N. de vlvulas en esta zona


c) Energa de la vlvula de la tabla anterior

Vatios

E
5JFNQPEFSJFHPEJBSJPQBSBFTUB[POB

minutos

6TPEFFOFSHBEJBSJPEFMBWMWVMBQPS[POB B C D
E
60,000

,XI

Uso de energa total diario de la vlvula Sume el uso diario de todas las zonas anteriores
Uso de energa diario del controlador Energa auxiliar del controlador 24 / 1000
Uso de energa anual/ mensual (Uso de energa diario del controlador N. de das que el sistema est
enchufado) + (Uso de energa total diario de la vlvula Cantidad de das
que riega el sistema)

El uso inteligente del agua.

kWh
kWh

kWh

141

Cuerpos de difusores

Controles centralizados
Introduccin
Cuerpos de
aspersores
Boquillas aspersoras
Rotores
Impactos

Recomendamos Maxicom2 a nuestros


clientes porque el sistema es el mtodo
ms eficaz y eficiente para controlar
reas individuales dentro de sistemas de
riego complejos. Maxicom2 analiza las
condiciones meteorolgicas a partir de las
24 horas previas y ajusta la cantidad de
agua necesaria segn dichas condiciones y
para cada rea especfica. Nuestros clientes
disfrutan de los beneficios: costos ms bajos
de mano de obra y agua, adems de plantas
y csped ms sanos.

Vlvulas
Accesorios
Programadores

Ellen Beighley, Presidente


Irrigation management Systems

Sistemas de control
centralizado
Xerigation
Bombas
Drenaje

Sugerencias para ahorrar agua


.

t Los sistemas Maxicom , SiteControl e


2

Recursos

*2 proporcionan un ajuste
completamente automtico de
FWBQPUSBOTQJSBDJO &5
EFQSPHSBNBT
de riego para ahorrar mayor cantidad
de agua.

Referencia

142

t Los sistemas Maxicom F*2


2

proporcionan las herramientas para


manejar de manera eficaz docenas y
hasta cientos de sistemas de riego en
diversos sitios remotos desde una
sola computadora.

t -BGVODJO'MP8BUDI

de Maxicom2
F*2 vigila y registra los flujos en
tiempo real, realiza un diagnstico
automtico y elimina los problemas
de flujo provocados por tuberas
rotas, vandalismo o vlvulas
obstruidas.

El uso inteligente del agua.

Sistemas de control centralizado

www.rainbird.com/centralcontrols

Productos principales

Caractersticas principales

Aplicaciones principales

IQ

Control centralizado para mltiples sitios


Control centralizado para un solo sitio
Sistema de controlador satelital
Sistema de decodificador de dos cables
Sistema de decodificador/satelital hbrido
Caractersticas
Programa de computadora
Monitoreo por computadora
Operacin manual de la computadora
Interfaz de mapa interactivo
1SPHSBNBDJOEF&5
"KVTUFBVUPNUJDPEF&5
Reaccin de Smart Weather
Programacin de operacin en seco
Gestin de caudal
Monitoreo de flujo
Busca/Elimina problemas de flujo
Cierre por flujo alto
Cierre por flujo bajo
Rain Watch
Apagado por lluvia
Sistema Cycle + Soak (de ciclo/remojo)
Hardware
Computadora incluida con el software
*OUFSGB[&414"5$$6
*OUFSGB[&414"558*
*OUFSGB[EFMEFDPEJGJDBEPS4%*-%*
%FDPEJGJDBEPSFTEFEPTDBCMFT'%563'
4BUMJUF&414"5
4BUMJUFEFTJUJP&414*5&4"5
,JUEFBDUVBMJ[BDJO&41.*#
,JUEFBDUVBMJ[BDJO&414*5&6
Satlite de la serie ESP-LX
,JUEFBDUVBMJ[BDJO*2/$$
,JUSBEJPNEFNEFFOMBDF
$POUSPMSFNPUP'3&&%0.
%FTDPEJGJDBEPSFTEFTFOTPSFTEFQVMTPT%&$
%JTQPTJUJWPEFBQBHBEPQPSMMVWJB34%
'4TFOTPSFTEFGMVKP
Estacin meteorolgica WSPRO2
&TUBDJONFUFPSPMHJDB84130-5
4&/403%&--67J"3BJOHBVHF
"/&..&530 TFOTPSEFWJFOUP

O
O
O
O
O

SiteControl

O
O
O
O
O
O
O
O
O
O
O
O
O

Maxicom2
O

O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O

O
O
O
O
O

O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O

O
O
O
O

O
O

O
O
O
O
O

O
O
O
O
O
O
O
O
O

O
O
O
O
O
O
O
O

Informacin sobre los sistemas de control centralizado


El sistema de control centralizado de riego es un sistema computarizado que
permite la programacin, el monitoreo y la operacin de un sistema de riego
desde una ubicacin central. Los sistemas de control centralizado estn diseados
para que un solo sitio (como un campus universitario o una sede corporativa) o
un grupo de sitios (tales como distritos escolares, oficinas gubernamentales de
parques y recreacin) puedan controlar todo el riego desde una computadora
central. El control centralizado permite monitorear y adaptar automticamente el
funcionamiento del sistema y los tiempos de riego como respuesta a condiciones
en el sistema y en las reas circundantes (como cambios climticos, roturas de
tuberas, etc.), adems de los parmetros definidos por el operador.

Sistema de control centralizado de Rain Bird


Rain Bird desarroll el sistema original de control centralizado computarizado en la
dcada de 1970, y actualmente tiene miles de sistemas instalados en todo el mundo.

Controladores de satlite y decodificadores de campo

Programacin centralizada
Un sistema de control centralizado permite realizar la programacin desde
una sola computadora, lo que ahorra el tiempo y el dinero que por lo general
se gasta en el traslado hasta los controladores. Los cambios que realiza el
programa a los mltiples controladores en mltiples sitios pueden realizarse
en slo unos minutos. Los tiempos de riego se pueden ajustar de manera
automtica agregando una estacin meteorolgica o sensores.

Comunicacin del sistema


Opciones de comunicacin entre la computadora central y los controladores
de riego, los decodificadores, los sensores y las estaciones meteorolgicas se
incluyen la conexin con cables, conexin directa, telfono, telfono celular,
SBEJP GJCSBQUJDB &UIFSOFUZ8J'J

Funcionamiento y monitoreo del sistema


El sistema de control centralizado realiza monitoreos y puede utilizar sensores
de flujo, lluvia, viento, humedad y dems para ajustar el funcionamiento
o llevar a cabo una accin en tiempo real. Los registros operativos del
sistema y cualquier alarma por los problemas que ocurran se comunican a la
computadora central, en donde se generan los reportes.

Sistemas Rain Bird de control centralizado para


mltiples sitios
Maxicom2
Maxicom2 es una herramienta de administracin de riego con caractersticas
que permiten controlar mltiples sistemas de riego remotos, pequeos y
grandes. Maxicom2 ofrece caractersticas superiores de administracin de riego
con la tecnologa de controlador por satlite. Maxicom2 es la herramienta de
eleccin de los administradores de riego, las oficinas gubernamentales de
parques y recreacin, los distritos escolares y los parques temticos en todo el
mundo.

IQ
&MTJTUFNB*2PGSFDFVOQSPHSBNBEFTPGUXBSFNPEVMBSTJNQMFZGDJMEF
entender y un hardware modular para la supervisin de los controladores
de satlite en mltiples sitios. Adems, incluye muchas caractersticas para el
ahorro de tiempo y agua que eliminan la necesidad de trasladarse al sitio para
volver a programar o monitorear el sistema de riego. Es la herramienta ideal
para una amplia variedad de aplicaciones comerciales.

Sistemas Rain Bird de control centralizado para


un solo sitio
SiteControl
El sistema SiteControl ofrece caractersticas de control centralizado altamente
eficaces para sitios simples, grandes y contiguos. SiteControl proporciona
un control interactivo basado en mapas y una comunicacin en tiempo real
entre el campo y la computadora central. Puede controlar decodificadores
de dos cables, controladores de satlite o ambos a la vez, a fin de permitir la
posibilidad de expansin y lograr una flexibilidad inigualable. Es ideal para
los desarrollos de propiedades, complejos de campos de deportes, centros
comerciales, cementerios, complejos vacacionales y hoteles.

Rain Bird ofrece una variedad de sistemas para satisfacer las necesidades del cliente,
de presupuesto, sitio o aplicacin. Seleccione sistemas diseados especficamente
para un solo sitio o para mltiples sitios, ya sean pequeos o grandes. Los sistemas
de control centralizado de Rain Bird pueden utilizar controladores de satlite,
decodificadores de dos cables o una combinacin de ambos.

El uso inteligente del agua.

143

Sistemas de control
centralizado

Productos principales

Sistemas de control centralizado


4PGUXBSF*2W

Software de control centralizado IQ v2.0


Control centralizado modular para mltiples sitios
Q 'VODJPOFTBWBO[BEBTEFDPNBOEPZDPOUSPMDPOVOBJOUFSGB[GDJMEF
aprender y utilizar
Q Proporciona funciones de gestin de agua avanzadas que permiten
ahorrar tiempo y dinero
Q &MTPGUXBSFEF*2DVFOUBDPODBQBDJEBEZGVODJPOFTQBSBDPOUSPMBEPSFT
de satlites modulares. Compre slo lo que necesite y actualcelo en el
futuro a medida de que cambien sus necesidades
*2QSPQPSDJPOBQSPHSBNBDJO HFTUJOZDPOUSPMSFNPUPTEFMPTDPOUSPMBEPSFT
EFMBTFSJF&41-9EFTEFFMPSEFOBEPSEFTVPGJDJOB*2FTMBTPMVDJOEF
control de riego perfecta para departamentos de parques, distritos escolares,
administradores de propiedades, contratistas de mantenimiento paisajstico y
HFTUPSFTEFSJFHP*2QVFEFHFTUJPOBSFNQMB[BNJFOUPTDPOVOTPMPDPOUSPMBEPS
y tambin emplazamientos con mltiples controladores y admite tanto los
controladores de la serie ESP-LX cableados del modo tradicional como los
controladores con decodificador de 2cables.

Paquete de software IQ v2.0


Software IQ v2.0

t&MQBRVFUFEFTPGUXBSFCTJDP*245"35$%UJFOFDBQBDJEBEQBSB
controladores de 5 satlites y ofrece un conjunto de funciones bsicas.
-BDBQBDJEBEEFDPOUSPMBEPSFTEFTBUMJUFTEFMTPGUXBSFEF*2TFQVFEF
BNQMJBSFOJODSFNFOUPTEFTBUMJUFTDPOMBBDUVBMJ[BDJO*24"5486IBTUB
la capacidad total de satlites que se necesite. Lospaquetes de funciones del
TPGUXBSFEF*2JODMVZFOGVODJPOFTBEJDJPOBMFT-PTQBRVFUFTEFGVODJPOFT
incluyen un lote de funciones relacionadas que amplan las capacidades del
QBRVFUFEFTPGUXBSFCTJDPEF*2

Sistemas de control
centralizado

t&MTPGUXBSFCTJDPEF*2ZMPTQBRVFUFTEFGVODJPOFTJODMVZFOVOTJTUFNBEF
ayuda sensible al contexto. Haga clic en el icono de ayuda disponible en la
mayora de las pantallas e ir directamente al tema de ayuda de la funcin
que est utilizando. El software ofrece mltiples idiomas y formatos de fecha/
hora y unidades, lo que permite al usuario interactuar con el software en su
idioma principal. Los idiomas que puede seleccionar el usuario son ingls,
espaol, francs, alemn, italiano y portugus.

Funciones del paquete de softwarebsico


t$BQBDJEBEEFDPOUSPMBEPSFTEFTBUMJUFTEFMTPGUXBSFBNQMJBCMFFO
incrementos de 5 satlites

Cmo especificar
SOFTWARE IQ V2.0 Y
PAQUETES DE FUNCIONES
*245"35$% 1BRVFUFEFTPGUXBSFCTJDP 
capacidad para 5 satlites
*24"5486 "NQMJBDJOEFMBDBQBDJEBE
del software en 5 satlites
adicionales
*24"5/$$6 "NQMJBDJOEFMBDBQBDJEBE
EF*2/FUFOTBUMJUFT
cliente adicionales
*2"$0.'1 1BRVFUFEFGVODJPOFT
avanzadas de
comunicaciones
*2"1(.'1 1BRVFUFEFGVODJPOFT
avanzadas de programacin
*2"&5'1
1BRVFUFEFGVODJPOFT
BWBO[BEBTEF&5
*2"'4&/'1 1BRVFUFEFGVODJPOFT
avanzadas de deteccin de
caudal

t$BQBDJEBEEFDPOUSPMBEPSFTEFTBUMJUFTDMJFOUFEF*2/FUBNQMJBCMFFO
incrementos de 5 satlites
t$PNQBUJCMFDPODPOUSPMBEPSFT&41-9.Z&41-9.&DBCMFBEPTEFGPSNB
USBEJDJPOBMZDPOUSPMBEPSFT&41-9%DPOEFDPEJGJDBEPSEFDBCMFT DPOTVMUF
las pginas 126-128)
t/PNCSFTEFFNQMB[BNJFOUP TBUMJUFZFTUBDJO
t1SPHSBNBDJOFOTFHVOEPT NJOVUPTZIPSBT
tEFBKVTUFFTUBDJPOBMEJBSJPPNFOTVBMPBKVTUFTEFUJFNQPEF
GVODJPOBNJFOUPEFFTUBDJPOFT&5QPSFNQMB[BNJFOUP
t3FWJTJODPOFMQSPHSBNBHSGJDP%SZ3VO
t$PNVOJDBDJOQBSB4JODSPOJ[BSZ3FDVQFSBSSFHJTUSPTJOJDJBEBQPSFMVTVBSJP
t*OJDJPTEFQSPHSBNBNBOVBM QSPHSBNBEFQSVFCBZFTUBDJO
t3FHJTUSPTFJOGPSNFTEFUBMMBEPT

-BFWBQPUSBOTQJSBDJO &5
FTMBDPNCJOBDJOEFMBQSEJEBEFBHVBEFMTVFMPQPSFWBQPSBDJOZMBQSEJEBEFBHVBQPSMBUSBOTQJSBDJOEFMBTQMBOUBT
&MDPOTVNPUPUBMEFMBHVBTFQVFEFSFEVDJSNFEJBOUFMBDBSBDUFSTUJDBEF&5EFMTJTUFNB*2QBSBEFUFSNJOBSDVOEPZRVDBOUJEBETFEFCFSFHBS

144

El uso inteligente del agua.

Sistemas de control centralizado


4PGUXBSF*2W

www.rainbird.com/centralcontrols

Requisitos del ordenador recomendados

Paquete de funciones avanzadas de programacin

t4JTUFNBPQFSBUJWP8JOEPXT91PEFCJUTPEFCJUT

t1SPUFDDJODPODEJHP1*/EFMPTTBUMJUFT TFSFRVJFSFVODEJHP1*/EF
dgitos para hacer cambios de programacin en el satlite)

t1SPDFTBEPS*OUFM*.PFRVJWBMFOUF
t.FNPSJB3"..OJNPEF(#
t&TQBDJPEJTQPOJCMFFOFMEJTDPEVSP(#
t6OJEBEEF$%30.7FMPDJEBENOJNBEF9
t3FTPMVDJOEFMBQBOUBMMBYNOJNP

t1SPHSBNBDJOCJEJSFDDJPOBMEFTBUMJUFT MPTDBNCJPTSFBMJ[BEPTFOFMTBUMJUF
TFQVFEFOWFSZBDFQUBSFOFMTPGUXBSFEF*2

t6UJMJEBEQBSBDPQJBSUSBTMBEBSTBUMJUFT DPQJBPUSBTMBEBVOTBUMJUFBPUSP
emplazamiento)

t.PEFNUFMFGOJDP'MFY, DPNVOJDBDJOUFMFGOJDB

Paquete de funciones avanzadas de ET

t$POFYJOEFSFE QBSB&UIFSOFU 8J'J DPNVOJDBDJO(134

t"KVTUFTBVUPNUJDPTEFMBQSPHSBNBDJOEFSJFHP."% HFTUJOEFMDPOTVNP
permitido)

t1VFSUPEFTFSJFPBEBQUBEPSEF64#BTFSJF QBSBDPOFYJOEJSFDUBZ
comunicacin por mdem externo)

Ampliacin de la capacidad en 5satlites adicionales


t-BDBQBDJEBEEFDPOUSPMBEPSFTEFTBUMJUFTDMJFOUFEFMTPGUXBSF*2F*2/FUTF
puede ampliar en incrementos de 5 satlites
t4FQVFEFBBEJSDBQBDJEBEBEJDJPOBMDPNQSBOEPVODEJHPEFBDUJWBDJOEF
software

t&MTPGUXBSFFNQMFBMBUFDOPMPHBZMBTGSNVMBTEFMB"TPDJBDJOEF3JFHP
t-BTGVFOUFTNFUFPSPMHJDBTEF&5MMVWJBTPOMBTTJHVJFOUFT
- Servicio de Internet CIMIS (slo California)
 %JSFDUPS&5.*&5EFMTFSWJDJPEF8FBUIFS3FBDI "NSJDBEFM/PSUF
solamente)
 &TUBDJONFUFPSPMHJDB3BJO#JSE84130-5
- Estacin meteorolgica Rain Bird WSPRO2

Paquetes de funciones de IQ

tUBMPOBSJPTEF&5QPSDPOUSPMBEPSEFTBUMJUFT

t-PTQBRVFUFTEFGVODJPOFTTFBDUJWBODPNQSBOEPVODEJHPEFBDUJWBDJOEF
software

t&YQPSUBDJOB.JDSPTPGU&YDFMQBSBJOGPSNFTQFSTPOBMJ[BEPT

t-PTQBRVFUFTEFGVODJPOFTTFBDUJWBOQBSBUPEPTMPTFNQMB[BNJFOUPTZ
TBUMJUFTFOFMTPGUXBSFEF*2

Paquete de funciones avanzadas de deteccin de caudal

Paquete de funciones avanzadas de comunicaciones


t$PNVOJDBDJOBVUPNBUJ[BEBQBSB4JODSPOJ[BSZ3FDVQFSBSSFHJTUSPTZ
Recuperar datos meteorolgicos de la fuente meteorolgica
t*2$BMMJOQBSBTBUMJUFT FMTBUMJUFJOJDJBMBDPNVOJDBDJO TPMPDBSUVDIP
telefnico NCC-PH)

t3FDVQFSBSFHJTUSPTEFDBVEBMNJOVUPBNJOVUPEFMTFOTPSEFDBVEBMJOUFHSBEP
FOMPTDPOUSPMBEPSFTEFTBUMJUFT&41-9.&'Z&41-9%
t*OGPSNFHSGJDPEFSFHJTUSPTEFDBVEBMGSFOUFBDBVEBMQSFWJTUP JEFOUJGJDBRV
programas y estaciones estaban funcionando en un momento determinado)
t*OGPSNFEFUPUBMFTEFDBVEBMBDUVBMFTBBEJEPTBMUJFNQPEFGVODJPOBNJFOUP
de la estacin de satlites (incluidos en los informes de correo electrnico
automticos)

Sistemas de control
centralizado

t"MBSNBBMFSUBEFDPSSFPFMFDUSOJDPBVUPNUJDBFJOGPSNFTEFUJFNQPEF
funcionamiento de las estaciones de satlites

El uso inteligente del agua.

145

Sistemas de control centralizado


$BSUVDIPEFDPNVOJDBDJPOFTEFSFE*2/$$

Cartucho de comunicaciones de red IQ NCC


Actualiza cualquier controlador serie ESP-LX a un controlador de
TBUMJUFEFMTJTUFNBEFDPOUSPMDFOUSBMJ[BEPEF*2
Q *2FTMBTPMVDJOEFDPOUSPMEFSJFHPQFSGFDUBQBSBEFQBSUBNFOUPTEF
parques, distritos escolares, administradores de propiedades, contratistas de
mantenimiento paisajstico y gestores de riego.

Q *2QVFEFHFTUJPOBSUBOUPTJUJPTDPOVOTPMPDPOUSPMBEPSDPNPHSBOEFTTJUJPTDPO
mltiples controladores

Q -PTDBSUVDIPT*2/$$TPODPNQBUJCMFTDPOMPTDPOUSPMBEPSFT&41-9.&
cableados de forma tradicional con capacidad para entre 1 y 48 estaciones y los
DPOUSPMBEPSFT&41-9%EFDBCMFTDPODBQBDJEBEQBSBFOUSFZFTUBDJPOFT

Satlites directos
t-PTTJUJPTDPOVOTPMPDPOUSPMBEPSVUJMJ[BSBOVODBSUVDIP*2/$$
configurado como satlite directo. Un satlite directo tiene una conexin de
DPNVOJDBDJPOFTDPOMBDPNQVUBEPSBDFOUSBMEF*2QFSPOPDPOFYJPOFTEFSFE
con otros satlites del sistema

Satlites servidores y clientes

Cartucho Wi-Fi IQ-NCC-WF


t*ODMVZFVONEFNEFSFEJOBMNCSJDB8J'JJOUFHSBEPDPODPOFDUPSEF
antena y una antena interna para cajas de controlador de plstico (requiere
direccin IP esttica para red LAN; antena externa opcional para cajas de
controlador metlicas)
t$PNQBUJCMFDPODJGSBEP81"81"

Cartucho RS232 IQ NCC-RS


t*ODMVZFVOQVFSUP34QBSBMBDPOFYJOEFDPNVOJDBDJPOFTEFMNEFN
FYUFSOPPDBCMFEJSFDUPEF*2DPOMBDPNQVUBEPSBDFOUSBMEF*2ZVODBCMF
QBSBFMNEFNFYUFSOP TFTVNJOJTUSBVODBCMFEJSFDUP*2DPOFMQBRVFUFEF
TPGUXBSF*2

t4FVUJMJ[BQBSBBQMJDBDJPOFTEFTBUMJUFTEJSFDUPTPTFSWJEPSFTRVFSFRVJFSFO
comunicacin a travs de una conexin por cable directo o un mdem
FYUFSOP SBEJPVPUSPEJTQPTJUJWPFYUFSOP
DPOMBDPNQVUBEPSBDFOUSBMEF*2
y para aplicaciones de satlites clientes que requieren comunicacin a travs
EFVODBCMFEFEBUPTEFBMUBWFMPDJEBE*2/FUPSBEJPDPOFMTBUMJUFTFSWJEPS

Mdulo de conexin inteligente de caudal IQ-FSCM-LXME


t1SPQPSDJPOBDPOFYJPOFTQPSDBCMFEFEBUPTEFBMUBWFMPDJEBE*2/FUQBSBFM
controlador ESP-LXME

t-PTTJUJPTDPONMUJQMFTDPOUSPMBEPSFTVUJMJ[BSBOVODBSUVDIP*2/$$
configurado como satlite servidor y los dems cartuchos NCCconfigurados
como satlites clientes. El satlite servidor tiene una conexin de
DPNVOJDBDJPOFTDPOFMPSEFOBEPSDFOUSBMEF*2ZDPNQBSUFFTUBDPOFYJO
de comunicaciones con los satlites clientes a travs de cables de datos de
alta velocidad o radios. La conexin de comunicaciones entre los satlites
TFSWJEPSFTZDMJFOUFTSFDJCFFMOPNCSFEF*2/FU

Mdulo de conexin IQ-CM-LXD

t-PTTBUMJUFTEFVOB*2/FUDPNODPNQBSUFOMPTTFOTPSFTNFUFPSPMHJDPTZMBT
vlvulas maestras

Mdem de radio IQ SS-Radio

Sistemas de control
centralizado

t-PTTBUMJUFTTFSWJEPSFTZDMJFOUFTRVFVUJMJ[BODBCMFEFEBUPTEFBMUBWFMPDJEBE
QBSBMBDPNVOJDBDJOFO*2/FUSFRVJFSFOMBJOTUBMBDJOEFVONEVMPEF
DPNVOJDBDJPOFT*2$.-PTTBUMJUFTTFSWJEPSFTZDMJFOUFTRVFVUJMJ[BOMB
DPNVOJDBDJOQPSSBEJPFO*2/FUSFRVJFSFOMBJOTUBMBDJOEFVOBSBEJP
*2443"%*0$BEBLJUEFDBSUVDIPJODMVZFMPTDBCMFTQBSBDPOFDUBSFMDBSUVDIP
NCC al mdulo de conexin y/o la radio

Cartucho telefnico IQ-NCC-PH

t*ODMVZFGVODJPOFTEFNEVMPJOUFMJHFOUFZNEVMPCTJDPEFDBVEBM
t4VTUJUVZFBMNEVMPCTJDP&41-9.&FTUOEBS

t1SPQPSDJPOBDPOFYJPOFTQPSDBCMFEFEBUPTEFBMUBWFMPDJEBE*2/FUQBSBFM
DPOUSPMBEPS&41-9%
t4FJOTUBMBFOMBSBOVSBQBSBFMNEVMP&41-9% DFSP


t1SPQPSDJPOBDPNVOJDBDJOQPSSBEJPJOBMNCSJDB*2/FUFOUSFMPT
controladores de satlites servidores y clientes
t5BNCJOTFQVFEFVUJMJ[BSDPOFMDBSUVDIP*2/$$3434QBSBMB
DPNVOJDBDJOEFMBDPNQVUBEPSBDFOUSBMEF*2DPOMBSBEJPEFMPTTBUMJUFT
directos o servidores
t*ODMVZFGVFOUFEFBMJNFOUBDJOZBOUFOBFYUFSOB FMTPGUXBSFEF
programacin y el cable se suministran por separado)

t*ODMVZFVONEFNUFMFGOJDPBOBMHJDPEF,JOUFHSBEPDPOQVFSUP3+
t*ODMVZFDBCMFEFUFMGPOPNPEVMBS3+ SFRVJFSFMOFBUFMFGOJDBBOBMHJDB

Cartucho GPRS/mvil IQ-NCC-GP


t*ODMVZFVONEFNEFEBUPT(134NWJMJOUFHSBEPDPODPOFDUPSEFBOUFOB
t*ODMVZFVOBBOUFOBJOUFSOBQBSBDBKBTEFDPOUSPMBEPSEFQMTUJDP BOUFOB
externa opcional disponible para cajas de controlador metlicas)
t3FRVJFSFVOQMBOEFTFSWJDJPEFEBUPT(134NWJMDPOEJSFDDJO*1FTUUJDBEFM
proveedor de servicios de telefona mvil
t%JTQPOJCMFDPOFMQSJNFSBPEFMTFSWJDJPEFDPNVOJDBDJOJODMVJEP&MDBSUVDIP
con el servicio de comunicacin incluido no est disponible en todas la reas
NOTA: Los dispositivos con comunicacin inalmbrica requieren un estudio del terreno
para el uso del servicio inalmbrico (Modelos: IQNCC-GP, IQNCCWF, IQSSRADIO)

Cartucho Ethernet IQ-NCC-EN


t*ODMVZFVONEFNEFSFE&UIFSOFUJOUFHSBEPDPOQVFSUP3+
t*ODMVZFDBCMFEFDPOFYJO3+F SFRVJFSFEJSFDDJO*1FTUUJDBEFSFE-"/

Cartucho de
comunicaciones
de red IQ NCC

146

El uso inteligente del agua.

Sistemas de control centralizado


SiteControl

www.rainbird.com/centralcontrols

SiteControl
Sistema de control centralizado completo para aplicaciones de un
solo sitio
Q Software interactivo basado en mapas fcil de utilizar, que proporciona
la posibilidad de tomar decisiones en tiempo real

Q 'MFYJCJMJEBEEFDPNVOJDBDJPOFTJOJHVBMBCMFDPOEFDPEJGJDBEPSFTZP
satlites

Q Las caractersticas de administracin de agua avanzadas maximizan las


 condiciones del terreno y el ahorro de agua
Caractersticas bsicas de control
t%FTEFFMDPOUSPMBEPSDFOUSBM4JUF$POUSPM FMTJTUFNBEFSJFHPQVFEF
programarse para los das de riego, tiempos de riego, horarios de enlace,
arranques del sensor, horarios Cycle+Soak (de ciclo/remojo), programacin
sensibilizada a la evapotranspiracin, etc.
t&MNBQBJOUFSBDUJWPQFSNJUFFMNYJNPDPOUSPM ZBVOBT TJNQMJGJDB
el mapa interactivo permite el mximo control, y aun as, simplifica
t7FSJGJRVFMBQSPHSBNBDJOIBTUBFMOJWFMEFMBFTUBDJOVUJMJ[BOEPMB
DBSBDUFSTUJDB*OUVJUJWF%SZ3VO GVODJPOBNJFOUPJOUVJUJWPFOTFDP

t0QFSBDJONBOVBMEFMTJTUFNBEFTEFMBDPNQVUBEPSBDFOUSBMNFEJBOUF
BDDFTPNBOVBMEJSFDUP %."

t0QFSBDJOEFBQMJDBDJPOFTRVFOPFTUOSFMBDJPOBEBTDPOFMSJFHPFOT UBMFT
como iluminacin, portones de seguridad, fuentes, bombas, sensores, etc.

Caractersticas adicionales
Mapeo grfico avanzado
t-PTNBQBTHFOFSBEPTDPOUFDOPMPHB(14 TJTUFNBEFQPTJDJPOBNJFOUP
HMPCBM
"VUP$"%PGPUPHSBGBBSFBSFDSFBOTVTJUJP
SiteControl
Sistemas de control
centralizado

t&MNBQFPJOUFSBDUJWPZMPTHSGJDPTFOQBOUBMMBNVFTUSBOFM
sitio completo y permiten localizar los aspersores y las vlvulas individuales.
Genera informes de estado exhaustivos con slo presionar un botn
t&MNEVMPEFTPGUXBSF.BQ6UJMJUJFT VUJMJEBEFTEFNBQFP
QFSNJUFNFEJSMBT
distancias y las reas a partir de su propio mapa

Sistema hbrido
t"NQMFFMTJTUFNBDPOFMNEVMPEFTPGUXBSFICSJEP
t&MNJTNPTJTUFNBQVFEFPQFSBSTBUMJUFT&414"5ZPEFTDPEJGJDBEPSFTEFMB
TFSJF'%

Smart Weather
t%JTFBEPQBSBBQSPWFDIBSBMNYJNPMBMOFBNTBWBO[BEBEFFTUBDJPOFT
meteorolgicas de RainBird
t3BTUSFBMPTOEJDFTEFFWBQPUSBOTQJSBDJO &5
DPOVOBFTUBDJO
meteorolgica y reacciona frente a las condiciones climticas actuales
mediante pasos secuenciales lgicos
t&MVTVBSJPQVFEFEFGJOJSMPTVNCSBMFTEFMTFOTPSQBSBFMTJTUFNBBWBO[BEP
de advertencias. El operador del sistema puede recibir una alerta
inmediatamente si se exceden los umbrales

Las funciones Smart Weather y RainWatch de SiteControl permiten al operador configurar condiciones climticas predefinidas y las correspondientes
reacciones del sistema para ahorrar agua con las funciones automticas de arranque, pausa, reanudacin o cancelacin del programa segn el
viento, la temperatura, la lluvia, la radiacin solar y la humedad.

El uso inteligente del agua.

147

Sistemas de control centralizado


SiteControl

SiteControl (continuacin)
Caractersticas de ET automticas
t"KVTUBMPTUJFNQPTEFSJFHPBVUPNUJDBNFOUFFOSFMBDJODPOMBT
fluctuaciones en los valores de evapotranspiracin
t-BFWBQPUSBOTQJSBDJONOJNB QBUFOUFFOUSNJUF
QFSNJUFFTUBCMFDFSFM
umbral para que comience el riego, lo que contribuye a un riego profundo

Otras caractersticas
t)BTUBQVOUPTEFDPOFYJO
t)BTUBTFOTPSFTEFQVMTPT
t3FHJTUSPTEFMVTPEFBHVB
t3FHJTUSPTEFMUJFNQPEFSJFHPEFDBEBFTUBDJO
t3FHJTUSPTBOUJDJQBEPTBDUVBMFTEFGVODJPOBNJFOUPFOTFDP QPTUFEESZSVO
logs)

RainWatch (Patente en trmite)

t)PKBEFDMDVMPEFFWBQPUSBOTQJSBDJO

t1SPQPSDJPOBMBDBSBDUFSTUJDBEFBQBHBEPQPSMMVWJBZMVFHPBKVTUBMPTUJFNQPT
de riego segn las mediciones de precipitacin

t*ODMVZFBPEF1MBOEFBTJTUFODJBHMPCBM

Modelos
Funcin expandida del sistema

t4$0/1$EFFTDSJUPSJPDPOTPGUXBSF4JUF$POUSPMJODMVZFFM1MBOEFBTJTUFODJB
global durante 1 ao.

t6UJMJ[BMBTIFSSBNJFOUBTEFEFTBSSPMMPEFTPGUXBSFNTBWBO[BEBTEF
la industria. SiteControl ofrece el mejor rendimiento y una excelente
compatibilidad de software y hardware

Opciones de mdulos de software

t&MTJTUFNBFTNPEVMBS$PNQSFTMPMPRVFOFDFTJUBZBNQMFMPNTBEFMBOUF

t4NBSU8FBUIFS

tVCJDBDJPOFTBEJDJPOBMFT

t1VFEFBNQMJBSMBDBQBDJEBEEFUSB[BEPTEFDBCMFDPOOVFWPTNEVMPT

t.FTTFOHFSEF3BJO#JSE
(para Smart Weather)

t5SB[BEPEFDBCMFBEJDJPOBM EB

Control remoto del sistema

t"VUPNBUJD&5 &WBQPUSBOTQJSBDJO
automtica)

t$POUSPMFTVTJTUFNBZPQFSFFM4JUF$POUSPMEFTEFDVBMRVJFSVCJDBDJOFOFM
TJUJP VUJMJ[BOEPFMTJTUFNB'3&&%0.EF3BJO#JSE%JTQPOJCMFQPSUFMGPOP 
UFMGPOPDFMVMBSPSBEJP6)'
t-BJOUFSGB[.*.PCJMFPGSFDFDPOUSPMEFSJFHPSFNPUPQPSUFMGPOPDFMVMBS
con conexin a Internet. Se requiere cdigo clave de software. El cliente
proporciona el telfono inteligente

t.EVMPICSJEP
t4NBSU4FOTPS TFOTPSJOUFMJHFOUF

t6UJMJEBEFTEFNBQFP

t5SB[BEPEFDBCMFBEJDJPOBM SB

t5SB[BEPEFDBCMFBEJDJPOBM UB

t4JUF$POUSPM1MVT
t#PNCFPJOUFMJHFOUF 4NBSU1VNQ

t.* *OUFSGB[NWJM

t'SFFEPN

Caractersticas de GSP
Monitoreo y programacin superiores

t"TJTUFODJBBUSBWTEFMOFBUFMFGOJDBHSBUVJUB DPOTVMUFMBQHJOB

t'MP(SBQI proporciona grficos en tiempo real con cuadros de informacin


a color sobre cada una de las estaciones

t%JBHOTUJDPTEFTJTUFNBSFNPUP
t&YUFOTJOEFMBHBSBOUB

Sistemas de control
centralizado

t-BGVODJO'MP.BOBHFS (administracin de flujo) equilibra las demandas


del sistema y las capacidades mximas de modo eficaz, lo cual contribuye a
disminuir la demanda de agua, a reducir el desgaste y las roturas del sistema
y a ahorrar energa

t%FTDVFOUPTEFDBQBDJUBDJOZFOUSFOBNJFOUPFOFMMVHBS

t&MTJTUFNB$ZDMF 4PBL mejora el control de la aplicacin de agua en


pendientes y reas con drenaje irregular

t%FTDVFOUPTEFM1SPHSBNBEFJOUFSDBNCJPEFUBCMFSP

t3FFNQMB[PEFIBSEXBSFFMTJHVJFOUFEBICJM
t"DUVBMJ[BDJPOFTGVUVSBTHSBUVJUBTEFMTPGUXBSFEF4JUF$POUSPM
t"TJTUFODJBFODBTPEFJODJEFOUFTZPUSPT

t-BTGVODJPOFT2VJDL*33 and SimpleIRR proporcionan mtodos fciles y


rpidos para crear horarios y programas de riego en base a sus parmetros
t-BDBSBDUFSTUJDB1SJOU0GGJDFJNQSJNFUPEPTMPTSFHJTUSPTEFNPOJUPSFPF
informacin del sitio en un formato claro y conciso, para controlar fcilmente
el sitio y llevar a cabo el diagnstico y solucin de problemas
t-BGVODJO4NBSU4FOTPST permite el monitoreo del flujo y otras condiciones,
adems de la configuracin de reacciones especficas seleccionadas por el
usuario

148

El uso inteligente del agua.

Sistemas de control centralizado

www.rainbird.com/centralcontrols

*OUFSGB[TBUFMJUBM58* *OUFSGB[QBSBEFDPEJGJDBEPSEFEPT
DBCMFT-%*4%*

Interfaz satelital TWI


Interfaz satelital para SiteControl solamente

Interfaz para decodificador de dos


cables LDI/SDI

Q Permite una comunicacin bidireccional en tiempo real entre los

Interfaz para decodificador para SiteControl solamente

satlites de campo y el controlador central de SiteControl

Q Permite una comunicacin bidireccional en tiempo real entre los

Q Permite el uso de funciones avanzadas en campo de las versiones


&414"5EFEPTDBCMFTPEF&/-"$&

decodificadores y el controlador central de SiteControl

Q Conecta las caractersticas eficaces de SiteControl con una fcil

Q La capacidad modular puede desarrollarse con el sitio

instalacin y seguridad de un sistema decodificador de dos cables

Caractersticas

Q El sistema puede configurarse y ampliarse segn las necesidades del

t-B58*PQFSBIBTUBTBUMJUFT NYJNPEFIBTUBFTUBDJPOFTEFTBUMJUF

decodificadores de sensores o de pulsos por trazado de cable

Caractersticas

t4FQVFEFFYUFOEFSIBTUB&414"5 NYJNPEFIBTUB FTUBDJPOFTEF


satlite), decodificadores de sensores o de pulsos en un sistema SiteControl

t'VODJPOBDPOMPTEFDPEJGJDBEPSFTEFTFOTPSFTZDBNQP5VSGEF3BJO
#JSE '%563' '%563' '%563' '%563' '%563' 
4%563'

t-B58*TFPGSFDFFTUOEBSDPOVOUSB[BEPEFDBCMF RVFTFQVFEFBDUVBMJ[BSB
4 trazados de cable con la compra del mdulo de trazados de cable adicional
t4JUF$POUSPMTFQVFEFDPOGJHVSBSQBSBPQFSBSJOUFSGBDFTUPUBMFT NEVMPEF
software hbrido requerido)
t"QSPCBEPQPS6-6TPFOJOUFSJPSFT
t.POUBKFFOQBSFEHBCJOFUFEFBDFSPMBNJOBEP TJOTPMEBEVSBT DPOQBOFM
frontal con bisagras
t4FDVFODJBEFEBUPTEFMBDPNQVUBEPSB$BCMFEFTFSJF34

Especificaciones elctricas
Conexin con cables TWI
t&OUSBEBSFRVFSJEB7$"B")[P7$"
10% a 0.5A 50/60Hz

proyecto

t-BSVUBEFDPNVOJDBDJOEFEPTDBCMFTDVFOUBUBNCJODPOMBTDBSBDUFSTUJDBT
de diagnstico avanzado y de sensor para el controlador central
t-BJOUFSGB[QFRVFBQBSBEFDPEJGJDBEPSFT 4%*
QVFEFDPOFDUBSTFDPOIBTUB
200 direcciones de decodificadores y puede activar hasta 400 solenoides
t-BJOUFSGB[HSBOEFQBSBEFDPEJGJDBEPSFT -%*
QVFEFDPOFDUBSTFDPOIBTUB
500 direcciones de decodificadores y puede activar hasta 1000 solenoides
Requiere el mdulo de software SiteControl Plus
t-BTJOUFSGBDFT-%*Z4%*TFJODMVZFOEFNBOFSBFTUOEBSDPOUSB[BEPTEF
hasta 4 cables
t&MTJTUFNB4JUF$POUSPMTFQVFEFDPOGJHVSBSQBSBPQFSBSIBTUBJOUFSGBDFT
totales (SiteControl Plus y/o mdulos de software hbrido requeridos)
t4FDVFODJBEFEBUPTEFMBDPNQVUBEPSB$BCMFEFTFSJF34

t4BMJEBY7$"B")[PY7$"B")[

t4FDVFODJBEFEBUPTEFMEFDPEJGJDBEPS$BCMF.BYJEFEPTDBCMFT

t$PSUBDJSDVJUPT/% SFDPOGJHVSBDJOBVUPNUJDB

t.POUBKFFOQBSFE(BCJOFUFEFQMTUJDPEFHSBOSFTJTUFODJBDPOQVFSUBDPO
llave

t&OUSBEBSFRVFSJEB7$"B")[P7$"
10% a 0.5A 50/60Hz

Especificaciones elctricas

t4BMJEB/%

t"NSJDBEFM/PSUF

SDI
Sistemas de control
centralizado

TWI Link

- Entrada: 120 VCA +/- 10%, 60Hz

t$PSUBDJSDVJUPT/%

- Salida: 24 VCA +/- 10% 50 VA

Descarga a tierra
t5PEBTMBTJOUFSGBDFTEFEPTDBCMFT 58*
EFCFSOUFOFSVOBEFTDBSHBBUJFSSB
de 10 ohmios o menos

t*OUFSOBDJPOBM
- Entrada: 220/230/240 VCA +/- 10% 60Hz
- Salida: 24 VCA +/- 10% 50 VA

Dimensiones

LDI

t"ODIP12" (39.4 cm)

t"NSJDBEFM/PSUF

t"MUVSB12" (31.7 cm)

- Entrada: 120 VCA +/- 10%, 60Hz

t1SPGVOEJEBE DN

- Salida: 24 VCA +/- 10% 75 VA


t*OUFSOBDJPOBM

Modelos
t58*4"5%PTDBCMFT DPOFYJODPODBCMFT

- Entrada: 220/230/240 VCA +/- 10% 60Hz

t58*4"5-&OMBDF SBEJP

- Salida: 24 VCA +/- 10% 75 VA

Interfaz SDI
(no se muestra
MB-%*

Dimensiones (LDI y SDI)


t"ODIP12" (24.1 cm); Altura: 1014" (26 cm); Profundidad: 438" (11.1 cm)

Modelos
t4%*563' DUSBOTGPSNBEPS
$POUSPMBEJSFDDJPOFT
t-%*563' DUSBOTGPSNBEPS
$POUSPMBEJSFDDJPOFT
Interfaz de dos
cables (TWI)

El uso inteligente del agua.

149

Sistemas de control centralizado


Maxicom2

Maxicom2
Control centralizado para mltiples sitios ideal
para grandes sistemas
Q Sistema de Control centralizado para mltiples sitios y aplicaciones de
riego industrial o comercial

Q Conserva el agua por medio de caractersticas avanzadas de riego


basadas en la evapotranspiracin

Q La programacin flexible permite al sistema reaccionar a los sensores y


trabajar dentro de las restricciones de riego

Caractersticas del sistema


t&MQBRVFUFEFMDPOUSPMBEPSDFOUSBM.BYJDPN2 incluye el software Maxicom2,
la computadora preconfigurada, el Plan de asistencia global (GSP) y la
capacitacin
t$POUSPMBODJFOUPTEFTBUMJUFT&414*5&4"5 TJUJPTQBSBVOTPMPDPOUSPMBEPS

y Cluster Control Units - CCU (unidades de control de grupo) que pueden
DPOUSPMBSIBTUBDPOUSPMBEPSFTEFTBUMJUF&414"5JOEJWJEVBMFTDBEBVOPFO
sitios para mltiples controladores
t.POJUPSFBOEPDFOBTEFGVFOUFTNFUFPSPMHJDBT DPNPFTUBDJPOFT
NFUFPSPMHJDBT84130 &5.BOBHFSTPTFOTPSFTEFNFEJDJOEFMMVWJB
(medidor de lluvia)
t&MDPOUSPMSFNPUP'SFFEPNQFSNJUFMBPQFSBDJONBOVBMEFMTJTUFNBBUSBWT
de un telfono celular o radio
t-PTNMUJQMFTSFHJTUSPTFJOGPSNFTEFMDPOTVNPEFBHVBTFHFOFSBO
automticamente para realizar un seguimiento del funcionamiento del
sistema y del ahorro de agua

Caractersticas de administracin de agua

Sistemas de control
centralizado

t0QFSBDJOEFIPSBSJPTEFDPNVOJDBDJOFOUSFTBUMJUFTIPSBSJPT
separados por CCU proporcionan precisin en el riego de reas y microclimas
t-BGVODJO&5$IFDLCPPLBENJOJTUSBMBFWBQPUSBOTQJSBDJO &5
ZBKVTUB
automticamente el tiempo de riego de cada estacin del controlador de
satlite y los intervalos de ciclo diario para que coincidan con los requisitos
de riego paisajstico
t-BGVODJO'MP.BOBHFSBENJOJTUSBMBEFNBOEBEFGMVKPUPUBMVCJDBEBFO
la(s) fuente(s) de agua, optimizando tanto la ventana de riego como la
disponibilidad de agua
t-BGVODJO'MP8BUDINPOJUPSFBMPTTFOTPSFTEFGMVKPFODBEBGVFOUFEF
agua, registra el flujo y reacciona automticamente a los problemas de flujo
apagando la parte afectada del sistema (la vlvula individual o lnea principal)
t-BGVODJO3BJO8BUDINPOJUPSFBMPTTFOTPSFTEFNFEJDJOEFMMVWJB SFHJTUSB
los valores de precipitacin y reacciona automticamente interrumpiendo
el riego para verificar la cantidad de agua que cay y determinar si el riego
debe reanudarse o cancelarse

t&MTJTUFNB$ZDMF 4PBLPQUJNJ[BMBBQMJDBDJOEFBHVBTFHOFMOEJDFEF
penetracin en el suelo, lo cual reduce la erosin y el encharcamiento
t$POUSPMBGVODJPOFTRVFOPFTUOSFMBDJPOBEBTDPOFMSJFHPFOT DPNPMB
iluminacin, las fuentes, los cierres de puertas y los portones

Maxicom2 Opciones de comunicaciones


t$POUSPMBEPSDFOUSBMB$$65FMGPOP DPOFYJOEJSFDUB SBEJP UFMGPOPDFMVMBS 
SFE &UIFSOFU 8J'J GJCSBQUJDB

t%F$$6B&414"55SB[BEPEFEPTDBCMFT
t%F$$6B&414"5-3BEJP .BTUFS-JOL SFE &UIFSOFU 8J'J GJCSBQUJDB

Caractersticas del Plan de asistencia global (GSP) (consulte la


pgina 159)
t"TJTUFODJBBUSBWTEFMOFBUFMFGOJDBHSBUVJUB
t%JBHOTUJDPTEFTJTUFNBTSFNPUPT
t1PMUJDBEFTBUJTGBDDJOEFMDMJFOUFTPCSFMPTDPNQPOFOUFTEFMTJTUFNBEF
control centralizado y reemplazo de hardware el siguiente da hbil.
t1BRVFUFTEFTFSWJDJPEFTPGUXBSFHSBUVJUP
t%FTDVFOUPEFDBQBDJUBDJOZFOUSFOBNJFOUPFOFMMVHBS
t%FTDVFOUPTEFM1SPHSBNBEFJOUFSDBNCJPEFUBCMFSP

Modelos
t.$(0-%OVFWPTJTUFNB1$EFFTDSJUPSJPDPOTPGUXBSF.BYJDPNJODMVZF
el Plan de asistencia global durante 1 ao.
t(41.$1-TVTDSJQUPSFTBDUVBMFTPBOUJHVPTEF(41 1$EFFTDSJUPSJPDPO
software Maxicom; incluye el Plan de asistencia global (GSP) de nivel
Platinum Plus durante 3 aos.
t(41.911$*"TVTDSJQUPSFTBDUVBMFTEF(41 1$EFFTDSJUPSJPDPOTPGUXBSF
Maxicom; basado en el Plan de asistencia global (GSP) de nivel Platinum Plus
de 3 aos; incluye 1 ao de GSP; requiere la compra de GSP el 2do y 3er ao
(M95543A2).
t(41.911$*.TVTDSJQUPSFTBDUVBMFTEF(41 1$EFFTDSJUPSJPDPOTPGUXBSF
Maxicom; basado en el Plan de asistencia global (GSP) de nivel Platinum Plus
de 3 aos; incluye 1 mes de GSP; requiere la compra de GSP desde el mes 2 al
36 (M95544M2).
t(41.911/*"TVTDSJQUPSFTOVFWPTPBOUJHVPTEF(41 1$EFFTDSJUPSJPDPO
software Maxicom; basado en el Plan de asistencia global (GSP) de nivel
Platinum Plus de 3 aos; incluye 1 ao de GSP; requiere la compra de GSP el
2do y 3er ao (M95541A2).
t(41.911/*.TVTDSJQUPSFTOVFWPTPBOUJHVPTEF(14 1$EFFTDSJUPSJPDPO
software Maxicom; basado en el Plan de asistencia global (GSP) de nivel
Platinum Plus de 3 aos; incluye 1 mes de GSP; requiere la compra de GSP
desde el mes 2 al 36 (M95542M2).
t.$61(TPGUXBSFEFBDUVBMJ[BDJOEF.BYJDPN TPMP$%BDUVBMJ[BDJOEF
Maxicom 1.X, 2.X y 3.X a la ltima versin.

Caractersticas operativas
t&MNFDBOJTNPEFDPOUSPMEFDPNVOJDBDJPOFTFOWBBVUPNUJDBNFOUFMB
programacin actualizada a los sitios antes del inicio del riego y recupera
los registros luego de la finalizacin del riego; se puede llevar a cabo una
operacin manual en cualquier momento
t$JDMPTEJBSJPTEFBSSBORVF$VTUPN QFSTPOBMJ[BEP
 EBEFMBTFNBOB

"Odd/Even/Odd31" (das impares/das pares/das impares excepto los das

P$ZDMJDBM DDMJDP
FJODMVZFIPSBSJPTDBMFOEBSJPEF&WFOU%BZ0GG
(apagado por da de evento)
t5JFNQPTEFSJFHPEFMBFTUBDJOQSPHSBNBCMFTEFTEFNJOVUPBIPSBT

Maxicom2

Maxicom2&5$IFDLCPPLBENJOJTUSBMBIVNFEBEEFMTVFMPEFMBNJTNBGPSNBRVFVTUFEBENJOJTUSBFMEJOFSPEFTVDVFOUBEFDIFRVFT-BQSEJEB
diaria de agua por evapotranspiracin representa un retiro, mientras que el riego y la precipitacin son depsitos de humedad en el suelo.

150

El uso inteligente del agua.

Sistemas de control centralizado

www.rainbird.com/centralcontrols

interfaz Cluster Control Unit - CCU (unidad de control de grupo)

Interfaz Cluster Control Unit - CCU


(unidad de control de grupo)

Especificaciones elctricas
t&OUSBEBSFRVFSJEB7"$!")[P
!")[

Interfaz CCU para Maxicom2 Solamente

t4BMJEB7"$ )[P)[ "

Q Ejecuta operaciones en tiempo real de un sitio con hasta 28 satlites

t$PSUBDJSDVJUPT/%

Q Adapta la secuencia de estaciones a las condiciones cambiantes para

t*OUFSSVQUPSEFQPMJFUJMFOPEFSFDPOGJHVSBDJOBVUPNUJDB"BCJFSUP FTUBEP
regular) 1.3A abierto (descarga)

lograr una mxima eficacia

Q Responde de manera instantnea a las condiciones inesperadas y las


entradas de sensor

t#BSSBDPMFDUPSBEFEFTDBSHBBUJFSSBEFVOTPMPQVOUP

Dimensiones
t%FNFUBMDPOSFDVCSJNJFOUPEFQJOUVSBFOQPMWPQBSBNPOUBSFOMBQBSFE

Caractersticas

- Ancho: 11516" (28.7 cm)

t"ENJOJTUSBMBTDPOFYJPOFTEFDPNVOJDBDJODPOFMDPOUSPMBEPSDFOUSBM
Maxicom2

- Altura: 1112" (29.2 cm)

t"ENJOJTUSBIBTUBDPOUSPMBEPSFTEFTBUMJUF FTUBDJPOFT
ZFOUSBEBT
de sensor como un solo sistema de control dinmico

- Profundidad: 612" (16.5 cm)


t1FEFTUBMEFBDFSPJOPYJEBCMF

t"MNBDFOBZFKFDVUBMBTJOTUSVDDJPOFTEFMPTIPSBSJPTEFSJFHPEFTEFFM
controlador central Maxicom2

- Ancho: 1112" (29.2 cm)

t1FSNJUFUPNBSEFDJTJPOFTFOUJFNQPSFBMQBSBSFBDDJPOBSBOUFDPOEJDJPOFT
inesperadas como tuberas rotas, vlvulas obstruidas, precipitaciones, etc.

- Profundidad: 1112" (29.2 cm)

- Altura: 30" (76.2 cm)

Caractersticas de administracin de agua


t0QFSBDJOEFIPSBSJPTEFDPNVOJDBDJOFOUSFTBUMJUFTIPSBSJPT
separados por CCU proporcionan precisin en el riego de reas y microclimas

Modelos
Canales
De metal,
(satlites de 24 montaje sobre
estaciones)
pared

6
28

t-BGVODJO'MP.BOBHFSBENJOJTUSBMBEFNBOEBEFGMVKPUPUBMVCJDBEBFO
la(s) fuente(s) de agua, optimizando tanto la ventana de riego como la
disponibilidad de agua
t-BGVODJO'MP8BUDINPOJUPSFBMPTTFOTPSFTEFGMVKPFODBEBGVFOUFEF
agua, registra el flujo y reacciona automticamente a los problemas de flujo
apagando la parte afectada del sistema (la vlvula individual o lnea principal)
t-BGVODJO3BJO8BUDINPOJUPSFBMPTTFOTPSFTEFNFEJDJOEFMMVWJB SFHJTUSB
los valores de precipitacin y reacciona automticamente interrumpiendo
el riego para verificar la cantidad de agua que cay y determinar si el riego
debe reanudarse o cancelarse

CCU6W
CCU28W

Pedestal de
acero
inoxidable

Estaciones de
satlite
mximas

Entradas de
sensor
mximas

CCU6S
CCU28S

144
672

12
56

Notas:
t -PTTBUMJUFTDPOFTUBDJPOFTPNFOPTSFRVJFSFODBOBM
t -PTTBUMJUFTDPOFTUBDJPOFTPNTSFRVJFSFODBOBMFT
t -BDBQBDJEBEEFFOUSBEBEFMTFOTPSEFVOB$$6WBSBMB$$6FOMBPQDJOEF
comunicacin satelital

Sistemas de control
centralizado

t3FHJTUSBFMUJFNQPEFSJFHPEFMBFTUBDJOEFMDPOUSPMBEPSEFTBUMJUFZMB
actividad del sensor reales

t .PEFMPTEFNFUBMNPOUBEPTTPCSFQBSFEEJTQPOJCMFTFO7$"Z7$" );

Maxicom2 Opciones de comunicacin


t$POUSPMBEPSDFOUSBMB$$65FMGPOP DPOFYJOEJSFDUB SBEJP UFMGPOPDFMVMBS 
SFE &UIFSOFU 8J'J GJCSBQUJDB
t%F$$6B&414"55SB[BEPEFEPTDBCMFT
t%F$$6B&414"5-3BEJP SFE &UIFSOFU 8J'J GJCSBQUJDB

Cmo especificar
CCU - 28 - W
Montaje
W: Montaje sobre pared
S: Pedestal de acero
inoxidable

Canales
6: 6 canales
28: 28 canales
Modelo
CCU

CCU-6-W CCU-28-W

El uso inteligente del agua.

El ejemplo especifica una CCU con 28 canales,


en un gabinete montado sobre la pared.

151

Sistemas de control centralizado


$POUSPMBEPSEFTBUMJUF&414"5

Controlador de satlite ESP-SAT


2

Controlador de satlite de 12, 24, 40 estaciones para Maxicom y


SiteControl
Q Controlador de satlite de campo para los sistemas de control de
 Maxicom2 o los sistemas de control centralizado de SiteControl
Q El poder de una herramienta de administracin de agua avanzada, en
un paquete fcil de usar

Q 5PEBTMBTDBSBDUFSTUJDBTZMBTGVODJPOFTJOEFQFOEJFOUFTEFMBMOFBEF
controladores ESP-MC de Rain Bird

t.FNPSJBOPWPMUJMQBSBBPTRVFBMCFSHBFMQSPHSBNB MBGFDIB
y la hora durante los cortes de energa
t3FTQBMEPDPOQJMBQJMBEF7$$EFORVFMDBENJP SFDBSHBCMF QBSB
programacin con pila y para mantener activo el programa en
funcionamiento durante los cortes de energa
t1SPUFDDJODPOUSBEFTDBSHBTFMDUSJDBTEFHSBOSFTJTUFODJB
t#BSSBDPMFDUPSBEFEFTDBSHBBUJFSSBEFVOTPMPQVOUP

Dimensiones
t%FNFUBMDPOSFDVCSJNJFOUPEFQJOUVSBFOQPMWPQBSBNPOUBSFOMBQBSFE
- Ancho: 11516" (28.7 cm)
- Altura: 1112" (29.2 cm)

Caractersticas
t&414"5TFDPOUSPMBBUSBWTEFMB$$6QBSB.BYJDPN2PMB58*QBSB
SiteControl
t&KFDVUBJOTUSVDDJPOFTFNJUJEBTEFTEFFMTJTUFNBEFDPOUSPMDFOUSBMJ[BEP
t-PTNPEFMPT&414"5-JODPSQPSBOEPTFOUSBEBTEFTFOTPS
t$POTVMUF4JTUFNBEFDPOUSPMDFOUSBMJ[BEP.BYJDPN2 (pgina 150) o
4JUF$POUSPM QHJOB
QBSBWFSMBTDBSBDUFSTUJDBTEF&414"5DPODPOUSPM
centralizado
t&MDPOUSPMBEPS&414"5UBNCJOQVFEFGVODJPOBSDPNPVODPOUSPMBEPS
independiente, con las mismas caractersticas que el ESP-MC

- Profundidad: 612" (16.5 cm)


t1FEFTUBMEFBDFSPJOPYJEBCMF
- Ancho: 1112" (29.2 cm)
- Altura: 30" (76.2 cm)
- Profundidad: 1112" (29.2 cm)

Modelos
Estacin

Dos cables,
de metal,
montaje sobre
pared

Opciones

Enlace,
Enlace, de metal,
Dos cables,
montaje sobre pedestal de acero
pedestal de
inoxidable
pared
acero inoxidable

t.PEFMPTEF ZFTUBDJPOFT

12

&414"58

&414"54

&414"5-8

&414"5-4

t$PNVOJDBDJOTFDVOEBSJBEFFOMBDF 4"5-
PEFEPTDBCMFT 4"5

24

&414"58

&414"54

&414"5-8

&414"5-4

t1FEFTUBMEFNFUBM

40

&414"58

&414"54

&414"5-8

&414"5-4

t%FNFUBM DPODBKBEFNPOUBKFTPCSFQBSFE
t1FEFTUBMEFBDFSPJOPYJEBCMF

Maxicom2 Opciones de comunicacin


t%F$$6B&414"55SB[BEPEFEPTDBCMFT

Notas:
t 4JTFVUJMJ[BSDPNVOJDBDJOEFSBEJPEFFOMBDFFOUSFMB$$6 VOJEBEEFDPOUSPMEFHSVQP

PMBJOUFSGB[EFEPTDBCMFT 58*
ZMPTTBUMJUFT EFCFFTQFDJGJDBSTFUBNCJOVOLJUSBEJP
mdem

Sistemas de control
centralizado

t%F$$6B&414"5-3BEJP .BTUFS-JOL SFE &UIFSOFU 8J'J GJCSBQUJDB

t -PTDPOUSPMBEPSFTEFTBUMJUFEFDBNQP&414"5SFRVJFSFOVOB$$6QBSBDPOFDUBSTFDPO
el sistema Maxicom2

Especificaciones elctricas

t -PTDPOUSPMBEPSFTEFTBUMJUFEFDBNQP&414"5SFRVJFSFOVOBJOUFSGB[EFEPTDBCMFT
(TWI) para conectarse con el sistema SiteControl

t&OUSBEBSFRVFSJEB7"$ )[
(Modelos internacionales: 230 VCA 10%, 50 Hz)

t &MUSB[BEPEFEPTDBCMFTFTVOUSB[BEPEFDPNVOJDBDJOEFDPOFYJODPODBCMFTRVF
conecta la CCU o la TWI con los satlites

t4BMJEB7$" "

t &MSBEJPEFFOMBDFFTVOBDPNVOJDBDJOQPSSBEJPJOBMNCSJDBRVFDPOFDUBMB$$6PMB
TWI con los satlites

t$BQBDJEBEEFDBSHBEFFTUBDJO)BTUBEPTWMWVMBTTPMFOPJEFTEF7$" 
VA por estacin, ms una vlvula maestra o rel de arranque de bomba
t%JBHOTUJDPEFDPSUBDJSDVJUPTRVFFWJUBFJOEJDBMBTFTUBDJPOFT
con circuitos sobrecargados

t -PTTBUMJUFTEFZFTUBDJPOFTPDVQBODBOBMFOMB$$6PMB58*-PTTBUMJUFTEF
estaciones ocupan 2 canales en la CCU o la TWI.
t -PTTBUMJUFTEFDPNVOJDBDJOEFSBEJPEFFOMBDFUJFOFOFOUSBEBTEFTFOTPSFT

Cmo especificar
ESP - 24SAT - 2W
Cantidad de
Estaciones
4"5FTUBDJPOFT
4"5FTUBDJPOFT
4"5FTUBDJPOFT

Modelo
ESP (120VAC)

Montaje
W: de metal,
montaje sobre
pared
S: Acero
Inoxidable
Secuencia de datos
del satlite
2: Radios
L: MAXILink de
dos cables

Satlite ESP-40SAT-2W

152

El uso inteligente del agua.

Sistemas de control centralizado

www.rainbird.com/centralcontrols

$POUSPMBEPSEFTBUMJUF&414J5&4"5

Controlador de satlite ESP-SITE-SAT


Controlador de satlite de 12, 24, 40 estaciones para Maxicom2
Solamente
Q Combina la energa de una Cluster Control Unit -CCU (unidad de
control de grupo) con funciones de un nico controlador de satlite
ESP para sitios pequeos con Maxicom2

Q Herramienta de administracin de agua avanzada en un paquete fcil


de utilizar

Q 5PEBTMBTDBSBDUFSTUJDBTZMBTGVODJPOFTJOEFQFOEJFOUFTEFMBMOFBEF
controladores ESP-MC de Rain Bird

Dimensiones
t%FNFUBMDPOSFDVCSJNJFOUPEFQJOUVSBFOQPMWPQBSBNPOUBSFOMBQBSFE
- Ancho: 11516" (28.7 cm)
- Altura: 1112" (29.2 cm)
- Profundidad: 612" (16.5 cm)
t1FEFTUBMEFBDFSPJOPYJEBCMF
- Ancho: 1112" (29.2 cm)
- Altura: 30" (76.2 cm)
- Profundidad: 1112" (29.2 cm)

Modelos

Caractersticas
t$PNCJOBMBGVODJOEFVOB$MVTUFS$POUSPM6OJU$$6 VOJEBEEFDPOUSPMEF
HSVQP
ZEFVODPOUSPMBEPSEFTBUMJUF&414"5FOVOTPMPEJTFPEFDBKB

Estaciones
12
24
40

t"MNBDFOBZFKFDVUBMBTJOTUSVDDJPOFTEFMPTIPSBSJPTEFSJFHPEFTEFFM
controlador central Maxicom2
t*ODPSQPSBEPTFOUSBEBTEFTFOTPS.BYJDPN2
t$POTVMUF4JTUFNBEFDPOUSPMDFOUSBMJ[BEP.BYJDPN2 (pgina 150) para ver las
DBSBDUFSTUJDBTEF&414*5&4"5DPODPOUSPMDFOUSBMJ[BEP

De metal
Montaje sobre pared
&414*5&8
&414*5&8
&414*5&8

Pedestal de acero
inoxidable
&414*5&4
&414*5&4
&414*5&4

Nota: No requiere una CCU para conectarse con Maxicom2

t&MDPOUSPMBEPS&414*5&4"5UBNCJOQVFEFGVODJPOBSDPNPVODPOUSPMBEPS
independiente, con las mismas caractersticas que el ESP-MC

Opciones
tNPEFMPTEF ZFTUBDJPOFT
t%FNFUBM DPODBKBEFNPOUBKFTPCSFQBSFE
t1FEFTUBMEFBDFSPJOPYJEBCMF

Maxicom2 Opciones de comunicacin


t$POUSPMBEPSDFOUSBMB&414*5&4"55FMGPOP DPOFYJOEJSFDUB SBEJP UFMGPOP
DFMVMBS SFE &UIFSOFU 8J'J GJCSBQUJDB

Satlite de sitio
ESP-24SITE-W
Sistemas de control
centralizado

Especificaciones elctricas
t&OUSBEBSFRVFSJEB7$" )[ NPEFMPTJOUFSOBDJPOBMFT
230 VAC y 240 VAC 10%, 50Hz)
t4BMJEB7$" "
t$BQBDJEBEEFDBSHBEFFTUBDJO)BTUBEPTWMWVMBTTPMFOPJEFTEF7$" 
7VA por estacin, un mximo de 4 estaciones, ms una vlvula maestra o rel
de arranque de bomba
t%JBHOTUJDPEFDPSUBDJSDVJUPTRVFFWJUBFJOEJDBMBTFTUBDJPOFTDPODJSDVJUPT
sobrecargados
t3FTQBMEPDPOQJMBQJMBEF7$$EFORVFMDBENJP SFDBSHBCMF 
para programacin con pila y para mantener activo el programa
en funcionamiento durante los cortes de energa
t1SPUFDDJODPOUSBEFTDBSHBTFMDUSJDBTEFHSBOSFTJTUFODJB
t#BSSBDPMFDUPSBEFEFTDBSHBBUJFSSBEFVOTPMPQVOUP

Cmo especificar
ESP-24SITE-W
Montaje
8%FNFUBM NPOUBKF
sobre pared
S: Acero inoxidable

Pedestal de
acero inoxidable

El uso inteligente del agua.

Cantidad de estaciones
4*5&FTUBDJPOFT
4*5&FTUBDJPOFT
4*5&FTUBDJPOFT
Modelo
ESP (120VAC)

153

Sistemas de control centralizado


Sistemas en paquete para el control de riego

Sistemas en paquete para control


de riego
Rain Bird, la empresa lder en productos para control centralizado
de riego, ofrece sus Sistemas de Control en Paquete para ayudar a
satisfacer sus necesidades de hardware en control centralizado y
controladores independientes.
Q Un sistema de control en paquete de Rain Bird le permite almacenar
 todo su equipo de control de riego en un montaje de tipo caja que se
coloca en la pared o en un pedestal personalizado para su aplicacin
FTQFDGJDB5BNCJOFYJTUFOEJWFSTPTNPOUBKFTEJTQPOJCMFTDPOQBOFMFT
que se abren por la parte posterior (sin caja) y que pueden instalarse
en una caja existente o montarse en la pared.

Q Los sistemas de control en paquete son sencillos de especificar,


 fciles de instalar y estn diseados para mantener sus componentes
Montaje en pared con CCU y
Controladores 3 ESP-SAT y
monitor de caudal

protegidos del clima, el vandalismo, los insectos y otros peligros


ambientales.

Q 5PEPTMPTTJTUFNBTEFDPOUSPMFOQBRVFUFEF3BJO#JSETFDPOTUSVZFO
 en un taller de paneles aprobado por UL. Usted tiene la opcin de
decidir si su sistema est aprobado por UL o no. Si necesita una opcin
especfica, nosotros la analizamos y trabajamos con nuestro equipo
de ingenieros para encontrar la solucin que mejor se ajuste a sus
necesidades.

Q Cada sistema de control en paquete viene preensamblado, probado y


 listo para su instalacin. Cada unidad se pone en funcionamiento en
la fbrica y pasa por una prueba completa para verificar que todos sus
componentes funcionen correctamente. El contratista que la instala
solamente debe montar la caja, suministrar energa y cablear el terreno
a los puntos de conexin con las etiquetas de fbrica.

Caractersticas
Sistemas de control
centralizado

Pedestal con
Controlador ESP-SAT

tDiseos estndar y personalizados Rain Bird disear, ensamblar y enviar


cada sistema de control en paquete de manera que se cumplan cabalmente sus
requisitos.
t$POGJHVSBDJPOFTEFSolucin "al instante para reducir el tiempo de instalacin a
travs de precableado y preinstalacin de componentes
tCajas UL con certificacin NEMA seleccionadas para cada servicio y ambiente
especfico (las cajas P1 y P7 no estn aprobadas por UL)
t&YJTUFOcajas aprobadas por UL y no aprobadas por ULEJTQPOJCMFT5PEBTMBT
cajas se construyen en un taller de paneles aprobado por UL
tSupresores de sobretensin para la energa entrante, telfono, sensor y va de
dos cables (segn corresponda)
tCaja de servicios*$'$5
tInterruptores de desconexin de circuitos elctricos: garantiza que se pueda
desconectar la corriente de manera segura al acceder a los componentes con
energa elctrica
tBloque de terminales para todos los cableados de terreno con conexiones de
presin
t4FSFBMJ[BOpruebas de funcionamiento e inspecciones de calidad para cada
unidad, antes del envo
tGaranta: la Poltica de satisfaccin del cliente profesional de Rain Bird brinda
cobertura a todos los componentes de los sistemas de control en paquete por un
perodo de 5 aos

Pedestal con controlador serie LX

154

El uso inteligente del agua.

Sistemas de control centralizado

www.rainbird.com/centralcontrols

Sistemas de control en paquete, Radio de espectro ensanchado

Opciones disponibles
t0QDJPOFTEFDBKBTDPOQFEFTUBM

Radio de espectro ensanchado


Maxicom2 4JUF$POUSPMP*2

- Pedestal de acero con recubrimiento de pintura en polvo


t0QDJPOFTEFDBKBTQBSBNPOUBSFOMBQBSFE
- Caja de acero con recubrimiento de pintura en polvo para montar en la
pared
- Caja de acero inoxidable para montar en la pared
t0QDJPOFTOJDBNFOUFDPOQBOFMQPTUFSJPS
 OJDBNFOUFDPOQBOFMQPTUFSJPSEFVOBQJF[BRVFFODBKBFOVOQFEFTUBM
estndar
 OJDBNFOUFDPOQBOFMQPTUFSJPSQBSBNPOUBSFOMBQBSFE

Caractersticas
t4BMUPEFGSFDVFODJBQBSBFWJUBSJOUFSGFSFODJB
t$PTUFSFEVDJEPEFQSPQJFEBE OPTFSFRVJFSFMJDFODJB'$$
t/PIBZSFTUSJDDJPOFTEFMB'$$TPCSFMBBMUVSBEFMBBOUFOB FMVTVBSJPEFCF
consultar las leyes locales)
t-PTSBEJPTQVFEFODPOGJHVSBSTFDPNPSFQFUJEPSFTQBSBBMDBO[BSEJTUBODJBT
mayores y superar obstculos

Requisitos de instalacin

Dispositivos con comunicacin

t"OUFTEFIBDFSFMQFEJEPEFCFIBDFSVOFTUVEJPEFMUFSSFOPZFOWJBSMPKVOUP
con su pedido

tControl centralizado Maxicom

t3"%5/.*#Z3"%5/58*TFNPOUBOEJSFDUBNFOUFFOFMUBCMFSP&414"5.*#

- La va principal (de la computadora al CCU/Site Sat) puede utilizar


dispositivos Ethernet, radios de 900 MHz, mdems telefnicos y mdems
de telfonos celulares, adems de una conexin directa por cable
- La va secundaria (de la CCU al Sat) puede utilizar dispositivos Ethernet,
radios de 450-470 MHz y 900 MHz o una conexin de dos cables
tControl centralizado de SiteControl
 -BWBQSJODJQBM EFMBDPNQVUBEPSBBM58*4%*-%*
QVFEFVUJMJ[BS
dispositivos Ethernet y radios de 900 MHz, adems de una conexin directa
por cable
 -BWBTFDVOEBSJB EF58*BM4BU
QVFEFVUJMJ[BSEJTQPTJUJWPT&UIFSOFU SBEJPT
de 450-470 MHz y 900 MHz o una conexin de dos cables
t4PGUXBSFEFDPOUSPMDFOUSBMIQ
- La va principal (de la computadora al satlite servidor) puede utilizar
DPOFYJOEJSFDUB UFMGPOP &UIFSOFUQPSDBCMF &UIFSOFUQPS8J'J NEFN
por telfono celular, adems de comunicacin por radio de 900 MHz de
espectro ensanchado
- La va secundaria (del satlite servidor al satlite cliente) puede utilizar
conexin directa o comunicacin por radio de 900 MHz de espectro
ensanchado
tDispositivos de supresin de sobretensin especficos para minimizar
el dao causado por rayos y sobretensin. Hay soluciones disponibles
para vas de dos cables, descodificadores, lneas telefnicas y otras vas de
comunicacin.
tCamCluster: la opcin CamCluster est disponible para los sistemas de radio
Link (450-470MHz) y permite que un radio comn pueda compartirse por
medio de los controladores locales.
tEntradas de sensores, caudal y clima: los monitores de caudal,
descodificadores de pulsos, descodificadores de sensores y dispositivos
meteorolgicos como los interruptores de lluvia pueden integrarse
fcilmente a los diseos de los sistemas de control en paquete, segn el
sistema de control especfico.
tVentilacin del panel: hay disponibles opciones de ventilacin enfriadas por
ventilador con persianas para varios tipos de cajas.
tEntradas y salidas adicionales: los sistemas de control de iluminacin y
de entrada y salidas de rel se pueden monitorear, encender y apagar, o
integrar a los diseos de sistemas de control en paquete, segn el sistema de
control. Par obtener ms informacin sobre las aplicaciones especficas de las
soluciones ingenieriles para clientes, pngase en contacto con nosotros.

t4FSFRVJFSFMBBOUFOBZFMDBCMFEFMBBOUFOB TFWFOEFOQPSTFQBSBEP


Modelos
tRadios: para las comunicaciones principal y secundaria IQ y para las
comunicaciones secundarias Maxicom y Site Control
 *2443"%*03BEJPEF.)[EFFTQFDUSPFOTBODIBEPQFSNJUFMB
DPNVOJDBDJOFOUSFMBDPNQVUBEPSBDFOUSBMZFMTBUMJUFEJSFDUP*2PFM
TBUMJUFTFSWJEPS*25BNCJOQVFEFVUJMJ[BSTFQBSBMBDPNVOJDBDJOFOUSF
la computadora central Maxicom y la CCU o el satlite del sitio, entre la
DPNQVUBEPSBDFOUSBMEFDPOUSPMEFMTJUJPZ58*4%*P-%*
t3BEJPTQBSBMBDPNVOJDBDJOTFDVOEBSJBFOUSF.BYJDPNZ4JUF$POUSPM
 3"%5/.*#3BEJP5SBOT/&5QFSNJUFMBDPNVOJDBDJOTJODBCMFTFOUSF
la CCU y los controladores de satlite
 3"%5/58*3BEJP5SBOT/&5QFSNJUFMBDPNVOJDBDJOTJODBCMFTFOUSF
MB58*ZMPTDPOUSPMBEPSFTEFTBUMJUF
t"OUFOBT
 "/54)05%#"OUFOB4IPU(MBTTEFE#JODMVZFQMBDBEFUJFSSBZDBCMF
de 3 pies (0.9 m)
 "/5#"4&%#"OUFOBPNOJEJSFDDJPOBMDPOCBTFEFE#
 "/5%*3&%#"OUFOBEJSFDDJPOBM:BHJE#
t$BCMFTZBDDFTPSJPTQBSBBOUFOB
 $"##"4&'$BCMFEFQJFT N
QBSBBOUFOBPNOJEJSFDDJPOBMDPO
CBTFQVOUBTNBDIP5/$ZIFNCSB/
 $"##"4&'$BCMFEFQJFT N
QBSBBOUFOBPNOJEJSFDDJPOBMDPO
CBTFQVOUBTNBDIP5/$ZIFNCSB/
 $"#%*3&'$BCMFEFQJFT N
QBSBBOUFOBEJSFDDJPOBM:BHJQVOUBT
NBDIP5/$ZIFNCSB/
 $"#%*3&'$BCMFEFQJFT N
QBSBBOUFOBEJSFDDJPOBM:BHJQVOUBT
NBDIP5/$ZIFNCSB/
 "/5463(&1SPUFDUPSEFTPCSFDBSHBTQBSBBOUFOBDPOQVOUBTEFNBDIP/
a hembra N
 "/5$"#"%15"EBQUBEPSQBSBDBCMFEFBOUFOBDPOQVOUBTEFNBDIP5/$
a hembra N

Rain Bird puede trabajar directamente con usted para dar


a su cliente una solucin sin problemas en su prximo proyecto de
control centralizado o controlador independiente.

El uso inteligente del agua.

155

Sistemas de control
centralizado

- Pedestal de acero inoxidable

Sistemas de control centralizado


'SFFEPNQBSBDPOUSPMDFOUSBMJ[BEP TUBDJPOFT
meteorolgicas WS-PRO

Freedom para control centralizado

Estaciones meteorolgicas WS-PRO

Maxicom,2 o SiteControl

Maxicom2 84130TPMBNFOUF
4JUF$POUSPM *2 (WS-PRO2 y
84130-5

Caractersticas
t&NQMFBMBJOUFSGB[EFUFMGPOPFTUOEBSPVOBSFQFUJEPSBEFSBEJPFOMB
computadora
t6OOJDPUFMGPOPDFMVMBSPVOBOJDBSBEJPQVFEFODPOUSPMBSUPEPFMTJTUFNBEF
control centralizado
t$PNVOJDBDJOEFDPOWFSTBDJOCJEJSFDDJPOBMEJTQPOJCMFDPOFMTJTUFNBEFSBEJP
t&MTJTUFNBUBNCJOTFQVFEFDPOUSPMBSEFTEFUFMGPOPTFTUOEBSEFMOFB
terrestre
t1SPUFHJEPDPODPOUSBTFBEFTFHVSJEBE
t"SSBORVFZEFUFODJOEFFTUBDJPOFT IPSBSJPTPTJUJP BQBHBEPQPSMMVWJB

Hardware
t4JTUFNBEFSBEJPSFQFUJEPSB VOJEBEQPSUUJM BOUFOB DBCMFT
t4JTUFNBUFMFGOJDPNEVMP%5.' TVNJOJTUSPEFFOFSHB DBCMF

Caractersticas
t4FOTPSFTEFQSFDJTJODJFOUGJDBVCJDBEPTBUSFTNFUSPTTPCSFFMTVFMPQBSBVOB
mayor resistencia al vandalismo
t1PUFOUFNJDSPSSFHJTUSBEPSJOUFSOPQBSBSFDPMFDDJO SFHJTUSPZBOMJTJTEFEBUPT
meteorolgicos, comunicacin continua con los sensores meteorolgicos y
almacenamiento de 30 das de datos
t&TUSVDUVSBEFNFUBMSFTJTUFOUFZMJWJBOBBMBWF[
t.FDBOJTNPTEFQSVFCBEFBVUPEJBHOTUJDPIVNFEBEJOUFSOB OJWFMEF
voltaje de la pila, puerto de prueba para control del sensor local, y sensores y
componentes internos fciles de reparar
t&MTPGUXBSFNFUFPSPMHJDPEFMUJNBHFOFSBDJODBMDVMBWBMPSFTEF
&5 BMNBDFOBEBUPTEJBSJPTFIJTUSJDPTEF&5 NPOJUPSFBZNVFTUSBMBT
condiciones meteorolgicas actuales y muestra en forma grfica los
parmetros del clima

Especificaciones elctricas

Caractersticas de SiteControl

t&OUSBEBSFRVFSJEB7"$)[
t4JTUFNBUFMFGOJDPMOFBUFMFGOJDBEFNBSDBDJOEFEJDBEB

t-BDPNQBUJCJMJEBEEFMBTFTUBDJPOFTNFUFPSPMHJDBT84130Z84130-5FT
estndar para SiteControl v3.0 o software posteriores

Requisitos de la licencia

t4JUF$POUSPMQVFEFGVODJPOBSFODPOKVOUPDPOIBTUBFTUBDJPOFT
meteorolgicas

t4JTUFNBUFMFGOJDPOJOHVOP
t4JTUFNBEFSBEJP4FSFRVJFSFMJDFODJBQBSBGSFDVFODJBEFMB'$$

Dimensiones
t4JTUFNBUFMFGOJDP.EVMP%5.'YY NNYNN
x 51 mm)

t-BDPNVOJDBDJOBVUPNUJDBFOUSFFMDPOUSPMBEPSDFOUSBMZMBFTUBDJO
NFUFPSPMHJDBSFRVJFSFFMNEVMPEFTPGUXBSFEF&5BVUPNUJDPEF
SiteControl
t&MNEVMPEFTPGUXBSF4NBSU8FBUIFSEF4JUF$POUSPMQFSNJUFSFBDDJPOFT
automticas, definidas por el usuario, ante eventos meteorolgicos (lluvia,
helada, viento fuerte, etc.)

t4JTUFNBEFSBEJP
- Repetidora: 16.38" x 9.63" x 4.50" (416 mm x 245 mm x 114 mm)
Sistemas de control
centralizado

- Porttil: 3.0" x 8.0" x 1.5" (76 mm x 203 mm x 38 mm)

Modelos
t'3&&%0.'03 (telfono)
t'3&&3"%/41 SBEJP GSFDVFODJBFTQFDJBM

Freedom para sistemas de control


centralizado: radio
WS-PRO2

156

El uso inteligente del agua.

Sistemas de control centralizado

www.rainbird.com/centralcontrols

Estaciones meteorolgicas WS-PRO, escodificadores de


sensores de pulsos

Caractersticas IQ v2.0
t-BTFTUBDJPOFTNFUFPSPMHJDBT84130P84130-5TPODPNQBUJCMFT
DPO*2WPWFSTJPOFTEFTPGUXBSFQPTUFSJPSFTDPO1BRVFUFEFGVODJPOFT
BWBO[BEBTEF&5 *2"&5'1

t-BDPNVOJDBDJOBVUPNUJDBFOUSFMBDFOUSBM*2WZMBFTUBDJO
meteorolgica requiere el Paquete de funciones de comunicacin
*2"$0.'1

t3FDVQFSBDJOEFMPTEBUPTNFUFPSPMHJDPTQPSIPSBPSFDVQFSBDJO
personalizada de hasta 5 veces por da

Descodificadores de sensores de pulsos


Para los sistemas de satlite de dos cables Maxicom2 o SiteControl
Caractersticas
t4JTUFNBDPNQMFUPEFSFUSPBMJNFOUBDJO
t&YUJFOEFMBWFSTBUJMJEBEEFMTJTUFNBEFDPOUSPMDFOUSBMJ[BEP
t$BCMFTDPOEVDUPSFTDPEJGJDBEPTQPSDPMPSQBSBGBDJMJUBSMBJOTUBMBDJO
t$EJHPTEFEJSFDDJOQSPHSBNBCMFTQBSBPQFSBDJOJOEJWJEVBM

t*2QVFEFGVODJPOBSFODPOKVOUPDPOFTUBDJPOFTNFUFPSPMHJDBT

t&ODBQTVMBEPFODVCJFSUBSFTJTUFOUFBMBIVNFEBEZMPTSBZPT67QBSBVUJMJ[BSFO
exteriores

Caractersticas de Maxicom2 (WS-PRO2 solamente)

Funciones

t-BDPNQBUJCJMJEBEEFMBFTUBDJONFUFPSPMHJDB84130FTFTUOEBSQBSB
Maxicom2 v3.6 o software posteriores

t%FDPEJGJDBEPSEFTFOTPS.POJUPSFBMPTJOUFSSVQUPSFTEFDPOUBDUPFOTFDP
(sensor de humedad, interruptor de presin, sistemas de seguridad, etc.) para
condiciones de abierto o cerrado, e informa al sistema sobre el estado del
interruptor

t$BEBTJUJPQVFEFUFOFSTVQSPQJBFTUBDJONFUFPSPMHJDBPQVFEFO
compartirla
t/JWFMFTUOEBSEFDPNVOJDBDJOBVUPNUJDB
t1VFEFODPOGJHVSBSTFIBTUBSFDVQFSBDJPOFTBVUPNUJDBTEFEBUPT
meteorolgicos por da

Sensores de estacin meteorolgica


t5FNQFSBUVSBEFMBJSF
t3BEJBDJOTPMBS
t)VNFEBESFMBUJWB
t7FMPDJEBEEFMWJFOUP
t%JSFDDJOEFMWJFOUP
t1SFDJQJUBDJO

t%FDPEJGJDBEPSEFQVMTPT-FFMPTQVMTPTEFTEFMPTEJTQPTJUJWPTEFNPOJUPSFP 
como sensores de flujo y medidor de lluvia, y enva la informacin al sistema
para analizarla y realizar la accin correspondiente

Especificaciones elctricas
t&OUSBEBSFRVFSJEB7"$ QSPQPSDJPOBEPTQPSFM
trazado de comunicacin de dos cables. No se requiere
suministro de energa por separado)

Dimensiones
t1BSUFTVQFSJPS14" (8.3 cm) de dimetro; Altura: 8 (20.3 cm);
Parte inferior: 212" (6.4 cm) de dimetro

Modelos

Compatibilidad del sistema

t%FDPEJGJDBEPSEFTFOTPSFT%&$4&/-3 QBSBTFOTPSEFJOUFSSVQUPS

t.BYJDPN2 (WS-PRO2 solamente)

t%FDPEJGJDBEPSEFQVMTPT%&$16--3 QBSBTFOTPSEFQVMTPT

t4PGUXBSFEFMTFSWJEPS8FBUIFS3FBDIQBSB&5.BOBHFS

Nota: Todos los decodificadores funcionan solamente con la ruta de comunicacin de dos
cables del satlite. No se requieren para la ruta de comunicacin MAXILink o los satlites
ESP-SITE
Sistemas de control
centralizado

t4JUF$POUSPM SFRVJFSFFMNEVMPEFTPGUXBSFEF&5BVUPNUJDP

t*2WDPO1BRVFUFEFGVODJPOFTBWBO[BEBTEF&5

Modelos
t.PEFMPEFDPOFYJOEJSFDUB84130%$DPOFYJOEFDBCMFQBSDPO
controlador central va mdem local
t.PEFMPEFDPOFYJOUFMFGOJDB841301)NEFNEFEJTDBEPUFMFGOJDP
para comunicaciones telefnicas con controlador central
t.PEFMPEFDPOFYJO841301)4 NPEFMPEFFOFSHBTPMBSNEFNEF
discado telefnico para comunicaciones telefnicas con controlador central, a
energa solar
t.PEFMPEFDPOFYJOMPDBM84130-54)DPOFYJOEFDBCMFQBSDPO
controlador central va mdem local
t.PEFMPJOBMNCSJDP84130-58-DPOFYJOJOBMNCSJDBDPODPOUSPMBEPS
central va radio de 916 MHz (slo disponible en EE. UU. y Canad)
t.PEFMPJOBMNCSJDP84130-58-4DPOFYJOJOBMNCSJDBDPODPOUSPMBEPS
central va radio de 916 MHz, a energa solar (slo disponible en EE. UU. y
Canad)

DEC-SEN-LR

El uso inteligente del agua.

DEC-PUL-LR

157

Sistemas de control centralizado


Sensores meteorolgicos, Accesorios, kits de actualizacin

Sensor de lluvia
RAINGAUGE

Sensor de viento
ANEMOMETER

Maxicom2 o SiteControl

Maxicom2 4JUF$POUSPM *2,


&41-9.& &41-9%

Caractersticas
t1SFDJTPJOUFSSVQUPSNFEJEPSEF
lluvia que mide las precipitaciones
en incrementos de 1/100 de
pulgada
t&TUSVDUVSBEFNFUBMEFHSBO
resistencia
t.OTVMBEFNPOUBKF
t.BMMBQSPUFDUPSBDPOUSBMBTVDJFEBE
tEJNFUSPEFhh

Modelo
t3"*/("6(&

Caractersticas
t.FEJDJOQSFDJTBEFMBWFMPDJEBE
del viento para apagado o
interrupcin de programas de
riego por viento excesivo

Tableros de interfaz Maxi


Actualiza cualquier controlador ESP-MC a un controlador de
satlite de sistema de control centralizado Maxicom2 o SiteControl
Caractersticas del kit de actualizacin
t"DUVBMJ[BVODPOUSPMBEPS&41.$ NPOUBKFTPCSFQBSFEPQFEFTUBM
BVO
DPOUSPMBEPSEFTBUMJUF&414"5P&414*5&
t/PTFSFRVJFSFODBKBTPDBCMFBEPFYUFSOPBEJDJPOBMFT
t*OTUBMBDJOFOTFQBSBEPSFTTPCSFFMUBCMFSPEFTBMJEBEFMDPOUSPMBEPS
t-PTLJUTEFFOMBDFZTJUJPJODMVZFOUSBOTGPSNBEPSFTEFSFQVFTUP

t.OTVMBEFNPOUBKFEFNFUBMEF
gran resistencia

t&MLJUEFBDUVBMJ[BDJOJODMVZFDBCMFTEFDPOFYJOZNBOVBMFT

t3FRVJFSFVOUSBOTNJTPSEFQVMTPT
15P15QBSBVUJMJ[BSDPOFM
sistema Maxicom2

Modelos

t3FRVJFSFVO5SBOTNJTPSEF
QVMTPT15QBSBVUJMJ[BSDPO
4JUF$POUSPM 4JTUFNBT*2 &41-9.& 
&41-9%

t4BUMJUFEFTJUJP&414*5&6 .BYJDPN2 solamente)

t$PNVOJDBDJOTFDVOEBSJBEFEPTDBCMFT41.*#
t$PNVOJDBDJOTFDVOEBSJBEFFOMBDF&41.*#-

Modelo
t"/&..&530

ESP-MIB-TW

Sistemas de control
centralizado

RAINGAUGE

ANEMOMETER

Proteccin contra sobretensiones MSP-1

Placa de descarga a tierra MGP-1

Proteccin contra sobretensiones Maxicom2 o SiteControl para


sistemas descodificadores y sistemas satelitales de dos cables

Proteccin contra sobretensiones Maxicom2 o SiteControl para


sistemas descodificadores y sistemas satelitales de dos cables

Caractersticas

Caractersticas

t1SPUFHFMPTDPNQPOFOUFTEFMTJTUFNBEFDPOUSPMDFOUSBMJ[BEPDPOUSB
descargas elctricas en una ruta de comunicacin de dos cables

t1SPQPSDJPOBVOBVCJDBDJOEFNPOUBKFQBSB.41VPUSPTDBCMFTEF
descarga a tierra directamente en una varilla o tubo de descarga a tierra

t1VFEFJOTUBMBSTFFOVOQFEFTUBMQBSBTBUMJUF FOVOB$$6PFOVOBDBKBEF
vlvulas junto con MGP-1 (placa de descarga a tierra Maxicom2)

t*OTUBMBEPTPCSFWBSJMMBPUVCPEFEFTDBSHBBUJFSSB

Modelo

Modelo
t.(1

t.41

MSP-1
MGP-1

158

El uso inteligente del agua.

Sistemas de control centralizado

www.rainbird.com/gsp

Planes de asistencia global para los sistemas


de control centralizado

Planes de asistencia global para los


sistemas de control centralizado
Paquetes de servicios con posibilidad de ampliacin para su
sistema de control centralizado
Q Los miembros del Plan de asistencia global disfrutan de una gran
cantidad de beneficios, tales como descuentos especiales en servicios
de GSP como el Programa de intercambio de tablero, costos de
mantenimiento ms bajos para su Sistema de control centralizado de
Rain Bird con nuestra caracterstica de asistencia tcnica de hardware
de nivel Platinum, y asistencia tcnica remota brindada por expertos
de nuestro grupo de ingenieros GSP para solucionar problemas
tcnicos o como asistencia durante el aprendizaje acerca de cmo
maximizar el rendimiento de su sistema

Q Los paquetes de servicios con posibilidad de ampliacin le brindan


ms opciones al decidir qu plan es mejor en funcin de sus
necesidades y su presupuesto. Elija entre:
t 1MBUJOVN1MVT BPT
t1MBUJOVN PBPT

t (PME  PBPT
t*2Z&41-9% BPT

t1MBOFTEFTFSWJDJP.BYJDPN2 y SiteControl
- Plan de asistencia de nivel Gold
t %JBHOTUJDPZTPMVDJOEFQSPCMFNBTEFTPGUXBSFZIBSEXBSF
- Asistencia a travs de lnea telefnica gratuita, de 8 am a 5 pm, horarios
de oficina locales, das hbiles normales
t"TJTUFODJBSFNPUBEFTPGUXBSF
&MTPGUXBSF4ZNBOUFDQD"OZXIFSFP(P5P"TTJTUQFSNJUFBMPT
ingenieros de asistencia acceder en forma remota a su sistema de
control centralizado cuando no es posible resolver los inconvenientes
por telfono
t%FTDVFOUPTEFM1SPHSBNBEFJOUFSDBNCJPEFUBCMFSP
- Le brinda la oportunidad de obtener un hardware de repuesto
seleccionado a un precio de descuento.
t"DUVBMJ[BDJPOFTNFOPSFTEFTPGUXBSF
- Le proporciona los paquetes de servicio para sistemas de control
centralizado ms nuevos para su nivel de servicio sin cargo adicional
- Plan de asistencia de nivel Platinum
 5PEBTMBTDBSBDUFSTUJDBTEFMQMBOEFTFSWJDJP(PME BEFNTEF
t.FKPSBTEFTPGUXBSFZOVFWPTMBO[BNJFOUPTJNQPSUBOUFT
- Reduce el gasto de la adicin de nuevas caractersticas, funciones y
actualizaciones de su sistema a versiones ms nuevas de su software del
sistema de control centralizado

Planes de asistencia global comercial


Platinum

Platinum
Plus

Programa de reemplazo de hardware


el siguiente da hbil.

t
t

Servicio de respaldo de
base de datos con seguridad remota

t
t
t
t

t
t
t
t
t

t
t
t
t
t

Rain Bird Services Corporation descuentos para la academia de Rain Bird

%FTDVFOUPTFOFMTFSWJDJPEFDPOWFSTJO
EFCBTFEFEBUPT.%$ TPMPDPOFMQMBO
independiente Gold)

Caractersticas

Gold

Nueva computadora de riego de Rain Bird

Actualizaciones menores gratuitas


de software
Soporte tcnico remoto a travs de una
lnea telefnica gratuita
%JBHOTUJDPTEFTJTUFNBBEJTUBODJB
%FTDVFOUPTEFM1SPHSBNBEFJOUFSDBNCJP
de tablero
Nuevos lanzamientos importantes
de software

t1SPHSBNBEFQSTUBNPEFIBSEXBSF 
- Asegura que, en caso de que un componente de hardware del sistema
de control centralizado de Rain Bird cubierto por el plan de asistencia
global deje de funcionar, recibir uno en prstamo por medio de
VOTFSWJDJPEFFOUSFHBBEPNJDJMJPFMTJHVJFOUFEBICJM`TJODBSHPT
BEJDJPOBMFT
- Plan de asistencia de nivel Platinum Plus
5PEBTMBTDBSBDUFSTUJDBTEFMQMBOEFTFSWJDJP1MBUJOVN BEFNTEF
tr"DUVBMJ[BDJOEF1$
- Reduce el gasto de actualizacin de su sistema a la ltima versin del
sistema computarizado para los sistemas de control centralizado de
Rain Bird

El uso inteligente del agua.

159

Sistemas de control
centralizado

Caractersticas

Sistemas de control centralizado


Planes de asistencia global para los sistemas
de control centralizado

Planes de asistencia global para los sistemas de control


centralizado (cont.)

Opciones de renovacin (Planes de suma fija)

t1MBOFTEFTFSWJDJP*2Z&41-9%

Maxicom2 Platinum/ Platinum Plus


Estndar
Estndar
Plus: estndar + computadora
Maxicom2 Gold
Prueba
Estndar
Estndar
Platinum/ Platinum Plus de SiteControl
Estndar
Estndar
Plus: estndar + computadora
Gold de SiteControl
Prueba
Estndar
Estndar
ESP-LXD
Estndar
IQ
Estndar

Modelo

1SPHSBNBEFQSTUBNPEFIBSEXBSF 
- Mejoras de software y nuevos lanzamientos importantes
- Actualizaciones menores de software
%JBHOTUJDPZTPMVDJOEFQSPCMFNBTEFTPGUXBSFZIBSEXBSFEF(41
t"TJTUFODJBFODBTPEFJODJEFOUFTZPUSPT
- Para los clientes sin GSP, Rain Bird ofrece servicios de asistencia por telfono
RVFTFDPCSBOQPSJODJEFOUF-MNFOPTBM(419135QBSBPCUFOFSNT
informacin
* Nota: El programa de prstamo de hardware requiere que obtenga una inspeccin
de verificacin de la instalacin del sistema de control centralizado de Rain Bird. Los
Programas de prstamo Platinum y Platinum Plus se limitan a 5 sitios registrados (en
base a los nmeros seriales CCU, Site-SAT, TWI, LDI o SDI). Se pueden comprar privilegios
de prstamo para sitios adicionales con una tarifa adicional.

Si desea obtener ms informacin acerca de nuestros Planes de


asistencia global sobre control centralizado, contctese con su
distribuidor de control central de Rain Bird local o comunquese
con GSP al (866) GSP XPRT.

N. de pieza

2 aos
3 aos
3 aos

M95520
M95530
M95540

1 aos
2 aos
3 aos

M95560
M95570
M95580

2 aos
3 aos
3 aos

M97520
M97530
M97540

1 aos
2 aos
3 aos

M97560
M97570
M97580

2 aos

M001351

2 aos

I95200

Opciones de renovacin (Planes de pago)


Modelo

Maxicom Platinum Plus


Suscriptores nuevos o antiguos
Suscriptores actuales
Maxicom Platinum
Suscriptores actuales
SiteControl Platinum Plus
Suscriptores nuevos o antiguos
Sistemas de control
centralizado

Suscriptores actuales
SiteControl Platinum
Suscriptores actuales

160

Suscripcin

Pago
Frecuencia

Suscripcin

N. de pieza

Anual
Mensual
Anual
Mensual

3 aos
3 aos
3 aos
3 aos

M95541A1
M95542M1
M95543A1
M95544M1

Anual
Mensual
Anual
Mensual

2 aos
2 aos
3 aos
3 aos

M95520A1
M95520M1
M95530A1
M95530M1

Anual
Mensual
Anual
Mensual

3 aos
3 aos
3 aos
3 aos

M97541A1
M97542M1
M97543A1
M97544M1

Anual
Mensual
Anual
Mensual

2 aos
2 aos
3 aos
3 aos

M97520A1
M97520M1
M97530A1
M97530M1

El uso inteligente del agua.

Impactos

Rotores

Boquillas aspersoras

Cuerpos de
aspersores

Introduccin

Cuerpos de difusores
Xerigation / Riego por goteo

Programadores

Accesorios

Vlvulas

Crec en Tucson, as que ahorrar agua es mi


pasin. Me interes en Drip-in-Turf despus
de ver el xito que tena en un edificio
corporativo en Del Mar y en una Universidad
de San Diego. Quise experimentarlo yo misma
y readapt mi propio jardn. Mi jardn tiene
una forma irregular y el riego excesivo era un
gran problema. Aplicar agua directamente
a la zona de la raz fue una solucin muy
eficiente. El jardn se ve fantstico y yo
ahorro agua. Ahora soy una firme creyente y
especifico Drip-in-Turf cada vez que puedo.

Bombas

Xerigation

Sistemas de control
centralizado

Marian Marum, ASLA, LEED AP


Marum Partnership Landscape Architecture
San Diego, California

El uso inteligente del agua.

t Utilice el riego por goteo para


eliminar el riego excesivo y el
desperdicio. Elimine tambin las
antiestticas manchas de agua en
FEJGJDJPTZDFSDBT:MBFSPTJOEFM
suelo, el escurrimiento de agua y los
posibles litigios. Mantenga secos los
caminos, las calles y los vehculos.

t Pregntele a su asesor fiscal acerca de


los gastos de amortizacin al calcular
el retorno de la inversin en un
sistema de riego por goteo. Ahorre
agua y dinero a la vez.

Recursos

agua directamente a la zona de la raz. Utilice


lneas de riego por goteo en plantaciones
densas donde es ms costeable distribuir bajos
volmenes de agua de manera uniforme. Utilice
un sistema de dispositivos de emisin precisa
para plantas con mayor espaciamiento donde es
ms factible regar cada planta por separado.

Referencia

t Los productos de riego por goteo proporcionan

Drenaje

Sugerencias para ahorrar agua

161

Xerigation/Riego por goteo


Panorama general del sistema Xerigation

Panorama general de un sistema de Riego por goteo/Xerigation


Riego localizado con Xerigation/Riego por goteo

La lnea de productos ms amplia en la industria

Los productos de Xerigation o riego por goteo de Rain Bird estn especialmente
diseados para sistemas de riego por goteo. Al regar las races de las plantas o las
zonas cercanas, los productos Xerigation de
Rain Bird proporcionan un riego localizado con las siguientes ventajas:

Con ms de 150 productos, Rain Bird posee los productos necesarios para su
aplicacin. Los sistemas se pueden disear para cumplir con todos los requisitos del
sitio y ofrecer muchos avances exclusivos de Rain Bird que incluyen:

t$POTFSWBDJOEFMBHVB
t.BZPSFGJDBDJB SJFHPMPDBMJ[BEPFODBEBQMBOUB

t%JTFPGMFYJCMF FTUSVDUVSBTJNQMFZGDJMNFOUFFYQBOTJCMF
t1MBOUBTNTTBMVEBCMFT
t.FOPTSJFTHPT TFFWJUBOFMSPDJBEPFYDFTJWPZFMFTDVSSJNJFOUP

t.FOPSOEJDFEFDSFDJNJFOUPEFNBMF[BT
t"IPSSPFODPTUPT

t4JTUFNBEFSJFHPQPSHPUFPGMFYJCMFTFSJF9FSJ'MFYDPOQPMNFSPTBWBO[BEPT
que brindan resistencia al pliegue y memoria de rollo reducida para una
instalacin ms sencilla.
t;POBTEFDPOUSPMDPNQBDUPDPOGJMUSPZSFHVMBEPSEFQSFTJODPNCJOBEPTQBSB
reducir la cantidad de piezas y los problemas de fugas potenciales, e insertar
ms zonas de control en una caja de vlvulas.
t#PRVJMMBTBTQFSTPSBTEFQSFDJTJO42EFCBKPWPMVNFO RVFPGSFDFOVOQBUSO
de riego cuadrado y se ajustan a distancias de alcance de 2.5 4 (0.76 1.2 m).
t&NJTPSFTEFGVFOUFEFQVOUBRVFCSJOEBODPNQFOTBDJOEFQSFTJODPOVOB
amplia seleccin de ndices de caudal y tres opciones de entrada (con conector
de punta, roscada 1032 y rosca hembra para tubera de 1/2" [1.3 cm]).
t-OFBEFSJFHPQPSHPUFPTVCUFSSOFPTFSJF9'4DPOUFDOPMPHB$PQQFS
Shield para usar en aplicaciones subterrneas debajo de csped o zonas
de arbustos y cubiertas vegetales. La tecnologa Copper Shield protege al
emisor con eficacia frente a la invasin de races.

Xerigation
NUEVO

37

,JUTEFDPOUSPMEF[POB QH

1a. Vlvula para caudal bajo (pg. 198)


C'JMUSPSFHVMBEPSEFQSFTJO QH

"EBQUBEPSIFNCSB&BTZ'JU QH

"DPQMF&BTZ'JU QH

4. Herramienta Xeriman (pg. 189)


5VCFSBEFSBZBTOFHSBT9FSJ#MBDL4USJQF
(pg. 185)

162

6. Emisor Xeri-Bug (pg. 164)


7. Estaca para tubera de 1/4 (6.3 mm) (pg. 176)
5VCFSBEFEJTUSJCVDJO92EFhh NN
(pg. 184)
$POFDUPSEFQVOUBFO5EF NN
 QH

10. Estaca para sujetar (pg. 188)


$PEP&BTZ'JU QH

12. Cubierta aspersora contra insectos (pg. 176)


13. Cubierta aspersora para emisores con compensacin
de presin (pg. 176)

14. Mdulo de compensacin de presin - 1032 (pg. 168)


&OTBNCMFEFUVCFSBEFFMFWBDJOEF1PMZ'MFY QH

&NJTPS9FSJ#VH3PTDBIFNCSBQBSBUVCFSBEFw
(1.3 cm) (pg. 164)
$POFDUPSBVUPQFSGPSBOUFEFw NN
 QH

#PRVJMMBDVBESBEBTFSJF42 BOUFSJPSNFOUFEFOPNJOBEB
XPCN) (pg. 170)
19. Xeri-Pop (pg. 172)
9FSJ#VCCMFS41:, QH

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

Panorama general del sistema Xerigation

Xerigation

NUEVO

NUEVO

,JUEFWMWVMBEFBMJWJPEFBJSF"37 QH

22. Caja de vlvulas para emisor SEB-7X (pg. 188)


-OFBEFSJFHPQPSHPUFP9'% QH

24. Cortador de tubera (pg. 188)


25. Xeri-Bird 8 (pg. 167)
26. Regulador de presin en lnea (pg. 204)
27. Maneral de 6 salidas (pg. 166)
"EBQUBEPSEFCPRVJMMBTFSJF42 QH

El uso inteligente del agua.

5&BTZ'JU QH

5BQOEFESFOBKF&BTZ'JU QH

31. Lnea de riego por goteo violeta (pg. 178)


32. Emisor Xeri-Bug - 1032 ((pg. 164)
5VCFSBEFEJTUSJCVDJO95 QH

34. Conector de punta de 1/4" (6.3 mm) (pg. 188)


35. Xeri-Bug de salidas mltiples (pg. 166)

4JTUFNBEFSJFHPQBJTBKTUJDPQPSHPUFPWJPMFUBEF
(6.3 mm) (pg. 187)
-OFBEFSJFHPQPSHPUFPTVCUFSSOFPTFSJF9'4DPO
tecnologa Copper Shield (pg. 180)
,JUEFSFFNQMB[PEFSPDJBEPBSJFHP3&530
(pg. 189)
39. Accesorio de transferencia gris con conectores en
QVOUBYSPTDBIFNCSBQBSBUVCFSBEFw DN

NUEVO
95 QH

163

Xerigation/Riego por goteo


%JTQPTJUJWPTEFFNJTJO

Entrada
Salida

Emisores Xeri-Bug
Emisores de caudal bajo de fuente de punta para regar la zona de
las races de plantas, rboles y plantas de macetas
Q Los nicos emisores con conectores autoperforantes que permiten una
instalacin ms fcil con la herramienta Xeriman
Q La ms amplia seleccin de emisores con compensacin de presin, con
3 ndices de caudal y 3 opciones de entrada

XB-05PC, XB-10PC, XB-20PC

Q Emisores ms compactos y ocultos

Caractersticas

NUEVO
Codificacin por
color Ahora en
Entrada

Entrada
Salida

XB-05PC-1032, XB-10PC-1032, XB-20PC-1032


Los modelos roscados 1032 estn
especficamente diseados para usar con
UVCFSBTEFFMFWBDJOEF1PMZ'MFY BEBQUBEPSFT
de rosca 1032 (1032-A) o el adaptador
Xeri-Bubbler 1800 (XBA-1800)
Salida

tOEJDFTEFDBVEBMEFZHQI ZMI

- El diseo del compensador de presin proporciona un caudal uniforme a


travs de un amplio rango de presin (15 a 50 psi; 1 a 3.5 bares)
t%JTQPOJCMFDPOFOUSBEBTEJGFSFOUFT NPEFMPTZ

- Conector autoperforante para una rpida insercin, de un solo paso, en la
tubera de riego por goteo de 1/2" (1.3 cm) 3/4" (1.9 cm)
- Entrada roscada 10-32 que se enrosca fcilmente a una tubera de elevacin
EF1PMZ'MFY DPOTVMUFMBQH
BEBQUBEPSEFSPTDB QH
P
adaptador Xeri-Bubbler 1800 (pg. 177)
- Entrada de rosca hembra para tubera de 1/2 (1.3 cm) que se enrosca
fcilmente a una tubera de elevacin de PVC de 1/2 (1.3 cm) (modelos de
1 y 2 gph [3.8 y 7.6 l/h])
t&MDPOFDUPSEFQVOUBEFMBTBMJEBTVKFUBEFGPSNBTFHVSBMBUVCFSBEF
EJTUSJCVDJO 92
EF1/4" (6.3 mm)
t&MEJTFPIBDFRVFMBJOTUBMBDJOZFMNBOUFOJNJFOUPTFBOGDJMFT
- La accin de limpieza automtica reduce las obstrucciones
 %JTFPGVFSUFIFDIPDPONBUFSJBMFTBMUBNFOUFJOFSUFT SFTJTUFOUFT
a los productos qumicos
- La estructura de plstico duradero es resistente a los rayos ultravioleta
t$PEJGJDBEPTQPSDPMPSQBSBJEFOUJGJDBSFMOEJDFEFDBVEBM

Rango operativo

Rosca hembra para tubera


de 12" (14 cm) Entrada

t$BVEBMEFBHQI EFBMI

t1SFTJOEFBQTJ EFBCBSFT

t'JMUSBDJOSFRVFSJEBNBMMB NJDSPOFT

Modelos: Conectores de punta con entrada x salida


XBT-10, XBT-20
Xerigation

t9#1$B[VM HQI MI

t9#1$OFHSP HQI MI

t9#1$SPKP HQI MI

Modelos: entrada de rosca 10-32 x salida del conector de punta

Cmo especificar
XB - T - 05 - PC - 1032
Caracterstica
entrada
roscada 1032
Compensacin de presin
Caudal
HQI MI

HQI MI

HQI MI

t9#1$B[VM HQI MI

t9#1$OFHSP HQI MI

t9#1$SPKP HQI MI

Modelos: Entrada de rosca hembra para tubera de 1/2" (1.3 cm)


t9#5OFHSP HQI MI

t9#5SPKP HQI MI

Caracterstica
Entrada de rosca hembra para
1
Modelo tubera de 2" (14 cm)
Xeri-Bug

Use un emisor roscado 1032 en una tubera de elevacin de Polyflex cortado justo sobre el nivel del terreno para reas de mucho trfico. Esta
configuracin asegura una alineacin adecuada del emisor y sus plantas estarn saludables, a pesar del trnsito a pie.

164

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

%JTQPTJUJWPTEFFNJTJO

XB-05PC
XB-10PC
XB-20PC
9#1$
9#1$
9#1$
9#51$
9#51$

Tipo de entrada/
Color

Nominal Filtracin
Caudal
requerido
gph
malla

Conector de punta/azul
Conector de punta/negro
Conector de punta/rojo
5B[VM
5OFHSP
5SPKP
'1512" (14 cm)/negro
'1512" (14 cm)/negro

0.5
1.0
2.0



1.0
2.0

200
150
150



150
150

4*45.53*$0
2.5

10.0

2.0

XB-20
9#5

1.5
1.0

XB-10
9#5

XB-05

0.5
0.0

10

20 30 40
Presin (psi)

50

60

Nominal
Caudal
l/h

Filtracin
requerido
micrones

XB-05PC
XB-10PC
XB-20PC
9#1$
9#1$
9#1$
9#51$
9#51$

Conector de punta/azul
Conector de punta/negro
Conector de punta/rojo
5B[VM
5OFHSP
5SPKP
'1512" (14 cm)/negro
'1512" (14 cm)/negro

1.89
3.79
7.57



3.79
7.57

75
100
100



100
100

6.0
4.0

XB-20
9#5

XB-10
9#5
XB-05

2.0
0.0

0 0.5 1.0 1.5 2.0 2.5 3.0 3.5 4.0


Presin (bares)

Opcin de instalacin 1

66

Tipo de entrada/
Color

8.0

(Para los nmeros de referencia a continuacin, consulte la


pgina 162 de informacin general del sistema Xerigation.)

Modelos y especificaciones de los emisores Xeri-Bug SIST. MTRICO


Modelo

ndice de caudal (l/h)

Modelo

Datos de rendimiento de los emisores Xeri-Bug

ndice de caudal (gph)

Modelos y especificaciones de los emisores Xeri-Bug

12

Con una herramienta Xeriman, inserte un


emisor directamente en una tubera de
goteo de o entre los emisores del
sistema de goteo, segn corresponda.

Opcin de instalacin 2
8

Para una distribucin de agua ms


precisa, utilice una tubera de
distribucin de , una estaca de tubera
de y una cubierta contra insectos.

66

Opcin de instalacin 3
Para una distribucin de agua precisa, se
puede perforar un conector de punta en la
tubera de distribucin. Despus, el emisor se
coloca en el extremo de la tubera de
distribucin de . NOTA: si se sale el emisor,
se producir un caudal irregular.

88

25
25

12
12

77
26
26

88

35

El Xeri-Bird 8 proporciona una ubicacin


centralizada para ocho emisores como
mximo. Se puede utilizar una mezcla de
emisores Xeri-Bug y/o PC para proporcionar
los ndices de caudal necesarios para
distintos materiales vegetales. Los
tentculos de la tubera de distribucin de
, las estacas de la tubera de y las
cubiertas contra insectos permiten una
distribucin de agua ms precisa.

Opcin de instalacin 5
8
8

66

27
27

77

Emisor Xeri-Bug, estaca TS025-1/4 (6.3 mm) y cubierta aspersora


contra insectos DBC025

El uso inteligente del agua.

El maneral de 6 salidas proporciona una


conexin de distribucin de agua
centralizada para seis dispositivos de
emisin como mximo. Conecte la tubera
de distribucin de a una de las salidas.
Utilice la estaca de la tubera de para
garantizar una distribucin de agua
precisa. El emisor se coloca en el extremo
de la tubera de distribucin de 1/4 para
regular el caudal de agua. NOTA: si se sale
el emisor, se producir un caudal irregular.

165

Xerigation

Opcin de instalacin 4

5
17

Xerigation/Riego por goteo


%JTQPTJUJWPTEFFNJTJO

Xeri-Bugde varias salidas


Caractersticas
t&MEJTFPEFMDPNQFOTBEPSEFQSFTJOQSPQPSDJPOBVODBVEBMVOJGPSNF
a travs de un amplio rango de presin (15 a 50 psi; 1 a 3.5 bares)
t&NJTPSEFTFJTTBMJEBTQSPQPSDJPOBEPDPOVOBTBMJEBBCJFSUB4JNQMFNFOUF
recorte las puntas de las salidas para abrirlas usando tijeras o un cortador,
a fin de habilitar orificios operativos adicionales
t-BTTBMJEBTDPODPOFDUPSFTEFQVOUBSFUJFOFOMBUVCFSBEFEJTUSJCVDJO 92
EF
1
/4" (6.3 mm)
t-BBDDJOEFMJNQJF[BBVUPNUJDBSFEVDFMBTPCTUSVDDJPOFT
t$BSDBTBEFQMTUJDPEVSBEFSPZSFTJTUFOUFBMPTSBZPTVMUSBWJPMFUB DPEJGJDBEBQPS
color

XB-05-6, XB-10-6, XB-20-6

Rango operativo
t$BVEBMHQI MI

t1SFTJOEFBQTJ EFBCBSFT

t'JMUSBDJONBMMB NJDSPOFT

Modelos: Entrada de rosca hembra para tubera de 1/2" (1.3 cm)


t9#5B[VM HQI MI

t9#5OFHSP HQI MI

t9#5SPKP HQI MI

Conector de 6 salidas - EMT-6XERI


Caractersticas

Xerigation

t-BFOUSBEBEFSPTDBIFNCSBQBSBUVCFSBEF1/2 (1.3 cm) se enrosca en la


tubera de elevacin de 1/2 (1.3 cm) y proporciona un maneral con seis
salidas de conectores de punta de caudal libre de 1/4 (6.3 mm)
t$BEBTBMJEBEFDPOFDUPSEFQVOUBFTUTFMMBEBDPOVOBDVCJFSUBEFQMTUJDP
duradera
t-BTDVCJFSUBTEFQMTUJDPTFRVJUBOGDJMNFOUFZQFSNJUFODSFBSVOSFBEF
riego por goteo que puede personalizarse con hasta seis dispositivos de
emisin diferentes
t$POFDUFVOBUVCFSBEFEJTUSJCVDJO 92
EF14" en cada salida para usar con:
Xeri-Bugs, mdulos compensadores de presin, Xeri-Sprays y Xeri-Bubblers

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

Modelo
t&.59&3*

SIST. MTRICO
2.5
2
1.5

XB-10-6, XBT -10-6

1
XB-05-6, XBT -05-6

0.5
0

10

20
30
Pressure (psi)

40

50

Conector
autoperforante de
1
4" (6.3 mm)
Caractersticas
t6TBEPQBSBDPOFDUBSMBUVCFSBEF
distribucin de 1/4 (6.3 mm) a una
tubera de distribucin de 1/2 3/4
(1.3 1.9 cm)
t&MDPOFDUPSBVUPQFSGPSBOUFTF
inserta fcilmente en la tubera
de distribucin de 1/2 (1.3 cm)
3
/4 (1.9 cm) con una herramienta
Xeriman 9.5PPM

t&MDPOFDUPSEFQVOUBEFMBTBMJEB
es compatible con la tubera de
EJTUSJCVDJO 92
EF1/4" (6.3 mm) El
conector de punta gris de la salida
indica que la unidad tiene caudal
sin restricciones

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

Modelo
EMT-6XERI

t41#

SPB-025

166

9.46

XB-20-6, XBT -20-6

Flow Rate (l/h)

t9#B[VM HQI MI

t9#OFHSP HQI MI

t9#SPKP HQI MI

Rendimiento del emisor Xeri-Bug de varias salidas

Flow Rate (gph)

Modelos: Conectores de punta con entrada x salida

XBT-05-6, XBT-10-6, XBT-20-6

XB-20-6, XBT -20-6

7.57
5.68

XB-10-6, XBT -10-6

3.79
XB-05-6, XBT -05-6

1.89
0

0.7

1.4
2.1
Pressure (bar)

2.8

3.5

Accesorio de
NUEVO
transferencia
gris con conectores
en punta x rosca
hembra para tubera
de (1.27 cm)
Caractersticas
t4BMJEBHSJTQBSBEFTJHOBSFMGMVKP
abierto
t-BFOUSBEBEFSPTDBIFNCSBQBSB
UVCFSBEFTFQVFEFDPOFDUBS
fcilmente a un elevador Schedule
80 o a la parte superior de un Retro
1800.
Salida con conectores de punta para
que la tubera de distribucin de
PMBUVCFSBEFHPUFPEFwTF
puedan conectar de forma segura.

Rango operativo
t1SFTJOEFBQTJ
(de 0 a 3.5 bares)

Modelo

Entrada

t95

Salida

XT025

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

%JTQPTJUJWPTEFFNJTJO

Dispositivo de emisin de varias salidas


Xeri-Bird 8

Desenrosque para acceder al


filtro de malla 200 (75 micrones)

El dispositivo de varias salidas ms flexible y con ms funciones


en el mercado, ideal para proyectos nuevos y aplicaciones de
retroadaptacin

Desenrosque para acceder a los


orificios de caudal independiente

Q El nico dispositivo de varias salidas en el mercado con 8 orificios


configurables y 10 opciones de caudal para cada orificio a fin de lograr la
mayor flexibilidad

La tuerca de la base de unin


permite quitarla de la tubera de
elevacin sin enredar las tuberas
de 14SDSq (6.3 mm)

Q -PTNPEFMPT9#%Z9#%DPOUJFOFOVOGJMUSPJODPSQPSBEPDBEBVOP
Hace que la retroadaptacin sea fcil cuando se instala con el regulador de
presin opcional en el vstago (PRS-050, pg. 204)

Q 'DJMEFNBOUFOFSQPSRVFFMDVFSQPTFQVFEFRVJUBSGDJMNFOUFEFMBUVCFSB

Regulador de presin PRS-05030


opcional en el vstago

de elevacin

Caractersticas
t4FFOSPTDBFODVBMRVJFSUVCFSBEFFMFWBDJOEF1/2 (1.3 cm) y proporciona
agua a mltiples ubicaciones para obtener una mayor flexibilidad del sistema
t$BEBPSJGJDJPBENJUFVOFNJTPS9FSJ#VH o un mdulo compensador de
presin para caudales independientes desde 0.5 hasta 24 gph (1.89 a 90.84
l/h), o bien puede utilizar un conector autoperforante (SPB-025) para caudal no
restringido
t-PTNPEFMPT9#%Z9#%DVFOUBODBEBVOPDPOVOGJMUSPEFNBMMBJOUFHSBM
200 (75 micrones) que es fcil de mantener desde la parte superior
t0DIPTBMJEBTDPODPOFDUPSFTEFQVOUB EFBHBSSFTFHVSPZNPOUBEPTFOMB
QBSUFJOGFSJPSSFUJFOFOMBUVCFSBEFEJTUSJCVDJO 92
EF
1
/4" (6.3 mm) de forma segura
t-BUVFSDBOJDBEFMBCBTFEFVOJOQFSNJUFRVJUBSFMDVFSQPEFM9FSJ#JSEEF
la tubera de elevacin para una instalacin y un mantenimiento sin problemas
t-PTFNJTPSFTTFEFCFOJOTUBMBSEFOUSPEFM9FSJ#JSEQBSBQSFWFOJSMB
contrapresin excesiva.

XBD-80

Rango operativo

Modelos
t9#%VOJEBE9FSJ#JSE JODMVZFUBQPOFTFYUSBCMFTQBSBMPTPSJGJDJPTZVO
filtro)
t9#%VOJEBE9FSJ#JSE JODMVZFPDIPFNJTPSFT9FSJ#VHEFHQI<MI>
instalados en fbrica y un filtro)

XBD-80 con 8 Xeri-Bugs y un


regulador en el vstago que se
muestra instalado (Xeri-Bugs y el
regulador de presin en el vstago
se solicitan por separado)

Xerigation

t$BVEBMEFBHQI EFBMI
QPSTBMJEB
t1SFTJOEFBQTJ EFBCBSFT

Piezas de repuesto:
t9#%4$3/NBMMBEFSFQVFTUPZEPTKVOUBTUSJDBT

Consejo til: siempre instale los emisores


con el extremo en punta (conector de
punta de entrada) o el extremo roscado
hacia arriba, como se muestra
Use una mezcla de emisores Xeri-Bug y el mdulo de compensacin de presin en un Xeri-Bird 8 para satisfacer las necesidades de riego de los
diferentes materiales de las plantas. Al mezclar emisores, asegrese de ver el tiempo de riego del sistema para evitar el riego excesivo o escaso.

El uso inteligente del agua.

167

Xerigation/Riego por goteo


%JTQPTJUJWPTEFFNJTJO

Mdulos compensadores de presin


Emisores de punta y caudal medio para regar arbustos grandes y
rboles
Q Los nicos emisores con conectores autoperforantes que permiten una
PC-05, PC-07, PC-10

instalacin ms fcil con la herramienta Xeriman

Q La ms amplia seleccin de emisores con compensacin de presin, con 6


ndices de caudal y 3 opciones de entrada
Entrada
Salida

PC-12, PC-18, PC-24

Q Emisores ms compactos y ocultos

Caractersticas
tOEJDFTEFDBVEBMEFBHQI EFBMI

t&MEJTFPEFMDPNQFOTBEPSEFQSFTJOQSPQPSDJPOBVODBVEBMVOJGPSNFB
travs de un amplio rango de presin (15 a 50 psi; 0.7 a 3.5 bares)
t%JTQPOJCMFDPOFOUSBEBTEJGFSFOUFT
- Conectores autoperforantes para una rpida insercin de un solo paso en la
UVCFSBEFSJFHPQPSHPUFPEF DN
 DN

- Entrada roscada 10-32 que se enrosca fcilmente a una tubera de
FMFWBDJOEF1PMZ'MFY DPOTVMUFMBQH
BEBQUBEPSEFSPTDB QH
177) o adaptador Xeri-Bubbler 1800 (pg. 177)
&OUSBEBEFSPTDBIFNCSBQBSBUVCFSBEFDN
RVFTFFOSPTDB
GDJMNFOUFBVOBUVCFSBEFFMFWBDJOEF17$EF DN

PC-05-1032, PC-07-1032, PC-10-1032


Los modelos roscados 1032 estn especficamente diseados para usar con
UVCFSBTEFFMFWBDJOEF1PMZ'MFY BEBQUBEPSFTEFSPTDB "
PFM
adaptador Xeri-Bubbler 1800 (XBA-1800)

t%JTFPGVFSUFMBFTUSVDUVSBEFQMTUJDPEVSBEFSPFTSFTJTUFOUFBMPTSBZPT
ultravioleta y est codificada por color para identificar el ndice de caudal

Rango Operativo*
t$BVEBMEFBHQI EFBMI

t1SFTJOEFBQTJ EFBCBSFT

t'JMUSBDJOSFRVFSJEBNBMMB NJDSPOFT

NUEVO

* Nota: use una cubierta aspersora con compensacin de presin para eliminar la
aspersin del agua al usar un mdulo compensador de presin estacado en el extremo
EFMBUVCFSBEFEJTUSJCVDJO 15
EF NN
PFOVOBUVCFSBEFFMFWBDJOEF
1PMZ'MFY 1'3'3"

Modelos: Conectores de punta con entrada x salida

Xerigation

PCT-05, PCT-07, PCT-10


Entrada de rosca hembra para tubera de 12" (1.3 cm)
que se enrosca fcilmente a una tubera de elevacin
de PVC de 12" (1.3 cm)

t1$NBSSODMBSP HQI MI

t1$WJPMFUB HQI MI

t1$WFSEF HQI MI

t1$NBSSOPTDVSP HQI MI

t1$CMBODP HQI MI

t1$OBSBOKB HQI MI

Modelos: entrada de rosca 10-32 x salida del conector de punta


t1$NBSSODMBSP HQI MI

t1$WJPMFUB HQI MI

t1$WFSEF HQI MI

Modelos: Entrada de rosca hembra para tubera de 1/2" (1.3 cm)

Cmo especificar

t1$5NBSSODMBSP HQI MI

t1$5WJPMFUB HQI MI

t1$5WFSEF HQI MI

PC - T - 05 - 1032
Caracterstica
Entrada roscada 1032
Caudal
5 gph (18.93 l/h)
Entrada de rosca hembra para
tubera de 1/2" (1.3 cm)
Modelo
PC: Compensacin de presin

168

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

%JTQPTJUJWPTEFFNJTJO

Modulos compensadores de presin


Modelos de mdulos compensadores de presin

Modelos de mdulos compensadores de presin SISTEMA MTRICO

Modelo

Tipo de entrada/
Salida/Color

Nominal Filtracin
Caudal
requerido
gph
malla

Modelo

Tipo de entrada/
Salida/Color

PC-05
PC-07
PC-10
PC-12
PC-18
PC-24
1$
1$
1$
1$5
1$5
1$5

Conector de punta/marrn claro


Conector de punta/violeta
Conector de punta/verde
Conector de punta/marrn oscuro
Conector de punta/blanco
Conector de punta/naranja
5NBSSODMBSP
5WJPMFUB
5WFSEF
/15NBSSODMBSP
/15WJPMFUB
/15WFSEF

5
7
10
12
18
24







PC-05
PC-07
PC-10
PC-12
PC-18
PC-24
 1$
 1$
 1$
 1$5
 1$5
 1$5

Conector de punta/marrn claro


Conector de punta/violeta
Conector de punta/verde
Conector de punta/marrn oscuro
Conector de punta/blanco
Conector de punta/naranja
5NBSSODMBSP
5WJPMFUB
5WFSEF
/15NBSSODMBSP
/15WJPMFUB
/15WFSEF

100
100
100
100
100
100







Nominal
Caudal
l/h
18.93
26.50
37.85
45.42
68.13
90.84







Filtracin
requerido
micrones
150
150
150
150
150
150







Rendimiento de los mdulos y burbujeadores compensadores de presin

28
24
20
16
12
8
4
0

105.98
90.84
75.70
60.56
45.42
30.28
15.14
0

Rango de flujo (l/h)

Rango de flujo (gph)

SIST. MTRICO
PC-24
PC-18
PC-12
PC-10 & PCT-10
PC-07 & PCT-07

0 10

20

30

40

PC-05 & PCT-05

50

60

Presin (psi)

PC-24
PC-18
PC-12
PC-10 & PCT-10
PC-07 & PCT-07

1.0

2.0

2.5

PC-05 & PCT-05

3.5

4.0

Presin (bar)

Xerigation

Tapas difusoras con compensacin de presin

Difusor con compensacin


de presin

Las cubiertas aspersoras de compensacin de presin estn diseadas para


encajar en la salida de los mdulos de riego por goteo con compensacin
de presin
Modelos: (para ver informacin ms detallada, consulte la pgina 175)
t"TQFSTPSDPODPNQFOTBDJOEFQSFTJOOFHSP

Mdulo compensador de presin


con cubierta aspersora con
compensacin de presin en la
tubera de elevacin de PolyFlex
(las tuberas de elevacin de
PolyFlex estn disponibles en los
modelos de 12" y 24")

t1$%*''11-WJPMFUBQBSBJEFOUJGJDBSFMBHVBOPQPUBCMF

El uso inteligente del agua.

169

Xerigation/Riego por goteo


%JTQPTJUJWPTEFFNJTJO

Boquillas de patrn cuadrado, serie SQ


La solucin de rociado de bajo volumen ms precisa y eficiente
para el riego de reas pequeas con plantas poco espaciadas
Q El patrn de rociado cuadrado y la compensacin de presin ofrecen
mayor eficiencia y control, y as se reducen el rociado excesivo y las
probabilidades de dao a la propiedad y situaciones riesgosas
Q Las exclusivas capacidades de extremo a extremo para aplicaciones sin
csped reducen la cantidad de boquillas necesarias, lo cual disminuye los
costos y reduce el tiempo de instalacin drsticamente
Q %JTFPFJOTUBMBDJOTJNQMJGJDBEPTDPOMBGMFYJCJMJEBEEFMBTBQMJDBDJPOFT
una boquilla alcanza 2.5' 4' (0.8 m 1.2 m) y se puede utilizar en diversos
cuerpos de aspersores y tuberas de elevacin
Boquilla SQ instalada en la tubera
de elevacin de PolyFlex con
adaptador de boquilla

Q Cumple con los requisitos del sistema de microrriego por menos del ndice
de caudal de 26 gph (98.4 l/h) a 30 psi (2 bares)

Caractersticas
t&MQBUSOEFSPDJBEPDVBESBEPDPODPCFSUVSBEFFYUSFNPBFYUSFNPMF
permite hacer diseos e instalaciones fcilmente en espacios pequeos
t&MEJTFPEFDPNQFOTBDJOEFQSFTJOCSJOEBVODBVEBMVOJGPSNFTPCSFFM
rango de presin
t%JTQPOJCMFFONPEFMPTQBUSPOFTEFVODVBSUP NFEJPZDPNQMFUPDPO
ndice de caudal proporcional a la superficie a regar
- Rendimiento virtual que no produce neblina desde 20 psi (1.4 bares) a 50
psi (3.4 bares)
 %PTEJTUBODJBTEFBMDBODFFODBEBCPRVJMMB$POVOTJNQMFDMJDTFBKVTUBB
2.5 o 4 (0.8 m 1.2 m)

Boquillas SQ con mallas

- Se envan con filtro de malla azul (0.02 x 0.02 [0.5 mm x 0.5 mm]) para
mantener una distancia de caudal precisa y evitar obstrucciones

Una boquilla... Dos alcances


Con slo girar la boquilla hacia el siguiente
QVOUPEFCMPRVFPQSFGJKBEP MBCPRVJMMB42
de Rain Bird se ajusta de un alcance de 2.5
pies (0.8 m) a un alcance de 4 pies (1.2 m). Es
como tener dos boquillas en una.

t$PNQBUJCMFDPOUPEBTMBTUVCFSBTEFFMFWBDJO4QSBZT 9FSJ1PQT FM


OVFWPBEBQUBEPSEFUVCFSBEFFMFWBDJOEF1PMZ'MFY 6/*4QSBZZUVCFSBT
de elevacin SCH 80

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

tOEJDFTEFDBVEBM ZHQI ZMI

t'JMUSBDJOSFRVFSJEBNBMMB

Se puede usar con


Xerigation

-B#PRVJMMB42FTVOBTPMVDJOJEFBMQBSBEJWFSTBTSFBTEJGDJMFTEFEJTFBS 
gracias a su compatibilidad con los productos de riego populares.

Modelos
t42253#PRVJMMB42 QBUSOEFVODVBSUP
t42)-'#PRVJMMB42 QBUSOEFNFEJP
t42'6-#PRVJMMB42 QBUSODPNQMFUP
t42"%1"EBQUBEPSEFCPRVJMMB42DPOUVCFSBEFFMFWBDJOEFw 
DN
EF1PMZ'MFY
t42"%1"EBQUBEPSEFCPRVJMMB42DPOUVCFSBEFFMFWBDJOEFw 
DN
EF1PMZ'MFY
t42"%1TMPFMBEBQUBEPS42EFUVCFSBEFFMFWBDJOEF1PMZ'MFY
* Nota: se necesita un adaptador para arbustos de plstico PA-8S (consulte la pgina 18) cuando se
utiliza una boquilla serie SQ montada en una tubera de elevacin SCH 80.

Cabezales
aspersores
p
serie
se
ser
ie 1800
ie

Xeri-Pop
Cuerpos de
difusores

Polyflex Programacin
Tuberas de 80 Tuberas
elevacin de elevacin

-BTCPRVJMMBT4FSJF42CSJOEBOVOQSFDJTPQBUSOEFSJFHPDVBESBEPZVOBDPMPDBDJOFGJDB[EFMBHVBDPODPNQFOTBDJOEFQSFTJO MPRVFUJFOFDPNP
resultado hasta un 65% en ahorro de agua. Son ideales para canteros estrechos, islas de estacionamientos y divisores de caminos, carreteras y calles.

170

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

%JTQPTJUJWPTEFFNJTJO

Rendimiento de la boquilla SQ

Rendimiento de la boquilla SQ
Alcance de 2.5 pies (0.76 m) a una altura de 6" (15.2 cm) sobre el terreno
Presin
psi

20
30
40
50
20
30
40
50
20
30
40
50

2.5
2.5
3.0
3.0
2.5
2.5
3.0
3.0
2.5
2.5
3.0
3.0

Alcance de 0.8 m a una altura de 0.15 m sobre el nivel del terreno

Caudal
gph

Caudal
gpm

ndice de precip.
sin superposicin
pulg./h

6.4
7.4
7.4
7.4
10.2
12.2
13.7
13.7
20.0
24.2
27.3
27.3

0.11
0.12
0.12
0.12
0.17
0.20
0.23
0.23
0.33
0.40
0.46
0.46

1.64
1.90
1.32
1.32
1.31
1.57
1.22
1.22
1.28
1.55
1.22
1.22

Alcance de 2.5 pies (121.92 cm) a una altura de 6" (15.2 cm) sobre el terreno
Boquilla

Presin
psi

20
30
40
50
20
30
40
50
20
30
40
50

4.0
4.0
4.5
4.5
4.0
4.0
4.5
4.5
4.0
4.0
4.5
4.5

Alcance
Presin
bares

Radio
m.

Caudal
l/h

Caudal
l/m

ndice de precip.
sin superposicin
mm/h

1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4

0.8
0.8
0.9
0.9
0.8
0.8
0.9
0.9
0.8
0.8
0.9
0.9

24
28
28
28
39
46
52
52
76
92
103
103

0.40
0.47
0.47
0.47
0.65
0.77
0.87
0.87
1.27
1.53
1.72
1.72

42
48
34
34
33
40
31
31
33
39
31
31

Rendimiento de la boquilla SQ

Rendimiento de la boquilla SQ
Alcance
Radio
pies

Boquilla

Caudal
gph

Caudal
gpm

ndice de precip.
sin superposicin
pulg./h

6.4
7.4
7.4
7.4
10.2
12.2
13.7
13.7
20.0
24.2
27.3
27.3

0.11
0.12
0.12
0.12
0.17
0.20
0.23
0.23
0.33
0.40
0.46
0.46

0.64
0.74
0.59
0.59
0.51
0.61
0.54
0.54
0.50
0.61
0.54
0.54

SIST. MTRICO

Alcance de 1.2 m a una altura de 0.15 m sobre el nivel del terreno


Boquilla

Alcance
Presin
bares

Radio
m.

Caudal
l/h

Caudal
l/m

ndice de precip.
sin superposicin
mm/h

1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4

1.2
1.2
1.4
1.4
1.2
1.2
1.4
1.4
1.2
1.2
1.4
1.4

24
28
28
28
39
46
52
52
76
92
103
103

0.40
0.47
0.47
0.47
0.65
0.77
0.87
0.87
1.27
1.53
1.72
1.72

16
19
15
15
13
16
14
14
13
15
14
14
Xerigation

Boquilla

Alcance
Radio
pies

SIST. MTRICO

Los datos de rendimiento se tomaron en condiciones de cero viento.

Rendimiento de la boquilla SQ
Modelo de medio

SIST. MTRICO

Modelo completo
Rango de flujo (gph)

Modelo de un cuarto

28
24
20
16
12
8
4
0

Full

Half
Quarter

0 10

20

30

40

Presin (psi)

50

60

105.98
90.84
75.70
60.56
45.42
30.28
15.14
0

Rango de flujo (l/h)

Boquillas SQ

Full

Half
Quarter

1.0

2.0

2.5

3.5

4.0

Presin (bar)

5'
4'
4'

2.5'
2.5'
4'

2.5'

5'

5'

8'
8'

8'

El uso inteligente del agua.

171

Xerigation/Riego por goteo


%JTQPTJUJWPTEFFNJTJO

Microaspersor Xeri-Pop

Modelos

El microaspersor Xeri-Pop facilita la integracin de un


microaspersor duradero en un diseo de riego por goteo
Q Es el nico aspersor de vstago retrctil que funciona en aplicaciones
de bajo volumen y baja presin, y la solucin perfecta para las reas
propensas al vandalismo

Q Los Xeri-Pops se pueden instalar en casi cualquier ubicacin y son ideales


para pequeos canteros de formas irregulares; la versin de 12" (30.5 cm)
es ideal para canteros de flores anuales

t919WTUBHPSFUSDUJMEF DN

t919WTUBHPSFUSDUJMEF DN

t919WTUBHPSFUSDUJMEF DN

Opciones de boquilla
t#PRVJMMBTTFSJF42 QH

t#PRVJMMB.13TFSJF UPEBTMBTDPOGJHVSBDJPOFT

t#VSCVKFBEPSEFQMTUJDPTFSJF
t#PRVJMMB.13TFSJF ) 5Z2

Q Los Xeri-Pop funcionan con las boquillas MPR de 5 y 8 (1.5 y 2.4 m) de


3BJO#JSEZDPOMBTCPRVJMMBTTFSJF42 CPRVJMMBTDPOQBUSPOFTEFSPDJBEP
cuadrado y alcances ajustables de 2.5 y 4 [76.2 cm y 1.2 m])

Caractersticas
t-PT9FSJ1PQQVFEFOGVODJPOBSDPOVOBQSFTJOCBTFEFBQTJ EFB
3.4 bares) cuando el agua se suministra mediante una tubera de distribucin
de 1/4 NN
 92

t-BGMFYJCJMJEBEEFMBUVCFSBEF1/4" (6.3 mm) permite que los Xeri-Pop se


ubiquen y reubiquen con facilidad segn lo requiera la disposicin de las
plantas determinada
t6ODPMMBSOBQSFTJOEFQMTUJDPEVSBEFSP FOMPTNPEFMPTEFZ<Z
15.2 cm]) asegura la tubera de 1/4 (6.3 mm) al exterior de la caja del Xeri-Pop
t-BUVCFSBEFEJTUSJCVDJOEF1/4" (6.3 mm) del Xeri-Pop puede conectarse
fcilmente a la tubera de polietileno de 1/2" (1.3 cm) o de 3/4" (1.9 cm) o
BVONBOFSBMEFWBSJBTTBMJEBT &.59&3*
-BTDPOFYJPOFTBMBUVCFSBEF
polietileno se realizan con un conector autoperforante SPB-025 de 1/4 (6.3
NN
PVODPOFDUPSBVUPQFSGPSBOUF9#'$0//EF1/4 (6.3 mm)
t-BTQJF[BTFYUFSOBTTPOSFTJTUFOUFTBMPTSBZPTVMUSBWJPMFUBZFTUOEJTQPOJCMFT
con alturas del vstago retrctil de 4, 6 y 12 (10.2; 15.2 y 30.5 cm)
Xeri-Pop de 12" (30.5 cm) en
canteros

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

t'JMUSBDJOEFQFOEFEFMBCPRVJMMBVUJMJ[BEBDPOFM9FSJ1PQ

Xerigation

Collarn a presin
de la tubera de
distribucin de "
(6.3 cm)

Cmo especificar

XP-400X

XP - 600X

XP-1200X

XP - 600X
Modelo
Xeri-Pop
Altura del vstago retrctil
9WTUBHPSFUSDUJMEFw DN

9WTUBHPSFUSDUJMEF DN

9WTUBHPSFUSDUJMEFw DN

Entrada de tubera
de distribucin de
" (6.3 cm)

Instale siempre una malla compensadora de presin


PCS-010, -020, 030 -040 si instala una boquilla
burbujeadora 5B en un Xeri-Pop.

172

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

%JTQPTJUJWPTEFFNJTJO

Xeri-Bubblers

Modelos

Ideal para plantaciones de arbustos, rboles, contenedores y


canteros de flores

t49#TFNJDSDVMP DIPSSPT FTUBDBEF DN

t49#TFNJDSDVMP DIPSSPT FTUBDBEF1/4" (0.6 cm)


t49#41:,TFNJDSDVMP DIPSSPT FTUBDBEF DN

incluye un acoplamiento de conector de punta x conector de punta
t49#DSDVMPDPNQMFUP DIPSSPT SPTDB
t49#DSDVMPDPNQMFUP DIPSSPT DPOFDUPSEFQVOUBEF1/4" (0.6 cm)
t49#41:,DSDVMPDPNQMFUP DIPSSPT FTUBDBEF DN

incluye un acoplamiento de conector de punta x conector de punta
t69#DSDVMPDPNQMFUP DPOP SPTDB
t69#DSDVMPDPNQMFUP DPOP DPOFDUPSEFQVOUBEF1/4" (0.6 cm)
t69#41:,DSDVMPDPNQMFUP DPOP FTUBDBEF DN

incluye un acoplamiento de conector de punta x conector de punta

Caractersticas
t&MDBVEBMZFMSBEJPTFBKVTUBOHJSBOEPMBDVCJFSUBFYUFSOB
t4FMJNQJBEFTBUPSOJMMBOEPDPNQMFUBNFOUFMBDVCJFSUBEFMBVOJEBECBTF
t5SFTQSDUJDBTDPOFYJPOFTEFJOTUBMBDJOQBSBEBSGMFYJCJMJEBEBMEJTFPSPTDB
autorroscante 10-32, conector de punta de 14" (6.3 mm) y estaca de 5" (12.7 cm)

Rango operativo
t$BVEBMEFMBTFSJF49#EFBHQI EFBMI

t$BVEBMEFMBTFSJF69#EFBHQI EFBMI

t1SFTJOEFBQTJ EFBCBSFT

ndice de caudal de SXB de 360 y 180

ndice de caudal de SXB de 360 y 180


50

z 200 kPa

z 20 psi
z 15 psi

40

z 150 kPa
z 100 kPa

30
20
10

10

12

14

16

18

20

22

10

Dimetro de alcance de 360 de SXB SIST. MTRICO

Dimetro de alcance de 360 de SXB

z 20 psi
z 15 psi

1.0

1.5

z 20 psi
z 15 psi

1.0

0 10

12

14

16

18

20

22

0.6

z 150 kPa

0.4

z 100 kPa

0.2

0.5
0

z 200 kPa

0.8

Dimetro (m)

Dimetro
(pies)
Descarga (gph)

2.0

2.0

z 30 psi

Radio (pies)
Descarga
(gph)

z 30 psi

3.0

0 8

14

16

18

20

22

10

12

14

16

18

20

22

Radio de alcance de 180 de SXB SIST. MTRICO


z 200 kPa

0.6

z 150 kPa
z 100 kPa

0.4
0.2
0

0
0 10

12

Nmero de clics

14

16

18

20

22

Nmero de clics

0 8

10

12

14

16

18

20

22

Nmero de clics

Xerigation

Nmero de clics

12

Nmero de clics

Radio (m)

Nmero de clics

SIST. MTRICO

z 30 psi

Descarga (l/h)

Descarga (gph)

14
12
10
8
6
4
2
0

SXB-180

SXB-360

UXB-360
SXB-180

SXB-360

UXB-360

Cmo especificar
SXB - 180 - 1032

SXB-180-025 SXB-360-025 UXB-360-025


$0/&$503%&16/5"

Conexin
1032: rosca autorroscante
10-32
025: conector de punta de
14" (20 mm)
41:,FTUBDBEF DN

Patrn
TFNJDSDVMP
DSDVMPDPNQMFUP

SXB-180-1032 SXB-360-1032 UXB-360-1032


roscas 10-32

El uso inteligente del agua.

SXB-180-SPYK SXB-360-SPYK UXB-360-SPYK


&45"$"

Modelo
SXB: boquilla burbujeadora
UXB: burbujeador de cono

173

Xerigation/Riego por goteo


%JTQPTJUJWPTEFFNJTJO

ndice de caudal de UXB

40
35
30
25
20
15
10
5
0

Descarga (gph)

30 psi

z 20 psi
z 15 psi

10

12

14

16

18

20

z 200 kPa
z 150 kPa
z 100 kPa

22

Nmero de clics

10

12

14

16

18

20

22

Nmero de clics

Dimetro de alcance de UXB

Dimetro de alcance de UXB

2.0

z 15 psi

0.5

Dimetro (m)

Dimetro
(pies)
Descarga (gph)

z 20 psi

1.0

SIST. MTRICO

0.5

z 30 psi

1.5

SIST. MTRICO

140
120
100
80
60
40
20
0

Descarga(gph)
(l/h)
Descarga

ndice de caudal de UXB

z 200 kPa

0.4
0.3

z 150 kPa

0.2

z 100 kPa

0.1
0

10

12

14

16

18

20

22

Nmero de clics

10

12

14

16

18

20

22

Nmero de clics

Xeri-Sprays y vaporizadores

Xeri-Spray 360 True Spray

Ideal para plantaciones masivas, cubiertas vegetales, canteros de


flores anuales y macetas

Ideal para plantaciones masivas, cubiertas vegetales, canteros de


flores anuales y macetas

Caractersticas

Caractersticas

t&MDBVEBMZFMSBEJPTFQVFEFOBKVTUBSHJSBOEPMBWMWVMBEFCPMBJOUFHSBM
t&MQBUSOEFFNJTJOVOJGPSNFQSPQPSDJPOBVOBFYDFMFOUFEJTUSJCVDJO
t3PTDBTBVUPSSPTDBOUFTRVFDBCFOFOFMBEBQUBEPSEF1/2" (1.3 cm) x
10-32 (10-32A); el adaptador 1800 Xeri-Bubbler (XBA-1800); y la tubera de
FMFWBDJOEF1PMZ'MFY 1'3

t.JDSPBTQFSTPSDPOSPDJBEPFOBCBOJDPZQBUSOEFDSDVMPDPNQMFUP
t&MDBVEBMZFMSBEJPTFBKVTUBOHJSBOEPMBUBQBFYUFSOB
t5SFTQSDUJDBTDPOFYJPOFTEFJOTUBMBDJOQBSBEBSGMFYJCJMJEBEBMEJTFP
rosca autorroscante 10-32, conector de punta de 14" (6.3 mm) y estaca de 5"
(12.7 cm)
t4FMJNQJBGDJMNFOUFEFTFOSPTDBOEPDPNQMFUBNFOUFMBDVCJFSUBEFMBVOJEBE
base

Rango operativo
t$BVEBMEFBHQI EFBMI

t1SFTJOEFBQTJ EFBCBSFT

t3BEJPDSDVMPDPNQMFUPEFBQJFT BN
VODVBSUPEFDSDVMPZ
semicrculo de 0 a 10.6 pies (0 a 3.2 m)

Modelos
Xerigation

XS-090

174

XS-180

XS-180

t$BVEBMEFBHQI EFBMI

t1SFTJOEFBQTJ EFBCBSFT

t3BEJPEFBQJFT EFBN

Modelos

t94VODVBSUPEFDSDVMP SPDJBEP
t94TFNJDSDVMP SPDJBEP
t94DSDVMPDPNQMFUP SPDJBEPEFDBVEBM
t9"%+.45DSDVMPDPNQMFUP OFCVMJ[BDJO

XS-090

Rango operativo

t9454SPTDBT
t9454DPOFDUPSEFQVOUBEF14" (6.3 mm)
t945441:,FTUBDBEF DN
JODMVZFVOBDPQMBNJFOUP
de conector de punta x conector de punta

XS-360

XS-360

XS-360TS

360 ADJMST

XS-360TS-025

XS-360TS-1032

XS-360TS-SPYK

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

%JTQPTJUJWPTEFFNJTJO

Rendimiento de los Xeri-Spray y los vaporizadores


Presin
psi

Caudal
gph

XS-90
Radio de
Alcance pies

XS-180
Radio de
Alcance pies

XS-360
Radio de
Alcance pies

Vaporizador 360
Radio de
Alcance pies

10
15
20
25
30

0-16.7
0-21.0
0-24.5
0-28.0
0-31.0

0-6.4
0-8.1
0-9.4
0-9.8
0-10.3

0-6.7
0-8.1
0-9.5
0-10.1
0-10.6

0-9.2
0-11.3
0-12.9
0-13.2
0-13.4

0-1.5
0-1.3
0-1.5
0-1.4
0-1.3

Rendimiento de los Xeri-Spray y los vaporizadores

SIST. MTRICO

Presin
bares

Caudal
l/h

XS-90
Radio de
Alcance m.

XS-180
Radio de
Alcance m.

XS-360
Radio de
Alcance m.

Vaporizador 360
Radio de
Alcance m.

0.7
1.0
1.4
1.7
2.1

0-63.21
0-79.49
0-92.73
0-105.98
0-117.34

0-2.0
0-2.5
0-2.9
0-3.0
0-3.1

0-2.0
0-2.5
0-2.9
0-3.1
0-3.2

0-2.8
0-3.4
0-3.9
0-4.0
0-4.1

0-0.46
0-0.40
0-0.44
0-0.43
0-0.40

ndice de caudal de Xeri-Spray 360 True Spray SIST. MTRICO


z 30 psi
z 20 psi
z 15 psi

Descarga (gph)

24
20
16
12
8
4
0

z 200 kPa

Descarga (l/h)

ndice de caudal de Xeri-Spray 360 True Spray

80

z 150 kPa
z 100 kPa

60
40
20
0

10

12

14

16

18

20

22

Nmero de clics

12

14

16

18

20

22

Dimetro de alcance de Xeri-Spray 360 True Spray SIST. MTRICO

Dimetro
(pies)
Descarga (gph)

z 30 psi
z 20 psi
z 15 psi

4.0

z 200 kPa
z 150 kPa
z 100 kPa

Dimetro(gph)
(m)
Descarga

Dimetro de alcance de Xeri-Spray 360 True Spray

3.0
2.0

Xerigation

14
12
10
8
6
4
2
0

10

Nmero de clics

1.0

10

12

Nmero de clics

El uso inteligente del agua.

14

16

18

20

22

10

12

14

16

18

20

22

Nmero de clics

175

Xerigation/Riego por goteo


%JTQPTJUJWPTEFFNJTJOZDPNQPOFOUFTEFEJTUSJCVDJO

Tapa difusora contra insectos

Tapa difusora con compensacin de presin

Caractersticas

Caractersticas

t&WJUBRVFJOTFDUPTZQBSUDVMBTEFTVDJFEBEPCTUSVZBOMBUVCFSBEFEJTUSJCVDJO
de 1/4" (6.3 mm)
t-BFOUSBEBDPODPOFDUPSEFQVOUBTFBEBQUBBMBUVCFSBEFEJTUSJCVDJO 92
EF
1
/4" (6.3 mm)
t&MQSPUFDUPSFNCSJEBEPQSPQBHBFMBHVBQBSBNJOJNJ[BSMB
erosin del suelo en el punto de emisin

t-BDVCJFSUBTFBTFHVSBBQSFTJOFOMBTBMJEBEFMNEVMPDPNQFOTBEPSEF
presin y del emisor XB para generar un efecto de burbuja y evitar una
inundacin.
t%JTFBEPQBSBVOBJOTUBMBDJOSQJEBZGDJM
t$POTUSVJEBDPOQPMJFUJMFOPSFTJTUFOUFBMPTSBZPTVMUSBWJPMFUB

Rango operativo

Modelos
t"TQFSTPSDPODPNQFOTBDJOEFQSFTJOOFHSP
t1$%*''11-WJPMFUBQBSBJEFOUJGJDBSFMBHVBOPQPUBCMF

t1SFTJOEFBQTJ EFBCBSFT

Modelos
t%#$OFHSP
Salida

Entrada

Difusor con
compensacin
de presin
DBC-025

Aplicaciones sugeridas

Xerigation

A. Tubera de 1/4" (6.3 mm), estaca de 1/4" (6.3 mm),


mdulo compensador de presin, cubierta aspersora
contra insectos. Usado para riegos mayores a 5 pies
(1.5 m) desde la lnea principal
B. Tubera de 1/4" (6.3 mm), estaca de 1/4" (6.3 mm),
cubierta aspersora contra insectos. Usado para riegos
de hasta 5 pies (1.5 m) desde la lnea principal
(No se muestra el emisor de riego. Se instala
directamente en la lnea lateral)

PC-DIFF-PPL

Estaca para tubera


universal de 14"
(6.3 mm)

Estaca para tubera


de 14SDSq (6.3 mm)
con cubierta

Caractersticas

Caractersticas

t.BOUJFOFMBUVCFSBEFEJTUSJCVDJO
de 1/4 (6.3 mm) y el emisor o la
cubierta aspersora contra insectos
en su lugar en la zona de las races
de las plantas
t%JTFBEPQBSBTVKFUBSEFNBOFSB
segura la tubera de distribucin
de 1/4 (6.3 mm) de Rain Bird y
otros fabricantes: dimetro interior
de 0.16 a 0.18 (4.1 a 4.6 mm) y
dimetro exterior de 0.22 a 0.25
(5.6 a 6.4 mm)
t&TUBDBSHJEBRVFDVFOUBDPOVO
cabezal plano agrandado
diseado para soportar el
martilleo contra el suelo
duro

tMBUBQBDPOTFHVSPNBOUJFOF
la tubera en su lugar
t4FVUJMJ[BQBSBTVKFUBSMBUVCFSBEF
EJTUSJCVDJO 92
EF1/4 (6.3 mm) en
su lugar en la zona de las races de
las plantas
t"ENJUFUVCFSBTEFEJTUSJCVDJO
de 1/4" (6.3 mm) con un dimetro
exterior de 0.19 a 0.256 (4.8 a 6.5 mm)
t*ODMVZFDVCJFSUBDPOUSBJOTFDUPT
t$POTUSVJEBDPONBUFSJBMQMTUJDP
resistente a los rayos ultravioleta

Nota: Si el emisor est instalado


en la entrada de la tubera de
distribucin, use una cubierta
aspersora contra insectos (DBC025) en la salida de la tubera
para evitar que los insectos
obstruyan la tubera y para
ayudar a mantener la
tubera en su lugar

Modelo

Modelo
t548$"1

TS-025WCAP

TS-025

t54

176

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

Componentes de distribucin

Tubera de
elevacin PolyFlex
de 12" (30.5 cm)

Conjunto de tubera de elevacin de


PolyFlex y adaptador

Caractersticas

t5VCFSBEFFMFWBDJOEFww DN
QSFFOTBNCMBEBDPOVOBCBTF
macho roscada de 1/2 (1.3 cm) que simplifica la instalacin
t6TFDPODVBMRVJFSEJTQPTJUJWPEFFNJTJOSPTDBEPQBSBTVNJOJTUSBSBHVB
directamente a una planta. Estos incluyen Xeri-Bugs, mdulos compensadores de
presin, Xeri-Bubblers y Xeri-Sprays
t"EBQUBEPSDPOVOOVFWPEJTFPRVFJODMVZFMFOHFUBTNTHSBOEFT
y hace que la instalacin sea ms fcil y rpida. Se puede usar en laterales de
PVC o con cualquier adaptador hembra roscado de 1/2 (1.3 cm)
t"EBQUBEPSSFBMJ[BEPEF.BSMFY de alta resistencia, que no requiere cinta de
5FGMPO y ahorra tiempo en la instalacin
t5VCFSBEFFMFWBDJOEF1PMZ'MFYEFHSBOSFTJTUFODJBZDPOGJBCMF
construida de polietileno de paredes gruesas y alta densidad

t5VCFSBEFFMFWBDJOEF 
cm) que se utiliza con cualquier
dispositivo de emisin roscado
10-32 para suministrar agua
directamente a una planta. Estos
incluyen Xeri-Bugs, mdulos
compensadores de presin,
Xeri-Bubblers y Xeri-Sprays
t%FHSBOSFTJTUFODJBZDPOGJBCMF 
construida de polietileno de
paredes gruesas y alta densidad
t4FQVFEFVUJMJ[BSDPOVOB
estaca para tubo de elevacin
345

Caractersticas

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

Rango operativo

Modelos

t1SFTJOEFBQTJ
(de 1 a 3.5 bares)

t1'3'3"UVCFSBEFFMFWBDJOEF1PMZ'MFYEF DN
ZBEBQUBEPS
t1'3'3"UVCFSBEFFMFWBDJOEF1PMZ'MFYEF DN
ZBEBQUBEPS

Modelo
t1'3

Conjunto de tubera
de elevacin de
PolyFlex y estaca

Estaca roscada para


tubera de elevacin

Adaptador de rosca
10-32

Adaptador
1800 Xeri-Bubbler

Caractersticas

Caractersticas

Caractersticas

Caractersticas

t&TUBDBSFTJTUFOUFEF DN

para usar con tuberas de elevacin
EF1PMZ'MFY
t$POTUSVJEBDPONBUFSJBMQMTUJDP
resistente a los rayos ultravioleta
t-BFOUSBEBMBUFSBMDPODPOFDUPSEF
punta es compatible con la tubera
EFEJTUSJCVDJO 92
EF1/4" (6.3 mm)
t-BTBMJEBSPTDBEB
permite enroscar fcilmente
MBUVCFSBEFFMFWBDJOEF1PMZ'MFY
EF DN
 1'3

t&OUSBEBSPTDBIFNCSBQBSBUVCFSB
de 1/2 (1.3 cm) que se atornilla a
cualquier tubera de elevacin con
rosca macho para tubera de 1/2
(1.3 cm)
t4BMJEBSPTDBTRVFBENJUFO
Xeri-Bugs, mdulos compensadores
de presin, Xeri-Bubblers y XeriSprays con roscas 10-32
t$POTUSVJEBDPONBUFSJBMQMTUJDP
resistente a los rayos ultravioleta

t1SFTJOEFBQTJ
(de 1 a 3.5 bares)

t&OUSBEBSPTDBTIFNCSBEF1/2
(1.3 cm) que se enroscan en los
adaptadores serie 1800 o UNI-Spray
o en los adaptadores para arbustos
de Rain Bird
t4BMJEBSPTDBTRVFBENJUFO
cualquier dispositivo de emisin con
roscas 10-32, incluidos emisores
Xeri-Bug, mdulos compensadores
de presin, adaptadores
Xeri-Bubbler y Xeri-Spray
t4FBQPZBEFGPSNBOJWFMBEBFO
el terreno cuando se instala en
un cabezal para una instalacin
resistente

Modelo

Rango operativo

t"

t1SFTJOEFBQTJ
(de 1 a 3.5 bares)

t5VCFSBEFFMFWBDJOEF 
cm) preensamblada con una estaca
de 7" (17.8 cm)
t6TFDPODVBMRVJFSEJTQPTJUJWP
de emisin roscado 10-32 para
suministrar agua directamente a
una planta. Estos incluyen Xeri-Bugs,
mdulos compensadores de presin,
Xeri-Bubblers y Xeri-Sprays
t"IPSSBUJFNQPZEJOFSPDVBOEP
se instala un sistema de riego
por goteo
t5VCFSBEFFMFWBDJOEF1PMZ'MFY
de gran resistencia y confiable
construida de polietileno de
paredes gruesas y alta densidad

Rango operativo

Rango operativo
t1SFTJOEFBQTJ
(de 1 a 3.5 bares)

Modelo

Rango operativo

t345

Modelo

t1SFTJOEFBQTJ
(de 1 a 3.5 bares)
PFR-RS

t9#"

Modelo

t1'334UVCFSBEFFMFWBDJO
EF1PMZ'MFYEF DN

y estaca de 7" (30.5 cm)

El uso inteligente del agua.

RS-025T
10-32A

XBA-1800

177

Xerigation

PFR-FRA

PFR-12

Xerigation/Riego por goteo


-OFBEFSJFHPQPSHPUFPFOTVQFSGJDJF9'%

Lnea de riego por goteo en superficie XFD


Lnea de riego por
goteo XFD

La lnea de tubera emisora con compensacin de presin


ms flexible en el mercado para regar cubierta vegetal,
plantaciones densas y setos, entre otras cosas.
Q 5VCFSBFYUSBGMFYJCMFQBSBVOBJOTUBMBDJOSQJEBZTFODJMMB
Q La tubera con doble laminado (marrn sobre negro o violeta sobre negro)
brinda una resistencia incomparable a los qumicos, al dao de los rayos
ultravioletas y al crecimiento de algas

Q El diseo del emisor con patente en trmite brinda mayor confiabilidad


Q Riegos laterales ms prolongados que los de la competencia
Caractersticas
t&MNBUFSJBMFYDMVTJWPPGSFDFVOBGMFYJCJMJEBEDPOTJEFSBCMFNFOUFNBZPS MPDVBM
permite giros ms ajustados con menos codos para una instalacin ms sencilla
t-BFMFDDJOEFOEJDFTEFDBVEBM FTQBDJBNJFOUPZMPOHJUVEFTEFSPMMP
proporciona flexibilidad de diseo para una variedad de aplicaciones que no
sean en csped
t"ENJUFBDDFTPSJPTEFDPNQSFTJO&BTZ'JUEF3BJO#JSE BDDFTPSJPTEFJOTFSDJO
QBSBTJTUFNBTEFSJFHPQPSHPUFP9FSJ'MFYZBDDFTPSJPTEFJOTFSDJOEFNN
t6TFVOLJUEFWMWVMBEFBMJWJPEFBJSFWBDPDVBOEPMBJOTUBMBDJOFTQPSEFCBKP
del suelo

Disponible en violeta para


identificar el agua no
potable

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

tOEJDFTEFDBVEBMHQIZHQI MIZMI

t5FNQFSBUVSB"HVBIBTUB' $
BNCJFOUFIBTUB' $

t'JMUSBDJOSFRVFSJEBNBMMB

Especificaciones

Xerigation

La lnea de riego por goteo XFD


ofrece mayor flexibilidad para
brindar resistencia al pliegue y
facilitar la instalacin

Cmo especificar
XFD - P - 09 - 12 - 100
Modelo
9'%
Lnea de
riego por
goteo
Caracterstica
Violeta

t%JNFUSPFYUFSOP NN

t%JNFUSPJOUFSOP NN

t&TQFTPSEFMBQBSFE NN

t&TQBDJBNJFOUPw ww DN



t-BSHPTSPMMPTEFh N
Zh N

t6TFDPOBDDFTPSJPTEFJOTFSDJOQBSBTJTUFNBTEFSJFHPQPSHPUFP9FSJ'MFY
DPOTVMUFMBQH
BDDFTPSJPTEFDPNQSFTJO&BTZ'JUEF3BJO#JSE DPOTVMUF
la pg. 186) y accesorios de insercin de 17 mm

Self-dispensing Dripline

Longitud de la
tubera
h N

h N

h N

Espaciamiento del emisor


 DN

 DN

 DN

ndice de flujo
HQI MI

HQI MI

La bobina autodispensadora reduce el tiempo


de disposicin y facilita la instalacin.

Lnea de riego por


goteo XFD

&MTJTUFNBEFSJFHPQPSHPUFP9'%PGSFDFIBTUBVOEFBIPSSPEFBHVBEFCJEPBRVFOPIBZQSEJEBBDBVTBEFMWJFOUP4FQVFEFJOTUBMBS
al nivel del terreno, justo debajo del nivel del terreno o debajo del mantillo.

178

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

-OFBEFSJFHPQPSHPUFPFOTVQFSGJDJF9'%

los de lnea de riego por goteo en superficie XFD

los de lnea de riego por goteo en superficie XFD SIST. MTRICO

Modelo

Caudal Espaciamiento Largo de rollo


gph
pulg.
pies

Modelo

Caudal
l/h

Espaciamiento Largo de rollo


cm
m

XFD-06-12-100
XFD-06-12-250
XFD-06-12-500
XFD-06-18-100
XFD-06-18-250
XFD-06-18-500
XFD-06-24-500
XFD-09-12-100
XFD-09-12-250
XFD-09-12-500
XFD-09-18-100
XFD-09-18-250
XFD-09-18-500
XFD-09-24-500
XFDP-06-12-500 (violeta)
XFDP-06-18-500 (violeta)
XFDP-09-12-500 (violeta)
XFDP-09-18-500 (violeta)

0.60
0.60
0.60
0.60
0.60
0.60
0.60
0.90
0.90
0.90
0.90
0.90
0.90
0.90
0.60
0.60
0.90
0.90

XFD-06-12-100
XFD-06-12-250
XFD-06-12-500
XFD-06-18-100
XFD-06-18-250
XFD-06-18-500
XFD-06-24-500
XFD-09-12-100
XFD-09-12-250
XFD-09-12-500
XFD-09-18-100
XFD-09-18-250
XFD-09-18-500
XFD-09-24-500
XFDP-06-12-500 (violeta)
XFDP-06-18-500 (violeta)
XFDP-09-12-500 (violeta)
XFDP-09-18-500 (violeta)

2.30
2.30
2.30
2.30
2.30
2.30
2.30
3.50
3.50
3.50
3.50
3.50
3.50
3.50
2.30
2.30
3.50
3.50

30.5
30.5
30.5
45.7
45.7
45.7
61.0
30.5
30.5
30.5
45.7
45.7
45.7
61.0
30.5
45.7
30.5
45.7

12
12
12
18
18
18
24
12
12
12
18
18
18
24
12
18
12
18

100
250
500
100
250
500
500
100
250
500
100
250
500
500
500
500
500
500

30.5
76.5
152.9
30.5
76.5
152.9
152.9
30.5
76.5
152.9
30.5
76.5
152.9
152.9
152.9
152.9
152.9
152.9

Longitudes laterales mximas de la lnea de riego por goteo en superficie XFD (en pies)
Presin de
entrada
(psi)

Longitud lateral mxima (pies)


Espaciamiento de 12"
Caudal nominal (gph):
0.6
0.9

Espaciamiento de 18"
Caudal nominal (gph):
0.6
0.9

Espaciamiento de 24"
Caudal nominal (gph):
0.6
0.9

15
20
30
40
50
60

273
318
360
395
417
460

314
353
413
465
528
596

424
508
586
652
720
780

250
294
350
402
420
455

Longitudes laterales mximas de la lnea de riego por goteo en superficie XFD (en metros)

322
368
414
474
488
514

SIST. MTRICO

Presin de
entrada
(bares)

Longitud lateral mxima (metros)


30.5 cm
Flujo nominal (l/h):
2.3
3.41

45.7 cm
Flujo nominal (l/h):
2.3
3.41

61.0 cm
Flujo nominal (l/h):
2.3
3.41

1.0
1.4
2.1
2.8
3.5
4.1

83.2
96.9
109.7
120.4
127.1
140.2

95.7
107.6
125.9
141.7
160.9
181.7

129.2
154.8
178.6
198.7
219.5
237.7

47.2
51.5
70.1
77.7
86.9
88.4

76.2
89.6
106.7
122.5
128.0
138.7

Xerigation

155
169
230
255
285
290

98.2
112.2
123.2
144.5
148.7
156.7

Caudal de la lnea de riego por goteo en superficie XFD (por 30.48 m de tubo)

Caudal de la lnea de riego por goteo en superficie XFD (por 100 m de tubo)

Espaciamiento del emisor

0.6 gph emisor

0.9 gph emisor

Espaciamiento del emisor 2.3 l/h emisor

3.41 l/h emisor

12"
18"
24"

61.0 gph 1.02 gpm


41.0 gph 0.68 gpm
31.0 gph 0.51 gpm

92.0 gph 1.53 gpm


61.0 gph 1.02 gpm
46 gph 0.77 gpm

0.30 metro
0.46 metro
0.61 metro

1,136.7 l/h
741.3 l/h
559.0 l/h

El uso inteligente del agua.

757.9 l/h
502.2 l/h
378.7 l/h

12.6 l/m
8.4 l/m
6.3 l/m

18.9 l/m
12.4 l/m
9.3 l/m

179

Xerigation/Riego por goteo


-OFBEFSJFHPQPSHPUFPTVCUFSSOFPTFSJF9'4DPO
tecnologa Copper Shield

Lnea de riego por goteo subterrneo XFS


con tecnologa Copper Shield
3JFHPQPSHPUFPTVCUFSSOFP 4%*
JEFBMQBSBKBSEJOFTQFRVFPT FTUSFDIPT
y apretados, esquinas pronunciadas y todos los terrenos de csped
Q -BMOFBEFSJFHPQPSHPUFPTVCUFSSOFP3BJO#JSE9'4DPOUFDOPMPHB

Ganadora de la
exhibicin de la
Asociacin de
riego

Lnea de riego por goteo


subterrneo XFS

Copper Shield es la ltima innovacin de la gama Rain Bird Xerigation. La


tecnologa Copper Shield de Rain Bird, con patente en trmite, protege al
emisor frente a la invasin de races y crea un sistema subterrneo duradero y
de bajo mantenimiento que se puede utilizar debajo de csped o en zonas de
arbustos y cubiertas vegetales

Q Un material de tubera patentado hace que el sistema de riego por goteo


TVCUFSSOFP9'4DPOUFDOPMPHB$PQQFS4IJFMETFBMBUVCFSBNTGMFYJCMFEFMB
industria y la lnea de goteo subterrnea ms fcil de disear e instalar.

Q "ENJUFBDDFTPSJPTEFDPNQSFTJO&BTZ'JUEF3BJO#JSE BDDFTPSJPTEFJOTFSDJO


EFOUBEPTQBSBMOFBTEFSJFHPQPSHPUFP9'ZPUSPTBDDFTPSJPTEFJOTFSDJO
dentados de 17 mm

Caractersticas

La lnea de riego por goteo XFS


ofrece mayor flexibilidad para
facilitar la instalacin

Tubera de color cobre

Xerigation

Simple
t&MEJTFPEFFNJTPSEFCBKPQFSGJMEF3BJO#JSESFEVDFMBQSEJEBEFQSFTJO
en la lnea y permite trazados laterales ms largos, simplificando el diseo y
reduciendo el tiempo de
t-PTEJWFSTPTOEJDFTEFDBVEBMZFTQBDJBNJFOUPTEFMPTFNJTPSFT ZMBTMPOHJUVEFT
de la bobina proporcionan flexibilidad de diseo para aplicaciones subterrneas
tanto para csped como para arbustos y cubiertas vegetales
Confiable
t-PTFNJTPSFTEFMBTMOFBTEFSJFHPQPSHPUFPTVCUFSSOFP9'4FTUOQSPUFHJEPT
frente a invasiones de races mediante la tecnologa de Rain Bird Copper Shield,
con patente en trmite, que da como resultado un sistema que no requiere
mantenimiento ni reemplazo de qumicos para impedir la invasin de races
t&MEJTFPEFMFNJTPSDPODPNQFOTBDJOEFQSFTJOQSPQPSDJPOBVODBVEBM
uniforme en toda la longitud lateral, lo cual asegura una mayor uniformidad para
aumentar la fiabilidad en el rango de presin de 8.5 a 60 psi
Duradera
t-BUVCFSBEFEPCMFDBQB DPCSFTPCSFOFHSP
QSPQPSDJPOBVOBSFTJTUFODJBTJO
igual a los daos ocasionados por productos qumicos, crecimiento de algas y
radiacin UV
t5PMFSBOUFBMBUJFSSBFMEJTFPQBUFOUBEPEFMFNJTPSEF3BJO#JSESFTJTUFMBT
obstrucciones al utilizar una va de caudal extra-ancha en combinacin con un
sistema de autopurgado

Rango operativo
Lnea de riego por goteo subterrneo serie
XFS con tecnologa Copper Shield

Cmo especificar
XFS - P - 09 - 12 - 100
Caracterstica
11SQVSB
sobre negro
Modelo
9'4
subterrnea
Lnea de riego
por goteo

180

Longitud de la tubera
h N

h N

Espaciamiento del emisor


 DN

 DN

 DN

t1SFTJOEFBQTJ EFBCBSFT

tOEJDFTEFDBVEBMZHQI MIZMI

t5FNQFSBUVSB
"HVBIBTUB' $

"NCJFOUFIBTUB' $

t'JMUSBDJOSFRVFSJEBNBMMB

Especificaciones
t%JNFOTJPOFT%JNFUSPFYUFSOP NN
EJNFUSPJOUFSOP 
mm); Espesor: 0.049" (1.2mm)
t   DNDN DN
EFFTQBDJBEP
t%JTQPOJCMFFOCPCJOBTEFhZh NZN

t$PMPSEFMBCPCJOBDPCSF

ndice de flujo
HQI MI

HQI MI

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

-OFBEFSJFHPQPSHPUFPTVCUFSSOFPTFSJF9'4DPO
tecnologa Copper Shield

Modelos de lnea de riego por goteo subterrneo XFS

Modelos de lnea de riego por goteo subterrneo XFS SIST. MTRICO

Modelo

Caudal
gph

Espaciamiento Largo de rollo


pulg.
pies

Modelo

Caudal
l/h

Espaciamiento Largo de rollo


cm
m

XFS-06-12-100
XFS-06-12-500
XFS-06-18-100
XFS-06-18-500
XFS-06-24-500
XFS-09-12-100
XFS-09-12-500
XFS-09-18-100
XFS-09-18-500
XFS-09-24-500
XFSP-06-12-500 (violeta)
XFSP-06-18-500 (violeta)
XFSP-06-24-500 (violeta)
XFSP-09-12-500 (violeta)
XFSP-09-18-500 (violeta)
XFSP-09-24-500 (violeta)

0.60
0.60
0.60
0.60
0.60
0.90
0.90
0.90
0.90
0.90
0.60
0.60
0.60
0.90
0.90
0.90

12
12
18
18
24
12
12
18
18
24
12
18
24
12
18
24

XFS-06-12-100
XFS-06-12-500
XFS-06-18-100
XFS-06-18-500
XFS-06-24-500
XFS-09-12-100
XFS-09-12-500
XFS-09-18-100
XFS-09-18-500
XFS-09-24-500
XFSP-06-12-500 (violeta)
XFSP-06-18-500 (violeta)
XFSP-06-24-500 (violeta)
XFSP-09-12-500 (violeta)
XFSP-09-18-500 (violeta)
XFSP-09-24-500 (violeta)

2.30
2.30
2.30
2.30
2.30
3.50
3.50
3.50
3.50
3.50
2.30
2.30
2.30
3.50
3.50
3.50

30.5
30.5
45.7
45.7
61.0
30.5
30.5
45.7
45.7
61.0
30.5
45.7
61.0
30.5
45.7
61.0

100
500
100
500
500
100
500
100
500
500
500
500
500
500
500
500

30.5
152.9
30.5
152.9
152.9
30.5
152.9
30.5
152.9
152.9
152.9
152.9
152.9
152.9
152.9
152.9

Longitudes laterales mximas de la lnea de riego por goteo subterrneo XFS (en pies)
Presin de
entrada
(psi)

Longitud lateral mxima (pies)


Espaciamiento de 12"
Caudal nominal (gph):
0.6
0.9

Espaciamiento de 18"
Caudal nominal (gph):
0.6
0.9

Espaciamiento de 24"
Caudal nominal (gph):
0.6
0.9

15
20
30
40
50
60

273
318
360
395
417
460

314
353
413
465
528
596

424
508
586
652
720
780

250
294
350
402
420
455

Longitudes laterales mximas de la lnea de goteo subterrnea XFS (en metros)

322
368
414
474
488
514

SIST. MTRICO

Presin de
entrada
(bares)

Longitud lateral mxima (metros)


30.5 cm
Flujo nominal (l/h):
2.3
3.41

45.7 cm
Flujo nominal (l/h):
2.3
3.41

61.0 cm
Flujo nominal (l/h):
2.3
3.41

1.0
1.4
2.1
2.8
3.5
4.1

83.2
96.9
109.7
120.4
127.1
140.2

95.7
107.6
125.9
141.7
160.9
181.7

129.2
154.8
178.6
198.7
219.5
237.7

47.2
51.5
70.1
77.7
86.9
88.4

76.2
89.6
106.7
122.5
128.0
138.7

Xerigation

155
169
230
255
285
290

98.2
112.2
123.2
144.5
148.7
156.7

Caudal de la lnea de riego por goteo subterrneo XFS (por 100 m de tubo)

Caudal de la lnea de goteo subterrnea XFS (por 100 m de tubo)

Espaciamiento del emisor

0.6 gph emisor

Espaciamiento del emisor 2.3 l/h emisor

12"
18"
24"

61.0 gph 1.02 gpm 92.0 gph 1.53 gpm


41.0 gph 0.68 gpm 61.0 gph 1.02 gpm
31.0 gph 0.51 gpm 46 gph 0.77 gpm

El uso inteligente del agua.

0.9 gph emisor

0.30 metro
0.46 metro
0.61 metro

3.41 l/h emisor

757.9 l/h 12.6 l/m 1,136.7 l/h 18.9 l/m


502.2 l/h 8.4 l/m 741.3 l/h 12.4 l/m
378.7 l/h 6.3 l/m 559.0 l/h 9.3 l/m

181

Xerigation/Riego por goteo


Componentes de distribucin

Tubera serie XF

Caractersticas de prdida por friccin de la tubera

Caractersticas:

Dim. ext. 0.634" Dim. int. 0.536"

Dim. ext. 16.1mm Dim. int. 13.6mm


SIST. MTRICO

Caudal
gpm

Velocidad Prdida
pps
psi

Caudal
l/h

Velocidad Prdida
m/s
bares

0.50
1.00
1.50
2.00
2.50
3.00
3.50
4.00
4.50
5.00
5.50
6.00

0.70
1.40
2.10
2.80
3.50
4.20
4.90
5.60
6.30
7.00
7.70
8.40

113.56
227.12
340.69
454.25
567.81
681.37
794.94
908.50
1022.06
1135.62
1249.19
1362.75

0.21
0.43
0.64
0.85
1.07
1.28
1.49
1.71
1.92
2.13
2.35
2.56

t.BZPSGMFYJCJMJEBE GDJMEFJOTUBMBSZBIPSSBEJOFSP
t&MDPMPSNBSSODPNCJOBDPOFMQBJTBKFZTFNF[DMBDPOFMNBOUJMMP$PNCJOB
DPOMBUVCFSBEFMFNJTPSFOMOFBEFMTJTUFNBEFSJFHPQPSHPUFPTFSJF9'
t$PNQBUJCMFDPOFMTJTUFNBEFSJFHPQPSHPUFPTFSJF9' EJNFUSPJOUFSOPEF
0.536 [13.6 mm] x dimetro externo de 0.634 [16.1 mm])
t"ENJUFBDDFTPSJPTEFDPNQSFTJO&BTZ'JUEF3BJO#JSE BDDFTPSJPTEFJOTFSDJO
QBSBTJTUFNBTEFSJFHPQPSHPUFP9FSJ'MFYZBDDFTPSJPTEFJOTFSDJOEFNN
t/PFTDPNQBUJCMFDPOBDDFTPSJPTEFNN

Especificaciones
t%JNFUSPFYUFSOP NN

t%JNFUSPJOUFSOP NN

t&TQFTPSEFMBQBSFE NN

Modelos:
t9'%SPMMPEFQJFT N

t9'%SPMMPEFQJFT N

t9'%SPMMPEFQJFT N

XFD100

0.27
0.97
2.06
3.50
5.29
7.42
9.87
2.64
15.72
19.11
22.80
26.78

Prdida en psi por cada 100 pies de tubo


QTJQJFT


0.06
0.22
0.46
0.79
1.20
1.68
2.23
2.86
3.56
4.32
5.16
6.06

Prdida en bares por cada 100 metros de


UVCFSB CBSFTN

Nota: No se recomienda el uso de tubera para los caudales indicados en las reas con
TPNCSFBEPPTDVSP ZBRVFMBTWFMPDJEBEFTTVQFSBOMPTQJFTT NT

Accesorios de insercin para sistemas de


riego por goteo Xeri-Flex
Caractersticas

Modelos

t-OFBDPNQMFUBEFBDDFTPSJPTEFJOTFSDJOEFNNQBSBTJNQMJGJDBSMB
JOTUBMBDJOEFMTJTUFNBEFSJFHPQPSHPUFPTFSJF9'
t$POFDUPSFTEFQVOUBEFBMUBDBMJEBERVFTPTUJFOFOMBUVCFSBQBSBVO
acople seguro
t%JTFPOJDPEFQVOUBQBSBSFEVDJSMBGVFS[BEFJOTFSDJOZBOBT
mantener un acople seguro
t"DDFTPSJPTEFDPMPSFTOPJOUFOTJWPTQBSBNF[DMBSTFDPOMPTUPOPTEFMB
naturaleza

t9''$061$POFDUPSEFQVOUBEFNNYBDPQMFEFMDPOFDUPSEFQVOUB
t9''&-#08$POFDUPSEFQVOUBYDPEPDPODPOFDUPSEFQVOUBEFNN
t9''."$POFDUPSEFQVOUBEFNNYBEBQUBEPSEFSPTDBNBDIPQBSB
tubera de 1/2
t9''5&&$POFDUPSEFQVOUBEFNNYDPOFDUPSEFQVOUBYDPOFDUPSEF
QVOUBFO5
t9''5."$POFDUPSEFQVOUBEFNNYSPTDBNBDIPQBSBUVCFSB
EFwYBEBQUBEPSEFQVOUBFO5NBDIPEFNN
t9''."$POFDUPSEFQVOUBEFNNYBEBQUBEPSEFSPTDBNBDIPQBSB
tubera de 3/4
t9'%$3044$POFDUPSEFQVOUBFODSV[EFNNYNNYNNYNN
t9'%5'""EBQUBEPSIFNCSBFO5'15EFNNYcYNN
t'*5*/4500-)FSSBNJFOUBEFBDDFTPSJPEFJOTFSDJO9'$PNQBUJCMFDPO9''
$061 9''&-#08Z9''5&&

Rango operativo
Xerigation

t1SFTJOEFBQTJ EFBCBSFT
 TJTFVTBEFQTJ CBSFT
TF
necesitarn abrazaderas)

9''."
9''."

9''5."
NUEVO

9''5'"
NUEVO

9''5&&
9'%$3044

'*5*/4500-

9'%'"

9''COUP
9''ELBOW

182

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

Componentes de distribucin

Adaptador de insercin para lnea de goteo


serie XF y PVC de 1" (2.5 cm), 1" (3.8 cm) o
ms grande
t$POFDUBFMTJTUFNBEFSJFHPQPSHPUFPTFSJF9'ZMBUVCFSBBMBTMOFBT
principales de PVC a bajas presiones.
t&TUBCJMJ[BEPDPO67QBSBVOBMBSHBWJEBUJM
t"CSB[BEFSBEFUSJORVFUFGDJMEFVTBSRVFBTFHVSBMBUVCFSBBMBEBQUBEPS

Modelo
Perfore un orificio con
una sierra perforadora
de 5/8".* Utilice un
taladro de velocidad
lenta. Quite las virutas
del orificio.

t9'17$"%1"EBQUBEPSQBSBVUJMJ[BSDPOUVCPEF17$EF DN

t9'17$#*5#SPDBQBSBVTBSDPOFMBEBQUBEPS9'17$"%1EF NUEVO
t9'%*/17$"EBQUBEPSQBSBVUJMJ[BSDPOUVCPEF17$EF DN
 NUEVO
o ms grande

Quite las partculas y


coloque la arandela
aislante adecuada con
firmeza en el orificio,
con la pestaa de frente
y hacia afuera.

Presione el adaptador
de insercin del sistema
de riego por goteo
serie XF en la arandela
hasta que la pestaa
y la arandela queden
alineadas.

NUEVO

XFD-INPVC

XFDPVCBIT
* Se debera utilizar la broca XFPVCBIT para perforar
orificios para el adaptador XFPVCADP de 1" (2.5 cm).
Se debe utilizar slo con tubos de PVC o PE. No es
adecuada para ningn otro material.

Kit de vlvula de
alivio de aire/vaco
Caractersticas

Longitud mxima del sistema de riego por goteo que se


puede usar con las vlvulas ARV
Espaciamiento del emisor

tTFMPDPOMBUVCFSBEFMFNJTPSFO
MOFBEFMBTFSJF9'PEFMTJTUFNB
de riego paisajstico por goteo de
Rain Bird cuando la instalacin es
QPSEFCBKPEFMTVFMP
t)FDIBDPONBUFSJBMFTEFDBMJEBE
resistentes a la corrosin.
t$BCFEFOUSPEFMBDBKBEFVO
emisor SEB 7XB.
*Rain Bird recomienda XFS lneas
de riego con Copper Shield para
instalaciones subterrneas, incluidas
las instalaciones debajo del csped.

12"
18"
24"

639'
958'
1278'

Capacidad de las vlvulas ARV


Caudal total (GPM)
Caudal total (GPH)

424'
636'
848'
6.5
390

Longitud mxima del sistema de riego por goteo que se


puede usar con las vlvulas ARV
SIST. MTRICO
Espaciamiento del emisor

0.30 m
0.46 m
0.61 m

Modelo
t"377MWVMBEFBMJWJPEFBJSF
EF DN

ARV de 1/2" (1.9 cm)


0.61 GPH
0.92 GPH

Capacidad de las vlvulas ARV


Caudal total (l/min)
Caudal total (l/h)

ARV de 1/2" (1.9 cm)


2.3 l/h
3.4 l/h

195
292
390

129
194
258
24.6
1476

Indicador de
funcionamiento para
sistemas de riego por
goteo
Caractersticas
t&MWTUBHPTFFMFWBQBSBVOB
mejor visibilidad
t$VBOEPFMWTUBHPFTUFYUFOEJEP FM
sistema de riego por goteo se carga
a 20 psi como mnimo
t-BCPRVJMMB7"/TFBKVTUBQBSBOP
dejar pasar el flujo pero se puede
abrir para observar el patrn de
riego.
t*ODMVZFw DN
Y DN

de tubera de distribucin con
accesorio de conexin preinstalado.

Modelo

NUEVO

t01&3*/%
NUEVO

Instale las vlvulas de alivio de aire/vaco


correctamente, para ello:
Localice el punto ms alto de la zona de la lnea de riego por goteo. Coloque
la vlvula en una cabeza de escape o en una lnea que funcione de forma
perpendicular a las filas laterales para garantizar que todas las filas de la lnea
de riego por goteo puedan aprovechar la vlvula de alivio de aire/vaco

OPERIND
ARV050

El uso inteligente del agua.

183

Xerigation

XFPVCADP

Xerigation/Riego por goteo


Componentes de distribucin

Tubera de distribucin XQ de 1/4'' (6.3 mm)


-BUVCFSBEFEJTUSJCVDJOEFNTGVFSUFZGMFYJCMF
disponible para extender las salidas del emisor a los lugares de
descarga deseados
Q Mezcla nica de polmeros que proporciona la flexibilidad del vinilo y el
agarre del polietileno.

Q Nuevo acabado texturado que mejora la maniobra


Q Caracterstica de rollo autoextrable que facilita el uso, el almacenamiento
y la eliminacin de desperdicios.

Q #BMEF92DPOQBUFOUFFOUSNJUFQBSBVOVTPZBMNBDFOBNJFOUPGDJMZ
rpido de rollos largos.

Caractersticas
t$BCFFOMPTPSJGJDJPTEFTBMJEBDPODPOFDUPSEFQVOUBZUPEPTMPTEJTQPTJUJWPT
de emisin y accesorios de transferencia de 1/4 (6.3 mm) de Xerigation
t.UPEPEFFOSPMMBEPFYDMVTJWPRVFQFSNJUFRVFMBUVCFSBQFSNBOF[DB
enrollada a medida que se extrae.
t&YUSVEJEBDPONBUFSJBMFTEFSFTJOBEFQPMJFUJMFOPSFTJTUFOUFTBMPTSBZPT
ultravioleta
t&MOEJDFEFQTJTVQFSBMBTFTQFDJGJDBDJPOFTEFMBDPNQFUFODJB

Especificaciones
t%JNFUSPFYUFSOP NN

t%JNFUSPJOUFSOP NN

t&TQFTPSEFMBQBSFE NN

t-BSHPTSPMMPTEFh N
Zh N

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

Modelos

Caractersticas de prdida por friccin de la tubera de


distribucin XQ de 1/4'' (6.3 mm)
Dim. ext. 0.25" Dim. int. 0.17"

Dim. ext. 6.3 mm Dim. int. 4.3 mm


SIST. MTRICO

Caudal
gph

Velocidad Prdida
pps
psi

Caudal Caudal
m3h
l/h

Velocidad Prdida
m/s
bares

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
25
30

0.27
0.53
0.80
1.06
1.33
1.59
1.86
2.13
2.39
2.66
2.92
3.19
3.45
3.72
3.98
4.25
4.52
4.78
5.05
5.31
6.64
7.97

0.00
0.01
0.01
0.02
0.02
0.02
0.03
0.03
0.03
0.04
0.04
0.05
0.05
0.05
0.06
0.06
0.06
0.07
0.07
0.08
0.09
0.11

0.08
0.16
0.24
0.32
0.41
0.48
0.57
0.65
0.73
0.81
0.89
0.97
1.05
1.13
1.21
1.30
1.38
1.46
1.54
1.62
2.03
2.43

0.16
0.59
1.24
2.12
3.20
4.49
5.97
7.64
9.50
11.54
13.79
16.17
18.75
21.50
24.43
27.53
30.80
34.23
37.83
41.60
62.86
88.08

Prdida en psi por cada 100 pies de


tubera; C=150

3.79
7.58
11.6
15.14
18.92
22.71
26.50
30.28
34.07
37.85
41.64
45.42
49.21
52.99
56.78
60.56
64.35
68.13
71.92
75.70
94.63
113.55

0.01
0.04
0.09
0.15
0.22
0.31
0.41
0.53
0.66
0.80
0.95
1.12
1.29
1.48
1.69
1.90
2.13
2.36
2.61
2.87
4.34
6.08

Prdida en bares por cada 100 metros de tubera

Nota: No se recomienda el uso de tubera para los caudales indicados en las reas con sombreado
PTDVSP ZBRVFMBTWFMPDJEBEFTTVQFSBOMPTQJFTT NT

t92SPMMPEFQJFT N
EFUVCFSBEFEJTUSJCVDJOEF
t92SPMMPEFQJFT N
EFUVCFSBEFEJTUSJCVDJOEF
t92#SPMMPEFQJFT N
EFUVCFSBEFEJTUSJCVDJOEF
en balde

Xerigation

Tubera XQ-100 y
XQ-1000 de "

Tubera XQ-1000-B
de "

184

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

Componentes de distribucin

Caractersticas de prdida por friccin de la tubera XT-700

La tubera de distribucin duradera y de paredes gruesas resiste


las condiciones difciles y funciona bien en todos los climas

Dim. ext. 0.700" Dim. int. .580"

D.E. 18 mm D.I. 15 mm SIST. MTRICO

Caractersticas

Caudal
gph

Velocidad Prdida
pps
psi

Caudal Caudal
m3h
l/h

Velocidad Prdida
m/s
bares

0.50
1.00
1.50
2.00
2.50
3.00
3.50
4.00
4.50
5.00
5.50
6.00

0.61
1.21
1.82
2.43
3.03
3.64
4.24
4.85
5.46
6.06
6.67
7.28

0.11
0.23
0.34
0.45
0.57
0.68
0.79
0.91
1.02
1.14
1.25
1.36

0.19
0.37
0.56
0.74
0.92
1.11
1.29
1.48
1.67
1.85
2.03
2.22

t-BUVCFSBGMFYJCMF EFQBSFEFTHSVFTBT SFTJTUFMPTQMJFHVFTZFMEBPDBVTBEP


por las actividades rutinarias de mantenimiento del terreno
t&YUSVEJEBDPONBUFSJBMFTEFSFTJOBEFQPMJFUJMFOPSFTJTUFOUFTBMPTSBZPT
ultravioleta

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

Especificaciones
t%JNFUSPFYUFSOP NN

t%JNFUSPJOUFSOP NN

t&TQFTPSEFMBQBSFE NN

Modelos
t95SPMMPEFQJFT N

t95SPMMPEFQJFT N

XT-700-100

Nota: en pos de la conservacin del agua y la apariencia, se recomienda colocar una


cubierta de mantillo de 2" a 3" (5 a 8 cm) sobre la tubera

Tubera de rayas negras XBS


5VCFSBGMFYJCMFEFBMUBDBMJEBE QBSBVTBSFOVOTJTUFNBEF
riego por goteo
 5VCFSBEF DN
FYUSVEJEBDPONBUFSJBMFTEFSFTJOBEFQPMJFUJMFOP
para una durabilidad consistente

%JTQPOJCMFDPOSBZBTEFDPMPSFTQBSBMBTEJGFSFOUFT[POBT
Resistente a los rayos ultravioleta para instalaciones al nivel del terreno o
por debajo

Caractersticas
t3PMMPTDPNQBDUPTQBSBGDJMBMNBDFOBNJFOUPZUSBTMBEP

Especificaciones
t%JNFUSPFYUFSOP NN

t%JNFUSPJOUFSOP NN

Rango operativo

t&TQFTPSEFMBQBSFE NN

t-BSHPTSPMMPTEFh N
Zh
(152.4 m)

t1SFTJOEFBQTJ EFBCBSFT

Modelos
XBS100: rollo de 100 pies (30 m) con rayas verdes
XBS500: rollo de 500 pies (152 m) con rayas verdes
XBS100B: rollo de 100 pies (30 m) con rayas negras
XBS500B: rollo de 500 pies (152 m) con rayas negras
XBS100R: rollo de 100 pies (30 m) con rayas rojas
XBS500R: rollo de 500 pies (152 m) con rayas rojas
XBS500P: rollo de 500 pies (152 m) con rayas violetas
9#4:SPMMPEFQJFT N
DPOSBZBTBNBSJMMBT

0.19
0.69
1.45
2.47
3.74
5.24
6.97
8.93
11.10
13.50
16.10
18.92

Prdida en psi por cada 100 pies de


UVCP QTJQJFT


0.03
0.06
0.09
0.13
0.16
0.19
0.22
0.25
0.28
0.32
0.35
0.38

0.01
0.05
0.10
0.17
0.26
0.36
0.48
0.62
0.77
0.93
1.11
1.31

Prdida en bares por cada 100 metros de tubera


CBSFTN

Nota: No se recomienda el uso de tubera para los caudales indicados en las reas con sombreado
PTDVSP ZBRVFMBTWFMPDJEBEFTTVQFSBOMPTQJFTT NT

XBS: caractersticas de prdida por friccin de la tubera


Dim. ext. 0.705" Dim. int. .615"

D.E. 18 mm D.I. 15.5 mm

Caudal
gph

Velocidad Prdida
pps
psi

Caudal Caudal
m3h
l/h

Velocidad Prdida
m/s
bares

0.50
1.00
1.50
2.00
2.50
3.00
3.50
4.00
4.50
5.00
5.50
6.00

0.54
1.08
1.62
2.16
2.70
3.24
3.78
4.31
4.85
5.39
5.93
6.47

0.11
0.23
0.34
0.45
0.57
0.68
0.79
0.91
1.02
1.14
1.25
1.36

0.16
0.33
0.49
0.66
0.82
0.99
1.15
1.32
1.48
1.64
1.81
1.97

0.14
0.52
1.09
1.86
2.81
3.94
5.24
6.71
8.35
10.15
12.11
14.22

113.6
227.1
340.7
454.3
567.8
681.4
794.9
908.5
1022.1
1135.6
1249.2
1362.8

SIST. MTRICO

0.03
0.12
0.25
0.42
0.64
0.89
1.19
1.52
1.89
2.30
2.74
3.22

Prdida en psi por cada 100 pies de


UVCP QTJQJFT


Prdida en bares por cada 100 metros de tubera


CBSFTN

Nota: No se recomienda el uso de tubera para los caudales indicados en las reas con sombreado
PTDVSP ZBRVFMBTWFMPDJEBEFTTVQFSBOMPTQJFTT NT

Rojo
Violeta

Amarillo

Negro

Verde

Tubera de rayas negras

El uso inteligente del agua.

185

Xerigation

Tubera de distribucin XT-700

Xerigation/Riego por goteo


Componentes de distribucin

Sistema de accesorios de compresin Easy Fit


Sistema completo de accesorios de compresin y adaptadores
para todas las necesidades de conexin de tubera en un sistema
de bajo volumen
Q Reduce los costos de inventario: los accesorios de compresin para
diversos dimetros admiten un amplio rango de tamaos de tuberas de
polietileno de 1/2 DN
 %JNFUSPFYUFSOPEFBNNB
17 mm)

Q Ahorra tiempo y esfuerzo: se requiere un 50% menos de fuerza para


conectar la tubera y los accesorios en comparacin con los accesorios de
compresin de la competencia. Los adaptadores giran para una instalacin
sencilla

Q #SJOEBNTGMFYJCJMJEBETFOFDFTJUBOTMPUSFTBDDFTPSJPT&BTZ'JUZDJODP

Prdida por friccin por cada accesorio


Caudal
gpm

Prdida
psi

SIST. MTRICO
Caudal
l/h

Prdida
bares

0.00
1.00
2.00
3.00
4.00
5.00
6.00

0.00
0.39
0.64
0.82
1.45
1.90
2.57

0.00
227.1
454.3
681.4
908.5
1135.6
1362.8

0.00
0.03
0.04
0.06
0.10
0.13
0.18

Nota: no se recomienda el uso de accesorios con los caudales indicados en el rea con
sombreado oscuro. (La prdida por friccin se muestra con la tubera XBS)

BEBQUBEPSFT&BTZ'JUQBSBIBDFSNTEFDPNCJOBDJPOFTEFDPOFYJPOFT
y se adapta a incontables situaciones de instalacin y mantenimiento

Caractersticas
t'VODJPOBDPOUPEBTMBTUVCFSBTEFQPMJFUJMFOPEF12" (15 mm) de un dimetro
FYUFSOPEFNN JODMVTPFMTJTUFNBEFSJFHPQPSHPUFP9'% 
9'4 MBUVCFSBEFNNZPUSBTUVCFSBTZTJTUFNBTEFSJFHP
por goteo de 17 mm de Rain Bird
MDCFTEE
t-PTBDDFTPSJPTZBEBQUBEPSFTQBUFOUBEPTFTUONPMEFBEPT
en materiales de ABS duradero y resistentes a los rayos ultravioleta
t-PTUBQPOFTEFESFOBKFSFNPWJCMFTTFQVFEFOVTBSQBSBMBWBSFMFYUSFNP
de la lnea y para tapar las lneas temporalmente a fin de expandirlas ms
adelante

MDCFCOUP
MDCF75FHT

MDCF50MPT

MDCF75FPT
MDCFPCAP

Rango operativo
t1SFTJOEFBQTJ EFBCBSFT

t"ENJUFUVCFSBTDPOVOEJNFUSPFYUFSOPEFB
16 mm a 17 mm)

Modelos
t"DDFTPSJPT&BTZ'JU

MDCFCAP
MDCFEL

MDCF75MPT

MDCF50FPT

 .%$'$061BDPQMBNJFOUP
 .%$'&-DPEP
 .%$'5&&5

t"EBQUBEPSFT&BTZ'JU
Xerigation

 .%$'.15BEBQUBEPSEFSPTDBNBDIPQBSBUVCFSBEF1/2" (1.9 cm)


 .%$'.15BEBQUBEPSEFSPTDBNBDIPQBSBUVCFSBEF3/4" (1.9 cm)
 .%$''15BEBQUBEPSEFSPTDBIFNCSBQBSBUVCFSBEF1/2" (1.9 cm)
 .%$''15BEBQUBEPSEFSPTDBIFNCSBQBSBUVCFSBEF3/4" (1.9 cm)
 .%$'')5BEBQUBEPSEFSPTDBIFNCSBQBSBNBOHVFSBEF3/4" (1.9 cm)
 .%$'$"1UBQOEFESFOBKFSFNPWJCMFQBSBBDDFTPSJPT&BTZ'JU OFHSP

 .%$'1$"1UBQOEFESFOBKFSFNPWJCMFQBSBBDDFTPSJPT&BTZ'JU WJPMFUB
para identificar el agua no potable)
Nota: Los adaptadores Easy Fit no son accesorios con conectores de punta.
Se deben usar solo con accesorios de compresin Easy Fit

186

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

Componentes de distribucin

Caractersticas
t4JNQMFEFVTBSHSBDJBTBMBUVCFSBGMFYJCMFRVFGBDJMJUBMBUBSFBEFSFHBSMBT
macetas y los jardines con macetas
- El tamao de la tubera de 1/4 (6.3 mm) complementa la esttica de
cualquier jardn
- Resistencia a las obstrucciones a travs de la filtracin incorporada y
dos orificios de salida, a 180 grados de distancia
t-BUVCFSBNBSSODPNQMFNFOUBFMTJTUFNBEFSJFHPQPSHPUFP9'EF3BJO#JSE
- El tamao discreto y la flexibilidad brindan un perfil bajo y medios
estticamente agradables para regar las plantas
t'VODJPOBDPOMPTBDDFTPSJPTDPODPOFDUPSFTEFQVOUBEF1/4 (6.3 mm) de
Rain Bird.
t7JFOFFOFTQBDJBNJFOUPT wZw<BDN>
ZVOBMPOHJUVEEFSPMMP
de 100 (30.5 m) para brindar flexibilidad de diseo

Caractersticas de caudal
Modelo

Caudal a 30 psi Espaciamiento

Largo de rollo

(gph) (l/h)

(pulg.) (cm)

(pies)

(m)










-%2 
-%2 







Rendimiento del sistema de riego paisajstico por goteo de " (6.3 mm)

SIST. MTRICO
ndice de caudal (l/h)

El sistema de riego por goteo de 1/4" (6.3 mm) de Rain Bird es la


opcin perfecta para las reas pequeas como cajas para plantas,
jardines con macetas, el recorrido alrededor de los rboles, jardines
vegetales y arbustos

ndice de caudal (gph)

Sistema de riego paisajstico por goteo de


" (6.3 mm)

1.2
1.0
0.8
0.6
0.4
0.2
0.0

0 10 15

20 25 30
Presin (psi)

35

40

4.0
3.5
3.0
2.5
2.0
1.5
1.0
0.5
0.0

0.5

1.0 1.5 2.0 2.5


Presin (bares)

3.0

Rango operativo
tEFBQTJ EFBCBSFT

tOEJDFEFDBVEBMBQTJ CBSFT
HQI MI

t'JMUSBDJOSFRVFSJEBNBMMB NJDSPOFT

Mxima longitud de riego (pies)

Especificaciones
t%JNFUSPFYUFSOP NN

t%JNFUSPJOUFSOP NN

t&TQFTPSEFMBQBSFE NN

t&TQBDJBNJFOUP DNZDN

t-BSHPCPCJOBTEFh N


Emisor
Espaciamiento

Mximo
Longitud del riego

Caudal por metro


a 15 psi

6"
12"

579.12 cm
1,005.84 cm

1 gph/pie
0.5 gph/pie

Modelos

Xerigation

t-%2
t-%2

LDQ-08-06-100

Riego paisajstico por goteo de " (6.3


mm) para plantas en macetas

Ahorre agua y tiempo usando el sistema de riego paisajstico por goteo de 1/4" (6.3 mm) en canastas colgantes y plantas en macetas.

El uso inteligente del agua.

187

Xerigation/Riego por goteo


Herramientas y componentes de distribucin

Accesorios transferencia de (6.3 mm)

Caja subterrnea para emisor

Caractersticas

Caractersticas

t4FVTBQBSBDPOFDUBSMBUVCFSBEFEJTUSJCVDJO92EF14" (6.3 mm) en


diferentes configuraciones o para sujetar la tubera de 14" (6.3 mm) a una
tubera de 12" (1.3 cm) 34" (1.9 cm)
t-PTDPOFDUPSFTEFOVFWPEJTFPQPTFFODPOFDUPSFTBVUPQFSGPSBOUFTRVF
perforan fcilmente la tubera de 1/2 (1.3 cm) 3/4 (1.9 cm)
t&MEJTFPEFMPTBDDFTPSJPTQFSNJUFVOBJOTUBMBDJOTJNQMFZSQJEBDPOMB
herramienta Xeriman 9.500-

t&TUSVDUVSBEFQMTUJDPSFTJTUFOUF

t1SPQPSDJPOBVOBDDFTPDNPEPBMFNJTPSTVCUFSSOFPZBMNJTNPUJFNQP
lo protege contra el vandalismo. Ideal para dispositivos de salidas mltiples
(como Xeri-Bird 8) y el kit de vlvula de alivio de aire/vaco
t&MOVFWPDVFSQPNTHSBOEFQFSNJUFNTFTQBDJPQBSBMPTDPNQPOFOUFTZ
las tuberas de distribucin
t&TUSVDUVSBUFSNPQMTUJDBGVFSUF SFTJTUFOUFBMPTSBZPTVMUSBWJPMFUB
t%JTQPOJCMFDPOUBQBOFHSB

Rango Operativo*

t"MUVSB DN

t%JNFUSPTVQFSJPS DN

t%JNFUSPEFMBCBTF DN

t1SFTJOEFBQTJ EFBCBSFT

* con tubera de polietileno

Modelos
t9#'$0//DPOFDUPSEFQVOUBEF14" (6.3 mm)
t9#'&-DPOFDUPSEFQVOUBYDPEPDPODPOFDUPSEFQVOUBEF14" (6.3 mm)
t9#'5&&DPOFDUPSEFQVOUBYDPOFDUPSEFQVOUBYDPOFDUPSEFQVOUBFO5EF
1
4" (6.3 mm)

XBF1CONN

Dimensiones

XBF2EL

Modelo
t4&#9#

SEB 7XB

XBF3TEE

Xerigation

Estaca galvanizada
para sujetar

Tapn para tubera

Cortador de tubera

Caractersticas

Caractersticas

Caractersticas

t6TBEPQBSBUBQBSMPTPSJGJDJPTOP
deseados en la tubera
t/VFWPEJTFPRVFGVODJPOBDPOMB
herramienta Xeriman 9.500-

para una instalacin rpida y fcil

t&MDPSUBEPSEFUVCFSBSFEJTFBEP9FSJHBUJPOQFSNJUFDPSUFTNTMJNQJPTZ
fciles de todas las tuberas de bajo volumen
t&MEJTFPFYDMVTJWPQSPQPSDJPOBEPTSBOVSBTEFEJGFSFOUFUBNBP VOPQBSB
una tubera de 1/2 (1.3 cm) - 3/4 (1.9 cm) y uno para una tubera de 1/4 (6.3
mm), para ejercer mayor presin, de manera que se necesite menos fuerza
para cortar cualquier tubera
t&MDPSUBEPSEFMBUVCFSBFTMJWJBOPDPOIPKBTEFBDFSPJOPYJEBCMF)BZIPKBT
EFSFQVFTUPEJTQPOJCMF 11$9#-%

t6OBWBSJMMBEFBDFSPHBMWBOJ[BEP
calibre 12 viene previamente
doblada para grapar la tubera de
distribucin, el sistema de riego
QPSHPUFPTFSJF9'PMBUVCFSB9#4
al nivel de la terminacin
t-PTMBUFSBMFTDPOSBOVSBTBZVEBOB
asegurar la estaca al suelo
t'VFSUF EVSBEFSPZSFTJTUFOUFBMB
corrosin

Modelo
t&."(19

Modelo
t11$9$PSUBEPSEFUVCFSB
t11$9#-%IPKBEFSFQVFTUP

Modelo
t5%4DPODPEP

Diseo mejorado de dos


ranuras que permite
cortes limpios
TDS-050 con codo

EMA-GPX
PPC-200X

188

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

Herramientas y componentes de conversin

Herramienta Xeriman

Xeri-Caps para aspersores

Caractersticas

Caractersticas

t1PTJCJMJUBVOBJOTUBMBDJOSQJEB GDJMZFOVOTPMPQBTPEFMPTNEVMPT
compensadores de presin y los emisores Xeri-Bug directamente en
las tuberas de riego por goteo de 1/2 (1.3 cm) 3/4 (1.9 cm), el sistema de
SJFHPQPSHPUFPTFSJF9'PFMTJTUFNBEFSJFHPQBJTBKTUJDPQPSHPUFP
t3FEVDFFMUJFNQPEFJOTUBMBDJOEFMFNJTPSFOVO
t-BIFSSBNJFOUB5PEPFOVOPJOTFSUBZSFUJSBFNJTPSFT DPMPDBBDDFTPSJPTDPO
conectores de punta de
1
/4 (6.3 mm) e instala tapones

t"ZVEBBSFUSPBEBQUBSVOTJTUFNBEFBTQFSTPSFTBVOTJTUFNBEFSJFHPQPSHPUFP
tapando los cabezales en desuso

Rango operativo
t1SFTJOIBTUBQTJ CBSFT

Dimensiones
t"ODIP14" (5.7 cm)

Modelo

Modelos

t9.500-

t9$DBCFFODVBMRVJFSDVFSQPEFBTQFSTPSEFMBTFSJFEF3BJO#JSE

Insercin de
Xeri-Bug
en un solo paso

Remocin de
Xeri-Bug

Insercin
para tapn

Rain Bird XC-1800


XM-TOOL

Dimensiones

,JUTJNQMFRVFDPOWJFSUFGDJMNFOUFVOB[POBEFBTQFSTPSFT
convencional en una zona de riego por goteo
Caractersticas
t$VFSQPEFBTQFSTPSFTTFSJFRVFDPOUJFOFVOGJMUSP VOSFHVMBEPSEF
presin y una salida macho roscada de 1/2 (1.3 cm)
t1FSNJUFMBDPOWFSTJODPOWFOJFOUFBMBUVCFSBEFSJFHPQPSHPUFPDVBOEPTF
VTBOMPTBDDFTPSJPT&BTZ'JUZVOBEBQUBEPSIFNCSB
- Se puede instalar por encima o por debajo del nivel de terreno
t&MFOTBNCMFJOUFSOPTFQVFEFRVJUBSZQBTBSGDJMNFOUFQPSFMDVFSQPEF
cualquier aspersor 1804, 1806 1812 para retroadaptar el sistema existente a
los productos Xerigation
t1SPQPSDJPOBVOBSFHVMBDJOEFQSFTJOEFQTJ CBSFT
Z
un filtro de malla 200 (75 micrones)
MDCF 50FPT
t4JFMDBVEBMEFSFUSPBEBQUBDJOFTJOGFSJPSBHQN SFNQMBDF
la vlvula electrnica por la vlvula de caudal bajo de Rain Bird

t&OUSBEBIFNCSBSPTDBEBEF1/2 (1.3 cm)


t4BMJEBHJSBUPSJBEFSPTDBNBDIPEF
1
/2 (1.3 cm)
t"MUVSB DN

t"ODIP DN

Regulador de
presin de 30 psi
(2.1 bares)

Modelo
t3&530

Filtro de malla
200

T MDCF

Rango operativo
t$BVEBMEFBHQN EFBMN

t1SFTJOEFFOUSBEBEFBQTJ EFBCBSFT

t1SFTJOSFHVMBEBQTJ CBSFT

t'JMUSBDJONBMMB NJDSPOFT

Salida giratoria
de rosca macho
para tubera de
1
2" (1.3 cm)

Cuerpo 1800
fuerte, resistente
a los rayos
ultravioleta

RETRO-1800
Convierte los cuerpos de
aspersores 1800 en un sistema
de riego por goteo

%JTFBEPFTQFDGJDBNFOUFQBSBSFBTDPOSFTUSJDDJPOFTEFSJFHP OVFTUSPLJUEFSFFNQMB[PEFBTQFSTPSFTBSJFHPQPSHPUFPQFSNJUFFMVTPEF
los cuerpos de aspersores serie 1800 existentes como puntos de conexin para el riego por goteo.

El uso inteligente del agua.

189

Xerigation

Kit de reemplazo para convertir a riego


por goteo

Xerigation/Riego por goteo


Guas de seleccin de la pirmide del kit de control de zona

Gua de seleccin para el kit de control de zona


Esta herramienta de seleccin fcil de usar est disponible en XXXSBJOCJSEDPN$;, y le ayudar a identificar el kit de control de
zona ms adecuado para la aplicacin.

XCZ-150-PRB-COM
CAUDAL: 15 - 40 gpm
CAUDAL:

XCZ-100-PRB-COM
CAUDAL: 3 - 20 gpm
CAUDAL:

CAUDAL: 3 - 15 gpm

CAUDAL: 3 - 20 gpm

XCZ-100-PRBR

CAUDAL: 3 - 20 gpm

Pginas
195 - 196

XCZF-100-PRF

CAUDAL: 3 - 15 gpm

XACZ-100-PRF

CAUDAL: 3 - 15 gpm

3 - 15 gpm

Xerigation

XCZ-075-PRF

CAUDAL: 0.2 - 5 gpm


CAUDAL:

XCZ-100-PRB-LC

3 - 20 gpm

XCZ-100-PRF
CAUDAL:

Pgina
197

15 - 40 gpm

XCZF-175-PRF

CAUDAL: 3 - 15 gpm

3 - 10 gpm

XCZ-LF-100-PRF

CAUDAL: 0.2 - 5 gpm

Pginas
193 - 194

XACZ-075-PRF

CAUDAL: 0.2 - 5 gpm

Pginas
192 - 193

0.2 - 5 gpm

Gua de seleccin en lnea para el kit de


control de zona
Los kits de control de zona de Rain Bird brindan todos los componentes necesarios
para el control de encendido y apagado, la filtracin y la regulacin de presin en
VOBTPMB[POBEFSJFHPQPSHPUFP%FFTUBNBOFSB FMFODBSHPFTNTTJNQMFZMB
instalacin, ms fcil.
Esta rpida herramienta de seleccin lo ayudar a encontrar el kit de control de
[POBBEFDVBEPQBSBTVBQMJDBDJO%FTQVTEFSFTQPOEFSVOBTQPDBTQSFHVOUBT
sencillas, la gua de seleccin le ofrecer los kits de control de zona recomendados
que mejor se adapten a su aplicacin. Simplemente haga clic en la imagen del kit
para ver la informacin detallada y las especificaciones del mismo.

190

Caractersticas
t*ODMVZFEJCVKPTEFUBMMBEPTZ
especificaciones para cada kit
t%JTQPOJCMFFO
XXXSBJOCJSEDPN$;,

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

Componentes de control de zona

Kits de control de zona


Los kits de control de zona de Rain Bird brindan todos los
componentes necesarios para el control de encendido y apagado,
MBGJMUSBDJOZMBSFHVMBDJOEFQSFTJOFOVOTPMPQBRVFUF%FFTUB
manera, el encargo es ms simple y la instalacin, ms fcil.
t-PTLJUTEFDPOUSPMEF[POBEF3BJO#JSETPOMPTLJUTNTDPOGJBCMFTZ
contienen productos revolucionarios como la vlvula de bajo caudal, el filtro
DPOSFHVMBDJOEFQSFTJO 13
FMGJMUSPDBOBTUB2VJDL$IFDLZFMGJMUSPDBOBTUB
2VJDL$IFDLDPOSFHVMBDJOEFQSFTJO 13

t5PEPTMPTLJUTFOUPEBTMBTDBUFHPSBTFNQMFBOFMJOOPWBEPSGJMUSP13
que combina el filtro y el regulador de presin en una unidad. Este filtro
elimina un componente por separado para ayudar a evitar fugas durante la
instalacin o durante la vida del kit en el campo. La mayora de los kits de
filtros con regulacin de presin vienen ensamblados para ahorrar tiempo de
instalacin y evitar errores en campo

t3BJO#JSEPGSFDFMBMOFBNTDPNQMFUBEFLJUTEFDPOUSPMEF[POBQBSBRVFMPT
contratistas y especificadores tengan la flexibilidad de encontrar una solucin
para cada caso en particular, de 0.2 a 40 gpm. Elija entre:
t"CFSUVSBEFFOUSBEBEF34", 1" 112" (1.9 cm; 2.5 cm 3.8 cm)
t7MWVMBEFDBVEBMCBKP WMWVMBBOUJTJGO WMWVMB%7PWMWVMB1&4#
t'JMUSP3#:SFHVMBEPSEFQSFTJO GJMUSPDBOBTUB2VJDL$IFDLDPOSFHVMBDJOEF
QSFTJOPGJMUSPDBOBTUB2VJDL$IFDL

Use el siguiente cuadro para identificar el kit ms adecuado o consulte las pginas 198 a 208 para obtener informacin detallada especfica sobre estos kits y sus
DPNQPOFOUFTJOEJWJEVBMFT5BNCJOFTUEJTQPOJCMFMB(VBJOUFSBDUJWBEFTFMFDDJOEFMBQJSNJEFEFMLJUEFDPOUSPMEF[POB DPOPSJFOUBDJOQBSBSFBMJ[BSMBTFMFDDJO
de productos e informacin de especificacin detallada, que se encuentra en XXXSBJOCJSEDPN$;,

Cuadro de seleccin de zonas de control


Tamao
Modelo

(Entrada x salida)

Caudal
Rango

Presin de entrada
Rango

Vlvula

Filtro

Salida
Presin

CAUDAL ALTO PARA APLICACIONES COMERCIALES: 15-40 gpm


 9$;13#$0.

YB

HQN

QTJ

1&4#

'DBOBTUB132VJDL$IFDLEF 
 QTJ

CAUDAL MEDIO PARA APLICACIONES COMERCIALES: 320 gpm


 9$;13#$0.

Y

HQN

QTJ

1&4#

'DBOBTUB132VJDL$IFDLEF

QTJ

 9$;13#3

Y

HQN

QTJ

1&4#3

'JMUSPDBOBTUB13EF

QTJ

 9$;13#-$

Y

HQN

QTJ

1("

'JMUSPDBOBTUB13EF

QTJ

 9$;'13'

Y

HQN

QTJ

%7'

'JMUSP133#:EF

QTJ

 9$;'13'

Y

HQN

QTJ

%7'

'JMUSP133#:EF

QTJ

 9$;13'

Y

HQN

QTJ

%7

'JMUSP133#:EF

QTJ

 9"$;13'

Y

HQN

QTJ

"47'

'JMUSP133#:EF

QTJ

CAUDAL BAJO PARA APLICACIONES COMERCIALES LIVIANAS/RESIDENCIALES: 0.25 gpm


 9$;-'13'

Y

HQN

QTJ

-'7

'JMUSP133#:EF

QTJ

 9$;13'

Y

HQN

QTJ

-'7

'JMUSP133#:EF

QTJ

 9"$;13'

Y

HQN

QTJ

"47-'7

'JMUSP133#:EF

QTJ

*Disponible con roscas BSP

Combine un kit de control de zona de Xerigation con un producto controlador de Rain Bird para regular los tiempos de riego de la zona
con precisin.

El uso inteligente del agua.

191

Xerigation

CAUDAL MEDIO PARA APLICACIONES COMERCIALES LIVIANAS/RESIDENCIALES: 3-15 gpm

Xerigation/Riego por goteo


Componentes de control de zona

Kits de control de zona de caudal bajo


con filtro PR

Presin de entrada mnima para una presin de salida de 30 psi

Q ,JUTEFDPOUSPMEF[POBDPOGJBCMFT RVFJODMVZFOMBWMWVMBEFDBVEBMCBKP MB


nica vlvula en el mercado que puede manejar caudales bajos (menos de
3 gpm) sin goteo

Q ,JUTNTQFRVFPTDPOTMPEPTDPNQPOFOUFT WMWVMBNTGJMUSPDPO


regulacin de presin), que permite adaptar ms kits de control de zona en
una caja de vlvula, lo cual permite ahorrar tiempo y dinero

Caudal (gpm)

Presin de entrada (psi)


XCZ-075-PRF
XCZ-LF-100-PRF

0.2
1.0
3.0
5.0

34.4
36.1
38.1
43.4

34.6
36.5
38.1
42.0

Q Estos kits de filtros con regulacin de presin (PR) proporcionan el control


de encendido y apagado, la filtracin y la regulacin de presin con menos
componentes, para que haya menos posibilidades de prdida en las
conexiones, tanto durante la instalacin como durante la vida til del sistema

Presin de entrada mnima para una presin de salida de 2.1 bares

Rango operativo

Caudal (l/min)

Presin de entrada (bares)


XCZ-075-PRF
XCZ-LF-100-PRF

t$BVEBMEFBHQN EFBMN

t1SFTJOEFFOUSBEBEFBQTJ EFBCBSFT

t1SFTJOSFHVMBEBQTJ CBSFT

t'JMUSBDJONBMMB NJDSPOFT
EFBDFSPJOPYJEBCMF

0.8
3.8
11.4
18.9

2.4
2.5
2.6
3.0

2.4
2.5
2.6
2.9

Modelos
t9$;13'WMWVMBEFDBVEBMCBKPEF3/4w DN
DPOGJMUSP133#:EF
3
/4 (1.9 cm) (ensamblada)
t9$;-'13'7MWVMBEFDBVEBMCBKPEF DN
DPOGJMUSP133#:EF
3
4" (1.9 cm)

Malla de repuesto
t3#:44.9 NBMMBEFBDFSPJOPYJEBCMF

Viene do!
bla
s
n
e am

Malla de
acero
inoxidable

Cuatro kits de control


de zona en una
caja de vlvulas
estndar

Xerigation

CZ-075-PRF

Malla de
acero
inoxidable

CZ-LF-100-PRF

192

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

Componentes de control de zona

Kits de control de zona de caudal bajo


con vlvula antisifn y filtro PR

Kits de control de zona de caudal medio


con vlvula antisifn y filtro PR

Q ,JUTEFDPOUSPMEF[POBDPOGJBCMFT RVFJODMVZFOMBWMWVMBEFDBVEBMCBKP 

Q Los kits de control de zona completos de dos piezas incluyen la vlvula

la nica vlvula en el mercado que puede manejar caudales bajos (menos


de 3 gpm) sin goteo

Q Los kits de control de zona completos de dos piezas incluyen la vlvula


antisifn de caudal bajo, probada en campo, que posee una vlvula vacuo
reguladora para prevenir el retrocaudal y una clasificacin de IAPMO

Q Estos kits de filtros PR proporcionan el control de encendido y apagado,


la filtracin y la regulacin de presin con slo dos piezas, para que haya
menos posibilidades de prdida en las conexiones, en la instalacin y
durante la vida til del sistema

Rango operativo

"47' QSPCBEBFODBNQP RVFQPTFFVOBWMWVMBWBDVPSFHVMBEPSBQBSB


prevenir el retrocaudal y una clasificacin de IAPMO

Q Estos kits de filtros PR proporcionan el control de encendido y apagado,


la filtracin y la regulacin de presin con slo dos piezas, para que haya
menos posibilidades de prdida en las conexiones, en la instalacin y
durante la vida til del sistema

Rango operativo
t$BVEBMEFBHQN EFBMN

t1SFTJOEFFOUSBEBEFBQTJ EFBCBSFT

t'JMUSBDJONBMMB NJDSPOFT
EFBDFSPJOPYJEBCMF
t1SFTJOSFHVMBEBQTJ CBSFT

t$BVEBMEFBHQN EFBMN

t1SFTJOEFFOUSBEBEFBQTJ EFBCBSFT

t'JMUSBDJONBMMB NJDSPOFT
EFBDFSPJOPYJEBCMF
t1SFTJOSFHVMBEBQTJ CBSFT

Modelos

Modelos

Malla de repuesto

t9"$;13'"47'EF DN

DPOGJMUSP133#:EF DN

t9"$;13'WMWVMBBOUJTJGOEFDBVEBMCBKPEF34" (1.9 cm) con filtro


133#:EF34" (1.9 cm)

t3#:44.9 NBMMB
de acero inoxidable)

Malla de repuesto

Malla de
acero
inoxidable

t3#:44.9 NBMMBEFBDFSP
inoxidable)
ACZ-100-PRF

ACZ-075-PRF

Presin de entrada mnima para una presin de salida de 30 psi

Caudal (gpm)

Presin de entrada (psi)


XACZ-075-PRF

0.2
1.0
3.0
5.0

37.4
39.1
40.0
49.7

Presin de entrada mnima para una presin de salida de 2.1 bares

Caudal (l/min)

Presin de entrada (bares)


XACZ-075-PRF

0.8
3.8
11.4
18.9

2.6
2.7
2.8
3.4

El uso inteligente del agua.

Presin de entrada mnima para una presin de salida de 40 psi


Caudal (gpm)

Presin de entrada (psi)


XACZ-100-PRF

3.0
5.0
7.0
9.0
11.0
13.0
15.0

43.3
44.7
46.2
47.3
50.8
55.4
59.7

Xerigation

Malla de
acero
inoxidable

Presin de entrada mnima para una presin de salida de 2.8 bares


Caudal (l/min)

Presin de entrada (bares)


XACZ-100-PRF

11.4
18.9
26.5
34.1
41.6
49.2
56.8

3.0
3.1
3.2
3.3
3.5
3.8
4.1

193

Xerigation/Riego por goteo


Componentes de control de zona

Kits de control de zona de caudal medio


con filtro PR, control de caudal

Kits de control de zona de caudal medio


con filtro PR

Q ,JUEFDPOUSPMEF[POBDPOGJBCMFRVFJODMVZFVOBWMWVMB%7DPODPOUSPMEF

Q ,JUTNTQFRVFPTDPOTMPEPTDPNQPOFOUFT WMWVMBNTGJMUSPDPO

caudal para una sintonizacin del sistema ms fcil

Q Estos kits de filtros PR proporcionan el control de encendido y apagado,


la filtracin y la regulacin de presin con slo dos piezas, para que haya
menos posibilidades de prdida en las conexiones, en la instalacin y
durante la vida til del sistema

Rango operativo

regulacin de presin), que permite adaptar ms kits de control de zona


en una caja de vlvula, lo cual permite ahorrar tiempo y dinero

Q Estos kits de filtros PR proporcionan el control de encendido y apagado,


la filtracin y la regulacin de presin con slo dos piezas, para que haya
menos posibilidades de prdida en las conexiones, en la instalacin y
durante la vida til del sistema

Rango operativo

t$BVEBMEFBHQN EFBMN

t1SFTJOEFFOUSBEBEFBQTJ EFBCBSFT

t'JMUSBDJONBMMB NJDSPOFT
EFBDFSPJOPYJEBCMF
t1SFTJOSFHVMBEBQTJ CBSFT

t$BVEBMEFBHQN EFBMN

t1SFTJOEFFOUSBEBEFBQTJ EFBCBSFT

t'JMUSBDJONBMMB NJDSPOFT
EFBDFSPJOPYJEBCMF
t1SFTJOSFHVMBEBQTJ CBSFT

Modelos
t9$;'13'WMWVMB%7'EFwDPOGJMUSP13EFwZBDDFTPSJPT.%$'
(tubera de 16-17 mm)

Malla de repuesto
t3#:44.9 NBMMBEFBDFSPJOPYJEBCMF

Modelos
t9$;13'7MWVMB%7EF DN
DPOGJMUSP133#:EF DN

FOTBNCMBEB

t9$;'13'WMWVMB%7EFwDPOGJMUSP13EFwZBDDFTPSJPT.%$'
UVCFSBEFNN

*Disponible con roscas BSP

Malla de repuesto
t3#:44.9 NBMMBEFBDFSPJOPYJEBCMF

Malla de
acero
inoxidable

vienen
Ambasadas.
arm

Malla de
acero
inoxidable

CZ-100-PRF

Xerigation

CZF-175-PRF
CZF-100-PRF

Presin de entrada mnima para una presin de salida de 30 psi


Caudal (gpm)
3.0
5.0
10.0
15.0

Presin de entrada (psi)


XCZF-175-PRF
32.7
36.4
56.7
75.5

Presin de entrada mnima para una presin de salida de 2.1 bares


Caudal (l/min)
11.4
18.9
37.9
56.8

194

Presin de entrada (bares)


XCZF-175-PRF
2.3
2.5
3.9
5.2

Presin de entrada mnima para una presin de salida de 40 psi


Caudal (gpm)
3.0
5.0
10.0
15.0

Presin de entrada (psi)


XCZ-100-PRF
42.9
44.1
48.5
55.5

Presin de entrada (psi)


XCZF-100-PRF
40.3
42.1
54.2
68.6

Presin de entrada mnima para una presin de salida de 2.8 bares


Caudal (l/min)
11.4
18.9
37.9
56.8

Presin de entrada (bares)


XCZ-100-PRF
3.0
3.0
3.3
3.8

Presin de entrada (bares)


XCZF-100-PRF
2.8
2.9
3.7
4.7

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

Componentes de control de zona

Kits de control de zona para aplicaciones NUEVO


comerciales pequeas de caudal medio con
filtro canasta y regulacin de presin
Q El kit completo es el kit de control de zona ms simple y confiable para
aplicaciones comerciales de entre 5 y 20 gpm (11 y 76 l/min)

Q Contiene la vlvula PGA confiable, flexible y probada con el resistente filtro


canasta regulador de presin

Presin de entrada mnima para una presin de salida de 40 psi

Caudal (gpm)

Presin de entrada (psi)


XCZ-100-PRB-LC

5.0
10.0
15.0
20.0

43.0
48.0
56.0
65.0

Q Este kit de filtros PR proporciona el control de encendido y apagado, la


filtracin y la regulacin de presin con slo dos piezas, para que haya
menos posibilidades de prdida en las conexiones, en la instalacin y
durante la vida til del sistema

Q La caracterstica antiderrame de la canasta asegura que la suciedad no


caiga de nuevo en el filtro durante la operacin de limpieza. La punta
roscada con junta trica facilita el trabajo de quitar y limpiar la malla de
acero inoxidable

Rango operativo

Presin de entrada mnima para una presin de salida de 2.8 bares

Caudal (l/min)

Presin de entrada (bares)


XCZ-100-PRB-LC

18.9
37.9
56.8
75.7

2.9
3.3
3.8
4.5

t$BVEBMEFBHQN EFBMN

t1SFTJOEFFOUSBEBEFBQTJ EFBCBSFT

t3FHVMBEPSEFQSFTJOQTJ CBSFT

t'JMUSBDJONBMMB NJDSPOFT
EFBDFSPJOPYJEBCMF
t5FNQFSBUVSBIBTUB' $

Modelo
t9$;13#-$WMWVMB1("EF DN
DPOGJMUSPDBOBTUBSFHVMBEPSEF
presin de 1" (2.5 cm) y 40 psi (2.8 bares)

Mallas de filtro de repuesto


t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMF SPKP
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMF WFSEF
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMF CMBODP

Cubierta de repuesto

Xerigation

t#'$"1 $VCJFSUBDPNQMFUBDPOKVOUBUSJDB

Malla de
acero
inoxidable

CZ-100-PRB-LC

El uso inteligente del agua.

195

Xerigation/Riego por goteo


Componentes de control de zona

Kit de control de zona para aplicaciones


comerciales de caudal medio con filtro
canasta regulador de presin

NUEVO

Q El kit completo es el kit de control de zona ms simple y confiable para


aplicaciones comerciales de entre 3 y 20 gpm (11 y 76 l/min)

Q Contiene la confiable y probada vlvula PESB que brinda una accin


de cepillado patentada. Esto hace que el kit sea ideal para aplicaciones
comerciales con agua sucia

Presin de entrada mnima para una presin de salida de 40 psi

Caudal (gpm)
3
5
10
15
20

Presin de entrada (psi)


XCZ-PRB-100-COM
42.0
44.0
47.3
53.0
62.5

Presin de entrada (psi)


XCZ-100-PRBR

45.0
49.0
57.0

Q *ODMVZFFMGJMUSPDBOBTUB2VJDL$IFDLSFHVMBEPSEFQSFTJODPOVOJOEJDBEPS
claro que va del verde al rojo para avisar cundo es necesario limpiar el
filtro. Esto reduce el mantenimiento y ya no habr que adivinar cundo
hay que limpiar el filtro. Adems, la punta roscada facilita el trabajo de
quitar y limpiar la malla de acero inoxidable

Q El filtro canasta y el regulador de presin se han combinado en un filtro


DBOBTUB2VJDL$IFDLSFHVMBEPSEFQSFTJOVONTQFRVFPRVFMB
unidad anterior

Rango operativo
t$BVEBMEFBHQN EFBMN

t1SFTJOEFFOUSBEBEFBQTJ EFBCBSFT

t3FHVMBEPSEFQSFTJOQTJ CBSFT

t'JMUSBDJONBMMB NJDSPOFT
EFBDFSPJOPYJEBCMF
t5FNQFSBUVSBIBTUB' $

Presin de entrada mnima para una presin de salida de 2.8 bares

Caudal (l/min)
11.4
18.9
37.9
56.8
75.7

Presin de entrada (bares)


XCZ-PRB-100-COM
2.9
3.0
3.3
3.6
4.3

Presin de entrada (bares)


XCZ-100-PRBR

3.1
3.4
3.9

Modelos
t9$;13#$0.WMWVMBEFCPMBEF DN
DPOWMWVMB1&4#EF 
DN
ZGJMUSPDBOBTUBSFHVMBEPSEFQSFTJO2VJDL$IFDLEF DN
ZQTJ
(2.8 bares)
t9$;13#3WMWVMB1&4#3EFw DN
ZGJMUSPDBOBTUBSFHVMBEPSEF
presin de 40 psi (2.8 bares)

Malla de repuesto
t2,$),. NBMMBEFBDFSPJOPYJEBCMF

t2,$),. NBMMBEFBDFSPJOPYJEBCMF

t2,$),. NBMMBEFBDFSPJOPYJEBCMF

Cubierta de repuesto
Xerigation

t2,$),$"1 $VCJFSUBDPNQMFUBDPOKVOUBUSJDB

XCZ-100-PRBR

Malla de
acero
inoxidable

CZ-PRB-100-COM

196

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

Componentes de control de zona

NUEVO
Kit de control de zona de caudal alto
para aplicaciones comerciales con 2 filtros
canasta reguladores de presin

Q El kit de control de zona de mayor caudal en el mercado para grandes zonas


comerciales de riego por goteo de 15 a 40 gpm (de 56.8 a 151.4 l/m)

Q $POUJFOFMBDPOGJBCMFZQSPCBEBWMWVMB1&4#EF DN


RVFCSJOEBVOB
accin de cepillado patentada. Esto hace que el kit sea ideal para aplicaciones
comerciales con agua sucia

Q *ODMVZFGJMUSPTDBOBTUB2VJDL$IFDLSFHVMBEPSFTEFQSFTJODPOVOJOEJDBEPS
claro que va del verde al rojo para avisar cundo es necesario limpiar el filtro.
Esto reduce el mantenimiento y ya no habr que adivinar cundo hay que
limpiar el filtro. Adems, la punta roscada facilita el trabajo de quitar y limpiar
la malla de acero inoxidable

Presin de entrada mnima para una presin de salida de 40 psi

Caudal (gpm)

Presin de entrada (psi)


XCZ-PRB-150-COM

15.0
20.0
25.0
30.0
35.0
40.0

40.0
49.0
50.2
53.5
56.1
60.7

Presin de entrada mnima para una presin de salida de 2.8 bares

Q El filtro canasta y el regulador de presin se han combinado en un filtro


DBOBTUB2VJDL$IFDLSFHVMBEPSEFQSFTJOVONTQFRVFPRVFMB
unidad anterior

Rango operativo
t$BVEBMEFBHQN EFBMN

t1SFTJOEFFOUSBEBEFBQTJ EFBCBSFT

t3FHVMBEPSEFQSFTJOQTJ CBSFT

t'JMUSBDJONBMMB NJDSPOFT
EFBDFSPJOPYJEBCMF
t5FNQFSBUVSBIBTUB' $

Caudal (l/min)

Presin de entrada (bares)


XCZ-PRB-150-COM

56.8
75.7
94.7
113.6
132.5
151.4

2.8
3.4
3.5
3.7
3.9
4.2

Modelos
t9$;13#$0.WMWVMB1&4#EF DN
DPOGJMUSPTDBOBTUB2VJDL
Check reguladores de presin de 1" (2.5 cm) y 40 psi (2.8 bares)

Malla de repuesto
t2,$),. NBMMBEFBDFSPJOPYJEBCMF

t2,$),. NBMMBEFBDFSPJOPYJEBCMF

t2,$),. NBMMBEFBDFSPJOPYJEBCMF

Cubierta de repuesto

Malla de
acero
inoxidable
Xerigation

t2,$),$"1 $VCJFSUBDPNQMFUBDPOKVOUBUSJDB

Malla de
acero
inoxidable

CZ-PRB-150-COM

El uso inteligente del agua.

197

Xerigation/Riego por goteo


Componentes de control de zona

Vlvulas de caudal bajo

Caractersticas de prdida de presin:

Vlvulas diseadas exclusivamente para los ndices de caudal bajo


de un sistema de riego por goteo (0.2 a 8 gpm; 0.6 a 30 l/m)
Q Las nicas vlvulas en la industria realizadas especficamente para los
sistemas de riego por goteo, lo cual las convierte en las nicas vlvulas
RVFQVFEFONBOFKBSEFGPSNBFGJDB[MPTOEJDFTEFDBVEBMCBKP%JTFP
patentado

Q Estas vlvulas contienen todas las caractersticas de las confiables vlvulas


%7P"47'EF3BJO#JSE KVOUPDPOVOEJTFPEFEJBGSBHNBOJDPRVF
permite que las partculas circulen a ndices de caudal extremadamente
bajos, y as se evita que la vlvula gotee

Q Permite colocar el filtro de forma segura a corriente descendente de la


vlvula ya que estas vlvulas manejan todos los tamaos de partculas

Caractersticas
1

t%JBGSBHNBOJDPEFiEPCMFDVDIJMMBwDPOBTJFOUPEF /2" (1.3 cm) de dimetro


para lograr un funcionamiento perfecto a bajos ndices de caudal
t-BWMWVMBEFDBVEBMCBKPFTUEJTQPOJCMFFOVONPEFMPFOMOFBEF3/4 (1.9
cm) y la vlvula antisifn de 3/4 (1.9 cm)
t%JTFPEFDBVEBMQJMPUPDPOEPCMFGJMUSBDJOQBSBVOBNYJNBDPOGJBCJMJEBE
t1VSHBFYUFSOBQBSBMJNQJBSFMTJTUFNBNBOVBMNFOUFZRVJUBSMBTQBSUDVMBTEF
suciedad durante la instalacin y la puesta en marcha del sistema
t1VSHBJOUFSOBQBSBVOBPQFSBDJONBOVBMFOTFDP

Caudal
gpm

LFV-075
psi

LFV-100
psi

ASV-LF-075
psi

0.2
1.0
2.0
4.0
6.0
8.0

3.0
3.2
3.3
3.6
4.2
5.1

3.0
3.2
3.3
3.6
4.2
5.1

2.5
3.1
3.7
4.6
5.3
5.7

Caractersticas de prdida de presin

SIST. MTRICO

Caudal
l/m

LFV-075
bares

LFV-100
bares

ASV-LF-075
bares

0.6
3.6
7.8
15.0
22.8
30.0

0.21
0.22
0.23
0.25
0.28
0.35

0.21
0.22
0.23
0.25
0.28
0.35

0.17
0.22
0.27
0.31
0.35
0.39

Rango operativo
t$BVEBMEFBHQN EFBMN

t1SFTJOEFBQTJ EFBCBSFT

Especificaciones elctricas
t4PMFOPJEFEF7$"B)[ DJDMPTTFH

t$PSSJFOUFEFFOUSBEB 7"
B)[
t$PSSJFOUFEFSFUFODJO" 7"

Modelos
t-'77MWVMB%7EFDBVEBMCBKPEF34" (20 mm)

t-'7 WMWVMB%7EFDBVEBMCBKPEF DN

ASV-LF-075

Xerigation

t"47-'7MWVMBBOUJTJGOEFDBVEBMCBKPEF34" (20 mm)


*Disponible con roscas BSP

Diafragma de repuesto
t-'7%*"1)3.QJF[BEFSFQVFTUPEFM
diafragma de la vlvula de caudal bajo

Diseo de diafragma nico


LFV-075

198

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

Componentes de control de zona

Filtro regulador de presin (RBY)


La exclusiva unidad compacta que combina filtracin y regulacin
de presin en una pieza para la proteccin de los componentes de
corriente descendente en los sistemas de riego por goteo
Q Reduce la cantidad de componentes en una zona de control. As, es ms
pequea y ms fcil de instalar. Se pueden adaptar ms zonas de control
a una caja de vlvulas

Q La unidad de combinacin reduce la cantidad de conexiones, lo cual hace


que la instalacin sea ms sencilla y rpida

Q Mayor confiabilidad: menos piezas y menos conexiones roscadas para


que haya menos posibilidades de que se produzca una prdida en la
instalacin y durante la vida til del sistema

Caractersticas de prdida de presin:


Caudal
gpm

PRF-075-RBY
psi

PRF-100-RBY
psi



3.0
5.0






6.1
10.0
/%
/%
/%

/%
/%
0.8
2.0




Caractersticas de prdida de presin:

SIST. MTRICO

Caractersticas
t&MGJMUSPFTUUJDP3#:SFHVMBMBQSFTJOBVOBOPNJOBMEFQTJ 
bares)
-BDVCJFSUBEFMGJMUSP133#:UJFOFVOFNQBMNFEFKVOUBUSJDBZTF
desenrosca para proporcionar acceso al filtro, a fin de facilitar la limpieza
t&MSFHVMBEPSEFQSFTJOEFQTJ CBSFT
FTUJOUFHSBEPFOFM
cuerpo del filtro
t&MDVFSQPSFTJTUFOUFZMBDVCJFSUBFTUOIFDIPTEFQPMJQSPQJMFOPDPOGJCSBEF
vidrio y brindan un ndice de presin de 150 psi (10.3 bares)
t'VODJPOBDPOUPEBTMBTWMWVMBTQBSBDSFBSVOB[POBEFDPOUSPMTJNQMFZ
eficiente

Caudal
l/m

PRF-075-RBY
bares

PRF-100-RBY
bares



11.4
18.9






0.42
0.69
/%
/%
/%

/%
/%
0.06
0.14




Nota: prdida de presin correspondiente a un filtro de malla 200

t7JFOFQSFFOTBNCMBEPDPOVOGJMUSPEFNBMMBEFBDFSPJOPYJEBCMF 
micrones) (los elementos de repuesto del filtro estn disponibles slo para el
GJMUSP3#:

Rango operativo
t$BVEBM
- unidades de 34" (14.6 cm): de 0.20 a 5 GPM (de 0.8 a 18.9 l/m)

Malla de
acero
inoxidable

- unidades de 1" (2.5 cm): de 3 a 15 GPM (de 11.4 a 56.8 l/m)


t1SFTJOEFFOUSBEBEFBQTJ EFBCBSFT

t1SFTJOSFHVMBEB
- unidades de 34" (14.6 cm): 30 psi (2.1 bares)
Xerigation

- unidades de 1" (2.5 cm): 40 psi (2.8 bares)


t'JMUSBDJONBMMB NJDSPOFT

Modelos
t13'3#:'133#:EF3/4" (20 mm)
t13'3#:GJMUSP133#:EF DN

*Disponible con roscas BSP

Malla de repuesto
t3#:44.9 NBMMBEFBDFSPJOPYJEBCMF

El uso inteligente del agua.

RF-075-RBY y PRF-100-RBY

Componentes
de los kits de
control de zona
en las pginas
192-198

199

Xerigation/Riego por goteo


Componentes de control de zona

Filtro RBY en lnea

Caractersticas de prdida de presin:

El filtro esttico ayuda a evitar las obstrucciones en un sistema de


riego por goteo
Q Un filtro simple y confiable para los sistemas de riego por goteo
Q 'DJMEFMJNQJBS ZBRVFMBDVCJFSUBUJFOFVOFNQBMNFEFKVOUBUSJDBZTF
desenrosca para proporcionar acceso al filtro

Q 'VFSUFZDPOGJBCMFEFCJEPBTVEJTFPSFTJTUFOUFZFTUSVDUVSBEF
polipropileno con fibra de vidrio

Caractersticas
t$POFYJPOFTEFSPTDBNBDIPYNBDIPQBSBDPOFDUBSEJSFDUBNFOUFDPOMBT
vlvulas y los reguladores de presin
t-PTFMFNFOUPTEFSFQVFTUPEFMGJMUSPFTUOEJTQPOJCMFFOVOBNBMMB
(75 micrones)

ndice de caudal
gpm

RBY075MPTX
psi

RBY100MPTX
psi

1.00
3.00
5.0
7.0
9.0
12.0
14.0
16.0
18.0

0.1
0.4
1.1
1.6
2.7
4.5
----

0.1
0.3
0.5
0.8
1.4
2.2
3.0
3.8
4.7

Caractersticas de prdida de presin:

SIST. MTRICO

Rango operativo
t$BVEBM
- unidades de 34" (14.6 cm): de 0.20 a 12.0 gpm (de 0.8 a 45.4 l/m)
- unidades de 1" (2.5 cm): de 0.20 a 18 gpm (de 0.8 a 68.1 l/m)
t1SFTJOEFBQTJ EFBCBSFT

t'JMUSBDJONBMMB NJDSPOFT

Modelos
t3#:.159GJMUSP3#:FOMOFBEF3/4" (20 mm) con malla 200:
t3#:.159GJMUSP3#:FOMOFBEFw DN
DPONBMMB

* Disponible con roscas BSP


Malla de repuesto:
t3#:44.9 NBMMBEFBDFSPJOPYJEBCMF


ndice de caudal
l/m

RBY075MPTX
bares

RBY100MPTX
bares

0.8
3.8
11.4
18.9
26.5
34.1
45.4
53.0
60.6
68.1

0.00
0.01
0.03
0.08
0.11
0.19
0.31
----

0.00
0.01
0.02
0.03
0.06
0.10
0.15
0.21
0.26
0.32

Nota: prdida de presin correspondiente a un filtro de malla 200

Xerigation

RBY075MPTX

200

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

Componentes de control de zona

Filtro canasta Quick Check

Caractersticas de prdida de presin - QKCHK-075

El nico filtro de uso comercial con un indicador de sucio o limpio


para las zonas de riego por goteo
Q Reduce el mantenimiento y los costos de mano de obra: el indicador le
avisa cundo se debe limpiar el filtro, sin tener que adivinar cul es el
momento de hacerlo

Q Brinda mayor confiabilidad: la caracterstica antiderrame asegura que la


suciedad no caiga de nuevo en el filtro durante la operacin de limpieza

Q Simplifica la instalacin y el mantenimiento: la parte superior roscada con


empalme de junta trica hace que sea fcil quitar y limpiar la malla

ndice de caudal
gpm

filtro de malla 200/150 psi


psi

0.20
2.00
4.00
6.0
8.0
10.0
12.0

0.0
0.0
0.1
0.4
0.9
1.3
2.0

Caractersticas

Caractersticas de prdida de presin - QKCHK-075 SIST. MTRICO

t%JTQPOJCMFFONPEFMPTEF3/4" (1.9 cm) y 1" (2.5 cm)


t7JFOFQSFFOTBNCMBEPDPOVOGJMUSPEFNBMMB NJDSPOFT
EFBDFSP
inoxidable (tambin hay otros tamaos disponibles)
t5BNCJOEJTQPOJCMFFOLJUTEFDPOUSPMEF[POBEFBQMJDBDJODPNFSDJBM 9$;
13#$0.Z9$;13#$0.

ndice de caudal
l/m

malla 75/100 micrones


bares

0.8
7.6
15.1
22.7
30.3
37.9
45.4

0.00
0.00
0.01
0.03
0.06
0.09
0.14

Rango operativo
t$BVEBM
- filtro canasta de 3/4" (20 mm): de 0.20 a 12.0 gpm (de 0.8 a 45.4 l/m)
  'JMUSPDBOBTUBEF DN
EFBHQN EFBMN

t1SFTJOEFBQTJ EFBCBSFT

Modelos

*Disponible con roscas BSP

Mallas de filtro de repuesto


t2,$),.GJMUSPEFNBMMB SPKP
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMF CMBODP

Cubierta de repuesto
t2,$),$"1 $VCJFSUBDPNQMFUBDPOKVOUBUSJDB

Caractersticas de prdida de presin - QKCHK-100


ndice de caudal
gpm

filtro de malla 200/150 psi


psi

3.0
5.0
7.0
9.0
11.0
14.0
17.0
20.0

0.0
0.0
0.4
0.7
1.1
1.6
2.3
3.2

Xerigation

t2,$),GJMUSPDBOBTUBEF3/4" (20 mm) con malla 200:


t2,$), GJMUSPDBOBTUBEF DN
DPONBMMBEFBDFSPJOPYJEBCMF

Caractersticas de prdida de presin - QKCHK-100 SIST. MTRICO

Malla de
acero
inoxidable

ndice de caudal
l/m

malla 75/100 micrones


bares

11.4
18.9
26.5
34.1
41.6
53.0
64.4
75.7

0.01
0.01
0.03
0.05
0.08
0.11
0.16
0.22

Nota: prdida de presin correspondiente a un filtro de malla 200

KCHK-075

El uso inteligente del agua.

201

Xerigation/Riego por goteo


Componentes de control de zona

Filtros canasta reguladores de presin

NUEVO

Presin de entrada mnima para una presin de salida de 40 psi

El nico filtro de uso comercial con regulador de presin


incorporado para las zonas de riego por goteo
Q Reduce el mantenimiento y los costos de mano de obra: su superficie
es un 40% ms grande que la de los filtros estndar, lo cual implica una
menor frecuencia de limpieza

Q Brinda mayor confiabilidad: la caracterstica antiderrame asegura que la


suciedad no caiga de nuevo en el filtro durante la operacin de limpieza

Caudal (gpm)

Presin de entrada (psi)


PRB-100

3.0
5.0
10.0
15.0
20.0

40.0
40.0
42.6
48.2
60.0

Q Simplifica la instalacin y el mantenimiento: la parte superior roscada con


empalme de junta trica hace que sea fcil quitar y limpiar la malla de
acero inoxidable

Presin de entrada mnima para una presin de salida de 2.8 bares

Q %JTFPFGJDJFOUFDPNCJOBGJMUSBDJOZSFHVMBDJOFOVOBTPMBVOJEBE
Caudal (l/min)

Presin de entrada (bares)


PRB-100

11.4
18.9
37.9
56.8
75.7

2.8
2.8
2.9
3.3
4.1

compacta con menos conexiones

Caractersticas
t%JTQPOJCMFFOFMNPEFMPEF DN

t7JFOFQSFFOTBNCMBEPDPOVOGJMUSPEFNBMMB NJDSPOFT
EFBDFSP
inoxidable (tambin hay otros tamaos disponibles)
t3FHVMBEPSEFQSFTJOJODPSQPSBEPEFQTJ CBSFT

t5BNCJOFTUEJTQPOJCMFFOMPTLJUTEFDPOUSPMEF[POBQBSBBQMJDBDJPOFT
DPNFSDJBMFTMJWJBOBT 9$;13#-$

Rango operativo
t$BVEBMEFBHQN EFBMN

t1SFTJOEFFOUSBEBEFBQTJ EFBCBSFT

t3FHVMBEPSEFQSFTJOQTJ CBSFT

t'JMUSBDJONBMMB NJDSPOFT
EFBDFSPJOPYJEBCMF
t5FNQFSBUVSBIBTUB' $

Modelos
t13#GJMUSPDBOBTUBEF DN
DPOSFHVMBEPSEF
presin incorporado (40 psi) y malla 200 (75 micrones)
de acero inoxidable

Componentes
de los kits de
control de zona
en las pginas
192-198

Malla de
acero
inoxidable

Mallas de filtro de repuesto

Xerigation

t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMF SPKP
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMF WFSEF
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMF CMBODP

Cubierta de repuesto
t#'$"1 $VCJFSUBDPNQMFUBDPOKVOUBUSJDB

PRB-100

BFCAP

202

El uso inteligente del agua.

Xerigation/Riego por goteo

www.rainbird.com/drip

Componentes de control de zona

Filtros canasta Quick-Check


reguladores de presin

NUEVO

El nico filtro comercial con regulador de presin incorporado e


indicador de sucio o limpio para las zonas de riego por goteo
Q Reduce el mantenimiento y los costos de mano de obra: el indicador le
avisa cundo se debe limpiar el filtro, sin tener que adivinar cul es el
momento de hacerlo

Q Brinda mayor confiabilidad: la caracterstica antiderrame asegura que la

Presin de entrada mnima para una presin de salida de 40 psi

Caudal (gpm)

Presin de entrada (psi)


PRB-QKCHK-100

3.0
5.0
10.0
15.0
20.0

40.0
40.0
42.6
48.2
56.4

suciedad no caiga de nuevo en el filtro durante la operacin de limpieza

Q Simplifica la instalacin y el mantenimiento: la parte superior roscada con


empalme de junta trica hace que sea fcil quitar y limpiar la malla de
acero inoxidable

Q %JTFPFGJDJFOUFDPNCJOBGJMUSBDJOZSFHVMBDJOFOVOBTPMBVOJEBE
compacta con menos conexiones

Caractersticas
t%JTQPOJCMFFOFMNPEFMPEF DN

t7JFOFQSFFOTBNCMBEPDPOVOGJMUSPEFNBMMB NJDSPOFT
EFBDFSP
inoxidable (tambin hay otros tamaos disponibles)
t3FHVMBEPSEFQSFTJOJODPSQPSBEPEFQTJ CBSFT

t5BNCJOEJTQPOJCMFFOLJUTEFDPOUSPMEF[POBEFBQMJDBDJODPNFSDJBM 9$;
13#$0.Z9$;13#$0.

Presin de entrada mnima para una presin de salida de 2.8 bares

Caudal (l/min)

Presin de entrada (bares)


PRB-QKCHK-100

11.4
18.9
37.9
56.8
75.7

2.8
2.8
2.9
3.3
3.9

Rango operativo
t$BVEBMEFBHQN EFBMN

t1SFTJOEFFOUSBEBEFBQTJ EFBCBSFT

t3FHVMBEPSEFQSFTJOQTJ CBSFT

t'JMUSBDJONBMMB NJDSPOFT
EFBDFSPJOPYJEBCMF
t5FNQFSBUVSBIBTUB' $

Componentes
de los kits de
control de zona
en las pginas
192-198

Modelos
t13#2,$),GJMUSPDBOBTUBEF DN
DPOSFHVMBEPSEFQSFTJO
incorporado (40 psi) y malla 200 (75 micrones) de acero inoxidable

t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMF SPKP
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMF WFSEF
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMF CMBODP

Xerigation

Malla de
acero
inoxidable

Mallas de filtro de repuesto

Cubierta de repuesto
t2,$),$"1 $VCJFSUBDPNQMFUBDPOKVOUBUSJDB

RB-QKCHK-100

El uso inteligente del agua.

203

Xerigation/Riego por goteo


Componentes de control de zona

Reguladores de presin en lnea

Regulador de presin de retroadaptacin

Caractersticas

Caractersticas

t4FQVFEFJOTUBMBSQPSFODJNBPQPSEFCBKPEFMOJWFMEFUFSSFOP
t1SFTJPOFTEFTBMJEBQSFFTUBCMFDJEBTQTJ CBSFT
ZQTJ CBSFT

t&OUSBEBZTBMJEBIFNCSBSPTDBEBDPONBDIPEFSPTDBQBSBUVCFSBTEF34"
(1.9 cm) o 1" (2.5 cm)

t1SPQPSDJPOBVOBDPOWFOJFOUFSFHVMBDJOEFQSFTJOEFQTJ CBSFT

en la tubera de elevacin para cualquier dispositivo de emisin con rosca
hembra para tubera de 1/2 (1.3 cm) o adaptador de compresin
t4FQVFEFJOTUBMBSQPSFODJNBPQPSEFCBKPEFMOJWFMEFUFSSFOP
t4FQVFEFVTBSDPOFMEJTQPTJUJWPEFFNJTJOEFTBMJEBTNMUJQMFT9FSJ#JSE 8
(consulte la pg. 167)

Rango operativo
t$BVEBM
- PSI-L30X-075: de 0.10 a 5 gpm; de 6 a 300 gph (de 0.4 a 18.9 l/m)
- PSI-M30X-075, psi-M40X-075: de 2 a 10 gpm; de 120 a 600 gph
(de 7.8 a 37.9 l/m)
- PSI-M40X-100: de 2 a 20 gpm; de 120 a 900 gph (de 7.8 a 56.8 l/m)
t1SFTJOEFFOUSBEBEFBQTJ EFBCBSFT

Modelos
t14*-X-075: regulador de 3/4" (1.9 cm), 30 psi (2.1 bares) para caudal
bajo (etiqueta roja)
t14*.X-075: regulador de 3/4" (1.9 cm), 30 psi (2.1 bares) para caudal
bajo (etiqueta roja)
t14*.9-075: regulador de 3/4" (1.9 cm), 40 psi (2.8 bares) para caudal
bajo (etiqueta roja)
t14*.40X-100: regulador de 1" (2.5 cm) y 40 psi (2.8 bares) para caudal
medio

Rango operativo
t$BVEBMEFBHQNEFBHQI EFBMN

t1SFTJOEFFOUSBEBEFBQTJ EFBCBSFT

Dimensiones
t&OUSBEBIFNCSBSPTDBEBEF1/2 (1.3 cm)
t"MUVSB DN

Modelo
t134

Xerigation

PSI-L30X-075, PSI-M40X-075, PSI-M40X-100

204

PRS-050-30

El uso inteligente del agua.

Bombas

Xerigation

Sistemas de control
centralizado

Programadores

Accesorios

Vlvulas

Impactos

Rotores

Boquillas aspersoras

Cuerpos de
aspersores

Introduccin

Cuerpos de difusores
Estaciones de bombeo

Sugerencias para ahorrar agua

Las estaciones de bombeo de


transmisin de frecuencia variable
7'%
EF3BJO#JSEBIPSSBOFOFSHB
y al mismo tiempo brindan la
presin de agua necesaria para
garantizar la mxima eficiencia en
el uso del agua.

Rain Bird disea estaciones de bombeo


especficamente para cada aplicacin, lo cual
garantiza que la bomba funcione en su mxima
eficiencia. Al brindar la presin adecuada
requerida por el sistema, garantiza un sistema de
riego eficiente y efectivo. Para obtener asistencia,
llame al 520-806-5620 o enve un mensaje de
DPSSFPFMFDUSOJDPBQVNQT!SBJOCJSEDPN

Drenaje

Recursos

Los motores ms nuevos de alta


eficiencia son capaces de
convertir un mayor porcentaje
del suministro elctrico en
trabajo mecnico til, lo que
permite ahorrar costos y energa.

Referencia

El uso inteligente del agua.

205

Estaciones de bombeo
Serie LC

Serie LC de Rain Bird

NUEVO

Especificaciones elctricas

EFBIQIBTUBQTJ CBSFT
IBTUBHQN EFN /h)

t Energa monofsica, 60 Hz: 208 V, 230 V

Q Revolucionario paquete completo de bomba que incluye una bomba


de nivel profesional, proteccin de la ms alta calidad para la bomba y
accesorios de fcil instalacin y uso, todo en una caja nica diseada
especialmente para una bomba

Aplicaciones

t Incremento o amplificacin de la succin


t Suministro de agua potable o reciclada
t Para uso residencial, comercial liviano, recreativo o para parques

Q #PNCBEFVTPQFTBEPEJTQPOJCMFFO    ZIQDPOJNQVMTPSFT
de latn, caja de hierro fundido, pernos y postes de acero inoxidable para
resistir la presin, medidor de temperatura e imprimacin
Q 1SPUFDDJOEFBQBHBEP143151SPQPSDJPOBQSPUFDDJOTJMBCPNCB
experimenta prdida de presin o situaciones de alta temperatura. El
14315FTUVCJDBEPFOVOBDBKBEFBDFSPSFDVCJFSUPEFQJOUVSBFOQPMWP
Q Caja con pintura en polvo estticamente agradable. Con una caja para
seguridad y proteccin contra el vandalismo para la bomba y los controles

Caractersticas
t Caja con apertura de concha de acero inoxidable pintada con pintura en
polvo. Ofrece completa accesibilidad a la bomba y a los controles elctricos
t El acoplamiento de rpida desconexin en caso de descarga y succin
proporciona conexiones simples de encendido-apagado para acelerar los
procesos de conexin y preparacin para el invierno

Capacidad de gpm US en base a un incremento de succin de 5 pies

HP

Descarga en psi
35 40 45

20

25

30

50

55

60

73

65

57

47

35

18

1.5

75

70

68

60

48

35

102

98

92

82

74

61

52

40

115

114 112 105 100

88

72

56

30

t Rejillas de enfriamiento que proporcionan suficiente aire para evitar que el


motor y la bomba se sobrecalienten
t El adaptador de 1.5 y el recipiente de drenaje de PVC descargan la lnea a
travs de la parte inferior de la caja, lo cual es un seguro contra robo
t Opcin de descarga a travs de la parte inferior o lateral de la caja
t Cable flexible de energa de rpida desconexin que brinda seguridad a la
bomba
t Conector principal de corriente de 230 V
t Candado de seguridad

Curvas de rendimiento de las bombas de la Serie LC


Bombas

Serie LC

206

El uso inteligente del agua.

Estaciones de bombeo

www.rainbird.com/pumps

Estacin de bombeo de perfil bajo (LP)

Estacin de bombeo de perfil bajo (LP)


de 5, 7.5 y 10 hp; hasta 120 psi (8.2 bares); hasta 235 gpm (53 m3/h)

Q "IPSSPEFFOFSHBMBUSBOTNJTJOEFGSFDVFODJBWBSJBCMF 7'%
NBOUJFOFMB
presin constante ante una demanda de caudal variable.

Q 3FOUBCMFFMTJTUFNBEFCPNCFPBDDJPOBEPQPS7'%CSJOEBVOBMUP
rendimiento con mnima inversin.

Q Perfil bajo: caja de aluminio compacto de calidad naval con tuberas y


patn recubiertos de pintura en polvo.

Q Confiabilidad: diseo estndar simple, fcil instalacin y mantenimiento.


Caractersticas
t Bombas de succin final horizontal (5; 7.5; y 10 hp)
t Caja de aluminio compacto de calidad naval
t Caja NEMA 3R separada para controles elctricos
t 5VCFSBTEFBDFSPFOUPEPFMTJTUFNBDPOQFTUBBPBDPQMBNJFOUPTEF7JDUBVMJD
t Recubrimiento de pintura en polvo resistente a la corrosin en los patines, las
tuberas y las pestaas
t Rel de arranque de bombas o arranque a presin opcional
t 5SBOTNJTJOEFGSFDVFODJBWBSJBCMF 7'%
QBSBVOBNYJNBFGJDJFODJB
t 1BOUBMMBUDUJMDPOUFYUP(5QBSBFMPQFSBEPS

Estacin de bombeo de perfil bajo (LP)


con caja NEMA 3R

t Proteccin de motor con disyuntor


t Proteccin contra descargas
t Interruptor trmico de la bomba para el apagado de seguridad
t Enfriamiento por ventilador y boca de entrada de aire
t Manmetros de entrada y salida rellenos con glicerina
t Interruptor de caudal
t Maneral de bypass de la bomba

Opciones
t Paquete ambiental: aislamiento y calentador
t Montaje de la malla de entrada y la vlvula de pie: Para aplicaciones de
succin /compresin negativa

Especificaciones elctricas
t Energa trifsica, 60 Hz: 208V, 230V, 460V
t Energa monofsica, 60 Hz: 208 V, 230 V

Interior de la estacin de bombeo de


perfil bajo (LP)

Aplicacin
Bombas

t Escoja la estacin de bombeo de perfil bajo para aplicaciones de


amplificacin de presin pequea a mediana, compresin positiva y succin/
impulso tales como parques y edificios urbanos, campos deportivos, edificios
comerciales, asociaciones pequeas de propietarios y sitios residenciales
grandes.

35"

38"
53"

El uso inteligente del agua.

207

Estaciones de bombeo
&TUBDJPOFTEFCPNCFP4FSJF% %1Z%19

Estaciones de bombeo Serie "D"


Estaciones de bombeo Serie D, DP y DPX
Caudales de hasta 300 gpm (68 m3/h) y mayor, presin de descarga de
hasta 150 psi (10.3 bares)

Q Confiabilidad: las estaciones de conexin integrada de bomba (hasta


300 gpm) brindan responsabilidad de fuente nica para todo el sistema
de bombeo, lo cual garantiza una instalacin y un funcionamiento sin
complicaciones

Q Compre sin problemas: adquiera todos los componentes del sistema de


SJFHPFOMBTJOTUBMBDJPOFT3BJO#JSEEF5VDTPO "SJ[POB

Q %FGDJMBSSBORVFTFSFBMJ[BOQSVFCBTEFIVNFEBEBUPEBTMBTFTUBDJPOFT

Especificaciones elctricas
t Energa trifsica, 60 Hz: 208 V, 230 V, 460 V, 575 V
t Energa trifsica, 50 Hz: 190 V, 380 V, 415 V
t Energa monofsica, 60 Hz: 208 V, 230 V (hasta 10 hp por bomba)
Nota:$POTVMUFMB(VBEFFTQFDJGJDBDJOEFFTUBDJPOFTEFCPNCFPQBSBCPNCBTEF
perfil bajo y de la serie D" en la pgina 233

Caractersticas de la Serie D
t El sistema de bombeo accionado por una bomba nica ofrece un buen
rendimiento, prctico y funcional, a un precio conveniente

Aplicaciones de la Serie D

Caractersticas

t Cualquier aplicacin de riego de compresin positiva, de aumento de presin


y de succin/impulso requiere una estacin de bombeo confiable, prctica y
funcional, que proporcione la presin y el ndice de caudal necesarios para el
sistema de riego

t Bomba vertical de mltiples fases para aplicaciones de compresin positiva o


aumento de presin

Caractersticas de la Serie DP

previo al envo

t Bomba de succin extrema horizontal para aplicaciones de compresin


positiva, aumento de presin o de succin/impulso
t5SBOTNJTJOEFGSFDVFODJBWBSJBCMF 7'%
QBSBVOBNYJNBFGJDJFODJBEF
energa
t La interfaz de operador con pantalla tctil con luz de fondo monocromtica
facilita el entrenamiento para el operador
t El reinicio automtico para cortes de energa garantiza un funcionamiento
fluido en caso de corte o recuperacin de la energa elctrica
t Caja resistente al vandalismo en colores verde csped PGS8-C0651
PIBCBOPPTDVSP'4

t El controlador lgico programable (PLC), adems de controlar la presin y


el caudal, cuenta con otras caractersticas, como controles de nivel de lagos,
filtracin de accin automtica y la capacidad de modificar los puntos de
configuracin de la presin basados en el tiempo (parmetros variables de
presin)

Aplicacin de la Serie DP
t Cualquier aplicacin de riego de compresin positiva, de aumento de presin
y de succin/impulso de hasta 300 gpm, con una presin de hasta 150 psi
(10.34 bares) que requiere controles lgicos programables

Opciones
t Paquete ambiental: aislamiento y calentador
t Alarma sonora y visual
t Vlvula de alivio de presin (PRV)
t 5VCFSBTFO;
t5BORVFEFFYQBOTJOFJOUFSSVQUPSEFDBVEBMTJMBTFBMEFBSSBORVFEFMB
bomba no est disponible
t Vlvula de pie: para aplicaciones de succin/impulso

Serie D

t Maneral de bypass de la bomba


t Medidor del caudal: entrada/descarga a travs de la pared de la caja solo si
est seleccionado el medidor del caudal

Bombas

Serie DP

208

El uso inteligente del agua.

Estaciones de bombeo

www.rainbird.com/pumps

&TUBDJPOFTEFCPNCFP4FSJF% %1Z%19

Caractersticas de la Serie DPX


t Integracin fluida del sistema con software de SiteControl de Rain Bird
(requiere pantalla tctil a todo color, opcional)
t El panel elctrico enfriado por lquido NEMA 3R garantiza confiabilidad y
duracin en los climas clidos
t El controlador lgico programable (PLC), adems de controlar la presin y
el caudal, cuenta con otras caractersticas, como controles de nivel de lagos,
filtracin de accin automtica y puntos de configuracin de la presin
basados en el tiempo (parmetros variables de presin)

Caractersticas de la bomba Serie D


SE
SE
NO SE
REQUIERE REQUIERE REQUIERE
PLC
PLC
PLC
DPX
DP
D

Artculo
Emisin confiable de la presin y el caudal
requeridos

Monitoreo remoto del bombeo


(utilice el administrador de bomba)

Aplicaciones de bombas mltiples

Controles de nivel de lagos

Presin o caudal (parmetros mx. o mn.)

Opcin de pantalla tctil a todo color

Controles de filtracin

Malla de entrada de limpieza automtica

Comunicacin entre la estacin de bombeo


y el sistema de control centralizado

t Cuando desee obtener comunicacin entre la estacin de bombeo y el


sistema SiteControl de Rain Bird

Intercambiador de calor en climas ms


clidos

Opciones de la Serie DPX

Control lgico programable (PLC)

t Pantalla tctil para el operador a todo color con pantallas en ingls y en


espaol. Esta opcin es necesaria para obtener comunicacin entre la estacin
de bombeo y la computadora del sistema de control centralizado

Interruptor de seguridad trmica


de la bomba

t Seleccin de pantalla tctil a todo color y opciones de mdem que brindan


comunicacin entre la estacin de bombeo y la computadora del sistema de
control centralizado
t El reinicio automtico para cortes de energa garantiza un funcionamiento
fluido en caso de corte o recuperacin de la energa elctrica

Aplicacin de la Serie DPX


t Aplicaciones de riego de compresin positiva, de aumento de presin y de
succin/impulso en clima clido de hasta 300 gpm, con una presin de hasta
150 psi (10.34 bares) que requiere una tecnologa electrnica enfriada por
lquido

t Mdems de comunicacin por radio o conexin por cable


t 1SPUFDUPSFOi:wPEFGJMUSBDJODPOMJNQJF[BBVUPNUJDB
t Malla de entrada de limpieza automtica
t t3FMEFBSSBORVFEFCPNCBT
t5VCFSBFOi;w
t Controles de nivel de lagos
t Bypass de la bomba
t Paquete ambiental: aislamiento y calentador
t Ensamble de succin/impulso

Bombas

Pantalla tctil a color


(opcional en las series D, DP y DPX)

Serie DPX

El uso inteligente del agua.

Bomba de estacin de succin


extrema horizontal

209

Estaciones de bombeo
Estaciones de bombeo de flujo intermedio

Estaciones de bombeo de caudal intermedio


Caudales de hasta 750 gpm (170 m3/h) y mayor, presiones de descarga de
hasta 120 psi (8.2 bares)

Q 'VODJPOBCJMJEBENFKPSBEBEJTFPFMDUSJDPZNPEFSOPRVFVUJMJ[BVOB
proteccin de motor con interruptor industrial en lugar de -fusibles, que
son una prdida de tiempo. Los cortacircuitos industriales se restablecen
rpidamente y estn diseados para una duracin prolongada

Q 'DJMFOUSFOBNJFOUPQBSBFMPQFSBEPSQBOUBMMBUDUJMEFGDJMOBWFHBDJO
Q Costo reducido: el recubrimiento de pintura en polvo le otorga un ndice
QFSGFDUPFOMBQSVFCBTEFDPSSPTJOEF"45..FOPSDPSSPTJORVF
equivale a una mayor duracin de la tubera, el patn y el maneral, lo cual
permite reducir los costos.

Caractersticas
t 5PEPMPRVFOFDFTJUBQBSBMBDPOTUSVDDJOPSFOPWBDJOEFTVTJTUFNBEFSJFHP
del nico fabricante dedicado al riego durante ocho dcadas
t %FGDJMJOTUBMBDJOZBSSBORVF
t Proteccin contra funcionamiento en seco sin caudal e interruptor trmico

Aplicacin
Proyectos medianos a grandes, como parques, transferencia de lagos, campos
deportivos, viveros, granjas de csped y otros proyectos agrcolas y de
recreacin

Pantalla tctil de estaciones


de bombeo de caudal
intermedio (opcional)

Opciones
t Enfriamiento de paneles elctricos con aire acondicionado
t Cajas: aluminio, acero pintado (colores especificados por el gobierno)
t Pantalla tctil a todo color en varios idiomas
t Medidor de caudal magntico
t Comunicacin va Ethernet, radio o conexin por cable
t Motor enfriado por ventilador completamente cubierto (5&'$)
t 1SPUFDUPSFO:DPOSFUSPMBWBEPBVUPNUJDP
t 5VCFSBEFEFTDBSHBFO;
t Configuraciones para mltiples bombas disponibles

Especificaciones elctricas
t Energa trifsica, 60 Hz:208 V, 230 V (hasta 60 hp por bomba), 460 V, 575 V
t Energa trifsica, 50 Hz: 190 V (hasta 60 hp por bomba), 380 V, 415 V
t Energa monofsica, 60 Hz: 208 V, 230 V (hasta 30 hp por bomba)
Bombas

Estacin de bombeo de caudal


intermedio

210

El uso inteligente del agua.

Estaciones de bombeo

www.rainbird.com/pumps

Estaciones de bombeo de riego principal

Estaciones de bombeo principales

Opciones

Caudales de hasta 10,000 gpm (2271 m3/h) y mayor, de hasta 150 psi
(10.3 bares)

t Sistema de enfriamiento de paneles elctricos con aire acondicionado

Q 'VODJPOBCJMJEBENFKPSBEBEJTFPFMDUSJDPZNPEFSOPRVFVUJMJ[BVOB

t Cajas: aluminio, acero pintado (colores especificados por el gobierno)

t Controles personalizados
t 5VCFSBTZNBOFSBMFTQFSTPOBMJ[BEPT

proteccin de motor con interruptor industrial en lugar de -fusibles, que


son una prdida de tiempo. Los cortacircuitos industriales se restablecen
rpidamente y estn diseados para una duracin prolongada

Q Reduccin del tiempo de inactividad: diseo elctrico y moderno que


utiliza una proteccin de motor con cortocircuito industrial en lugar de
fusibles, que son una prdida de tiempo. Los cortacircuitos industriales son
buenos para una variedad de dispositivos interruptores

Q 'DJMDBQBDJUBDJOQBSBFMPQFSBEPSQBOUBMMBUDUJMBDPMPS FOWBSJPTJEJPNBT 
fcil de aprender a usar

t Aspersores de descarga fabricados


t Sistemas de fertirrigacin
t 'JMUSBDJOGJMUSPTEFNBMMBDPOSFUSPMBWBEPZGJMUSPTDPOFTDOFSEFTVDDJO
(hidrulicos o elctricos)
t $BMFOUBEPS NPOUBEPFOQBUO ,8

t Pantalla de caja de entrada con 3 mallas de acero inoxidable


t Control de nivel de lagos: interruptor flotante y sensor de nivel de lagos
sumergible
t Medidor de caudal magntico
t Comunicacin va Ethernet, radio o conexin por cable

Caractersticas
t Costo reducido: el recubrimiento de pintura en polvo le otorga el ndice
NTBMUPFOMBQSVFCBTEFDPSSPTJOEF"45..FOPSDPSSPTJORVFFRVJWBMFB
una mayor duracin de la tubera, el patn y el maneral, lo cual permite reducir
los costos.

t ;POBTEFQPUFODJB  P,7"
t .PUPSFTFOGSJBEPTQPSWFOUJMBEPSDPNQMFUBNFOUFDVCJFSUPT 5&'$

t 1SPUFDUPSFO:DPOSFUSPMBWBEPBVUPNUJDP
t 5VCFSBEFEFTDBSHBFO;

t Compre-sin problemas: todo lo que necesita para la construccin o


renovacin de su sistema de riego del nico fabricante dedicado al riego

t 5VCFSB)%1&

t Comunicacin en tiempo real entre la estacin de bombeo y


el sistema de control centralizado de Rain Bird

t Energa trifsica, 60 Hz: 208 V, 230 V (hasta 60 hp por bomba), 460 V, 575 V

Especificaciones elctricas
t Energa trifsica, 50 Hz: 190 V (hasta 60 hp por bomba), 380 V, 415 V

Aplicacin

t Energa monofsica, 60 Hz: 230 V (hasta 30 hp por bomba)

Estaciones de bombeo con transmisin de frecuencia variable confiables


diseadas para actuar como la estacin de bombeo de riego principal para
grandes proyectos y sitios comerciales. Los sistemas de bombeo de Rain Bird
estn diseados para los proyectos de construccin nuevos y tambin se
pueden construir por encargo para proyectos de renovacin ms complejos.
5BNCJOFTBEFDVBEPQBSBMBTGVODJPOFTEFSJFHP
tDisponible en las siguientes configuraciones:
- Estaciones de bombeo de turbina vertical y sumergible para aplicaciones
con agua de pozos
- Succin de extremo horizontal para aplicaciones de compresin positiva, de
succin/impulso y de aumento de presin

Bombas

- Bombas de mltiples fases para aplicaciones de compresin positiva y


aumento de presin donde se necesite una
presin diferencial mayor que 130 psi (9 bares)

Estacin de bombeo de riego principal

El uso inteligente del agua.

211

Estaciones de bombeo
Administrador de bombas con SmartPump,
y servicio de estacin de bombeo de Rain Bird

Administrador de bombas con SmartPump


Combina una estacin de bombeo de Rain Bird y un software del sistema
de control centralizado a fin de integrar completamente el funcionamiento
de la estacin de bombeo con el sistema de control centralizado utilizando
comunicacin en tiempo real.

Administrador de bombas con SmartPump


t Ajusta el funcionamiento del sistema de riego a la capacidad real de la
estacin de bombeo, lo cual reduce la ventana de riego y disminuye el
consumo de energa

Servicio para estaciones de bombeo


Rain Bird presenta una red nacional de proveedores de servicio autorizados
para garantizar que su estacin de bombeo permanezca en funcionamiento.
Adems, Rain Bird brinda Asistencia telefnica, planes de mantenimiento
preventivo y cobertura de servicio completo durante y despus de que se
complete la Poltica de satisfaccin del cliente. Agregue estos servicios a su
compra para obtener el paquete completo. Comunquese con su distribuidor
autorizado de Rain Bird para obtener informacin detallada.

t Alerta al encargado en tiempo real sobre los problemas de riego y las


estaciones de bombeo a travs de mensajes de texto por telfono celular
t Brinda una respuesta a los problemas en el sistema de riego y el sistema de
bombas en tiempo real. Otros sistemas pueden perder una hora del tiempo
de riego al intentar recuperarse de una falla
El administrador de bombas con SmartPump ofrece funciones de control de
la estacin de bombeo y de monitoreo total a cargo del sistema de control
centralizado

Bombas

212

El uso inteligente del agua.

Estaciones de bombeo

www.rainbird.com/pumps

Rels de arranque de bombas PSR, PSRP y PSRPL

Rels de arranque de bombas


PSR, PSRP y PSRPL

NUEVO

Para un rendimiento y proteccin de la bomba ptimos


Q Los rels universales de arranque de bombas de Rain Bird (PSR) ofrecen
un rendimiento sin preocupaciones para su sistema de riego y son
compatibles con todos los controladores de Rain Bird y de otras marcas
confiables
Q Escoja el PSRP para la proteccin de funcionamiento en seco. Un
interruptor de presin agregado garantiza proteccin adicional en caso de
que se pierda la presin de agua de la fuente de abastecimiento
Q El PSRPL es ideal para sistemas que operan mediante un sistema de
fuentes de abastecimiento o alguna otra fuente que requiere control de
nivel. Esta funcin de control evita que la bomba permanezca encendida si
la fuente de abastecimiento de agua est vaca

Funciones de rel universal de arranque de bombas PSR


t'VODJPOBDPOFMDPNBOEPEFFODFOEJEPBQBHBEPEFVODPOUSPMBEPSEFSJFHP
para facilitar la ruta elctrica desde la caja del disyuntor hasta el motor de la
bomba
t1SPQPSDJPOBVOBPQFSBDJODPNQSPCBEBQPSFOTBZPZFSSPSQBSBUPEPTMPT
tipos de equipos de bombas elctricas con voltajes de 24, 110 y 220 VCA
t3FMEF"DFSUJGJDBEP
t5FSNJOBMFTEFDPOFYJOSQJEBDPOUVFSDBTQBSBDBCMFT
t4VNJOJTUSPEFDPOFYJOBUJFSSB
t$PNQBUJCMFDPODPOUSPMBEPSFTEFSJFHPEFUJFNQPEF7$"
t$PNQBUJCMFDPOCPNCBTNPOPGTJDBTEF7$"EFIBTUBIQ
t$BQBEFQJOUVSBFOQPMWPIPSOFBEB QBSBVOBMBSHBWJEBFOBNCJFOUFT
difciles
t6-MJTUBEPDPNPQBOFMFTEFDPOUSPMJOEVTUSJBMFTFODBKBSFTQBMEBEPTQPSVOB
garanta limitada de dos aos

t$BCMFBEPDPODEJHPEFDPMPSFTQBSBVOBGDJMJOTUBMBDJO
t4VNJOJTUSPEFDPOFYJOBUJFSSB
t1SPUFDDJOEFMBCPNCBUPUBMNFOUFBVUPNUJDB
t5JFNQPEFSFUSBTPBKVTUBCMF
t3FEVDFMBEJGFSFODJBFOUSFMPTDPOUSPMBEPSFTEFSJFHPEF7$"ZMPTNPUPSFT
de bomba de 110/220V
t6ONPEFMPGVODJPOBDPOUPEBTMBCPNCBTEFTEFEFIQIBTUBIQ
t4FOTPSEFCBKBQSFTJORVFQSPUFHFMBCPNCBTJFMGMVKPEFFOUSBEBEFBHVB
se detiene, reduce o bloquea totalmente
t1SPUFHJEBTFODBKB/&."3SFTJTUFOUFTBMBHVB QJOUBEBTDPOQJOUVSBFO
polvo "horneada" para una larga duracin en ambientes difciles

Funciones de control de la bomba de recoleccin de agua de


lluvia PSRPL
t.POJUPSFBFMCBMBODFEJTQPOJCMFEFBHVBFOMPTTJTUFNBTEFSFDPMFDDJOEF
agua de lluvia y los compara con el nivel de agua necesario para asegurar el
funcionamiento adecuado de la bomba.
t.FEJBOUFFMVTPEFTJNQMFTDPOUSPMFTEFGMPUBDJO FM1431-EF3BJO#JSE
proporciona un control eficiente de la bomba para recoleccin de agua de
lluvia mediante la sincronizacin la fuente de agua con los requerimientos
de la bomba. Si el agua de lluvia est disponible, el PSRPL de Rain Bird usa
primero el agua almacenada, si no hay agua de lluvia disponible, el PSRPL
de Rain Bird usa una alternativa domstica o fuente alterna para suministrar
agua a la bomba durante el ciclo de riego. El control de flotacin (inferior) se
usa para verificar que haya agua disponible durante el ciclo de riego de la
bomba.
t&MDPOUSPMEFGMPUBDJO TVQFSJPS
TFVTBQBSBBHSFHBSBHVBBMTVNJOJTUSPEF
agua de lluvia recogida usando una vlvula solenoide domstica de 24 VCA.
(El solenoide debe ser suministrado por otros).
t4FOTPSEFCBKBQSFTJORVFQSPUFHFMBCPNCBTJFMGMVKPEFFOUSBEBEFBHVB
se detiene, reduce o bloquea totalmente.

t1SPUFHJEPTFODPNQBDUBTDBKBT/&."3SFTJTUFOUFTBMBHVB

t4FOTPSEFUFNQFSBUVSBBMUBRVFQSPUFHFMBCPNCBTJMBEFTDBSHBTFDJFSSBP
bloquea.

Funciones de rel de arranque de bomba PSR

t1SPUFDDJOEFMBCPNCBUPUBMNFOUFBVUPNUJDB

t.POJUPSFBFMTJTUFNBEFSJFHPNFEJBOUFFMVTPEFVOTFOTPSEFQSFTJOVCJDBEP
a un lado de descarga de la bomba para protegerla de daos debido a baja
presin. Si la presin no se ha recuperado durante el ciclo del controlador, la
bomba se apaga para protegerse antes de que ocurra un dao.

t3FEVDFMBEJGFSFODJBFOUSFMPTDPOUSPMBEPSFTEFDTQFEEF7$"ZMPT
motores de bomba de 110/220 V.

t5PEPTMPTTFOTPSFTZGMPUBEPSFTFOFMUBORVFVTBOFOFSHBTFHVSBEF7$"

t'VODJPOBDPNPVOSFMEFBSSBORVFEFCPNCBTZPGSFDFQSPUFDDJOEF
desconexin de la bomba si la fuente de agua no est disponible.

t3FTUBCMFDJNJFOUPBVUPNUJDPEFMTFOTPSEFQSFTJO

t6ONPEFMPGVODJPOBDPOUPEBTMBCPNCBTEFTEFEFIQIBTUBIQ

t3FMEF"DFSUJGJDBEP

t$BCMFBEPBMCMPRVFEFUFSNJOBMFTQBSBVOBGDJMJOTUBMBDJO
Bombas

t4FOTPSEFQSFTJOCBKBGJKPBQTJ
t4FOTPSEFUFNQFSBUVSBBMUBGJKPB
t1SPUFHJEPTFODBKBT/&."3SFTJTUFOUFTBMBHVB
t$BQBEFQJOUVSBFOQPMWPIPSOFBEB QBSBVOBMBSHBWJEBFOBNCJFOUFT
difciles
t6-MJTUBEPDPNPQBOFMFTEFDPOUSPMJOEVTUSJBMFTFODBKBSFTQBMEBEPTQPSVOB
garanta limitada de dos aos.
*cuando hay proteccin trmica

Rels de arranque de bombas


PSR, PSRP y PSRPL

El uso inteligente del agua.

213

Estaciones de bombeo
Malla de filtracin y succin hidrulica de la "Serie G"

Malla de filtracin y succin


hidrulica de la "Serie G"

'"#3*$"%0&/&&66

t 'JMUSBEP FMSFUSPMBWBEPEFBHVBMJNQJBJOJDJBBVUPNUJDBNFOUFQPSUJFNQPP
diferencial de presin mediante un controlador integrado de Rain Bird
t Entrada y salida bridadas estndar excepto en las configuraciones de los
NPEFMPTEFGJMUSPT)47Z)4( MBTDVBMFTFTUOSPTDBEBT5BNCJO
hay disponible de modo opcional una configuracin de entrada y salida
acanalada.

Ahorro y valor con volmenes menores de retrolavado

Caractersticas
t Proporciona un ndice medio de flujo de agua filtrada de calidad 300
micrones (estndar)
t Activado por la presin de la lnea de entrada de la fuente de agua, el sistema
de retrolavado de filtro produce un flujo concentrado de alta velocidad y bajo
volumen de agua en reversa para limpiar sistemticamente la malla del filtro
de cualquier contaminante atrapado.
t Los modelos estn disponibles como un solo filtro o como ensambles de
filtros que incluye la invalidacin del bombeo y vlvulas para una rpida y
fcil instalacin en el lugar
t El elemento de filtracin de la malla de tela metlica SS con soporte de
PVC de gran resistencia y duradero se surte de manera estndar. Otras
construcciones de malla, como el SS multicapa sinterizado y de alambre a
presin tambin son opcionales y estn disponibles sobre pedido.
t Las mallas estndar de tela metlica se suministran en 300 micrones. Los
tamaos de malla de tela metlica SS opcionales estn disponibles en 50, 80,
100, 150 o 200 micrones
t Las tazas de caudal estndar van de 25 a 3500 GPM
t La presin de operacin mxima estndar es de 150 psi (hay disponibles
presiones ms altas)

Diseo econmico con ensamble


de invalidacin integrado para
instalacin rpida y fcil.

Datos de rendimiento de la malla de los filtros de escner de succin hidrulica de la "Serie G"

Bombas

Pintado con pintura


en polvo
Acero al carbn
Nmero de modelo

acero inoxidable
Nmero de modelo

HS-V-01-LE-M
HS-G-02-LE-M
HS-G-03-LE-M
HS-G-04-LS-M
HS-G-04-LE-M
HS-G-06-LS-M
HS-G-06-LE-M
HS-G-08-LS-M
HS-G-10-LS-M

HS-V-01-LE-S-M
HS-G-02-LE-S-M
HS-G-03-LE-S-M
HS-G-04-LS-S-M
HS-G-04-LE-S-M
HS-G-06-LS-S-M
HS-G-06-LE-S-M
HS-G-08-LS-S-M
HS-G-10-LS-S-M

HS-V-01-LE-B-M
HS-G-02-LE-B-M
HS-G-03-LE-B-M
HS-G-04-LS-B-M
HS-G-04-LE-B-M
HS-G-06-LS-B-M
HS-G-06-LE-B-M
HS-G-08-LS-B-M
HS-G-10-LS-B-M
%4(-&#.
%4(-4#.
%4(-4#.

HS-V-01-LE-S-B-M
HS-G-02-LE-S-B-M
HS-G-03-LE-S-B-M
HS-G-04-LS-S-B-M
HS-G-04-LE-S-B-M
HS-G-06-LS-S-B-M
HS-G-06-LE-S-B-M
HS-G-08-LS-S-B-M
HS-G-10-LS-S-B-M
%4(-&4#.
%4(-44#.
%4(-44#.

-M indica el nmero de modelo comercial.

Entrada/salida
Tamao de la brida
(pulg.)

Lnea de
purga
Tamao
(pulg.)

Presin mnima de
entrada durante el
ciclo de enjuagado
(psi)

2
2
3
4
4
6
6
8
10

2
2
2
2
3
3
3
3
3

30
30
30
30
30
30
30
30
30

2
2
3
4
4
6
6
8
10
10
10
12

2
2
2
2
3
3
3
3
3
3
3
3

30
30
30
30
30
30
30
30
30
30
30
30

Mxima
Presin (psi)
m3/hora
Solo filtro
25
5.7
150
100
22.7
150
200
45.4
150
300
68.1
150
400
90.9
150
650
147.6
150
850
193.1
150
1300
295.3
150
1750
397.5
150
Ensamble del filtro con colector de invalidacin
25
5.7
150
100
22.7
150
200
45.4
150
300
68.1
150
400
90.9
150
650
147.6
150
850
193.1
150
1300
295.3
150
1750
397.5
150
1700
386.2
150
2600
590.6
150
3500
795.0
150

Caudal mximo
GPM US

Pngase en contacto con Rain Bird para ver los planos o visite www.rainbird.com para descargarlos.

El flujo del filtro est basado en la filtracin de 200 micrones o ms de agua de riego limpia. Se requiere una devaluacin apropiada del flujo por cargas excesivas de desechos (limo, restos orgnicos, algas, etc.),
agua reciclada y mallas ms finas. Pngase en contacto con Rain Bird para obtener ayuda en la seleccin de filtros para estas aplicaciones.

214

El uso inteligente del agua.

Estaciones de bombeo

www.rainbird.com/pumps

Malla de filtracin y succin hidrulica de la "Serie I"

Malla de filtracin y succin


hidrulica de la "Serie I"

'"#3*$"%0&/&&66

t 'JMUSBEP FMSFUSPMBWBEPEFBHVBMJNQJBJOJDJBBVUPNUJDBNFOUFQPSUJFNQPP
diferencial de presin mediante un controlador integrado de Rain Bird
t &OUSBEBZTBMJEBFNCSJEBEBFTUOEBS5BNCJOIBZEJTQPOJCMFEFNPEP
opcional una configuracin de entrada y salida acanalada

El estndar de alto rendimiento en mallas de filtracin

Caractersticas
t Proporciona un elevado ndice de flujo de agua filtrada de calidad sin
preocupaciones
t Activado por la presin de la lnea de entrada de la fuente de agua, el sistema
de retrolavado de filtro produce un flujo concentrado de alta velocidad de
agua en reversa para limpiar sistemticamente el filtro de malla de cualquier
contaminante atrapado.
t Los modelos estn disponibles como un solo filtro o como ensambles de
filtros que incluye la invalidacin del bombeo y vlvulas para una rpida y
fcil instalacin en el lugar
t %JTQPOJCMFDPNPVOTPMPGJMUSP TJOJOWBMJEBDJOEFCPNCFP
PDPNPVO
ensamble completo con invalidacin de bombeo y vlvulas para una fcil
instalacin
t El elemento de filtracin de la malla de tela metlica SS con soporte de
PVC de gran resistencia y duradero se surte de manera estndar. Otras
construcciones de malla, como el SS multicapa sinterizado y de alambre a
presin tambin son opcionales y estn disponibles sobre pedido.
t Las mallas estndar de tela metlica se suministran en 300 micrones. Los
tamaos de malla de tela metlica SS opcionales estn disponibles en 50, 80,
100, 150 o 200 micrones
t Las tazas de caudal estndar van de 400 a 5,000 GPM
t La presin de operacin mxima estndar es de 150 psi (hay disponibles
presiones ms altas)

Serie I

Datos de rendimiento de la malla de los filtros de escner de succin hidrulica de la "Serie I"

acero inoxidable
Nmero de modelo

HS-I-04-PE-M
HS-I-06-PE-M
HS-I-08-PS-M
HS-I-08-PE-M
HS-I-10-PS-M
HS-I-10-PE-M
HS-I-12-PS-M

HS-I-04-PE-S-M
HS-I-06-PE-S-M
HS-I-08-PS-S-M
HS-I-08-PE-S-M
HS-I-10-PS-S-M
HS-I-10-PE-S-M
HS-I-12-PS-S-M

HS-I-04-PE-B-M
HS-I-06-PE-B-M
HS-I-08-PS-B-M
HS-I-08-PE-B-M
HS-I-10-PS-B-M
HS-I-10-PE-B-M
HS-I-12-PS-B-M
%4*1&#.
%4*14#.
%4*1&#.
%4*14#.

HS-I-04-PE-S-B-M
HS-I-06-PE-S-B-M
HS-I-08-PS-S-B-M
HS-I-08-PE-S-B-M
HS-I-10-PS-S-B-M
HS-I-10-PE-S-B-M
HS-I-12-PS-S-B-M
%4*1&4#.
%4*144#.
%4*1&4#.
%4*144#.

Caudal mximo
GPM US

Entrada/salida
Tamao de la brida
(pulg.)

Lnea de
purga
Tamao
(pulg.)

Presin mnima de
entrada durante el
ciclo de enjuagado
(psi)

4
6
8
8
10
10
12

4
4
4
4
4
4
4

30
30
30
30
30
30
30

4
6
8
8
10
10
12
12
12
14
14

4
4
4
4
4
4
4
4
4
4
4

30
30
30
30
30
30
30
30
30
30
30

Mxima
m3/hora
Presin (psi)
Solo filtro
400
90.9
150
650
147.6
150
1200
272.6
150
1500
340.7
150
1750
397.5
150
2000
454.3
150
2500
567.9
150
Ensamble del filtro con colector de invalidacin
400
90.9
150
650
147.6
150
1200
272.6
150
1500
340.7
150
1750
397.5
150
2000
454.3
150
2500
567.9
150
3000
681.5
150
3500
795.0
150
4000
908.6
150
5000
1135.8
150

Bombas

Pintado con pintura


en polvo
Acero al carbn
Nmero de modelo

* El flujo del filtro est basado en la filtracin de 200 micrones de agua de riego limpia. Se requiere una devaluacin apropiada del flujo por cargas excesivas de desechos (limo, restos orgnicos, algas, etc.), agua reciclada y mallas ms
finas. Pngase en contacto con Rain Bird para obtener ayuda en la seleccin de filtros para estas aplicaciones.
-M significa Nmero de modelo comercial
Pngase en contacto con Rain Bird para ver los planos o visite www.
rainbird.com para descargarlos

El uso inteligente del agua.

215

Estaciones de bombeo
'JMUSPEFBSFOB

Filtro de arena

'"#3*$"%0&/&&66

Proceso de retrolavado
t El drenaje inferior de Rain Bird requiere menos agua para el retrolavado y
requiere un retrolavado menos frecuente.

Para las condiciones ms desafiantes de abastecimiento de agua

Caractersticas
t 0GSFDFDPOGJBCJMJEBE FGJDJFODJBZBIPSSPBMBSHPQMB[P'BCSJDBEPFOMPT
Estados Unidos, estos filtros estn diseados y fabricados segn estndares
precisos, para que pueda disfrutar de muchos aos del ms alto rendimiento.

Proceso de filtracin
t Profundidad uniforme para cama de arena de 14 para capturar las partculas
de manera ms ptima
t La filtracin se logra mediante el flujo del colector de entrada (superior) al
colector de salida (abajo)

t El retrolavado limpia un tanque a la vez, de manera que usted puede


continuar regando durante el ciclo de retrolavado
t El sistema hace el retrolavado con agua filtrada limpia
t Operacin de una sola vlvula, ya sea manualmente, en forma
semiautomtica o automtica, asegura una adecuada eficiencia y secuencia
de retrolavado
t El flujo uniforme a travs de la cama de arena asegura una limpieza total
del sistema, a la vez que produce una cama plana y uniforme despus de la
limpieza

t Aspersor de entrada de 2 fases


t Alta resistencia, drenaje inferior de acero inoxidable tipo 304 hidrulicamente
balanceado para un retrolavado completo

Cmo especificar

t Goteo de baja presin y flujo de dispersin uniforme

SM1816 - 2 B - M
Modelo comercial
SM1816
SM2416
SM3016

Designacin
Uso comercial
Fusin
#MBODP/NFSPEF*%0%
*4PMP*%
#*%Z0%
N. de tanques
2

SM4816 - 6 B - G
Designacin
Golf
Fusin
#MBODP/NFSPEF*%0%
*4PMP*%
#*%Z0%

Modelo para
golf
SM4816

N de tanques
de 2 a 10

Los filtros de arena de Rain Bird protegern su sistema de riego


de contaminantes slidos incluyendo algas, arena y desechos.

Datos de rendimiento de los filtros de arena


Nmero de modelo del filtro

Bombas

Nmero de ID / OD
Fusin
Revestimiento
de epoxi
adherido

Solo ID
Fusin
Revestimiento
de epoxi
adherido

ID y OD
Fusin
Revestimiento
de epoxi
adherido

N. de
tanques

(psi)

GPM US

m3/hora

GPM US

SM1816-2-M
SM2416-2-M
SM3016-2-M
SM3616-2-M
SM4816-2-M
SM4816-3-M
SM4816-4-M
SM4816-5-M
SM4816-6-M
SM4816-7-M
SM4816-8-M
SM4816-9-M
SM4816-10-M

SM1816-2I-M
SM2416-2I-M
SM3016-2I-M
SM3616-2I-M
SM4816-2I-M
SM4816-3I-M
SM4816-4I-M
SM4816-5I-M
SM4816-6I-M
SM4816-7I-M
SM4816-8I-M
SM4816-9I-M
SM4816-10I-M

SM1816-2B-M
SM2416-2B-M
SM3016-2B-M
SM3616-2B-M
SM4816-2B-M
SM4816-3B-M
SM4816-4B-M
SM4816-5B-M
SM4816-6B-M
SM4816-7B-M
SM4816-8B-M
SM4816-9B-M
SM4816-10B-M

2
2
2
2
2
3
4
5
6
7
8
9
10

150
150
125
125
125
125
125
125
125
125
125
125
125

60
107
170
238
425
638
850
1063
1275
1488
1700
1913
2125

13.6
24.3
38.6
54.1
96.5
144.9
193.1
241.5
289.6
338.0
386.2
434.5
482.7

88
158
250
350
625
938
1250
1563
1875
2188
2500
2813
3125

-M significa Nmero de modelo comercial

Filtracin

Requisitos
del material

ndice de
caudal
del
retrolavado

m3/hora

rea (pies 2)

(Bolsas 100#)

GPM US

20.0
35.9
56.8
79.5
142.0
213.1
283.9
355.0
425.9
497.0
567.9
639.0
709.8

3.5
6.3
10.0
14.0
25.0
37.5
50.0
62.5
75.0
87.5
100.0
112.5
125.0

4
8
10
16
26
39
52
65
78
91
104
117
130

25
50
80
110
190
190
190
190
190
190
190
190
190

Rangos de caudal de riego


Presin
mxima

Flujo mnimo

Caudal mximo

Pngase en contacto con Rain Bird para ver los planos o visite www.rainbird.com para descargarlos

El flujo del filtro est basado en la filtracin de 200 micrones o ms de agua de riego limpia. Se requiere una devaluacin apropiada del flujo por cargas excesivas de desechos (limo, restos orgnicos, algas, etc.),
agua reciclada y mallas ms finas. Pngase en contacto con Rain Bird para obtener ayuda en la seleccin de filtros para estas aplicaciones.

216

El uso inteligente del agua.

Estaciones de bombeo

www.rainbird.com/pumps

Malla de Succin de bomba con limpieza automtica

Malla de Succin de bomba con


limpieza automtica

Conexiones de unin
estndar otros
adaptadores tambin
son disponibles

'"#3*$"%0&/&&66

Mantiene la sociedad fuera de su sistema de bombeo y riego

Hacia la tubera principal


de succin de bomba

Entrada para suministro


de agua hacia los
chorros de limpieza

Caractersticas
t La malla galvanizada autolimpiable de la bomba de succin elimina partculas
grandes de basura y suciedad de las fuentes de agua, lo cual permite ahorrar
tiempo y dinero en energa, adems logra eficiencia en el bombeo y reduce
los costos de mantenimiento.

Soporte de alta
resistencia para
una larga vida

t La malla de acero inoxidable de uso pesado 12 30 incrementa la eficiencia


de bombeo por muchos aos
t 5PEBFMBHVBEFCFQBTBSBUSBWTEFMBNBMMBEFMBCPNCBEFTVDDJO
colocada al final de la lnea de succin de la bomba antes de entrar al
tubo de alimentacin de la bomba. Un pequeo chorro lateral de la
tubera de descarga de la bomba impulsa dos barras aspersoras que giran
continuamente, lanzando chorros de agua a la malla para eliminan la
suciedad

Malla pesada de
12-mesh ( o 30 mesh)
con tejido de acero
inoxidable

Acero galvanizado de alta


resistencia- canasta exterior
removible para servicio

Barras rotativas dobles


con fuertes chorros
continuamente
funcionando para
eliminar las partculas
de suciedad de la malla

Nmero de modelo

Caudal
GPM US

Caudal
m3/hora

Malla
Longitud
(pulg.)

PSS200-M
PSS400-M
PSS600-M
PSS800-M
PSS1000-M
PSS1400-M
PSS1700-M
PSS2000-M
PSS2400-M
PSS3000-M
PSS3500-M
PSS4000-M

325
550
750
950
1350
1650
1950
2350
2600
3000
3500
4000

73.8
124.9
170.3
215.7
306.5
374.6
442.7
533.5
590.2
681.0
794.5
908.0

11
15
16
18
23
26
28
32
35
40
40
40

PSS20030-M
PSS40030-M
PSS60030-M
PSS80030-M
PSS100030-M
PSS140030-M
PSS170030-M
PSS200030-M
PSS240030-M
PSS300030-M
PSS350030-M
PSS400030-M

225
400
525
700
950
1200
1400
1650
1800
2075
2420
2765

51.1
90.8
119.2
158.9
215.7
272.4
317.8
374.6
408.6
471.0
549.3
627.7

11
15
16
18
23
26
28
32
35
40
40
40

-M significa Nmero de modelo comercial

Total
Longitud
(pulg.)

Malla
Dimetro
(pulg.)

Filtro de malla 12
25
16
28.8
16
32.5
24
34.5
24
39.5
24
42.5
24
44.5
26
48.5
26
52.5
30
57.5
30
59.5
36
63.5
42
Filtro de malla 30
25
16
28.8
16
32.5
24
34.5
24
39.5
24
42.5
24
44.5
26
48.5
26
52.5
30
57.5
30
59.5
36
63.5
42

Brida
Tamao
(pulg.)

Retorno de
entrada
Tamao del
tubo (pulg.)

Presin
operativa
(psi mnima mxima)

Peso
Libras

Limpieza
Aspersor
(GPM)

4
6
8
10
10
12
12
14
16
16
18
18

1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5

35-100
40-100
40-100
45-100
50-100
55-100
55-100
60-100
65-100
40-65
40-65
40-65

38
57
101
108
116
128
148
160
223
236
283
358

20
20
20
20
24
24
24
24
28
44
44
44

4
6
8
10
10
12
12
14
16
16
18
18

1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5

35-100
40-100
40-100
45-100
50-100
55-100
55-100
60-100
65-100
40-65
40-65
40-65

38
57
101
108
116
128
148
160
223
236
283
358

20
20
20
20
24
24
24
24
28
44
44
44

Pngase en contacto con Rain Bird para ver los planos o visite www.rainbird.com para descargarlos

El uso inteligente del agua.

217

Bombas

Datos del rendimiento de la malla de bomba de succin que se limpia automticamente

Estaciones de bombeo
Separadores centrfugos de arena

Separadores centrfugos de arena

'"#3*$"%0&/&&66

Elimina contaminantes para minimizar el mantenimiento


necesario e incrementar la eficiencia

Caractersticas
t Capacidades de 4 a 8300 gpm
t Instalacin simple (no se requiere electricidad)
t 'JMUSBDJOQSFWJBFGJDJFOUFQBSBSFEVDJSMBDBSHBEFBSFOBFOMPTDPNQPOFOUFT
en el flujo de corriente
t Los separadores centrfugos de arena de Rain Bird estn diseados para
separar partculas abrasivas antes de que estas entren en el sistema de
riego, manteniendo el equipo limpio y libre de desechos, lo cual minimiza
la cantidad de mantenimiento que se requiere e incrementa la eficiencia
operativa
t El separador elimina la arena y partculas que son ms pesadas que el agua
(material con gravedad especfica de 2 o superior
t Los lquidos y slidos entran en la unidad y comienzan a viajar en un flujo
circular. Esta accin centrfuga arroja las partculas ms pesadas hacia las
paredes del filtro y finalmente hacia abajo en un movimiento en espiral hacia
la cmara de separacin. Las partculas se recogen en la cmara de separacin
y se eliminan manualmente del sistema. El agua filtrada es entonces atrada al
vrtice del separador y hacia la salida

Separador centrfugo de arena

t Se puede usar un controlador de purga automtico y una vlvula en todas


las aplicaciones para automatizar el proceso de purga, lo cual elimina la
necesidad de un enjuague manual. Se pueden montar pequeos separadores
verticales en la pared o en el sistema de tuberas

Datos de rendimiento de los separadores centrfugos de arena

Bombas

Nmero de modelo

Flujo*
GPM US

Flujo
m3/Hora

VCS-R5V-M
VCS-R7V-M
VCS-R10V-M
VCS-R12V-M
VCS-R15V-M
VCS-R20V-M
VCS-R25V-M
VCS-R30V-M
VCS-R40V-M

4 -10
10 - 20
18 - 38
26 - 52
38 - 79
63 - 120
100 - 180
125 - 260
190 - 345

0.9 - 2.3
2.3 - 4.6
4 - 8.7
6 - 12
8.7 - 18
14.5 - 27.6
23 - 41.4
28.8 - 59.8
43.7 - 79.4

ACS-R40LA-M
ACS-R60LA-M
ACS-R80LA-M
ACS-R100LA-M
ACS-R120LA-M
ACS-R140LA-M
ACS-R160LA-M
ACS-R180LA-M

200 - 525
365 - 960
800 - 1600
1300 - 2300
2025 - 3400
2975 - 5000
4000 - 6200
5100 - 8300

46 - 120
84 - 220
184 - 369
299 - 529
465 - 782
684 - 1150
920 - 1426
1173 - 1909

Entrada / Salida
Tamao de la
Longitud
lnea (pulg.)
(pulg.)
(cm)
Separadores verticales
0.5
20
50.8
0.75
20
50.8
1
30.5
77.5
1.25
30.5
77.5
1.5
30.5
77.5
2
36
91.4
2.5
44
111.8
3
48
121.9
4
52
132.1
Separadores angulares
4
80
221
6
106.25
293.4
8
114
316.9
10
123.5
342.9
12
139
396.2
14
148
424.2
16
160
462.3
18
177
462.3

Peso
Libras

Tamao
mximo de la
partcula (pulg.)

Tamao de
la vlvula de
purga (pulg.)

13
15
26
26
26
44
55
75
120

0.625
0.375
0.5
0.5
0.5
0.5
0.5
0.5
0.5

1
1
1
1
1
2
2
2
2

280
493
722
840
1400
1550
1850
2400

1.5
1.5
1.5
1.5
1.5
2
2
2

2
2
2
2
2
2
2
3

El flujo del filtro est basado en la filtracin de 200 micrones o ms de agua de riego limpia. Se requiere una devaluacin apropiada del flujo por cargas excesivas de desechos (limo, restos orgnicos, algas, etc.),
agua reciclada y mallas ms finas. Pngase en contacto con Rain Bird para obtener ayuda en la seleccin de filtros para estas aplicaciones.

218

El uso inteligente del agua.

Estaciones de bombeo

www.rainbird.com/pumps

Aireadores para mantenimiento de lagos

Serie LM
Aireadores de patrn simple para mantenimiento de lagos
Q Mantienen el atractivo de lagos y estanques estimulando la circulacin
vertical y agregando oxgeno disuelto al agua

Modelos
LM10: la caracterstica principal es un patrn de rociado de un surtidor,
similar a un giser que se eleva por el aire

Q Mantienen la calidad del agua necesaria para evitar la acumulacin


no deseada de algas, el crecimiento excesivo de malezas, los olores
desagradables y la disminucin de poblaciones de peces

LM11: rociado bien proporcionado, en forma de abanico; el equilibrio


perfecto entre forma y funcin

Q 5SBCBKBOEFGPSNBFGJDB[QBSBNBOUFOFSFMFRVJMJCSJPFDPMHJDPFOMBHPTP
estanques de menos de 15 pies (5 m) de profundidad

LM20: las populares opciones con patrn de rociado doble benefician


el aspecto esttico mientras mantienen la calidad del agua en forma
efectiva

Caractersticas
t%JTQPOJCMFFOCPNCBTEFB)1 7 7 NPOPGTJDBTZUSJGTJDBT
t5PEBTMBTVOJEBEFT-.WJFOFOBSNBEBTEFGCSJDBZTFFOUSFHBOMJTUBTQBSBTFS
instaladas
t#SB[PTEFBDFSPJOPYJEBCMFSFTJTUFOUFRVFTPTUJFOFOVOGMPUBEPSSFMMFOP
con espuma de celdillas cerradas aprobada por la guardia costera de los
EE.UU., para lograr una mxima flotabilidad
t$BSDBTBEFBDFSPJOPYJEBCMFRVFDPOUJFOFVONPUPSFMDUSJDPGBCSJDBEPQPS
encargo, diseado para mover altos volmenes de agua y proporcionar aos
de servicio confiable

LM30: la caracterstica que lo diferencia es su diseo


multidimensional de tres surtidores

Caractersticas opcionales
t4JTUFNBTDPOKVFHPTEFMVDFTRVFGVODJPOBODPOWPMUJPTEJTQPOJCMFTDPO
bombillas halgenas de 65 vatios
t$SJTUBMFTFODPMPSSPKP B[VM WFSEFZBNBSJMMP
t-BNBMMBEFFOUSBEBFTPQDJPOBMQBSBFMNPEFMP-.

t&YDMVTJWBDNBSBEFCPNCFPFOMBDBSDBTBEFMNPUPSRVFQFSNJUFBMDBO[BS
altos ndices de bombeo para maximizar la circulacin
t1MBDBEFGMFDUPSBRVFQSPQPSDJPOBVOBWJTJOBUSBDUJWB
t'JMUSPEFNBMMBGJOBRVFFWJUBMBFOUSBEBEFTVDJFEBEQBSBQFSNJUJSFMDBVEBM
continuo de agua entrante y garantizar patrones de rociado completos y
simtricos cuando est en funcionamiento
t4MP-.QSPQVMTPSFTUJMPIFMJDQUFSP EFBDFSPJOPYJEBCMFQSDUJDBNFOUF
irrompible
t"OJMMPTGMPUBEPSFTEJTFBEPTFTQFDJBMNFOUFQBSBQFSNJUJSRVFMBVOJEBE
permanezca a nivel del agua

Especificaciones
t6OJEBEGBCSJDBEBFOBDFSPJOPYJEBCMFSFTJTUFOUFBMBDPSSPTJOZ
plsticos trmicos de alta densidad. La resistencia a la corrosin permite que
la unidad sea instalada en casi todos los tipos de fuentes de agua

LM11

t'MPUBEPSDBSDBTBFYUFSJPSOFHSBGBCSJDBEBDPOQPMJFUJMFOPQMTUJDPUSNJDPEF
alta densidad. El interior del flotador es de polietileno de celdillas cerradas
t.PUPSNPUPSFMDUSJDPGBCSJDBEPQPSFODBSHPDPOSPUPSFTFOFRVJMJCSJP
dinmico. Empotrado en una carcasa de acero inoxidable totalmente oculto a
la vista
Bombas

t$BCMFUPEBTMBTVOJEBEFTTFFOWBODPODBCMFTVCBDVUJDP RVFTFPSEFOB
por separado, con un mnimo de 50 pies (15.2 m), con incrementos de 25 pies
N

t.BMMBGJMUSPEFFOUSBEBEFBHVBEFNBMMBGJOBGBCSJDBEPFOOZMPOEF14" (0.6
cm) (solo en los modelos LM10, LM20 y LM30)
t$FOUSPEFDPOUSPMEFFOFSHBFMDFOUSPEFDPOUSPM DPODFSUJGJDBDJO3
de NEMA) incluye interruptor por fallas con descarga a tierra, arrancador
magntico, disipador de descargas, desconexin de energa, temporizador de
encendido y apagado de 24 horas
t1SVFCBEFTFHVSJEBEDPNQPOFOUFTBQSPCBEPTQPS6-Z$4"QSPCBEPTFOFM
FOTBNCMBEPZBQSPCBEPTQPS&5- &5-$Z$&
* Cable subacutico calibre 10 que se ordena por separado con incrementos de 25 pies (7.6 metros)

Ejemplo de un LM20 en uso

El uso inteligente del agua.

219

Estaciones de bombeo
Aireadores para mantenimiento de lagos

Serie LMM

Especificaciones

Aireadores de patrn mltiple para mantenimiento de lagos

t6OJEBEGBCSJDBEBFOBDFSPJOPYJEBCMFSFTJTUFOUFBMBDPSSPTJOZ
plsticos trmicos de alta densidad. La resistencia a la corrosin permite que
la unidad sea instalada en casi todos los tipos de fuentes de agua

Q 5SBCBKBOEFGPSNBFGJDB[QBSBNBOUFOFSFMFRVJMJCSJPFDPMHJDPFOMBHPTP
estanques de menos de 15 pies (5 m) de profundidad
Q Mantienen el atractivo de lagos y estanques estimulando la circulacin
vertical y agregando oxgeno disuelto al agua

t'MPUBEPSDBSDBTBFYUFSJPSOFHSBGBCSJDBEBDPOQPMJFUJMFOPQMTUJDPUSNJDPEF
alta densidad. El interior del flotador es de polietileno de celdillas cerradas.
Cada flotador consta de anillos flotadores especialmente diseados, que
hacen que la unidad permanezca a nivel del agua

Q Mantienen la calidad del agua necesaria para evitar la acumulacin


no deseada de algas, el crecimiento excesivo de malezas, los olores
desagradables y la disminucin de poblaciones de peces

t.PUPSNPUPSEFBDFSPJOPYJEBCMFGBCSJDBEPQPSFODBSHP TVNFSHJCMF 
enfriado por agua y resistente a la corrosin. Construido para funcionamiento
continuo y disponible en 60 Hz a 3450 RPM

Caractersticas

t*NQVMTPSFTQSPQVMTPSFTGBCSJDBEPTFOYJEPEFQPMJGFOJMFOP NPEJGJDBEP&M
material es resistente a la corrosin para casi todo tipo de agua, soluciones
salinas y cidos

t%JTQPOJCMFFOCPNCBTNPOPGTJDBTEFZIQ 7 7


t5PEBTMBTVOJEBEFT-..WJFOFOBSNBEBTEFGCSJDBZTFFOUSFHBOMJTUBTQBSB
ser instaladas
t'BCSJDBEPUPUBMNFOUFFOBDFSPJOPYJEBCMFZQMTUJDPTUSNJDPTQBSB
proporcionar aos de servicio confiable
t.BMMBQBSBTVDJFEBEEFBDFSPJOPYJEBCMFRVFFWJUBMBFOUSBEBEFPCKFUPT
extraos para permitir el caudal continuo de agua entrante y garantizar
patrones de rociado estticamente agradables
t.JOJDFOUSPEFFOFSHBFNQPUSBEPFOVOBDVCJFSUBEFHSBEPJOEVTUSJBM
resistente a la corrosin que garantiza confiabilidad
t&MQBUSOEFSPDJBEPTFQVFEFNPEJGJDBSBMEFM-. -.P-.
t"OJMMPBTQFSTPSRVFQFSNJUFRVFFMQBUSOEFSPDJBEPTFBEFBMUVSBZEJNFUSP
variables (LMM solo con patrones LM10 y LM11)

t$BCMFUPEBTMBTVOJEBEFTTFFOWBODPODBCMFTVCBDVUJDP RVFTFPSEFOBQPS
separado, con un mnimo de 50 pies (15.2 m), con incrementos de 25 pies
N

t.JOJDFOUSPEFFOFSHBDPOUSPMFTEFMBVOJEBEEF7EFOUSPEFVOB
cubierta de 5" x 5" x 4" (12.7 cm x 12.7 cm x 10.2 cm) de grado industrial,
completamente de plstico y resistente a la corrosin. Los controles de 115 V
constan de temporizador de encendido y apagado de 24 horas e interruptor
QPSGBMMBTFOEFTDBSHBBUJFSSB ('*
-BTVOJEBEFTEF7TFFODVFOUSBO
dentro de una cubierta de alto impacto de 11" x 11" x 6" (27.9 cm x 27.9
cm x 15.2 cm), de plstico trmico resistente a la corrosin, certificada por
NEMA como tipo 3S. Los controles de las unidades de 230 V constan de
temporizador de encendido y apagado de 24 horas, fusibles o proteccin de
DPSUBDJSDVJUPTFJOUFSSVQUPSQPS('*
t.BMMBNBMMBJOUBDUBEFBDFSPJOPYJEBCMFSFTJTUFOUFBMBDPSSPTJORVF
evita las obstrucciones en forma eficaz
t1SVFCBEFTFHVSJEBETPNFUJEPBQSVFCBEFTFHVSJEBEZBQSPCBEPDPNPVO
QBRVFUFQPS&5- &5-$Z$&
* Cable subacutico calibre 12 que se ordena por separado con incrementos de 25 pies (7.6 metros)

Modelos
t*ODMVZFCPRVJMMBTJOUFSDBNCJBCMFTQBSBDBNCJBSEF-. -. -.
LM10: la caracterstica principal es un patrn de rociado de un surtidor,
similar a un giser que se eleva por el aire
LM11: rociado bien proporcionado, en forma de abanico; el equilibrio
perfecto entre forma y funcin

Bombas

LM20: las populares opciones con patrn de rociado doble benefician


el aspecto esttico mientras mantienen la calidad del agua en forma
efectiva

Caractersticas opcionales
t4JTUFNBTDPOKVFHPTEFMVDFTRVFGVODJPOBODPOWPMUJPTEJTQPOJCMFTDPO
bombillas halgenas de 20 vatios. Mnsulas de montaje de acero inoxidable
que facilitan la instalacin para lograr diversos efectos de iluminacin
t$SJTUBMFTFODPMPSSPKP B[VM WFSEFZBNBSJMMP
LMM se muestra con el patrn de LM20 seleccionado

220

El uso inteligente del agua.

Impactos

Rotores

Boquillas aspersoras

Cuerpos de
aspersores

Introduccin

Cuerpos de difusores
Productos de drenaje

Vlvulas

La marca ms actual en drenaje es


aqulla en la que usted ya confa.

Xerigation

Sistemas de control
centralizado

Programadores

Accesorios

Durante dcadas hemos estado buscando nuevas


formas de usar el agua de manera ms inteligente.
Estamos orgullosos de presentar algunas ms:
Productos de drenaje de Rain Bird. Fuertemente
construidos y diseados para trabajar en conjunto,
estas grandes cuencas y accesorios le pueden
ayudar a manejar eficientemente el escurrimiento
de agua en casi cualquier sitio residencial,
comercial o municipal. Colquelos en el terreno.
Ver por qu son los primeros productos de drenaje
dignos del nombre Rain Bird.

Un sistema de drenaje instalado


adecuadamente puede eliminar
problemas en el lugar causados por agua
corriente o estancada que puede resultar
en la erosin del suelo, dao a las plantas
o a la estructura.

Recuerde, el agua siempre corre hacia


abajo. Asegrese de que haya cuando
menos una diferencia de elevacin del 2%
entre la parte ms alta y la ms baja del
sistema de drenaje.

el dao a las estructuras al dirigir el agua


lejos de los cimientos de construccin a
un rea ms deseable del lugar.

t 6OBWMWVMBSFUSDUJMQBSBESFOBKF %167

de Rain Bird se puede instalar en el
punto ms bajo de la red de tubera para
permitir que el agua recolectada se filtre
lentamente en el suelo para recuperar
los niveles de agua en el subsuelo.

Drenaje

El agua recolectada puede dirigirse


posteriormente a un tanque de
almacenamiento en el lugar, tratarse
(si se requiere) y bombearse segn
sea necesario para alimentar un
sistema eficiente de riego de
Rain Bird.

t Los sistemas de drenaje pueden reducir

Referencia

La instalacin de un sistema de
drenaje bien diseado resultar en
la recoleccin y captura de lluvia,
agua de lluvia y agua estancada en
el lugar.

Recursos

Bombas

Sugerencias para ahorrar agua

El uso inteligente del agua.

221

Productos de drenaje
Introduccin

Nueva categora de productos. La misma


resistencia.

Color, tamao y estilo son opcionales.


Los acoples sueltos no lo son.

Aqu no hay atajos. Nuestras rejillas, cuencas y accesorios de drenaje


fueron diseados con la misma ingeniera y los mismos estndares de
precisin que los aspersores, vlvulas y controladores de Rain Bird.

Sin importar el trabajo, usted tendr el equipo que necesita para hacerlo
bien. Ofrecemos rejillas y cuencas de diferentes dimensiones, formas y
colores: todos ellos planeados para que ajusten perfectamente, sin tener que
preocuparse por las conexiones.

Confiabilidad comprobada
5FOFNPTVOBSFQVUBDJORVFQSPUFHFS-PTQSPEVDUPTEFESFOBKFEF
Rain Bird se construyen usando los materiales de la ms alta calidad y se
someten a rigurosas pruebas de durabilidad.
Garanta de tres aos
Usted necesita productos que duren mucho tiempo despus de que
se hace el trabajo. Esa es la razn por la que respaldamos nuestros
productos de drenaje con la garanta ms alta en la categora de
productos de drenaje.

Cuatro colores
/BEJFOPUBSRVFFTUOBI%JTQPOJCMFTFOWFSEF OFHSP BSFOBZHSJT 
nuestras rejillas se mezclan fcilmente con cualquier paisaje, pasando
inadvertidas y protegiendo la esttica general.
Compatibilidad total
No importa cmo las combine, nuestras rejillas y cuencas se adaptarn de la
mejor manera. Para mejoras fciles y remplazos rpidos, nuestros productos
son compatibles con los componentes de la mayora de los fabricantes de
drenaje.

Cuenca recolectora redonda


Cuenca de bajo perfil
Rejilla universal
cuadrada de 7" (17.8 cm)

Rejilla redonda atrio de


6" (15.2 cm) (pg. 223)

Rejilla cuadrada
atrio (pg. 224)

(pg. 224)

Rejilla cuadrada plana


(pg. 224)

Acople de 6" (15.2 cm),


opcional

5VCFSBEF DN

para extender la altura
de la cuenca, opcional

Rejilla redonda
plana de 6" (15.2 cm)
(15.2 cm) (pg. 223)

Cuenca cuadrada de
perfil bajo (pg. 227)

Adaptador de cuenca,
para tubera de 3" (7.6 cm) o 4" (10.2 cm) (pg. 229)

Cuencas recolectoras
redondas de
6" (15.2 cm) (pg. 225)

Cuenca recolectora cuadrada

Tubera de drenaje compatible


Rejilla cuadrada
atrio (pg. 224)

(no fabricada por Rain Bird)


5VCFSBEFBMDBOUBSJMMBZESFOBKFEF DN
 DN
P DN

(tubera de 6" (15.2 cm) solo para las cuencas recolectoras cuadradas)

Elevador de cuenca:
opcional (pg. 229)

Drenaje

Adaptador de cuenca, para tubera de


3" (7.6 cm) o 4" (10.2 cm) (pg. 229)
Adaptador de compensacin
para cuenca, para tubera de
3" (7.6 cm) o 4" (10.2 cm) (pg. 229)
Adaptador de cuenca,
para tubera de 6" (15.2 cm)

5VCFSBEFQBSFEUSJQMFEF
3" (7.6 cm) o 4" (10.2 cm)

(pg. 229)

Rejilla cuadrada
plana (pg. 224)

Cuenca
recolectora cuadrada
(pg. 226)

Conexin de
cuenca
(pg. 229)

5VCFSBDPSSVHBEBEF DN
 DN
P
6" (15.2 cm) (tubera de 6" (15.2 cm) solo para las
cuencas recolectoras cuadradas)

222

El uso inteligente del agua.

Productos de drenaje

www.rainbird.com/drainage

Rejillas redondas de plstico

Rejillas redondas de plstico

Plano

Caractersticas
t 'BCSJDBEBTDPOFTQVNBEFQPMJFUJMFOPFTUSVDUVSBMEFBMUBEFOTJEBE )%1&

t Estabilizado con UV para proteger contra la degradacin producida por el sol


t Perfiles planos y de atrio (en forma de domo)
t Rejillas planas disponibles en verde, negro, arena y gris
t Rejillas de atrio disponibles en verde, negro y arena
t Cada rejilla tiene tres dimetros superpuestos para ajustarse a la tubera de
BMDBOUBSJMMBZBMESFOBKF 4Z%
ZBMPTBDDFTPSJPT UVCFSBEFUSJQMFQBSFEZ
tubera corrugada

3" (7.6 cm)

4" (10.2 cm)

6" (15.2 cm)

DG3RFG

DG4RFG

DG6RFG

3" (7.6 cm)

4" (10.2 cm)

6" (15.2 cm)

DG3RAG

DG4RAG

DG6RAG

Atrio

t Superficie texturizada y antideslizante 1


t Carga clasificada para trfico peatonal 1, 2
t Carga clasificada para autos y camiones ligeros a velocidades menores que
20 mi/h (30 km/h) 1, 2
t $PODFSUJGJDBDJO"%"1
t 'BCSJDBEPFO&&66

Nmero de
modelo

Cada dimetro es adecuado para


Color

Pequea

Mediana

Grande

Ancho de
ranura
abierta

rea de
superficie
abierta

ndice de
caudal
mximo

Carga
mxima

316"

3 sq in
(19.35 cm)

3 GPM
(11.4 l/m)

500 lb
(226.8 kg)

5 sq in
(32.26 cm)

6 GPM
(22.7 l/m)

750 lb
(340.2 kg)

13 sq in
(83.87 cm)

16 GPM
(60.6 l/m)

1000 lb
(453.6 kg)

9 sq in
(58.06 cm)

12 GPM
(45.4 l/m)

/%

516"

16 sq in
(103.23 cm)

20 GPM
(75.7 l/m)

/%

28 sq in
(180.64 cm)

36 GPM
(136.3 l/m)

/%

Redonda plana de 3" (7.6 cm)


%(3'(

Verde

%(3'#

negro

%(3'4

Arena

%(3'$

Gris

5VCFSBEF
triple pared de
3" (7.6 cm)

5VCFSBEFBMDBOUBSJMMBZ
drenaje de 3" (7.6 cm)
"45.%

5VCFSBDPSSVHBEBEF
3" (7.6 cm)

Accesorios de alcantarilla y
drenaje de 3" (7.6 cm)
4%3

(4.8 mm)

Redonda plana de 4" (10.2 cm)


%(3'(

Verde

%(3'#

negro

%(3'4

Arena

%(3'$

Gris

5VCFSBEF
triple pared de
4" (10.2 cm)

5VCFSBEFBMDBOUBSJMMBZ
drenaje de 4" (10.2 cm)
"45.%

Accesorios de alcantarilla y
drenaje de 4" (10.2 cm)

(6.3 mm)

5VCFSBDPSSVHBEBEF
4" (10.2 cm)

4%3

5VCFSBEF
alcantarilla de
6" (15.2 cm)

5VCFSBEFBMDBOUBSJMMBZ
drenaje de 6" (15.2 cm)

Accesorios de alcantarilla
y drenaje de 6" (15.2 cm)

"45.%

4%3

516"

"45.% 
4%3

5VCFSBDPSSVHBEBEF
6" (15.2 cm)

Cuencas recolectoras
redondas de 6" (15.2 cm)

(10.5 mm)

Redonda plana de 6" (15.2 cm)


%(3'(

Verde

%(3'#

negro

%(3'4

Arena

%(3'$

Gris

%#3Z%#3)

%(3"(

Verde

%(3"#

negro

%(3"4

Arena

5VCFSBEF
triple pared de
3" (7.6 cm)

Atrio plano de 4" (10.2 cm)


%(3"(

Verde

%(3"#

negro

%(3"4

Arena

5VCFSBEF
triple pared de
4" (10.2 cm)

5VCFSBEFBMDBOUBSJMMBZ
drenaje de 3" (7.6 cm)
"45.%

5VCFSBDPSSVHBEBEF
3" (7.6 cm)
5VCFSBEFBMDBOUBSJMMBZ
drenaje de 4" (10.2 cm)
"45.%

Accesorios de alcantarilla y
drenaje de 3" (7.6 cm)
4%3

Accesorios de alcantarilla y
drenaje de 4" (10.2 cm)

5VCFSBDPSSVHBEBEF
4" (10.2 cm)

4%3

5VCFSBEF
alcantarilla de
6" (15.2 cm)

5VCFSBEFBMDBOUBSJMMBZ
drenaje de 6" (15.2 cm)

Accesorios de alcantarilla
y drenaje de 6" (15.2 cm)

"45.% 
4%3

5VCFSBDPSSVHBEBEF
6" (15.2 cm)

(6.3 mm)

(10.5 mm)

Atrio plano de 6" (15.2 cm)


%(3"(

Verde

%(3"#

negro

%(3"4

Arena

"45.%

4%3

Cuencas recolectoras
redondas de 6" (15.2 cm)

38"
(12.6 mm)

%#3Z%#3)

1 Solo rejilla plana


2 Mxima clasificacin de carga basada en la cuenca empotrada en concreto y con el peso aplicado uniformemente sobre toda la superficie de la rejilla

El uso inteligente del agua.

223

Drenaje

Atrio plano de 3" (7.6 cm)

Productos de drenaje
Rejillas cuadradas de plstico

Rejillas cuadradas de plstico


Plano

Caractersticas
t 'BCSJDBEPTDPOFTQVNBEFQPMJFUJMFOPFTUSVDUVSBMEFBMUB
EFOTJEBE )%1&

t Estabilizado con UV para proteger contra la degradacin


producida por el sol
t Perfiles planos y de atrio (en forma de domo)
t Rejillas planas disponibles en verde, negro, arena y gris
t Rejillas atrio disponibles en verde y negro
t Para cuencas recolectoras cuadradas de 9" (22.9 cm), 12"
(30.5 cm) y 18" (45.7 cm)
Para cuencas cuadradas de perfil bajo de 9" (22.9 cm) y
12" (30.5 cm)
Superficie texturizada y antideslizante 1

9" (22.9 cm)

12" (30.5 cm)

DG9RFG

DG12SFG

18" (45.7 cm)


DG12SFG

Atrio

t Carga clasificada para autos y camiones ligeros a


velocidades menores a 20 mi/h (30 kmh) 1, 2
t Incluye dos orificios para tornillos para asegurar la
cuenca 3
t $PODFSUJGJDBDJO"%"1
t 'BCSJDBEPFO&&66

Nmero de modelo

Color

9" (22.9 cm)

12" (30.5 cm)

DG9RFG

DG12SFG

Ajuste

Ancho de
ranura abierta

rea de
superficie
abierta

ndice de
caudal
mximo

Carga mxima

38"

38 sq in
245.16 cm

50 GPM
(189.3 l/m)

2,000 lb.
(907.2 kg)

53 sq in
341.93 cm

70 GPM
(265.0 l/m)

3,000 lb.
(1360.8 kg)

92 sq in
593.55 cm

120 GPM
(454.2 l/m)

4,000 lb.
(1814.4 kg)

31 sq in
200.00 cm

40 GPM
(151.4 l/m)

/%

50 sq in
322.58 cm

65 GPM
(246.1 l/m)

/%

Cuadrada plana de 9" (22.9 cm)


%(4'(

Verde

%(4'#

negro

%(4'4

Arena

%(4'$

Gris

Cuencas recolectoras cuadradas de


9" (22.9 cm) %#3

Cuencas de perfil bajo de 9" (22.9 cm)

(12.6 mm)

%#4-1

Cuadrada plana de 12" (30.5 cm)


%(4'(

Verde

%(4'#

negro

%(4'4

Arena

%(4'$

Gris

Cuencas recolectoras cuadradas


de 12" (30.5 cm)
%#4Z%#4

Cuencas de perfil bajo de


12" (30.5 cm) %#4-1

716"
(14.7 mm)

Cuadrada plana de 18" (45.7 cm)


%(4'(

Verde

%(4'#

negro

Cuencas recolectoras cuadradas


de 18" (45.7 cm)

%(4'4

Arena

%#4Z%#4

%(4'$

Gris

1532"
(15.8 mm)

Cuadrada atrio de 9" (22.9 cm)


Drenaje

%(4"(

Verde

%(4"#

negro

Cuencas recolectoras cuadradas


de 9" (22.9 cm) %#3

Cuencas de perfil bajo


de 9" (22.9 cm) %#4-1

38"
(12.6 mm)

Cuadrada atrio de 12" (30.5 cm)


%(4"(

Verde

Cuencas recolectoras cuadradas


de 12" (30.5 cm)

%(4"#

negro

Cuencas de perfil bajo


de 12" (30.5 cm) %#4-1

%#4Z%#4

716"
(14.7 mm)

1 Solo rejilla plana


2 Mxima clasificacin de carga basada en la cuenca empotrada en concreto y con el peso aplicado uniformemente sobre toda la superficie de la rejilla
3 Use tornillos Phillips n. 6 de 1.5" (3.8 cm) de largo de cabeza plana de acero inoxidable

224

El uso inteligente del agua.

Productos de drenaje

www.rainbird.com/drainage

Rejillas cuadradas universales

Rejillas cuadradas universales


Caractersticas
t 'BCSJDBEPTDPOFTQVNBEFQPMJFUJMFOPFTUSVDUVSBMEF
BMUBEFOTJEBE )%1&

t Con superficie texturizada y


antiderrapante

t Estabilizado con UV para proteger contra la


degradacin producida por el sol

t Carga clasificada para trfico peatonal 1

t %JTQPOJCMFTFOWFSEF OFHSP BSFOBZHSJT

t 'BCSJDBEPFO&&66

Nmero de
modelo

Color

t $PODFSUJGJDBDJO"%"
DG7USG

Ajuste

Ancho de
ranura abierta

rea de
superficie
abierta

ndice de
caudal mximo

Carga
mxima

13 sq in
(83.87 cm)

11 GPM
(41.6 l/m)

250 lb.
(113.4 kg)

Plano cuadrado universal de 7" (17.8 cm)


%(64(

Verde

%(64#

negro

%(644

Arena

%(64$

Gris

tCuencas recolectoras redondas de 6" (15.2 cm) %#3Z%#3

t5VCFSBEFBMDBOUBSJMMBZESFOBKFEF DN
 "45.%

t5VCFSBDPSSVHBEBEF DN
P DN

t5VCFSBEFQBSFEUSJQMFEF DN
P DN

tAccesorios de alcantarilla y drenaje de 3" (7.6 cm), 4" (10.2 cm)

(6.3 mm)

o 6" (15.2 cm) 4%3

1 Mxima clasificacin de carga basada en la cuenca empotrada en concreto y con el peso aplicado uniformemente sobre toda la superficie de la rejilla

Cuencas recolectoras redondas


Caractersticas
t 'BCSJDBEPDPOQPMJFUJMFOPEFBMUPJNQBDUP )*14

t Estabilizado con UV para proteger contra la degradacin producida por


el sol
t %JTQPOJCMFFONPEFMPTEFVOBZEPTTBMJEBT
t Acepta rejillas planas de 6" (15.2 cm), rejillas atrio de 6" (15.2 cm) y rejillas
universales de 7" (17.8 cm)
t Las salidas universales se usan para conectar tuberas de
BMDBOUBSJMMBZESFOBKFEF DN
Z DN
 "45.%
PUVCFSBT
corrugadas de 4" (10.2 cm) y tuberas de pared triple de 4" (10.2 cm).
t Incluye un depsito para permitir que los sedimentos se depositen en la
cuenca para reducir al mnimo la posibilidad de que se tapen las tuberas.

DB6R1

t Para extender la altura de la cuenca, use tubera de PVC de 6" (15.2 cm) y
"45.% 4%3
DPNPFMFWBEPS
t 'BCSJDBEPFO&&66

Nmero de
modelo

DB6R2

Cantidad de
salidas

A la entrada (superior) le caben

A la salida (lateral) le cabe

Capacidad

Capacidad del
depsito

0.8 gal.
(3.0 l)

0.2 gal.
(0.75 l)

0.8 gal.
(3.0 l)

0.2 gal.
(0.75 l)

%#3

tRejillas redondas planas y de atrio de 6" (15.2 cm) t5VCFSBDPSSVHBEBEF DN


P DN

t5VCFSBEFQBSFEUSJQMFEF DN
P
tRejilla universal cuadrada de 7" (17.8 cm)
t5VCFSB17$EF DN
 "45.% "45.%  4" (10.2 cm)
4%3

t5VCFSBEFBMDBOUBSJMMBZESFOBKF "45.%

Drenaje

1 salida redonda de 6" (15.2 cm)

Redonda de 6" (15.2 cm), 2 salidas

%#3

tRejillas redondas planas y de atrio de 6" (15.2 cm) t5VCFSBDPSSVHBEBEF DN


P DN

t5VCFSBEFQBSFEUSJQMFEF DN
P
tRejilla universal cuadrada de 7" (17.8 cm)
t5VCFSB17$EF DN
 "45.% "45.%  4" (10.2 cm)
4%3

t5VCFSBEFBMDBOUBSJMMBZESFOBKF "45.%

El uso inteligente del agua.

225

Productos de drenaje
Cuencas recolectoras cuadradas

Rejillas cuadradas

DB18S2

Caractersticas
t 'BCSJDBEPTDPOFTQVNBEFQPMJFUJMFOPEFBMUBEFOTJEBE )%1&

t Estabilizado con UV para proteger contra la degradacin producida


por el sol
t Las cuencas de 12" (30.5 cm) y 18" (45.7 cm) tienen dos o cuarto salidas
adems de una salida opcional perforada en la parte inferior de la
cuenca
t Use un adaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm) para conectar
la cuenca a la tubera corrugada de 3" (7.6 cm) y 4" (10.2 cm) y a la
tubera de triple pared de 3" (7.6 cm) y 4" (10.2 cm)
t Use un adaptador de cuenca de 6" (15.2 cm) para conectar la cuenca a
MBUVCFSBEF17$EF DN
 "45.%Z"45.% 4%3

y a la tubera corrugada de 6" (15.2 cm)
t Use un tapn de cuenca para para tapar las salidas que no se usen
t Use elevadores de cuenca cuadrada de 9" (22.9 cm) o 12" (30.5 cm)
para extender 6" (15.2 cm) la altura de las cuencas de 9" (22.9 cm) y
12" (30.5 cm) respectivamente

DB12S4

t Acepta rejillas planas de 9" (22.9 cm), 12" (30.5 cm) o 18" (45.7 cm) y
rejillas atrio cuadradas

DB18S4

t Incluye un depsito para permitir que los sedimentos se depositen


en la cuenca para reducir al mnimo la posibilidad de que se tapen las
tuberas.

DB12S2

t Incluye cuatro orificios para tornillo para permitir que las rejillas se
aseguren a la cuenca
DB9S2

t 'BCSJDBEPFO&&66

Nmero
de
modelo

Cantidad
de
salidas

A la entrada (superior) le caben

Capacidad

Capacidad
del
depsito

tConexin de cuenca %#""1

tAdaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm)


%#""P%#""0

tAdaptador de cuenca de 6" (15.2 cm) %#""

2.2 gal.
(8.3 l

0.5 ga.
(1.70 l)

tConexin de cuenca %#""1

tAdaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm)


%#""P%#""0

tAdaptador de cuenca de 6" (15.2 cm) %#""

5.1 gal.
(19.3 l)

1.3 gal.
(4.7 l)

tConexin de cuenca %#""1

tAdaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm)


%#""P%#""0

tAdaptador de cuenca de 6" (15.2 cm) %#""

5.1 gal.
(19.3 l)

1.3 gal.
(4.7 l)

tConexin de cuenca %#""1

tAdaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm)


%#""P%#""0

tAdaptador de cuenca de 6" (15.2 cm) %#""

16.7 ga.
(2.8 l)

4.9 gal.
(18.5 l)

tConexin de cuenca %#""1

tAdaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm)


%#""P%#""0

tAdaptador de cuenca de 6" (15.2 cm) %#""

16.7 ga.
(2.8 l)

4.9 gal.
(18.5 l)

A la salida (lateral) le cabe

Cuadrada de 9" (22.9 cm), 2 salidas


%#4

tRejilla cuadrada plana de 9" (22.9 cm)


tRejilla cuadrada atrio de 9" (22.9 cm)
tElevador de cuenca cuadrada de 9" (22.9 cm) %#3&

Cuadrada de 12" (30.5 cm), 2 salidas


%#4

tRejilla cuadrada plana de 12" (30.5 cm)


tRejilla cuadrada atrio de 12" (30.5 cm)
tElevador de cuenca cuadrada de 12" (30.5 cm)
%#3&

Cuadrada de 12" (30.5 cm), 4 salidas


%#4

tRejilla cuadrada plana de 12" (30.5 cm)


tRejilla cuadrada atrio de 12" (30.5 cm)
tElevador de cuenca cuadrada de 12" (30.5 cm)

Drenaje

%#3&

Cuadrada de 18" (45.7 cm), 2 salidas


%#4

tRejilla cuadrada plana de 18" (45.7 cm)

Cuadrada de 18" (45.7 cm), 4 salidas


%#4

226

tRejilla cuadrada plana de 18" (45.7 cm)

El uso inteligente del agua.

Productos de drenaje

www.rainbird.com/drainage

Cuencas de perfil bajo cuadradas y kits de cuencas cuadradas

Rejillas cuadradas de bajo perfil


Caractersticas
t 'BCSJDBEPDPOQPMJFUJMFOPEFBMUPJNQBDUP )*14

t Estabilizado con UV para proteger contra la degradacin producida por el sol


t Una salida inferior diseada para aceptar todos los adaptadores de cuenca
t Use un adaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm) para conectar a la
tubera corrugada de 3" (7.6 cm) y 4" (10.2 cm) y la tubera de triple pared de
3" (7.6 cm) y 4" (10.2 cm)
t Use un adaptador de cuenca de 6" (15.2 cm) para conectar tubera de PVC de
 DN
 "45.%Z"45.% 4%3
ZMBUVCFSBDPSSVHBEBEF
6" (15.2 cm)

DB9SLP

t Acepta rejillas cuadradas planas de 9" (22.9 cm) y 12" (30.5 cm)
t Acepta rejillas cuadradas atrio de 9" (22.9 cm) y 12" (30.5 cm)
t Incluye dos orificios para tornillo para permitir que las rejillas se fijen a la
cuenca de perfil bajo
t 'BCSJDBEPFO&&66
Nmero de
modelo

A la entrada (superior) le caben

A la salida (lateral) le cabe

Cuadrada de 9" (22.9 cm)


%#4-1

tRejilla cuadrada plana de 9" (22.9 cm)


tRejilla cuadrada atrio de 9" (22.9 cm)
tElevador de cuenca cuadrada de 9" (22.9 cm)
(%#3&)

DB12SLP

tAdaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm)


%#""P%#""0

tAdaptador de cuenca de 6" (15.2 cm) %#""

Cuadrada de 12" (30.5 cm)


%#4-1

tRejilla cuadrada plana de 12" (30.5 cm)


tRejilla cuadrada atrio de 12" (30.5 cm)
tElevador de cuenca cuadrada de 12" (30.5 cm)
%#3&

tAdaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm)


%#""P%#""0

tAdaptador de cuenca de 6" (15.2 cm) %#""

Kits de rejillas cuadradas


Para su conveniencia, estn disponibles kits de cuenca con las cuencas, rejillas y los
componentes de adaptador ms populares que se requieren para la mayora de los trabajos.
Nmero de
modelo

Cada equipo incluye

Equipo de cuenca cuadrada de 9" (22.9 cm)


%#,*5(

tCuencas cuadradas de 9" (22.9 cm) t$POFYJOEFDVFODB %#""1

DPOEPTTBMJEBT %#3

cuadrada plana de
t%PTBEBQUBEPSFTEF DN
Z tR9"ejilla
(22.9 cm) 7&3%& %(4'(

 DN
 %#""

tCuencas cuadradas de 9" (22.9 cm) t$POFYJOEFDVFODB %#""1

DPOEPTTBMJEBT %#3

cuadrada plana de
t%PTBEBQUBEPSFTEF DN
Z tR9"ejilla
(22.9 cm) NEGRA %(4'#

Drenaje

%#,*5#

 DN
 %#""

Kit de cuenca cuadrada de 12" (30.5 cm) (no se muestra)


%#,*5(

tCuencas cuadradas de 12" (30.5 cm) t$POFYJOEFDVFODB %#""1

DPOEPTTBMJEBT %#4

cuadrada plana de
t%PTBEBQUBEPSFTEF DN
Z tR12"ejilla(30.5
cm) 7&3%& %(4'(

 DN
 %#""

%#,*5#

tCuencas cuadradas de 12" (30.5 cm) t$POFYJOEFDVFODB %#""1

DPOEPTTBMJEBT %#4

cuadrada plana de
t%PTBEBQUBEPSFTEF DN
Z tR12"ejilla(30.5
cm) NEGRA %(4'#

 DN
 %#""

El uso inteligente del agua.

DB9KITG

227

Productos de drenaje
Vlvulas retrctiles para drenaje

Vlvulas retrctiles para drenaje


Caractersticas
t %JTQPOJCMFFODVBUSPDPOGJHVSBDJPOFT
t Cuerpo de vlvula retrctil fabricado con espuma de polietileno estructural
EFBMUBEFOTJEBE )%1&

t Codo (donde se requiera) fabricado en PVC


t Adaptador (cuando sea necesario) fabricado con polietileno de alto impacto
(HIPS)
t Estabilizado con UV para proteger contra la degradacin producida por el sol
t 6OBDPCFSUVSBBDUJWBEBQPSSFTPSUFTFFMFWBQBSBEFTDBSHBSFMFYDFTPEF
agua en el sistema
t El resorte retrae automticamente la cobertura a la posicin cerrada despus
de que se ha descargado el exceso de agua

DPUV3E
DPUV0

t Se puede usar tanto en posicin horizontal como vertical


t Resorte de acero inoxidable para evitar que se oxide
t Los codos de PVC (cuando sea necesario) incluyen un orificio de drenaje de
QBSBFMJNJOBSFMBHVBFTUBODBEB
t 'BCSJDBEPFO&&66

DPUV4E
DPUV4EHUB

Color

Descripcin

%167

Verde

Vlvula retrctil para drenaje

%167&

Verde

Vlvula retrctil de drenaje con codo de PVC de 3" (7.6 cm)

t5VCFSBEFBMDBOUBSJMMBZESFOBKFEF DN
 "45.%

t5VCFSBEFQBSFEUSJQMFEF DN

%167&

Verde

Vlvula retrctil de drenaje con codo de PVC de 4" (10.2 cm)

t5VCFSBEFBMDBOUBSJMMBZESFOBKFEF DN
 "45.%Z%

t5VCFSBEFQBSFEUSJQMFEF DN

%167&)6#

Verde

Vlvula retrctil de drenaje con codo y adaptador de PVC


de 4" (10.2 cm) (%1"')")

Drenaje

Nmero de
modelo

228

Conexin con

tAccesorios de alcantarilla y drenaje de 3" (7.6 cm) o 4" (10.2 cm) 4%3

t5VCFSBDPSSVHBEBEF DN
P DN

t5VCFSBEFQBSFEUSJQMFEF DN
P DN

t5VCFSBEFBMDBOUBSJMMBZESFOBKFEF DN
 "45.%

El uso inteligente del agua.

Productos de drenaje

www.rainbird.com/drainage

Adaptadores y accesorios para rejillas

Adaptadores y accesorios para rejillas


Nmero de
modelo

Descripcin

%#""1

Conexin de cuenca

%#""

Adaptador de cuenca de 3" (7.6 cm)


y 4" (10.2 cm)

%#""0

Adaptador de compensacin para


cuenca de 3" (7.6 cm) y 4" (10.2 cm)

Uso

t5BQBEFDVFODBTSFDPMFDUPSBTDVBESBEBTEF DN

12" (30.5 cm) y 18" (45.7 cm)

tAdapta salidas laterales de cuencas cuadradas de 9" (22.9 cm),


12" (30.5 cm) y 18" (45.7 cm) y salidas de cuencas de bajo perfil
de 9" (22.9 cm) y 12" (30.5 cm) a la tubera de PVC y corrugada
de 3" (7.6 cm) o 4" (10.2 cm)

tAdapta salidas laterales de cuencas cuadradas de 9" (22.9 cm),


12" (30.5 cm) y 18" (45.7 cm) y salidas de cuencas de bajo perfil
de 9" (22.9 cm) y 12" (30.5 cm) a la tubera de PVC y corrugada
de 3" (7.6 cm) o 4" (10.2 cm)

tAdapta salidas laterales de cuencas cuadradas de 9" (22.9 cm),


%#""

%1"')

Adaptador de cuenca de 6" (15.2 cm)

Adaptador de ajuste

Elevador de cuenca cuadrada de 9" (22.9


cm)

%#3&

Elevador de cuenca cuadrada de


12" (30.5 cm)

tAdapta tubera de pared triple de 3" (7.6 cm) o 4" (10.2 cm) a
tubera PVC y corrugada de 3" (7.6 cm) o 4" (10.2 cm)

tAumenta 6" (15.2 cm) a la altura de la cuenca cuadrada de


9" (22.9 cm) o a la cuenca de perfil bajo de 9" (22.9 cm)
Drenaje

%#3&

12" (30.5 cm) y 18" (45.7 cm) y salidas de cuencas de bajo perfil
de 9" (22.9 cm) y 12" (30.5 cm) a la tubera de PVC y corrugada
de 6" (15.2 cm)

El uso inteligente del agua.

tExtiende la altura de la cuenca cuadrada de 12" (30.5 cm)


o 6" (15.2 cm) a la cuenca de perfil bajo de 12" (30.5 cm)

229

www.rainbird.com/resources
Cuerpos
de difusores

Recursos
Introduccin
Cuerpos de
aspersores
Boquillas aspersoras
Rotores
Impactos

Programa de recompensas Rewards


Vlvulas
Accesorios

Rain Bird ofrece programas de recompensas


Rewards para agencias pblicas o sin
fines de lucro y contratistas de sistemas
de riego. Con Rain Bird Rewards y Agency
Rewards, puede acumular valiosos puntos
solo por comprar la lnea ms extensa de
productos de riego y drenaje en jardines
disponible. Cambie los puntos del programa
de recompensas Rewards para obtener
ms productos de Rain Bird, material de
marketing u otros artculos diseados para
contribuir al xito de su empresa.

Programadores
Sistemas de control
centralizado
Xerigation
Bombas

Sugerencias para ahorrar agua

Drenaje

t Rain Bird Rewards ofrece

Recursos

materiales de marketing
profesional que los contratistas
pueden utilizar para informar a
sus clientes sobre los beneficios y
las ventajas de los productos para
el ahorro de agua.

t Los folletos de productos de


riego eficiente, las tarjetas
postales y los colgantes de
puerta le ayudan a mostrar los
productos Rain Bird que ofrecen
ahorro de agua.

t Una serie de informes tcnicos que investigan


las causas y establecen posibles soluciones
para la creciente crisis mundial de agua;
campaas de difusin de inters pblico para
la televisin con sugerencias destinadas a los
propietarios sobre la reduccin del
desperdicio de agua en exteriores; y planes de
estudios sobre el consumo de agua para
escuelas primarias y secundarias.

Referencia

230

El uso inteligente del agua.

Recursos

www.rainbird.com/resources

Programas de recompensas Rewards

Programas de recompensas Rewards


Rain Bird Rewards

Rain Bird Agency Rewards

Rain Bird Rewards es el programa de recompensas nmero 1 para los


profesionales paisajistas y de riego. Puede ganar puntos en todos los productos
EFSJFHPZESFOBKFFOKBSEJOFTEF3BJO#JSE QBSUJDJQBOUFTBTQFSTPSFT SPUPSFT 
vlvulas, controladores, riego por goteo, estaciones de bombeo, rejillas de
drenaje, cuencas de drenaje y accesorios.

Rain Bird sabe que las agencias deben aprovechar al mximo cada dlar que se gasta
en riego. Rain Bird Agency Rewards contribuye a que reinviertan el presupuesto de
riego en la agencia y la gente. Los premios del programa de recompensas incluyen:

Existen tres niveles de membresa en el programa de recompensas


Rewards:
Por cada $100
que usted gaste,
ganar:

Por cada $100 que usted


gaste por encima de su
objetivo bsico, ganar:

Puntos bsicos

Puntos de crecimiento

Rewards Contractor

60 puntos

160 puntos

Select Contractor

80 puntos

200 puntos

100% Select Contractor

100 puntos

200 puntos

Nivel de programa

Puede encontrar una lista completa de requisitos en


ww2.rainbird.com/rewards

t$BQBDJUBDJOFOSJFHP
t'POEPTQBSBEFTBSSPMMPQSPGFTJPOBM
t-JUFSBUVSBEFSFGFSFODJBEFMBJOEVTUSJBZMPTQSPEVDUPT
t$SEJUPQBSBFMEJTUSJCVJEPS

Cmo solicitar folletos


t3FBMJDFTVQFEJEPBUSBWTEFMSFQSFTFOUBOUFEFTFSWJDJPEFEJTUSJCVDJOEF3BJO#JSE
t/NFSPTEFNPEFMP
 (VBQBSBNJFNCSPTEF3BJO#JSE3FXBSET%%
 %Y 'PMMFUPEFMQSPHSBNBEFSFDPNQFOTBT3BJO#JSE3FXBSET
 %Y 'PMMFUPEFJOTDSJQDJOB3BJO#JSE3FXBSET
 %Y 'PMMFUPEFJOTDSJQDJOB3BJO#JSE3FXBSET TPMPQBSB$BOBE

 %Y 'PMMFUPEFJOTDSJQDJOB3BJO#JSE"HFODZ3FXBSET
 %Y 'PMMFUPEFJOTDSJQDJOB3BJO#JSE"HFODZ3FXBSET TPMPQBSB$BOBE

Los contratistas pueden cambiar los puntos por los siguientes


artculos importantes:

 %Y 'PMMFUPEFMQSPHSBNBEFSFDPNQFOTBT3BJO#JSE"HFODZ3FXBSET

t4FSWJDJPTEFNBSLFUJOHZQVCMJDJEBE

Informacin sobre la inscripcin al programa

t.FSDBEFSBRVFJODMVZFFMFDUSOJDB JOEVNFOUBSJBZIFSSBNJFOUBT

Para inscribirse en Rain Bird Rewards o Rain Bird Agency Rewards, o para obtener ms
informacin sobre el programa, visite www.rainbird.com/rewards o llame a la oficina del
programa de recompensas Rain Bird Rewards al +1 (888) 370-1814.

t5BSKFUBTEFSFHBMP
t$SEJUPQBSBFMEJTUSJCVJEPS
t$BQBDJUBDJOFOSJFHP
t&GFDUJWP

Recursos

* Los miembros del programa acumulan puntos con la compra de productos de riego paisajstico calificados de Rain
Bird a travs de distribuidores autorizados de Rain Bird. Los productos de riego paisajstico incluyen todos los productos
accesorios, comerciales, residenciales y de riego por goteo, pero no incluyen productos o piezas agrcolas, para golf, de control
centralizado o para el consumidor, o ningn otro producto que Rain Bird designe como no calificado. Rain Bird se reserva el
derecho de modificar o suspender los programas de recompensas Rain Bird Rewards o Rain Bird Agency Rewards segn los
SFTQFDUJWPT"DVFSEPTEFMPTQSPHSBNBT EJTQPOJCMFTFOXXXSBJOCJSEDPNSFXBSET


El uso inteligente del agua.

231

Recursos
1SPHSBNB'BDUPSZ5SBJOFEEF3BJO#JSE

Programa "Factory Trained" de Rain Bird


&MQSPHSBNB'BDUPSZ5SBJOFE FOUSFOBEPEFGCSJDB
EF3BJO#JSEFTUEJTFBEP
para ofrecerle a los profesionales un profundo entrenamiento de alto nivel
sobre los productos de Rain Bird y sobre las mejores prcticas de operacin e
JOTUBMBDJO&MQSPHSBNB'BDUPSZ5SBJOFEEF3BJO#JSEMFPGSFDFUSBORVJMJEBE
al diseador o al propietario del sistema de control centralizado a la hora de
elegir a un contratista, y el contratista recibe una designacin y una marca que
puede utilizar para promover su experiencia y servicio con sus clientes.
El programa "Entrenado por la fbrica" de Rain Bird tiene designaciones en las
siguientes categoras:

Instalador entrenado de fbrica


Enfoque: Aprender los procedimientos de instalacin y las mejores prcticas
para los productos y sistemas Rain Bird.
tInstalador de control centralizado: procedimientos de instalacin de
hardware y mejores prcticas utilizando todos los productos de Rain Bird de
control centralizado para sitios de nivel comercial y golf.

Operador entrenado de fbrica


Enfoque: optimizar las funciones del software de control centralizado de
Rain Bird, tales como la gestin de caudal, la programacin basada en la
evapotranspiracin, las opciones de comunicacin y muchas otras funciones.

Factory Trained

Existen designaciones para los operadores en las siguientes reas:


t.BYJDPN2

Your Name Here

t4JUF$POUSPM
t*2W
t$POUSPMBEPSEFMBTFSJF&41-9

CENT

R A L CO NTROL IN S TA L L E R

Tcnico entrenado de fbrica


Enfoque: aprender cmo mantener, solucionar problemas y reparar
discrepancias en el sistema de manera eficiente as como retirar y reemplazar
los componentes de hardware.
Existen designaciones para los tcnicos en las siguientes reas:
t.BYJDPN2

Factory Trained

t4JUF$POUSPM
t4JUF4VSWFZ

CENT

t*2 v 2.0

En 2013 habr ms designaciones disponibles para los sistemas de riego


residencial, de bombas y de golf.

R A L CO NTROL IN S TA L L E R

M A X IC OM TECHN IC IA N

M A XI CO M OPER AT O R

Recursos

Rain Bird International, Inc. -- Services


Division (Divisin de servicios) es el
proveedor exclusivo del programa
"Entrenado por la fbrica" de Rain Bird y de
las designaciones para Rain Bird.

Para conocer los precios y registrarse en los cursos, visite nuestro sitio web.

232

El uso inteligente del agua.

Introduccin

Cuerpos de difusores
Referencia
Su recurso de informacin 24x7

Boquillas aspersoras

Cuerpos de
aspersores

El sitio web de Rain Bird centraliza toda la informacin ms


reciente sobre los productos y las ltimas noticias de Rain
Bird. Vistelo en cualquier momento del da o de la noche y
descargue justo lo que necesita para ser ms eficaz al trabajar.
Conozca los productos ms nuevos de Rain Bird, consulte
grficos de rendimiento, descargue esquemas detallados en
$"%ZNVDIPNT

Impactos

Rotores

Visite www.rainbird.com hoy mismo y explore este


recurso con la tecnologa ms avanzada.

'BDFCPPL

www.facebook.com/RainBirdCorp

El uso inteligente del agua

www.rainbird.com/IUOW

#JCMJPUFDBEF-&&%

XXXSBJOCJSEDPN-&&%

.BYJDPN%PMMBST

XXXSBJOCJSEDPNNBYJDPNEPMMBSTt$PSSFPFMFDUSOJDPNBYJDPN!SBJOCJSE
com

'PUPHSBGBTZMPHPUJQPT

www.rainbird.com/library

Catlogo de productos

www.rainbird.com/catalog

%FNPTUSBDJPOFTEFQSPEVDUPTZHVBTJOUFSBDUJWBT

www.rainbird.com/landscape (Seleccione un producto de la lista en el men de


la izquierda)

Especificaciones tcnicas y literatura de productos

www.rainbird.com/landscape/support

Rain Bird Agency Rewards (agencias gubernamentales y


sin fines de lucro)

XXXSBJOCJSEDPNBHFODZt$PSSFPFMFDUSOJDPSFXBSET!SBJOCJSEDPN

Servicios de ingeniera de Rain Bird

$PSSFPFMFDUSOJDPSCTDFOH!SBJOCJSEDPN

Programas de recompensas Rewards

XXXSBJOCJSEDPNSFXBSETt$PSSFPFMFDUSOJDPSFXBSET!SBJOCJSEDPN

Servicios y capacitacin de Rain Bird

www.rainbirdservicescorporation.com

Museo virtual de Rain Bird

www.rainbird.com/museum

5XJUUFS

www.twitter.com/rainbirdcorp

Calculadoras de eficiencia del agua

www.rainbird.com/calculators

Cursos va Internet

www.rainbird.com/webinars

:PV5VCF

www.youtube.com/rainbirdcorp

El uso inteligente del agua.

Accesorios

ww2.rainbird.com/turfdistributor/newlogin.htm

Programadores

Sitio web del portal para distribuidores

Sistemas de control
centralizado

www.rainbird.com/landscape (Seleccione un producto de la lista en el men de


la izquierda)

Xerigation

Recursos de diseo y especificaciones

Bombas

http://bidsupport.rainbird.com

Drenaje

Soporte para cotizaciones

Recursos

Contactos/Informacin

Referencia

Programas y recursos de marketing

Vlvulas

Lista de contactos y recursos en lnea de Rain Bird

233

Referencia
Cmo usar este catlogo, prdida de presin
a travs de medidores de agua

Cmo usar este catlogo

Prdida de presin a travs de medidores de agua

ndices de precipitacin
Rain Bird ha calculado por usted los ndices de precipitacin correspondientes
a nuestras completas lneas de impactos, aspersores y rotores. Esta
informacin muestra el ndice aproximado en que se est aplicando el agua. A
continuacin presentamos las ecuaciones utilizadas para calcular los ndices de
precipitacin:

Patrn de distribucin
cuadrado
EE.UU.:
Sistema mtrico:

Patrn de distribucin
triangular
EE.UU.:
Sistema mtrico:

PR=96.3 x gpm
SxS

PR=96.3 x gpm
SxL

PR=1000 x m /h
SxS
3

PR=1000 x m /h
SxL
3

DPOTUBOUF QVMHBEBTQJFDVBESBEPIPSB

DPOTUBOUF NJMNFUSPNFUSPDVBESBEPIPSB

HQNHBMPOFTQPSNJOVUP BQMJDBEPTBMSFBDPOMPTBTQFSTPSFT

m3INFUSPTDCJDPTQPSIPSB DPSSFTQPOEJFOUFTBMSFBDPOMPTBTQFSTPSFT

4FTQBDJBNJFOUPFOUSFBTQFSTPSFT
-FTQBDJBNJFOUPFOUSFGJMBT 4Y

Informacin de especificaciones
La informacin de este catlogo era exacta en el momento de su impresin y
puede utilizarse para ver las especificaciones correspondientes a cada producto.
Si desea obtener informacin ms actualizada, visite el sitio web de Rain Bird en
www.rainbird.com.

Declaracin de certificacin de conformidad con la prueba ASABE


Rain Bird Corporation certifica que los datos de presin, ndice de caudal y
radio de sus productos fueron determinados y aprobados de acuerdo con la
Norma ASABE S398.1, Procedimiento para prueba de aspersores e informe de
rendimiento, y que representan el rendimiento de los aspersores producidos a
la fecha de publicacin. El rendimiento real de los productos puede diferir de las
especificaciones publicadas debido a las variaciones normales de fabricacin y la
TFMFDDJOEFNVFTUSBT5PEBTMBTEFNTFTQFDJGJDBDJPOFTDPOTUJUVZFOOJDBNFOUF
recomendaciones de Rain Bird Corporation.

Cuadros de referencia
La informacin de este catlogo est basada en frmulas, clculos y prcticas
del sector generalmente aceptadas. Rain Bird Corporation, y sus subsidiarias
y filiales, no sern por lo tanto responsables si se produjesen problemas,
dificultades o lesiones ocasionadas o relacionadas con el uso o la aplicacin de
esta informacin, o si existiese algn error de tipografa u otra naturaleza en la
presente publicacin.

Asistencia tcnica
La asistencia tcnica de Rain Bird tiene las respuestas a sus preguntas sobre
productos especficos y administracin de agua. Llame a nuestros nmeros
gratuitos de Servicio tcnico o Especificaciones, o bien, para mayor comodidad,
visite el sitio web de Rain Bird. Obtendr una opinin experta y las soluciones
adecuadas.

Servicio tcnico
3"*/#*3%
(1-800-724-6247)

Referencia

234

Lnea de
especificaciones

Direccin en
internet

1-800-458-3005

www.rainbird.com

Prdida de presin: psi


5BNBPOPNJOBM

Caudal
gpm

5/8"

3/4"

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
22
24
26
28
30
32
34
36
38
40
42
44
46
48
50
52
54
56
58
60
65
70
75
80
90
100
110
120
130
140
150
160
170
180
190
200
220
240
260
280
300
350
400
450
500

0.2
0.3
0.4
0.6
0.9
1.3
1.8
2.3
3.0
3.7
4.4
5.1
6.1
7.2
8.3
9.4
10.7
12.0
13.4
15.0

0.1
0.2
0.3
0.5
0.6
0.7
0.8
1.0
1.3
1.6
1.9
2.2
2.6
3.1
3.6
4.1
4.6
5.2
5.8
6.5
7.9
9.5
11.2
13.0
15.0

1"

1 1/2"

2"

3"

4"

Cuadros de
0.1
0.2
0.3
0.4
0.5
0.6
0.7
0.8
0.9
1.0
1.1
1.2
1.4
1.6
1.8
2.0
2.2
2.8
3.4
4.0
4.6
5.3
6.0
6.9
7.8
8.7
9.6
10.6
11.7
12.8
13.9
15.0

referencia
de prdida
de presin

0.4
0.5
0.6
0.7
0.8
1.0
1.2
1.4
1.6
1.8
2.1
2.4
2.7
3.0
3.3
3.6
3.9
4.2
4.5
4.9
5.3
5.7
6.2
6.7
7.2
8.3
9.8
11.2
12.8
16.1
20.0

0.8
0.9
1.0
1.2
1.3
1.4
1.5
1.6
1.7
1.9
2.1
2.2
2.3
2.5
2.7
3.2
3.7
4.3
4.9
6.2
7.8
9.5
11.3
13.0
15.1
17.3
20.0

0.7

1.1
1.3
1.5
1.6
2.0
2.5
2.9
3.4
3.9
4.5
5.1
5.8
6.5
7.2
8.0
9.0
11.0
13.0
15.0
17.3
20.0

0.7
0.8
0.9
1.0
1.2
1.4
1.6
1.8
2.1
2.4
2.7
3.0
3.2
3.9
4.7
5.5
6.3
7.2
10.0
13.0
16.2
20.0

El uso inteligente del agua.

Referencia

www.rainbird.com/reference

5VCPQMTUJDPJ14EF17$$MBTF

Tubo plstico IPS de PVC Clase 160


 
4%3$

Prdida en psi por cada 100 pies de tubo (psi/100 pies)


5BNBPTEF DN
B DN
DBVEBMTEFBHQN BMT

Tamao
D.E.
D.I.
Esp. pared

1"
1.315
1.195
0.06

Caudal
(gpm)
1
2
3
4
5
6
7
8
9
10
11
12
14
16
18
20
22
24
26
28
30
35
40
45
50
55
60
65
70
75
80
85
90
95
100
110
120
130
140
150
160
170
180
190
200
225
250
275
300
325
350
375
400
425
450
475
500
550
600

Velocidad
pps
0.29
0.57
0.86
1.14
1.43
1.72
2.00
2.29
2.57
2.86
3.15
3.43
4.00
4.58
5.15
5.72
6.29
6.87
7.44
8.01
8.58
10.01
11.44
12.87
14.30
15.73
17.16
18.59
20.02

1 1/4"
1.660
1.532
0.064

Prdida
psi
0.02
0.06
0.14
0.23
0.35
0.49
0.66
0.84
1.04
1.27
1.51
1.78
2.36
3.02
3.76
4.57
5.45
6.40
7.43
8.52
9.68
12.87
16.48
20.49
24.90
29.70
34.89
40.45
46.40

Velocidad
pps
0.17
0.35
0.52
0.70
0.87
1.04
1.22
1.39
1.57
1.74
1.91
2.09
2.44
2.78
3.13
3.48
3.83
4.18
4.53
4.87
5.22
6.09
6.96
7.83
8.70
9.57
10.44
11.31
12.18
13.05
13.92
14.79
15.66
16.53
17.41
19.15

1 1/2"
1.900
1.754
0.073

Prdida
psi
0.01
0.02
0.04
0.07
0.11
0.15
0.20
0.25
0.31
0.38
0.45
0.53
0.71
0.90
1.12
1.36
1.63
1.91
2.22
2.54
2.89
3.84
4.92
6.12
7.43
8.87
10.42
12.08
13.85
15.74
17.74
19.84
22.05
24.37
26.80
31.97

Velocidad
pps
0.13
0.27
0.40
0.53
0.66
0.80
0.93
1.06
1.20
1.33
1.46
1.59
1.86
2.12
2.39
2.66
2.92
3.19
3.45
3.72
3.98
4.65
5.31
5.98
6.64
7.30
7.97
8.63
9.29
9.96
10.62
11.29
11.95
12.61
13.28
14.61
15.93
17.26
18.59
19.92

V
2"
2.375
2.193
0.091

Prdida
psi
0.00
0.01
0.02
0.04
0.05
0.08
0.10
0.13
0.16
0.20
0.23
0.27
0.37
0.47
0.58
0.71
0.84
0.99
1.15
1.32
1.50
1.99
2.55
3.17
3.85
4.59
5.39
6.25
7.17
8.15
9.18
10.27
11.42
12.62
13.87
16.55
19.44
22.54
25.85
29.37

2 1/2"
2.875
2.655
0.110

Velocidad
pps
0.08
0.17
0.25
0.34
0.42
0.51
0.59
0.68
0.76
0.85
0.93
1.02
1.19
1.36
1.53
1.70
1.87
2.04
2.21
2.38
2.55
2.97
3.40
3.82
4.25
4.67
5.10
5.52
5.95
6.37
6.80
7.22
7.64
8.07
8.49
9.34
10.19
11.04
11.89
12.74
13.59
14.44
15.29
16.14
16.99
19.11

Prdida
psi
0.00
0.00
0.01
0.01
0.02
0.03
0.03
0.04
0.05
0.07
0.08
0.09
0.12
0.16
0.20
0.24
0.28
0.33
0.39
0.44
0.50
0.67
0.86
1.07
1.30
1.55
1.82
2.11
2.42
2.75
3.10
3.46
3.85
4.26
4.68
5.58
6.56
7.60
8.72
9.91
11.16
12.49
13.88
15.34
16.87
20.98

Velocidad
pps
0.06
0.12
0.17
0.23
0.29
0.35
0.41
0.46
0.52
0.58
0.64
0.70
0.81
0.93
1.04
1.16
1.27
1.39
1.51
1.62
1.74
2.03
2.32
2.61
2.90
3.19
3.48
3.77
4.06
4.35
4.64
4.93
5.22
5.51
5.80
6.37
6.95
7.53
8.11
8.69
9.27
9.85
10.43
11.01
11.59
13.04
14.49
15.94
17.39
18.83

3"
3.500
3.230
0.135

Prdida
psi
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.02
0.02
0.03
0.03
0.04
0.05
0.06
0.08
0.09
0.11
0.13
0.15
0.18
0.20
0.26
0.34
0.42
0.51
0.61
0.72
0.83
0.95
1.08
1.22
1.37
1.52
1.68
1.85
2.20
2.59
3.00
3.44
3.91
4.40
4.93
5.48
6.05
6.65
8.27
10.06
11.99
14.09
16.34

Velocidad
pps
0.04
0.08
0.12
0.16
0.20
0.23
0.27
0.31
0.35
0.39
0.43
0.47
0.55
0.63
0.70
0.78
0.86
0.94
1.02
1.10
1.17
1.37
1.57
1.76
1.96
2.15
2.35
2.55
2.74
2.94
3.13
3.33
3.52
3.72
3.92
4.31
4.70
5.09
5.48
5.87
6.26
6.66
7.05
7.44
7.83
8.81
9.79
10.77
11.75
12.73
13.70
14.68
15.66
16.64
17.62
18.60
19.58

4"
4.500
4.154
0.173

Prdida
psi
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.03
0.04
0.04
0.05
0.06
0.07
0.08
0.10
0.13
0.16
0.20
0.24
0.28
0.32
0.37
0.42
0.47
0.53
0.59
0.65
0.71
0.85
1.00
1.16
1.33
1.51
1.70
1.90
2.11
2.33
2.56
3.19
3.87
4.62
5.43
6.29
7.22
8.20
9.24
10.34
11.49
12.70
13.97

Velocidad
pps
0.02
0.05
0.07
0.09
0.12
0.14
0.17
0.19
0.21
0.24
0.26
0.28
0.33
0.38
0.43
0.47
0.52
0.57
0.62
0.66
0.71
0.83
0.95
1.07
1.18
1.30
1.42
1.54
1.66
1.78
1.89
2.01
2.13
2.25
2.37
2.60
2.84
3.08
3.31
3.55
3.79
4.02
4.26
4.50
4.73
5.33
5.92
6.51
7.10
7.69
8.29
8.88
9.47
10.06
10.65
11.24
11.84
13.02
14.20

6"
6.625
6.115
0.225

Prdida
psi
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.03
0.04
0.05
0.06
0.07
0.08
0.09
0.11
0.12
0.14
0.15
0.17
0.19
0.21
0.25
0.29
0.34
0.39
0.44
0.50
0.56
0.62
0.69
0.75
0.94
1.14
1.36
1.60
1.85
2.12
2.41
2.72
3.04
3.38
3.73
4.11
4.90
5.75

Velocidad
pps
0.01
0.02
0.03
0.04
0.05
0.07
0.08
0.09
0.10
0.11
0.12
0.13
0.15
0.17
0.20
0.22
0.24
0.26
0.28
0.31
0.33
0.38
0.44
0.49
0.55
0.60
0.66
0.71
0.76
0.82
0.87
0.93
0.98
1.04
1.09
1.20
1.31
1.42
1.53
1.64
1.75
1.86
1.97
2.08
2.18
2.46
2.73
3.00
3.28
3.55
3.82
4.10
4.37
4.64
4.92
5.19
5.46
6.01
6.55

Prdida
psi
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.02
0.03
0.03
0.03
0.04
0.04
0.05
0.06
0.07
0.08
0.09
0.09
0.10
0.11
0.14
0.17
0.21
0.24
0.28
0.32
0.37
0.41
0.46
0.51
0.57
0.63
0.75
0.88

Nota: El rea de la tabla con sombreado oscuro indica velocidades superiores a 5 pies por segundo. Utilice con precaucin.
-BWFMPDJEBEEFMPTWBMPSFTEFDBVEBMTFDBMDVMBQPSNFEJPEFMBFDVBDJOHFOFSBM72d 2
2
Los valores de prdida de presin por friccin se computan a partir de la siguiente ecuacin: IG 100
x.433 para calcular la prdida en psi cada 100 pies de tubo
c 1.852d4.866

( )

Referencia

El uso inteligente del agua.

235

Referencia
5VCPQMTUJDPJ14EF17$$MBTF

Tubo plstico IPS de PVC Clase 200


 
4%3$

Prdida en psi por cada 100 pies de tubo (psi/100 pies)


5BNBPTEF DN
B DN
DBVEBMTEFBHQN BMT

Tamao
D.E.
D.I.
Esp. pared
Caudal
(gpm)

3/4"
1.050
0.930
0.060
Velocidad Prdida
pps
psi

1"
1.315
1.189
0.063
Velocidad Prdida
pps
psi

1 1/4"
1.660
1.502
0.079
Velocidad Prdida
pps
psi

1 1/2"
1.900
1.720
0.090
Velocidad Prdida
pps
psi

2"
2.375
2.149
0.113
Velocidad Prdida
pps
psi

2 1/2"
2.875
2.601
0.137
Velocidad Prdida
pps
psi

3"
3.500
3.166
0.167
Velocidad Prdida
pps
psi

4"
4.500
4.072
0.214
Velocidad Prdida
pps
psi

6"
6.625
5.993
0.316
Velocidad Prdida
pps
psi

1
2
3
4
5
6
7
8
9
10
11
12
14
16
18
20
22
24
26
28
30
35
40
45
50
55
60
65
70
75
80
85
90
95
100
110
120
130
140
150
160
170
180
190
200
225
250
275
300
325
350
375
400
425
450
475
500
550
600

0.47
0.94
1.42
1.89
2.36
2.83
3.31
3.78
4.25
4.72
5.20
5.67
6.61
7.56
8.50
9.45
10.39
11.34
12.28
13.22
14.17
16.53
18.89

0.29
0.58
0.87
1.16
1.44
1.73
2.02
2.31
2.60
2.89
3.18
3.47
4.05
4.62
5.20
5.78
6.36
6.93
7.51
8.09
8.67
10.11
11.56
13.00
14.45
15.89
17.34
18.78

0.18
0.36
0.54
0.72
0.91
1.09
1.27
1.45
1.63
1.81
1.99
2.17
2.54
2.90
3.26
3.62
3.98
4.35
4.71
5.07
5.43
6.34
7.24
8.15
9.05
9.96
10.86
11.77
12.68
13.58
14.49
15.39
16.30
17.20
18.11
19.92

0.14
0.28
0.41
0.55
0.69
0.83
0.97
1.10
1.24
1.38
1.52
1.66
1.93
2.21
2.49
2.76
3.04
3.31
3.59
3.87
4.14
4.83
5.52
6.21
6.90
7.59
8.28
8.98
9.67
10.36
11.05
11.74
12.43
13.12
13.81
15.19
16.57
17.95
19.33

0.09
0.18
0.27
0.35
0.44
0.53
0.62
0.71
0.80
0.88
0.97
1.06
1.24
1.42
1.59
1.77
1.95
2.12
2.30
2.48
2.65
3.10
3.54
3.98
4.42
4.86
5.31
5.75
6.19
6.63
7.08
7.52
7.96
8.40
8.85
9.73
10.61
11.50
12.38
13.27
14.15
15.04
15.92
16.81
17.69
19.90

0.06
0.12
0.18
0.24
0.30
0.36
0.42
0.48
0.54
0.60
0.66
0.72
0.85
0.97
1.09
1.21
1.33
1.45
1.57
1.69
1.81
2.11
2.42
2.72
3.02
3.32
3.62
3.92
4.23
4.53
4.83
5.13
5.43
5.74
6.04
6.64
7.25
7.85
8.45
9.06
9.66
10.27
10.87
11.47
12.08
13.59
15.10
16.61
18.11
19.62

0.04
0.08
0.12
0.16
0.20
0.24
0.29
0.33
0.37
0.41
0.45
0.49
0.57
0.65
0.73
0.82
0.90
0.98
1.06
1.14
1.22
1.43
1.63
1.83
2.04
2.24
2.45
2.65
2.85
3.06
3.26
3.46
3.67
3.87
4.08
4.48
4.89
5.30
5.71
6.11
6.52
6.93
7.34
7.74
8.15
9.17
10.19
11.21
12.23
13.25
14.26
15.28
16.30
17.32
18.34
19.36

0.02
0.05
0.07
0.10
0.12
0.15
0.17
0.20
0.22
0.25
0.27
0.30
0.34
0.39
0.44
0.49
0.54
0.59
0.64
0.69
0.74
0.86
0.99
1.11
1.23
1.35
1.48
1.60
1.72
1.85
1.97
2.09
2.22
2.34
2.46
2.71
2.96
3.20
3.45
3.70
3.94
4.19
4.43
4.68
4.93
5.54
6.16
6.77
7.39
8.01
8.62
9.24
9.85
10.47
11.09
11.70
12.32
13.55
14.78

0.01
0.02
0.03
0.05
0.06
0.07
0.08
0.09
0.10
0.11
0.13
0.14
0.16
0.18
0.20
0.23
0.25
0.27
0.30
0.32
0.34
0.40
0.45
0.51
0.57
0.63
0.68
0.74
0.80
0.85
0.91
0.97
1.02
1.08
1.14
1.25
1.36
1.48
1.59
1.71
1.82
1.93
2.05
2.16
2.27
2.56
2.84
3.13
3.41
3.70
3.98
4.27
4.55
4.83
5.12
5.40
5.69
6.26
6.82

0.06
0.22
0.46
0.79
1.19
1.67
2.22
2.84
3.53
4.29
5.12
6.02
8.00
10.24
12.74
15.48
18.46
21.69
25.15
28.85
32.77
43.59
55.80

0.02
0.07
0.14
0.24
0.36
0.50
0.67
0.86
1.07
1.30
1.55
1.82
2.42
3.10
3.85
4.68
5.59
6.56
7.61
8.73
9.92
13.19
16.89
21.00
25.51
30.43
35.75
41.46

0.01
0.02
0.04
0.08
0.12
0.16
0.22
0.28
0.34
0.42
0.50
0.58
0.78
0.99
1.24
1.50
1.79
2.11
2.44
2.80
3.18
4.23
5.42
6.74
8.18
9.76
11.47
13.30
15.25
17.33
19.53
21.84
24.28
26.83
29.51
35.20

0.00
0.01
0.02
0.04
0.06
0.08
0.11
0.14
0.18
0.22
0.26
0.30
0.40
0.51
0.64
0.78
0.93
1.09
1.26
1.45
1.65
2.19
2.80
3.48
4.23
5.05
5.93
6.88
7.89
8.96
10.10
11.30
12.56
13.88
15.26
18.20
21.38
24.79
28.44

0.00
0.00
0.01
0.01
0.02
0.03
0.04
0.05
0.06
0.07
0.09
0.10
0.14
0.17
0.22
0.26
0.31
0.37
0.43
0.49
0.56
0.74
0.95
1.18
1.43
1.71
2.01
2.33
2.67
3.03
3.42
3.82
4.25
4.70
5.16
6.16
7.24
8.39
9.62
10.93
12.32
13.78
15.32
16.93
18.62
23.15

0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.02
0.02
0.03
0.03
0.04
0.05
0.07
0.09
0.10
0.12
0.15
0.17
0.19
0.22
0.29
0.37
0.47
0.57
0.67
0.79
0.92
1.05
1.20
1.35
1.51
1.68
1.86
2.04
2.43
2.86
3.31
3.80
4.32
4.87
5.44
6.05
6.69
7.35
9.14
11.11
13.26
15.57
18.06

0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.03
0.03
0.04
0.05
0.06
0.06
0.07
0.08
0.11
0.14
0.18
0.22
0.26
0.30
0.35
0.41
0.46
0.52
0.58
0.65
0.71
0.78
0.94
1.10
1.27
1.46
1.66
1.87
2.09
2.33
2.57
2.83
3.51
4.27
5.09
5.98
6.94
7.96
9.04
10.19
11.40
12.67
14.00

0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.02
0.03
0.04
0.05
0.06
0.08
0.09
0.10
0.12
0.14
0.15
0.17
0.19
0.21
0.23
0.27
0.32
0.37
0.43
0.49
0.55
0.61
0.68
0.76
0.83
1.03
1.26
1.50
1.76
2.04
2.34
2.66
2.99
3.35
3.72
4.11
4.52
5.40
6.34

0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.02
0.03
0.03
0.03
0.04
0.04
0.05
0.06
0.07
0.07
0.08
0.09
0.10
0.12
0.13
0.16
0.19
0.23
0.27
0.31
0.36
0.41
0.46
0.51
0.57
0.63
0.69
0.82
0.97

Nota: El rea de la tabla con sombreado oscuro indica velocidades superiores a 5 pies por segundo. Utilice con precaucin.
-BWFMPDJEBEEFMPTWBMPSFTEFDBVEBMTFDBMDVMBQPSNFEJPEFMBFDVBDJOHFOFSBM72d 2
2
Los valores de prdida de presin por friccin se computan a partir de la siguiente ecuacin: IG 100
x.433 para calcular la prdida en psi cada 100 pies de tubo
c 1.852d4.866

( )

Referencia

236

El uso inteligente del agua.

Referencia

www.rainbird.com/reference

5VCPQMTUJDPJ14EF17$$MBTF

Tubo plstico IPS de PVC Clase 315


 
4%3$
Tubo plstico IPS de PVC Clase 315
Prdida en psi por cada 100 pies de tubo (psi/100 pies)
5BNBPTEF DN
B DN
DBVEBMTEFBHQN BMT

Tamao
D.E.
D.I.
Esp. pared
Caudal
(gpm)

1/2"
0.840
0.716
0.062
Velocidad Prdida
pps
psi

3/4"
1"
1.050
1.315
0.894
1.121
0.078
0.097
Velocidad Prdida Velocidad Prdida
pps
psi
pps
psi

1 1/4"
1.660
1.414
0.123
Velocidad Prdida
pps
psi

1 1/2"
1.900
1.618
0.141
Velocidad Prdida
pps
psi

2"
2.375
2.023
0.176
Velocidad Prdida
pps
psi

2 1/2"
2.875
2.449
0.213
Velocidad Prdida
pps
psi

3"
3.500
2.982
0.259
Velocidad Prdida
pps
psi

4"
4.500
3.834
0.333
Velocidad Prdida
pps
psi

6"
6.625
5.643
0.491
Velocidad Prdida
pps
psi

1
2
3
4
5
6
7
8
9
10
11
12
14
16
18
20
22
24
26
28
30
35
40
45
50
55
60
65
70
75
80
85
90
95
100
110
120
130
140
150
160
170
180
190
200
225
250
275
300
325
350
375
400
425
450
475
500
550
600

0.80
1.59
2.39
3.19
3.98
4.78
5.58
6.37
7.17
7.97
8.77
9.56
11.16
12.75
14.34
15.94
17.53
19.12

0.51
1.02
1.53
2.04
2.56
3.07
3.58
4.09
4.60
5.11
5.62
6.13
7.16
8.18
9.20
10.22
11.24
12.27
13.29
14.31
15.33
17.89

0.20
0.41
0.61
0.82
1.02
1.23
1.43
1.63
1.84
2.04
2.25
2.45
2.86
3.27
3.68
4.09
4.49
4.90
5.31
5.72
6.13
7.15
8.17
9.19
10.22
11.24
12.26
13.28
14.30
15.32
16.34
17.37
18.39
19.41

0.16
0.31
0.47
0.62
0.78
0.94
1.09
1.25
1.40
1.56
1.72
1.87
2.18
2.50
2.81
3.12
3.43
3.74
4.06
4.37
4.68
5.46
6.24
7.02
7.80
8.58
9.36
10.14
10.92
11.70
12.48
13.26
14.04
14.82
15.60
17.16
18.72

0.10
0.20
0.30
0.40
0.50
0.60
0.70
0.80
0.90
1.00
1.10
1.20
1.40
1.60
1.80
2.00
2.20
2.40
2.60
2.79
2.99
3.49
3.99
4.49
4.99
5.49
5.99
6.49
6.99
7.49
7.99
8.48
8.98
9.48
9.98
10.98
11.98
12.98
13.97
14.97
15.97
16.97
17.97
18.97
19.96

0.07
0.14
0.20
0.27
0.34
0.41
0.48
0.54
0.61
0.68
0.75
0.82
0.95
1.09
1.23
1.36
1.50
1.63
1.77
1.91
2.04
2.38
2.72
3.06
3.41
3.75
4.09
4.43
4.77
5.11
5.45
5.79
6.13
6.47
6.81
7.49
8.17
8.85
9.54
10.22
10.90
11.58
12.26
12.94
13.62
15.32
17.03
18.73

0.05
0.09
0.14
0.18
0.23
0.28
0.32
0.37
0.41
0.46
0.51
0.55
0.64
0.74
0.83
0.92
1.01
1.10
1.19
1.29
1.38
1.61
1.84
2.07
2.30
2.53
2.76
2.99
3.22
3.45
3.68
3.90
4.13
4.36
4.59
5.05
5.51
5.97
6.43
6.89
7.35
7.81
8.27
8.73
9.19
10.34
11.48
12.63
13.78
14.93
16.08
17.23
18.38
19.52

0.03
0.06
0.08
0.11
0.14
0.17
0.19
0.22
0.25
0.28
0.31
0.33
0.39
0.44
0.50
0.56
0.61
0.67
0.72
0.78
0.83
0.97
1.11
1.25
1.39
1.53
1.67
1.81
1.95
2.08
2.22
2.36
2.50
2.64
2.78
3.06
3.33
3.61
3.89
4.17
4.45
4.72
5.00
5.28
5.56
6.25
6.95
7.64
8.34
9.03
9.73
10.42
11.12
11.81
12.51
13.20
13.89
15.28
16.67

0.01
0.03
0.04
0.05
0.06
0.08
0.09
0.10
0.12
0.13
0.14
0.15
0.18
0.21
0.23
0.26
0.28
0.31
0.33
0.36
0.38
0.45
0.51
0.58
0.64
0.71
0.77
0.83
0.90
0.96
1.03
1.09
1.15
1.22
1.28
1.41
1.54
1.67
1.80
1.92
2.05
2.18
2.31
2.44
2.57
2.89
3.21
3.53
3.85
4.17
4.49
4.81
5.13
5.45
5.77
6.09
6.41
7.06
7.70

0.22
0.78
1.65
2.81
4.25
5.96
7.92
10.14
12.61
15.33
18.28
21.47
28.56
36.56
45.46
55.25
65.90
77.41

0.07
0.26
0.56
0.96
1.44
2.02
2.69
3.44
4.28
5.20
6.21
7.29
9.70
12.41
15.44
18.76
22.37
26.28
30.48
34.95
39.71
52.82

0.33
0.65
0.98
1.30
1.63
1.95
2.28
2.60
2.93
3.25
3.58
3.90
4.55
5.20
5.85
6.50
7.15
7.80
8.45
9.10
9.75
11.38
13.00
14.63
16.25
17.88
19.50

0.02
0.09
0.19
0.32
0.48
0.67
0.89
1.15
1.42
1.73
2.06
2.42
3.22
4.13
5.13
6.24
7.44
8.74
10.14
11.62
13.21
17.57
22.49
27.96
33.98
40.53
47.61

0.01
0.03
0.06
0.10
0.16
0.22
0.29
0.37
0.46
0.56
0.67
0.78
1.04
1.33
1.66
2.02
2.40
2.82
3.27
3.76
4.27
5.68
7.27
9.03
10.98
13.10
15.38
17.84
20.46
23.25
26.19
29.30
32.57
36.00

0.00
0.01
0.03
0.05
0.08
0.11
0.15
0.19
0.24
0.29
0.35
0.41
0.54
0.69
0.86
1.05
1.25
1.47
1.70
1.95
2.22
2.95
3.77
4.69
5.70
6.80
7.99
9.26
10.62
12.07
13.60
15.21
16.91
18.69
20.55
24.51
28.79

0.00
0.00
0.01
0.02
0.03
0.04
0.05
0.06
0.08
0.10
0.12
0.14
0.18
0.23
0.29
0.35
0.42
0.49
0.57
0.66
0.75
0.99
1.27
1.58
1.92
2.29
2.69
3.12
3.58
4.07
4.59
5.13
5.70
6.30
6.93
8.27
9.71
11.26
12.91
14.67
16.53
18.49
20.56
22.72
24.98

0.00
0.00
0.00
0.01
0.01
0.02
0.02
0.03
0.03
0.04
0.05
0.05
0.07
0.09
0.11
0.14
0.17
0.20
0.23
0.26
0.29
0.39
0.50
0.62
0.76
0.90
1.06
1.23
1.41
1.61
1.81
2.02
2.25
2.49
2.73
3.26
3.83
4.44
5.10
5.79
6.52
7.30
8.11
8.97
9.86
12.26
14.90
17.77

0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0