You are on page 1of 18

14/9/2016

SistemicaCibernetica

ELPROCESODELAS
IDEASSISTEMICO
CIBERNETICAS*
Lic.SaraB.Jutoran**

"Eslateoralaquedecidesobreloquepodemosobservar"
AlbertEinstein

Enelpresentetrabajoseintentadescribirlospresupuestosdelparadigmasistmicociberntico,
fundamentodelaterapiasistmica,desdelasegundamitaddelsigloXXhastanuestrosdas.
Teniendoencuentaladificultaddeunanlisisexhaustivodelasmltiplesvariablesque
configuranesteparadigmasehantomadolosconceptosmsrepresentativosdelaTeora
GeneraldelosSistemas,laTeoradelaComunicacin,laCiberntica,ylosaportesdeGregory
Bateson,HeinzvonFoersteryHumbertoMaturana,renombradoscientficoscuyasideas
constituyenloscimientosdelpensamientosistmico.
Elparadigmasistmicocibernticoofrecealcampodelascienciasunanuevacosmovisin.
Dichacosmovisinsefundamentaenunaepistemologacuyaspremisasbsicasdifieren
sustancialmentedeotrosfundamentosepistemolgicos.
Lapalabraepistemologaprovienedelarazgriegaepistemeinquesignificaestarparadoencima
yseladefinecomotratadooteora(logos)delconocimiento.Existendiferentescriteriosrespecto
alconceptodeepistemologa.TradicionalmentehasidoconsideradaunaramadelaFilosofaque
seocupadelconocimientocientfico,aunqueconfrecuenciaseladesignacomognoseologa.
VonFoersterproponelapreguntadedndesurgeelconocimiento?paradefinirala
epistemologadesdeunaposicinontogenticacomo"teoradelaadquisicindel
conocimiento"..."Elvocabulariogriegotienediversostrminosparareferirsealconocimiento,con
diferentesmaticesensusignificado.Gnosis,porejemplo,serefierealabsquedadel
conocimiento,esdecir,laadquisicindelconocimientoatravsdelosprocesoscognitivospraxis
eslaadquisicindelconocimientopormediodelhacerydelactuaryepistemeinsignifica
hacerseexpertoenunarte.Elgran'epistemlogogenticosuizoJeanPiagetcombinagnosisy
praxiscomocondicinnecesariaparalaadquisicindelconocimiento"(25).
SegnB.Keeney(8)laepistemologasaledelcampodelaFilosofayentraenelcampodela
BiologaatravsdelaobradelosbilogosexperimentalescontemporneosMc.Culloch,Lettvin,
Maturana,VarelayvonFoerster.FueMc.Cullochquienledielttulogenricode"epistemologa
experimental"(8),yGregoryBatesonquienproponeconsiderarla"...comounaramadelaciencia
combinadaconunaramadelafilosofa.Comociencia,laepistemologaeselestudiodecmolos
organismosparticularesoagregadosdeorganismosconocen,piensanydeciden.Comofilosofa,
laepistemologaeselestudiodeloslmitesnecesariosyotrascaractersticasdelosprocesosdel
http://www.click.vi.it/sistemieculture/Jutoran.html

1/18

14/9/2016

SistemicaCibernetica

conocer,pensarydecidir"(2).Laepistemologa,desdeestepuntodevista,secentraencmo
conocenlosqueconocen:laspropiedadesdelobservador,enlugarde,quesloqueseconoce:
laspropiedadesdelobjetodeconocimiento.

INTRODUCCIONALATEORIAGENERALDELOSSISTEMAS
JamesGrierMiller(1978)consideraque"Unageneracincientficaformasusmodelosenbasea
susmetforaspredominantes.Lostrminoscientficosdellenguajedelsiglodiecinuevese
referanalosefectoslinealesmsquealasfuerzasdecampo..."."Elsigloveinte
caractersticamentehatomadosusmetforasdelateorarelativistade
Einstein..."."Lateoradelcampo,lateoradelaGestaltylateoradelossistemas,apesarde
susdiferencias,reconocentodasquelasinterrelacionesentrecomponentescoactuantesdeun
todoorganizado,sondefundamentalimportanciaparacomprenderlatotalidad"(17).
ElconceptodesistemacomototalidadexistayaenelpensamientodeAristteles,perocon
Descartesdesapareceylarealidadcomienzaaserdesmembradayreducidaaunacreciente
fragmentacin.SegnBertalanffy"Como'filosofanatural'podemosremontarloaLeibniza
NicolsdeCusaconsucoincidenciadelosopuestosalamedicinamsticadeParacelsoala
visindelahistoriadeVicoeIbnKaldun,comosucesindeentidadeso'sistemas'culturalesala
dialcticadeMarxyHegelpormencionarunoscuantosnombresdeunaricapanopliade
pensadores"(3).
DespusdelaSegundaGuerraMundialcomienzaaconsolidarse,endistintoslugaresyen
diferentescamposcientficosunpensamientocadavezmstotalizadorymenosfragmentado.La
TeoradelaGestalt,deWertheimer,KohleryKoffka(1924),laTeoradelosJuegos,deVon
NeumannyMorgenstern(1947),laTeoradelosConjuntos,deMesarovicyMaccia(1964y
1966),laTeoradelasGrficas,deRashevskyyRosen(1956y1960),laobradeAshby"Diseno
parauncerebro",lostrabajosdeCannonsobre"homeostasis"(1929y1932),laTeoraGeneral
delosSistemas,deLudwigvonBertalanffy(1968),laTeoradelaComunicacin,deShannony
Weaver,(1949),laCiberntica,deNorbertWiener(1948),ylosfundamentalesaportesdel
antroplogoGregoryBateson.Esimposibledejardemencionarlaimportanciaeincidenciadelos
desarrolloscientficosdeAlbertEinstein,MaxPlanck,elPrincipiodeIndeterminacindeWerner
Heisenberg,elPrincipiodeComplementariedaddeNielsBohr,ylosconceptosdeordenatravs
delafluctuacindelPremioNobeldeQumicaIlyaPrigogine,entreotros.
PRIMERPERIODO
LUDWIGVONBERTALANFFY
LaTeoraGeneraldelosSistemasdesarrolladaporelbilogoaustrocanadienseLudwigvon
Bertalanffyen1968,proponeencontrarlascorrespondenciasoisomorfismosentresistemasde
todotipo,unModelodeSistemaGeneralqueseacompatibleconotrosmodelosdedistintas
disciplinas,esdecirquetengalasmismascaractersticas,ancuandolasdisciplinassean
totalmentediferentes.
Lateorageneraldelossistemasentantocrticadelosmodelosconstrudosypropuestade
cmoconstruirmodelos,enreferenciaasususosylimitaciones,consideraqueenelmundo
conceptuallosmodelosnopuedenserisomrficosalarealidadsinosloentres,dadoque
somosnosotroslosqueloscreamosconnuestramente.AAlfredKorzybski,uncientficoy
filsofopolaco,fallecidoen1950enU.S.A.,sedebeelconcepto"elmapanoeselterritorio"(1).
DeacuerdoaKorzybski,todoslosintentoshumanosdeexplicarlarealidadsonyhansido
construcciones,representaciones,modelosdelarealidad,mapasdeterritorios.Toda
conceptualizacinpartedeunapercepcin,limitadapornuestrapropiaestructurahumana.A
partirdeunatomadeconcienciadeesapercepcinobtenemosunaidea,unconcepto,una
palabra,unaaccin.
http://www.click.vi.it/sistemieculture/Jutoran.html

2/18

14/9/2016

SistemicaCibernetica

Todaconceptualizacinpartedelopercibidoyesentoncesuna"construccin"humana,unmapa
delarealidad,ynolarealidadmisma.Loqueestenelmapaeslaproduccindenuestros
sentidos,denuestrapercepcindelarealidad.Dadoqueesimposiblecaptartotalidadesenlas
cualesestamosnosotrosmismosincludos,ydebidoalalimitacindenuestracapacidad
perceptiva,cadapercepcinesunmodelo,unmapadelarealidadperodemasiado
frecuentementeseconsideralopercibidocomolarealidad,seconfundenlosmodelosconla
realidad.
LudwigvonBertalanffyproponeunModelodeSistemaGeneralcomointentodeunificarel
conocimientocientfico,favorecereldesarrollodelatareainterdisciplinariaylograrunamayor
integracinyunidadenlaciencia.SuTeoraGeneraldelosSistemasbusca"principiosyleyes
aplicablesasistemasgeneralizadosoasussubclases,sinimportarsuparticulargnero,la
naturalezadesuselementoscomponentesylasrelacioneso'fuerzas'queimperenentreellos"
(3).Deestamanerasurgensimilaridadesestructuralesoisomorfismosendistintoscampos
disciplinarios.Elisomorfismoocorrespondenciaentrelosmodelospermiteaplicarlasmismas
caractersticasalasmsvariadasdisciplinas.
Bertalanffydefinelos"sistemas",como"complejosdeelementoseninteraccin"(3)yestablece
unadistincinentresistemascerradosyabiertos,considerandoquetodoslossistemasvivientes
sonabiertosalintercambiodemateria,energaeinformacinconelentorno.TomadeCannonel
conceptodehomeostasisoequilibriodinmicoentreentradasysalidas,loquepermiteenel
sistemacambioscontnuosalavezquepredominancondicionesrelativamenteuniformes.
Sostienequeenlossistemasvivientesexisteunatendenciahacianivelesdemayor
heterogeneidadyorganizacin,encontraposicinalossistemascerradosenlosquehayuna
contnuatendenciahacialadesorganizacinydestruccindelorden,conlocualdesaparece"la
aparentecontradiccinentreentropayevolucin"(3).DelaTeoradelaComunicacinincorpora
elconceptodeinformacincomoentropanegativa,medidaquefavoreceelordenyla
organizacin.Apartirdelasnocionesdeadaptabilidad,intencionalidadypersecusindemetas,
consideraelcomportamientoteleolgicodelossistemasvivoscomoalgodefinibleentrminos
cientficos.Proponeelprincipiodeequifinalidadylodefinecomo"...latendenciaaunestadofinal
caractersticoapartirdediferentesestadosinicialesypordiferentescaminos,fundadaenla
interaccindinmicaenunsistemaabiertoquealcanzaunestadouniforme...."(3).Segneste
principio,apartirdediferentescondicionesinicialesypordiferentescaminossepuedealcanzar
elmismoestadofinal.Comoconsecuencia,lossistemasvivientes,entantoabiertos,nopueden
serexplicadosentrminosdecausalidad,dadoquelascircunstanciasinicialesnolos
determinan.Unsistemaabiertoalcanzaunestadoindependientedesuscondicionesiniciales,
determinadoporlaorganizacindelsistema.Utilizalanocindeorganizacincomoelemento
importanteparacomprenderlacomplejidaddelossistemasvivos,ytomadelaCibernticael
conceptoderetroalimentacinysusmecanismosdecontrol,positivosynegativos,queamplifican
ycorrigenladesviacinrespectivamente,paramanteneralsistemadentrodeunequilibrio
dinmico.
ParaBertalanffy,queintentadesacralizarlospostuladosabsolutosdelafsica"..."larelacinentre
lenguajeyvisindelmundonoesunidireccionalsinorecproca...."."Laestructuradellenguaje
parecedeterminarqurasgosdelarealidadsernabstrados,yconelloquformaadoptarnlas
categorasdelpensamiento.Porotrolado,elcmoseavistoelmundodeterminayformael
lenguaje"(3).
TantoBertalanffycomoBatesonylostericosdelaComunicacinadhierenalaconcepcinde
Korzybski"elmapanoeselterritorio".
DeberntranscurrirdosdcadasparaquelosavancesdelaCibernticaofrezcanalaciencia
humanaunanuevamaneradepensarseapartirdeconceptostalescomolaclausura
operacional,laautorreferenciaylaautoorganizacin.

GREGORYBATESON
http://www.click.vi.it/sistemieculture/Jutoran.html

3/18

14/9/2016

SistemicaCibernetica

NoresultafciltareacaptarytransmitirlacomplejariquezadelpensamientodeBateson.Bilogo,
antroplogo,epistemlogo,susideashaninfludoyseguirninfluyendolosmsdiversoscampos
delpensamientocientficomoderno.Ladiversidaddetemasqueatraparonsuinters
incluyen,entreotros,unavastaerudicinenzoologa,psiquiatra,antropologa,esttica,
lingustica,educacin,evolucin,cibernticayepistemologa.
"StephenToulmin(citadoenWilderMottyWeakland,1981),profesordepensamientosocialy
filosofaenlaUniversidaddeChicago,declaraque'loquevuelvetansignificativalaobrade
GregoryBatesonesquefueelprofetadeunaciencia<posmoderna>...yviqueparadarel
primerpasohacialaindispensablereorientacinfilosficadelascienciashumanassenecesitaba
deunanuevaepistemologa'(pg.365)"(8).
GregoryBatesonfueunrevolucionarioparasupoca,ycomotal,nimuyaceptadonimuy
comprendido.Unodelosconceptosfundamentalesdelaproduccinbatesonianaes"lapauta
queconecta".Batesonseplanteculeslapautaqueconectaatodaslascriaturasvivientes
culessonlasconfiguraciones,lasformasylasrelacionesquepuedenserobservadasentodos
losfenmenos.Descartconceptostalescomomateriaysustanciaenrelacinalosseresvivos,
priorizandolosconceptosdeforma,patrnypautaparabuscarunaconcepcintotalizadoradela
mente.
Propusolanocindecontextocomoelementofundamentaldetodacomunicacinysignificacin,
planteandoquenosedebeaislarelfenmenodesucontexto,puescadafenmenotienesentido
ysignificadodentrodelcontextoenqueseproduce.
TomdeJung,desulibroSeptemSermonesadMortuos,elconceptodepleroma,parareferirse
almundodelafsicaydelosobjetosmateriales,yelconceptodecreaturaparadesignarel
mundodelosseresvivos,considerandoqueesteltimonopuedeserexplicadodesdelafsica
newtoniana,esdecirdesdeunacausalidadlinealqueimplicafuerzasqueactan
unidireccionalmente.ParaBateson,enelmundodelasformasvivientes,esnecesariotomaren
cuentaconceptostalescomoinformacinyrelacin,paralocualesfundamentalencontrarun
nuevolenguajequepermitadescribirlarecursividaddetodosloselementosquesemueven
conjuntamenteenunproceso.
ComoantroplogoenNuevaGuineaen1927,estudiandoalatribuIatmul,Batesonacunael
trminocismognesis,definidocomo"procesosdediferenciacinenlasnormasdel
comportamientoindividualqueresultandelainteraccinacumulativaentrelosindividuos"..."Este
trminodescribeeltipodeescaladaqueseencuentraenelmundonaturalejemplificadoporlos
crculosviciososyllamadoporotrosinvestigadores'procesosdereaccinmutua,''procesos
mutuamentecausalesdedesviacinamplificacin,''cadenasderetroalimentacinpositiva',etc"
(6).ParaBatesonlagnesisdeuncismaenlossistemassocialesseproduceporuna
amplificacindeprocesossimtricos,representadosporlacarreraarmamentista,o
complementarios,ejemplificadosporlastensionesentrelasclasessociales."Lacontribucinde
Batesonfueunacrecientesospechadequeenlosgrupossocialespodraexistirunordeninterno
autoequilibrador,quemantuvieralosmovimientoscismognicosbajocontrol.....""...lostipos
simtricosycomplementariosdecismognesispodranoperardemaneramutuamente
neutralizante"(6).
En1950esunodelospromotoresdelaConferenciaMacysobreretroalimentacinquerenea
Wieneryungrupodeneurofisilogos,fsicosymatemticos,pionerosdelmovimientocibernetista
norteamericano.Bateson"...creequelaexplicacincibernticaconstituyeelavanceintelectual
msimportanteyfundamentaldelosltimosdosmilanos"(4).
DespusdelencuentroconDonJacksonyotrosinvestigadoresenlaConferenciaMacy,dedica
conellosvariosaosaestudiarlacomunicacin.Laclebreycontrovertida"Teoradeldoble
vnculo"eselproductodeestaetapa.Dedichateorasurge"...lahiptesisdeldoblevnculoque
proveyunmarcodereferenciaparaladescripcinformaldelossntomasesquizofrnicosyla
experienciadelesquizofrnicoensufamilia"(4).Interesadoenelestudiodelcomportamientode

http://www.click.vi.it/sistemieculture/Jutoran.html

4/18

14/9/2016

SistemicaCibernetica

losdelfinesyotroscetceosdesarrollasuteorasobrelosdistintosnivelesdeaprendizajey
acuaeltrminodeuteroaprendizajeparareferirsealconceptode"aprenderaaprender".
En1972sepublica"Pasosparaunaecologadelamente",unacompilacindesusensayosque
seiniciaconlosfamosos"Metlogos"dilogosimaginariosentreunpadreyunahija,ytemas
talescomo"Formaypautaenantropologa","Formaypatologaenlasrelaciones","Biologay
evolucin","Epistemologayecologa"y"Crisisenlaecologadelamente".
Batesonproponeunaconcepcintotalizadorasobrelanaturalezadelordenylaorganizacinen
lossistemashumanos."...elconceptodementesurgi,param,comounreflejodepartesms
ampliasymltiplespartesdelmundonaturalafueradelserpensante"(2)."Lamenteindividuales
inmanenteperonosloenelcuerpo.Esinmanentetambinenloscaminosymensajesfueradel
cuerpoyhayunamentemsampliadelacuallamenteindividualesslounsubsistema...,pero
estambininmanenteenelsistemasocialtotalmenteinterconectadoylaecologaplanetaria"(4).
NadiemejorqueBatesonparadefinirsuposicinepistemolgicaenunacartaaJohnBrockman:
"Todosadherimosrpidamentealailusindequesomoscapacesdeunapercepcindirecta,no
codificadaynomediadaporunaepistemologa...""Detantoentantoreciboquejasdequemis
escritossondensosydifcilesdecomprender..."."Permtemecomenzarcaracterizandomi
epistemologa..."."...esunaramadelahistorianatural.FueMcCullochquien,param,bajla
epistemologadeldominiodelafilosofaabstractaaldominiomuchomssimpledelahistoria
natural.Lohizodramticamenteeneltrabajoqueconsusamigostitul'Loqueelojodelarana
ledicealcerebrodelarana.'."...lmostrquecualquierrespuestaalapregunta:Cmopuedela
ranasaberalgo?estaradelimitadaporlamaquinariasensorialdelaranayquelamaquinaria
sensorialdelaranapoda,porsupuesto,serinvestigadapormediosexperimentalesuotros...".
"Deestetrabajoresultque,paracomprenderalossereshumanos,ananivelmuyelemental,
unotienequeconocerlaslimitacionesdesuinputsensorial".
"...laepistemologaqueestoyconstruyendoesmonstica"."...elmaterialismoengeneral
constituyunesfuerzoparaexcluirlamente"."...cuandoestabapreparandolaConferencia
Korzybski,deprontomedicuentaque,porcierto,elpuenteentremapayterritorioesla
diferencia.Sonsolamentenocionesdediferencialasquepuedenllegardelterritorioalmapa,y
estehechoeslaafirmacinepistemolgicabsicasobrelarelacinentretodalarealidadall
afueraytodalapercepcinaqudentro...lamente...sersiempreintangible,siempresereferir
aintangibles,ysiempretendrciertaslimitacionesporquenuncaencontrarloqueImmanuel
KantllamelDinganSichlacosaensmisma.Slopuedeencontrarinformacindefronteras
informacindecontextosdediferencias.
"Paracontinuarconmidiseodelaepistemologaquesurgidemitrabajo,elprximopuntoes
larecursividad.Aquparecehaberdostiposderecursividaddediferentenaturaleza...elprimero
retrocedehastaNorbertWieneryesbienconocido,el'feedback'quizselelementoms
conocidodetodoelsndromeciberntico"."Elsegundotipoderecursividadhasidopropuestopor
VarelayMaturana"...
"Quienquieracreaunaimagendeunobjeto,lohaceenprofundidadusandovariosindicadores
paraesacreacin,..."."Perolamayoradelagentenosedacuentaquehaceesto,yaldarse
cuentaqueesthacindolo,demaneramuycuriosa,unoseacercamuchomsalmundoquelo
circunda.Lapalabra'objetivo'seconviertelentamenteenobsoletayalmismotiempolapalabra
'subjetivo',quenormalmenteloconfinaa'uno'dentrodesupiel,tambindesaparece"."Elmundo
yanoest'allafuera'delamismamaneraenqueparecaestar.Sinestartotalmenteconsciente
deellotodoeltiempo,sinembargos,quemisimgenesespecialmentelasvisuales,pero
tambinlasauditivas,gustatorias,dolor,yfatigasquelasimgenesson'mas'yqueyosoy
responsabledeestasimgenesdemaneramuypeculiar"..."Hayunacombinacinomatrimonio
entreunaobjetividadqueespasivahaciaelmundoexternoyunasubjetividadcreativa,nipuro
solipsismonisuopuesto"."Enelsolipsismounoestdefinitivamenteaisladoyslo,aisladoporla
premisa'Yolohagotodo'.Peroenelotroextremo,elopuestoalsolipsismo,unodejaradeexistir,
convertidoenunametafricaplumallevadaporlosvientosdela'realidad'externa.(Enesaregin
sinembargonohaymetforas!).Enalgnlugarentrestasdoshayunaregindondeunoesen
http://www.click.vi.it/sistemieculture/Jutoran.html

5/18

14/9/2016

SistemicaCibernetica

partellevadoporlosvientosdelarealidadyenparteunartistacreandouncompuestodelos
acontecimientosinternosyexternos"(4).
TEORIADELACOMUNICACION
Lacomunicacinentendidacomointercambiodesignificadosentreindividuosatravsdeun
sistemacomndesmbolos,hasidolapreocupacindeestudiososdesdelostiemposdela
antiguaGrecia.
Hastamediadosdeestesigloeltemaestabaincludoenotrasdisciplinas,peroapartirde
entoncessefuecreandouncrecienteintersenrelacinalosdiferentesmodosyprocesosdela
comunicacin.Lamayorpartedelostericosdelacomunicacinconsideraron,enunprimer
momento,quesutrabajodebaresponderalapreguntadelespecialistaencienciaspolticas
HaroldD.Lasswell:QUIENlediceQUE,aQUIEN,yconQUEEFECTO.
Unodelosmodelosdelacomunicacin,propuestoen1949comorespuestaalapreguntade
Lasswell,surgidelosdesarrollosdedosnorteamericanos,ClaudeShannon,ingenieroelectr
nico,yWarrenWeaver,matemtico.EstemodelodelaComunicacintenacomoobjetode
estudioelanlisisdelaeficaciaenlainformacin,ybuscabaestablecermedidascuantitativas
sobrelacapacidaddevariadossistemas,detransmitir,almacenar,yademsprocesar
informacin,paradescubrirlasleyesmatemticasquelosgobiernan,intentandoestablecerla
medidacuantitativamnimaquereducelaincertidumbreenunmensaje.
Originalmenteestateoraconsiderabaqueparaqueseproduzcaunacomunicacindeban
tenerseencuentacincoelementosorganizadoslinealmente:fuentedeinformacin,transmisor,
canaldetransmisin,receptorydestino.Mstardesecambielnombredeestoscinco
elementosparapoderespecificarloscomponentesdeotrosmodosdecomunicacin.Lafuente
deinformacinfuedivididaenfuenteymensajeparaaccederaunmayorcampodeaplicabilidad.
Seconsideraronentoncesseiselementos:fuente,encodificador,mensaje,canal,decodificadory
receptor.Seincorporaestemodelootroconcepto,definidoporShannonenunprimermomento,
como"fuentederuido"enrelacinalainterferenciaoperturbacinenlaclaridaddela
transmisindelainformacin.Unodelosobjetivosdeestateoraeraencontrarlarelacinentre
informacinyruido.Elconceptoderuidofueasociadoalanocindeentropapropuestaporla
segundaleydelatermoinmica,considerndosesteanlogoalaestticaenlacomunicacin
visualyauditiva,esdecir,alasinfluenciasexternasquedisminuyenlaintegridaddela
comunicacinydistorsionanelmensajeparaelreceptor.
Laredundanciarepeticindeelementosdentrodeunmensajequeevitaladistorsinyel
fracasodelatransmisindeinformacin,esconsideradacomoentropanegativao
neguentropa,siendounelementoindispensableparaeliminarlosefectosdistorsionantesdel
ruidoyfavorecerunacomunicacinefectiva.
ElmodelodesarrolladoporShannonyWeaverofreceunalecturalinealydidicadela
comunicacindadoqueestcentradoenlosmensajesenviadosdeunpuntoaotroyenlos
resultadosoposiblesinfluenciassobreemisoryreceptor.Alincorporarelconceptode
retroalimentacindelaCibernticaseobtieneunamayorcomprensindelascomplejas
comunicacionesinterpersonalesysepasadelaconcepcinlinealalacircular.
Estateorahatenidograninfluenciaentrelosingenieros,fsicos,socilogos,psiclogosy
linguistas.En1960RomanJakobsonproponeunmodelosimilareliminandolosaspectosms
tcnicos,loqueloconvierteenmodelodelacomunicacinenlascienciassocialesenEstados
UnidosyenEuropa.YvesWinkinlodenominael"ModeloTelegrficodelaComunicacin"(32).
La"universidadinvisible"eseltrminoconelquesehadesignadoaungrupodeinvestigadores
interesadosenlacomunicacinyeneldesarrollodemodelosgeneralesdesdelasmsdiversas
disciplinas.Sonellos,GregoryBateson,RayBirdwhistell,elgrupodePaloAlto,AlbertScheflen,
EdwardHallyErwingGoffman.

http://www.click.vi.it/sistemieculture/Jutoran.html

6/18

14/9/2016

SistemicaCibernetica

BatesonescribejuntoconJurgenRueschen1951,ellibro"Comunicacin,lamatrizsocialdela
psiquiatra",enelqueproponen"...quelacomunicacineslamatrizenlaqueestnenclavadas
todaslasactividadeshumanas"(19).Estelibroeselpredecesor,16aosantes,dellibro
"PragmticadelaComunicacinHumana"deWatzlawick,BeavinyJackson.
BatesonyReuschestablecendistintosnivelesenlatransmisindelacomunicacin:verbales
lingusticosyextralingusticos,noverbales,ycontextuales,yunsegundoniveldeabstraccin,la
metacomunicacin,comunicacinacercadelacomunicacin.
DespusdelaConferenciaMacyde1950,Batesonemprendelatareadeintroducirlaciberntica
enlascienciassociales.AlrecibirfondosdelaFundacinMacyparaestudiarlacomunicacinen
losanimales,temaqueleinteresabaparaelaborarunateorageneraldelacomunicacin,
organizaungrupointegradoporJohnWeakland,JayHaley,VirginiaSatir,JulesRiskin,William
FryyPaulWatzlawick,alqueluegoseintegraelpsiquiatraDonJackson,quieninteresadoenel
conceptode"homeostasisfamiliar"(7)proponeconsideraralafamiliacomounsistema
homeosttico,enequilibriointernopormediodemecanismosderetroalimentacinnegativa.
TrabajandoenelHospitaldelaVeteransAdministrationelgrupopartedelestudiodelosanimales
parapasarluegoaestudiarlasfamiliasdelospacientesesquizofrnicos.Elartculo"Haciauna
teoradelaesquizofrenia"(1956),esproductodeestetrabajointerdisciplinarioenelque
desarrollanlafamosaycontrovertida"TeoradelDobleVnculo".
En1959Jackson,interesadoenaplicarlasinvestigacionesdelgrupoalapsicoterapiayestudiar
alafamiliacomounsistemagobernadoporunconjuntodereglas,fundaelMentalResearch
Institute.ElgrupoestintegradoporJulesRiskin,VirginiaSatir,yseincluyenluegoPaul
Watzlawick,JohnWeakland,JayHaley,RichardFischyArthurBodin.ElM.R.I.,ogrupodePalo
Alto,comoseloconoceinternacionalmente,setransformaenunodelosprincipalescentrosde
investigacin,formacinyasistenciaenelcampodelaterapiafamiliar.En1967sepublica
"PragmticadelaComunicacinHumana.UnEstudiodePatronesInteraccionales,Patologasy
Paradojas"(enespaol,TeoradelaComunicacinHumana).SusautoressonPaulWatzlawick,
DonJacksonyJanetBeavin.Estaobra,quepresentalasnuevasideassobrecomunicacin
fundadasenlacibernticaylateorageneraldelossistemasesconsideradahastahoyun
clsicoenelcampodelaterapiasistmica.Enella,losautoresserefierenfundamentalmentea
lacomunicacincomocomportamientosoconductasqueafectanalaspersonasensu
interaccin,yplanteanenformadeaxiomasalgunasdelasideassurgidasdesutrabajocon
Bateson.Laimposibilidaddenocomunicarseelconceptodeinformacineinstruccin,aportado
porMc.Culloch,losdosnivelescomponentesdetodacomunicacin,elprimeroreferidoal
contenidodelmensaje,yelsegundo,aladefinicindelarelacinlapuntuacindelasecuencia
dehechos,organizacindeloshechosdeacuerdoalasdistincionesquetrazacadaparticipante,
demodoqueunooelotrotienelainiciativaenesasecuencia,loquedeterminadistintaslecturas
deunamismasituacinladiferenciacinentrelosdoscomponentesdetodacomunicacin,
digitalyanalgico,verbalesynoverbalesrespectivamente,larelacinsimtricay
complementariaentrelosparticipantes,conceptostomadosdelaclasificacinquehaceBateson
sobrecismognesissimtricaycomplementaria,queseutilizanindependientementedelproceso
cismognicoycaracterizancomosimtricaslasinteraccionesenlascualeslosparticipantes
igualansuscomportamientosrecprocos,ycomplementariaslasquesebasanenunamxima
diferencia.Apartirdeestosaxiomaslosautoresdesarrollanconceptosrespectoala
comunicacinpatolgicayelModelodelCentrodeTerapiasBrevesdelMentalResearchInstitute
dePaloAlto.
En1944losantroplogosRayL.BirdwhistellyMargaretMeadestudianlosritualesamorososen
Inglaterra.Birdwhistell,interesadoenestudiarellenguajedelosgestos,kinsica,seencuentra
mstardeconBatesonyjuntosproducen"lahistorianaturaldeunaentrevista"secuenciadeuna
entrevistarealizadaporBatesonconunamadreysuhijo.Durante10aos,Birdwhistellsededica
ahacerunanlisispsicolgico,lingusticoykinsicodelafamosa"escenadelcigarrillo",
secuenciade9"dondeBatesonenciendeelcigarrillodelamadre.Desarrollaunateoraenlaque
lagestualidadyellenguajeconfiguranenunsistemaconstitudopormltiplesmodosde
comunicacin:tacto,olfato,espacioytiempo.Birdwhistellconsidera"...elcomportamiento
http://www.click.vi.it/sistemieculture/Jutoran.html

7/18

14/9/2016

SistemicaCibernetica

interindividualcomouna'corrientedecomunicacin'..."(32),enlaquelapersonanosecomunica
con,sinoqueparticipaenunacomunicacin.
AlbertScheflen,mdicopsiquiatra,dedicatambin10aosalestudiodeunaprimerasesinde
30'deunajovenesquizofrnicaysumadre.TrabajaconunidadesmsextensasqueBirdwhistell
ycomolrealizaun"anlisisdecontexto"(32).Analizacmoserelacionanlaspersonasrespecto
asusposturas.Enestesentido,consideraquelacomunicacinesun"...'ballet',bailadosegn
papelescomplementariosoparalelos"."...enfuncindeunapartiturainvisible"(32).
ElantroplogoEdwardHallestudialaproxmica,organizacinsocialdelespaciointerpersonaly
loscdigosquerigensuutilizacin,considerandoquecadaculturaloorganizademanera
diferente.EdwardT.Hallbuscadescubrirel"LenguajeSilencioso"ttulodeunodesuslibros
delaculturacomosistemadecomunicacin.Sededicaaestudiarlaestructuracinyla
significacindelespaciodemueblesypuertasylodenomina"espaciodeorganizacinsemifija",
ymsadelanteamplasucampodeestudioalosedificiosyciudades,definidocomoespaciode
"organizacinfija".
ElsocilogoErwinGoffmanensuslibrosEstigmayAsilosestudiaalosdisminudosyalos
internadosrespectivamente,paraobtenerreferenciasdelasreglas"normales"querigenla
comunicacin."ParaGoffman,lasinteraccionessocialesconstituyenlatramadeunciertonivel
delordensocial,porquesefundanenreglasynormasaligualquelasgrandesinstituciones,tales
comolafamilia,elEstado,laIglesia,etc"(32).
Todosloscientficosquepertenecenala"universidadinvisible"compartenlaconcepcindeque
lacomunicacines"...unprocesosocialpermanentequeintegramltiplesmodosde
comportamiento,lapalabra,elgesto,lamirada,lammica,elespaciointerindividualetc.",(32)
considerndolacomountodointegradoregidoporunconjuntodecdigosyreglasdeterminados
porcadacultura.ElmodelotelegrficodeShannonyWeaverqueconsiderabalacomunicacin
comointercambiootransmisindeinformacinsehaampliadoconfigurndose"elmodelo
orquestaldelacomunicacin",(32)enelquestaseconsideraunfenmenosocial.
CIBERNETICA
"Ciberntica,delgriegokybernetikeesuntrminoquesignificaelartedegobernar,utilizadopor
primeravezen1834porAndrMarieAmpere.Ensentidoamplio"laCibernticaperteneceala
cienciadelapautaylaorganizacin"(8).
SegnHeinzvonFoersterlahistoriadelacibernticasepuedeobservarcomounprocesoque
sedesarrollaentresnivelesdecomplejidad:unaCibernticade"0orden",implcita,la
Cibernticade"1er.Orden",reflexinexplicitadaenlaobradeNorbertWiener(1948),yuna
Cibernticade"2doOrden",reflexinsobrelareflexindelaCiberntica,resultandoimposible
accederaunnivelsuperioraste,dadoquecuandounoreflexionasobrelareflexinsecierrael
crculodeargumentacinseproduceunaclausuraorganizacionalqueslopuedetrascendersea
smismadentrodesmisma(15).
CIBERNETICA"0ORDEN"
HerndeAlejandraenelao62A.C.fueelprimeroqueinventunsistemaciberntico.Este
sistemaconsistaenunmecanismoderetroalimentacinnegativaqueregulabaellquidoque
saladeunajarraalllenarunvaso,ysedetenaenundeterminadomomentoprevisto
anteriormente.Elsistemadeautorregulacinseaplicyaeneseentonces,peronohubo
desarrollostericosoreflexionesaeserespecto.
CIBERNETICADE1ER.ORDEN
PrimeraCiberntica
DesdelapocadeHernhastalaaparicindelaCibernticade1er.ordendebernpasar2.000
aos.En1932,elbilogoClaudeBernardutilizaelconceptodemediointernoparahacer
http://www.click.vi.it/sistemieculture/Jutoran.html

8/18

14/9/2016

SistemicaCibernetica

referenciaalorganismocomosistemayplantearquenoesposibleconsideraraunapartedel
organismoseparadadelasotras,yquetodassoninterdependientesenunadinmicano
descriptibleenlostrminoscausalescorrientes.
AWalterCannonsedebeelconceptodehomeostasis.PredecesordirectodeWiener,tomala
nocindeClaudeBernarddelmediointerno,ylaconsideraentrminosdemecanismos
fisiolgicosenrelacinalaconstanciadelmedio.Cannonestinteresadoenlosmecanismosde
regulacinylanocindehomeostasissurgeenladescripcindeunareddeinteracciones
recprocasenlaquelosdistintoscomponentesdelmediointeriorestnenequilibriodinmico.
EstasnocionesestimularonadistintaspersonasdelcampodelaBiologa,lasMatemticas,la
Fsica,antroplogos,socilogoseingenieroselectrnicos.Entreellos,GregoryBateson,Warren
Mc.Culloch,MargaretMead,JohnvonNeumannyNorbertWiener.
NorbertWiener(1954/1967)estudiandolaconductadetirodeloscaonesantiareosparapoder
optimizarsuobjetivo,utilizaelprincipioderetroalimentacinofeedbackcomounadelasbases
desuteora.Dichoprincipiohacereferenciaaunmecanismoquereintroduceenelsistemalos
resultadosdesudesempeo.Deestamaneralainformacinsobrelosefectosretroactasobre
lascausasconvirtiendoelprocesodelinealencircular.Paraquesepuedaproducireste
movimientodecontrolesnecesariotenerunsensorquedeinformacinrespectoalaposicin
actualdelsistemaenrelacinalestadodeseado,demaneratalquelosmecanismosde
correccindeladesviacinentreunoyotropuedanactuar.Wienerconsiderqueelprincipiode
correcindelerroreselmismoenlasmquinasyenlossereshumanos.Esteprincipioest
basadoenlosmecanismosdeactivacinycorreccindelerror.Wienerlodenomin"Controly
comunicacinenelanimalylamquina"yacueltrminoCibernticaen1948."WarrenMc.
Culloch(1965)ladescribicomounaepistemologaexperimentalcentradaenla'comunicacin
dentrodelobservadoryentreelobservadoryelmedio'"(21).
Enestaetapaseconsiderabaquelosprocesosdecorreccindeladesviacin(feedback
negativo)permitanmantenerlaorganizacinyquelosprocesosdeampliacindeladesviacin
llevabanaladesorganizacin,elcaosyladestruccindelsistema.Porlotanto,lahomeostasis
comoprocesoautocorrectivoeraelconceptopredominante.
SegundaCiberntica
FueMagorohMaruyama(1963)quiendefiniestaetapacomo"segundaciberntica"(6).El
considerquetodosistemavivientedependeparasusupervivenciadedosprocesos:
"morfostasis"y"morfognesis".Elprimeroserefierealmantenimientodelaconstanciadeun
sistemaatravsdemecanismosderetroalimentacinnegativa.Elsegundo,porelcontrario,ala
desviacin,variabilidaddelsistemaatravsdemecanismosderetroalimentacinpositiva.Segn
Maruyama,encadasituacin,losprocesosdedesviacinydeamplificacinseequilibran
mutuamente.
ApartirdelostrabajosdelfsicoIlyaPrigoginesobre"ordenapartirdelafluctuacin"(18)se
empiezaaconsiderarqueladesviacinylosprocesosquepromueveneldesordenyla
desorganizacinnonecesariamentesondestructivos.Lasdesviacionesofluctuaciones,sise
mantienenynosoncontrarrestadaspormecanismoscorrectores,producenunabifurcacinque
generaunsaltocualitativohaciaunanuevaorganizacin.Enestasegundaetapadeldesarrollo
delpensamientocibernticolaampliacindeladesviacinylosmecanismosde
retroalimentacinpositiva,procesosfavorecedoresdelcambio,adquierenunnuevostatus,son
consideradosesencialesparalaevolucindelossistemasvivientes.
CIBERNETICADESEGUNDOORDEN
Losnuevosdesarrollosdelafsicaquntica,losaportesdelfilsofoLudwigWittgenstein,del
neurofisilogoWarrenMc.Culloch,delfsico,cibernetista,biomatemticoyfilsofoHeinzvon
FoersterylosbilogoschilenosHumbertoMaturanayFranciscoVarelaconstituyenlospilares
sobrelosquesehaconfiguradoelterritoriodelacibernticadesegundoorden.
http://www.click.vi.it/sistemieculture/Jutoran.html

9/18

14/9/2016

SistemicaCibernetica

En1972,lapresidentadelaAsociacinNorteamericanadeCiberntica,MargaretMead,
pronunciaundiscursotitulado"Cibernticadelaciberntica".EselProfesorHeinzvonFoerster
quiensugierecambiarestenombrepor"CibernticadeSegundoOrden"o"Cibernticadelos
SistemasObservantes"diferencindoladelaCibernticadePrimerOrdendefinidacomo
CibernticadelosSistemasObservados.
Laepistemologatradicionalconsideraquelarealidadexisteindependientementedequienla
observa.Elpensamientocientficosebasaenestapremisaalconsiderarquelaobjetividadenla
cienciaesfundamentalyqueporlotanto,laspropiedadesdelobservadornodebenestar
includasenladescripcindesusobservaciones.
ComosealavonFoerster"Mientrasqueenelprimercuartodeestesiglolosfsicosy
cosmlogosfueronobligadosarevisarlosconceptosfundamentalesquegobiernanlasciencias
naturales,enelltimocuartodeestesiglosernlosbilogoslosqueimpondrnunarevisinde
losconceptosfundamentalesquegobiernanalacienciamisma.EneltempranosigloXXera
claroqueelconceptoclsicodeuna'ciencialtima',oseadeunacienciaquesignificarauna
descripcinobjetivadelmundoenlacualnohayasujetos(un'universosinsujetos')contena
contradicciones.
Paraeliminarestascontradicciones,eranecesariotomarencuentaaun'observador'(almenos
unsujeto):(i)Lasobservacionesnosonabsolutas,sinorelativasalpuntodevistadelobservador
(esdecirasusistemadecoordenadas:lateoradelarelatividaddeEinstein)(ii)Elactode
observarinfluyesobreelobjetoobservadoalpuntodeanulartodaexpectativadeprediccinde
partedelobservador(esdecirquelaincertidumbre,laindeterminacin,setransformaen
absoluta:Heisenberg)".(24)
ParavonFoerster"Lareintroduccindelobservador,laprdidadelaneutralidadydela
objetividad,sonrequisitosfundamentalesparaunaepistemologadelossistemasvivientes"(24).
Segnestecientfico,larespuestaalapregunta:"Lasleyesdelanaturaleza,losobjetos,una
frmulamatemtica,losnmeros,lasleyes,sondescubrimientosoinvenciones?"(24)definela
posicinepistemolgicadelobservador,yaseaquesteconsiderelaexistenciadeunarealidad
trascendenteaserdescubierta,osedefinacomoinventoroconstructordelarealidadobservada.
Desdeestaposicinlonicoqueunobservadorpuedehacer"...eshablardesmismo"."...de
todasmanerasquotracosapuedeunohacer?"(26).Sugiereporlotantomodificarlafrasede
Korszybski:"Elmapanoeselterritorio"por:"ElmapaESelterritorio",definiendouna
epistemologaquedacuentadelobservador.Maturanatambindir"Todolodichoesdichopor
unobservadoraotroobservador,oasmismo"(12).
Lacibernticadesegundoordennosintroduceenlaobservacindelobservador.Elobjetode
estudiopasaaconstituirseenelobservadorobservandosupropiaobservacin
cibernticamentehablando,lacibernticasetransformaencibernticadelaciberntica,o
cibernticade2do.orden.
VonFoersterestinteresadoenexplicarlanaturalezadelavida,losprocesoscognitivos,el
problemadelapercepcin,delconocimientodelosobjetosylanaturalezadellenguaje,paralo
cualincursionaenlasmatemticas,laneurofisiologa,lacomputacinylaciberntica,
reflexionandosobrelasnominalizaciones,lossilogismoslgicos,lasparadojas,lacausalidady
lasexplicaciones,paradesarrollarlosconceptosderecursividad,autorreferencia,auto
organizacin,complejidadyautonomadelossistemasvivientes.
Lacircularidadylaretroalimentacin,temascentralesdelaciberntica,estnrepresentadaspor
elouroborus,laserpientemticaquesemuerdesupropiacola.Estosconceptosestnimplcitos
enlanocinderecursividad,lasoperacionesqueserepitensobresmismas,siendola
autorreferenciaunanocinparticulardelconceptomsgeneralderecursividad.Conrespectoa
ella,vonFoersteranalizalaexclusindelasparadojasdelpensamientolgicoaristotlicotoda
proposicindebeserverdaderaofalsa,dadoquestassonfalsascuandosonverdaderasy
verdaderascuandosonfalsas,ytambinsuexclusindelaTeoradelosTiposLgicosde
http://www.click.vi.it/sistemieculture/Jutoran.html

10/18

14/9/2016

SistemicaCibernetica

WhiteheadyRusselllaparadojadelapertenenciaasmismaono,delaclasedetodaslas
clases,yplanteaquelasparadojassurgendelasproposicionesautorreferencialesoreflexivas,
("Soyunmentiroso"EpimimnidesdeCreta)preguntndose:"qusucedesilaautorreferenciaes
elmodusoperandidelorganismohumano?"(20).Larespuestaafirmativaaestapregunta
resuelveeldilemaplanteadoporlasparadojas.
Laepistemologatradicionalplanteaquelosdatossonincorporadosatravsdelsistema
sensorialyluegoprocesadosporelcerebroparagenerarunaaccin.Desdelaposicin
constructivistaseconsideraque"Hayefectivamenteuncontnuoprocesocircularyrepetitivoen
elquelaepistemologadeterminaloquevemosestoestableceloquehacemosalavez
nuestrasaccionesorganizanloquesucedeennuestromundo,queluegodeterminanuestra
epistemologa"(24).
ParavonFoerster,losobjetossonconstrudosatravsdelasaccionesmotoras,esdecirqueel
conocimientoesinseparabledelaaccin."Piagetdesarrollen1937en'Laconstruccindela
realidadenelnio'laideadequelacognicinsurgedelaadquisicindehabilidadessensomo
toras.Elclarificlanaturalezarecursivadeestosprocesosalllamarnuestraatencinsobrelas
accionescircularesdelosensorialsiendointerpretadasporlomotrizy,delamismamanera,
aquellasmotricessiendointerpretadasporlosensorial"(25).VonFoerstercoincideconPiagetal
proponersuimperativoesttico:"Sidecidesveraprendeaactuar".
Otrodesusaporteshasidolaincorporacindeltrminocomputacinalosprocesoscognitivos.
SegnVonFoersterelconocimientoeslacomputacindedescripcionesdeunarealidad.Utiliza
estetrminoensentidoampliocomo"todaoperacinpormediodelacualsetransforma,
modifica,rearregla,ordena,ydems,entidadesfsicasobservadas('objetos')osus
representaciones('smbolos')"(27).Alpostularquetodadescripcinsesustentaenotras
descripcionesquesontambincmputos,proponedefinirelconocimientocomoprocesos
ilimitadamenterecursivosdeclculo,esdecir,lacomputacindelacomputacindela
computacin,etc.
EnsuanlisisdellenguajevonFoersterplanteaqueselopuedeconsiderardesdedospuntos
devistadiferentes:ellenguajeensuapariencia,queserefierealascosascomoson,oel
lenguajeensufuncin,queserefierealasnocionesquecadaunotienedelascosas.Desdela
primeraposicinunoesunobservadorindependiente,separadodelUniversoyellenguajees
monolgico,denotativo,descriptivo,sintcticodicecomoesoes.Desdelasegundaposicinuno
esunactorparticipanteenmutuainteraccinconlosotrosyellenguajeesdialgico,connotativo,
constructivo,semntico,participativo,escomounodice."Cuandopronuncioalgo,nomeestoy
refiriendoaalgoallafuera.Msbien,generoenUd.,toco,pordecircomounviolinistapulsando
unacuerda,lotocaaUd.consumsicatodaunaresonanciadecorrelatossemnticos"(20).
Laclausuraoperacionaldelsistemanervioso,laautoorganizacinylaautorreferenciaestn
inextricablementeligadasalaautonomadelossistemasvivientes,pero"laautonomaimplica
responsabilidad.Siyosoyelnicoquedecidecmoacto,tambinsoyresponsableporello"
(20).
Lacibernticadesegundoordenabreunespacioparalareflexinsobreelpropio
comportamientoyentradirectamenteenelterritoriodelaresponsabilidadylatica.Dadoquese
fundamentaenlapremisadequenosomosdescubridoresdeunmundoexterioranosotros,sino
inventoresoconstructoresdelapropiarealidad,todosycadaunodenosotrossomos
fundamentalmenteresponsablesdenuestraspropiasinvenciones.SegnvonFoersterelcambio
fundamentalqueimplicaasumirestaposicinnoslosemanifiestaenelquehacercientfico,
docente,empresarialotantosotros,sinoenlacomprensindelasrelacioneshumanasenlavida
diaria.Siunoseconsideraunobservadorindependiente,"...puededeciralotrocomopensary
actuar:'Tdebes...''Tnodebes...':Esteeselorigendeloscdigosmorales"."Siunose
consideraunactorparticipanteeneldramadelamutuainteraccin,deldaryrecibirenla
circularidaddelasrelacioneshumanas"....."...dadamiinterdependencia,slopuedodecirmeam
mismocmopensaryactuar:'Yodebo...','Yonodebo...':Esteeselorigendelatica"(26).
http://www.click.vi.it/sistemieculture/Jutoran.html

11/18

14/9/2016

SistemicaCibernetica

ElProf.HeinzvonFoersterhaaceptadogentilmentelainvitacinacolaborarenestetrabajo.
"SaraJutoranmehainvitadoadarmipuntodevistarespectoalasideassistmicasrelacionadas
conlaTerapiaSistmica.Lamitologaenlaquecrec,lamitologarespectoalsurgimientodela
TerapiaSistmica,comienzaconGregoryBateson,elantroplogo,cuyointersenlaformayla
patologadelarelacinlopusoencontactoconlospsiquiatras.Unavezselepidiobservaraun
nio,el'pacienteidentificado'enunafamilia,cuyocomportamientoeraaparentemente
insoportableparasusmaestros,compaeros,padres,etc.Batesonrehusveralniosolo:qu
podaverlenestenioaislado,separadodelmundoquelorodeaba?Seracomopreguntarpor
elsignificadodeunapalabraexcludadelcontexto.Cuandollegelnioconsufamilia,fue
evidentequetodalafamilianecesitabaayuda,siendoelnio,quizs,elmssanoenese
'sistema'.
ProbablementedebidoamiamistadconBatesondesdeelfinaldelosaoscuarenta,yasu
conocimientodemiinterssobrelosaspectosmsformalesdelafilosofaylaepistemologa,fu
invitadoporlagentedelMentalResearchInstitutedePaloAltoenCalifornia,parahablaralos
terapeutasfamiliaressobrelasanomalaslgicasquesurgencuandounoobservasistemasde
loscualesunomismoesparte.Elegparamiconferenciaelttulo:'Paradojas,Contradicciones,
CrculosViciosos,yOtrosRecursosCreativos.'
Pareceserquealaaudiencialegustloquedijey,porrazonesimpenetrablesparamenese
entonces,fuvariasvecesinvitadoparareferirmeaestosproblemasepistemolgicosyotros
relacionadosconellos.Lentamenteempecacomprenderquelasexperienciasypercepciones
quesurganenlaprcticateraputicayalgunasdelasideas,queresultarondeltrabajodelgrupo
interdisciplinariodeinvestigacinalqueyoperteneca,elLaboratoriodeComputacinBiolgica
delaUniversidaddeIllinois,dedicadoaestudiarlosprocesoscognitivosdesdeunpuntodevista
experimental,tericoyepistemolgico,estabanconceptualmentetanestrechamente
entrelazadasquedieronaluznuevosinsightsyperspectivasenestaproductivainterfase.
Fue,porsupuesto,laautoridaddelalgicaAristotlicalaquehizodudaralosterapeutasde
entraralmundoparadjicodelaclausura,laautoreferencia,ylossistemas,'sistemas'enel
sentidooriginalgriegode'synhistamein',esdecir,'estarjuntos',enelsentidode'nosotros'ms
que'tallyoaqu'yfue,porcierto,laempatadelterapeutaensuprctica,laquepermitia
losformalistasverelmsprofundosignificadodesutrabajo.Estoyagradecidodehabersido
invitadoaparticiparenlaconstruccindeunpuenteentrelaautoconcienciaylaconciencia
moral*,esdecir,unpuenteentreelconocimientoylatica"(HeinzvonFoerster,1992).
HUMBERTOMATURANA
LosfundamentosdelateoradelconocimientodelbilogoHumbertoMaturanaR.surgendetres
preguntas:Culeslaorganizacindelservivo?Culeslaorganizacindelsistemanervioso?
Culeslaorganizacindelsistemasocial?Maturanadesarrollaunateorasobrelaorganizacin
delosseresvivientesylanaturalezadelfenmenodelconocerbasadaenlaautonoma
operacionaldelservivo,proponiendounadescripcindeloperarcognoscitivodelservivosin
referenciaaunarealidadexterna.
PercepcineIlusin,SistemaNerviosoyCognicin.
Apartirdesusinvestigacionessobrelasdistincionescromticasenlapercepcindeloscolores,
Maturanaponeendudalaobjetividadcientficayplantealaimposibilidaddedistinguirenla
experiencia,entrepercepcineilusin,entreverdadyerror(distincinquesehace
comparativamenteenreferenciaaotraexperienciaqueseconsideravlida),considerandoque
paraexplicarlosfenmenosdelapercepcinesnecesarioentendercmooperaelsistema
nervioso.Defineesteoperarcomounaredcircularcerradadecambiosderelacionesdeactividad
neuronal.
Autopoiesis
EnsutrabajosobrelaorganizacindelosseresvivosMaturana,conlacolaboracinde
FranciscoVarela,proponequestosseconstituyenyoperancomosistemascerradosde
http://www.click.vi.it/sistemieculture/Jutoran.html

12/18

14/9/2016

SistemicaCibernetica

produccionesmolecularesabiertosalflujomaterialyenergtico.Maturanaacuaeltrmino
autopoiesisparareferirsealaorganizacinquedefineyconstituyealosseresvivos(autos=s
mismopoiesis=producir).AsMaturanadice:"Unaunidadcompuestacuyaorganizacinpuede
serdescritacomounaredcerradadeproduccionesdecomponentesqueensusinteracciones
constituyenlareddeproduccionesquelosproducen,yespecificansuextensinalconstituirsus
fronterasensudominiodeexistenciaesunsistemaautopoitico"(15).
Loquehacealosseresvivossistemasautnomosessuorganizacinautopoitica,ylosseres
vivosexistenentantoserealizancomosistemasautopoiticosmoleculares,explicanMaturanay
Varelaensulibro"Elrboldelconocimiento".Maturanaaplicaademsalosseresvivoslanocin
dedeterminismoestructuralsealandoquelosseresvivos,entantosistemasmoleculares,son
sistemasdeterminadosensuestructura.Lossistemasvivientessonsistemastalesquetodolo
quepasaenellossurgedeterminadoensudinmicaestructural,demodoqueloexternoslo
puedegatillarenunservivocambiosestructuralesdeterminadosenl.Estosignificaqueelser
humano,entantoservivo,slopodroryactuardesdesmismo.ComosealaMaturana,la
coincidenciaqueunobservadorveeneloperardeunservivoconsucircunstanciaresultade
quesudinmicaestructuralesconcordanteconelmedioenqueopera.Estoesasporqueelser
vivotieneunaestructuraplsticaquecambiaenconcordanciaconlaestructuradelmedio,sino
semuere(acoplamientoestructural).Lanocindeacoplamientoestructuralesfundamentalpues
serefierealadinmicaquehaceposiblequeservivoymedio,aunquesistemasdeterminadosen
suestructura,cambienestasestructurasdemaneracoherentedemodoqueelservivomientras
vive,generaconductasconcordantesconelmedio.
LacomprensindeloquediceMaturanaexigeoperarconlanocindedeterminismoestructural.
Conrespectoaestanocin,Maturanaesclaroensealarquestanoesunsupuestoontolgico,
sinounaabstraccindelascoherenciasdelaexperiencia.Haytantosdominiosdedeterminismo
estructuralcomodominiosdecoherenciasexperiencialesycadadominiodecoherencias
experiencialesesundominiodedeterminismoestructural.Enlosmltiplesdominiosde
acoplamientoestructurallossistemascambianjuntosensusinteraccionesrecurrentesy
conservansucoherenciaoperacionalcomoresultadodesuplasticidadestructural.Esdecirque,
aunquelosseresvivos,entantoautopoiticos,sonsistemascerrados,sumododeoperar
cambiasegnlascontingenciasdesusinteraccionesporquesuestructuraplsticacambiade
maneracontingentealcursodeesasinteracciones.EsdesdeesteentendimientoqueMaturana
hageneradolosconceptosde:clausuraorganizacionaldelsistemanervioso:estamoscerradosa
lainformacindeterminismoestructural:loquenospasadependedenuestraestructura
acoplamientoestructural:vivimosencongruenciaconelmedioyconlosotrosyenconstante
cambioestructural."Organismoymediosegatillanmutuamentecambiosestructurales"..."Uno
existecomoservivoenunespaciodecoherenciaoperacionalconsucircunstancia,en
acoplamientoestructural.Porlotantonopasacualquiercosa,slopasaloquepuedepasarde
acuerdoaladinmicaestructuraldelsistemaydelacircunstania"(16).
Alexplicarelfenmenodelconocer,Maturanapartedelaexperienciadelobservarysepregunta
porelorigendelascapacidadesdelobservadoraceptandolapregunta:cmoseexplicanmis
habilidadesocapacidadescomoobservador?Enelprocesoderesponderaestapregunta
desarrollaloquelllama"Laontologadelobservar".Enesteprocesomuestraqueelexplicar
cientficonohacereferenciaaunarealidadindependientedelobservadoryquenoserequiereel
supuestodeunatalrealidadpostulandoquelanocinderealidadesunaproposicinexplicativa.
Asdice:"Todolodichoesdichoporunobservadoraotroobservadorquepuedeserloella
misma"(12)ensupropuestadesuspenderlaconviccinrespectoalaobjetividaddenuestras
percepciones"...invitandoaponerlaobjetividadentreparntesisenelprocesodeexplicar"(13).
G.SpencerBrown,ensulibroLeyesdelaForma,consideraqueelpuntodepartidadetodo
conocerimplicaeltrazarunadistincin,"ununiversoseengendracuandoseseparaoapartaun
espacio"y"loslmitespuedentrazarseencualquierlugarquenosplazca"(22).Demanera
independientedeSpencerBrownMaturanadir"todoactodeconocertraeunmundoalamano"
(11)parareferirsealasoperacionesdedistincindelobservadorquetraenalamanolo
distinguido.Segnllaoperacindedistincinespecificalodistinguido,ylodistinguidosurgede
lanadaconlaoperacinquelodistingueyloconfigura.Paraelobservadorlodistinguidosurge
http://www.click.vi.it/sistemieculture/Jutoran.html

13/18

14/9/2016

SistemicaCibernetica

comosihubieseexistidoantesdeladistincinycomosifueseaexistirsiempredespusdeella.
Esenlaexplicacindelaexperienciadeladistincinquesurgeelproblemadelarealidad.
Maturanamantienequeloqueelobservadorexplicaessuexperiencia,yquelaexperienciaeslo
queelobservadordistinguequelepasaencircunstanciasqueelexplicarestambinuna
experienciaaexplicar.Desdeestaperspectivasurgendoscaminosexplicativossegnuno
acepteonoaceptelapreguntaporelobservadoryelobservar.Unoeselcaminoexplicativodela
objetividadsinparntesisquesurgeapartirdequeelobservadoraceptaqueposeecomo
propiedadconstitutivalacapacidaddehacerreferenciaaunarealidadtrascendenteparavalidar
suexplicar(13).Elotroeselcaminoexplicativodelaobjetividadenparntesis,quesurgeal
aceptarelobservadorquesushabilidadescomotalsurgendesuoperarcomoservivoenel
lenguaje,yreconocerquecomoservivonopuededistinguirenlaexperienciaentreilusiny
percepcin.Laposturadelaobjetividadenparntesisnocorrespondealosubjetivosinoque
sealaundarsecuenta.Elobservadorsedacuentadequeenlaexperiencianopuededistinguir
entreilusinypercepcinyaceptanousar,dadoquenoesposible,elsupuestoaccesoauna
realidadtrascendenteparavalidarsuexplicar.Reconocedeestamaneraqueexplicala
experienciaconcoherenciasdelaexperienciayqueloquevalidasuexplicarsonlascoherencias
desuexperiencia.Respectoalasexplicacionescientficas,Maturanamuestraqueelcriteriode
validacinnorequiereelsupuestodeunarealidadindependiente.Porlotantolacienciacomo
dominioexplicativo,aloperarconcoherenciasdelaexperienciaseconstituyecomoundominio
generadordemundosexperienciales.
Maturanadaorigenaungirofundamentalenlacomprensindelasrelacioneshumanasal
aceptarcomocondicinconstitutivadelohumanoelnoaccesoaunarealidadindependientedel
observadorysuobservar.NingnserhumanotieneunaccesoprivilegiadoaLaRealidady/oLa
Verdad,ycadadominioexperiencialysurespectivodominioexplicativosonlegtimamente
vlidos,aunquepuedennoserdeseables.Siunoaceptalaexistenciadeunarealidad
independienteydeunconocimientoobjetivodeesarealidad,entraenundominioenelcual
suponequepuedeteneraccesoaella,yqueenconsecuenciapuedeimponersusargumentosal
otro,conlocualsejustificatodotipodeviolencia.Siseaceptalainvitacinaponerlaobjetividad
entreparntesis,entonces"larealidadaparececomoloquees,unargumentoexplicativo"(16).
Unonoespartedeluniverso,sinoqueparticipaenun"multiverso",consideradocomoelconjunto
detodoslosdominiosderealidadquesurgendenuestrasdistincionesyexplicaciones.Enel
multiversocadarealidad,esdecir,cadadominioexplicativodelaexperiencia,eslegtima,pero
unoessiempreresponsableporlasconsecuenciasdecadaunodesusactos.
ParaMaturanacreamoselmundoenellenguajear.Esennuestrasconversaciones
entrelazamientodelemocionaryellenguajearquesomoshumanos.ElplanteodeMaturananos
llevaadarnoscuentaquelaspreocupacionesticasnosurgendelaraznodeunargumento
trascendentesinodelabiologadelamor,delveralotrocomoalguienqueaunoleimporta,lo
queremitealaticaenlaconvivenciaytienefundamentalesrepercusionesparaeldevenirdelas
relacioneshumanas."Laresponsabilidadsedacuandonoshacemoscargodesiqueremosono
lasconsecuenciasdenuestrasaccionesylalibertadsedacuandonoshacemoscargodesi
queremosononuestroquereronoquererlasconsecuenciasdenuestrasacciones"(13).
"Cuandounooperaconlaobjetividadenparntesis,enlamedidaquesabequenopuedehacer
referenciaaunarealidadindependientedeuno,sabequeslopuedeoperarenlasrelaciones
humanasenconsensooenacuerdosisequierelaconvivencia"(16).
CONSTRUCTIVISMO
Aunqueeltrminoconstructivismo,ensentidoestricto,derivadeunmovimientodelasartes
plsticasylaarquitecturaenlaUninSoviticaalrededorde1920,sepodraconsiderarquefue
JeanPiagetelqueiniciestaescueladepensamientoapartirdesutrabajo"laconstruccindela
realidadenelnio",aunquelasracesdeestemovimientopuedenrastrearsehastaPlatn,
pasandoporGianbattistaVicoyKant.
Unadelascaractersticasfundamentalesdelconstructivismoeselreemplazodelanocinde
descubrimientoporeldeconstruccinoinvencin.BatesonlomencionaensuMetlogo"Ques
http://www.click.vi.it/sistemieculture/Jutoran.html

14/18

14/9/2016

SistemicaCibernetica

uninstinto?"(1)alreferirseaNewtoncomoinventandoynodescubriendolagravedad.Desde
estaposicinsesostienequenoesposibleunaccesodirectoaunarealidadindependientedel
observadoryquenoesnecesariopresuponerlaexistenciaindependientedeunmundoexterno
paraexplicarlo.
Adiferenciadelaepistemologatradicionalcuyoobjetivoes"quesloqueconocemos",el
constructivismosebasaenunaepistemologadelobservador,plantendose"cmoesque
conocemos"Enestesentido,elconocimientoesunconocimientodelpropioconocimiento.
"Elconstructivismoes,comosugierevonFoerster,unaepistemologadelaepistemologa,es
decirunaepistemologaquedebedarcuentadesmisma"(24).
"Losconstructivistasdescartanlaobjetividadeintentandesarrollarunaepistemologa'deadentro
haciaafuera'.Comienzaconelobservadoryluegoeligepostularoestipularelmundoexterior"
(20).AlbertEinsteindir"...enunaconversacinconHeisenberg:Enunateoraesimposible
aceptarslomagnitudesobservables.Esmsbienlateoralaquedecideloquesepuede
observar"(31).
ElconstructivismoradicalpropuestoporErnstvonGlasersfeldparaexplicarelpensamiento
racionalsefundamentaencuatrofuentes:elLenguaje,elEscepticismo,laTeoradelaEvolucin
deDarwinylaCiberntica.
Consideraqueelmundoesdiferentedeacuerdoallenguaje.Desdeestaposicinel
constructivismosefundamentaendosprincipiosbsicos:"1.Elconocimientonoesrecibido
pasivamenteyaseaatravsdelossentidosopormediodelacomunicacin,sinoconstrudo
activamenteporunsujetocognoscente.2.Lafuncindelacogniciesadaptativaysirveparala
organizacindelmundoexperiencial,noparaeldescubrimientodeunarealidadobjetiva
ontolgica"(28).Elconocimientoes,porlotanto,elresultadodelaactividadracionalesuna
construccindelsujetonoesunarepresentacindelarealidad.Esimposibleaccederal
conocimientodelarealidadylaexperienciadelaimposibilidaddeconocerlarealidadsenos
apareceslocuandosurgenobstculosqueimpidenlaviabilidadrespectoaunametadeseada.
SegnvonGlasersfeldelconstructivismoradicalnoniegalarealidadontolgica,sinoqueplantea
laimposibilidaddeunarepresentacinverdaderadeella.Elconocimientoes"...elmapadelos
caminosdeaccinypensamientoque,enesemomento,enelcursodenuestraexperiencia,se
hahechoviableparanosotros"(28).Elconceptodeviabilidadserefierealanoaparicinde
obstculosenlainstrumentacindeunameta."...laviabilidadyelencaje(fit)debensiempre
referirsealmundoexperiencialdelsujetocognoscente"(28).Lanocindeencajeestporlo
tantocentradaensabersielobjeto"...cumpleelservicioosecomportacomoseesperadely,
porlotanto,si'encaja'onoalasituacin"(29).ElplanteodevonGlasersfeldsebasaenlateora
evolucionistaalconsiderarque"losorganismosonuestrasideasnuncapuedenajustarseala
realidad,sinoqueeslarealidadlaquemediantesulimitacindeloposibleeliminasinmsloque
noesaptoparalavida"(29).Sostienequedelamismamanerasepuedeconsideraral
conocimientocomo"capazdesobrevivirsiresistealmundodelaexperienciaynoscapacitapara
hacerciertasprediccionesoparahacerqueciertosfenmenos(apariciones,eventos,
experiencias)ocurranoparaimpedirqueocurran"(29).Elmundoaparecealsujetoslocuando
lasconstruccionesnoencajanystefracasaosurgenobstculosparalograrunameta.Defineal
constructivismocomoradicalporque"...rompeconlasconvencionesydesarrollaunateoradel
conocimientoenlacualsteyanoserefiereaunarealidadontolgica,'objetiva',sinoquese
refiereexclusivamentealordenamientoyorganizacindeunmundoconstitudodenuestras
experiencias"(29).
BRINGFORTHISMO
HasidoHeinzvonFoersterelqueacueltrminobringforthistaparareferirseaMaturana,yes
KarlTomm(1990)elqueproponeelconceptodebringforthismo.SegnKarlTomm,"Maturanaes
elprincipaloriginadordelbringforthismo.Elofreceunaexplicacinheursticadelfenmenodel
observar,ycomosurgeelobservador.Tambinexplicacmosontradasalamanolas
observacionesyconstruccionesenellenguaje,enlaconversacinyenlaconciencia".Maturana
http://www.click.vi.it/sistemieculture/Jutoran.html

15/18

14/9/2016

SistemicaCibernetica

consideraquenoesunconstructivista.SilocomparamosconelpensamientodeVonGlaserfeld,
ste"...tiendeacentrarseenlosconstructosysuviabilidad,mientrasqueMaturanatomaen
cuentatantoelconstructocomosudominiodeexistencia,ylaviabilidaddeambos.Esdecir,
Maturanaconsideralasimultaneidadaltraeralamano'figurayfondo'cuandosehaceuna
distincin.Cualquierdistincinoconstruccinnopuedeaparecersolanecesitateneruncontexto
odominiodeexistenciasiselatraealaexperienciaconalgngradodecoherenciay
autenticidad.Laconstruccintienequeacoplarseexperiencialmenteconsumedio,demanera
complementaria,antesdequepuedaaparecer,enprimerlugar,yslodespuspuedeacoplarse
alfluirdenuestraexperiencia"diceKarlTomm.PeroMaturanainsistequelodistinguidoyel
mediosurgenenladistincinyquenadapreexisteasudistincin(23).
Losconstructivistasconsideranqueesposibletrazarcualquierdistincin.SegnMaturanaslo
podemostraeralamanoanuestraconcienciaynuestrasdescripcionesaquelloquees
consistenteconnuestraexperienciaenelvivir.

"Laepistemologanoesporlotantoniunmapa,descripcin,teora,modelo,paradigma,ni
paradigmadeparadigmas.Esunprocesodelconocer,construir,ymantenerunmundode
experiencia"(9).

http://www.click.vi.it/sistemieculture/Jutoran.html

16/18

14/9/2016

SistemicaCibernetica

Ladecisindepensaryactuardesdeestaepistemologatienecomoconsecuenciafundamental
laprdidadelacertidumbreylaconsiguienteaperturaaunmundoparticipatorioyresponsable
enununiversodeinfinitasposibilidades.
PrincipiodeIndeterminacin:Dadoquelaposicinylavelocidaddeunobjetonopuedenser
medidosalmismotiempo,elmomentodeunobservablecambiaconrespectoalobservador,por
lotantolamedidaexactadeunobjetoesincierta.Elobservadorestsiempreincludoenlo
observado.
Principiodecomplementariedad:ExtensindelPrincipiodeIndeterminacin.Consideraquelos
distintoslenguajesposiblesylosdistintospuntosdevistasobreelsistemasoncomplementarios.
Noexistelaposibilidaddeunnicopuntodevistadelarealidad.
Principiodelordenatravsdelcaos:LatermodinmicadelnoequilibriodePrigogineserefiereal
conceptodeordenatravsdelafluctuacinyconsideraquelossistemasevolucionanpormedio
desaltosdiscontnuoshacianuevasorganizacioneslogradaspormediodefluctuacionesdentro
delsistema.Latransformacindiscontnuadelossistemassedebealaamplificacin
impredecibledealgunadesusfluctuaciones.
SegundaleydelaTermodinmica:elconceptodeentropapropuestoporClausius,consideraque
laenerganosetransforma,sinoquesegastaenelprocesodetransformacinhayuna
tendenciahaciaunacrecientedegradacindelaenergayaunmximodesorden.
Eneltextooriginaleningls:consciousnessandconscience
REFERENCIASBIBLIOGRAFICAS
1.Bateson,G.:Pasosparaunaecologadelamente,BuenosAires,EdicionesCarlosLohl,1976,pags.449,65.
2.G.:MenteyNaturaleza,NuevaYork,BantamBooks,1979,pags.250,5.
3.Bertalanffy,L.:TeoraGeneraldelosSistemas,Mxico,FondodeCulturaEconmica,1976,pags.9,32,33,41,46,
250.
4.BrockmanJ.,Bateson,G.:AboutBateson,U.S.A.,JohnBrockmanAssociates,Inc.,1977,pags.13,10,4,5,235
247.
5.GuerinP.:FamilyTherapy:TheoryandPractice,NewYork,GardnerPress,1978.
6.Hoffman,L.:FoundationsofFamilyTherapy,U.S.A.,BasicBooks,1981,pags.4046,49.
7.Jackson,D.:"ElproblemadelaHomeostasisdelaFamilia",D.D.Jackson,Comunicacin,FamiliayMatrimonio,
BuenosAires,NuevaVision,1977,pag.16.
8.Keeney,B.:EstticadelCambio,BuenosAires,Ed.Paids,1987,pags.27,20,77.
9.:"WhatisanEpistemologyofFamilyTherapy?"FamilyProcess,vol.21,n*2,1982,pag.165.
10.Maturana,H.,Varela,F.:DeMquinasySeresVivos,Chile,1972,Ed.Universitaria.
11.:ElArboldelConocimiento,Santiago,Ed.Universitaria,1984,pag.13.
12.:"OntologyofObserving",Santiago,1986,pag.14.
13.:EmocionesyLenguajeenEducacinyPoltica,Santiago,Hachette,1990,pags.56,43,44,45,30.
14.:"Ontologadelconversar".SistemasFamiliares,Ao6No.2,4353,Argentina.
15.Maturana,H.,vonFoerster,H.:"Biologa,CibernticayComunicacin",SeminarioorganizadoporlaAsociacin
SistmicadeBuenosAires,Argentina,1988.
16.Maturana,H.:"ConversandoconHumbertoMaturana".SeminarioorganizadoporelInstitutodeTerapiaSistmica,
BuenosAires,1990.
17.Miller,J.G.:LivingSystems,U.S.A.,McGrawHill,Inc.,1978,pags.xiv,xv.
http://www.click.vi.it/sistemieculture/Jutoran.html

17/18

14/9/2016

SistemicaCibernetica

18.Prigogine,I.,Stengers,I.:Lanuovaalleanza,Torino,GiulioEinaudi,1981,CaptuloVI.
19.Ruesch,J.,Bateson,G.:Comunicacin,laMatrizSocialdelaPsiquiatra,BuenosAires,Paids,1965,pag.17.
20.Segal,L.:TheDreamofReality,NewYork,W.W.Norton&Co,1986,pags.59,149,54,148.
21.Sluzki,C.:"Cibernticayterapiafamiliar.Unmapamnimo",Sistemasfamiliares,vol3,n*2,1987,pag.65.
22.SpencerBrown,G.:LawsofForm.Toronto,NuevaYork,Londres,BantamBooks,1973,pag.v.
23.Tomm,K.:"TellmeCarl,wheredoIexist?AcontributiontoaFestschriftforCarlvonAuer.Praga,Ed.byG.Weber,
1990.
24.VonFoerster,H.:Sistemicheosservano,Roma,Astrolabio,1987,pags.152,29,30,28,25.
25.:"UnderstandingUnderstanding",Montedison,1987,pags.6,7,56.
26.:"EthicsandSecondOrderCybernetics",InternationalConference:Systmes&thrapiefamiliale,Paris,
1990.
27.:"Construyendounarealidad",Watzlawick,P.yotros,Larealidadinventada,BuenosAires,Gedisa,
1988,pag.43.
28.VonGlasersfeld,E.:"TheReluctancetoChangeaWayofThiking",TheIrishJournalofPsychology,vol.9,n*1,
1988,pags.83,8687.
29.:"IntroduccinalConstructivismoRadical",WatzlawickP.yotros,LarealidadInventada,Buenos
Aires,Gedisa,1988,pags.34,24,25.
30.Watzlawick,P.,Beavin,J.,Jackson,D.:TeoradelaComunicacinHumana.BuenosAires,Ed.Tiempo
Contemporneo,1967.
31.Watzlawick,P.:"Profecasqueseautocumplen",WatzlawickP.yotros,LaRealidadInventada,BuenosAires,
Gedisa,1988,pag.87.
32.Winkin,Y.:LaNuevaComunicacin,Barcelona,Ed.Kairs,1984,pags.18,77,82,85,98,23,25.

*'Sistemasfamiliares'Ao10No.1Abril1994,BuenosAires,Argentina
**SARABEATRIZJUTORAN
LICENCIADAENPSICOLOGIA,TERAPEUTAFAMILIAR,
DIRECTORADELINSTITUTODETERAPIASISTEMICA
VTA.DEOBLIGADO1593,BuenosAires,Argentina,1426.
Tel.:54147813752
email:zucho@fibertel.com.ar

TRABAJOESCRITOCONLACOLABORACIONDELALIC.NORARICARDI,LICENCIADAENPSICOLOGIA,
TERAPEUTAFAMILIAR,SERVICIODEMEDICINAPARAADOLESCENCIA,HOSPITALDECLINICASJOSEDE
SANMARTIN.

http://www.click.vi.it/sistemieculture/Jutoran.html

18/18