You are on page 1of 340

A Trusted Brand

ACC LIMITED 
WK$QQXDO5HSRUW

80

th
year

A Trusted Brand

(LJKWGHFDGHVDIWHUFRPLQJLQWREHLQJRXWRIDQXQSDUDOOHOHGPHUJHUZLWKDYLVLRQWR
VHUYHFXVWRPHUVVWDNHKROGHUVDQGWKHQDWLRQZLWKGHGLFDWLRQWKHSURGXFWRIWKDW
DPDOJDPDWLRQLVUHVSHFWHGDVDQRUJDQL]DWLRQWKDWHPERGLHVIDLUEXVLQHVVSUDFWLFHV
7RGD\WKHQDPH$&&UHSUHVHQWVQRWMXVWDWUDGHPDUNIRUFHPHQWDQGFRQFUHWHEXWD
EUDQGQDPHWKDWUHSRVHVRQVHYHUDOSURPLVHV
v DVDGHSHQGDEOHVXSSOLHURIKLJKTXDOLW\EXLOGLQJPDWHULDOV
v DVDJUHDWSODFHWRZRUN
v DVDUHOLDEOHEXVLQHVVDVVRFLDWHDQG
v DVDJRRGFRUSRUDWHFLWL]HQ
,WLVDQRUJDQL]DWLRQWKDWLVFRXQWHGDPRQJ,QGLD
VPRVWVXVWDLQDEOHFRPSDQLHV
,WLVFRPPHQGHGE\WKH,QVWLWXWHRI&KDUWHUHG$FFRXQWDQWVRI,QGLDIRUH[FHOOHQFHLQ
oQDQFLDOUHSRUWLQJ
,WVVFULSLVIHOLFLWDWHGE\1DWLRQDO6WRFN([FKDQJHRI,QGLDIRUEHLQJSDUWRIWKH
RULJLQDO1LIW\,QGH[
,WLVDQRUJDQL]DWLRQWKDWLPELEHVJOREDOEHVWSUDFWLFHVIURPLWVVWURQJDOOLDQFHZLWK
/DIDUJH+ROFLPZRUOGOHDGHULQEXLOGLQJPDWHULDOV
,WLVD6XSHUEUDQGFRXQWHGDPRQJ,QGLD
VPRVWDGPLUHGFRPSDQLHVUHDG\WR
FRQWULEXWHLQEXLOGLQJWKHQDWLRQ
VIXWXUH
ANNUAL GENERAL MEETING
2Q:HGQHVGD\$SULODWSP
DW%LUOD0DWXVKUL6DEKDJDU 
6LU9LWKDOGDV7KDFNHUVH\0DUJ
Mumbai 400 020
0HPEHUVDUHUHTXHVWHGWRNLQGO\EULQJWKHLUFRS\RIWKH$QQXDO5HSRUWWRWKH0HHWLQJ
4

Contents
02 - 03
Hallmark of Quality
- Cement & Concrete
04 - 05
Customer Excellence

Board of Directors
(as on February 10, 2016)

Mr N S Sekhsaria
Chairman
Mr Bernard Terver
Deputy Chairman

06 - 07
Innovative &
Future Ready
08 - 09
Leadership &
Governance
10 - 11
A Brand that Cares
12
People
- Architects of Success
13 - 16
Performance Highlights

17 Financial Highlights
18 Value Added Statement
19 Notice
30 Board’s Report and Management
Discussion & Analysis
50 Annexures A-G to Board’s Report
74 Corporate Governance Report
105 Business Responsibility Report
117 Financial Analysis
126 Auditor’s Report
130 Balance Sheet
131 Statement of Profit and Loss
132 Cash Flow Statement
134 Notes to Financial Statements
177 Form AOC-1
179 Consolidated Financial Statements
Subsidiary Companies
234 ACC Mineral Resources Limited
258 Bulk Cement Corporation (India)
Limited
282 Lucky Minmat Limited
301 National Limestone Company Private
Limited
320 Singhania Minerals Private Limited

Mr Harish Badami
Chief Executive Officer &
Managing Director
Mr Eric Olsen
Mr Shailesh Haribhakti
Mr Sushil Kumar Roongta
Mr Ashwin Dani
Mr Farrokh K Kavarana
Mr Vijay Kumar Sharma
Mr Arunkumar R Gandhi
Mrs Falguni Nayar
Mr Christof Hassig
AUDIT COMMITTEE
Mr Arunkumar R Gandhi
Chairman
Mr Bernard Terver
Mr Sushil Kumar Roongta
Mr Ashwin Dani
Mr Farrokh K Kavarana
STAKEHOLDERS’
RELATIONSHIP
COMMITTEE
Mr Bernard Terver
Chairman
Mr Shailesh Haribhakti
Mr Harish Badami
NOMINATION &
REMUNERATION
COMMITTEE
Mr Ashwin Dani
Chairman
Mr N S Sekhsaria
Mr Bernard Terver
Mr Shailesh Haribhakti
Mr Farrokh K Kavarana
Mr Eric Olsen

CORPORATE SOCIAL
RESPONSIBILITY
COMMITTEE
Mr Shailesh Haribhakti
Chairman
Mrs Falguni Nayar
Mr Farrokh K Kavarana
Mr Bernard Terver
Mr Harish Badami
RISK MANAGEMENT
COMMITTEE
Mr Shailesh Haribhakti
Chairman
Mrs Falguni Nayar
Mr Bernard Terver
Mr Harish Badami
COMPLIANCE COMMITTEE
Mr Farrokh K Kavarana
Chairman
Mr Bernard Terver
Mr Shailesh Haribhakti
Mr Harish Badami
CAPEX COMMITTEE
Mr Bernard Terver
Chairman
Mr Sushil Kumar Roongta
Mr Shailesh Haribhakti
Mr Harish Badami

EXECUTIVE COMMITTEE
Mr Harish Badami
CEO & Managing Director
(Chairman of Executive
Committee)
Mr Sunil K Nayak
Chief Financial Officer
Mr Naveen Chadha
Chief Manufacturing
Officer
Mr Jayanta DattaGupta
Chief Marketing Officer
Mr Behram Sherdiwala
Chief People Officer
Mr Pierre-Alexandre de
Lavallaz
Chief Procurement Officer
COMPANY SECRETARY &
HEAD COMPLIANCE
Mr Burjor D Nariman
AUDITOR
S R B C & CO LLP
COST AUDITOR
N I Mehta & Co.
BANKERS
State Bank of India
Citibank NA
HDFC Bank Limited
REGISTERED OFFICE
Cement House
121 Maharshi Karve Road
Mumbai 400 020
Website:
www.acclimited.com

Hallmark of Quality
- Cement & Concrete
ACC Cement
$&& KDV EHHQ D WUHQGVHWWHU LQ ,QGLD
V EXLOGLQJ PDWHULDOV LQGXVWU\ UHFDOOHG DV WKH oUVW QDPH
LQ &HPHQW DQG 5HDG\ 0L[HG &RQFUHWH $&& KDV EHHQ WKH EUDQG RI FKRLFH LQ EXLOGLQJ KRPHV IRU
WKHPDVVHVRI,QGLDLQLWVFLWLHVDQGYLOODJHVDVZHOODVHQGXULQJVWUXFWXUHVIRULQIUDVWUXFWXUHDQG
LQGXVWU\ 2XU UDQJH RI FHPHQWV LV PDUNHWHG E\ D YDVW FRXQWU\ZLGH GLVWULEXWLRQ QHWZRUN RI RYHU 
GHDOHUVDQGUHWDLOHUV

Product Development
$&& PDQXIDFWXUHV YDULRXV NLQGV RI
2UGLQDU\3RUWODQG&HPHQWDQG%OHQGHG
&HPHQWV IRU JHQHUDO FRQVWUXFWLRQ DQG
VSHFLDO DSSOLFDWLRQV q VXSSOLHG LQ EDJV
DQGLQEXONIRUODUJHFRQVWUXFWLRQVLWHV
:H KDYH DQ DVVRUWPHQW RI SUHPLXP
FHPHQWV IRU VSHFLDO DSSOLFDWLRQV DQG
FOLPHV 3URGXFW 'HYHORSPHQW LV D YLWDO
EXLOGLQJ EORFN LQ RXU HQGHDYRXU IRU
FXVWRPHUH[FHOOHQFHHQDEOHGE\DIRFXV
RQDSSOLHGUHVHDUFKDQGLQQRYDWLRQWKDW
GULYHVTXDOLW\SURFHVVLPSURYHPHQWDQG
DSSOLFDWLRQ

Quality
ACC demonstrates a tradition of
SURYLGLQJ WUXVWZRUWK\ DQG FRQVLVWHQW
TXDOLW\ WKURXJK WKH DSSOLFDWLRQ RI
PRGHUQ WHFKQRORJ\ WR PHHW WKH QHHGV
DQG SUHIHUHQFHV RI D QDWLRQZLGH
FXVWRPHU EDVH DQG FRQVWUXFWLRQ
LQGXVWU\$OO$&&IDFWRULHVKDYHVWDWHRI
WKHDUWSURFHVVFRQWUROLQVWUXPHQWDWLRQ
TXDOLW\ FRQWURO V\VWHPV DQG WHVWLQJ
ODERUDWRULHV PDQQHG E\ TXDOLoHG
SHUVRQQHO $V D UHVXOW RI WKLV
XQZDYHULQJ IRFXV RQ TXDOLW\ $&&
FHPHQW VSHFLoFDWLRQV H[FHHG VWDWXWRU\
standards by a wide margin.

(QGXUDQFH
02

1DWLRQDO
3UHVHQFH

Corporate Overview)LQDQFLDO+LJKOLJKWV%RDUG 0DQDJHPHQW5HSRUWV)LQDQFLDO6WDWHPHQWV6XEVLGLDU\&RPSDQLHV

80

th
year

ACC Concrete
$&&
V SLRQHHULQJ HIIRUWV LQ LQWURGXFLQJ 5HDG\ 0L[HG
&RQFUHWH 50;

 LQ ,QGLD LQ  FRXSOHG ZLWK WKH
SURPRWLRQ RI %XON FHPHQW KDQGOLQJ IDFLOLWLHV KDYH
EHHQ UHVSRQVLEOH IRU UHGHoQLQJ WKH SDFH DQG TXDOLW\ RI
FRQVWUXFWLRQ DFWLYLW\ LQ PHWURSROLWDQ FLWLHV DQG LQ PHJD
LQIUDVWUXFWXUH SURMHFWV 7RGD\ $&& 50; LV RQH RI WKH
ODUJHVW PDQXIDFWXUHUV RI FRQFUHWH LQ ,QGLD ZLWK RYHU 
PRGHUQSODQWVLQPDMRUFLWLHV
1XPHURXV ODQGPDUN VWUXFWXUHV LQ ,QGLD
V PHWUR FLWLHV
KDYH EHHQ EXLOW XVLQJ $&& &RQFUHWH  PHJD KRXVLQJ
SURMHFWV WRZQVKLSV FRPPHUFLDO FRPSOH[HV IDFWRULHV
EULGJHV p\RYHUV URDGV DQG UDLOZD\V $&& &RQFUHWH
DOVR UHDFKHV RXW WR VPDOO EXLOGHUV DQG LQGLYLGXDO KRPH
EXLOGHUVZLWKWKHVDPHVRSKLVWLFDWLRQ

$&& 50; LV PDQXIDFWXUHG XQGHU FRPSXWHUFRQWUROOHG RSHUDWLRQV WUDQVSRUWHG DQG SODFHG DW VLWH XVLQJ
VRSKLVWLFDWHGHTXLSPHQWDQGPHWKRGV7KHXVHRI50;LVDQHQYLURQPHQWIULHQGO\SUDFWLFHWKDWLVVRSKLVWLFDWHG
HQVXUHVKLJKOHYHOVRITXDOLW\DVVXUDQFHDQGYDOXHDGGLWLRQDQGFDXVHVPLQLPDOGLVWXUEDQFHWRLWVVXUURXQGLQJV
7KLVPDNHVLWVXWLOLW\PRUHVLJQLoFDQWLQFURZGHGFLWLHVDQGORFDOLWLHV
$&&50;LVVXSSOLHGLQDYDULHW\RIJUDGHVDQGFRPSRVLWLRQVWRPHHWVSHFLoFGHPDQGVRIFXVWRPL]HGDSSOLFDWLRQV
IURPVLPSOHUHTXLUHPHQWVIRUVPDOOKRPHVWR+LJK3HUIRUPDQFH&RQFUHWHWRPHHWWKHFRPSOH[QHHGVRIPHJDSURMHFWV

High Strength
Concrete
High Performance
Concrete

Fiber Reinforced
Concrete
Stamped Concrete

Self-leveling
Concrete
Self-compacting
Concrete

Polished
Concrete

Awards
AFFRODGHV
,QGLD*UHHQ
0DQXIDFWXULQJ
&KDOOHQJH
DZDUGLQ*ROG
FDWHJRU\WR
ACC Chanda by
,QWHUQDWLRQDO
5HVHDUFK,QVWLWXWH
IRU0DQXIDFWXULQJ

Stained Concrete
Coloured
Concrete
Early Strength
Concrete

Exposed
Aggregates
Dry Mortars for
Plastering
Dry Mortars for
Tile Fixing

03

Customer Excellence :H GR RXU XWPRVW WR FUHDWH D XQLTXH H[SHULHQFH IRU RXU FXVWRPHUV:HGRZKDWLWWDNHVWRVHHWKDWWKHFXVWRPHU H[SHULHQFHVYDOXHLQHYHU\WKLQJZHGRqLQRXUSURGXFWVLQ RXUVHUYLFHLQRXUFRPPXQLFDWLRQLQHYHU\WUDQVDFWLRQDQG LQ HYHU\ LQWHUIDFH LQYROYLQJWKH FXVWRPHU7KLV FXVWRPHU FHQWULFDSSURDFKGHPDQGVWKDWZHRIIHU6XSHULRUSURGXFWV 6XSHULRUORJLVWLFVDQG6XSHULRUVHUYLFH $ \RXQJ DQG G\QDPLF VDOHV IRUFH PDQDJHV WKH IURQWOLQH HQJDJHPHQW ZLWK FXVWRPHUV 7KH\ ZRUN ZLWK D ODUJH FRQWLQJHQWRIGHGLFDWHGFKDQQHOSDUWQHUVZKRDUHLQWXUQ FRPSOHPHQWHGE\DQH[WHQVLYHQHWZRUNRIUHWDLOHURXWOHWV WKDWPDNHVLWHDV\WRUHDFKWKHPDVVHVRI.QVWRUH &RQVXPHU %HKDYLRU 7RROV OLNH 1HW 3URPRWHU 6FRUH 136.QGLDZKRPDNH XSRXUPDLQFXVWRPHUV &XVWRPHU6HUYLFHWHDPVRIIHUDUDQJHRI7HFKQLFDO6HUYLFHV IURP SURYLGLQJ EDVLF SURGXFW NQRZOHGJH WR UHWDLO EX\HUV WR FXVWRPL]HG DQG IHHEDVHG VHUYLFHV IRU WKH ODUJH EX\HU VXFKDVFRQFUHWHPL[GHVLJQFHPHQWDQGFRQFUHWHWHVWLQJ JRRGFRQVWUXFWLRQSUDFWLFHVDQGVLWHVXSHUYLVLRQ$YDULHW\ RI RWKHU WHFKQLFDO VHPLQDUV DQG WUDLQLQJ SURJUDPPHV FRQGXFWHG E\ RXU &XVWRPHU 6HUYLFH WHDPV DOORZ XVHIXO HQJDJHPHQWVZLWKFRQVWUXFWLRQHQJLQHHUVDQGFRQWUDFWRUV %HVLGHVRXUVWDQGDUGRIIHULQJZHSURPRWHDQDVVRUWPHQW RI3UHPLXPSURGXFWVWKDWLQFRUSRUDWHVHQKDQFHGWHFKQLFDO IHDWXUHVDSSURSULDWHIRUGLIIHUHQWORFDOFRQGLWLRQV3UHPLXP SURGXFWVFRPHSDFNHGLQWDPSHUSURRISDFNDJLQJ $VHOHFWLRQRIURXWLQHVWXGLHVDQGGLSVWLFNVXUYH\VHQVXUHV WKDW ZH DOZD\V KDYH WKH SXOVH RI RXU YDOXHG FOLHQWHOH )URQWOLQH VDOHV SHUVRQQHO VSHQG WLPH LQ UHWDLO RXWOHWV WR JDWKHU LQVLJKWV LQWR WKH EX\LQJ SURFHVV IURP .

 DQG WKH ( 0RGHO (FRQRPLF (PRWLRQDO  (JR.

 KHOSV JDXJHGHDOHUVDWLVIDFWLRQDQGXQGHUVWDQGWKHLUQHHGV 04 .

Corporate Overview)LQDQFLDO+LJKOLJKWV%RDUG 0DQDJHPHQW5HSRUWV)LQDQFLDO6WDWHPHQWV6XEVLGLDU\&RPSDQLHV Awards AFFRODGHV 5HDGHU V'LJHVW Trusted Brand *ROG award in Cement FDWHJRU\ 7KH&RPSDQ\ VYDVWQHWZRUNRIFKDQQHOSDUWQHUVSOD\VDYLWDOUROHLQFXVWRPHUVHUYLFLQJDQGEUDQGEXLOGLQJ .QGLDQ0HUFKDQWV  Chamber IT $ZDUGIRU H[FHOOHQFHLQWKH use of Information 7HFKQRORJ\LQWKH 0DQXIDFWXULQJ VHFWRUIRU/RJLVWLFV 05 .

GHQWLoFDWLRQ 'HYLFH 5).Q LWV \HDU MRXUQH\ $&& KDV FUDIWHG D XQLTXH WUDFN UHFRUG RI LQQRYDWLYH UHVHDUFK DQG GHYHORSPHQW MXVWO\ HDUQLQJ IRU LWVHOI WKH VREULTXHW RI SLRQHHU DQG WUHQGVHWWHU 7KH FRPSDQ\ VDFFRPSOLVKPHQWVKDYHDGGHGYDOXH WR WKH EXLOGLQJ PDWHULDOV LQGXVWU\ q QRWDEO\ ZLWK WKH HVWDEOLVKPHQW RI WKH FRXQWU\ V oUVW ZKROO\ LQGLJHQRXV FHPHQW SODQW DW &KDLEDVD WKH LQWURGXFWLRQ RI %XON &HPHQW GLVWULEXWLRQ 5HDG\ 0L[HG &RQFUHWH HQYLURQPHQWIULHQGO\ EOHQGHG FHPHQWV DQG FRPPLVVLRQLQJ RI WKH ZRUOG VODUJHVWSODQWDW:DGL 5HJXODU LQVLJKWV IURP RXU PDUNHWLQJ DQG 5 ' WHDPV KHOS XV GLVFRYHU QHZ ZD\V WR DGGUHVV WKH XUEDQ DQG ODUJH FXVWRPHUV  FKDQJLQJ QHHGV WKURXJK HQKDQFHPHQWV LQ VHUYLFH GHOLYHU\ DQG SURGXFW GHYHORSPHQW 2XU UHFHQW DGYDQFHPHQWV LQFOXGLQJ WKH DGRSWLRQ RI WHFKQRORJLHVOLNH5DGLR)UHTXHQF\.'.Innovative & Future Ready .

 DQG *OREDO 3RVLWLRQLQJ 6\VWHPV *36.

QGLD LV KHOSLQJ XV LQ VKDUSHQLQJ SURMHFW PDQDJHPHQWVNLOOVWRDKLJKRUGHU 7KHVH DQG RWKHU VXFK HIIRUWV VHHN WR VKDSH IRUWKHFRPSDQ\DIXWXUHDVQRWHZRUWK\DVLWV SDVWqUHQGHULQJLWLQQRYDWLYHDQGIXWXUHUHDG\ LQ EXLOGLQJ VXVWDLQDEOH VROXWLRQV DQG HQDEOLQJ WKHSHRSOHZKRFDQKHOSPDNHLWKDSSHQ 06 The new Jamul Project .KDYHVWUHQJWKHQHGORJLVWLFV :HDUHPLQGIXORIWKHQHHGVRIRWKHUFXVWRPHU VHJPHQWVDVZHOOVXFKDVHQDEOLQJWKHVHWWLQJ XS RI *UHHQ %XLOGLQJ &HQWUHV WR DGGUHVV WKH GHPDQG IRU DIIRUGDEOH KRXVLQJ LQ WKH VPDOOHU WRZQVDQGYLOODJHV 2XUWHFKQLFDOWHDPVDUHHQJURVVHGLQSXUVXLQJ FRQWLQXRXV LPSURYHPHQWV LQ PDQXIDFWXULQJ RSHUDWLRQV DQG HQHUJ\ HIoFLHQF\ :H SUHSDUH RXUVHOYHV WR SDUWLFLSDWH LQ WKH FRXQWU\ V DPELWLRXV JURZWK SODQV ZLWK WKH H[SDQVLRQ RI RXU FDSDFLW\ 7KH -DPXO SURMHFW LQ HDVWHUQ .

6XSSO\&KDLQ /RJLVWLFV ([FHOOHQFH$ZDUG 6&$/(.Corporate Overview)LQDQFLDO+LJKOLJKWV%RDUG 0DQDJHPHQW5HSRUWV)LQDQFLDO6WDWHPHQWV6XEVLGLDU\&RPSDQLHV 80 th year Smart Cities Infrastructure Housing Urban Rejuvenation Awards AFFRODGHV &..

LQ ([FHOOHQWFDWHJRU\ 07 .

Deputy Chairman 0U$UXQNXPDU5DPDQODO*DQGKL 0U6KDLOHVK+DULEKDNWL 0U6XVKLO.Leadership & Governance Board of Directors* Seated (Left to Right) Standing (Left to Right) 0U(ULF2OVHQ 0U9LMD\. Mr Bernard Terver.XPDU6KDUPD 0U166HNKVDULDChairman 0U&KULVWRI+DVVLJ 0U+DULVK%DGDPL&(2 0' 7.DYDUDQD 9..XPDU5RRQJWD 08 . Mr Ashwin Dani 0UV)DOJXQL1D\DU 0U)DUURNK.

QGHSHQGHQW'LUHFWRUV7KH%RDUGHQGHDYRXUVWR PDLQWDLQWKHFRPSDQ\ VWUDGLWLRQRIXSKROGLQJWKHKLJKHVWVWDQGDUGV RI&RUSRUDWH*RYHUQDQFH7KH&KLHI([HFXWLYH2IoFHUDQG0DQDJLQJ 'LUHFWRURYHUVHHVGD\WRGD\ZRUNLQJDQGRSHUDWLRQVRIWKH&RPSDQ\ +H LV DVVLVWHG E\ WKH ([HFXWLYH &RPPLWWHH ([&R.Corporate Overview)LQDQFLDO+LJKOLJKWV%RDUG 0DQDJHPHQW5HSRUWV)LQDQFLDO6WDWHPHQWV6XEVLGLDU\&RPSDQLHV $&&LVDSURIHVVLRQDOO\PDQDJHGFRPSDQ\ZLWKLWVFRUHYDOXHVEDVHG RQ HWKLFV DQG JRRG FRUSRUDWH FLWL]HQVKLS 7KH %RDUG RI 'LUHFWRUV FRPSULVHV HPLQHQW SURIHVVLRQDOV RI XQTXHVWLRQDEOH LQWHJULW\ D PDMRULW\RIZKRDUH.

1D\DN 0U1DYHHQ&KDGKD Mr Harish Badami 2. 2016 09 09 . M 0U3LHUUH$OH[DQGUHGH/DYDOOD] 0U-D\DQWD'DWWD*XSWD  0 0U%HKUDP6KHUGLZDOD Executive Committee* Awards AFFRODGHV v k6LOYHU6KLHOGy IRUk([FHOOHQFH LQ)LQDQFLDO 5HSRUWLQJy IRU$QQXDO 5HSRUW by Institute of Chartered $FFRXQWDQWVRI India v $&&VFULS FRPPHQGHGE\ 1DWLRQDO6WRFN ([FKDQJHRI India for being SDUWRI1LIW\ .QGH[IURP LQFHSWLRQ years ago * as on February 10. ZKLFK LQFOXGHV WKHIXQFWLRQDOKHDGVRI)LQDQFH0DQXIDFWXULQJ0DUNHWLQJ+XPDQ 5HVRXUFHVDQG3URFXUHPHQW7KH([&RLVUHVSRQVLEOHDQGDFFRXQWDEOH IRURYHUDOOEXVLQHVVGHOLYHUDEOHV 80 th year Seated (Left to Right) Standing (Left to Right) 0U6XQLO.

A Brand that Cares Sustainable Business :H UHMRLFH LQ JUHHQLQJ WKH HQYLURQV DURXQG XV $ GHHS FRQFHUQ IRU FRQVHUYDWLRQ RI WKH HDUWK V SUHFLRXV UHVRXUFHV LV LQWHJUDWHG LQWR DOO DFWLYLWLHV RI RXU YDOXH FKDLQ IURP PLQLQJWRVDOHV:HFRQWLQXRXVO\H[SORUHZD\VWRPDNHRXU EXVLQHVVPRUHSODQHWIULHQGO\IURPGHSOR\LQJFOHDQPLQLQJ WHFKQLTXHVWRWUDQVIRUPLQJXVHGPLQHVLQWROXVKIRUHVWVRU XVHIXOZDWHUERGLHV:HPLQLPL]HWKHXVHRIOLPHVWRQHE\ SURPRWLQJEOHQGHGFHPHQWVWKDWJDLQIXOO\XWLOL]HLQGXVWULDO ZDVWHVOLNHVODJDQGp\DVK.QGLD V PRVW VXVWDLQDEOH FRPSDQLHV DQG DGMXGJHG DV D EHQFKPDUN LQ FRQGXFWLQJ VXVWDLQDEOHEXVLQHVV A water conservation project 10 ..Q UHFHLYLQJ WKH &.QSXUVXLWRI$OWHUQDWLYH)XHODQG 5HVRXUFHV ZH RIIHU YLDEOH VROXWLRQV IRU HIoFLHQW GLVSRVDO RI KD]DUGRXV DQG RWKHU ZDVWHV WKURXJK FRSURFHVVLQJ LQ FHPHQW NLOQV $ ODUJH HIoFLHQW FDSWLYH SRZHU FDSDFLW\ together with three wind energy farms and a waste heat SRZHUJHQHUDWLRQV\VWHPPDNHXSRXUHQHUJ\HIoFLHQF\DQG HQHUJ\FRQVHUYDWLRQSRUWIROLR $OO WKLV KHOSV FXW RXU FDUERQ IRRWSULQW GRZQ WR D OHYHO WKDW LV EHVWLQFODVV ..7& 6XVWDLQDELOLW\ $ZDUG  ZH KDYH EHHQ VLQJOHG RXW DV EHLQJ DPRQJ .

QRWKHUVFKHPHVSHRSOH UHFHLYHGKHDOWKDQGQXWULWLRQDVVLVWDQFHDERXW FKLOGUHQ ZHUH QXUWXUHG LQ  DQJDQZDGL FHQWUHV ZH VXSSRUWHG ZKLOH RXU $QWL 5HWURYLUDO 7UHDWPHQW $57.Q  WKH &RPSDQ\ V FRXQWU\ZLGH FRPPXQLW\ GHYHORSPHQW HIIRUWVUHDFKHGRXWWRODNKSHRSOHLQYLOODJHV (GXFDWLRQ LQLWLDWLYHV DGGUHVVHG  VWXGHQWV ZLWKVFKRODUVKLSVDQGPRGHUQPHWKRGVRIOHDUQLQJ :RPHQ V HPSRZHUPHQW HIIRUWV VDZ  QHZ ZRPHQ V 6HOI +HOS *URXSV EHLQJ VHW XS ZKLOH WKH “ACC ki Ladli” SURJUDPPH SURYLGHG HGXFDWLRQ WR JLUOFKLOGUHQ.Corporate Overview)LQDQFLDO+LJKOLJKWV%RDUG 0DQDJHPHQW5HSRUWV)LQDQFLDO6WDWHPHQWV6XEVLGLDU\&RPSDQLHV 80 th year A Caring Company :HSDUWQHUZLWKWKHUXUDOFRPPXQLW\OLYLQJDURXQG RXU RSHUDWLRQV WR LPSURYH WKH TXDOLW\ RI WKHLU OLYHV .Q WKHLU ZHOOEHLQJ OLHV RXU OLFHQVH WR RSHUDWH 7KURXJKRXUPHDQLQJIXOLQWHUYHQWLRQVLQ/LYHOLKRRG (GXFDWLRQ :DWHU +HDOWK DQG 6DQLWDWLRQ ZH VWULYH WR VWUHQJWKHQ WKHLU VXEVLVWHQFH .

9$.7& 6XVWDLQDELOLW\ $ZDUG IRU&RUSRUDWH ([FHOOHQFHLQ WKHFDWHJRU\ k2XWVWDQGLQJ $FFRPSOLVKPHQWy A Women’s Self Help Group $ZDUGHG&... V 6XVWDLQDEOH 3OXV3ODWLQXP ODEHOWKHZRUOG V oUVW&RUSRUDWH 6XVWDLQDELOLW\ rating 11 ..'6 $&& V &65 HQJDJHPHQW ZDV UDQNHG oUVW LQ WKH &HPHQW 6HFWRU DQG WK DPRQJ WKH WRS  OLVWHG FRPSDQLHV LQ D VXUYH\ E\ (FRQRPLF 7LPHV DQG . &HQWUHV JDYH D UHQHZHG OHDVH RI OLIH WR  SDWLHQWVRI+.QVWLWXWHRI0DQDJHPHQW8GDLSXU Awards AFFRODGHV &.

People .07.QGLD 0DQXIDFWXULQJ 7UDQVIRUPDWLRQ .Architects of Success $&& LV SURXG WR UHWDLQ LWV SRVLWLRQ DV WKH %HVW (PSOR\HU WR ZRUN IRU LQ WKH FHPHQW VHFWRU 7KH FRPSDQ\ V +XPDQ5HVRXUFHIXQFWLRQLQFRUSRUDWHV HIIHFWLYHHQJDJHPHQWVZLWKDOOOHYHOVRI HPSOR\HHV ZLWK D YLHZ WR HQVXUH WKDW WKH ZRUNIRUFH LV FORVHNQLW PRWLYDWHG DQGUHDG\WRH[FHOLQWKHPDUNHWSODFH 7KH k.

y SURJUDPPH LQLWLDWHG LQ  DLPV WR UHHQJLQHHU WKH ZRUN FXOWXUH LQ RXU PDQXIDFWXULQJ XQLWV VXFK WKDW WKH\ FDQ EHFRPH PRUH UHVSRQVLYH WR DGGUHVV WKH 12 FKDQJLQJUHTXLUHPHQWVRIWKHLQGXVWU\ 2XU 6KRS )ORRU $VVRFLDWHV HQGRUVHG WKLV LQLWLDWLYH DV SDUW RI D UHPDUNDEOH FRPPRQ ORQJWHUP DFFRUG VLJQHG E\ WUDGHXQLRQVZLWKWKHFRPSDQ\ (IIRUWV FRQWLQXHG WR PDNH VXUH WKDW WUDLQLQJ DQG OHDGHUVKLS GHYHORSPHQW SURFHVVHV DUH GHVLJQHG WR HQKDQFH WHFKQLFDO DQG IXQFWLRQDO FDSDELOLWLHV ZLWK VSHFLDO IRFXV RQ QXUWXULQJ \RXQJ WDOHQW 7KLV ZLOO KHOS XV PHHW HPHUJLQJ FKDOOHQJHV DQG NHHS WKH RUJDQL]DWLRQ V WDOHQW SRRO HIIHUYHVFHQWDQGIXWXUHUHDG\ .

OPERATING EBITDA & OPERATING EBITDA MARGIN SEGMENT-WISE NET SALES*   20 20 8000 20    4000 2000 10000  1921    10     2011* 2012  1HW6DOHV2S(%.7'$ 2014  4000 2000  2011  24.24   8  .&RUSRUDWH2YHUYLHZFinancial Highlights%RDUG 0DQDJHPHQW5HSRUWV)LQDQFLDO6WDWHPHQWV6XEVLGLDU\&RPSDQLHV Performance Highlights (Standalone Financial) NET SALES.12 24.11   24.

0 2012 6DOHV9ROXPH  2014  77       20    1000  0  2014 2S(%.7'$0DUJLQ 2014   8WLOL]DWLRQ READY MIXED CONCRETE SALES VOLUME & GROWTH 10  2012 &HPHQW3URGXFWLRQ  /DNKFXELFPHWUHV   2011 2S(%.7'$0DUJLQ .

 2S(%.7 2012 78 70 .7'$ 78 10 *URZWK 2194 20.

4  . 1921 2011 79     80 81 CEMENT OPERATING EBITDA & OPERATING EBITDA MARGIN 20.

.

2  0LOOLRQ7RQQHV 11 100  *URZWK . 2011 90 20 2 1.

21  2012 Cement 2S(%.QWHUVHJPHQWVDOHV 24.7'$0DUJLQ CEMENT SALES VOLUME & GROWTH    0 ([FOXGLQJ$&&&RQFUHWHZKLFKPHUJHGLQ   8000 0 0    &DSDFLW\XWLOL]DWLRQ . 0LOOLRQ7RQQHV  20 14   ` Crore  17 10 2000 2014  5HDG\0L[HG&RQFUHWH CEMENT PRODUCTION & CAPACITY UTILIZATION 20    &HPHQW6DOHVLQFOXGH.

97 20   10   0.2 10 1.8   19.9 0 . 10889 12000  20  27.70 18.00 17.

 0  *URZWK .

7'$0DUJLQ . ` Crore 10000   ` Crore 12000 11481  2S(%.

14000 .

.

.

2011 2012 6DOHV9ROXPH  2014  *URZWK 13 .

Performance Highlights (Standalone Financial) PROFIT BEFORE TAX & PROFIT AFTER TAX READY MIXED CONCRETE OPERATING EBITDA & OPERATING EBITDA MARGIN  1800    4    2  10 0   .

12 . 1 0 2.


2011

2012

2014   

400 

` Crore

7000    

24
22 

20 

4000  

14 

11

2000

10

1000
0 

2011

2012

2014   

28  

40   

40  

20

17

10  

(36

2012
'36 

2014 

'LYLGHQG3D\RXW5DWLR 

'LYLGHQGSD\RXWUDWLRLVFDOFXODWHGZLWKRXWFRQVLGHULQJGLYLGHQGGLVWULEXWLRQWD[

14

3$7

7000 

7192   

20

18
14 

14

14 

10
7 

0 

2011   

2012 

2014 

521:

1800

20

0
2011 

4000

` Crore

`3HU6KDUH     

40 

2014

NET CASH GENERATED FROM OPERATIONS

'LYLGHQG3D\RXW5DWLR 

    

71 


2012

1HW:RUWK

80 

2011

8000

DIVIDEND PER SHARE, EARNING PER SHARE
AND DIVIDEND PAYOUT RATIO*
70 

9000

ROCE

$YHUDJH&DSLWDO(PSOR\HG 

NET WORTH & RETURN ON NET WORTH

8048  



784

3%7

9000  

1000 

AVERAGE CAPITAL EMPLOYED &
RETURN ON CAPITAL EMPLOYED
8000

1227

1200

2S(%,7'$0DUJLQ

2S(%,7'$  

800

` Crore

20

1400     

1400
1200 

1000
800 

2011

2012 

2014 

5HWXUQRQ1HW:RUWK 

40

5HWXUQRQ$YHUDJH&DSLWDO(PSOR\HG 

` Crore  

` Crore  

2S(%,7'$0DUJLQ 

70

2 1.1  0.4 1.7 4000  1.1      2000 1000  0  2011 2012  2014 2011  CORPORATE SOCIAL RESPONSIBILITY EXPENDITURE        2014   20000 ` Crore 22   27  2012 MARKET CAPITALIZATION AT YEAR END   ` Crore 1.0 4000 420    ` Crore `SHUVKDUH 1.4   2.2 CONTRIBUTION TO EXCHEQUER   9071  (PSOR\HHV BOOK VALUE PER SHARE 440 1.8     2000 1.&RUSRUDWH2YHUYLHZFinancial Highlights%RDUG 0DQDJHPHQW5HSRUWV)LQDQFLDO6WDWHPHQWV6XEVLGLDU\&RPSDQLHV 9000     10000 1.7   Asset Turnover Ratio 1HW)L[HG$VVHWV  8000 1000 0 2.0 1.0 1RRI(PSOR\HHV ` Crore 7000    Asset Turnover Ratio 8000 EMPLOYEES AT THE YEAR END & AVERAGE SALES PER EMPLOYEE  2011 2012  2014 9000    1.8  2011 2012  2014  7XUQRYHUSHU(PSOR\HH      2014   400 1.0 ` Crore NET FIXED ASSETS & ASSET TURNOVER RATIO 20   10000 10   0 2011 2012  2014  0 2011 2012  15 .

&RVW 3URoWDVD3HUFHQWDJH of Revenue from operations 2015 2WKHULQFRPH ` .

740 Crore 15% )LQDQFHFRVWV ` &URUH 1% 'HSUHFLDWLRQ ` &URUH 5% 3RZHUDQGIXHO ` &URUH 20% (PSOR\HH&RVW ` 770 Crore 7% 0DQXIDFWXULQJ DQGRWKHUFRVWV ` &URUH 22% Freight and Forwarding H[SHQVH ` &URUH 23% 2014 2WKHULQFRPH ` .&URUH -1% 3URoWEHIRUH([FHSWLRQDOLWHPDQGWD[ ` &URUH 8% &RVWRIPDWHULDOVFRQVXPHG ` 1.

442 Crore 21% (PSOR\HH&RVW ` 747 Crore 6% Freight and Forwarding H[SHQVH ` &URUH 22% .788 Crore 15% )LQDQFHFRVWV ` &URUH 1% 'HSUHFLDWLRQ ` &URUH 5% 0DQXIDFWXULQJ DQGRWKHUFRVWV ` &URUH 22% 16 3RZHUDQGIXHO ` 2.&URUH -2% 3URoWEHIRUH([FHSWLRQDOLWHPDQGWD[ ` &URUH 10% &RVWRIPDWHULDOVFRQVXPHG ` 1.

84 24.325 1.439 1.24 23.213 1.433 11.507 1.QFOXGLQJ&:.50 21.84 19.236 7.294 1.430 7.153 3.469 6.540 1.899 1.607 1.294 1.29 21.130 9.928 4.01 19.46 21.967 7.461 2.803 Capacity utilisation INCOME STATEMENT Net Sales Operating EBITDA 1.232 8.620 3URoWDIWHU7D[ 592 1.644 1.443 8.629 2.227 1.930 1.192 6.120 1.227 1.717 3URoWEHIRUHH[FHSWLRQDOLWHPDQGWD[ 937 1.540 1.717 1.096 1.461 2.993 1.70 Cement Sales (Million Tonnes) 23.921 1.11 23.061 1.21 23.016 4.905 5.14 21.12 23.787 1.126 6.135 1.688 1.196 1.86 77% 78% 78% 79% 81% 77% 91% 93% 91% 90% 11.3.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies STANDALONE FINANCIAL HIGHLIGHTS ` Crore Particulars 2015 2014 2013 2012 2011 2010 2009 2008 2007 2006 Cement Production (Million Tonnes) 23.889 11.92 18.383 7.97 18.73 21.481 10.86 24.812 2.142 - - 35 163 511 524 567 482 306 771 1HW)L[HG$VVHWV .135 1.737 1.537 1.62 24.710 7.93 24.825 7.451 1.168 1.459 3URoWEHIRUH7D[ 784 1.37 20.

52 70.00 30.00 30.703 6.00 30.577 1.29 18.56 18.137 2.02 0.07 0.25 Price Earning Ratio 43.459 3.23 58.170) (824) (483) Financing activities (681) (834) (1.114 2.396 Cash and cash equivalents 1.708 2.893 3.93 0.93 0.60 64.04 10.485 3.89 0.863 3.15 95.932 2.93 104.36 56.00 28.656 7.573 6.00 34.221 1.98 0.741 3.44 1HWZRUWKSHU6KDUH `) 450 439 416 393 385 345 320 263 221 168 Dividend per share (`) 17.236 7.768 3.006 &XUUHQW/LDELOLWLHV 3.08 0.50 23.993 6.410 4.113 4.00 15.15 16.93 88.00 20.056 1.583 5.39 13.90 80.426 2.443 8.80 0.751 2.422 Investing activities (948) (1.621 3.900 3.64 Operating activities 1.75 66.59 59.023 1.72 1.63 76.09 0.098 3.07 22.57 103.548 6.717 3.075) (423) CASH FLOWS 1HWFDVKSURYLGHGE\ XVHGLQ.609 3.332 1.913 Operating EBITDA margin 13% 13% 15% 20% 20% 24% 33% 27% 29% 30% Average Return on Capital Employed 11% 14% 16% 24% 22% 22% 39% 35% 42% 42% 7% 14% 14% 14% 18% 17% 27% 25% 35% 39% SIGNIFICANT RATIOS Return on Net Worth Current Ratio 0. 7.766 2.388 1.31 93.726 3.876 1.686 2.476 3.571 1.116 2.73 0.83 80.40 91.00 0.066) (768) (621) (297) (1.15 'HEWV(TXLW\5DWLR - - 0.458 3.324 6.489 1.03 79.07 0.00 Basic Earnings per Share (`) 31.004 0.437) (858) (311) (258) (812) (1.746 3.438 1.860 7.10 0.00 20.513 6.66 85.99 1.74 16.175 6.51 62.691 2.23 7.672 Capital Employed 8.546 7.080 BALANCE SHEET Net Worth /RQJWHUPERUURZLQJV Current Assets 3.935 1.461 1.02 Cash Earnings per Share (`) 74.91 25.389 1.505) (1.

397 (455) 17 . (837) 2.

7$YHUDJH&DSLWDO(PSOR\HG  &DSLWDO(PSOR\HG1HWZRUWK/RQJWHUPERUURZLQJV&XUUHQWPDWXULWLHVRI/RQJ7HUPERUURZLQJV.7'$3URoWIURPRSHUDWLRQVEHIRUHRWKHULQFRPHoQDQFHFRVWVDQG'HSUHFLDWLRQDQGDPRUWL]DWLRQ H[SHQVH  $YHUDJH5HWXUQRQ&DSLWDO(PSOR\HG(%.ACC Limited Notes:  &DVKDQGFDVKHTXLYDOHQWVLQFOXGHV&DVKDQGEDQNEDODQFHVLQYHVWPHQWLQVKRUWWHUPGHSRVLWVDQGPXWXDOIXQGV  &XUUHQWPDWXULWLHVRI/RQJ7HUP%RUURZLQJVKDYHEHHQLQFOXGHGLQ%RUURZLQJVDQGH[FOXGLQJVDPHIURPFXUUHQW OLDELOLWLHV  2SHUDWLQJ(%.

73URoWEHIRUHH[FHSWLRQDOLWHPDQGWD[.QWHUHVWRQ/RQJWHUPERUURZLQJV.  (%.

 5HWXUQRQ1HWZRUWK3URoWDIWHU7D[1HWZRUWK  'HEWV(TXLW\5DWLR /RQJWHUPERUURZLQJV&XUUHQWPDWXULWLHVRI/RQJ7HUPERUURZLQJV.

30 18.096 1.357 &RVWRI&DSLWDO 1.192 /RQJWHUP'HEWV - - 35 163 511 Capital employed 8.348 692 1.325 - 1 4 31 32 692 1.47 :HLJKWHG$YHUDJH&RVWRI&DSLWDO .169 1.53 14.339 8.100 1.443 8.017 919 897 Value added (382) 131 83 400 460 8.625 7.6KDUHKROGHUV IXQGV  3(5DWLR0DUNHW3ULFHSHUVKDUH%DVLF(DUQLQJVSHUVKDUH  1HWZRUWKSHUVKDUH1HW:RUWK1XPEHURI(TXLW\6KDUHV  &XUUHQW$VVHWV7RWDODVVHWV)L[HGDVVHWV.825 7.168 1.546 7.30 14.703 7.28 17.048 7.288 1.703 Average Capital Employed 8.038 1.383 7.074 1.860 7.236 7.319 1.QYHVWPHQWV  &XUUHQW/LDELOLW\&XUUHQWOLDELOLW\H[FOXGLQJ6KRUWWHUPERUURZLQJV/RQJWHUPSURYLVLRQV VALUE ADDED STATEMENT (` in Crore) 2015 2014 2013 2012 2011 8.443 8.236 7.

90 13.86 2.63 1.08 5. 12.32 3.287 20.58) 1.546 26.05 12.389 1.686 2.27 25.137 2.924 2.46 Equity Value added 1HWRSHUDWLQJSURoWDIWHUWD[HV $GGLQWHUHVWRQ/RQJWHUPERUURZLQJVDIWHUWD[ 1HWRSHUDWLQJSURoWDIWHUWD[HV 123$7.16 2.345 - - 35 163 511 1.862 18.601 18.25 6.88 12.836 21.20 12.806 26.20 Value added / Average Capital Employed (%) (4.932 24.621 3.157 24.99 2.220 23.

123$7$YHUDJH&DSLWDOHPSOR\HG .

Enterprise Value 0DUNHW&DSLWDOLVDWLRQ $VDW'HFHPEHU.

$GG'HEWV Less: Cash and Cash Equivalents EV (Enterprise Value) EV / Yr. End Capital Employed (Times) 1HW2SHUDWLQJSURoWLVH[FOXGLQJH[FHSWLRQDOLWHPDQGWD[LPSDFWRQWKHVDPH 18 .

to transact the following business: SPECIAL BUSINESS ORDINARY BUSINESS 5. Sir Vithaldas Thackersey Marg.00 p. 2016 at 3. Mumbai 400 020 on Wednesday.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTICE NOTICE IS HEREBY GIVEN THAT THE EIGHTIETH ANNUAL GENERAL MEETING OF ACC LIMITED (CIN:L26940MH1936PLC002515) will be held at Birla Matushri Sabhagar.m. Appointment of Mr Eric Olsen as Non-Executive / Non-Independent Director  7R FRQVLGHU DQG LI WKRXJKW oW WR SDVV ZLWK RU ZLWKRXWPRGLoFDWLRQ V. 19. April 13.

” the Audited Standalone Financial Statements RI WKH &RPSDQ\ IRU WKH oQDQFLDO \HDU HQGHG December 31. 2014 (the Rules). “RESOLVED THAT SXUVXDQW WR WKH SURYLVLRQV RI 6HFWLRQ  DQG RWKHU DSSOLFDEOH SURYLVLRQV of the Companies Act. To consider and adopt: (i) Company to be held in 2017 on such remuneration SOXVVHUYLFHWD[RXWRISRFNHWH[SHQVHVHWFDVPD\ be mutually agreed upon by the Board of Directors and the Auditors. including DQ\ VWDWXWRU\ PRGLoFDWLRQ V.WKHIROORZLQJ5HVROXWLRQDV an Ordinary Resolution: 1. 2013 (the Act) read with 7KH &RPSDQLHV $SSRLQWPHQW DQG 4XDOLoFDWLRQV of Directors) Rules. 2015 and the Reports of the Board of Directors and the Auditors’ thereon.

 RU UHHQDFWPHQW V.

who being eligible. 2015 and the Reports of the Board of Directors and the Auditors’ thereon. offers himself for appointment and in respect of ZKRPWKH&RPSDQ\KDVUHFHLYHGDQRWLFHLQZULWLQJ under Section 160 of the Act. WKHUHRI IRU WKH WLPH EHLQJ LQ IRUFH 0U (ULF 2OVHQ KDYLQJ 'LUHFWRU . be and is hereby appointed as a Director RIWKH&RPSDQ\LQWKHFDWHJRU\RID1RQ([HFXWLYH Non-Independent Director. from a Member SURSRVLQJWKHFDQGLGDWXUHRI0U2OVHQIRUWKHRIoFH of Director. DQG ZKR KROGV RIoFH XSWR WKH GDWH RI WKLV $QQXDO General Meeting of the Company. as an Additional Director of the Company with effect from July 17. 4.  7RGHFODUHoQDOGLYLGHQGRQ(TXLW\6KDUHV 3.” (ii) the Audited Consolidated Financial Statements RI WKH &RPSDQ\ IRU WKH oQDQFLDO \HDU HQGHG December 31. pursuant to Section 161 of the Act and the Articles of Association of the Company.GHQWLoFDWLRQ 1XPEHU  who was appointed by the Board of Directors. To appoint a Director in place of Mr Vijay Kumar 6KDUPDD1RQ([HFXWLYH1RQ.QGHSHQGHQW'LUHFWRU KDYLQJ 'LUHFWRU .GHQWLoFDWLRQ 1XPEHU  who retires by rotation and being eligible offers himself for re-appointment. Appointment of Statutory Auditors  7R FRQVLGHU DQG LI WKRXJKW oW WR SDVV ZLWK RU ZLWKRXWPRGLoFDWLRQ V. 2015.

of the Companies Act.WKHIROORZLQJ5HVROXWLRQDV an Ordinary Resolution: “RESOLVED THAT SXUVXDQW WR WKH SURYLVLRQV RI 6HFWLRQV   DQG RWKHU DSSOLFDEOH SURYLVLRQV if any. 2014 (the 5XOHV. 2013 (the Act) and The Companies (Audit and Auditors) Rules.

 LQFOXGLQJ DQ\ VWDWXWRU\ PRGLoFDWLRQ V.

 RU re-enactment(s) thereof for the time being in force.&$. Messrs S R B C & CO LLP. 0XPEDLKDYLQJ. Chartered Accountants. be and are hereby re-appointed as Statutory Auditors of the Company IRU WKH )LQDQFLDO <HDU  WR KROG RIoFH IURP WKH conclusion of this Annual General Meeting until the FRQFOXVLRQRIWKHQH[W$QQXDO*HQHUDO0HHWLQJRIWKH 6. Appointment of Mr Christof Hassig Non-Executive / Non-Independent Director as  7R FRQVLGHU DQG LI WKRXJKW oW WR SDVV ZLWK RU ZLWKRXWPRGLoFDWLRQ V.)LUP5HJLVWUDWLRQ1R( ZKR KDYH RIIHUHG WKHPVHOYHV IRU UHDSSRLQWPHQW DQG KDYH FRQoUPHG WKHLU HOLJLELOLW\ WR EH DSSRLQWHGDV$XGLWRUVLQWHUPVRIWKHSURYLVLRQVRI Section 141 of the Act and the Rules.

including any VWDWXWRU\PRGLoFDWLRQ V. 2013 (the Act) read with The &RPSDQLHV $SSRLQWPHQW DQG 4XDOLoFDWLRQV RI Directors) Rules.WKHIROORZLQJ5HVROXWLRQDV an Ordinary Resolution: “RESOLVED THAT SXUVXDQW WR WKH SURYLVLRQV RI 6HFWLRQ  DQG RWKHU DSSOLFDEOH SURYLVLRQV RI the Companies Act. 2014 (the Rules).

RUUHHQDFWPHQW V.

WKHUHRI for the time being in force.GHQWLoFDWLRQ 1XPEHU  19 . Mr Christof Hassig KDYLQJ 'LUHFWRU .

2014 iQFOXGLQJ DQ\ VWDWXWRU\ PRGLoFDWLRQ V.ACC Limited Companies (Audit and Auditors) Rules.

appointed by the Board of Directors of the Company as Cost Auditors to conduct the audit of the cost records of the Company for the Financial Year 2016. the remuneration payable to Messrs N I Mehta & &R &RVW $FFRXQWDQWV KDYLQJ )LUP 5HJLVWUDWLRQ No. 000023. RU re-enactment(s) thereof for the time being in force. being `  ODNK 5XSHHV (OHYHQ ODNK.

2015. and ZKRKROGVRIoFHXSWRWKHGDWHRIWKLV$QQXDO*HQHUDO Meeting of the Company. DVDOVRWKHSD\PHQWRIVHUYLFHWD[DVDSSOLFDEOHDQG UHLPEXUVHPHQW RI RXWRISRFNHW H[SHQVHV HWF incurred by them in connection with the aforesaid DXGLWEHDQGLVKHUHE\UDWLoHGDQGFRQoUPHGy who was appointed by the Board of Directors as an Additional Director of the Company with effect from December 9. who being eligible. pursuant to Section 161 of the Act and the Articles of Association of the Company. be and is hereby appointed as a Director of WKH &RPSDQ\ LQ WKH FDWHJRU\ RI  D 1RQ([HFXWLYH  Non-Independent Director.” 7. from a Member proposing WKH FDQGLGDWXUH RI 0U +DVVLJ IRU WKH RIoFH RI Director. offers himself for appointment and in respect of whom WKH&RPSDQ\KDVUHFHLYHGDQRWLFHLQZULWLQJXQGHU Section 160 of the Act. Appointment of Mr Martin Kriegner Non-Executive / Non-Independent Director as a  7RFRQVLGHUDQGLIWKRXJKWoWWRSDVVZLWKRUZLWKRXW PRGLoFDWLRQ V.

 WKH IROORZLQJ 5HVROXWLRQ DV DQ Ordinary Resolution: “RESOLVED THAT SXUVXDQW WR WKH SURYLVLRQV RI 6HFWLRQ  DQG RWKHU DSSOLFDEOH SURYLVLRQV RI the Companies Act. 2014 (the Rules). including any VWDWXWRU\PRGLoFDWLRQ V. 2013 (the Act) read with The &RPSDQLHV $SSRLQWPHQW DQG 4XDOLoFDWLRQV RI Directors) Rules.

RUUHHQDFWPHQW V.

2016.ULHJQHU IRU WKH RIoFH RI Director. and ZKRKROGVRIoFHXSWRWKHGDWHRIWKLV$QQXDO*HQHUDO Meeting of the Company. Mr Martin Kriegner KDYLQJ 'LUHFWRU . be and is hereby appointed as a Director of WKH &RPSDQ\ LQ WKH FDWHJRU\ RI  D 1RQ([HFXWLYH  Non-Independent Director.”  5DWLoFDWLRQRI5HPXQHUDWLRQWR&RVW$XGLWRU  7R FRQVLGHU DQG LI WKRXJKW oW WR SDVV ZLWK RU ZLWKRXWPRGLoFDWLRQ V. pursuant to Section 161 of the Act and the Articles of Association of the Company. who being eligible.WKHUHRI for the time being in force. from a Member proposing WKH FDQGLGDWXUH RI 0U . as an Additional Director of the Company with effect from February 11.GHQWLoFDWLRQ 1XPEHU  who was appointed by the Board of Directors. offers himself for appointment and in respect of whom WKH&RPSDQ\KDVUHFHLYHGDQRWLFHLQZULWLQJXQGHU Section 160 of the Act.

WKHIROORZLQJ5HVROXWLRQDV an Ordinary Resolution: “RESOLVED THAT SXUVXDQW WR WKH SURYLVLRQV RI 6HFWLRQ  .

Adoption of the new Articles of Association  7R FRQVLGHU DQG LI WKRXJKW oW WR SDVV ZLWK RU ZLWKRXWPRGLoFDWLRQ V. DQG RWKHU DSSOLFDEOH SURYLVLRQV if any. of the Companies Act. 2013 and The 20 9.

2013 read with The Companies (Incorporation) Rules 2014 LQFOXGLQJDQ\VWDWXWRU\PRGLoFDWLRQ V.WKHIROORZLQJ5HVROXWLRQDV a Special Resolution: “RESOLVED THAT pursuant to Section 14 and other DSSOLFDEOH SURYLVLRQV LI DQ\ RI WKH &RPSDQLHV Act.

RU re-enactment(s) thereof. DQG VXEMHFW WR WKH DSSURYDO DQG UHJLVWUDWLRQ E\ WKH Registrar of Companies and other authorities as may be applicable. RESOLVED FURTHER THAT the Board be and is hereby DXWKRUL]HGWRWDNHDOOVXFKVWHSVDQGDFWLRQVDQGJLYH such directions. duly initialed by a Director RI WKH &RPSDQ\ IRU WKH SXUSRVH RI LGHQWLoFDWLRQ be and is hereby adopted as the new set of Articles RI $VVRFLDWLRQ LQ VXEVWLWXWLRQ RI WKH H[LVWLQJ VHW RI Articles of Association. things. which DPHQGPHQWVRUPRGLoFDWLRQVWKH%RDUGRI'LUHFWRUV hereinafter referred to as “the Board” (which includes a duly constituted committee thereof). is authorized to accept the consent of the Company be and is hereby granted to amend the Articles of Association of the Company as per the draft placed before the Meeting. as may be in its absolute discretion GHHPHG QHFHVVDU\ WR VHWWOH DQ\ TXHVWLRQ WKDW PD\ arise in this regard and do all such acts. deeds and matters which are incidental and ancillary thereto (including the delegation of this authority) IRUWKHSXUSRVHRIJLYLQJHIIHFWWRWKLV5HVROXWLRQ . and subject to such terms and FRQGLWLRQVDPHQGPHQWVRUPRGLoFDWLRQVDVPD\EH prescribed by any such appropriate authority. for the time being in force).

pursuant to Section 113 of the &RPSDQLHV $FW  DUH UHTXHVWHG WR VHQG WR WKH &RPSDQ\ D FHUWLoHG FRS\ RI WKH UHOHYDQW %RDUG 5HVROXWLRQ WRJHWKHU ZLWK WKH UHVSHFWLYH VSHFLPHQ VLJQDWXUHV RI WKRVH UHSUHVHQWDWLYH V. returns. documents.Corporate Overview Financial Highlights Board & Management Reports Subsidiary Companies RESOLVED FURTHER THAT any Director of the Company or the Company Secretary & Head &RPSOLDQFH RU WKH &KLHI )LQDQFLDO 2IoFHU EH DQG DUH KHUHE\ VHYHUDOO\ DXWKRUL]HG WR VLJQ DQG oOH WKH prescribed forms. applications and deeds with all authorities including the Registrar of Companies. along with the UHTXLVLWHIHHVLQUHVSHFWRIWKHDGRSWLRQRIWKHQHZ Articles of Association. e. Corporate Members intending to send their DXWKRUL]HG UHSUHVHQWDWLYHV WR DWWHQG WKH $QQXDO General Meeting. Maharashtra.

RESOLVED FURTHER THAT D FHUWLoHG WUXH FRS\ of this resolution be submitted to the prescribed authorities. In case of joint holders attending the Meeting.')ROLR1R g. 2013. a VWDWHPHQW JLYLQJ DGGLWLRQDO LQIRUPDWLRQ RQ  WKH 'LUHFWRUV VHHNLQJ DSSRLQWPHQW  UHDSSRLQWPHQW LV DQQH[HG KHUHZLWK DV UHTXLUHG XQGHU 6(%. /LVWLQJ 2EOLJDWLRQV DQG 'LVFORVXUH 5HTXLUHPHQWV. In respect of Resolutions at Item Nos. in respect of the business under Item Nos. DXWKRUL]HG XQGHUWKHVDLGUHVROXWLRQWRDWWHQGDQGYRWHRQWKHLU behalf at the Meeting. 5 to 9 of the DFFRPSDQ\LQJ1RWLFHDUHDQQH[HGKHUHWR b.” I 0HPEHUV3UR[LHVDQG$XWKRUL]HGUHSUHVHQWDWLYHVDUH UHTXHVWHG WR EULQJ WR WKH 0HHWLQJ WKH DWWHQGDQFH slips enclosed herewith duly completed and signed mentioning therein details of their DP ID and &OLHQW. 3. the joint holder who is higher in the order of names will EHHQWLWOHGWRYRWHDWWKH0HHWLQJ Notes: D 7KH UHODWLYH ([SODQDWRU\ 6WDWHPHQWV SXUVXDQW WR Section 102 of the Companies Act. 5 to 7.

 5HJXODWLRQV 6(%.5HJXODWLRQV.

as per the OLVWSURYLGHGE\WKH'HSRVLWRULHVIRUWKLVSXUSRVHThe dividend will be payable on and from April 20. BY 3. Members who hold shares in dematerialized IRUP VKRXOG LQIRUP  WKHLU 'HSRVLWRU\ 3DUWLFLSDQWV (DP) as well as to the Company and such Members holding shares in physical form should inform the IN ORDER THAT THE APPOINTMENT OF A PROXY IS EFFECTIVE. February 29.I D GLYLGHQG DV SURSRVHG LV GHFODUHG DW WKH $QQXDO *HQHUDO 0HHWLQJ WKH SD\PHQW RI VXFK GLYLGHQG will be made to those Members of the Company whose names stand on the Register of Members of WKH &RPSDQ\ RQ )HEUXDU\   7KH GLYLGHQG in respect of shares held in dematerialized form in WKH'HSRVLWRU\6\VWHPZLOOEHSDLGWRWKHEHQHoFLDO owners of shares as on February 23. APRIL 11.M. February 24. K 5HOHYDQWGRFXPHQWVUHIHUUHGWRLQWKHDFFRPSDQ\LQJ 1RWLFH DQG LQ WKH ([SODQDWRU\ 6WDWHPHQWV DUH RSHQ for inspection by the Members at the Company’s 5HJLVWHUHG2IoFHRQDOOZRUNLQJGD\VRIWKH&RPSDQ\ during business hours upto the date of the Meeting. THE INSTRUMENT APPOINTING A PROXY MUST BE RECEIVED AT THE REGISTERED OFFICE OF THE COMPANY NOT LATER THAN FORTYEIGHT HOURS BEFORE THE COMMENCEMENT OF THE MEETING i.e. ON MONDAY. c. i. N 6(%. 2016. 2016 to Monday. 2016. ERWKGD\VLQFOXVLYHIRUSD\PHQWRIoQDOGLYLGHQGLI GHFODUHGDSSURYHGDWWKH$QQXDO*HQHUDO0HHWLQJ M . 2016. 2016.00 P. G $ SHUVRQ FDQ DFW DV D SUR[\ RQ EHKDOI RI 0HPEHUV QRW H[FHHGLQJ oIW\ LQ QXPEHU DQG KROGLQJ LQ WKH aggregate not more than ten percent of the total VKDUHFDSLWDORIWKH&RPSDQ\FDUU\LQJYRWLQJULJKWV A Member holding more than ten percent of the total VKDUH FDSLWDO RI WKH &RPSDQ\ FDUU\LQJ YRWLQJ ULJKWV PD\ DSSRLQW D VLQJOH SHUVRQ DV D SUR[\ DQG VXFK SHUVRQVKDOOQRWDFWDVSUR[\IRUDQ\RWKHU0HPEHU 21 .5HJXODWLRQVKDVPDQGDWHGFRPSDQLHVWRFUHGLW WKH GLYLGHQGV HOHFWURQLFDOO\ WR WKH 0HPEHUV  EDQN account. The Register of Members and Share Transfer Books of the Company will be closed from Wednesday. Financial Statements A MEMBER ENTITLED TO ATTEND AND VOTE AT THE ANNUAL GENERAL MEETING IS ENTITLED TO APPOINT A PROXY TO ATTEND AND VOTE IN THE MEETING INSTEAD OF HIMSELF AND A PROXY NEED NOT BE A MEMBER OF THE COMPANY.

The information is also DYDLODEOHRQWKHZHEVLWHRIWKH0LQLVWU\RI&RUSRUDWH Affairs ZZZPFDJRYLQ o. the date of the last Annual General Meeting. 2013 read with Rule 20 of the Companies (Management and Administration) Rules.QYHVWRU (GXFDWLRQ DQG Protection Fund (Uploading of Information regarding Unpaid and Unclaimed amounts lying with Companies) Rules. the information RQ GLYLGHQGV ZKLFK UHPDLQ ZLWK WKH &RPSDQ\ unclaimed as on March 20. the Company has placed on its website www.ACC Limited &RPSDQ\   WKHLU %DQN GHWDLOV YL] %DQN $FFRXQW Number. 2014 as amended from time to time and sub FODXVH . $V SHU WKH SURYLVLRQV RI .e. 22 General Information: i. .Q FRPSOLDQFH ZLWK WKH SURYLVLRQV RI 6HFWLRQ  of the Companies Act. 2012.&5 &RGH 7KRVH 0HPEHUV ZKR KDYH HDUOLHU SURYLGHGWKHDERYHLQIRUPDWLRQVKRXOGXSGDWHWKH GHWDLOVLIUHTXLUHG l.acclimited. 2015 i.com. Name of the Bank and Branch details DQG 0.

  .

5HJXODWLRQVWKH &RPSDQ\LVSOHDVHGWRRIIHUHYRWLQJIDFLOLWLHVWRLWV Members in respect of the business to be transacted DW WKH WK $QQXDO *HQHUDO 0HHWLQJ 7KH &RPSDQ\ KDV HQJDJHG WKH VHUYLFHV RI 1DWLRQDO 6HFXULWLHV Depository Limited (NSDL) as authorized agency WR SURYLGH HYRWLQJ IDFLOLW\ . LL 7KHIDFLOLW\IRUHYRWLQJVKDOODOVREHPDGHDYDLODEOH DW WKH $*0 IRU WKRVH 0HPEHUV ZKR KDYH QRW FDVW WKHLUYRWHVHDUOLHU 7KH 6HFXULWLHV DQG ([FKDQJH %RDUG RI .QGLD 6(%.QRUGHUWRIDFLOLWDWHWKRVH0HPEHUV ZKR GR QRW ZLVK WR XVH WKH HYRWLQJ IDFLOLW\ WKH Company is enclosing a Ballot Form. Resolutions SDVVHGE\0HPEHUVWKURXJKHYRWLQJRUEDOORWIRUPV DUHGHHPHGWRKDYHEHHQSDVVHGDVLIWKH\KDYHEHHQ passed at the Annual General Meeting (AGM).W LV FODULoHG WKDW LW LV QRW PDQGDWRU\ IRU D 0HPEHU WR YRWH XVLQJ UHPRWH HYRWLQJIDFLOLW\.RI&ODXVHRI6(%.

 has mandated the submission of Permanent  $FFRXQW 1XPEHU 3$1.

3XUVXDQW WR WKH SURYLVLRQV RI 6HFWLRQ $ . Members holding shares in dematerialized form should inform their DP and Members holding shares in physical form should inform the Company their PAN details along with proof thereof. E\ HYHU\ SDUWLFLSDQW LQ the securities market. m.

QYHVWRU (GXFDWLRQ DQG 3URWHFWLRQ )XQG .(3). 1956 (which are in force). and 205C of the Companies Act. the Company has transferred on due GDWHV WKH XQSDLG  XQFODLPHG oQDO GLYLGHQG IRU WKH oQDQFLDO \HDU HQGHG 'HFHPEHU   DQG LQWHULP GLYLGHQG IRU WKH oQDQFLDO \HDU HQGHG 'HFHPEHU   WR WKH .

' DQG &OLHQW .Q FDVH 0HPEHUV FDVWWKHLUYRWHVWKURXJKERWKWKHPRGHVYRWLQJGRQH E\HYRWLQJVKDOOSUHYDLODQGYRWHVFDVWWKURXJK%DOORW )RUPVKDOOEHWUHDWHGDVLQYDOLG Y . 121 Maharshi .' 1R +RZHYHU the duly completed Ballot Form should reach the 6FUXWLQL]HU 0U . LLL 7KH 0HPEHUV ZKR KDYH FDVW WKHLU YRWHV E\ UHPRWH HYRWLQJRUE\%DOORW)RUPSULRUWRWKH$*0PD\DOVR attend the Meeting but they shall not be entitled to FDVWWKHLUYRWHDJDLQ LY 0HPEHUV FDQ RSW IRU RQO\ RQH PRGH RI YRWLQJ LH HLWKHU E\ %DOORW )RUP RU HYRWLQJ . 'ULYHU &R $&& /LPLWHG Share Department.KXVKURR .chitre@acclimited. Cement House. $5RXWHPDSVKRZLQJGLUHFWLRQVWRUHDFKWKHYHQXH RIWKHth$*0LVJLYHQDWWKHHQGRIWKLV1RWLFHDV SHU WKH UHTXLUHPHQW RI WKH 6HFUHWDULDO 6WDQGDUGV on “General Meeting”. Process and manner for voting through electronic means Members holding shares in their single name are DGYLVHG WR PDNH D QRPLQDWLRQ LQ UHVSHFW RI WKHLU shareholding in the Company.com by mentioning WKHLU )ROLR 1R  '3 .DUYH5RDG0XPEDLQRWODWHUWKDQ)ULGD\ $SULO SP.com.QFDVHD0HPEHULVGHVLURXVRIREWDLQLQJDGXSOLFDWH %DOORW )RUP KH  VKH PD\ VHQG DQ HPDLO WR sujata. The nomination form can be downloaded from the Company’s website www. Members holding shares in SK\VLFDO IRUP VKRXOG oOH WKHLU QRPLQDWLRQ ZLWK WKH Company whilst those Members holding shares in GHPDWHULDOL]HG  PRGH VKRXOG oOH WKHLU QRPLQDWLRQ with their DP. HVWDEOLVKHG E\ WKH &HQWUDO *RYHUQPHQW n.acclimited.

%DOORW)RUPVUHFHLYHGDIWHU WKLVGDWHZLOOEHWUHDWHGDVLQYDOLG .

Wednesday.00 a.m. 2016.00 p.Corporate Overview Financial Highlights Board & Management Reports YL The remote e-voting period will commence on Saturday. During this period. Members of the Company. 'ULYHU RI .) and will end on Tuesday. April 6.m. April 9. holding shares either in physical form or in dematerialized form. April 12.).  . may FDVW WKHLU YRWH E\ UHPRWH HYRWLQJ 7KH UHPRWH HYRWLQJPRGXOHZLOOEHGLVDEOHGE\16'/IRUYRWLQJ thereafter.KXVKURR .e. as on the cut-off date i. &RUSRUDWH 6ROXWLRQV 3ULYDWH /LPLWHG 0HPEHUVKLS 1R $ . 2016 (9.  YLL 7KH 0HPEHUV ZKR DUH SUHVHQW DW WKH 0HHWLQJ EXW KDYH QRW FDVW WKHLU YRWHV E\ DYDLOLQJ WKH UHPRWH HYRWLQJIDFLOLW\RUE\D%DOORWHDUOLHUZLOOEHDOORZHG WR YRWH HOHFWURQLFDOO\ DW WKH 0HHWLQJ  ZLWK WKH DVVLVWDQFHRIWKHUHSUHVHQWDWLYHVRI16'/ 0U . 2016 (5.

e. 2016.acclimited. The results declared along with the report of the Scrutinizer shall be placed on the website of the Company www.com and on the website of NSDL ZZZHYRWLQJQVGOFRP immediately after the declaration of result by the Chairman or a person authorized by him in this behalf. April 13. The results VKDOODOVREHXSORDGHGRQWKH%6(/LVWLQJ3RUWDODQG RQWKH16(1($363RUWDO L[ 6XEMHFW WR UHFHLSW RI UHTXLVLWH QXPEHU RI YRWHV WKH Resolutions shall be deemed to be passed on the date of the Annual General Meeting i. For Members whose e-mail addresses are registeredz with the Company / Depositories: L 7KRVH 0HPEHUV ZKRVH YDOLG HPDLO . Wednesday. Subsidiary Companies Process and manner for remote e-voting A. YLLL 7KH 6FUXWLQL]HU VKDOO VXEPLW KLV UHSRUW WR WKH Chairman.'V DUH UHJLVWHUHG ZLWK WKH &RPSDQ\  'HSRVLWRU\ 3DUWLFLSDQW V. KDV EHHQ DSSRLQWHGDVWKH6FUXWLQL]HUIRURYHUVHHLQJWKHYRWLQJ DQGUHPRWHHYRWLQJSURFHVVLQDIDLUDQGWUDQVSDUHQW manner.

April 6. 7KH VDLG 3') oOH FRQWDLQV \RXU XVHU . Open the e-mail and thereafter open the DWWDFKHG 3') oOH YL] k$&& UHPRWH HYRWLQJ pdf” with your Client ID or Folio No.1IRUUHPRWHHYRWLQJ3OHDVHQRWH that the password is an initial password.I D SHUVRQ ZDV D 0HPEHU RQ WKH GDWH RI the Book Closure as aforesaid but has ceased to be D0HPEHURQWKHFXWRIIGDWHKHVKHVKDOOQRWEH HQWLWOHGWRYRWH6XFKSHUVRQVKRXOGWUHDWWKLV1RWLFH for information purpose only.  Financial Statements LLL %URZVHWKHIROORZLQJ85/KWWSVZZZHYRWLQJ QVGOFRP LY &OLFNRQ6KDUHKROGHU/RJLQ Y . Wednesday.QVHUWXVHU. 7KHYRWLQJULJKWVRI0HPEHUVVKDOOEHLQSURSRUWLRQ RIWKHSDLGXSHTXLW\VKDUHFDSLWDORIWKH&RPSDQ\DV on the cut-off date i. 2016.1DVQRWHGLQVWHS LL.' DQG SDVVZRUG3. as password.'DQGSDVVZRUGDVLQLWLDOSDVVZRUG 3. Only those Members whose names are recorded in the Register of Members of the Company or in the 5HJLVWHU RI %HQHoFLDO 2ZQHUV PDLQWDLQHG E\ WKH Depositories as on the cut-off date shall be entitled WR YRWH .e.ZLOOUHFHLYHDQHPDLOIURP16'/ ii.

[LL 2QFH\RXKDYHYRWHGRQWKHUHVROXWLRQ\RXZLOO QRWEHDOORZHGWRPRGLI\\RXUYRWH [LLL . It is strongly recommended not to share your password with any other person and take utmost FDUHWRNHHS\RXUSDVVZRUGFRQoGHQWLDO YLL +RPH SDJH RI UHPRWH HYRWLQJ RSHQV &OLFN RQ UHPRWHHYRWLQJ$FWLYH9RWLQJ&\FOHV YLLL 6HOHFWk(9(1yRIk$&&/LPLWHGyZKLFKLV L[ 1RZ \RX DUH UHDG\ IRU UHPRWH HYRWLQJ DV “Cast Vote” page opens. Please keep a note of your new password. [L 8SRQ FRQoUPDWLRQ WKH PHVVDJH k9RWH FDVW successfully” will be displayed.1ZLWKQHZSDVVZRUGRI\RXU FKRLFHKDYLQJPLQLPXPGLJLWVFKDUDFWHUVRU combination thereof.DERYH&OLFN/RJLQ YL 3DVVZRUG FKDQJH PHQX ZLOO DSSHDU &KDQJH WKHSDVVZRUG3. HWF.QVWLWXWLRQDO 0HPEHUV LH RWKHU WKDQ LQGLYLGXDOV +8) 15. [ &DVW \RXU YRWH E\ VHOHFWLQJ DSSURSULDWH RSWLRQ DQGFOLFNRQk6XEPLWyDQGDOVRk&RQoUPyZKHQ prompted.

 ZKR ZLVK WR FDVW WKHLUYRWHVWKURXJKUHPRWHHYRWLQJDUHUHTXLUHG WRVHQGDVFDQQHGFRS\ 3')-3*)RUPDW.

RIWKH UHOHYDQW%RDUG5HVROXWLRQ$XWKRULW\/HWWHUHWF 23 .

ACC Limited together with attested specimen signature(s) of WKH GXO\ DXWKRUL]HG VLJQDWRU\ LHV.

com with a FRS\PDUNHGWRHYRWLQJ#QVGOFRLQ B. ZKR LV  DUH DXWKRUL]HGWRYRWHWRWKH6FUXWLQL]HUWKURXJKDQ e-mail to kkd.  )ROORZ DOO VWHSV DV JLYHQ LQ 6U 1R LL. For Members whose e-mail addresses are not registered with the Company / Depositories: 0HPEHUV ZLOO UHFHLYH D %DOORW )RUP DORQJ ZLWK WKH $QQXDO5HSRUW7KH\KDYHWZRRSWLRQV L 7RRSWIRUHYRWLQJE\XVLQJWKHLQLWLDOSDVVZRUG that is pURYided in the enclosed Ballot Form.scrutinizer@acclimited.

 WR 6U 1R [LLL.

Q FDVH 0HPEHUV KDYH DQ\ TXHULHV UHODWLQJ WR UHPRWH HYRWLQJ WKH\ DUH UHTXHVWHG WR UHIHU WR WKH k)UHTXHQWO\ $VNHG 4XHVWLRQV )$4V.DERYHWRFDVW\RXUYRWH OR LL 7R RSW IRU FDVWLQJ WKHLU YRWH LQ SK\VLFDO IRUP E\ oOOLQJ LQ WKH %DOORW )RUP DQG SRVWLQJ LW WR the address mentioned in the enclosed prepaid %XVLQHVV5HSO\(QYHORSH Additional Information: L     .

LY $Q\ SHUVRQ ZKR DFTXLUHV VKDUHV RI WKH Company and becomes a Member of the Company after despatch of the Notice and holding shares as of the cut-off date i.' DQG SDVVZRUG E\ VHQGLQJ D UHTXHVW DW HYRWLQJ#QVGOFRLQ +RZHYHU LI \RX DUH already registered with NSDL for remote HYRWLQJ WKHQ \RX FDQ XVH \RXU H[LVWLQJ XVHU . IRU 0HPEHUVy DQG k5HPRWH HYRWLQJ 8VHU 0DQXDO IRU0HPEHUVyDYDLODEOHDWWKHGRZQORDGVVHFWLRQ at ZZZHYRWLQJQVGOFRP or call on toll free 1R 0HPEHUV PD\ DOVR VHQG WKHLU TXHULHV UHODWLQJ WR HYRWLQJ WR 0U 5DMLY 5DQMDQ $VVW 0DQDJHU NSDL. at: (PDLOLGUDMLYU#QVGOFRLQHYRWLQJ#QVGOFRLQ 7ROOIUHH1R 7HO1R ii. 7KRVHPHPEHUVZKRKDYHFKDQJHGWKHLU(PDLO.'ZLWKWKH&RPSDQ\LQ case the shares are held in physical form and with the Depository Participant where shares are held in Demat mode.' DQG SDVVZRUG IRU FDVWLQJ \RXU YRWH . February 10.DUYH5RDG Mumbai 400 020 Registration / Updating of Email IDs and Bank Details 0HPEHUV DUH UHTXHVWHG WR VXSSRUW WKH k*UHHQ .'DQGSDVVZRUG3.1IRUFDVWLQJ WKHLUYRWHV iii. For ACC Limited Burjor D Nariman Company Secretary & Head Compliance Mumbai. April 6.QLWLDWLYHy E\ UHJLVWHULQJ WKHLU (PDLO DGGUHVV ZLWK WKH &RPSDQ\ if not already done.I \RX KDYH IRUJRWWHQ \RXU SDVVZRUG \RX can reset your password by using “Forgot 8VHU 'HWDLOV  3DVVZRUGy RSWLRQ DYDLODEOH RQ ZZZHYRWLQJQVGOFRP RU FRQWDFW 16'/ DW WKH WROOIUHH1R By Order of the Board of Directors. 3XUVXDQWWR6(%. 2016.e. Wednesday.'DUHUHTXHVWHGWRUHJLVWHUWKHLUQHZ(PDLO. If a Member is already registered with NSDL for UHPRWH HYRWLQJ WKHQ KHVKHFDQXVHKLVKHU H[LVWLQJXVHU.' VLQWKHXVHUSURoOHGHWDLOV of the folio. /LVWLQJ2EOLJDWLRQVDQG'LVFORVXUH5HTXLUHPHQWV. 2016 5HJLVWHUHG2IoFH k&HPHQW+RXVHy0DKDUVKL. 7KH0HPEHUVDUHUHTXHVWHGWRXSGDWHWKHLUPRELOH QXPEHUVDQGHPDLO. which may be used by the Company for sending future communication(s) to them. may obtain the ORJLQ .

5HJXODWLRQVWKH&RPSDQ\LVUHTXLUHGWR PDLQWDLQ%DQNGHWDLOVRILWV0HPEHUVIRUWKHSXUSRVHRI3D\PHQWRI'LYLGHQGVHWFMembers are requested to register / update their bank details with the Company in case shares are held in physical form and with their Depository Participants as well as the Company where shares are held in dematerialized mode. 24 . to enable expeditious credit of the dividend to their bank accounts electronically through ACH / NECS.

QGHSHQGHQW'LUHFWRU. 5: The Board of Directors on the recommendation of the Nomination & Remuneration Committee appointed 0U (ULF 2OVHQ DV DQ $GGLWLRQDO 'LUHFWRU RI WKH &RPSDQ\ with effect from July 17. +HLVDEXVLQHVVJUDGXDWHIURPWKH8QLYHUVLW\RI&RORUDGR &HUWLoHG 3XEOLF $FFRXQWDQW &KLFDJR 86$. 2013. 5 to 9 of the accompanying Notice dated February 10. 0U 2OVHQ KROGV RIoFH XSWR WKH GDWH RI WKH IRUWKFRPLQJ Annual General Meeting and is eligible for appointment as a Director of the Company in the category of 1RQ([HFXWLYH1RQ.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies EXPLANATORY STATEMENTS 7KHIROORZLQJ([SODQDWRU\6WDWHPHQWVDVUHTXLUHGXQGHU Section 102 of the Companies Act. Item No. is the &KLHI([HFXWLYH2IoFHURI/DIDUJH+ROFLP/WGWKHXOWLPDWH Holding Company of ACC Limited.QGHSHQGHQW'LUHFWRU7KH&RPSDQ\ KDVUHFHLYHGDQRWLFHXQGHU6HFWLRQRIWKH&RPSDQLHV $FWIURPD0HPEHUDORQJZLWKWKHUHTXLVLWHGHSRVLW signifying his intention to propose the candidature of 0U(ULF2OVHQDVD'LUHFWRURIWKH&RPSDQ\7KHQRWLFHLV DYDLODEOHIRULQVSHFWLRQE\WKH0HPEHUVRIWKH&RPSDQ\ DW WKH 5HJLVWHUHG 2IoFH GXULQJ EXVLQHVV KRXUV RQ DQ\ working day upto the date of the Annual General Meeting. 2016. and Holcim /WGKHVHUYHGDV([HFXWLYH9LFe President Operations of /DIDUJHDQGDPHPEHURILWV([HFXWLYH&RPPLWWHH +HMRLQHGWKH/DIDUJH*URXSLQoUVWDV6HQLRU9LFH 3UHVLGHQWIRU6WUDWHJ\DQG'HYHORSPHQWRI/DIDUJH1RUWK $PHULFD 6LQFH  KH VHUYHG DV 3UHVLGHQW 1RUWK(DVW Cement Region and Senior Vice President. 6LQFH  KH VHUYHG DV &KLHI )LQDQFLDO 2IoFHU DQG 6HQLRU 9LFH 3UHVLGHQW IRU /DIDUJH 1RUWK $PHULFD D 1<6( listed Company. American and French citizen.QDFFRUGDQFH with Section 161(1) of the Companies Act. 51 years old. Purchasing. )URPWRKHVHUYHGDV([HFXWLYH9LFH3UHVLGHQW Organization and Human Resources of Lafarge Group. 2013. 2015 in the category of a 1RQ([HFXWLYH1RQ. 3ULRU WR /DIDUJH 0U 2OVHQ VWDUWHG KLV FDUHHU LQ WKH oHOG RI0 $DW'HORLWWH 7RXFKH%DQTXH3DULEDVDQGZDVD partner of Trinity Associates. Prior to the global merger of Lafarge Ltd. set out all material facts relating to the business at Item Nos. Mr Olsen.

QYHVWPHQW%DQNHUIRU multinational corporates in Switzerland and abroad.QGHSHQGHQW'LUHFWRU In accordance with Section 161(1) of the Companies $FW  0U +DVVLJ KROGV RIoFH XSWR WKH GDWH RI WKH forthcoming Annual General Meeting and is eligible for appointment as a Director of the Company in the FDWHJRU\ RI 1RQ([HFXWLYH  1RQ. 2015 in the FDWHJRU\RID1RQ([HFXWLYH1RQ. he was reporting to the Chief )LQDQFLDO 2IoFHU ZLWK PDQ\ GLUHFW OLQNV WR DOO RWKHU ([HFXWLYH'LUHFWRUVLQFOXGLQJWKH&KLHI([HFXWLYH2IoFHU )RUWKHSDVWoIWHHQ\HDUVKHEXLOWDQGOHGWKH&RUSRUDWH Financing and Treasury Department. The Board of Directors commend the Ordinary Resolution set out at Item No.QGHSHQGHQW 'LUHFWRU 7KH&RPSDQ\KDVUHFHLYHGDQRWLFHXQGHU6HFWLRQRI the Companies Act.Q 0DUFK  WKH *URXS . Mr Christof Hassig heads the Corporate Strategy and 0HUJHUV  $FTXLVLWLRQV IXQFWLRQ LQ /DIDUJH+ROFLP UHSRUWLQJWRWKH&KLHI([HFXWLYH2IoFHU Within former Holcim. 2013 from a Member along with the UHTXLVLWHGHSRVLWSURSRVLQJWKHFDQGLGDWXUHRI0U+DVVLJ as a Director of the Company. Mr Christof Hassig worked for twenty oYH \HDUV DW 8%6 LQ PDQ\ GLIIHUHQW IXQFWLRQV LQFOXGLQJ *OREDO5HODWLRQVKLS0DQDJHUDQG.Q'HFHPEHUKHWRRNRYHUDGGLWLRQDOUHVSRQVLELOLWLHV DV KHDG RI WKH QHZO\ FUHDWHG 0HUJHUV  $FTXLVLWLRQV IXQFWLRQ RQ *URXS OHYHO . Item No. DQG KROGV D 0DVWHURI%XVLQHVV$GPLQLVWUDWLRQIURP+(&.QVXUDQFHGHSDUWPHQWZDVPRYHGDQGLQWHJUDWHGLQWRWKH Corporate Finance & Treasury Department. He started his career with a three year apprenticeship in Banking followed by a Masters Degree in Banking and the 25 . 6: The Board of Directors on the recommendation of the Nomination & Remuneration Committee appointed Mr Christof Hassig as an Additional Director of the Company with effect from December 9. 5 of the accompanying Notice for the DSSURYDORIWKH0HPEHUV None of the Directors or Key Managerial Personnel DQG WKHLU UHODWLYHV H[FHSW 0U (ULF 2OVHQ DUH LQ DQ\ ZD\ concerned or interested in the Resolution. Prior to 1999. 7KH QRWLFH LV DYDLODEOH for inspection by the Members of the Company at the 5HJLVWHUHG 2IoFH GXULQJ EXVLQHVV KRXUV RQ DQ\ ZRUNLQJ day upto the date of the Annual General Meeting.QWHUQDWLRQDO Business School in Paris. The function spans across all the geographic regions and includes a PDWUL[RUJDQL]DWLRQZLWKWKHoQDQFHGHSDUWPHQWRIWKH RSHUDWLQJFRPSDQLHVLQYDULRXVFRXQWULHV .

.ULHJQHUDUHLQDQ\ZD\ concerned or interested in the Resolution.QGLDLQWKH*URXSZLWKHIIHFW from March 1.Q WHUPV RI WKH SURYLVLRQV RI 6HFWLRQ  . The notice is DYDLODEOHIRULQVSHFWLRQE\WKH0HPEHUVRIWKH&RPSDQ\ DW WKH 5HJLVWHUHG 2IoFH GXULQJ EXVLQHVV KRXUV RQ DQ\ working day upto the date of the Annual General Meeting.ACC Limited $GYDQFHG0DQDJHPHQW3URJUDPPHDW+DUYDUG%XVLQHVV School in 2006. N I Mehta & Co. to conduct the audit of the cost records of the Company for the Financial Year 2016 on a remuneration of `  ODNK DQG SD\PHQW RI VHUYLFH WD[ DV DSSOLFDEOH DQG UHLPEXUVHPHQW RI RXWRISRFNHW H[SHQVHV LQFXUUHG by the Cost Auditors in connection with the said audit. Item No. The Board of Directors commend the Ordinary Resolution set out at Item No.ULHJQHULVDQ$XVWULDQ1DWLRQDO The Board of Directors commend the Ordinary Resolution set out at Item No. 6 of the accompanying Notice for the DSSURYDORIWKH0HPEHUV None of the Directors or Key Managerial Personnel and WKHLUUHODWLYHVH[FHSW0U+DVVLJDUHLQDQ\ZD\FRQFHUQHG or interested in the Resolution.QGLD 3ULYDWH /WG DQG 3UHVLGHQW IRU $VLD 5HJLRQ ORRNLQJDIWHUWKDW&RPSDQ\ V&HPHQWDFWLYLW\ 0U .QGHSHQGHQW'LUHFWRU In accordance with Section 161(1) of the Companies $FW0U.QGHSHQGHQW 'LUHFWRU 7KH &RPSDQ\ KDV UHFHLYHG D QRWLFH XQGHU 6HFWLRQ  of the Companies Act.ULHJQHU JUDGXDWHG IURP 9LHQQD 8QLYHUVLW\ ZLWK D 'RFWRUDWHLQ/DZDQGREWDLQHGDQ0%$DWWKH8QLYHUVLW\RI (FRQRPLFVLQ9LHQQD0U. 8:7KH&RPSDQ\LVUHTXLUHGWRKDYHLWVFRVWVUHFRUGV audited by a Cost Accountant in practice. He joined Lafarge Limited in 1990 in which Company KH KHOG VHQLRU OHDGHUVKLS SRVLWLRQV LQFOXGLQJ DV &(2 RI /DIDUJH .ULHJQHUVKDOOKROGRIoFHXSWRWKHGDWHRI the forthcoming Annual General Meeting and is eligible for appointment as a Director of the Company in the FDWHJRU\ RI 1RQ([HFXWLYH  1RQ. the Board of Directors of the Company on the recommendation RI WKH $XGLW &RPPLWWHH DSSURYHG WKH DSSRLQWPHQW and remuneration of Messrs. 2016. who was hitherto the Area Manager RI&HQWUDO(XURSHIRU/DIDUJH+ROFLP*URXSZLOOEHWDNLQJ RYHUDV$UHD0DQDJHUIRU. 7 of the accompanying Notice for the DSSURYDORIWKH0HPEHUV 26 None of the Directors or Key Managerial Personnel and WKHLUUHODWLYHVH[FHSW0U0DUWLQ. Item No. Mr Martin Kriegner. . 2016 in the FDWHJRU\RID1RQ([HFXWLYH1RQ. Cost Accountants. Accordingly. 7: The Board of Directors on the recommendation of the Nomination & Remuneration Committee has appointed Mr Martin Kriegner as an Additional Director of the Company with effect from February 11. 2013 from a Member along with WKH UHTXLVLWH GHSRVLW SURSRVLQJ WKH FDQGLGDWXUH RI 0U Kriegner as a Director of the Company.

7KH FKDQJH LV QHFHVVLWDWHG DV PDQ\ SURYLVLRQV RI WKH &RPSDQLHV$FWKDYHEHHQUHSHDOHGDQGVRPHQHZ FRQFHSWV KDYH EHHQ LQWURGXFHG XQGHU WKH &RPSDQLHV Act. the Members DUH UHTXHVWHG WR SDVV DQ 2UGLQDU\ 5HVROXWLRQ DV VHW RXW DW. 2013 read with Rule 14 of The Companies (Audit and Auditors) Rules. 2015 and Rules framed thereunder.W LV QRZ SURSRVHG WR KDYH D QHZ VHW RI $UWLFOHV RI $VVRFLDWLRQ WKH SURYLVLRQV RI ZKLFK DUH FRQVLVWHQW with the Companies Act.WHP 1R  RI WKH DFFRPSDQ\LQJ 1RWLFH IRU DSSURYDOE\WKH0HPEHUV None of the Directors or Key Managerial Personnel and WKHLUUHODWLYHVDUHLQDQ\ZD\FRQFHUQHGRULQWHUHVWHGLQ the Resolution. . The Board of Directors commend the Ordinary Resolution VHW RXW DW . 1956. Item No. RI WKH Companies Act. 2013 and The Companies (Amendment) Act. 9: The Articles of Association (AoA) of the Company currently in force were originally adopted when the Company was incorporated under the Companies Act.WHP1RRIWKH1RWLFHIRUUDWLoFDWLRQRIWKHSD\PHQW RI UHPXQHUDWLRQ WR WKH &RVW $XGLWRU IRU WKH oQDQFLDO year 2016. 2014. 2013. Accordingly. the remuneration SD\DEOH WR WKH &RVW $XGLWRU LV UHTXLUHG WR EH UDWLoHG E\ the Members of the Company. 1913 and were thereafter amended from time to WLPHLQDFFRUGDQFHZLWKWKHSURYLVLRQVRIWKH&RPSDQLHV Act. .

acclimited. 9 of the accompanying Notice for the DSSURYDORIWKH0HPEHUV LLL 3URYLVLRQV UHODWLQJ WR WKH DSSRLQWPHQW RI . For ACC Limited Y 3URYLVLRQVUHODWLQJWRWKHGLVFORVXUHVWREHPDGHE\ 'LUHFWRUVDWWKH0HHWLQJRIWKH%RDUGDQGYDFDWLRQRI RIoFHE\'LUHFWRUVKDYHEHHQDPHQGHGLQDFFRUGDQFH with the Act.H\ 0DQDJHULDO3HUVRQQHOKDYHEHHQDGGHG By Order of the Board of Directors.QGHSHQGHQWDQG:RPHQ'LUHFWRUVKDYHEHHQDGGHG None of the Directors or Key Managerial Personnel and WKHLUUHODWLYHVDUHLQDQ\ZD\FRQFHUQHGRULQWHUHVWHGLQ this Resolution. The proposed draft $UWLFOHVRI$VVRFLDWLRQLVDOVRDYDLODEOHRQWKH&RPSDQ\ V website www. 2016 5HJLVWHUHG2IoFH k&HPHQW+RXVHy0DKDUVKL. L 9DULRXVH[LVWLQJ$UWLFOHVKDYHEHHQDOLJQHGWRWKH$FW LL 3URYLVLRQV UHODWLQJ WR WKH XVH RI HOHFWURQLF PHGLXP E\ WKH 0HPEHUV DQG WKH 'LUHFWRUV KDYH EHHQ incorporated. LY 3URYLVLRQV UHODWLQJ WR WKH DSSRLQWPHQW RI .Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 7KHQHZ$R$LVWREHVXEVWLWXWHGLQSODFHRIWKHH[LVWLQJ $R$ DQG 0HPEHUV DWWHQWLRQ LV LQYLWHG WR FHUWDLQ VDOLHQW SURYLVLRQVLQWKHQHZ$R$RIWKH&RPSDQ\YL] date of the Annual General Meeting. February 10. A copy of the proposed set of new Articles of Association of WKH&RPSDQ\LVDYDLODEOHIRULQVSHFWLRQE\WKH0HPEHUV RIWKH&RPSDQ\DWWKH5HJLVWHUHG2IoFHGXULQJEXVLQHVV hours.com for perusal by the Members.DUYH5RDG Mumbai 400 020 27 . on any working day of the Company. upto the Burjor D Nariman Company Secretary & Head Compliance Mumbai. The Board of Directors commend the Special Resolution set out at Item No.

5.ACC Limited ANNEXURE TO ITEMS 3. 6 AND 7 OF THE NOTICE Details of Directors seeking re-appointment / appointment at the forthcoming Annual General Meeting >LQSXUVXDQFHRI6(%. /LVWLQJ2EOLJDWLRQVDQG'LVFORVXUH5HTXLUHPHQWV.

2016 Nationality Date of Appointment on Board 4XDOLoFDWLRQ M.Sc. Product 'HYHORSPHQW  Branding.02.GHQWLoFDWLRQ1XPEHU (DIN)    00077715 Date of Birth    06.2015 11.2014 17. Finance and General Management NIL Ambuja Cements Limited NIL . Strategy & 'HYHORSPHQWDQG Finance Corporate Finance & Treasury. 28 NIL Ambuja Cements Limited NIL Operations.1961 Indian American & French Swiss Austrian 06.02. ([SHUWLVHLQVSHFLoFIXQFWLRQDO Business area Strategy. private and Section 8 Companies) Memberships / Chairmanships of Audit and Stakeholders’ Relationship Committees across Public companies including ACC Limited NIL &HUWLoHG3XEOLF Accountant from Chicago (USA) & an MBA from the +(&. Risk Mitigation & Compliance Shareholding in ACC List of Directorships held in other Companies (excluding foreign.09. ICICI Bank Limited NIL NIL There are no inter-se relationships between the Board Members.2015 09.5HJXODWLRQV@ Name of the Director Mr Vijay Kumar Sharma Mr Eric Olsen Mr Christof Hassig Mr Martin Kriegner 'LUHFWRU. Mergers & $FTXLVLWLRQV NIL Life Insurance Ambuja Cements Corporation of Limited India.07.QWHUQDWLRQDO Business School.12. Paris Doctorate of Law & Masters in %DQNLQJ$GYDQFHG MBA from Austrian Management 8QLYHUVLW\ Programme from +DUYDUG%XVLQHVV School Operations. Infrastructure Leasing & Financial 6HUYLFHV/LPLWHG LIC Pension Fund Limited.

PV VENUE: Birla Matushri Sabhagar 19.Bombay Hospital and Medical Research Centre Source: Google maps Financial Highlights Board & Management Reports Financial Statements /DQGPDUN1H[WWR%RPED\+RVSLWDO Distance from Churchgate Station: 1 Km 'LVWDQFHIURP&KKDWUDSDWL6KLYDML7HUPLQXV. Mumbai 400 020 MAP SHOWING LOCATION OF THE VENUE OF 80TH ANNUAL GENERAL MEETING OF ACC LIMITED Corporate Overview Subsidiary Companies 29 . Sir Vithaldas Thackersey Marg.

49 3URoW%HIRUH7D[ 3%7.ACC Limited BOARD’S REPORT & MANAGEMENT DISCUSSION AND ANALYSIS TO THE MEMBERS OF ACC LIMITED The Directors take pleasure in presenting the Eightieth Annual Report together with the audited accounts for the year ended December 31. FINANCIAL RESULTS Consolidated Standalone ` Crore ` Crore 2015 Revenue from Operations (Net) and other income 2014 2015 2014 11.94 11.18 12. The Management Discussion and Analysis has also been incorporated into this report.995. 1.42 11. 2015.916.916.006.

98 (31. 765.13) 192.20 3URYLVLRQIRU7D[ 189.97 1.40 (33.09) 3URoW$IWHU7D[ 3$7.53 1.54 783.119.135.

64 4.56 5. 'HSUHFLDWLRQDQG([FHSWLRQDO.74 4. being the carrying DPRXQW DV RI -DQXDU\   RI WKH o[HG DVVHWV with no remaining useful life (as revised) as of that date.60 1.87 crore.161.16 crore from ` 11.995.29 Balance brought forward from previous year 4.606.65 356.00 130.74 crore being DFFUXDO RI VDOHV WD[ LQFHQWLYHV DW &KDLEDVD 3ODQW in the State of Jharkhand pertaining to the period August 2005 to March 2015.62 Proposed Final Equity Dividend 112.64 5.020.42 crore in 2014. Average rate of return on investment was also lower as compared to the previous year. is recognized in the year ended December 31.45 crore.048.797.18 Transfer to General Reserve 30. Other Income Other income reduced due to lower cash and cash equivalent on account of utilization of funds 30 IRU YDULRXV FDSH[ SURMHFWV DV FRPSDUHG WR WKH previous year.f.e. Total consolidated Revenue from Operations (Net) increased to ` 11.50 4.87 3URoWDYDLODEOHIRU$SSURSULDWLRQV 5. OVERVIEW OF COMPANY’S FINANCIAL PERFORMANCE Consolidated Income Consolidated income.916.175. January 1.WHPV Pursuant to the provisions of Schedule II of the Companies Act.57 1. 2013 (hereinafter referred to as “the Act”) becoming applicable to the Company w.97 119.21 5.72 7D[RQ(TXLW\'LYLGHQGV 64.00 130.16 Interim Equity Dividend 206.456.04 4.72 112.00 4.07 4.456. 587. 2015.433. comprising Revenue from Operations (Net) and other income for the year was ` 11. the Company has reviewed and where necessary. 2015 and has been disclosed as an H[FHSWLRQDOLWHP .18 64.64 Appropriations: 6XUSOXVFDUULHGWRWKHQH[W\HDU VDFFRXQW 2.168.158.634.52 281.738. Finance Costs Finance costs decreased mainly due to reduction in LQWHUHVWRQLQFRPHWD[E\` 12.97 119.320.344.00 30. 1% lower as compared to ` 11. Other Operating Revenue Other operating revenue for the year ended December 31.82 591. 2015 includes ` 139.79 crore in 2014.52 281. revised estimates of the XVHIXOOLIHRIo[HGDVVHWV$FFRUGLQJO\DQDGGLWLRQDO charge of ` 164.94 crore.04 4.65 356.62 206.433.

82 crore in 2014.60 crore as compared to ` 1. 4. coupled with a SURYLVLRQIRUKLJKHUGHSUHFLDWLRQDVH[SODLQHGLQWKH SUHYLRXVSDUDJUDSKOHGWRORZHUSURoWVDQGUHGXFHG Earnings Per Share. In the previous year.119. No disclosure is required under Section 67(3)(c) of WKH $FW LQ UHVSHFW RI YRWLQJ ULJKWV QRW H[HUFLVHG directly by the employees of the Company as the provisions of the said Section are not applicable DIVIDEND A general slowdown in the cement industry impacted the performance of the Company. This. the dividend payout ratio KDVEHHQPDLQWDLQWHGDWSUHYLRXV\HDU VOHYHODW RIWKH3URoW$IWHU7D[ 3$7.Corporate Overview  Financial Highlights Board & Management Reports &RQVROLGDWHG3URoW%HIRUH7D[ &RQVROLGDWHG SURoW EHIRUH WD[ IRU WKH \HDU ZDV ` 765. on completion of assessments DQG UHYLHZ RI FHUWDLQ WD[ SRVLWLRQV DQ DPRXQW RI ` 309 crore had to be written back.53 crore as compared to ` 1. However. 5. Consequently. whereas no such write backs were necessary in 2015. dividend for the year is recommended at a lower rate as compared to the previous year.161.54 crore in 2014.  &RQVROLGDWHG3URoW$IWHU7D[  &RQVROLGDWHG 3URoW DIWHU 7D[ IRU WKH \HDU ZDV ` 587.

606.18 crore in the previous year.per equity share of ` 10 each.97 crore as against `FURUHLQFOXGLQJGLYLGHQGGLVWULEXWLRQWD[RI ` 119.IRUWKH\HDU SHARE CAPITAL The paid up Equity Share Capital as on December 31. The total outgo for the current year amounts to ` 384. 2015 would accordingly be ` 17/. There are no material changes or commitments DIIHFWLQJ WKH oQDQFLDO SRVLWLRQ RI WKH &RPSDQ\ which have occurred between the end of the calendar year and the date of this Report. TRANSFER TO RESERVES The Company proposes to transfer an amount of ` 30 crore to the General Reserves.per equity share of ` 10 each.per equity share of ` 10 each in July 2015. including GLYLGHQGGLVWULEXWLRQWD[RI` 64. As on December 31.95 crore. an additional depreciation charge of ` 181 crore QHWRIWD[. The total dividend for the year ended December 31. none of the Directors of the Company hold shares or convertible instruments of the Company. as stated above.14 crore. under any Scheme. The Company has neither issued shares with differential rights as to dividend. 2015. 2015 was ` 187. voting or otherwise nor issued shares (including sweat equity shares) to the employees or Directors of the Company.per equity share of ` 10 each as compared to ` 34/. An amount of ` 4. Your Directors are pleased to recommend a oQDOGLYLGHQGRI` 6/.50 crore is proposed to be retained in the &RQVROLGDWHG6WDWHPHQWRI3URoWDQG/RVV In the year under review. The Company had distributed an interim dividend of ` 11/.

The Company FRQWLQXHV WR IRFXV RQ MXGLFLRXV PDQDJHPHQW RI LWV working capital./ D UHSXWHG 5DWLQJ $JHQF\ KDV UHDIoUPHG the highest credit rating of CRISIL AAA/ STABLE for ORQJ WHUP DQG &5. 7. 2015 was ` 1. inventories and other working capital parameters were kept under strict check through continuous monitoring.  Financial Statements 6.6./ $ IRU VKRUW WHUP oQDQFLDO instruments of the Company.ZDVPDGHRQDFFRXQWRIFKDQJHLQXVHIXO OLIHRIo[HGDVVHWVLQDFFRUGDQFHZLWKWKHSURYLVLRQV of Schedule II of the Act.81 crore. CREDIT RATING  &5.16 crore were transferred to the Investor Education & Protection Fund after sending due reminders to the shareholders.389 crore. :LWK WKLV FKDQJH WKH FXUUHQW \HDU V GHSUHFLDWLRQ LV also higher by ` 111. 3. Receivables.6. 2007 and the 71st Interim Dividend for the year ended December 31. FINANCIAL LIQUIDITY  7KH &RPSDQ\ V FDVK DQG FDVK HTXLYDOHQW DV DW December 31. Subsidiary Companies During the year. 8. 2008 aggregating `2. DEPOSITS  7KH &RPSDQ\ KDG GLVFRQWLQXHG LWV o[HG GHSRVLW VFKHPH LQ WKH oQDQFLDO \HDU  'HVSLWH sustained efforts to identify and repay unclaimed deposits. the WRWDODPRXQWRIo[HGGHSRVLWVPDWXUHG and remaining unclaimed with the Company as on 31 . the unclaimed dividend pertaining to the 70th Final Dividend for the year ended December 31.

ACC Limited 9. LOANS.02 crore. are given in the notes to the Financial Statements. PDNLQJ LW DPRQJ WKH ZRUOG V IDVWHVW JURZLQJ economies. and the Rules framed thereunder.5% as compared to the previous year 2014. Accounting Standards and as prescribed by Securities DQG ([FKDQJH %RDUG RI .8% as compared to the previous \HDU VUDWHRILQpDWLRQRI7KLVZDVRQDFFRXQWRI a high base rate effect and other factors such as the sharp fall in global oil and commodity prices. PARTICULARS OF INVESTMENTS 7KHUDWHRILQpDWLRQDVSHUWKHZKROHVDOHSULFHLQGH[ maintained its year-long negative trend and showed a declined of (-)2. sluggish domestic demand conditions and some softening of food prices. December 31. 2015 was ` 0. The Company has not accepted deposits from the public falling within the ambit of Section 73 of the Act. the calendar year 2015 is estimated to have risen to 7. GUARANTEES AND Details of Loans. Guarantees and Investments covered under the provisions of Section 186 of the Act. CONSOLIDATED FINANCIAL STATEMENTS  7KH FRQVROLGDWHG oQDQFLDO VWDWHPHQWV RI WKH Company for the calendar year 2015 are prepared in compliance with the applicable provisions of the Act. 10.QGLD 6(%.

2015 (hereinafter referred to as ‘the SEBI 5HJXODWLRQV . XQGHU 6(%. (Listing Obligations and Disclosure Requirements) Regulations.

This would drive overall JURZWKJHQHUDWHLQFRPHVDQGORZHULQpDWLRQUDWH 13. Last year. Government realigned its methodology IRU FRPSLOLQJ WKH FRXQWU\ V *'3 XVLQJ YDOXH DGGHG data that makes it closer to accepted international SUDFWLFH %DVHG RQ WKLV . 12. the slowest rate of growth in a decade.QGLD V QDWLRQDO HFRQRP\ LQ FDOHQGDU \HDU  and beyond shows a strong emerging potential. the Consolidated Financial Statements along with all UHOHYDQWGRFXPHQWVDQGWKH$XGLWRUV 5HSRUWWKHUHRQ form part of this Annual Report. the cement market in the country remained very competitive.5% as compared to ~6% growth in 2014. the outlook IRU . CEMENT INDUSTRY . Pursuant to the provisions of Section 136 of the Act. the slowest in the last decade. However.OUTLOOK AND OPPORTUNITIES The Indian Cement Industry has an installed capacity of ~372 million tonnes per annum while domestic consumption of cement in 2015 was ~271 million tonnes. the Company will continue to have the calendar year (1st January . manufacturing growth in 2015 was strong at ~7.  2IoFLDO HVWLPDWHV IRU *'3 JURZWK H[SHFWHG LQ WKH oVFDO \HDU  LV RI WKH RUGHU RI  Disregarding some sectoral imbalances.acclimited. although there was some loss of steam in certain sectors.QGLD V HFRQRPLF JURZWK LQ 32 Notwithstanding some slackening in the last quarter.QGLDHQMR\HG relative macro economic stability in 2015. ECONOMIC SCENARIO AND OUTLOOK  $VFRPSDUHGWRPDQ\RWKHUFRXQWULHV. the spurt in manufacturing activity did not translate into growth in the construction sector which was lower by ~3. This spurt in manufacturing resulted in higher industrial production and revival in urban consumer demand. CONTINUANCE OF THE EXISTING FINANCIAL YEAR Pursuant to a favourable Order from the Company Law Board. As already indicated.com/newsite/ oQDQFHDQQXDOBUHSRUWBSGI 11. As a result. It is H[SHFWHG WKDW *'3 JURZWK LQ  ZRXOG EH PRUH SRVLWLYHDPLGH[SHFWDWLRQVRIKLJKHULQYHVWPHQWVLQ infrastructure and industry.31st December) as LWV oQDQFLDO \HDU LQ UHVSHFW RI LWVHOI DV ZHOO DV LWV subsidiaries.7% as compared to 2014. cement consumption grew at the rate of ~2% in the calendar year 2015. The Financial Statements as stated above are also available on the website of the Company and can be accessed at the weblink http://www. In WXUQWKHFHPHQWVHFWRUDOVRH[SHULHQFHGGDPSHQHG growth in cement production of ~2% in 2015 as compared to the preceding year. With a second consecutive year of a weak monsoon and unseasonal rains.7KHFRQVROLGDWHGoQDQFLDOVWDWHPHQWV have been prepared on the basis of the audited oQDQFLDOVWDWHPHQWVRIWKH&RPSDQ\LWVVXEVLGLDULHV MRLQWYHQWXUHDQGDVVRFLDWHFRPSDQLHVDVDSSURYHG by their respective Boards of Directors. . agricultural growth and rural demand remained muted in 2015. the Financial Statements of the Company.

the ICI (Infrastructure. promoting the sale of its premium products. railways and PHWURUDLOSURMHFWV Overall cement demand in the calendar year 2016 is estimated to grow at a rate faster than the preceding year.QGXVWULDO. &RPPHUFLDO DQG . CEMENT BUSINESS .PERFORMANCE Financial Statements Subsidiary Companies DuULQJWKH\HDUWKHVDOHVYROXPHRIWKH&RPSDQ\ V premium products increased to 2. While Individual House Builders remained the PDMRU FXVWRPHU VHJPHQW FDWHUHG E\ DQ H[WHQVLYH dealer and retailer network.  <RXU&RPSDQ\ VPDLQIRFXVDUHDVLQFOXGHGPDQDJLQJ costs of distribution and logistics.3 million tonnes in 2015 as compared to 2. Besides this. irrigation schemes.1 million tonnes in 2014. Consumption could pick up well beyond 6% if investments in infrastructure development and DPELWLRXV SURMHFWV VXFK DV k0DNH LQ .Corporate Overview Financial Highlights Board & Management Reports Consistent with the positive outlook for the Indian economy. housing and industrial growth. there are healthy indicators of an uptrend in demand for cement and concrete from SURMHFWV VXFK DV FRQFUHWH URDGV p\RYHUV  EULGJHV power plants. if supported by a faster pace of infrastructure development. Selling prices of cement improved by ~1% in 2015 over 2014.QGLDy 6PDUW &LWLHV 0LVVLRQ $WDO 0LVVLRQ IRU 5HMXYHQDWLRQ  Urban Transformation (AMRUT). enhancing customer VHUYLFHOHYHOVDQGYDULRXVRWKHUFXVWRPHUH[FHOOHQFH initiatives. Demand in the housing sector may be stimulated with a gradual reduction in interest rates. and Housing For All (including low cost housing) are accelerated. we foresee a similar revival in demand for cement and concrete. Signs of increased construction activity have been witnessed in industrial and commercial segments as well as from mass housing and mid-income housing schemes across the country. ports. wider supply of DIIRUGDEOH KRXVLQJ WD[ EHQHoWV DQG DQ LQFUHDVH LQ disposable incomes and household savings. 14.

 WHDP RI WKH &RPSDQ\ V sales division has also been actively servicing the growing requirements from infrastructure. LQGXVWULDO DQG FRPPHUFLDO SURMHFWV :LWK LQFUHDVLQJ urbanization. the Company maintained a close focus on effective cost management through various initiatives. demand from these sectors is also H[SHFWHGWRDFFHOHUDWH 14. D.2 Costs – Cement Business During the year 2015.

13 Operating EBITDA Margin (%) 13.842. Cost of materials consumed was reduced by 7% in 2015 over 2014.82 -1.7% from 13.4%.84 24.92 13.21 million tonnes in 2014.8 Operating EBITDA (` crore) 1.1 Sales Volume & Pricing Cement sales volume in 2015 was 23. despite an additional cost burden of ` 23 crore towards purchase of clinker due to temporary suspension of limestone mining operations at Chaibasa and Bargarh mines during the earlier part of the year.7 14. 33 .60 10.21 -2.4 Net Sale Value (`crore) 10.652.24 -1.88 1.62 million tonnes as compared to 24. a decrease of 2. &RVWRI0DWHULDOVFRQVXPHG 2015 2014 Change % Production .5% in 2014.482.million tonnes 23. The landed cost of gypsum rose by 5% on account of an increase in the price of imported gypsum and also due to a shortage of wagons at Paradip port that necessitated costlier road transportation to some plants.473. Thus. the Company is taking steps to RSWLPL]HLWVJ\SVXPPL[E\UHGXFLQJLWVUHOLDQFH on imported gypsum and instead increasing the consumption of phosphor-gypsum. To mitigate such cost increases.59 0. chemical gypsum. Sales volume was impacted mainly in the Eastern region where production at Chaibasa and Bargarh was constrained on account of temporary suspension of mining operations during the earlier part of the year on account of regulatory changes. activated gypsum and also the more cost effective variety of high purity domestic mineral gypsum. the cost of materials consumed as share of total income from operations came down to 12.7 Sales Volume .million tonnes 23.62 24.

)UHLJKWDQGIRUZDUGLQJH[SHQVHVGXULQJWKH\HDU were ` 2. effected mainly by rail. E.76 crore as compared to ` 2.ACC Limited  7KH ODQGHG FRVW RI pyash increased by 4% as it had to be procured over longer leads.530. following a drop in availability from sources close to our plants. Freight on clinker transfers.640. Efforts were made to achieve cost reductions by entering into long term contracts ZLWKVODJDQGp\DVKVXSSOLHUV6ODJSULFHVZHUH negotiated to achieve a reduction of 27%. up marginally from a share of 23% in the previous year. increased by about 8% due to the rail tariff hikes and the movement of clinker over longer leads to Chaibasa and Bargarh occasioned by the curtailment of clinker production at these SODQWVIRUUHDVRQVH[SODLQHGKHUHWRIRUH)UHLJKW on cement despatches also rose by about 6% on account of the increase in rail tariffs. Freight and IRUZDUGLQJ H[SHQVHV FRQVWLWXWHG D VLJQLoFDQW VKDUH RI  RI WKH &RPSDQ\ V WRWDO LQFRPH from operations.30 crore in 2014. an increase of 4%.

the Company put plans in place to enable increased consumption of petcoke.427. 3RZHU )XHO Power & Fuel costs were reduced by 2% in 2015 as compared to 2014. proactive efforts were made to bring down the cost of road transportation which accounts for about 56% of total despatches. The Company is taking further steps to rationalize freight and C&F rates and pursue improvements in other operational levers such as lead distances and the share of direct despatches. The Company continues to focus on reducing the overall cost of fuel as well as shifting its dependence on linkage and imported coal by RSWLPL]LQJ WKH IXHO PL[ WR HQKDQFH WKH XVH RI alternative fuels and petcoke. The Power & Fuel spend in 2015 was ` 2. The supply of petcoke became attractive following a general decline in global oil prices. as compared to ` 2.45 crore spent in 2014. the same as in the previous year. G. During the year. Taking advantage of the decline in diesel prices. this enabled petcoke consumption to rise from average consumption of 16% in 2014 to 27% during the last quarter of 2015.377. Average road freight rates were cut by 6%. Taking advantage. This constituted 22% of the total income from operations.85 crore.

mainly due to increase in rail freight on coal and electricity duty on generation of power.5% in 2015 from 6. In the forthcoming year.8% in 2014.67 per unit against ` 4. As a result of various initiatives taken with UHVSHFWWRSRZHU IXHONLOQWKHUPDOHIoFLHQF\ was maintained at 3050 MJ/per tonne of clinker.59 per unit in 2014. as H[SODLQHG ODWHU DUH H[SHFWHG WR UHpHFW IXUWKHU improvement in employee costs. certain initiatives taken as part of the India Manufacturing Transformation programme. as a share of total income from operations.  F. declined to 6. the same level as in the last year.7% on a like-for-like basis. (PSOR\HH&RVWV Employee costs during the year were brought down by 2. Overall employee costs. The generation cost per KW of our Captive Power Plants (CPP) in 2015 rose by 2% to ` 4.

particularly because 44% of total cement despatches during the year were moved by rail. thus also helping reduce overall power and fuel costs.5 MW at Gagal Plant delivered saving of ` 22 crore during the year. 34 H. )UHLJKW )RUZDUGLQJH[SHQVHV A general hike in rail tariffs impacted the cost of inward and outbound transportation in 2015. 3RZHU JHQHUDWHG E\ WKH &RPSDQ\ V ZDVWH heat recovery plant of 7.

2015 for contributions to be made to the District Mineral Foundation (DMF) DQG 1DWLRQDO 0LQHUDO ([SORUDWLRQ 7UXVW 10(7. This includes (i) provision for additional royalty on limestone of ` 52 crore necessitated by the Mines and Minerals (Development and Regulation) Amendment Act. 2WKHU([SHQGLWXUH  2WKHU H[SHQGLWXUH FRQVWLWXWHV a RI WRWDO income from operations of the Company (as compared to 22% in 2014).

 in the districts where mining takes place. .

('&21&5(7( 50..   5($'<0. the concrete industry at large continues to face issues of tight liquidity and increased participation by unorganized local players.Corporate Overview Financial Highlights Board & Management Reports While there was some uptake in a few markets.

12 59. 35 .50 760.8 23. Packing material cost reduced by ` 79 crore on account of a fall in the prices of polypropylene granules and other initiatives like standardization of bags across plants. an increase of 59%. the number of RMX plants rose to 50 by the close of 2015 as compared to 48 plants in 2014.15 2014 Change % 17. Bicharpur.10 million tonnes at Jamul and 1.2 54.61 4. The auction/allocation process of other three Coal Blocks viz.1 5. RMX Production Lakh Cubic Metres RMX Sales Volume Lakh Cubic Metres Net Sale Value (` crore) Operating EBITDA (` crore) Operating EBITDA Margin (%) 2015 22.  $ ODUJH VKDUH RI WKH &RPSDQ\ V FRQFUHWH EXVLQHVV FRPHVIURP.79 million tonnes per annum at Jamul and grinding facilities of capacity 1. Despite these increases. The Company had entered into through its wholly owned subsidiary company ACC Mineral Resources Limited (AMRL).77 27. 16.QGXVWULDOSURMHFWVLQ addition to mass housing schemes.4% in 2015 over 2014. 17. Consistent growth is foreseen in housing. As part of its endeavour to enrich customer service OHYHOV WKH &RPSDQ\ V FRQFUHWH EXVLQHVV LQWURGXFHG Subsidiary Companies an on-line Customer Feedback system which has resulted in improved customer satisfaction and better customer retention. EBITDA from RMX business for the year rose to ` 54 crore as compared to ` 34 crore in 2014. Infrastructure. despite an intensely competitive environment. Financial Statements 7KH FRQVWUXFWLRQ VHFWRU LV H[SHFWHG WR JURZ DW D steady pace in 2016. a Joint Venture Agreement with MPSMC. The Ministry of Coal. Your Company has a wide spread of RMX plants in the country. Marki Barka. Morga IV and Semaria Piparia are yet to be carried out by the Ministry of Coal.48 The RHDG\ 0L[HG &RQFUHWH %XVLQHVV RI WKH Company performed well.35 million tonnes at Sindri. COAL BLOCKS Pursuant to Orders of the Supreme Court passed in August 2014 and September 2014. this business has implemented a programme of widening its customer base. CAPEX  7KHRQJRLQJLQWHJUDWHG-DPXO3URMHFWLQ&KKDWWLVJDUK which partly comprises a new clinkering line of capacity 2. the allocations of four coal blocks to Madhya Pradesh State Mining Corporation Limited (MPSMC) were cancelled. This programme has yielded increased sales volumes and margins.29 34. Concrete Sales Volume increased by 28% and Operating EBITDA grew at a much higher rate on account of volume growth and new value added products and solutions.34 27.44 18.61 25. Semaria Piparia and Morga IV (all in the State of Madhya Pradesh) all of which stood cancelled. the overall HVFDODWLRQLQk2WKHU([SHQGLWXUHyZDVUHVWULFWHG to 1. broadening its portfolio with a range of value-added products and customized solutions while simultaneously keeping a close focus on costs. is nearing FRPSOHWLRQDQGH[SHFWHGWREHFRPPLVVLRQHGGXULQJ the second quarter of 2016. Government of India completed the auction of Bicharpur Coal Block in February 2015 and the block was allotted to the successful ELGGHU 7KH UHLPEXUVHPHQW RI H[SHQVHV LQFXUUHG on development of coal blocks is awaited. In the last two years. especially of large customers ZLWKJRRGoQDQFLDOFUHGHQWLDOV (ii) increase in royalty rate from ` 63 to ` 80 per tonne of limestone mined effective September 2014 impacting an additional cost incidence of ` 24 crore and (iii) severance cost of ` 13 crore on account of rationalization of third party manpower.QIUDVWUXFWXUHDQG. Government of India. for development of these four coal blocks viz.8 967. Marki Barka. commercial and Industrial SURMHFWVLQDGGLWLRQWRWKHUDSLGXUEDQL]DWLRQWDNLQJ SODFH LQ WKH FRXQWU\ $FFRUGLQJO\ WKH &RPSDQ\ V &RQFUHWH %XVLQHVV SODQV WR H[WHQG LWV UHDFK WR address segments where the markets are promising.

Your Company was felicitated with the prestigious CII-ITC Sustainability Award 2015 for “Outstanding Accomplishment” in recognition of its continuous effort and commitment to the cause of Sustainable Development and its improvement in all VXVWDLQDELOLW\SDUDPHWHUV7KLVLVRQHRIWKH&RXQWU\ V PRVW FRYHWHG DZDUGV LQ WKH oHOG RI FRUSRUDWH sustainable development.1 CO2 Emissions: Your Company is committed to cut its carbon footprint in line with the Low Carbon Technology Roadmap for the Indian Cement Industry of the Cement Sustainability Initiative (CSI).  36 7KH&RPSDQ\KDVEHHQLGHQWLoHGDVRQHRIWKH leading business houses in India. However. SUSTAINABLE DEVELOPMENT  7KH &RPSDQ\ V 6XVWDLQDEOH 'HYHORSPHQW programme is comprehensive and robust. there was a small increase of 1% in these emissions as compared to the previous year. organised by the United Nations Conference on Climate Change. which was due to some change in the pattern of cement production caused by the suspension of limestone mining at Chaibasa and Bargarh for part of the year.2014 adhering to GRI G4 principles in accordance with comprehensive reporting. which it has disclosed through the Carbon Disclosure 3URMHFW &'3.acclimited. The Company maintained its best-in-class position in terms of its carbon footprint with VSHFLoF &22 emissions per tonne of cement at 533 kg CO2 / tonne in 2015. 18. During the year. for the quality of climate change related information. 6LJQLoFDQW DGYDQFHPHQWV ZHUH PDGH DJDLQVW targets set in its sustainable development roadmap for 2014-2017. the Company released its 8th Sustainable Development Report .ACC Limited 18.com. The Report is available RQ WKH &RPSDQ\ V ZHEVLWH www. The brand “ACC” was one of those prominently displayed in the India Pavilion at the COP 21 (Conference of Parties) meet held in Paris in December 2015.

Despite this and the increasing demand for Ordinary Portland Cement (OPC).3$OWHUQDWLYH)XHOVDQG5HVRXUFHV $)5. the share of Blended Cements in the total product portfolio was maintained at 84. 18.QGXVWU\LQWKLV UHVSHFW6RPHVKRUWIDOOLQWKHDYDLODELOLW\RIp\DVK from regular sources nearer the plants did have a VPDOOLPSDFWLQWKHVXSSO\RIp\DVKDQGKHQFHRQ the clinker factor which showed a minor change of 1%. The reported data was independently assessed DJDLQVW &'3 V VFRULQJ PHWKRGRORJ\ DQG \RXU Company is one of the few organizations that received a high score of 98 points out of 100 in respect of its disclosure. 18.2 Clinker Factor Reducing the clinker factor in cement is an important pillar of the Low Carbon Technology Roadmap for the Indian Cement Industry.5%. D QRQSURoW JOREDO LQLWLDWLYH that shares information to help drive carbon reduction strategies for sustainable economies. Your Company strives to achieve this through the promotion of blended cements using slag and p\DVKDQGSOD\VDOHDGUROHLQWKH.

4*UHHQ(QHUJ\ D. Your Company takes pride in being one of the few in the forefront of the national effort to promote co-processing of both hazardous and non-hazardous industrial and municipal wastes in cement kilns in order to reduce dependence on fossil fuel. The Company has two state-of-the-art preprocessing facilities at Wadi and at Kymore to enable safe handling of varied types and volumes of waste streams. 18. These facilities added momentum to co-processing of hazardous ZDVWHV LQ D VDIHU DQG PRUH HIoFLHQW PDQQHU With the stabilization of these pre-processing IDFLOLWLHVZHH[SHFWWRHQKDQFHERWKWKHTXDOLW\ and quantity of waste feed processed in cement kilns and thus increase the thermal substitution rate in the forthcoming year.

0:LQ5DMDVWKDQDQG0:LQ Maharashtra. :LQG(QHUJ\ The Company has 19 MW capacity from wind farms in three states viz. These wind farms helped the Company meet its non-solar renewable purchase obligations for Madukkarai. . 9 MW in Tamil Nadu.

6% with respect to the previous year. Lakheri.Corporate Overview Financial Highlights Board & Management Reports Financial Statements community areas and sustained water harvesting measures undertaken over the years has helped Kymore and Jamul Plants become self-reliant without being dependent on natural water sources like rivers and bore wells. Various options are being evaluated to enhance the renewable energy portfolio such as setting up new assets of renewable energy and by use of renewable energy through the Power Purchase Agreement route. Thane Campus and the Kalamboli Bulk Cement Terminal Plant. E. During the year 2015. These two approaches have helped \RXU &RPSDQ\ UHGXFH LWV VSHFLoF ZDWHU consumption per tonne of cement by 7.5 million Kwh in 2014. 29.2 million kilowatt hours (Kwh) of renewable energy was produced as compared to 32.

 :DVWH+HDW3RZHUJHQHUDWLRQIURPSURFHVV
ZDVWHKHDW

18.7%LRGLYHUVLW\
Your Company is committed to the conservation
of biodiversity and mine rehabilitation. Efforts
on biodiversity conservation are focused on
following areas:

During the year 2015, the Waste Heat
Recovery System (WHRS) at Gagal Cement
Plant produced 51.8 million Kwh of electrical
energy as compared to 46.6 million Kwh
in 2014.

(i)

18.5 Controlling Emissions
Various measures were implemented across all
operations of the Company to control fugitive
HPLVVLRQVE\LQVWDOOLQJGXVWH[WUDFWLRQDQGGXVW
suppression systems.
Kiln stack dust emissions data and ambient air
quality data are uploaded on Central Pollution
Control Board (CPCB) website and those of
the respective State Pollution Control Boards
wherever available. The installation of dust
monitors as per the statutory requirement was
completed at various plants. The Company
also installed Continuous Ambient Air Quality
Monitoring stations (CAAQMS) at Wadi and
Chanda plants.

:LWKDQREMHFWLYHWRFRQWLQXRXVO\LPSURYHZDWHU
performance and to achieve a water positive
status, the Company has focused its efforts on
two approaches:
(i)

Reduction of fresh water intake by lowering
water demand in process and non-process
areas and waste water recycling after
treatment. Water metering and monitoring
systems were installed at various plants.

(ii) Conservation of water by rain water
harvesting in plants, mines, colonies,

To study and assess the biodiversity around
the limestone mines operated by the
Company. During the year, biodiversity
assessment studies were conducted by an
LQGHSHQGHQWWKLUGSDUW\DWoYHPLQHV

(ii) On-ground implementation of activities
which conserves biodiversity:
(iii) Afforestation activities in and around our
plant premises with native species of trees
at all our plants.
(iv) Water harvesting in mined out pits. This is a
regular practice at the plants. 
&25325$7(
INITIATIVES

62&,$/

5(63216,%,/,7<

&65

 

7RWDO &65 H[SHQGLWXUH LQFXUUHG E\ \RXU &RPSDQ\
during the year was ` 31.16 crore which was higher
than the statutory requirement of 2% of the average
SURoWRIWKHODVWWKUHH\HDUV 

7KH &65 3URMHFWV RI WKH &RPSDQ\ PDLQO\ IRFXV RQ
Livelihood, Education, Water, Health and Sanitation.
7KHVHSURMHFWVIDOOXQGHU6FKHGXOH9,,RIWKH$FW 

7KH &RPSDQ\
V FRPPXQLW\ GHYHORSPHQW HIIRUWV
reached out to more than 4 lakh people residing in
~156 villages across the country.

18.6:DWHU3HUIRUPDQFH 

Subsidiary Companies

Education initiatives in the vicinity of plants addressed
35,000 students during the year. Scholarships were
awarded to ~400 meritorious students belonging
to weaker sections of society. Modern methods of
37

ACC Limited

learning such as smart classes and interactive kiosks
EHQHoWWHGVWXGHQWVLQaUXUDOVFKRROV(IIRUWVZHUH
made to provide education to ~1,500 girl children as
SDUW RI WKH k$&& NL /DGOLy 3URMHFW :H FRQWLQXHG WR
support seven government-run Industrial Training
Institutes as part of the Public Private Partnership
Scheme with Ministry of Labour and Employment,
Government of India.
About 1,800 unemployed youth attended skill
GHYHORSPHQWWUDLQLQJSURJUDPPHVDQGUHFHLYHGMRE
placements in various manufacturing and service
sector enterprises. Support was provided for the
establishment of ~200 new Self Help Groups (SHGs)
ZKLOH H[LVWLQJ 6+*V ZHUH DVVLVWHG LQ REWDLQLQJ
UHJLVWUDWLRQ DQG IRUPDWLRQ RI D k)DUPHUV 
3URGXFHU
Companies”.   

2XU KHDOWK DQG QXWULWLRQ LQLWLDWLYHV EHQHoWWHG WR
~58,000 people. About 8,000 children received access
to better health and nutrition through support
SURYLGHG WR  DQJDQZDGL FHQWUHV 2XU H[LVWLQJ
Anti Retroviral Treatment (ART) Centres provided
valuable support to nearly 5,400 persons through
counseling, testing and treatment for HIV/AIDS.
<RXU&RPSDQ\
V&65)RRWSULQWKDVEHHQGXO\DXGLWHG
E\ D WHDP RI VRFLDO DXGLWRUV FKDLUHG E\ ([HFXWLYH
Director, Global Compact Network of India. Your
&RPSDQ\
V &65 HIIRUW KDV EHHQ UDQNHG WZHOIWK
DPRQJWKHWRSOLVWHGFRPSDQLHVDQGoUVWDPRQJ
the Cement Sector companies therein as per the
annual CSR ranking initiative by Economic Times and
Indian Institute of Management, Udaipur.
7KH &RPSDQ\
V &65 3ROLF\ KDV EHHQ UHVWDWHG
making it more comprehensive and in alignment
with the requirements of the Act, and United
1DWLRQ
V 6XVWDLQDEOH 'HYHORSPHQW *RDOV 6'*V


The CSR Policy Statement and Report on the activities
XQGHUWDNHQGXULQJWKH\HDULVDQQH[HGWRWKH%RDUG
V
5HSRUWLQ$QQH[XUHC$  

+($/7+ 6$)(7< + 6

20.1+ 63ROLF\DQG5XOHV
Health and Safety (H&S) of employees and all
stakeholders is an overarching value of your
&RPSDQ\ 'XULQJ WKH \HDU WKH &RPSDQ\
V
H&S Policy and H&S Rules were restated to
be in alignment with the new Group global
vision on H&S. The revised policy reiterates the
SOHGJH WR FRQGXFW WKH &RPSDQ\
V EXVLQHVV LQ
38

a manner that helps create a healthy and safe
environment for all stakeholders (employees,
contractors, communities and customers)
based on the adoption of a true safety culture.
It further directs that H&S be embedded in
everything the Company does when it comes
to its people, its processes, its customers, in
delivering results and in leading sustainability.
7KH + 6 UXOHV UHGHoQH HVVHQWLDO EHKDYLRXU
necessary to ensure safety. Identifying H&S not
as a separate activity but as a critical success
factor for operational performance, the policy
places personal responsibility on every individual
employee at all levels for ensuring safe working
conditions in their respective work areas coupled
with a fair and transparent consequence
management process, in the event of negligence
or wilful disregard for safety rules. The policy
and rules were widely communicated across
the organization to employees and contractor
workmen.
20.2 H&S Initiatives
The thrust on “Surakhsha Samvad” and Zone
Improvement initiatives that were launched in
the preceding year in the plants was maintained.
A new strategy was adopted to provide impetus
to implementation of Fatality Prevention
Elements (FPE) and requirements of Contractor
Safety Management (CSM) directives, thereby
creating an environment which strives to
ensure “Zero harm to people”. Nine facilitators
were nominated from Corporate and Regional
H&S teams to support plants in implementing
the directive requirements with each facilitator
assigned to work in these areas with two
Cement Plants and the nearest RMX plant/s
and thus help raise the implementation level of
CSM and FPE requirements. The progress was
closely monitored by top management with the
facilitator team to review activities, sharing of
learning and resolving bottlenecks.
H&S business processes and information systems
across the Company were further strengthened
with the launch of an online H&S application
called “Click2Safety”. This application helps
streamline reporting in a manner that gives

Corporate Overview

Financial Highlights

Board & Management Reports

access to all employees, is standardized, is faster
and enriches the H&S database.
As part of the UN Global Road Safety Week in
0D\  \RXU &RPSDQ\ H[WHQGHG
wholehearted support to the “SaveKidsLives”
campaign to demonstrate a serious commitment
to road safety for children and to enhance
general road safety awareness. The campaign
was planned and implemented as a highinvolvement campaign across the organization.
In the course of this campaign, all units engaged
with their key stakeholders comprising children
of employees and the community, parents,
schools, teachers, guardians, drivers and the
general public. This campaign engaged over
32,000 people around our units, making it among
the largest Employee Volunteering programmes.
Considering road safety to be an essential part
RIWKH&RPSDQ\
VORJLVWLFVH[FHOOHQFHREMHFWLYH
\RXU &RPSDQ\ DOVR GHFLGHG WR H[WHQG WKLV WR
make it an ongoing three-year commitment to
URDGVDIHW\WREHLPSOHPHQWHGDVD&65SURMHFW
20.3/RJLVWLFV6DIHW\  

/RJLVWLFVVDIHW\LVRQHRIWKHPDMRUIRFXVDUHDVIRU
your Company. Ongoing initiatives undertaken
in this regard included provisions of various
plant and parking level protocols, creation of
certain hygiene factors for truck drivers and
their crew such as amenities at truck parking
yards, improving tarpaulin tying practices,
improving Personal Protective Equipment usage,
renewal of logistics contracts to include safety
parameters and issue of “passports” for drivers
as well as vehicles which are informal internal
databases that provide details of individual
identity, registration, roadworthiness and safety
preparedness.
<RXU&RPSDQ\IRFXVHGRQVL[SURMHFWVSHUWDLQLQJ
to the Indian logistics scenario which consisted of
Driver Management Centre (DMC), Community
road safety education with the help of CSR, use
of technology (GPS & RFID) in logistics safety,
engagement of drivers and transporters and
reduced dependence on market trucks.
Another focus area was inclusion of safety
awareness in warehouses. This involved display

Financial Statements

Subsidiary Companies

of standardized safety posters and observation
of safety day/month at each warehouse with a
o[HGVDIHW\WRSLFEHLQJGLVFXVVHG
20.4 Health Initiatives
In the area of health, your Company worked
to raise EMR (Emergency Medical Response)
capabilities in mines and in Captive Power
Plants (CPP) during the year. Each Cement
Manufacturing Unit is now equipped with
basic life-saving equipment in the health
FHQWUH ZHOOHTXLSSHG oUVW DLG URRP LQ PLQHV
and CPP. Each site has an Advanced Life
Support (ALS) ambulance with stretchers and
$('V $XWRPDWHG ([WHUQDO 'HoEULOODWRU

HUMAN RESOURCES The Company adopted a new functional organization structure with effect from April 1. your Company tied up with $LU DPEXODQFH VHUYLFHV WR H[SHGLWH HYDFXDWLRQ in the event of medical emergencies at remote plant locations. This will go a long way in ensuring timely medical care to the employees when needed. The new structure is intended to enable the organization to be more collaborative. During the year. This structured approach is yielding results and we estimate it to have helped reduce the health risk factor among employees by 2%. other employees and their families. 7KHVWUDWHJ\LQFOXGHVXVHRI&RPSDQ\ VLQWHUQDO electronic portal for health sensitization programme and nomination of “Health Peers” from among Shop Floor Associates (SFA) cadre to spread health awareness among their colleagues. 39 . To reduce health risk factors among employees and their families a well-structured approach has been started which involves all stakeholders. thus creating a companywide pool of 3. agile and streamlined in implementing strategy.500 trained shift supervisors. <RXU Company has trained all the shift supervisors at each plant in basic life support techniques. 2015. replacing the earlier regional-based structure in a smooth swift transition. 21. harnessing LQWHUQDO IXQFWLRQDO H[SHUWLVH WR WKH IXOOHVW DQG LQ enhancing stakeholder value.

capability building and its development programmes IRU VKRS pRRU DVVRFLDWHV (IIRUWV FRQWLQXHG WR EH taken to develop leadership lines as well as to enhance technical and functional capabilities with special focus on nurturing young talent. 7KH&RPSDQ\ V+5IXQFWLRQLVUHFRJQL]HGLQWKHVHFWRU for its engagement and leadership development processes in nurturing talent necessary to keep WKH RUJDQL]DWLRQ V WDOHQW SRRO IXWXUH UHDG\ 7KH Company continued with efforts to ensure that its pool of human resources is “future ready” through its robust processes of learning & development. the Company participated in a Global Employee Engagement Survey conducted by the Group.07.ACC Limited (PSOR\HH5HODWLRQV   A new HR policy was introduced from January 1. . your Company has established vocational guidance centres manned by full-time trainers to provide skill training useful in securing alternative re-employment and in setting-up micro enterprises and cottage industries. In 2015.6% in productivity.W ZDV LQWHQGHG DV D SDUW RI WKH &RPSDQ\ V FRQWLQXRXV efforts to offer one of the “Best Places to Work” in the cement industry. A detailed need assessment was conducted to understand the potential employment opportunity in nearby areas alongside a demographic survey of  HPSOR\HHV  IDPLO\ PHPEHUV WR XQGHUVWDQG their learning and employability potential. people processes.5% in the deployment of human resources in all categories and enhancement of 11. whilst at the same time resulted in a reduction of 12. Designed by Aon Hewitt. The high satisfaction score suggests that a predominant VKDUHRIHPSOR\HHVZHUHVDWLVoHGZLWKYDULRXVZRUN related initiatives. 2015 which described employee compensation. training and learning opportunities. in order to PHHW IXWXUH FKDOOHQJHV 7KH &RPSDQ\ V /HDUQLQJ Academy at Thane received the Golden Peacock National Training Award of the Institute of Directors. SHUTXLVLWHV DOORZDQFHV DQG RWKHU EHQHoWV .QGLD0DQXIDFWXULQJ7UDQVIRUPDWLRQ . Recognizing the need to rehabilitate those employees (permanent as well as on contract) who are affected by the IMT programme. Maintaining the trend seen in WKH ()5 H[HUFLVH WKLV VXUYH\ DOVR VDZ SDUWLFLSDWLRQ of a very high order at 96%. more meaningfully the results showed an employee satisfaction of 86%. The IMT initiative has brought about visible signs of improvement in on-site safety performance and work culture. The new policy was designed to DWWUDFWQHZWDOHQWDQGPRWLYDWHH[LVWLQJHPSOR\HHV to contribute to their peak performance levels. this was felt to be more insightful than the “Engaging For Results” (EFR) Survey of employee feedback that was conducted annually since 2007.

6H[XDO+DUDVVPHQWRI:RPHQDW:RUNSODFH The Company is an equal opportunity employer and consciously strives to build a work culture that promotes dignity of all employees. A PDMRU DFKLHYHPHQW LQ WKLV DUHD ZDV WKH VXFFHVVIXO conclusion of a common long term wage settlement between the Company and trade unions at all plants that takes effect retrospectively from April 2014 and will be in force till March 2018. improved productivity standards. improvement in housekeeping. a new incentive scheme to encourage clinker despatches. The IMT programme aims to make the work-culture in the core areas of production and maintenance in the cement plants more contemporary. This envisages a lean manufacturing organization design ZLWKPXOWLWDVNLQJVWDQGDUGL]DWLRQDQGVLPSOLoFDWLRQ of manufacturing processes. This has helped to build a healthy relationship and resolve issues through mutual dialogue. Industrial Relations Employee Relations at all the Units remained cordial. elimination of waste and effective XWLOL]DWLRQ RI WLPH 7KH VHWWOHPHQW LV H[SHFWHG to contribute towards enhancing productivity at WKH SODQWV EHVLGHV HQMRLQLQJ HPSOR\HHV DQG VKRSpRRU DVVRFLDWHV Dt plants to adapt to a richer work culture. This accord incorporates novel elements such as a productivity enhancement scheme. As required under WKHSURYLVLRQVRIWKH6H[XDO+DUDVVPHQWRI:RPHQ at Workplace (Prevention. Prohibition and Redressal) . These initiatives will enable 40 WKH FHPHQW SODQWV RSHUDWH PRUH HIoFLHQWO\ LQ a competitive environment and render them compatible with global manufacturing standards. introduction of a centralized maintenance design with better planning and benchmarking with the best-in-class.

particularly ZLWK UHVSHFW WR SUHYHQWLRQ RI VH[XDO KDUDVVPHQW Some employees were sent to attend training SURJUDPPHVFRQGXFWHGE\DQH[WHUQDODJHQF\ The Company has implemented a Business Risk Management Policy which lays down the framework to identify business risks at both Corporate level and at Business Segment level. temporary or contractual including those of service providers are covered under the policy.  In future. 41 . This will give the incumbent lease holder an opportunity to obtain the same lease at the highest bid. 22. the period of lease ZLOOEHoIW\\HDUVIURPWKHGDWHRIJUDQW Awareness programmes were conducted across the Company to sensitize the employees to uphold the dignity of their colleagues at workplace. There were no complaints pending for more than 90 days. IRUFDSWLYHXVHDUHH[WHQGHGXSWRDSHULRGHQGLQJRQ March 31. Under the new Mines and Minerals (Development and Regulation) Amendment Act. thereby enhancing the &RPSDQ\ V FRPSHWLWLYH DGYDQWDJH 6HSDUDWH approaches DUHGHoQHGIRUHDFKRIWKHPDLQEXVLQHVV segments of cement and RMX and forms an integral SDUWRIWKH&RPSDQ\ V0LG7HUP3ODQQLQJF\FOH 5DZ0DWHULDOV5LVNV Limestone is the principal raw material for Portland Cement. However. Simultaneously. Subsidiary Companies The Company is faced with various risks at an operational level which very often have the potential to offer business opportunities. 2030. the Company has implemented a policy on prevention. BUSINESS RISKS & OPPORTUNITIES  7KH&RPSDQ\ VDSSURDFKWRDGGUHVVLQJEXVLQHVVULVNV is comprehensive and enables timely anticipation RI ULVNV DQG LGHQWLoFDWLRQ RI RSSRUWXQLWLHV HQDEOLQJ appropriate responses. under the MMDR WKHH[LVWLQJOHDVHKROGHUZKRVHWHUPRIOHDVH KDVH[SLUHGZLOOJHWWKHULJKWRIoUVWUHIXVDODWWKHWLPH of auction of the said mining lease. broaden its product portfolio and service offerings while leveraging on its ICI (Infrastructure. The Company is also closely monitoring its costs so as to be more competitive in the marketplace. in each of the units there is one nodal person WR UHFHLYH DQG IRUZDUG FRPSODLQWV WR WKH koUVW instance person (FIP) who is a woman” or directly to the Committee. leases granted before the commencement of the Act. its terms of reference and functioning are set out in the Corporate Governance Report.QGXVWU\ LV SUHVHQWO\ IDFLQJ intense competition with the entry of new players and VRPHH[LVWLQJPDQXIDFWXUHUVJURZLQJLQRUJDQLFDOO\ :H H[SHFW WKLV VLWXDWLRQ WR FRQWLQXH 7R PLWLJDWH WKLVULVNWKH&RPSDQ\LVOHYHUDJLQJRQLWVH[SHUWLVH H[SHULHQFH DQG WKH DGGLWLRQDO  FDSDFLWLHV DW -DPXO DQG6LQGULZKLFKDUHH[SHFWHGWREHFRPPLVVLRQHGLQ Q2 2016. chaired by an Independent Director.Corporate Overview Financial Highlights Board & Management Reports Act. The Committee met twice during the year. This will enable the Company to maintain its market share particularly in the Eastern Region. is functioning as required under SEBI Regulations. 2013 and Rules framed thereunder. For new leases. The Business Risk Management Committee. visibility and comparative advantage. An Internal Complaints &RPPLWWHH FRPSULVLQJ oYH PDQDJHPHQW VWDII has been set up which includes three women to UHGUHVV FRPSODLQWV UHODWLQJ WR VH[XDO KDUDVVPHQW Besides. Financial Statements Competition Risks  7KH FRXQWU\ V &HPHQW . the Company is implementing measures to enhance its brand equity. Details of this Committee. All women. which is likely be at an increased cost. Some of the main risks are discussed herein: During the year. 2015. prohibition DQGUHGUHVVDORIVH[XDOKDUDVVPHQWDWWKHZRUNSODFH ZKLFK KDV EHHQ XSORDGHG RQ WKH &RPSDQ\ V intranet portal. the Company is increasing the consumption of petcoke and additives which enables it to use low grade limestone and thus achieve mineral conservation while increasing the life of the plant. in cases where the mineral is used for captive purposes. the Company received one complaint RQ VH[XDO KDUDVVPHQW 7KH FRPSODLQW KDV EHHQ investigated and appropriate action has been taken. Commercial and Institutional) Sales team to offer value to large customers. permanent. all Mining leases will be granted by a process of auction/bidding. or till the completion of their renewal SHULRG  ZKLFKHYHU LV ODWHU 0RVW RI WKH &RPSDQ\ V OLPHVWRQHOHDVHVWKHUHE\JHWDQH[WHQVLRQXSWR by virtue of this Act. To mitigate this risk.

21$33(//$7(75. HQHUJ\HIoFLHQF\DQGFRQVHUYDWLRQORJLVWLFVSURGXFW development and market segmentation based on research. These include possibilities in the areas of the availability and sourcing of raw materials. Safety on National roads is largely dependent on various factors such as the overall condition and maintenance of roads.7. vehicle inspection for road-worthiness and the use of Global Positioning Systems (GPS) to monitor outbound movement of cement to the end user. These include programmes on Behaviour Based Safety Training and Visible Safety Leadership. Health and Safety competencies are integrated into WKH MRE GHVFULSWLRQV RI DOO 0DQDJHPHQW 6WDII VXFK that accountability is further strengthened. the Company has taken several initiatives including regular simulator-based driver training. Opportunities  <RXU &RPSDQ\ DOVR UHJXODUO\ H[DPLQHV SRWHQWLDO opportunities created from situations involving business risks.  &203(7. vehicle road-worthiness DQGJHQHUDOREVHUYDQFHRIURDGWUDIoFODZV$VSDUW of its Logistics Safety function and Indian Road Safety Programme.%81$/ &203$7. Various safety assessments and training programmes are regularly conducted to reinforce the concept of “Safety as a Value” and to nurture a proactive safety culture. imbibing best practices in manufacturing and other areas leading to productivity improvement.ACC Limited 3URDFWLYH6DIHW\&XOWXUH  <RXU &RPSDQ\ KDV LGHQWLoHG +HDOWK  6DIHW\ RI employees and workmen as one of its key focus areas.

The Company has an in-house Internal Audit (IA) function. The scope and authority of the . the IA function reports to the Chairman of the Audit Committee of the Board.59 crore.$33($/ In December 2015. The said CCI order of June 2012 was LQ UHVSRQVH WR D FRPSODLQW oOHG E\ WKH %XLOGHUV Association of India against leading cement companies (including ACC) alleging violations of certain sections of the Competition Act. . COMPAT had granted an interim 42 stay while directing the Company and others to deposit 10% of the penalty which was placed as a )L[HG 'HSRVLW ZLWK D EDQN ZLWK WKH &RPPLVVLRQ having a lien thereon. 7KH .2 Internal Controls Over Financial Reporting The Company has in place adequate internal oQDQFLDO FRQWUROV FRPPHQVXUDWH ZLWK WKH VL]H VFDOH DQG FRPSOH[LW\ RI LWV RSHUDWLRQV 'XULQJ the year. 37 in the Notes to the Financial Statements. Based on the report of IA function. The CCI order had levied a penalty on cement companies. process owners undertake corrective action in their respective areas and thereby VWUHQJWKHQ WKH FRQWUROV 6LJQLoFDQW DXGLW observations and corrective actions thereon are presented to the Audit Committee of the Board. The Company has policies and procedures in place for ensuring SURSHU DQG HIoFLHQW FRQGXFW RI LWV EXVLQHVV the safeguarding of its assets. 24. the accuracy and completeness of the accounting records DQG WKH WLPHO\ SUHSDUDWLRQ RI UHOLDEOH oQDQFLDO information. its compliance with operating systems and policies of the Company and accounting procedures at all locations of the Company. Responding to appeals against payment of this penalty. the Competition Appellate Tribunal (COMPAT) set aside an Order passed by the Competition Commission of India (CCI) in June 2012 and remanded the matter to the Commission IRU IUHVK DGMXGLFDWLRQ ZLWKLQ D WLPHOLQH RI WKUHH months. The deposit amount has since EHHQUHIXQGHGWRWKH&RPSDQ\0HPEHUV DWWHQWLRQ is invited to Note No. INTERNAL CONTROL SYSTEMS 24. the prevention and detection of frauds and errors.$ 'HSDUWPHQW HYDOXDWHV WKH HIoFDF\ and adequacy of internal control system.1.QWHUQDO$XGLWIXQFWLRQLVGHoQHGLQWKH.147. 24.QWHUQDO $XGLW &KDUWHU 7R PDLQWDLQ LWV REMHFWLYLW\ DQG independence. 2002. which for the Company was of ` 1.QWHUQDO&RQWURO6\VWHPVDQGWKHLUDGHTXDF\  7KH &RPSDQ\ KDV LQ SODFH ZHOO GHoQHG DQG adequate internal controls commensurate with the size of the Company and the same were operating effectively throughout the year. such controls were tested and no reportable material weakness in the design or operations were observed.

$1 $&&2817. These are in accordance with generally accepted accounting principles in India. Changes in policies. SUBSIDIARIES. accounting hygiene and accuracy of provisions and other estimates.1'. achieving a high OHYHO RI HQJDJHPHQW DQG FRPSOLDQFH 7KLV UHpHFWV \RXU &RPSDQ\ V VWURQJ FRPPLWPHQW WR k=HUR tolerance” for non-compliances in this regard and to doing business the right way and with integrity. if required.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies The Company has adopted accounting policies which are in line with the Accounting Standards and the Act. 27.1* 67$1'$5'6 . ASSOCIATE AND JOINT VENTURE COMPANIES  .1' $6. 7KH &RPSDQ\ KDV D UREXVW oQDQFLDO FORVXUH FHUWLoFDWLRQPHFKDQLVPIRUFHUWLI\LQJDGKHUHQFH to various accounting policies. are made in consultation with the Auditors and are approved by the Audit Committee. Environment (VCCE) and on Anti Bribery and Corruption Directive (ABCD) through e-learning modules and face to face sessions.

 q .  . The Audit Committee of the Board oversees the functioning of the EthicalView Committee.Q SXUVXDQFH RI WKLV QRWLoFDWLRQ WKH &RPSDQ\ LWV VXEVLGLDULHV DQG MRLQW YHQWXUH FRPSDQ\ ZLOO adopt IND AS with effect from January 01. The impact of the change on adoption of IND AS is being assessed.acclimited. 2015.QGLD.  7KH LPSOHPHQWDWLRQ RI . The Company has disclosed the details of the EthicalView Reporting Policy on its website www. BCCI handled cement volumes of 1. An EthicalView Committee KDV EHHQ FRQVWLWXWHG WR GLVFXVV WKH oQGLQJ RI WKH investigations of the complaints and to recommend remedial actions.1' $6 LV D PDMRU FKDQJH process for which the Company has established D SURMHFW WHDP DQG LV GHGLFDWLQJ FRQVLGHUDEOH resources. 2016.29 crore in the year 2014. Also during the year.)56 CONVERGED STANDARDS During the year under review.   7KH0LQLVWU\RI&RUSRUDWH$IIDLUVYLGHLWVQRWLoFDWLRQ GDWHG)HEUXDU\KDVQRWLoHGWKH&RPSDQLHV (Indian Accounting Standard) Rules. 2017. actual/suspected frauds DQG YLRODWLRQ RI &RPSDQ\ V &RGH RI &RQGXFW Protected disclosures can be made by a whistle blower through several channels.1 SUBSIDIARIES BXON&HPHQW&RUSRUDWLRQ . VIGIL MECHANISM / WHISTLE BLOWER POLICY The Company has a vigil mechanism named EthicalView Reporting Policy (EVRP) to report concerns about unethical behaviour.04 crore as against ` 6. with the comparatives for the periods ending December 31. your Company reached out H[WHQVLYHO\ WR HPSOR\HHV WR FRQGXFW JUHDWHU awareness on Value Creation in Competitive 27.00 million tonnes as DJDLQVW  PLOOLRQ WRQQHV LQ  7KH 3URoW EHIRUH WD[ DQG H[FHSWLRQDO LWHPV IRU WKH \HDU 2015 was ` 3.com. 26.

/LPLWHG %&&.

$&&0LQHUDO5HVRXUFHV/LPLWHG $05/.

AMRL had entered into a Joint Venture for developing four coal blocks. ZLWKDQDLPWRSURYLGHEDFNRIoFHVHUYLFHVZLWK respect to routine processess. 2015. the following are Associate Companies: v $OFRQ&HPHQWV&RPSDQ\3ULYDte Limited v $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG v $VLDQ&RQFUHWHVDQG&HPHQWV3ULYDWH/LPLWHG During the year. the Company has invested ` 2.5 crore in equity shares of “OneIndia BSC 3ULYDWH /LPLWHGy ZKLFK LV D MRLQWO\ FRQWUROOHG HQWLW\ ZLWK HTXDO SDUWLFLSDWLRQ ZLWK $PEXMD Cements Limited. 27. National Limestone Company Private Limited and Singhania Minerals Private Limited. this Company does not have any operating income. Consequent upon the cancellation of these coal blocks during 2014. these are limestone deposit companies and are currently not operational. 43 . Other Subsidiaries As regards the other three Subsidiary Companies. a fellow subsidiary Company.e Lucky Minmat Limited. i.2 ASSOCIATE / JOINT VENTURE COMPANIES As on December 31.

Holcim Limited (which represents \RXU &RPSDQ\ V SURPRWHU JURXS. v 0U 0DUWLQ . v 0U &KULVWRI +DVVLJ  DV DQ $GGLWLRQDO Director of the Company with effect from December 9. Mr Kriegner who is currently Area Manager for LH operations in Central Europe. heads the Corporate Strategy and Mergers & Acquisitions function in LH.acclimited.3 6WDWHPHQW FRQWDLQLQJ VDOLHQW IHDWXUHV RI $FFRXQWV RI WKH &RPSDQ\ V 6XEVLGLDULHV  Associate / Joint Venture Companies Pursuant to Section 129(3) of the Act. 2015 in the category of 1RQ([HFXWLYH 1RQ. the same are enclosed as and by way of better disclosure practices. 2016. LAFARGEHOLCIM LTD. will be taking over as Area Manager for India in the LH group with effect from March 1. FRPQHZVLWHoQDQFHDQQXDOBUHSRUWBSGI the Company with effect from July 17.  LQ WKH FDWHJRU\ RI 1RQ([HFXWLYH Non-Independent Director.QGHSHQGHQW 'LUHFWRU Mr Hassig.ULHJQHU DV $GGLWLRQDO 'LUHFWRU of the Company with effect from February LQWKHFDWHJRU\RID1RQ([HFXWLYH Non-Independent Director. 28. These are also DYDLODEOHRQWKH&RPSDQ\ VZHEVLWHDQGFDQEH accessed at the weblink http://www. In April 2014. a statement in Form “AOC 1” containing the salient features of the Financial Statements of HDFK RI WKH VXEVLGLDULHV DVVRFLDWHV DQG MRLQW venture companies is attached. Although the audited statements of account. UHODWLQJ WR WKH &RPSDQ\ V VXEVLGLDULHV DUH QR ORQJHUUHTXLUHGWREHDWWDFKHGWRWKH&RPSDQ\ V Annual Report.ACC Limited 27.

Holcim and Lafarge completed their global merger to create a new company called LafargeHolcim Ltd. Mr Bernard Fontana. 2015 and which has emerged as a world leader in the building materials industry. to consider the appointment of their representatives on the Board of Directors and on the recommendation of the Nomination & Remuneration Committee.QGHSHQGHQW Director of the Company resigned from the Board of Directors with effect from July 17.QGHSHQGHQW Directors has been sought in the Notice convening the forthcoming Annual General Meeting of the Company. the DIRUHVDLG 'LUHFWRUV KROG RIoFH XSWR WKH GDWH of the forthcoming Annual General Meeting of the Company and being eligible offer their candidature for appointment as Directors. KDG DQQRXQFHG its intention to combine with Lafarge S. D 1RQ([HFXWLYH DQG 1RQ. as an Additional Director of . 2015. which was launched on July 15. While the global merger has no immediate impact RQ \RXU &RPSDQ\ V RSHUDWLRQV WKH &RPSDQ\ KDV taken advantage of the opportunity to align itself ZLWK VRPH RI WKH JURXS V SROLFLHV LQ WKH DUHDV RI Health & Safety and Sustainable Development as also EHQHoW IURP WKH DFFHVV WR D ODUJHU SRRO RI JOREDO best practices. Your approval for their appointment as Directors in WKHFDWHJRU\RI1RQ([HFXWLYH1RQ. 2016. 29.1 $SSRLQWPHQWRI'LUHFWRUV Pursuant to the request received from Holcim (India) Private Ltd. 29. DIRECTORS & KEY MANAGERIAL PERSONNEL 29.25HVLJQDWLRQRI'LUHFWRUV v &RQVHTXHQWXSRQKLVUHVLJQDWLRQDV&(2RI former Holcim Limited. as Deputy Chairman of the Board with effect from February 11.. v 0U $LGDQ /\QDP D 1RQ([HFXWLYH DQG D Non-Independent Director of the Company also resigned from the services of former Holcim Limited and consequently stepped down from the Board of Directors of the Company with effect from July 14. (LH). the Board of Directors has appointed: v 44 0U (ULF 2OVHQ &(2 RI /DIDUJH+ROFLP Ltd. through a merger of equals to create the most advanced company in the global building materials industry. In accordance with Section 161 of the Act. The Board of Directors has elected Mr Eric Olsen.A. CEO of LafargeHolcim Ltd. 2015.

the Board has carried out the annual performance evaluation of its own performance.H\0DQDJHULDO3HUVRQQHO The following persons have been designated as Key Managerial Personnel of the Company pursuant to Section 2(51) and Section 203 of the Act. 29. nature of the industry in which the Company operates. read with the Rules framed thereunder. 29. business model etc. Nomination & Remuneration and Compliance Committees.Corporate Overview v Financial Highlights Board & Management Reports Financial Statements Report. 0U 9LMD\ . rights and responsibility as Directors. b. In accordance with the provisions of the Act. 29.H\ 0DQDJHULDO Personnel and Senior leadership positions  <RXU &RPSDQ\ KDV ODLG GRZQ D ZHOOGHoQHG criteria for the selection of candidates for appointment as Directors.XPDU 6KDUPD UHWLUHV E\ URWDWLRQ and being eligible offers his candidature for re-appointment as a Director. 29. The relevant information has been given in $QQH[XUH C%  ZKLFK IRUPV SDUW RI WKH %RDUG V Report.6. The Board of Directors has placed on record its warm appreciation of the rich contribution made by Mr Fontana. the working of the Company. In accordance with Section 149(7) of the Act.acclimited.com/ QHZVLWHSGI.QGHSHQGHQW Director decided to retire from the services of LafargeHolcim Ltd. The criteria applied in the evaluation process are H[SODLQHG LQ WKH &RUSRUDWH *RYHUQDQFH Report. and has therefore stepped down from the Board of Directors of the Company with effect from February 11. Key Managerial Personnel and Senior Management 3HUVRQQHOLVVHWRXWLQ$QQH[XUHC& ZKLFKIRUPV SDUWRIWKH%RDUG V5HSRUW 45 . 29. The same is also available on the website of the Company and can be accessed by web link http://www. the Company has put in place a familiarization programme for the Independent Directors to familiarize them with their role. The details of the familiarization programme DUHH[SODLQHGLQWKH&RUSRUDWH*RYHUQDQFH Board Evaluation Pursuant to the provisions of the Act and the SEBI Regulations.5%RDUG(IIHFWLYHQHVV D )DPLOLDUL]DWLRQ 3URJUDPPH Independent Directors IRU WKH In compliance with the requirements of SEBI Regulations. each Independent Director has given a written GHFODUDWLRQ WR WKH &RPSDQ\ FRQoUPLQJ WKDW he/she meets the criteria of independence as mentioned under Section 149(6) of the Act and SEBI Regulations. 2016.4 Independent Directors  7KH .QGXFWLRQBSURJUDPSGI 0U %HUQDUG 7HUYHU 'HSXW\ &KDLUPDQ D 1RQ([HFXWLYH DQG 1RQ.QGHSHQGHQW 'LUHFWRUV KROG RIoFH IRU D o[HG WHUP RI oYH \HDUV DQG DUH QRW OLDEOH WR retire by rotation.3'LUHFWRUVFRPLQJXSIRUUHWLUHPHQWE\URWDWLRQ 29. Subsidiary Companies 1. the Directors individually as well as the evaluation of the working of its Audit.7 &ULWHULD IRU VHOHFWLRQ RI FDQGLGDWHV IRU DSSRLQWPHQW DV 'LUHFWRUV . and the Articles of Association of the Company. Mr Lynam and Mr Terver during their respective tenures as Directors of the Company.85HPXQHUDWLRQ3ROLF\IRU'LUHFWRUV The policy for remuneration of Directors. Mr Harish Badami. Key Managerial Personnel and senior leadership positions. CEO & Managing Director  0U6XQLO1D\DN&KLHI)LQDQFLDO2IoFHU  0U%XUMRU'1DULPDQ&RPSDQ\6HFUHWDU\  Head Compliance None of the Key Managerial Personnel have resigned during the year under review.

that such accounting policies as mentioned in Note 2 of the Notes to the Financial Statements have been selected and applied consistently DQG MXGJPHQW DQG HVWLPDWHV KDYH EHHQ PDGH that are reasonable and prudent so as to give a true and fair view of the state of affairs of the Company as on December 31. 7KH $XGLW &RPPLWWHH FRPSULVHV oYH 0HPEHUV of which four including the Chairman of the 7KH &65 &RPPLWWHH FRPSULVHV oYH PHPEHUV of which three including the Chairman of the Committee are Independent Directors. During WKH \HDU VL[ $XGLW &RPPLWWHH 0HHWLQJV ZHUH convened and held. The Committee met twice during the reporting period.3 CSR Committee a. Details of the Committee are given in the Corporate Governance Report.pdf All transactions entered into with related parties GXULQJWKH\HDUZHUHRQDQDUP VOHQJWKSULFLQJEDVLV and were in the ordinary course of business.e transactions H[FHHGLQJ WHQ SHUFHQW RI WKH DQQXDO FRQVROLGDWHG WXUQRYHUDVSHUWKHODVWDXGLWHGoQDQFLDOVWDWHPHQWV entered into during the year. if any. 2013 for safeguarding the assets of the Company and for preventing and detecting fraud and other irregularities. and f. 31. and of the SURoW RI WKH &RPSDQ\ IRU WKH \HDU HQGHG RQ that date. your Directors make the following statement in terms of Section 134 of the Act: 31. None of the Directors nor the Key Managerial Personnel has any pecuniary relationships or transactions vis-à-vis the Company. 31. Standard Operating 3URFHGXUHV IRU WKH SXUSRVH RI LGHQWLoFDWLRQ DQG monitoring of Related Party Transactions. Accordingly. the details of which are given in the Corporate Governance Report. MEETINGS 31. F WKDW SURSHU DQG VXIoFLHQW FDUH KDV EHHQ WDNHQ for the maintenance of adequate accounting records in accordance with the provisions of the Companies Act. Details of the Committee are given in the Corporate Governance Report.ACC Limited 30. H WKDWSURSHULQWHUQDOoQDQFLDOFRQWUROVODLGGRZQ by the Directors were followed by the Company DQGVXFKLQWHUQDOoQDQFLDOFRQWUROVDUHDGHTXDWH and were operating effectively. PARTICULARS OF CONTRACTS OR ARRANGEMENTS WITH RELATED PARTIES All transactions with Related Parties are placed before the Audit Committee as also the Board for approval. Prior omnibus approval of the Audit Committee and the Board is obtained for the transactions which are of a foreseen and repetitive nature. d. that the annual accounts have been prepared on a going concern basis. . the applicable accounting standards have been IROORZHGDORQJZLWKSURSHUH[SODQDWLRQUHODWLQJ to material departures. 2015. that proper systems to ensure compliance with the provisions of all applicable laws have been devised and such systems were adequate and were operating effectively. 2015. 32.1 Board Meetings  'XULQJ WKH \HDU VL[ %RDUG 0HHWLQJV ZHUH convened and held. The policy on Related Party Transactions as approved E\WKH%RDUGLVDYDLODEOHRQWKH&RPSDQ\ VZHEVLWH and can be accessed through weblink http://www.2 Audit Committee  46 Committee are Independent Directors. The transactions entered into pursuant to the omnibus approval so granted are audited and a statement giving details of all related party transactions is placed before the Audit Committee and the Board of Directors for their approval on a quarterly basis. there are no transactions that are required to be reported in Form AOC 2. DIRECTORS’ RESPONSIBILITY STATEMENT To the best of their knowledge and belief and DFFRUGLQJ WR WKH LQIRUPDWLRQ DQG H[SODQDWLRQV obtained by them. that in the preparation of the annual accounts for the year ended December 31. The statement is VXSSRUWHG E\ D FHUWLoFDWH IURP WKH &(2  0' DQG the CFO. acclimited.com/newsite/pdf/CG/PolicyonRPT. There were no material related party transactions i.  b. Your Company has developed a Related Party Transactions Manual.

Your Directors have on the recommendation of the Audit Committee. As per Subsidiary Companies  7KH $XGLWRUV KDYH JLYHQ DQ XQTXDOLoHG $XGLW Report. As required under the Act. Chaibasa Mining  7KH 'LVWULFW 0LQLQJ 2IoFHU &KDLEDVD E\ KLV letters dated January 2. the remuneration payable to the Cost Auditor is required to be placed before the Members LQ D *HQHUDO 0HHWLQJ IRU WKHLU UDWLoFDWLRQ. 47 . It is accordingly proposed that a new set of Articles of Association be adopted by the Members and a Resolution to this effect is included at Item No.2 Cost Auditors The cost audit records maintained by the Company in respect of its cement activity are required to be audited pursuant to Section 148 of the Act and the Rules framed thereunder. 2015. Parliament had introduced the MMDR Amendment Ordinance on 12. who retire at the ensuing Annual General Meeting of the Company are eligible for re-appointment. 36(B)(f) of the Notes to the Financial Statements. 2015 and March 21. and the rules framed thereunder for re-appointment as Auditors of the Company.87 hectares and 598.16WDWXWRU\$XGLWRUV 7KH&RPSDQ\ V$XGLWRUV0HVVUV65%& &2//3 Chartered Accountants. ADOPTION OF NEW ARTICLES The Companies Act. to audit the cost DFFRXQWVRIWKH&RPSDQ\IRUWKHoQDQFLDO\HDU ended December 31. Financial Statements Section 8A(5) of the MMDR (Amendment) Act. respectively. The Board recommends the resolution for adoption by the Members. The aforesaid demands were challenged by your &RPSDQ\E\ZD\RID:ULW3HWLWLRQEHIRUHWKH+RQ EOH High Court of Jharkhand at Ranchi on the grounds that pursuant to the Supreme Court Judgements. has stayed both the demands upon the deposit of ` 48 Crore.  0HPEHUV  DWWHQWLRQ LV DOVR LQYLWHG WR 1RWHV RQ Contingent Liabilities. AUDITORS 35. which subsequently became the MMDR (Amendment) Act. 35. the leases stood automatically H[WHQGHGIURPWKHGDWHRIWKHODVWH[SLU\XSWR  7KH +RQ EOH +LJK &RXUW DIWHU KHDULQJ WKH 6HQLRU Counsel for the Company. 2015 has necessitated changes in the Articles of Association of the Company. which LV ZLWKRXW SUHMXGLFH WR WKH ULJKWV DQG FRQWHQWLRQV RI ERWK WKH SDUWLHV 0HPEHUV  DWWHQWLRQ LV LQYLWHG to Note No. As required under SEBI Regulations. appointed Messrs N I Mehta & Co. The basis for the State to issue these demands were WZR MXGJHPHQWV RI WKH +RQ EOH 6XSUHPH &RXUW YL] the Goa Foundation case (dated April 21. in the notes forming part of the Financial Statements. 9 in the Notice of the Annual General Meeting.01. They KDYH FRQoUPHG WKHLU HOLJLELOLW\ XQGHU 6HFWLRQ 141 of the Act. 2015. It was the contention of the State that in view of the aforesaid MXGJHPHQWVWKHEHQHoWRIGHHPHGUHQHZDOFDQQRWEH made available for second and subsequent renewals and the mining activity therefore subsequent to validity of the last renewals would attract penalties under Section 21(5) of the Mines & Mineral (Development & Regulation) Act (MMDR Act) and hence the levy of penalties as aforesaid. Mumbai. 2013 and The Companies (Amendment) Act. 34. 2014). in those cases where application for renewal of mining leases were pending. 2014) and Common Causes case (dated May 16. Courts or Tribunals which impact the going concern status of the Company and its future RSHUDWLRQV +RZHYHU 0HPEHUV  DWWHQWLRQ LV GUDZQ to the following development. SIGNIFICANT AND MATERIAL ORDERS PASSED BY THE REGULATORS OR COURTS  7KHUHDUHQRVLJQLoFDQWRUPDWHULDORUGHUVSDVVHGE\ the Regulators. the Auditors KDYH DOVR FRQoUPHG WKDW WKH\ KROG D YDOLG FHUWLoFDWHLVVXHGE\WKH3HHU5HYLHZ%RDUGRIWKH Institute of Chartered Accountants of India. demanded amounts of ` 215 crore and ` 666 crore towards alleged illegal mining on the part of the Company in mining lease areas of 63. 2015. 35.Corporate Overview Financial Highlights Board & Management Reports 33.2015.88 hectares.

3 Secretarial Audit Pursuant to the provisions of Section 204 of the Act. AWARDS  $&& KDV EHHQ UHFRJQL]HG IRU &RUSRUDWH ([FHOOHQFH in Sustainability and felicitated with the prestigious CII-ITC Sustainability Award 2015 for “Outstanding Accomplishment” in the Category A (large companies with turnover > ` 2000 crore). 35. Winners of the CII-ITC 6XVWDLQDELOLW\$ZDUGDUHFRQVLGHUHGDVWKHFRXQWU\ V best role models in sustainability practices. the Company has appointed Messrs. a Resolution for seeking Members UDWLoFDWLRQ IRU WKH UHPXQHUDWLRQ SD\DEOH WR Messrs N I Mehta & Co. is included at Item No.QGLD /LPLWHG 16(. Cost Auditor. 3UDPRG66KDK $VVRFLDWHVDoUPRI&RPSDQ\ Secretaries in Practice to undertake the Secretarial Audit of the Company.ACC Limited Accordingly. National Stock ([FKDQJH RI . 8 of the Notice convening the Annual General Meeting.. and the Rules framed thereunder. Celebrating its 20th anniversary. The Report of WKH6HFUHWDULDO$XGLWRULVDQQH[HGWRWKH%RDUG V 5HSRUWDV$QQH[XUHC'  36.

Manufacturing. Your Company is committed to creating and PD[LPL]LQJ ORQJWHUP YDOXH IRU VKDUHKROGHUV DQG essentially follows a four pronged approach to achieve this end. During the year under review.  <RXU &RPSDQ\ V $QQXDO 5HSRUW IRU  ZRQ WKH “Silver Shield” from the prestigious Institute of &KDUWHUHG $FFRXQWDQWV RI . Logistics. Energy Conservation.QGLD IRU k([FHOOHQFH LQ Financial Reporting”. IHOLFLWDWHG \RXU &RPSDQ\ DQG oIWHHQ RWKHU FRPSDQLHV RXW RI WKH 50 companies whose scrip constitutes the Nifty 50 . The organizational vision is founded on the principles of good governance and by the resolve to be a customer-centric organization which PRWLYDWHVWKH&RPSDQ\ V0DQDJHPHQWWREHDOLJQHG to deliver leading-edge building products backed with dependable after sales services.QGH[ DQG KDYH EHHQ D SDUW RI WKH LQGH[ IURP LWV inception. D. ENHANCING SHAREHOLDER VALUE  48 <RXU &RPSDQ\ oUPO\ EHOLHYHV WKDW LWV VXFFHVV LQ the marketplace and a good reputation are among the primary determinants of value to the shareholder. Environment Management and Communication. your Company also received several other awards and citations from reputed bodies for good performance in areas as diverse as Safety. 37.

societal and environmental dimensions of the Triple Bottom Line. E\LQFUHDVLQJDOOURXQGRSHUDWLRQDOHIoFLHQFLHV b) by identifying strategies that enhance its competitive advantage. together with a FHUWLoFDWH IURP WKH &RPSDQ\ V $XGLWRUV FRQoUPLQJ compliance. CORPORATE GOVERNANCE A separate section on corporate governance practices followed by the Company. ENERGY CONSERVATION. technology DEVRUSWLRQDQGIRUHLJQH[FKDQJHHDUQLQJVDQGRXWJR as stipulated in Section 134(3)(m) of the Act. TECHNOLOGY ABSORPTION AND FOREIGN EXCHANGE EARNINGS AND OUTGO The information on conservation of energy. Underlying this is also a dedication to value-friendly oQDQFLDOUHSRUWLQJWKDWDVVXUHVWKHVKDUHKROGHUDQG investor of receiving transparent and unfettered LQIRUPDWLRQRQWKH&RPSDQ\ VSHUIRUPDQFH 38. 39. BUSINESS RESPONSIBILITY REPORTING A separate section on Business Responsibility forms part of this Annual Report as required by SEBI Regulations. forms a part of this Annual Report. and the 5XOHV IUDPHG WKHUHXQGHU LV DQQH[HG KHUHZLWK DV $QQH[XUHC( WRWKH%RDUG V5HSRUW . as per SEBI Regulations. 40. c) by managing risks and pursuing opportunities IRUSURoWDEOHJURZWKDQG d) by cementing relationships with other important stakeholder groups through meaningful engagement processes and mutually rewarding associations that enable it to create positive impacts on the economic.

our customers. PARTICULARS OF EMPLOYEES Disclosure pertaining to the remuneration and other details as required under Section 197(12) of the Act. The Directors are grateful to all valuable stakeholders of the Company viz. Organizations and Agencies for their continued guidance and Subsidiary Companies N S Sekhsaria Chairman Mumbai February 10. economic developments within the country and other factors such as litigation and industrial relations. In terms of Section 136 of the Act. Important IDFWRUVWKDWFRXOGLQpXHQFHWKH&RPSDQ\ VRSHUDWLRQV include global and domestic demand and supply FRQGLWLRQV DIIHFWLQJ VHOOLQJ SULFHV RI oQLVKHG JRRGV input availability and prices. The Directors also acknowledge the unstinted commitment and valued contribution of all employees of the Company. ACKNOWLEDGEMENTS Your Directors are thankful to the Central and State Government Departments. vendors. EXTRACT OF ANNUAL RETURN As required by Section 92(3) of the Act and the Rules IUDPHGWKHUHXQGHUWKHH[WUDFWRIWKH$QQXDO5HWXUQ LQ )RUP 0*7  LV HQFORVHG DV $QQH[XUH C)  WR WKH %RDUG V5HSRUW 42. For and on behalf of the Board of Directors 44.Corporate Overview Financial Highlights Board & Management Reports 41. 45. Financial Statements co-operation. expectations or forecasts may be forwardlooking within the meaning of applicable securities laws and regulations. 2016 49 . Actual results may differ materially from those expressed in the statement. changes in government regulations. the Report and Accounts are being sent to the 0HPEHUVDQGRWKHUVHQWLWOHGWKHUHWRH[FOXGLQJWKH DIRUHVDLG$QQH[XUHZKLFKLVDYDLODEOHIRULQVSHFWLRQ E\ WKH 0HPEHUV DW WKH 5HJLVWHUHG 2IoFH RI WKH Company during business hours on working days of the Company up to the date of the ensuing Annual General Meeting. shareholders. dealers. CAUTIONARY STATEMENT Statements in the Board’s Report and the Management Discussion & Analysis describing the Company’s objectives. banks and RWKHUEXVLQHVVDVVRFLDWHVIRUWKHLUH[FHOOHQWVXSSRUW and help rendered during the year. and the Rules framed thereunder is enclosed as $QQH[XUHC* WRWKH%RDUG V5HSRUW The information on employees who were in receipt of remuneration of not less than ` 60 lakhs during the year or ` 5 lakhs per month during any part of the year forms part of this Report and will be provided to any Member on a written request to the Company Secretary. tax laws.

ACC Limited ANNEXURE ‘A’ TO BOARD’S REPORT CSR POLICY STATEMENT DSSURYHGE\WKH%RDUGRI'LUHFWRUVRQ'HFHPEHU.

v 'HYLVH DQG LPSOHPHQW &RPPXQLW\ 'HYHORSPHQW 3ODQV EDVHG RQ WKH QHHGV and priorities of our host communities and measure the effectiveness of such development programmes. employees. shareholders. and host communities. v :RUNDFWLYHO\LQWKHDUHDVRI/LYHOLKRRGDGYDQFHPHQW(QKDQFLQJHPSOR\DELOLW\ and Income Generation. business partners. Our vision is to be one of the most respected companies in India. conserving the Environment and supporting local Sports. Our CSR initiatives focus on the holistic development of our host communities while creating social. Promoting Health and Sanitation. environmental and economic value to society.QWHUDFWUHJXODUO\ZLWKVWDNHKROGHUVUHYLHZDQGSXEOLFO\UHSRUWRXU&65LQLWLDWLYHV . 7RSXUVXHWKHVHREMHFWLYHVZHZLOOFRQWLQXHWR 50 v 8SKROG DQG SURPRWH WKH SULQFLSOHV RI LQFOXVLYH JURZWK DQG HTXLWDEOH development. delivering superior and sustainable value to all our customers. Arts and Culture. v &ROODERUDWH ZLWK OLNHPLQGHG ERGLHV VXFK DV *RYHUQPHQWV &LYLO 6RFLHW\ Organisations and Academic Institutions in pursuit of our Goals. v . Improving Quality and reach of Education.

com/newsite/pdf/Policy/ ACCCSRPolicy_2015SignedbyMD. Chairman (Non-Executive / Independent Director) 5.90 Crore The Composition of the CSR Committee: Mr. Falguni Nayar. Member (Non-Executive / Independent Director) Mr.20 Crore. Bernard Terver. ` 27. 4. Ms. Mr. Member (Non-Executive / Independent Director) c) 'HWDLOVRI&65VSHQWIRUWKHoQDQFLDO\HDUV D. including overview of projects or programmes proposed to be undertaken and a reference to the weblink to the CSR Policy and projects or programmes. $YHUDJH QHW SURoW RI WKH FRPSDQ\ IRU ODVW WKUHH oQDQFLDO\HDUV The DYHUDJHQHWSURoWRIWKH&RPSDQ\IRUODVWWKUHH oQDQFLDO\HDUVLV` 1. Member (Non-Executive Director) Mr. Farrokh K Kavarana.395.pdf 2. A brief outline of the Company’s CSR Policy. Member (CEO&MD) 3. Shailesh Haribhakti. Prescribed CSR Expenditure (two percent of the amount as in item 3 above) CSR Policy statement is given hereinbefore. Harish Badami. Weblink: http://www.acclimited.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies ANNEXURE ‘A’ TO BOARD’S REPORT ANNUAL REPORT ON CORPORATE SOCIAL RESPONSIBILITY (CSR) ACTIVITIES 1.

Bellary (Karnataka). Dhanbad (Jharkhand). CSR Project/ Activities 1. No. Yavatmal (Maharashtra). Chandrapur (Maharashtra).Districts (States) Bilaspur (Himachal Pradesh).(ii) Promotion of education including special education and employment enhancing vocation skills especially among children.71 51 . 7RWDO DPRXQW WR EH VSHQW GXULQJ WKH oQDQFLDO year: ` 27. West Singhbhum (Jharkhand). Katni (Madhya Pradesh). Gulbarga(Karnataka). Durg (Chhatisgarh). Chikkaballarpur (Karnataka). Purulia (West Bengal). Bargarh (Odisha). women.71 3.95 Amount Spent on the project or programs Cumulative Amount Expenditure Spent: Direct (` Crore) upto or through Sub . Bundi (Rajasthan). and Coimbatore (Tamil Nadu) Amount Outlay (Budget) Project or Program wise (` Crore) 2. Direct agency period Expenditure (` Crore) on Projects or (` Crore) programs 2YHUKHDGV 3. elderly and the differently abled and livelihood enhancement project) Locations .71 3.Heads: reporting implementation 1. ACC DISHA Youth Employability Sector (Schedule VII . Gauriganj (Uttarpradesh). if any: NIL The PDQQHULQZKLFKWKHDPRXQWKDVEHHQVSHQWGXULQJWKHoQDQFLDO\HDULVGHWDLOHGEHORZ Sr.90 Crore b) Amount unspent.

Gauriganj (Uttarpradesh). Durg (Chhatisgarh).ACC Limited Sr. Bargarh (Odisha). Chandrapur (Maharashtra). Bargarh (Odisha). Bundi (Rajasthan). Dhanbad (Jharkhand). West Singhbhum (Jharkhand).LIESA Sector Sustainable Agriculture (Schedule VII – (ii) Promotion of education including special education and employment enhancing vocation skills especially among children. Gulbarga (Karnataka).05 3.36 3. and Coimbatore (Tamil Nadu) 3. setting up homes and hostels for women and orphans.Districts (States) Amount Outlay (Budget) Project or Program wise (` Crore) Amount Spent on the project or programs Cumulative Amount Expenditure Spent: Direct (` Crore) upto or through Sub . day care centres and such other facilities for senior citizens and measures for reducing inequalities faced by socially and economically backward groups)  Locations .Heads: reporting implementation 1. Bellary (Karnataka). Purulia (West Bengal).64 Bilaspur (Himachal Pradesh). Yavatmal (Maharashtra). ACC Women Swavlamban Empowerment (Schedule VII – (iii) Promoting gender equality.04 6. setting up old age homes. ACC. Yavatmal (Maharashtra). Durg (Chhatisgarh). Chandrapur (Maharashtra). Purulia (West Bengal). empowering women. Gauriganj (Uttarpradesh). Katni (Madhya Pradesh). Dhanbad (Jharkhand).36 3. Direct agency period Expenditure (` Crore) on Projects or (` Crore) programs 2YHUKHDGV Bilaspur (Himachal Pradesh).36 . Bundi (Rajasthan). No. Katni (Madhya Pradesh). Chikkaballarpur (Karnataka). Gulbarga (Karnataka).64 6.64 6. women. Bellary (Karnataka). CSR Project/ Activities 2. West Singhbhum (Jharkhand). elderly and the differently abled and livelihood enhancement project) 3. Chikkaballarpur (Karnataka) and Coimbatore (Tamil Nadu) 4.

Mirzapur (Uttar Pradesh). Chikkaballarpur (Karnataka). ACC Vidya Utkarsh Quality Education ACC Vidya Saarathi Scholarship and support 5. Katni (Madhya Pradesh). Bargarh (Odisha).13 Bilaspur (Himachal Pradesh). Sector (Schedule VII – (ii) Promotion of education including special education and employment enhancing vocation skills especially among children. No. Purulia (West Bengal). Yavatmal (Maharashtra). Gauriganj (Uttarpradesh). Gauriganj (Uttarpradesh). Chikkaballarpur (Karnataka). Durg (Chhatisgarh). CSR Project/ Activities 4. Dhanbad (Jharkhand). Gulbarga (Karnataka). women. women. Purulia (West Bengal). Sirmaur (Himachal Pradesh). Katni (Madhya Pradesh). elderly and the differently abled and livelihood enhancement project) (Schedule VII – (ii) Promotion of education including special education and employment enhancing vocation skills especially among children. West Singhbhum (Jharkhand). and Coimbatore (Tamil Nadu) 6. Rudraprayag (Uttarakhand).Mewat (Haryana).38 0. Bundi (Rajasthan). Jaunpur (Uttar Pradesh).Corporate Overview Financial Highlights Sr. Chandrapur (Maharashtra).13 5. Bellary (Karnataka). Bundi (Rajasthan). Gulbarga (Karnataka). Dhanbad (Jharkhand). Alwar (Rajasthan).17 5.Heads: reporting implementation 1. Direct agency period Expenditure (` Crore) on Projects or (` Crore) programs 2YHUKHDGV Bilaspur (Himachal Pradesh). Durg (Chhatisgarh).38 0.57 0. Shrawasti (Uttar Pradesh). and Coimbatore (Tamil Nadu) 0. elderly and the differently abled and livelihood enhancement project) Board & Management Reports Financial Statements Locations . West Singhbhum (Jharkhand). Shahazanhapur (Uttar Pradesh).Districts (States) Amount Outlay (Budget) Project or Program wise (` Crore) Subsidiary Companies Amount Spent on the project or programs Cumulative Amount Expenditure Spent: Direct (` Crore) upto or through Sub . Sheopur (Madhya Pradesh).38 53 . Bellary (Karnataka). Bargarh (Odisha).13 5. Chandrapur (Maharashtra). Yavatmal (Maharashtra).

Bellary (Karnataka). Purulia (West Bengal). Katni (Madhya Pradesh). Katni (Madhya Pradesh).14 4.Districts (States) Amount Outlay (Budget) Project or Program wise (` Crore) Amount Spent on the project or programs Cumulative Amount Expenditure Spent: Direct (` Crore) upto or through Sub .16 3.14 4. Coimbatore (Tamil Nadu) Aurangabad (Maharashtra) and Beed (Maharashtra) 2. Gauriganj (Uttarpradesh). Gulbarga (Karnataka). Dhanbad (Jharkhand). Gulbarga (Karnataka). ecological balance. Gauriganj (Uttarpradesh).53 3. agroforestry. air and water) Bilaspur (Himachal Pradesh). Purulia (West Bengal).70 3. ACC Sanitation Sampoorn (Schedule VII – Swachhata (i) Eradicating hunger poverty and malnutrition. CSR Project/ Activities 6. Bargarh (Odisha).14 8. No. protection of pRUDDQGIDXQD animal welfare. Chandrapur (Maharashtra). Dhanbad (Jharkhand). Durg (Chhatisgarh). ACCArogyam Sector Health (Schedule VII – (i) Eradicating hunger poverty and malnutrition. Yavatmal (Maharashtra). West Singhbhum (Jharkhand). promoting preventive health care and sanitation and making available safe drinking water) Locations . Chikkaballarpur (Karnataka). Gulbarga (Karnataka). West Singhbhum (Jharkhand). Bundi (Rajasthan).70 3. Bundi (Rajasthan). Yavatmal (Maharashtra). Bundi (Rajasthan). Durg (Chhatisgarh). Conservation of ACC Sanrakshit Environment Paryavaran (Schedule VII – (iv) Ensuring environmental sustainability. Bargarh (Odisha). Purulia (West Bengal). West Singhbhum (Jharkhand). and Coimbatore (Tamil Nadu) 5. promoting preventive health care and sanitation and making available safe drinking water) Bilaspur (Himachal Pradesh).70 7. Chandrapur (Maharashtra).Heads: reporting implementation 1. Bellary (Karnataka). Katni (Madhya Pradesh). Yavatmal (Maharashtra). Chandrapur (Maharashtra).06 4.18 3.ACC Limited Sr. Direct agency period Expenditure (` Crore) on Projects or (` Crore) programs 2YHUKHDGV Bilaspur (Himachal Pradesh). Coimbatore (Tamil Nadu) 5. Dhanbad (Jharkhand). Durg (Chhatisgarh). conservation of natural resources and maintaining quality of soil.16 54 . Bellary (Karnataka). Chikkaballarpur (Karnataka).16 3. Chikkaballarpur (Karnataka). Gauriganj (Uttarpradesh). Bargarh (Odisha).

IIMPACT. New Delhi. CSR Committee 55 . SANSKAR.16 31. ACC CSR projects were designed. Dilasa Janvikas Pratishthan.Sulabh International. CSR Project/ Activities 9. Mahashakti Foundation. Foundation for MSME clusters . 11. 9. Bagepalli Tal. (v) Protection ofnational heritage. Durg recognized sports.Akruti Rural Development Trust.94 0. Rajasthan. A responsibility statement of the CSR Committee that the implementation and monitoring of CSR Policy is in compliance with CSR objective and Policy of the company. 28. Loka Kalyan Parishad. 3. promotion and development of traditional arts and handicrafts) TOTAL 31. and Coimbatore (Tamil restoration of buildings Nadu) Amount Outlay (Budget) Project or Program wise (` Crore) Subsidiary Companies Amount Spent on the project or programs Cumulative Amount Expenditure Spent: Direct (` Crore) upto or through Sub . which in turn is based on and implemented with statutory requirements. Chandrapur (Maharashtra). ACC -Drona Promoting Local. Himachal Pradesh Voluntary Health Association(HPVHA). SERDS. Mahatma Gandhi Integrated development and Education Institute. New Delhi. 8. Jan Sevak Samiti. Bargarh (Schedule VII – (vii) (Odisha). 24. SATTVA. Forum for Rural Development (FORD). Agranee Jan Kalyan Anusthan. Bundi (Rajasthan). Katni (Madhya Pradesh). 7. 16. HARITIKA. Bhilai. Direct agency period Expenditure (` Crore) on Projects or (` Crore) programs 2YHUKHDGV 1. 5. No. SEEDS.Heads: reporting implementation 1. implemented and periodically monitored based on need assessment reports and CSR Policy of the Company.47 31. Amhi Amchya Arogyasathi. 31. Chikkaballarpur and culture including (Karnataka). WESTRIC TRUST ** Overheads : ` 3.94 0. 21.Districts (States) Bilaspur (Himachal Pradesh).CMRC.Self reliant initiatives through joint action (SRIJAN).95 0. Training to promote rural sports. CREDA. Sd/- Sd/- HARISH BADAMI CEO & Managing Director SHAILESH V. 10. Gulbarga (Karnataka). 32. 4. 6. Creative India. Dhanbad (Jharkhand). 26. Dehat ( Developmenal Association for Human Advancement ) Bahraich. 15.QFDVHWKHFRPSDQ\KDVIDLOHGWRVSHQGWKHWZRSHUFHQWRIWKHDYHUDJHQHWSURoWRIWKHODVWWKUHHoQDQFLDO\HDUVRUDQ\SDUW thereof. 27. Jan Mangal Sansthan. 29.16 31. Gauriganj (Uttarpradesh). 33. 17. Indian Grameen Services. CENTUM Foundation. Paralympic sports and (Chhatisgarh). the company shall provide the reasons for not spending the amount in its board report. 25. Aurangabad. Shimla. Udyogini. nationally Purulia (West Bengal). Pancham Research and Bio tech Sansthan . West Singhbhum (Jharkhand). 14. DEEDS. Bala ji associates .2. Sarva Seva Samiti Sanstha.94 and sites of historical importance and works of art. Arts and Culture Sector Board & Management Reports Financial Statements Locations . ACC MAVIM Loksanchalit Sadhan Kendra . Uttarpradesh. 13. 20. 34. Chattisgarh Pradesh Judo sangh. 19. art Bellary (Karnataka). Naad Gunjan Kala Parishad. setting up public libraries. HARIBHAKTI Chairman. 18. Lucknow. 30.16 * Details of some of the implementing agencies – 1. 12. New Delhi.Corporate Overview Financial Highlights Sr. 22.53 Crore  . 23. Bandikui. Not Applicable 7. Yavatmal Olympic sports (Maharashtra).Ghugus. Kadirannagari Palli.

the following attributes / criteria will be considered whilst recommending the candidature for appointment as Director: i. WKH FDQGLGDWHV LGHQWLoHG IRU DSSRLQWPHQW DV 'LUHFWRUVVKRXOGQRWEHGLVTXDOLoHGIRUDSSRLQWPHQW under Section 164 of the Act. selection of candidates from a wide cross section of industries and professional backgrounds. shall take into consideration the performance evaluation of the Director and his engagement level. v DELOLW\ WR WKLQN LQGHSHQGHQWO\ ZLWKRXW EHLQJ LQpXHQFHG E\ H[WUDQHRXV FLUFXPVWDQFHV RU consideration. v UHIUDLQ IURP VLWXDWLRQV WKDW PD\ KDYH D GLUHFW RU LQGLUHFW FRQpLFW RI LQWHUHVW ZLWK WKRVH RI WKH Company. the Nomination & Remuneration Committee shall also satisfy itself with regard to the independent nature of the Director vis-à-vis the Company. the Nomination & 5HPXQHUDWLRQ &RPPLWWHH LGHQWLoHV SHUVRQV RI LQWHJULW\ ZKRSRVVHVVUHOHYDQWH[SHUWLVHDQGH[SHULHQFHGRPDLQ . For the purpose of assessing the attributes of the candidate. TXDOLoFDWLRQV H[SHUWLVH DQG H[SHULHQFH RI WKH candidate.ACC Limited ANNEXURE ‘B’ TO BOARD’S REPORT CRITERIA FOR SELECTION OF CANDIDATES FOR APPOINTMENT AS DIRECTORS. b. v DELOLW\WRGHYRWHWLPHDQGDWWHQWLRQIRUWKHEXVLQHVV and governance of the Company. positive attributes of the candidate. their domain and functional knowledge LQ WKH oHOGV RI PDQXIDFWXULQJ PDUNHWLQJ oQDQFH WD[DWLRQODZJRYHUQDQFHDQGJHQHUDOPDQDJHPHQW so as to enable the Board to discharge its function and duties effectively. The Board of Directors (including the Nomination & Remuneration Committee) periodically review vacancies likely to occur on the completion of the tenure of Non([HFXWLYH'LUHFWRUVIRUWLPHO\oOOLQJRIVXFKYDFDQFLHV In the selection of the CEO&MD. age of the candidate. ii. interalia. v DFFHSWDQFH WR DELGH E\ WKH &RPSDQ\ V &RGH RI Business Conduct. take into consideration whether the candidate demonstrates: v KLJKVWDQGDUGVRIHWKLFDOEHKDYLRXU v SRVLWLYH GLVSRVLWLRQ JRRG LQWHUSHUVRQDO  DQG communication skills. v. H[SHULHQFHDQGWKHLUSHUVRQDODQGRWKHUSRVLWLYHDWWULEXWHV before making its recommendation to the Board. 7KH &RPPLWWHH WDNHV LQWR DFFRXQW WKH %RDUG V H[LVWLQJ composition vis-a-vis the need to have a broad based and diverse Board commensurate with the size and FRPSOH[LW\ RI WKH &RPSDQ\ V RSHUDWLRQV 7KLV HQVXUHV WKDW WKH &RPSDQ\ JHWV WKH PD[LPXP EHQHoW IURP WKH contributions and deliberations of an accomplished and diverse group of individuals and professionals. iii. responsible for identifying potential candidates for appointment as Directors. KEY MANAGERIAL PERSONNEL AND MEMBERS OF THE EXECUTIVE COMMITTEE The Nomination & Remuneration Committee plays an important role in ensuring that there is a formal and transparent process for appointment to the Board of Directors and is. v FDSDELOLW\WRDFWZLWKUHDVRQDEOHFDUHLQJRRGIDLWK and in the best interests of the Company and its stakeholders. iv. The Nomination & Remuneration Committee shall meet potential candidates to assess their level of competence. YL LQ FDVH RI UHDSSRLQWPHQW RI 1RQ([HFXWLYH Directors. F d. the Committee shall. Professional or Business Standing. 56 diversity of the Board. interalia. that issues are discussed from different angles fostering creativity LQWKH%RDUG VGHFLVLRQPDNLQJSURFHVVDVZHOODVSURYLGH for comprehensive strategic planning and effective risk management at the highest level. Some of the important criteria considered by the Nomination & Remuneration Committee in identifying candidates for appointment as Directors are: a. in case of recommendation for appointment of Independent Directors. integrity of the candidate. the Nomination & Remuneration Committee whilst making its recommendation to the Board of Directors. personal.

The Committee also HQVXUHVWKDWWKHLGHQWLoHGFDQGLGDWHLVQRWGLVTXDOLoHGIRU appointment as a Director. the Committee also takes into consideration the recommendations received from any Member of the Committee / Board of Directors. 57 .Corporate Overview Financial Highlights Board & Management Reports DQG IXQFWLRQDO NQRZOHGJH  UHTXLUHG IRU VXFK RIoFH DQG ZKRGHPRQVWUDWHSRVLWLYHDWWULEXWHVDVH[SODLQHGDERYH The ability of the candidate to adapt to the organizational culture and ethos are also considered. who shall base his recommendation on the DVVHVVPHQWRIWKHTXDOLoFDWLRQVH[SHUWLVHDQGH[SHULHQFH functional knowledge and skills of the candidate. In this regard. his/ her positive attributes and the ability and agility of the candidate to adapt to the overall organizational culture and ethos. the Nomination & Remuneration Committee considers the recommendation of the CEO&MD in this regard.Q FDVH RI DSSRLQWPHQW RI SHUVRQV WR WKH ([HFXWLYH Committee. Financial Statements Subsidiary Companies .

KEY MANAGERIAL PERSONNEL AND MEMBERS OF THE EXECUTIVE COMMITTEE 5HPXQHUDWLRQ3KLORVRSK\ The collective responsibility of the Board of Directors is the guiding principle in determining the compensation IRU 1RQ([HFXWLYH 'LUHFWRUV ZKLOVW DW WKH VDPH WLPH recognizing and adequately compensating the Chairman of the Board of Directors. The Members of the Audit Committee and the Compliance Committee and particularly the Chairman of the Audit Committees is required to spend considerable time for providing guidance to the 0DQDJHPHQWLQGHDOLQJZLWKPDMRULVVXHV Remuneration 7KH UHPXQHUDWLRQ RI WKH 1RQ([HFXWLYH 'LUHFWRUV LV determined within the limits prescribed under Section 179 read with the rules framed thereunder and Schedule V to the Companies Act. v. The Chairman of the Board is required to provide leadership and EDODQFHFRQpLFWVRILQWHUHVWLIDQ\VRWKDWGHFLVLRQVDUH taken in the best interests of the Company and to ensure highest standards of governance. as may be recommended to the Board by the Nomination & Remuneration Committee. vi. 2015 (hereinafter referred to as “SEBI Regulations”). the Nomination & Remuneration Committee may recommend a higher commission for the Chairman of the Board of Directors. if any. the Chairman of the Audit Committee and Members of the Audit Committee and Compliance Committee for the additional responsibilities shouldered by them.QGHSHQGHQW'LUHFWRUVRIWKH&RPSDQ\VKDOOQRW be entitled to participate in Stock Option Scheme of the Company. the Chairman of the Audit Committee shall be paid an additional commission. the commission shall be payable on a prorata basis to WKRVH'LUHFWRUVZKRRFFXS\RIoFHIRUSDUWRIWKH\HDU L[ WKH. the total commission SD\DEOH WR WKH 'LUHFWRUV VKDOO QRW H[FHHG  RI WKH QHWSURoWRIWKH&RPSDQ\ iii. taking into consideration his overall responsibility. payment of commission on an annual basis. viii. VXEMHFW WR WKH DSSURYDO RI WKH 0HPEHUV LQ *HQHUDO Meeting. in determining the quantum of commission payable to the Directors. 7KH 1RQ([HFXWLYH 'LUHFWRUV RI WKH &RPSDQ\ UHFHLYH remuneration by way of sitting fees for attending the Board / Committee Meetings and commission as detailed hereunder: i.ACC Limited ANNEXURE ‘C’ TO BOARD’S REPORT POLICY FOR REMUNERATION OF DIRECTORS. to reinforce the principles of collective responsibility of the Board. LL 58 sitting fees for each meeting of the Board or Committee of the Board attended by the Director. the Nomination & Remuneration Committee may recommend to the Board. the Nomination & Remuneration Committee shall make its recommendation after taking into consideration the overall performance of the Company and having regard to the onerous responsibilities required to be shouldered by the Director etc. introduced by the Company. Likewise. of such sum as may be approved by the Board of Directors within the overall limits prescribed under the Act. the commission is generally paid on a uniform basis. The CSR Committee has decided not to accept any sitting fees and pursuant thereto. for the payment of an additional commission to those Directors who are Members on the Audit Committee and WKH &RPSOLDQFH &RPPLWWHH RI WKH %RDUG VXEMHFW to a ceiling on the total commission payable as may be decided. no sitting fees are paid to the Members of the CSR Committee for attending CSR Committee Meetings 5HPXQHUDWLRQ 3ROLF\ IRU WKH &KLHI ([HFXWLYH 2IoFHU  0DQDJLQJ'LUHFWRU &(2 0'. 2013 (hereinafter collectively referred to as “the Act”) and SEBI (Listing Obligations and Disclosure Requirements) Regulations. in addition to the remuneration paid under Clause (ii) and (vi) above. Pursuant thereto. vii. the Members of the Audit Committee and the Compliance Committee have the onerous responsibility to respectively ensure DGHTXDF\ RI LQWHUQDO FRQWUROV UREXVWQHVV RI oQDQFLDO policies and accounting principles and compliance with applicable laws. of such sum as may be approved by the Board on the recommendation of the Nomination & Remuneration &RPPLWWHH VXEMHFW WR WKH FHLOLQJ SUHVFULEHG XQGHU the Act. iv.

DQG([HFXWLYH&RPPLWWHH Members 7KH&RPSDQ\ VFRPSHQVDWLRQSKLORVRSK\IRUWKH&(2 0' DQG WKH ([HFXWLYH &RPPLWWHH Members is broadly .

c. In determining the remuneration the Nomination & Remuneration Committee shall consider the following: the relationship between remuneration and performance. the industry benchmarks and current trends. responsibility required to be shouldered by the CEO&MD. This can be ensured by providing a remuneration structure which when benchmarked with comparable companies within the industry / sector compares favourably so as to attract talent. to ensure that the remuneration is competitive and that it compares favourably with the Industry. in keeping with best industry practices. the CoPSDQ\ VSHUIRUPDQFHYLVÅYLVWKHDQQXDO budget achievement and individual performance vis-à-vis the KRAs / KPIs. In determining the remuneration of the Key Managerial 3HUVRQQHO . At the same time the reward proposition is OLQNHGWRWKHRYHUDOOFRPSDQ\ VSHUIRUPDQFHLQGLYLGXDO SHUIRUPDQFH HPSOR\HH V SRWHQWLDO FULWLFDOLW\ RI WKH function and its importance for achieving a competitive advantage in business. LL i. The CEO&MD shall be paid such remuneration as may be mutually agreed between the Company (which includes the Nomination & Remuneration Committee and the Board of Directors) and the CEO&MD. within the overall limits prescribed under the Act.Corporate Overview Financial Highlights Board & Management Reports guided by the fact that the Company gains a competitive advantage in attracting.03. E EDODQFH EHWZHHQ o[HG DQG LQFHQWLYH SD\ UHpHFWLQJ VKRUW DQG ORQJ WHUP SHUIRUPDQFH REMHFWLYHV DSSURSULDWH WR WKH ZRUNLQJ RI WKH Company and its goals. e. retaining and motivating talent.

industry benchmarks and current compensation trends in the market. d. the remuneration including annual increment and performance bonus. iv. Subsidiary Companies 5HPXQHUDWLRQ 3ROLF\ IRU WKH . c. Financial Statements ii. E WKH EDODQFH EHWZHHQ o[HG DQG LQFHQWLYH SD\ UHpHFWLQJ VKRUW DQG ORQJ WHUP SHUIRUPDQFH REMHFWLYHV DSSURSULDWH WR WKH ZRUNLQJ RI WKH Company and its goals. 7KHUHPXQHUDWLRQVKDOOEHVXEMHFWWRWKHDSSURYDORI the Members of the Company in General Meeting. The remuneration of the CEO&MD shall be broadly GLYLGHG LQWR o[HG DQG YDULDEOH FRPSRQHQWV 7KH o[HG FRPSRQHQW FRPSULVHV VDODU\ DOORZDQFHV SHUTXLVLWHV DPHQLWLHV DQG UHWLUHPHQW EHQHoWV 7KH variable component viz. 59 .DQG([HFXWLYH&RPPLWWHH0HPEHUVWKH Nomination & Remuneration Committee shall consider the following: the relationship between remuneration and performance. is decided based on the criticality of the roles and responsibilities. whilst recommending the annual increment and performance incentive to the Nomination & Remuneration Committee for its review and approval. a. a. The CEO&MD will carry out the individual performance review based on the standard appraisal PDWUL[ DQG VKDOO WDNH LQWR DFFRXQW WKH DSSUDLVDO score card and other factors mentioned hereinabove. WKH&RPSDQ\ VSHUIRUPDQFHYLVÅYLVWKHDQQXDO budget achievement. the remuneration is divided into two components YL] o[HG FRPSRQHQW FRPSULVLQJ VDODULHV SHUTXLVLWHVDQGUHWLUHPHQWEHQHoWVDQGDYDULDEOH component comprising performance bonus.H\ 0DQDJHULDO 3HUVRQQHO DQGWKH([HFXWLYH&RPPLWWHH0HPEHUV 5HPXQHUDWLRQ3ROLF\IRUWKH&(2 0' i. iii. performance bonus and other long term incentives. d. individuals performance vis-à-vis KRAs/KPIs.

The Members.ACC Limited ANNEXURE ‘D’ TO BOARD’S REPORT Form No. 2015 [Pursuant to section 204(1) of the Companies Act. 2013 and rule No. ACC Ltd D. MR-3 SECRETARIAL AUDIT REPORT FOR THE FINANCIAL YEAR ENDED 31st DECEMBER. 2014] To. 9 of the Companies (Appointment and Remuneration of Managerial Personnel) Rules.

We have conducted the secretarial audit of the compliance of applicable statutory provisions and the adherence to good corporate practices by ACC Ltd (hereinafter called the Company). 7KH 6HFXULWLHV DQG ([FKDQJH %RDUG RI .QGLD (Substantial Acquisition of Shares and Takeovers) Regulations. Secretarial Audit was conducted in a manner that provided us a reasonable basis for evaluating the corporate conducts/statutory compliances and H[SUHVVLQJRXURSLQLRQWKHUHRQ E. as amended from time to time.

1956 C6&5$ . during the audit period covering the oQDQFLDO \HDU HQGHG RQ VW 'HFHPEHU  FRPSOLHG with the statutory provisions listed hereunder and also that the Company has proper Board-processes and FRPSOLDQFH PHFKDQLVP LQ SODFH WR WKH H[WHQW LQ WKH PDQQHUDQGVXEMHFWWRWKHUHSRUWLQJPDGHKHUHLQDIWHU :H KDYH H[DPLQHG WKH ERRNV SDSHUV PLQXWH ERRNV IRUPV DQG UHWXUQV oOHG DQG RWKHU UHFRUGV PDLQWDLQHG E\ WKH &RPSDQ\ IRU WKH oQDQFLDO \HDU HQGHG RQ 31st December. the Company has. 7KH 6HFXULWLHV DQG ([FKDQJH %RDUG RI . (ii) The Securities Contracts (Regulation) Act. 2013 (the Act) and the rules made there under. %DVHG RQ RXU YHULoFDWLRQ RI WKH &RPSDQ\ V ERRNV SDSHUV PLQXWH ERRNV IRUPV DQG UHWXUQV oOHG DQG other records maintained by the Company and also the LQIRUPDWLRQSURYLGHGE\WKH&RPSDQ\LWVRIoFHUVDJHQWV and authorized representatives during the conduct of secretarial audit. We hereby report that in our opinion.QGLD (Prohibition of Insider Trading Regulations. 2015 according to the provisions of: (i) The Companies Act. as amended from time to time.

1996 and the Regulations and Bye-laws framed thereunder.$FW . (iv) The following Regulations and Guidelines prescribed XQGHUWKH6HFXULWLHVDQG([FKDQJH%RDUGRI.DQGWKHUXOHVPDGHWKHUHXQGHU (iii) The Depositories Act.QGLD$FW  C6(%.

 60 :H KDYH DOVR H[DPLQHG FRPSOLDQFH ZLWK WKH DSSOLFDEOH clauses of the following: (i) The Listing Agreements entered into by the Company ZLWK %6( /LPLWHG %RPED\ 6WRFN ([FKDQJH.

 DQG 1DWLRQDO6WRFN([FKDQJHRI.QGLD/LPLWHG 16(.

 LL.

2015). (iii) Secretarial Standards issued by The Institute of Company Secretaries of India. During the period. We have relied on the representation made by the &RPSDQ\LWV2IoFHUVDQG5HSRUWVRIWKH6WDWXWRU\$XGLWRU . :HIXUWKHUUHSRUWWKDW The Board of Directors of the Company is duly constituted ZLWKSURSHUEDODQFHRI([HFXWLYH'LUHFWRUV1RQ([HFXWLYH Directors and Independent Directors. all the decisions in the Board Meetings were carried out unanimously. and a system H[LVWVIRUVHHNLQJDQGREWDLQLQJIXUWKHULQIRUPDWLRQDQG FODULoFDWLRQVRQWKHDJHQGDLWHPVEHIRUHWKHPHHWLQJDQG for meaningful participation at the meeting.QGLD /LVWLQJ Obligation and Disclosure Requirements) Regulations. 6HFXULWLHV DQG ([FKDQJH %RDUG RI . The changes in the composition of the Board of Directors that took place during the period under review were carried out in compliance with the provisions of the Act. agenda and detailed notes on agenda were sent at least seven days in advance. Adequate notice is given to all directors to schedule the Board Meetings. 2015 (with effect from 1st December.

EmSOR\HHV 3URYLGHQW)XQG$FWDQG5XOHV  3URIHVVLRQDO7D[$FWDQG5XOHV :H IXUWKHU UHSRUW WKDW there are adequate systems and processes in the Company commensurate with the size and operations of the Company to monitor and ensure compliance with applicable laws.. rules.Corporate Overview Financial Highlights Board & Management Reports for systems and mechanism framed by the Company for compliances under other Acts. 1. regulations and JXLGHOLQHV $VPHQWLRQHGDERYHDQGOLVWHGLQ$QQH[XUH. Laws and Regulations DSSOLFDEOHWRWKH&RPSDQ\DVOLVWHGLQ$QQH[XUH Financial Statements Subsidiary Companies $QQH[XUH.

1972 4. 1961 5.: 3804 Place: Mumbai Date: January 22. 1970  (PSOR\PHQW([FKDQJHV &RPSXOVRU\1RWLoFDWLRQRI vacancies) Act. 1947 8. 1948 11.: 334 C P No. Minimum Wages Act. Employees Provident Fund & Misc provisions Act. Shop and Establishment Act  . Employees State Insurance Act. Payment of Bonus Act. 1965 12. Contract Labour (R&A) Act.QFRPH7D[$FW 14. Equal Remuneration Act. 2016 3. 1959 7. Apprentices Act. Shah-Partner Pramod S. 1952 9. 1976 10. :HIXUWKHUUHSRUWWKDW during the audit period there were QRVSHFLoFHYHQWVDFWLRQVKDYLQJDPDMRUEHDULQJRQWKH &RPSDQ\ VDIIDLUV Pramod S. Shah & Associates FCS No. Finance Act. 1994 61 . Payment of Gratuity Act.

ACC Limited ANNEXURE ‘E’ TO BOARD’S REPORT CONSERVATION OF ENERGY. TECHNOLOGY ABSORPTION AND FOREIGN EXCHANGE EARNINGS & OUTGO [SeFWLRQ .

P.

RIWKH&RPSDQLHV$FWUHDGZLWK5XOH .

RIWKH&RPSDQLHV $FFRXQWV.

5XOHV@ $.

 &216(59$7.212)(1(5*< The year under review was very crucial from the point of view of Energy Conservation as it was the DVVHVVPHQW\HDUIRUWKHoUVWF\FOHRI3HUIRUP$FKLHYH and Trade (PAT) Scheme introduced by the Ministry RI 3RZHU IRU EULQJLQJ LQ HIoFLHQFLHV LQ HQHUJ\ LQ PDMRULQGXVWULHV Your Company turned out a good PAT performance DQG UHGXFHG WRWDO VSHFLoF HQHUJ\ FRQVXPSWLRQ surpassing the target set by the Government of India *R.

GXULQJWKHYHU\oUVW\HDURIWKH3$7F\FOH7KH &RPSDQ\LVH[SHFWHGWRJHWa(QHUJ\6DYLQJ &HUWLoFDWHV (6&V.

 IRU H[FHHGLQJ WKH VHW WDUJHWV 7KH HVWLPDWHG number of ESCs are based on recommendations JLYHQ E\ DQ H[WHUQDO 0RQLWRULQJ DQG 9HULoFDWLRQ 7HDP WR WKH %XUHDX RI (QHUJ\ (IoFLHQF\ %((.WUDGDEOHRQWKHPDUNHWIURPWKH *R.

before WKHoQDOUHFRPPHQGDWLRQIRULVVXDQFHRIFHUWLoFDWHV is given by BEE to the GoI.QGLDQ. supported by BEE for best practices in energy conservation. Maharashtra.17 million XQLWVRIJUHHQSRZHU 5DMDVWKDQPLOOLRQXQLWV Tamil Nadu . mainly through operational measures as under: v IRFXV RQ DUUHVWLQJ OHDNDJHV DQG SUHVVXUH GURSV further to a Computational Fluid Dynamics (CFD) study.Q0DKDUDVKWUDWKH&RPSDQ\ V7KDQHFRPSOH[DQG LW VVXEVLGLDU\&RPSDQ\%XON&HPHQW&RUSRUDWLRQRI (India) Limited.  (QHUJ\ FRQVHUYDWLRQ HIoFLHQF\ PHDVXUHV ZHUH undertaken in various areas of Cement Manufacturing and Captive Power Plants (CPPs). the Company spent ` 11.20 crore on PDMRUFDSH[SURMHFWVIRUHQHUJ\FRQVHUYDWLRQEHVLGHV LPSOHPHQWLQJ ORZ FRVW FDSH[  RSH[ PHDVXUHV WR reduce energy consumption. These units helped the Company to fully meet the Renewable Purchase Obligation (Non-Solar) for Madukkarai Plant in Tamil Nadu & Lakheri Plant in 5DMDVWKDQ EHVLGHV JHWWLQJ SRZHU DW D YHU\ FKHDS cost. During the year.17 million units).22 million units. Kalamboli are operating mainly on renewable energy with negligible cost through the wind turbines at Satara.   62 XSJUDGDWLRQRIFRQWUROV\VWHPV v FDSDFLWRUEDQNVKDYHEHHQDGGHGWRWKHV\VWHP at all Plants to improve plant power factor and also to reduce harmonics. Maharashtra . Kymore Plant also received the CII DZDUG IRU LQQRYDWLRQ LQ HQHUJ\ DQG HIoFLHQF\ improvement.13. the Company FRXOGDFKLHYHDUHGXFWLRQRILQVSHFLoFHOHFWULFDO energy consumption for the year 2015 as compared WRWKH\HDUWKRXJKWKHVSHFLoFWKHUPDOHQHUJ\ was maintained at the same level. v UHSODFHPHQW RI FRQYHQWLRQDO ODPSV ZLWK /(' lights is being done in phases for plant and colony lighting across all plants.  7KH LQLWLDWLYHV WDNHQ DV H[SODLQHG DERYH ZRXOG further improve the thermal and electrical energy HIoFLHQF\RIWKH3ODQWs.QGXVWULHV (CII). Despite lower production volumes. v XVHRI9DULDEOH6SHHG'ULYHV 96'V. IRU issuance of ESCs and may change marginally.3.  . v <RXU &RPSDQ\ V  5HQHZDEOH (QHUJ\ 3RUWIROLR consists of 19 MW in the form of Wind Farms across three states which has generated ~29. *UHHQ3RZHU  /DNKHUL DQG &KDQGD 3ODQWV ZHUH DGMXGJHG HQHUJ\ HIoFLHQWXQLWVE\&RQIHGHUDWLRQRI.

 7KH5HQHZDEOH(QHUJ\&HUWLoFDWHV 5(&V.

Gagal and Madukkarai Plants. The Renewable Power Obligations (Solar & Non Solar) of other plants were met by purchasing Renewable (QHUJ\&HUWLoFDWHV 5(&V. Lakheri.JHQHUDWHG through the Wind Turbine Generators were used to partly trade off the Non Solar Renewable Power Obligation of Gagal and Tikaria Plants. resulting in substantial savings. Tikaria. Bargarh. Chaibasa. v GHWDLOHG (QHUJ\ $XGLWV ZHUH FRQGXFWHG DW Kymore.

 .

Corporate Overview Financial Highlights Board & Management Reports %.

 TECHNOLOGY ABSORPTION Your Company as part of LafargeHolcim Group HQMR\V DFFHVV WR YDULRXV JOREDO UHVRXUFHV LQ WKH form of Technology. In addition to the above.  PHHWYDULRXVVXVWDLQDELOLW\REMHFWLYHV   HQKDQFHSURGXFWLRQHIoFLHQF\DQG   optimize cost.WKDV during the year accessed and applied such resources with necessary application oriented research and development in the following areas: v XVLQJ LQGXVWULDO ZDVWH DV DOWHUQDWLYH IXHO through innovative co-processing. Information and H[SHULHQFHVLQUHODWLRQWRWKHFHPHQWEXVLQHVV. v RSWLPL]LQJIXHOPL[ v UHGXFWLRQRIHPLVVLRQ v GHYHORSLQJQHZDQDO\WLFV v LQWURGXFWLRQRIDSSOLFDWLRQRULHQWHGSURGXFWV v YDOXHDGGHGSURGXFWVDQGVHUYLFHVDQG Financial Statements v Subsidiary Companies LPSOHPHntation of Quality audits and Laboratory Information Managment Systems. your Company has also WDNHQLQLWLDWLYHVIRULPSURYLQJSURGXFWLRQHIoFLHQF\ and Plant availability and conservation of natural resources by using low grade limestone etc. increDVHUHYHQXHDQGSURoWDELOLW\ &. Your Company is in the process of further LPSOHPHQWDWLQJ YDULRXV SURMHFWV IRU DEVRUSWLRQ of Technology and Knowhow and use of relevant H[SHULHQFHV DQG LQIRUPDWLRQ JDWKHUHG DFURVV  WKH LafargeHolcim Units to:  enhance its customer reach through improvement of product quality and increasing application oriented products. Knowhow.

59 124.85 135.80 2014 ` Crore 1.*1(. )25(.1*6 287*2 )RUHLJQH[FKDQJHHDUQHG )RUHLJQH[FKDQJHXVHG 2015 ` Crore 2.39 N S Sekhsaria Chairman Mumbai February 10.&+$1*(($51. 2016 63 .

9 EXTRACT OF ANNUAL RETURN as on December 31.ACC Limited ANNEXURE ‘F’ TO BOARD’S REPORT FORM No. MGT. 2015 >3XUVXDQWWR6HFWLRQ .

RIWKH&RPSDQLHV$FWDQG5XOH .

RIWKH &RPSDQLHV 0DQDJHPHQWDQG$GPLQLVWUDWLRQ.

Bani Park. 1. Mumbai 400 020 Plot No. Bhopal 462 011 (MP) QG)ORRU9HOKR%OGJ2SS0XQLFLSDO*DUGHQ3DQDML*RD SCF-270. 121. 2nd Floor. Jaipur 302 016 Singhania Minerals Private Limited Paryavas Bhavan.01 2(46) Foreign Company Holding 0. Saket District Centre. if any L26940MH1936PLC002515 August 1.54 5HDG\0L[HG&RQFUHWH 3279 8.&&RGHRIWKH WRWRWDOWXUQRYHURIWKH&RPSDQ\ Product / Services Product / Service Cement 3242 91..5XOHV@ I. Bani Park. Mumbai . Motor Market. Saket. Zurich. Jail Road.46 . 1936 ACC Limited Public listed Company having Share Capital Cement House. Plot A-1. DLF South Court. Mansadevi Road. 022-33024321 Yes The Company has an in-house Share Department DWWKH5HJLVWHUHG2IoFH7HO1R .110 017 Holderind Investments Limited Hagenholzstrasse 85. Arera Hills. Address and contact details of Registrar and Transfer Agent.400020 Tel No.8050. U99999MH1992PLC066679 Subsidiary 94.3DUWLFXODUVRI+ROGLQJ6XEVLGLDU\$VVRFLDWHDQG-RLQW9HQWXUH&RPSDQLHV 1DPHDQGDGGUHVVRIWKH&RPSDQ\ CIN / GLN Holcim (India) Private Limited Suite 304. Maharshi Karve Road.. Jaipur 302 016 G-9/C.3ULQFLSDO%XVLQHVV$FWLYLWLHVRIWKH&RPSDQ\ $OOWKH%XVLQHVV$FWLYLWLHVFRQWULEXWLQJRUPRUHRIWKHWRWDOWXUQRYHURIWKH&RPSDQ\VKDOOEHVWDWHG 1DPHDQG'HVFULSWLRQRIWKHPDLQ 1. Delhi .3rd Floor. Switzerland Holding / RI Applicable 6XEVLGLDU\ Shares Section / Associate held / Joint Venture U26943DL2002PTC116851 Holding 50.. Chandigarh 160 101 QG)ORRU9HOKR%OGJ2SS0XQLFLSDO*DUGHQ3DQDML*RD OneIndia BSC Private Limited 1RC$ *URXQG)ORRUC7KH(VWDWH 1R'LFNHQVRQ5RDG Bangalore .560 042 64 . Kabir Marg.29 2(46) ACC Mineral Resources Limited U10100MH1930PLC001612 Subsidiary 100 2(87) Bulk Cement Corporation (India) Ltd. Registration and other details CIN Registration Date Name of the Company Category / Sub Category of the Company $GGUHVVRIWKH5HJLVWHUHG2IoFHDQGFRQWDFWGHWDLOV Whether Listed Company Name.65 2(87) Lucky Minmat Limited U14219RJ1976PLC001697 Subsidiary 100 2(87) National Limestone Company Private Limited U26944RJ1981PTC002227 Subsidiary 100 2(87) U14109MP1992PTC007264 Subsidiary 100 2(87) Alcon Cement Company Private Limited U26942GA1992PTC001281 Associate 40 2(6) Asian Concretes and Cements Private Limited U26940CH2009PTC031641 Associate 45 2(6) Aakaash Manufacturing Company Private Limited U55101GA1995PTC001908 Associate 40 2(6) U74900KA2015PTC082264 Joint Venture 50 2(6) Cement House. W-7. KWC KalamboIi. 121 Maharshi Karve Road. CH . Dist Raigad 410 218 G-9/C Kabir Marg. Block No.

Corporate Overview Board & Management Reports Financial Highlights Financial Statements Subsidiary Companies .96KDUHKROGLQJ3DWWHUQ (TXLW\6KDUH&DSLWDO%UHDNXSDVSHUFHQWDJHRI7RWDO(TXLW\.

L.

&DWHJRU\ZLVH6KDUHKROGLQJ &DWHJRU\RI Shareholders 1RRI6KDUHVKHOGDWWKHEHJLQQLQJRIWKH\HDU -DQXDU\.

Demat A. 3K\VLFDO Total RI7RWDO Shares % Change RI7RWDO during WKH\HDU Shares 1RRI6KDUHVKHOGDWWKHHQGRIWKH\HDU 'HFHPEHU.

Demat 3K\VLFDO Total 3URPRWHUV LQFOXGLQJ 3URPRWHU*URXS.

.

01 0 e) Banks / Fl 0 0 0 0 0 0 0 0 0 f) Any Other (specify) 0 0 0 0 0 0 0 0 0 93888120 0 93888120 0 93888120 50.(s) 0 0 0 0 0 0 0 0 0 d) Bodies Corporate 93888120 0 93888120 0 93888120 50. Indian a) Individuals / HUF 0 0 0 0 0 0 0 0 0 b) Central Govt.01 0 6XE7RWDO $. 0 0 0 0 0 0 0 0 0 c) State Govt.

.

50.01 93888120 .01 93888120 50.

30 94429120 0 541000 50.68 (0.30 0 7782296 28620 7810916 28620 6901246 3.41 3. Foreign a) NRIs .Individuals 0 0 0 0 0 0 0 0 0 c) Bodies Corporate 541000 0 541000 0.29 0 94429120 0 94429120 50.Individuals 0 0 0 0 0 0 0 0 0 b) Other .11 6XE7RWDO $.29 0 d) Banks / Fl 0 0 0 0 0 0 0 0 0 e) Any Other (specify) 0 0 0 0 0 0 0 0 0 541000 0 541000 0.48) 21129205 80471 21209676 80271 27058631 14.29 541000 0 541000 0.29 541000 0 541000 0.

.

7RWDO6KDUHKROGLQJRI Promoters & Promoter *URXS $.

$.

.

 $.

.

Public Shareholding . B.

15 56475 231340 287815 0. 0 0 0 0 0 0 0 0 0 d) State Govt. Institutions a) Mutual Funds b) Banks / FI c) Central Govt.91) 6XE7RWDO %.(s) 56475 231340 287815 0.16 (4.15 0 e) Venture Capital Funds 0 0 0 0 0 0 0 0 0 f) Insurance Companies 0 0 0 0 0 0 0 0 0 g) FIIs 31328117 17175 31345292 16475 22834842 12.40 (1.54) h) Foreign Venture Capital Funds 0 0 0 0 0 0 0 0 0 i) Any Other (specify) 0 0 0 0 0 0 0 0 0 60296093 357606 60653699 356706 57082534 30.

.

16 6872626 11.70 22818367 32.30 26978360 16. 4.31 56725828 65 .

ACC Limited .96KDUHKROGLQJ3DWWHUQ (TXLW\6KDUH&DSLWDO%UHDNXSDVSHUFHQWDJHRI7RWDO(TXLW\.

L.

&DWHJRU\ZLVH6KDUHKROGLQJ &DWHJRU\RI Shareholders 1RRI6KDUHVKHOGDWWKHEHJLQQLQJRIWKH\HDU -DQXDU\.

Demat 3K\VLFDO Total RI7RWDO Shares % Change RI7RWDO during WKH\HDU Shares 1RRI6KDUHVKHOGDWWKHHQGRIWKH\HDU 'HFHPEHU.

Demat 3K\VLFDO Total .

Non-Institutions D.

Bodies Corporate i) Indian ii) Overseas E.

19) 0 0 0 0 0 0 0 0 0 i) Individual Shareholders 14303617 holding nominal share capital upto ` 1 lakh 6405742 20709359 6009260 20285842 10.81 (0.52 4245164 125371 4370535 2.33 (1.22) ii) Individual Shareholders holding nominal share FDSLWDOLQH[FHVVRI` 1 lakh 962894 2858517 F. Individuals 6479350 133311 6612661 3.

$Q\2WKHU 6SHFLI\.

i) Shares held by Pakistani citizens vested with the Custodian of Enemy Property ii) Other Foreign Nationals iii) Foreign Bodies iv) 1895623 11.19 5884162 0 5884162 3.13 2.11 (0.11 207887 0 207887 0.52 2080644 0 2080644 1.77 3086 0 3086 0 854 0 854 0 0 358164 0 358164 0.15 0.94 0 0 0 0 0 0 0 0 0 6XE7RWDO %.38 2163477 0 2163477 1.1) 900 0 900 0 168901 0 168901 0.09 0 0 0 0 0 0 0 0 0 NRI / OCBs 591806 209350 801156 0.09 0.43 648175 207460 855635 0.03 v) Clearing Members / Clearing House 214940 0 214940 0.21 0 215765 215765 0.03 14276582 1.11 0 vi) Trusts 717789 0 717789 0.46 0.11 (0.41) 0 385965 385965 0.

.

 24565275 8097262 32662537 17.40 29675846 6557856 36233702 19.30 1.90 Total Public Shareholding %.

 %.

.

 %.

.

00 0 vii) Limited Liability Partnership viii) Foreign Portfolio Investors (Corporate) L[. 84861368 8454868 93316236 49.70 86401674 6914562 93316236 49.00 180830794 6914562 187745356 100.70 0 179290488 8454868 187745356 100.

C. 4XDOLoHG)RUHLJQ Investor 6KDUHVKHOGE\&XVWRGLDQ IRU*'5V $'5V *UDQG7RWDO $.

 %.

 &.

66 .

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies LL.

6KDUHKROGLQJRI3URPRWHUV LQFOXGLQJ3URPRWHU*URXS.

Shareholder’s Name Holcim (India) Private Limted Holderind Investments Limited Total 6KDUHKROGLQJDWWKHEHJLQQLQJRIWKH\HDU 6KDUHKROGLQJDWWKHHQGRIWKH\HDU % change in -DQXDU\.

'HFHPEHU.

29 0 541000 0.30 0 94429120 50.29 0 0 94429120 50.01 0 0 541000 0. shareholding during the 1RRI RIWRWDO RI6KDUHV RI6KDUHV 1RRI RIWRWDO \HDU Shares VKDUHVRIWKH Pledged / Pledged / Shares shares &RPSDQ\ encumbered to encumbered to RIWKH total shares total shares &RPSDQ\ 93888120 50.01 0 93888120 50.30 0 0 LLL.

&KDQJHLQ3URPRWHUV LQFOXGLQJ3URPRWHU*URXS

6KDUHKROGLQJ 3OHDVH6SHFLI\LIWKHUHLVQRFKDQJH

6KDUHKROGLQJDWWKHEHJLQQLQJRIWKH\HDU
-DQXDU\

1RRI6KDUHV 
RIWRWDOVKDUHV
RIWKH&RPSDQ\
At the beginning of the year
Datewise increase / decrease in
Promoters Shareholding during the
year specifying the reasons for increase
/ decrease (e.g) allotment/ transfer/
bonus / Sweat Equity etc)
At the end of the year

&XPXODWLYH6KDUHKROGLQJGXULQJWKH\HDU
-DQWR'HF

1RRI6KDUHV 
RIWRWDOVKDUHV
RIWKH&RPSDQ\

No Change during the year

LY

6KDUHKROGLQJ3DWWHUQRI7RS7HQ6KDUHKROGHUV 2WKHUWKDQ'LUHFWRUV3URPRWHUVDQG+ROGHUVRI*'5VDQG$'5V

2015 Sl. 1 2 /LIH.QVXUDQFH&RUSRUDWLRQRI.QGLD At the beginning of the year Bought during the year Sold during the year At the end of the year $EHUGHHQ*OREDO. as on December 31.QGLDQ(TXLW\ 0DXULWLXV. 1DPHRIVKDUHKROGHUV No.

/LPLWHG Shareholding at the Cumulative Shareholding EHJLQQLQJRIWKH\HDU GXULQJWKH\HDU -DQXDU\.

-DQWR'HF.

1RRIVKDUHV RIWRWDO 1RRIVKDUHV RIWRWDO VKDUHVRI VKDUHVRI WKHFRPSDQ\ WKHFRPSDQ\ 17971429 4285327 82005 - 9.81 11.QGLDQ(TXLW\/LPLWHG IURP.01 - 1994039 88854 88854 1.05 )XQGQDPHFKDQJHGWRC$EHUGHHQ*OREDO.09 0.00 1.00 0.11 2.00 - 2546356 2546356 2546356 1.26 0.81 3968936 0 200000 - 2.57 2.85 11.11 - 3968936 3768936 3768936 2.28 0.11 0.06 0.04 - 22256756 22174751 22174751 11.01 2.05 0.06 0.36 1.36 1994039 0 1905185 - 1.01 2054678 491678 0 - 1.36 1.

3 4 At the beginning of the year Bought during the year Sold during the year At the end of the year -30RUJDQ6LFDY.QYHVWPHQW&RPSDQ\ 0DXULWLXV.

/LPLWHG At the beginning of the year Bought during the year Sold during the year At the end of the year $UDQGD.QYHVWPHQWV 0DXULWLXV.

3WH/WG At the beginning of the year Bought during the year Sold during the year At the end of the year 67 .

ACC Limited Sl. 5 6 7 8 9 10 Shareholding at the Cumulative Shareholding EHJLQQLQJRIWKH\HDU GXULQJWKH\HDU -DQXDU\. 1DPHRIVKDUHKROGHUV No.

-DQWR'HF.

QYHVWPHQW&RPSDQ\ 0DXULWLXV.QGLDQ.QYHVWPHQW$XWKRULW\-KHOXP At the beginning of the year Bought during the year Sold during the year At the end of the year -30RUJDQ. RIWRWDO 1RRIVKDUHV RIWRWDO 1RRIVKDUHV VKDUHVRI VKDUHVRI WKHFRPSDQ\ WKHFRPSDQ\ JP Morgan India Fund At the beginning of the year Bought during the year Sold during the year At the end of the year ICICI3UXGHQWLDO/LIH.QVXUDQFH&RPSDQ\/WG At the beginning of the year Bought during the year Sold during the year At the end of the year $EX'KDEL.

55 0.00 0.00 - 1358211 1358211 1358211 0.72 1041660 758927 131244 - 0.78 0.17 1.39 Notes: 7KHDERYHLQIRUPDWLRQLVEDVHGRQWKHZHHNO\EHQHoFLDU\SRVLWLRQUHFHLYHGIURP'HSRVLWRULHV The datewise increase or decrease in shareholding of the top ten shareholders is available on the website of the Company www.QGH[)XQG$6HULHV RI9DQJXDUG.07 - 1800587 1669343 1669343 0.34 0.58 0.89 0.10 0.54 0.40 0.12 - 1033438 814188 814188 0.acclimted.15 0.com Y.50 0.39 0.89 1033438 0 219250 - 0.83 0.13 1.QGH[)XQG At the beginning of the year Bought during the year Sold during the year At the end of the year 1561882 634106 80000 - 0.54 1083211 275000 0 - 0.43 0.QWHUQDWLRQDO(TXLW\.96 0.12 - 949352 730371 730371 0.51 0.13 1473109 186185 654168 - 0.72 0.88 0./LPLWHG At the beginning of the year Bought during the year Sold during the year At the end of the year -30RUJDQ)XQGV(PHUJLQJ0DUNHWV(TXLW\)XQG At the beginning of the year Bought during the year Sold during the year At the end of the year 9DQJXDUG(PHUJLQJ0DUNHWV6WRFN.55 0.04 - 2195988 2115988 2115988 1.00 0.43 940798 8554 218981 - 0.55 0.72 0.35 - 1659294 1005126 1005126 0.

6KDUHKROGLQJRI'LUHFWRUVDQG.g allotment / transfer / bonus / Sweat Equity etc) At the end of the year 68 6KDUHKROGLQJDWWKHEHJLQQLQJRI Cumulative Shareholding during WKH\HDU WKH\HDU -DQXDU\.H\0DQDJHULDO3HUVRQQHO 1DPHRIWKH'LUHFWRU At the beginning of the year Datewise increase / decrease in shareholding during the year specifying the reason for increase / decrease (e.

-DQWR'HF.

1RRI6KDUHV RIWRWDOVKDUHVRI 1RRI6KDUHV RIWRWDOVKDUHVRI WKHFRPSDQ\ WKHFRPSDQ\ None of the Directors hold shares in the Company .

Corporate Overview Financial Highlights Board & Management Reports 1DPHRIWKH .H\0DQDJHULDO3HUVRQQHO Financial Statements Subsidiary Companies Cumulative Shareholding during WKH\HDU -DQWR'HF.

6KDUHKROGLQJDWWKHEHJLQQLQJRI WKH\HDU -DQXDU\.

00 200 0. 1RRI6KDUHV RIWRWDOVKDUHVRI 1RRI6KDUHV WKHFRPSDQ\ RIWRWDO6KDUHVRI WKHFRPSDQ\ 0U6XQLO.g allotment / transfer / bonus / Sweat Equity etc) At the end of the year 05 0.1D\DN &KLHI)LQDQFLDO2IoFHU At the beginning of the year Datewise increase / decrease in shareholding during the year specifying the reason for increase / decrease (e.00 - - - 200 0.00 05 0.g allotment / transfer / bonus / Sweat Equity etc) At the end of the year 9.00 - - - - 200 0.00 0U%XUMRU'1DULPDQ &RPSDQ\6HFUHWDU\ +HDG&RPSOLDQFH At the beginning of the year Datewise increase / decrease in shareholding during the year specifying the reason for increase / decrease (e.00 05 0.00 - - - - 05 0.00 200 0.

94 Reduction - - - - Net Change - - - - 7RWDO LLLLLL.QGHEWHGQHVV .02 0..02 0.02 Addition - 37.94 - 37.02 ii) Interest due but not paid - - - - iii) Interest accrued but not due - - - - - - 0.QGHEWHGQHVVDWWKHEHJLQQLQJRIWKHoQDQFLDO\HDU i) Principal Amount - - 0.QGHEWHGQHVVRIWKH&RPSDQ\LQFOXGLQJLQWHUHVWRXWVWDQGLQJDFFUXHGEXWQRWGXHIRUSD\PHQW Secured Loans H[FOXGLQJ deposits Unsecured Loans Deposits Total Indebtedness ` Crore .

44 - 2. &KDQJHLQ.96 7RWDO LLLLLL.02 35.QGHEWHGQHVVGXULQJWKHoQDQFLDO\HDU .QGHEWHGQHVVDWWKHHQGRIWKH)LQDQFLDO\HDU i) Principal Amount - 35.50 0.44 - 37.52 ii) Interest due but not paid - - - - iii) Interest accrued but not due - 2.02 37.94 0.

69 .

ACC Limited 9.

H\0DQDJHULDO3HUVRQQHO A. 5HPXQHUDWLRQRI'LUHFWRUVDQG. Remuneration to Managing Director. 1 Mr Harish Badami Total Amount `ODNKV. Whole-time Director and/or Manager Sr. 3DUWLFXODUVRI5HPXQHUDWLRQ No.

Gross Salary (a) Salary as per provisions contained in Section 17(1) of the .QFRPH7D[$FW 529.96 529.40 0.96 0.40 F.

3URoWVLQOLHXRIVDODU\XQGHU6HFWLRQ .

.QFRPH7D[$FW Nil Nil 2 Stock Options Nil Nil 3 Sweat Equity Nil Nil 4 Commission Nil Nil 5 Others E.

9DOXHRISHUTXLVLWHVXQGHU6HFWLRQ .

Roongta Mr.. Sekhsaria Haribhakti Fee for attending Board / Committee Meetings Commission Mr. Mr.55 569.55 Ceiling as per Companies Act. 2013 B. Dani Mr.QFRPH7D[$FW i Deferred bonus (to be decided by the Board of Directors at a later date) ii Retirals TOTAL - - 39. Gandhi 0V1D\DU Kavarana Total Amount `ODNKV. Independent Directors 1DPHRI'LUHFWRU 3DUWLFXODUVRI5HPXQHUDWLRQ Mr.19 569. Remuneration to Other Directors 1.19 39. Mr.

10 Others.50 34.30 34. Please specify 6XE7RWDO %.40 5.00 16.30 3.30 19. 4.50 6.40 33.00 28.00 28.10 37.00 35.00 28.00 199.70 6.00 7.70 40.00 41.00 34.30 6.00 28.90 40.90 239.

.

Terver Mr. Sharma Fee for attending Board / Committee Meetings Commission Mr Eric Olsen 0U&KULVWRI Hassig Mr. Bernard Mr. 2WKHU1RQ([HFXWLYH'LUHFWRUV 3DUWLFXODUVRI5HPXQHUDWLRQ 1DPHRI'LUHFWRU Mr. Aidan Fontana /\QDP retired during retired during WKH\HDU WKH\HDU Total Amount `ODNKV.

68 8.50 8.51 10.00 14.80 28.00 0.50 69. Please specify 6XE7RWDO %.50 1.00 7.50 Others.18 9.32 1.50 1.32 1.50 1.00 16.51 36. 8.30 18.01 8.30 2.

.

7RWDO %.

  %.

.

 %.

.

41 1RWH&RPPLVVLRQUHODWHVWRWKHoQDQFLDO\HDUHQGHG'HFHPEHU7KLVZLOOEHSDLGDIWHUWKH$QQXDO*HQHUDO Meeting to be held on April 13.31 323. 2016. 84. 70 .

1D\DN 0U%XUMRU'1DULPDQ Total &KLHI)LQDQFLDO &RPSDQ\6HFUHWDU\  Amount ` Lakh Head Compliance 2IoFHU Gross Salary (a) Salary as per provisions contained in Section 17(1) of the .H\0DQDJHULDO3HUVRQQHO 0U6XQLO. 1 .QFRPH7D[$FW 233.28 119.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies &5HPXQHUDWLRQWR.07 352.H\0DQDJHULDO3HUVRQQHORWKHUWKDQ0'0DQDJHU:7' Sr. 3DUWLFXODURI5HPXQHUDWLRQ No.35 E.

9DOXHRISHUTXLVLWHVXQGHU6HFWLRQ .

QFRPH7D[$FW Nil Nil Nil F..

3URoWVLQOLHXRIVDODU\XQGHU6HFWLRQ .

please specify ..QFRPH7D[$FW Nil Nil Nil 2 Stock Options Nil Nil Nil 3 Sweat Equity Nil Nil Nil 4 Commission Nil Nil Nil 5 Others.Retirals 7RWDO &.

17.54 9.19 250.80 124.52 5.74 375.67 23.

N S Sekhsaria Chairman Mumbai February 10.3HQDOWLHV3XQLVKPHQWV&RPSRXQGLQJRI2IIHQFHV There were no penalties / punishments / compounding of offences for the year ended December 31. 2016 71 . 2015.

ACC Limited ANNEXURE ‘G’ TO BOARD’S REPORT  .21 .2138568$17726(&7.1)250$7.

$/3(56211(/.7+58/(2)7+(&203$1.212)0$1$*(5.170(17$1'5(081(5$7.(6 $332.5($':.

1RQ([HFXWLYH and Independent Directors &KDQJH .58/(6  5DWLRRI5HPXQHUDWLRQRI1RQ([HFXWLYH'LUHFWRUVWRWKHPHGLDQUHPXQHUDWLRQRIWKHHPSOR\HHVRIWKH&RPSDQ\ for the year 2015.

50 -8% 7 0U9LMD\.00 28. N.32 0. Ratio to median Remuneration 2015 2014 Mr.01 0.42 11% 4 Mr Arunkumar Gandhi 34. Sushil Kumar Roongta 28. Bernard Fontana .00 NIL 7 Mr.00 * 2 Mr.e.00 * 0 Mr.2015 1.appointed w. Bernard Terver 28. Sekhsaria 37. Aidan Lynam resigned as Director w.05 45% 4 Mr Christof Hassig .07.XPDU Sharma 16.00 NIL 7 Mr.50 16.22 53% 8 Mrs Falguni Nayar 16.f. Eric Olsen appointed w.00 28.00 11. 17.00 NIL 7 Mr.00 * 2 * for part of the Year 72 Remuneration in `/DNK. 17.e.00 NIL 9 Mr.07.00 NIL 7 Mr. Kavarana 28.00 28.2015 8.00 14. S. 09.e.12.00 37.07.resigned as a Director w.00 22. K. 14.f. Ashwin Dani 28.2015 7.e.f.00 28. Shailesh Haribhakti 28.2015 8. F.00 30.68 16.00 * 2 Mr.f.

.

Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies Ratio of remuneration of Key Managerial Personnel (KMP) against the performance of the company: Whole.time Directors & KMP Remuneration in `LQ/DNKV.Corporate Overview 2.

Ratio to median &KDQJH .

5% in 2015 as compared to 2014.04 30 2* 7% 0.022 0.368. the Company has decided to SD\VL[PRQWKO\ERQXVLQWKH\HDUZKLFKLVLQGLFDWHGLQWKHSHUFHQWDJHLQFUHDVHLQWKHUHPXQHUDWLRQFROXPQ 3. Market Capitalization & Price Earnings Ratio details are as under: As on December 31. Median Remuneration of both the employees and the Key Managerial Personnel has increased by 10.968 Sunil Nayak Chief Financial 2IoFHU 250. 5. 5HDVRQVIRUGHFUHDVHLQSURoWVKDYHEHHQH[SODLQHGLQ%RDUG V5HSRUW 8. The number of permanent employees on the rolls of th Company were 8.80 202.73 122. 2015 As on December 31.82 60 24* 10% 0. * Generally CEO&MD and other Key Managerial Personnel are eligible for annual bonus.212 # Remuneration paid in to 2015 is not comparable to the remuneration paid in 2014 since CEO & MD was appointed with effect from August 2014.  7KHH[SODQDWLRQRQWKHUHODWLRQVKLSEHWZHHQDYHUDJHLQFUHDVHLQUHPXQHUDWLRQDQG&RPSDQ\SHUIRUPDQFHLV7KH PHGLDQUHPXQHUDWLRQLQFUHDVHGE\LQZKHUHDVWKH3URoWDIWHU7D[GHFUHDVHGE\7KHFRPSHQVDWLRQ structure is benchmarked from time to time and salary increase during the year are alligned to market forces. 4. Remuneration % Increase LQ&7&RI (PSOR\HHV Revenue 1HW3URoW 5DWLRRI Remuneration to 2015 2014 Harish Badami CEO & MD 569.425 %XUMDU1DULPDQ Company Secretary & Head Compliance 124.H\ 0DQDJHULDO 3HUVRQQHO DQG HPSOR\HHV LV DV SHU WKH Remuneration policy of the Company.050 0.011 0. The ratio of the remuneration of the highest paid Director to that employees who are not Directors but receive UHPXQHUDWLRQLQH[FHVVRIWKHKLJKHVWSDLG'LUHFWRUVGXULQJWKH\HDU1RWDSSOLFDEOH  :H DIoUP WKDW WKH UHPXQHUDWLRQ SDLG WR 'LUHFWRUV .92 137 83* 9% 0. 2014 Increase/ 'HFUHDVH. However.55# 310.

 .

546 26. 73 .287 (2.82) The Company has not made any public issue of shares.56 90. Price Earnings Ratio 43.91 Market Capitalization (` in crore) 25.07 22.

lays down policy guidelines and ensures implementation of the decisions of the Board of Directors and its various committees. 2015 (hereinafter referred to as “SEBI Regulations”) is given below: and accountability in the Company’s dealing with its Members and other stakeholders and the utilization of resources for creating sustainable growth and societal wealth. Risk Management Committee. business partners. employees and other Stakeholders. The Company’s focus on sustainable development. 2015.The Board of Directors and its Committees play a fundamental role in upholding and nurturing the principles of good governance which translates into ethical business practices.This Committee FRPSULVHV WKH &KLHI ([HFXWLYH 2IoFHU  0DQDJLQJ 'LUHFWRU&KLHI)LQDQFLDO2IoFHU&KLHI0DQXIDFWXULQJ 2IoFHU&KLHI0DUNHWLQJ2IoFHU&KLHI3HRSOH2IoFHU &KLHI &RUSRUDWH 6HUYLFHV 2IoFHU DQG &KLHI &HQWUDO 3URFXUHPHQW2IoFHU7KH&RPPLWWHHRSHUDWHVZLWKLQ the framework of the strategic policies laid down by the Board and is responsible and accountable for overall business deliverables. its EthicalView Reporting Policy and its well structured internal control systems which are subjected to regular review for their effectiveness. COMPANY’S PHILOSOPHY ON CORPORATE GOVERNANCE The Governance Philosophy of your Company is founded on a bedrock of ethical values and professionalism which over the past 80 years of the Company’s existence has become a part of its culture and DNA.Management Structure for the day-to-day business operations and management of the Company is in place with appropriate delegation of powers and responsibilities. The majority of the Directors on the Board including the Chairman are Independent Directors who have considerable expertise DQGH[SHULHQFHLQWKHLUUHVSHFWLYHoHOGV Committee of Directors . discuss and decide on cross GOVERNANCE STRUCTURE ACC’s Governance structure comprises the Board of Directors and the Committees of the Board at the apex level and the Management structure at the operational level. The Company’s Code of Business Conduct. reinforces accountability and integrity of reporting and ensures transparency and fairness in dealing with the Company’s stakeholders.ACC Limited CORPORATE GOVERNANCE The Directors present the Company’s Report on Corporate Governance for the year ended December 31. fairness. its customer centric approach to creating value for the customers by ensuring product quality and innovative service offerings coupled with its outreach to the communities it impacts through CSR activities and programmes has enabled your Company to earn the trust and goodwill of its investors. He gives strategic directions. Corporate Social Responsibility (CSR) Committee which are mandatory Committees and the Compliance Committee and Capex Committee which are non-mandatory. A Report on compliance with the principles of Corporate Governance as prescribed by The Securities and Exchange Board of India (SEBI) in Chapter IV read with Schedule V of SEBI (Listing Obligations and Disclosure Requirements) Regulations. v Executive Committee (ExCo) .Recognizing the immense contribution that committees make in assisting the Board of Directors in discharging its duties and responsibilities and with a view to have a close focus on various facets of the business. This broadly is as under: v &KLHI ([HFXWLYH 2IoFHU  0DQDJLQJ 'LUHFWRU  The &KLHI ([HFXWLYH 2IoFHU DQG 0DQDJLQJ 'LUHFWRU (CEO&MD) is in overall operational control and responsible for the day-to-day working of the Company. This brings about a conducive environment for value creation through sustainable SURoWDEOHJURZWK Board of Directors . transparency. The Committee provides a platform for the ExCo Members to meet on a regular basis to review monthly performance against set targets. the Board has constituted the following Committees viz. Management Structure . Integrity. Audit Committee. The Board’s composition and size is robust and enables it to deal competently with emerging business issues and exercise independent judgement. The Board operates within the framework of a well GHoQHGUHVSRQVLELOLW\PDWUL[ZKLFKHQDEOHVLWWRGLVFKDUJH LWV oGXFLDU\ GXWLHV RI VDIHJXDUGLQJ WKH LQWHUHVWV RI WKH Company. Stakeholders’ Relationship Committee. Nomination & Remuneration Committee. accountability and compliance with the law are embedded in the Company’s robust business practices to ensure ethical and responsible leadership both at the Board and at the Management level. This structure brings about a judicious blend in governance as the Board sets out the overall corporate objectives and provides direction and independence to the Management to achieve these corporate objectives within a given framework. transparency 74 .

interalia. after reviewing its organizational capabilities. capability building of employees. The Director Plant reports to the respective Manufacturing Cluster Heads in the Region. This has resulted in leveraging functional expertise in driving business objectives and become ready to address various operational and business challenges in a more proactive manner thereby enhancing customer value. Corporate Services. Sales & Marketing.Corporate Overview Financial Highlights Board & Management Reports functional operational matter. Manufacturing. Each of these verticals operate under the overall supervision of the respective function head who is an ExCo Member. &(2 0' ExCo 6DOHV  Marketing ICI Business Logistics Concrete Business Corp . West & Central and East. Services Manufacturing Human Resource Finance Procurement Cluster Heads Legal Director Plants 6HFUHWDULDO  Compliance Techport Geocycle + 6 Internal Audit function reports to the Chairman of the Audit Committee 75 . adoption of best practices. coordination of demand / supply as per market requirements and to support sales and logistics team in the despatch of cement from the respective Units. systems and processes. The Cement Plants and Marketing Units are grouped into four region-wise clusters viz. address various business challenges and monitor implementation of decisions taken. South. The new function based structure is broadly divided into verticals viz. The Projects Cluster Head reports to the CEO&MD. The plant. Human Resource. accountable for ensuring continuous improvement in the operations and maintenance performance of the Plants. marketing. logistics and administrative related procurement activities are managed by an India 3URFXUHPHQW 2UJDQL]DWLRQ DQG H[HFXWHG IURP oYH 3URFXUHPHQW&OXVWHU2IoFHV Taking into consideration that the Jamul and Sindri Projects are at an advanced stage of completion. Finance and Procurement. the Regional Director Finance and the Regional HR Head have a direct reporting line to the respective Vertical Head who is an ExCo Member. North. Roles and Responsibilities During the year. Organization Structure. the region based organization structure was replaced by a function based structure. The Director Plant of manufacturing units is responsible for the day-to-day operations and maintenance of the Plant and all related functions including addressing local issues and compliances as applicable at plant level. They are. Legal and common functions such as Techport and Geocycle India also report to the CEO&MD. The other functions like Health and Safety (H&S). The Regional Director Sales. Secretarial & Compliance. productivity improvement. a Projects Cluster has been set up for a closer monitoring of the Projects. The manufacturing vertical has a Manufacturing Cluster Head in each Region who reports to the Chief 0DQXIDFWXULQJ 2IoFHU 7KH 0DQXIDFWXULQJ &OXVWHU +HDG Financial Statements Subsidiary Companies are in overall charge of all the Plants which are part of the cluster under their control.

GHQWLoFDWLRQ 1XPEHU (DIN: 00276351) Mr Sekhsaria is the Chairman of the Board of Directors and a Non-Executive and an Independent Director. Mr Sekhsaria championed community development by establishing the Ambuja Cement 76 Foundation and guiding it into a model of excellence in social responsibility. 0U 1 6 6HNKVDULD  'LUHFWRU . In 2006. $oUVWJHQHUDWLRQLQGXVWULDOLVW0U6HNKVDULDREWDLQHGKLV Bachelor degree in Chemical Engineering with honours and distinction from the University of Bombay. in 1976. 2015 Category No of Directors Non-Executive & Independent Directors including a Woman Director 7 Other Non-Executive Directors 4 Executive Director (CEO & Managing Director) 1 Total 12 The Chairman of the Board of Directors is a Non-Executive and an Independent Director. Paris.QGLD DQG UHGHoQHG LQGXVWU\ SUDFWLFHV E\ FKDQJLQJ the perception of cement from a commodity to a branded product. The impact of this guidance is visible in the high growth trajectory ACC has experienced since 1999.(DIN: 02298385) Mr Badami is the &KLHI ([HFXWLYH 2IoFHU  0DQDJLQJ 'LUHFWRU &(2 0'. Mr Sekhsaria took over as Chairman of the Board. Mr Sekhsaria is a doyen of the Indian Cement Industry and one of the most respected business personalities in India. Mr Sekhsaria built Ambuja Cements Limited into a benchmark for Indian Cement Industry. Mr Terver also has a strong track UHFRUGLQoQDQFLDOSHUIRUPDQFHDQG2FFXSDWLRQDO+HDOWK & Safety. which enhances the quality of the Board’s decision making process. logistics and overall cost-competitiveness. 2000.ACC Limited BOARD OF DIRECTORS Composition of the Board as on December 31. His acumen as an entrepreneur and technocrat turned that Company LQWR WKH PRVW HIoFLHQW DQG SURoWDEOH FHPHQW FRPSDQ\ LQ . he is responsible for overseeing the operations of LafargeHolcim group companies in India. Under his OHDGHUVKLS $&& KDV DFKLHYHG VLJQLoFDQW LPSURYHPHQWV in the areas of project management. Mr Bernard Terver . Presently. The composition of the Board of Directors is in conformity with the SEBI Regulations. Mr Terver is Chairman of the Stakeholders’ Relationship Committee and Capex Committee and a Member on the Audit Committee. 'LUHFWRUV 3URoOH The Board of Directors comprises highly renowned SURIHVVLRQDOVGUDZQIURPGLYHUVHoHOGV7KH\FROOHFWLYHO\ bring with them a range of skills and experience to the Board. He introduced new standards in management. (Mr Terver has resigned from the Board of Directors with effect from February 11. Mr Sekhsaria is a Member on the Nomination & Remuneration Committee of the Board. where he held various senior positions. Mr Sekhsaria was invited to join the ACC Board in 1999 and was appointed Deputy Chairman in January. Risk Management Committee. He has DZRUNH[SHULHQFHRIRYHUWKLUW\oYH\HDUVLQWKHFHPHQW business and has been in the services of Holcim Limited since 1994. Mr Terver graduated from Ecole Polytechnique. Mr Sekhsaria brings immense value to the Board of ACC. He is the Principal Founder-Promoter and current Chairman of Ambuja Cements Limited. In addition to his rich operational experience in cement and aggregates business. With his considerable wealth of experience.(DIN: 06771125) Mr Terver is the Deputy Chairman of the Board of Directors and is a Non-Executive and Non-Independent Director. 2016.) Mr Harish Badami . Corporate Social Responsibility Committee and the Compliance Committee of the Board. PDUNHWLQJ HIoFLHQF\ DQG FRUSRUDWH VRFLDO UHVSRQVLELOLW\ to an industry he helped transform. Nomination & Remuneration Committee.

Dow Chemical India and Celanese Chemicals India Private Limited. Mr Badami has been conferred with the Distinguished Alumnus Award by IIT Bombay. Mr Badami is a B. In these roles. Mr Badami was responsible for developing integrated strategies for the local subsidiaries including implementation of robust business plans. his alma mater.0 &DOFXWWD +H KDV RYHU WZHQW\oYH years experience in the Chemical Industry with leading multinational companies viz.Tech from IIT Bombay DQG DQ 0%$ IURP . of the Company. Rohm and Haas India. . ICI.. Mr Badami was the President and Managing Director of Dow Chemical India during the period 20092011 and was the Managing Director of Celanese Chemicals India Private Limited prior to his joining ACC. building organizational capability and manufacturing footprint.

Pilani and a Post Graduate Diploma in Business Management – International Trade from the Indian Institute of Foreign Trade (IIFT). constituted by the Planning Commission. (now known as Institute of Chemical Technology (ICT). during his tenure as Chairman of SAIL from August 2006 to May 2010. He has also been a Member of the Committee formed by the Ministry of Corporate Affairs. to formulate Policy Document on Corporate Governance.f. Mr Haribhakti is the Chairman of the Risk Management Committee and CSR Committee. Evolving from a background in Audit. and holds a Master of Business Administration from HEC International Business School in Paris. Mr Olsen started his FDUHHULQWKHoHOGRI0 $DW'HORLWWH 7RXFKH%DQTXH Paribas and was a partner of Trinity Associates. He holds a BSc (Hons) degree from the Institute of Science. 2015 as a Non-Executive and Non-Independent Director. University of Mumbai. (now known as BASF). Mr Eric Olsen . He is associated with several academic institutions. Chartered Accountants.K. He holds a degree in Bachelor of Engineering from Birla Institute of Technology & Science (BITS). He is also a Board Member of Cimpress N. Prior to joining Lafarge Limited. C1RWIRU3URoW2UJDQL]DWLRQV DQGLVD0HPEHURIVHYHUDO Advisory Boards. He is a strong supporter of a clean and green environment and is pioneering the concept of ‘innovating to zero’ in the social context. Mr Roongta has a wide and varied experience in public sector undertakings. Earlier. CSR Committee.T. serves on Boards of multinational and Indian Companies.Sc.e. Mr Dani started his career in 1967. LLP. He is Non-Executive Chairman of Bharat Aluminium Company Limited (BALCO) and Talwandi Sabo Power Limited (TSPL). Mr Roongta headed a “Panel of Experts on the Reforms in the Central PSEs”. He is a Managing Partner of Haribhakti & Co. Capex Committee and Compliance Committee of the Board. He completed B. (Tech) . As CEO&MD of ACC.QWHUQDO$XGLWRU Financial Planner and Fraud Examiner. the ranking of SAIL among ‘World Class Steel Makers’ moved up to the second position from the seventeenth position. Mr Roongta is a Member on the Audit Committee of the Board.(DIN: 00009126) Mr Dani is a Non-Executive and Independent Director. His strong belief is that good governance is a sustainable competitive advantage creator.Paints. Stakeholders’ Relationship Committee and Compliance Committee. Mr Olsen is a Member on the Nomination & Remuneration Committee. Mr Shailesh Haribhakti . July 17. New Delhi. Risk Management Committee. He is a Member on the Nomination & Remuneration Committee. 6LQFH -XO\  0U 2OVHQ LV WKH &KLHI ([HFXWLYH 2IoFHU of LafargeHolcim Ltd. Mr Haribhakti is a deeply engaged Independent Director. and has been the Chairman. University of Mumbai.(DIN: 00007347) Mr Haribhakti is a Non-Executive and Independent Director. IIT Bhubaneswar (2012-2015) and is a member of Board of Management. He was formerly Executive Vice President Operations of Lafarge and a member of its Executive Committee. Pigments and Varnishes from U.Individual Category. He is a Fellow of All India Management Association (AIMA). Mr Badami is in overall control and responsible for the day-to-day working of the Company.Corporate Overview Financial Highlights Board & Management Reports Mr Badami is a Member of the Stakeholders’ Relationship Committee.V. as per World Steel Dynamics. He is also associated with apex chambers. being member of Steering Committee of Federation of Indian Chambers of Commerce and Industry (FICCI) and is the Chairman of its Metal Committee. Board of Governors. Mr Ashwin Dani . as a Development Chemist with Inmont Corp. USA). Lakshmipat University. He is currently Chairman of the National Pension Scheme Trust of India. USA. he now seeks to create enduring value for Companies and Organizations he is involved with. He is a &KDUWHUHG &RVW$FFRXQWDQWDFHUWLoHG. J. He also chairs the National Expert Committee on Minerals & Metals of Indian Chambers of Commerce (ICC). Mr Roongta is a recipient of several awards and accolades including SCOPE Award for excellence and outstanding contribution to the Public Sector Management . Financial Statements Subsidiary Companies Mr S K Roongta . Tax and Consulting.D. He holds a Masters Degree in Polymer Science (USA) and a Diploma in Colour Science (USA).C.(DIN: 07238383) Mr Olsen was appointed w.(DIN: 00309302) Mr Roongta is a Non-Executive and Independent Director. He is a business graduate IURP WKH 8QLYHUVLW\ RI &RORUDGR &HUWLoHG 3XEOLF Accountant (Chicago. 77 .

Executive Director of Tata Motors Limited from 1994 to 2000. he was the Managing Director & Chief ([HFXWLYH2IoFHU/. Tata AIA Life Insurance Company Ltd.Com.. He is a Fellow of the Institute of Chartered Accountants in England & Wales and a Member of the Institute of Chartered Accountants of India. Mr Dani is the past President of the Indian Paint Association (IPA) and has received a number of awards for his contributions to the Paint Industry. He holds a Masters Degree in Science. Trent Limited. He was a member of the Central Board of Trustees . in London and Washington D. Whole-time Director and as Vice Chairman and Managing Director from December 1998 to March 2009. He was the Vice President of Federation of Indian Chambers of Commerce and Industry (FICCI). University of Pennsylvania. He was also Chairman of several Tata Companies in India and abroad . He was a founder Trustee of Childline India Foundation from 1999 to 2014.ACC Limited Detroit.. Mr Dani is the Chairman of the Nomination & Remuneration Committee and is a Member of the Audit Committee of the Board. Mr Kavarana holds a B. responsible for Tata Sons’ overseas operations and investments. (Hons.Employees Provident Fund of the Government of India and was also the President of the Board of Governors of the UDCT (presently ICT) Alumni Association. Trustee .(DIN: 02449088) Mr Sharma is a Non-Executive and Non-Independent Director. Mr Vijay Kumar Sharma . LIC of India. a major supplier of automotive OEM and UHoQLVKHV +H MRLQHG $VLDQ 3DLQWV /WG LQ  DV 6HQLRU Executive and moved through successive senior positions like Director ..R&D.Tata AIG General Insurance Company Ltd. Life Insurance Corporation of India on November 1. he was Vice Chairman & Managing Director of Tata International AG. Switzerland and Tata Ltd. the apex holding companies of the Tata Group. from 2000 to 2005. he is a Member on the Board of Management of ICT Mumbai. Prior to that from 1975 to 1994.) degree of the University of Bombay and an MBA from the Wharton School.C. He has also held senior executive positions within the Tata Group such as Executive Chairman of Tata Asset Management Ltd from 2005 to 2009 and of Tata Infotech Ltd.(DIN: 00027689) Mr Kavarana is a Non-Executive and Independent Director. He is the Chairman of the Compliance Committee of the Board. U. Nomination & Remuneration Committee and the Corporate Social Responsibility Committee of the Board. he was with McKinsey & Co. Mr Dani has a good knowledge of supply chain management.. Currently.&+RXVLQJ)LQDQFH/LPLWHG /. he is the Non-Executive Vice Chairman of Asian Paints Limited. 2013.Nani Palkhivala Memorial Trust and the National Centre for the Performing Arts.K.&+)/. Prior to his taking over as Managing Director. He took charge as Managing Director. Works Director. He is involved with several social and charitable institutions and is Chairman . Tata Projects Limited. Mumbai. USA. Mr Farrokh Kavarana .Lady Tata Memorial 78 Trust. He is a Member of the Audit Committee. From 1970 to 1974. Inc. Currently. He is a recipient of the Dadabhai Naoroji International Millennium Award 2005 and the Wharton India Alumni Award 2009. Mr Kavarana retired in 2014 as a Director of Tata Sons Limited and Tata Industries Limited. after a career spanning four decades.

he is acclaimed as a “Crisis Manager” for stabilizing operations and leading turnaround growth strategies in uniquely challenging situations. re-organizing teams and developing talent.& DV 'LUHFW 5HFUXLW 2IoFHU LQ  and has grown with the Company since then. Business Development. A strategic leader. making it the No. . Branding and Product Development. and Risk Mitigation and Compliance. 1 zone in 2010. During his tenure. he successfully turned around its operations and put it on growth trajectory. recognized for making sweeping improvements to HIoFLHQF\ SURGXFW GHYHORSPHQW  PDUNHWLQJ DQG identifying areas of opportunity. As Zonal Manager in-charge of Southern Zone. During his stint as Senior Divisional Manager. 0U6KDUPD VIRFXVHGOHDGHUVKLSSURoFLHQWLQLQYLJRUDWLQJ staff performance. Processes and Systems. 0U 6KDUPD MRLQHG /. Leadership Development. LICHFL maintained its growth momentum despite volatile markets and adverse macro-economic conditions. LICHFL was adjudged as “Best Housing Finance Company 2011” by CNBC-TV18. As Executive Director of Pension & Group Schemes. a rural division.D SUHPLHUKRXVLQJoQDQFHSURYLGHULQWKHFRXQWU\ZLWKORDQ portfolio exceeding ` 83. had catapulated to Number One position in the country in premium income ahead of all other metro centres.000 crore. His key areas of expertise have been Business Strategy. Karnal. he pioneered the launch of various prestigious pension schemes in the country.

She has held senior positions in various Financial Statements Subsidiary Companies capacities and was the Managing Director and Chief ([HFXWLYH2IoFHURI.2015.f.e.). Currently. Ms Falguni Nayar is a Graduate from Sydenham College of Commerce & Economics and Post Graduate from Indian Institute of Management. He was the Executive Director of Tata Sons Ltd. Mr Fontana holds a degree in Engineering from the Ecole Polytechnique and the Ecole Nationale Superieure des Techniques Avancees in Paris. from August 2003 till August 2008 and was thereafter appointed Director of Tata Sons Ltd. she joined Kotak Mahindra Group to lead the M&A and Project Advisory Initiatives. Mr Gandhi audited several public sector and private sector entities. mergers / demergers etc. believes in “bottom-up approach” and has the ability to see the Big Picture and translate to reality. M. a Fellow Member of the Institute of Chartered Accountants of India and an Associate Member of the Chartered Institute of Taxation.e.(DIN: 00007597) Mr Gandhi is a Non-Executive and Independent Director. He is a Fellow Member of the Institute of Chartered Accountants in England & Wales. This has enabled the Tata Group to acquire critical assets. In these WUDQVDFWLRQV KHDGYLVHGRQEXVLQHVVYDOXDWLRQoQDQFLDO GXH GLOLJHQFH FRXQWHUSDUW\ QHJRWLDWLRQV oQDQFLQJ DQG merger control. In March 2013.07.e. as a partner from 1969 and in 1993 became a Senior Partner upto July 2003. Mr Arunkumar Gandhi . which is an on-line shopping website. In December 2012. Mr Gandhi has been assisting the Tata Group in acquiring diverse assets and companies across the globe. She has also received FICCI Ladies Organization Award for Top Woman Achiever LQWKHoHOGRIEDQNLQJLQ Ms Nayar is a Member on the CSR Committee and Risk Management Committee of the Board.. including global relationship manager and investment banker for multinational corporates in Switzerland and abroad. Ms Nayar has a rich experience of over two and half decades. Mr Gandhi served on the Board of Directors of various Indian and foreign companies. Chartered Accountants. London. 09. Before joining Holcim Limited in 1999. reporting GLUHFWO\WRWKH&KLHI([HFXWLYH2IoFHU In the former Holcim Limited. the Group Insurance Department was moved and integrated into Corporate Finance & Treasury Department. Over the last 20 years. He started his career with 79 .12.f. She started her career as a Manager and Consultant at A F Ferguson & Company. he took over additional responsibilities as head of the newly created Mergers & Acquisitions function on a Group level.2015 as a Non-Executive and Non-Independent Director.RWDN. Ms Nayar was recognized as Top Woman in Business by Business Today in 2009 and 2011. Mr Gandhi is the Chairman of the Audit Committee of the Board. he is an Advisor to the Tata Group. As partner.(DIN: 01680305) Mr Hassig was appointed w. This function spanned across all the geographic regions and included a matrix RUJDQL]DWLRQZLWKWKHoQDQFHGHSDUWPHQWRIWKHRSHUDWLQJ companies in the various countries. Mr Hassig heads the Corporate Strategy and Mergers & Acquisitions function in LafargeHolcim Ltd.QYHVWPHQW%DQNIURPWR 0V1D\DULVWKHIRXQGHUDQG&KLHI([HFXWLYH2IoFHU of Nykaa. resources and access to world class R&D facilities.. Christof Hassig ZRUNHG IRU WZHQW\oYH \HDUV DW 8%6 LQ PDQ\ GLIIHUHQW functions. He is an expert on share valuation and corporate restructuring (i. He was with N. Mr Christof Hassig . on whose Board he served upto March 2013. Directors who resigned during the year Mr Bernard Fontana . 17. Ms Falguni Nayar . he was reporting directly WRWKH&KLHI)LQDQFLDO2IoFHUZLWKPDQ\GLUHFWOLQNVWRDOO RWKHU([HFXWLYH'LUHFWRUVLQFOXGLQJ&KLHI([HFXWLYH2IoFHU )RUWKHSDVWoIWHHQ\HDUVKHEXLOWDQGOHGWKHGHSDUWPHQW Corporate Financing & Treasury.(DIN: 00003633) Ms Nayar is a Non-Executive and Independent Director. Raiji & Co. Ahmedabad.Corporate Overview Financial Highlights Board & Management Reports He has been an inspirational leader who utilizes negotiation skills gained over thirty four years of extensive H[SHULHQFHLQLQVXUDQFHDQGoQDQFLDOVHFWRUVDQGVWURQJO\ connects to the grass root levels.(DIN: 05178749) Mr Fontana who ZDVWKH&KLHI([HFXWLYH2IoFHURI+ROFLP/LPLWHGUHVLJQHG from the Board of Directors w. In 1993. consequent upon his ceasing to be the CEO of former Holcim Limited. He holds a Masters degree in Banking and has completed the Advanced Management Programme at Harvard Business School in 2006.

2015 2 - - Mr Shailesh Haribhakti 17. 80 . 2013 (hereinafter referred to as “the Act”) and “SEBI Regulations” in this regard.08. In addition to the above.E. Mr Fontana thereafter joined ArcelorMittal where he was given the responsibility for HR. 2015 consequent upon his resignation from Holcim Limited.E.2013 2 2 1 Mr Harish Badami 13. Mr Aidan Lynam .I. From 2001 to 2004. he was appointed Head .2010 1 - - (resigned as Director w. Lausanne.2014 7 3 - Mr Christof Hassig 09.04. # information as available on the date of cessation.I.2014 1 1 - Mr Eric Olsen 17.07.07. In 2010.02.12.US Operations. Mr Fontana was a Member of the Executive Committee of the said Company.2011 6 3 2 Mr Farrokh Kavarana 03.2014 5 - - Mr Arunkumar Gandhi 24. Mr Lynam holds a degree in Engineering from the University College of Dublin and an MBA from IMD.2015) * excludes Directorships held in Private Limited Companies. ** committees considered are Audit Committee & Stakeholders’ Relationship Committee including that of ACC.02.I). Foreign Companies and Section 8 Companies. 17.Eng M. All the Directors are compliant with the provisions of the Companies Act.2015) #Mr Aidan Lynam (resigned as Director w. He was subsequently made responsible for HR and the global alliance with Nippon Steel.2013 2 2 - Mr Vijay Kumar Sharma 06. Mr Lynam is a Member of the Institute of Engineers in Ireland (M.12.05. 14.f. Switzerland.07. Chartered Member of the British Institute of Manufacturing Engineers (C. Committee Membership(s) & Chairmanships are counted separately.1999 2 - - Mr Bernard Terver 04.04. He was also a Member of the Management Committee with responsibility for the Automotive Worldwide Business Unit.2006 7 3 4 Mr Sushil Kumar Roongta 03.2015 2 - - #Mr Bernard Fontana 28. Mr Lynam was a Member of the Risk Management Committee and Capex Committee of the Board. During his tenure as a Director of the Company.2014 4 2 1 Ms Falguni Nayar 24.).e.12.03. Name of the Director Date of Appointment *Number of Directorship(s) held in Indian public limited companies (including ACC) **Committee(s) position (including ACC) Member Chairman Mr N S Sekhsaria 27.2011 6 3 1 Mr Ashwin Dani 15. Directors of the Company with effect from July 14.02. Mr )RQWDQD WRRN RYHU DV &KLHI ([HFXWLYH 2IoFHU RI $SHUDP a Luxembourg-domiciled listed corporate group that was spun off from ArcelorMittal. Directorships and Membership on Committees: The total number of Directorships held by the Directors and the position of Membership / Chairmanship on Committees is given below. IT and business development at Flat Carbon Division.(DIN: 03058208) Mr Lynam who was in the services of Holcim Limited resigned from the Board of None of the Directors of the Company and Key Managerial Personnel are inter se related.f.12.04.2012 2 - - 22.E.e.ACC Limited Groupe SNPE in France and in 1998.

QGHSHQGHQW'LUHFWRUVKDYHFRQoUPHGWKDWWKH\PHHW with the criteria of independence laid down under the Act and the SEBI Regulations.pdf INDEPENDENT DIRECTORS Independent Directors play an important role in the governance processes of the Board. relevant Annual Reports. v (YDOXDWLRQ RI WKH SHUIRUPDQFH RI WKH &KDLUPDQ RI the Company. None of the Independent Directors serve as “Independent Directors” in more than seven listed companies. copies of “The Indian Concrete Journal” which is a well accepted journal on civil engineering and construction. governance and internal control processes and other relevant information pertaining to the Company’s business. the functioning of various divisions / departments. the Director is presented with a book on the Company which traces its history over 80 years of its existence. They expressed satisfaction at the robustness of the evaluation process. function. its business and the regulatory framework in which the Company operates and equips him/her to HIIHFWLYHO\IXOoOOKLVKHUUROHDVD'LUHFWRURIWKH&ompany. The above initiatives help the Director to understand the Company. to discuss: v (YDOXDWLRQ RI WKH SHUIRUPDQFH RI 1RQ. 7KH. Their appointment has been approved by the Members of the Company at the Extraordinary General Meeting of the Company held on September 10. the Board’s freedom to express views on the business transacted at the Meetings and the openness with which the Management discussed various subject matters on the agenda of meetings. At the time of appointing a Director. background. v 2WKHUPDWWHUV All the Independent Directors were present throughout the Meeting. age and culture. gender. the Company’s market share and the markets in which it operates. published by the Company.Corporate Overview Financial Highlights Board & Management Reports Board Diversity Your Company has over the years been fortunate to KDYH HPLQHQW SHUVRQV IURP GLYHUVH oHOGV DV 'LUHFWRUV on its Board. They bring to bear their expertise and experience on the deliberations of the Board. The Director is also explained in detail the compliances required from him / her under the Act. perspective. Their suggestions were discussed at the Board Meeting and are being implemented to ensure a more robust interaction at a Board level. Pursuant to SEBI Regulations. SEBI Regulations and other relevant regulations and KLVKHUDIoUPDWLRQWDNHQZLWKUHVSHFWWRWKHVDPH By way of an introduction to the Company. knowledge. the Nomination & Remuneration Committee has formalized a policy on Board Diversity to ensure diversity of experience. “ACC Parivar”. During the year under review. v (YDOXDWLRQ RI WKH TXDOLW\ FRQWHQW DQG WLPHOLQHV RI pRZ RI LQIRUPDWLRQ EHWZHHQ WKH Management and Financial Statements Subsidiary Companies the Board that is necessary for the Board to effectively and reasonably perform its duties. the Independent Directors met on December 8. The Nomination & 5HPXQHUDWLRQ&RPPLWWHHLGHQWLoHVSRWHQWLDOFDQGLGDWHV based on certain laid down criteria and takes into consideration the diversity of the Board. explains his / her role. interalia. INDUCTION PROGRAMME FOR NEW DIRECTORS AND ONGOING FAMILIARIZATION PROGRAMME FOR EXISTING INDEPENDENT AND NON INDEPENDENT DIRECTORS An appropriate induction programme for new Directors and ongoing familiarization with respect to the business / working of the Company for all Directors is a major contributor for meaningful Board level deliberations and sound business decisions.acclimited. taking into account the views of the Executive and Non-Executive Directors. duties and responsibilities and the Board’s expectations from him / her as a Director of the Company. The policy is posted on the Company’s website and can be accessed on web link http://www. The Independent Directors have been appointed IRU D o[HG WHQXUH RI oYH \HDUV IURP WKHLU UHVSHFWLYH dates of appointment. A presentation is also shared with the newly appointed Director giving an overarching perspective of the cement industry. a house magazine. This enriches the decision making process at the Board with different points of view and experiences and prevents FRQpLFWRILQWHUHVWLQWKHGHFLVLRQPDNLQJSURFHVV The appointment of the Independent Directors is carried out in a structured manner. a formal letter of appointment is given to him / her which. organizational set-up of the Company. com/newsite/pdf/Policyondiversityoftheboard. 2015. 81 . 2014. interalia.QGHSHQGHQW Directors and the Board of Directors as a whole. brochure on the CSR activities pursued by the Company. Sustainable Development Report.

iii. The Chairman of the Board of Directors and the Chairman of Nomination & Remuneration Committee met all the Directors individually to get an overview of the functioning of the Board and its constituents interalia on the following broad criteria i. Personal Accident Insurance Policy.Contribution to Provident Fund and Superannuation Fund. Gratuity at the rate of half month’s basic salary for each completed year of service. . LTA: An amount not exceeding 12. attendance and level of participation. A structured questionnaire was prepared after taking into consideration inputs received from the Directors.acclimited. as per the rules of the Company. as an ongoing process. marketing strategy. in addition to Group Mediclaim Policy. subject to the overall ceiling on managerial remuneration as prescribed under the Companies Act.ACC Limited Further. as per the rules of the Company.5% of the basic salary. The entitlement for any one year to the extent not availed of shall be allowed to be accumulated XSWRWKHQH[WWZR&RPSDQ\ VoQDQFLDO\HDUV PERFORMANCE EVALUATION OF THE BOARD AND INDIVIDUAL DIRECTORS Pursuant to the provisions of the Act and the SEBI Regulations.e. Perquisites i. Medical Reimbursement: Such amount as may be decided by the Company and CEO&MD. covering various aspects of the Board’s functioning such as adequacy of the composition of the Board and its Committees.000 per month Allowances - iii. iv. A separate exercise was carried out to evaluate the performance of individual Directors. independence of judgement exercised by Independent Directors. ii.pdf i. interpersonal relationship etc.00. the Board has carried out the annual performance evaluation of its own performance. analysis of the circumstances which helped or adversely impacted the Company’s performance and the initiatives taken / proposed to be taken to bring about an overall improvement in the performance of the Company.` 25. 2013. as may be decided by the Board. REMUNERATION OF DIRECTORS The policy for remuneration of Directors. the performance of the Cement Industry and that of the Company. execution and performance RIVSHFLoFGXWLHVREOLJDWLRQVDQGJRYHUQDQFH The terms and conditions for appointment and remuneration of the CEO&MD as approved by the Members of the Company at the Extraordinary General Meeting held on September 10.00. 2014 Salary Grade . 2014 are as under: Period of Appointment  oYH \HDUV ZLWK HIIHFW IURP August 13. Terms ofDSSRLQWPHQWDQGUHPXQHUDWLRQRIWKH&(2 0' Details of familiarization of Independent Directors with the working of the Company are available on the website of the Company and can be accessed through web link http://www.` 11. Nomination & Remuneration and Compliance Committees respectively. comparison of the Company’s performance with its peers in the Industry as available in public domain. on the recommendation of the Nomination & Remuneration Committee. Based on the valuable inputs received from the Directors. Housing: Free furnished residential accommodation or HRA at the rate of 40% of the basic salary. Other Perquisites. as well as the evaluation of the working of its Audit. an action plan has been drawn up to encourage greater engagement of the Independent Directors with the Company.000 . 82 5HWLUDO %HQHoWV . Special Allowance: as may be decided by the Board. Membership of one club. as per the rules of the Company.com/newsite/pdf/Induction_ program. ii. on the recommendation of the Nomination and Remuneration Committee. Board culture. business risks and mitigation plans etc.Annual Performance Bonus not exceeding 30% of the Annual Fixed Gross Compensation based on CEO&MD’s performance against set goals and the Company meeting the WDUJHW SHUIRUPDQFH IRU WKH oQDQFLDO \HDU The performance bonus will be paid only if the CEO&MD is in the employment of the Company and not on nRWLFH SHULRG DV RQ 0DUFK  RI WKH oQDQFLDO \HDU under consideration. Key Managerial Personnel and Management Executive Committee is set out as Annexure ‘C’ to the Boards’ Report. the Board of Directors is updated on a quarterly basis through presentations and discussions on the overall economic trends. Performance Bonus .

payable on the LafargeHolcim shares so allotted shall be borne by the Company.5% of the Annual Fixed Gross Compensation. Tax. This incentive component will be payable to the CEO&MD.00 lakh as on January 1. 2017 Financial Statements Subsidiary Companies his joining.00 lakh as on January 1. Sign-on Amount ` 2. as per the rules of LafargeHolcim Performance Compensation Share Plan. if any.20 Crore payable as under: ` 60.Corporate Overview Financial Highlights Board & Management Reports In addition to the payment of performance bonus as aforesaid.00 lakh on joining the Company ` 40. 2016 ` 40.00 lakh as on January 1. the CEO&MD will be eligible for shares of LafargeHolcim Ltd. 2015 ` 80. if employed in the Company (and QRWRQQRWLFHSHULRG. The LafargeHolcim shares so granted shall not exceed 7.

30 19.e.00 28.40 5.70 2.2015) Mr Bernard Fontana (resigned on 17. 17.e.00 1.30 569.50 Sitting Fees - ` Lakh Total 41.f.50 1.30 34.07.50 6. Minimum Remuneration  :KHUH LQ WKH oQDQFLDO years during the currency of the tenure of the &(2 0' WKH &RPSDQ\ KDV QR SURoWV RU LWV SURoWV are inadequate. Company Secretary & Head Compliance Salary 569.32 34.55 Salary 250.00 lakh per annum which will become payable WKUHH \HDUV DIWHU HDFK JUDQW 7KH oUVW JUDQW ZLOO EH made in April 2015 on a prorata basis from the date of v v v v 5HVLJQDWLRQIURPVHUYLFH 7HUPLQDWLRQRIVHUYLFHVE\WKH&RPSDQ\ 7HUPLQDWLRQRIVHUYLFHVZLWKFDXVH .30 3.90 1. the Company will pay remuneration E\ZD\RIVDODU\DQGSHUTXLVLWHVDVVSHFLoHGVXEMHFW to requisite approvals being obtained.00 1.00 35.74 None of the Directors of the Company / Key Managerial Personnel had any pecuniary relationship with the Company during the year.50 10.00 16.80 124.50 8.f on 14.68 Commission - Sitting Fees 4.e.50 40.00 6.f.55 8.18 Total 250.12.00 34.00 28.01 8.80 124.2015) Name of Key Managerial Personnel 0U6XQLO1D\DN&KLHI)LQDQFLDO2IoFHU Mr Burjor D Nariman.00 28.00 7.50 8.70 18. the CEO&MD shall be paid an additional bonus (deferred bonus) of ` 70.00 28.74 Commission 37. Chairman Mr Bernard Terver Mr Harish Badami Mr Eric Olsen (appointed w.2015) Mr Aidan Lynam (resigned w.32 28. The remuneration drawn by the Directors and the Key Managerial Personnel during the year is as under: Name of the Director Mr N S Sekhsaria.07. 09.30 6. 83 .50 36.30 1.40 33.00 7.07.Q WKH FDVH RI FKDQJH RI FRQWURO RU VLJQLoFDQW re-organization.DVRQ0DUFKRIWKHoQDQFLDO year under consideration. Notice Period & Severance Fees As per the agreed terms under the following scenarios: Deferred Bonus .90 0.2015) Mr Shailesh Haribhakti Mr Sushil Kumar Roongta Mr Ashwin Dani Mr Farrokh K Kavarana Mr Vijay Kumar Sharma Mr Arunkumar Gandhi Ms Falguni Nayar Mr Christof Hassig (appointed w.Based on his performance and upon achieving the targeted goals. This deferred bonus may be substituted by a stock plan once implemented by LafargeHolcim for senior leadership.51 9.00 16.

9.07.e. 2015 12 11 July 17. 2015 12 10 April 14. 2015 9 9 9 9 9 9 9 Mr Bernard Terver (Dy Chairman) Leave of Absence 9 9 9 9 9 Leave of Absence Mr Harish Badami 9 9 9 9 9 9 9 9 Leave of Absence 9 Not Applicable Mr N S Sekhsaria (Chairman) (appointed w.f. 09. 2015 July 17.e.2015) (retd. 2015 2015 February 3.2015) Not Applicable Mr Shailesh Haribhakti 9 9 9 Leave of Absence 9 9 9 Leave of Absence 9 9 9 9 9 Leave of Absence Mr Ashwin Dani 9 9 9 Leave of Absence 9 9 9 Mr Farrokh K Kavarana 9 Leave of Absence 9 9 9 9 9 Mr Vijay Kumar Sharma 9 9 9 9 9 Leave of Absence 9 Mr Arunkumar Gandhi 9 9 9 9 9 9 9 Ms Falguni Nayar 9 9 9 9 9 9 9 Mr Christof Hassig Not Applicable 9 Not Applicable Mr Eric Olsen Mr Sushil Kumar Roongta (appointed w. 2015 October 20.2015) 84 Not Not Applicable Applicable Leave of Absence Not Not Not Applicable Applicable Applicable Leave of Absence 9 . 17. 2015 April 14. 2015 11 10 December 9.f. 2015 12 11 Attendance of Directors at Board Meetings and Annual General Meeting Name of the Director Attendance at the Board Meetings held on Attendance at the AGM held on December March 20.e.ACC Limited MEETINGS Board Meetings held during the Year Dates on which the Board Meetings were held Total Strength of the Board No of Directors Present February 3.07.e. 14. 2015 March 24. 2015 12 10 October 20.12.f.2015) Not Not Applicable Applicable Not Not Not Not Applicable Applicable Applicable Applicable Mr Bernard Fontana 9 Leave of Absence 9 Mr Aidan Lynam 9 9 Leave of Absence (resigned as Director w.f. as Director w.07. 17. 2015 12 10 March 24.

The Minutes of the Committee Meetings are sent to all Directors individually and tabled at the respective Board / Committee Meetings. v 5HYLHZ WKH 0DQDJHPHQW 'LVFXVVLRQ  $QDO\VLV RI oQDQFLDODQGRSHUDWLRQDOSHUIRUPDQFH COMMITTEES OF THE BOARD Over the long years of its existence.Corporate Overview Financial Highlights Board & Management Reports The Act facilitates the participation of a Director in Board / Committee Meetings through video conference or other audio visual mode.Mandatory Committee The Audit Committee acts as a link between the Statutory and Internal Auditors and the Board of Directors. Majority of the Members on the Committee. monitors operational performance and ensures that robust policies and procedures are in place and through its various Committees guarantees the quality of the Company’s risk management. The Board of Directors provide strategic guidance. It also sets standards of corporate behaviour. This would. Likewise. Financial Statements 85 . interalia. including the Chairman are Independent Directors. projects and capital expenditure. the Board of Directors had constituted the Audit Committee in 1986. Some of the important functions performed by the Committee are: Financial Reporting and Related Processes v 2YHUVLJKW RI WKH &RPSDQ\ V oQDQFLDO UHSRUWLQJ SURFHVV DQG oQDQFLDO LQIRUPDWLRQ VXEPLWWHG WR WKH Stock Exchanges. The Agenda for the Board Meeting covers items set out as per the guidelines in SEBI Regulations to the extent these are relevant and applicable. In particular. The Board reviews the functioning of these committees from time to time. Accordingly. which Committee has transformed as Stakeholders’ Relationship Committee. the option to participate in the Meeting through video conference was made available for the Directors except in respect of such Meetings / Items which are not permitted by law to be transacted through video conference. The Meetings of each of these Committees are convened by the respective Chairman of the Committees. The Agenda is sent out to the Directors within the period stipulated in the Secretarial Standards. the Board periodically reviews the items required to be placed before it and reviews and approves quarterly XQDXGLWHGoQDQFLDOVWDWHPHQWVDQGWKHDXGLWHGDQQXDO oQDQFLDO VWDWHPHQWV FRUSRUDWH VWUDWHJLHV EXVLQHVV plans. The constitution. ensures transparency in corporate dealings and compliance with laws and regulations. long before it was mandated by the law. terms of reference and the functioning of the existing Committees of the Board is explained herein. the Company has developed robust governance structure and processes. All agenda items are supported by relevant information. regulatory authorities or the public. The Committee is governed by a Charter which is in line with the regulatory requirements mandated by the Act and SEBI Regulations. who also inform the Board about the summary of discussions held in the Committee Meetings. Subsidiary Companies Each of these Committees have the requisite expertise to KDQGOH LVVXHV UHOHYDQW WR WKHLU oHOG 7KHVH &RPPLWWHHV spend considerable time and give focused attention to the various issues placed before it and the guidance provided by these Committees lends immense value and enhances the decision making process of the Board. progress of major projects and reviews such other items which require Boards’ attention. A Share Committee was constituted in 1962 to look into various matters relating to the shares of the Company and Investor Relations. audited annual oQDQFLDO VWDWHPHQWV DQG $XGLWRUV  5HSRUW WKHUHRQ before submission to the Board for approval. annual budgets. It DVVLVWVWKH%RDUGLQIXOoOOLQJLWVRYHUVLJKWUHVSRQVLELOLWLHV RI PRQLWRULQJ oQDQFLDO UHSRUWLQJ SURFHVVHV UHYLHZLQJ the Company’s established systems & processes for LQWHUQDOoQDQFLDOFRQWUROVJRYHUQDQFHDQGUHYLHZLQJWKH Company’s statutory and internal audit activities. This Committee has been reconstituted as the Nomination & Remuneration Committee with wider terms of reference. It directs and guides the activities of the Management towards achieving set goals and seeks accountability. a Compensation Committee was constituted in 1992. made by the Statutory Auditors in this regard. Major accounting estimates based on exercise of judgement E\ WKH 0DQDJHPHQW VLJQLoFDQW DGMXVWPHQWV PDGH LQWKHoQDQFLDOVWDWHPHQWVDQGRUUHFRPPHQGDWLRQ if any. For instance. internal controls and ensures compliance with all relevant laws. documents and presentations to enable the Board to take informed decisions. include reviewing changes in the accounting policies and reasons for the same. Audit Committee . Health & Safety (H&S) performance. It monitors overall operating performance. v 5HYLHZLQJ ZLWK WKH 0DQDJHPHQW WKH TXDUWHUO\ XQDXGLWHG oQDQFLDO VWDWHPHQWV DQG WKH $XGLWRUV  Limited Review Report thereon.

v 7R RYHUVHH DQG UHYLHZ WKH IXQFWLRQLQJ RI D YLJLO mechanism (implemented in the Company as EthicalView Reporting Policy) and to review the oQGLQJVRILQYHVWLJDWLRQLQWRFDVHVRIPDWHULDOQDWXUH and the actions taken in respect thereof. v 5HFRPPHQGV WR WKH %RDUG WKH UHPXQHUDWLRQ RI WKH Statutory Auditors / Cost Auditors. 2015 and details of the Members participation at the Meetings of the Committee are as under: Name of the Member Category Mr Arunkumar Gandhi (Chairman) Mr Bernard Terver Non-Executive/ Independent Non-Executive Mr Sushil Kumar Roongta Mr Ashwin Dani Non-Executive/ Independent Non-Executive/ Independent Non-Executive/ Independent Mr Farrokh K Kavarana Attendance at the Audit Committee Meeting held on February April 13. 2015 2015 2015 2015 20. Internal Financial Controls and Governance Processes v 5HYLHZ WKH DGHTXDF\ DQG HIIHFWLYHQHVV RI WKH Company’s system and internal controls. v 5HYLHZ DQG GLVFXVV ZLWK WKH 0DQDJHPHQW WKH &RPSDQ\ VPDMRUoQDQFLDOULVNH[SRVXUHVDQGVWHSV taken by the Management to monitor and control such exposure.ACC Limited v 'LVFXVV ZLWK WKH 6WDWXWRU\ $XGLWRUV LWV MXGJHPHQW about the quality and appropriateness of the Company’s accounting principles with reference to the Generally Accepted Accounting Principles in India (IGAAP). v 5HYLHZ WKH VLJQLoFDQW DXGLW oQGLQJV IURP WKH statutory and internal audits carried out. May 22.QWHUQDO $XGLWRU RQ VLJQLoFDQW GLIoFXOWLHV encountered during the course of the Audit. 2015 9 9 9 9 9 9 Leave of Absence Leave of Absence 9 9 9 9 9 9 9 9 9 9 9 9 9 9 Leave of Absence Leave of Absence 9 9 9 Leave of Absence 9 9 As prescribed under the Act. v 'LVFXVVLRQV ZLWK WKH 6WDWXWRU\ $XGLWRUV  &KLHI . v 5HYLHZVWKHLQYHVWPHQWVPDGHE\WKH&RPSDQ\ v $SSURYH VXFK DGGLWLRQDO VHUYLFHV WR EH UHQGHUHG E\ the Statutory Auditors except those enumerated in Section 144 of the Act and payment for such services. 2015 9. Other Duties v 7R DSSURYH WKH DSSRLQWPHQW UHPRYDO DQG WHUPV of remuneration of the Chief Internal Auditor and to approve the appointment of the Chief Financial 2IoFHU v 7R JUDQW RPQLEXV DSSURYDO IRU UHODWHG SDUW\ transactions which are in the ordinary course of business and on an arms length pricing basis and to review and approve such transactions subject to the approval of the Board. the recommendations and Management’s response thereto. v Review and recommend to the Board the appointment / re-appointment of the Statutory Auditors and Cost Auditors considering their independence and effectiveness and their replacement and removal. v 5HYLHZLQJ WKH DQQXDO &RVW $XGLW 5HSRUW VXEPLWWHG by the Cost Auditor. the Chairman of the Committee who is an Independent Director was present at the Annual General Meeting of the Company. The composition of the Audit Committee as at December 31. 86 . July 17. Audit v 5HYLHZ WKH VFRSH RI WKH 6WDWXWRU\ $XGLWRUV WKH annual audit plan and the Internal Audit Plan with a view to ensure adequate coverage. October December 2.

The representatives of the Statutory Auditors are permanent invitees to the Audit Committee Meetings. They have attended all the Audit Committee Meetings held during the year.Corporate Overview Financial Highlights Board & Management Reports All the Members on the Audit Committee possess the UHTXLVLWHTXDOLoFDWLRQIRUDSSRLQWPHQWRQWKH&RPPLWWHH DQG KDYH VRXQG NQRZOHGJH RI oQDQFH DFFRXQWLQJ practices and internal controls. The representative of the Cost Auditor is invited to attend the Meeting of the Audit Committee when the Cost Audit Report is tabled for GLVFXVVLRQ 7KH &KLHI ([HFXWLYH 2IoFHU  0DQDJLQJ 'LUHFWRU &(2 0'.

WKH&KLHI)LQDQFLDO2IoFHU &)2.

non-receipt of declared dividends / Annual 5HSRUWV LVVXH RI GXSOLFDWH FHUWLoFDWHV DQG RWKHU complaints. The Company Secretary is the Secretary to the Committee. v WR RYHUVHH WKH LPSOHPHQWDWLRQ RI (626 VFKHPH LI any. Financial Statements 87 .QYHVWRU5HODWLRQDFWLYLWLHVRIWKH&RPSDQ\ DQG JLYH JXLGDQFH RQ WKH pRZ RI LQIRUPDWLRQ IURP the Company to the Investors. Stakeholders’ Relationship Committee . Subsidiary Companies v Self Assessment by the Audit Committee The Audit Committee has set in place a process to measure and benchmark its performance each year. internal control systems and overview of internal and external audits. change of address for correspondence etc and to monitor action taken.Mandatory Committee The Stakeholders’ Relationship Committee comprises three Members of which one Member is an Independent Director. v WR PRQLWRU H[SHGLWLRXV UHGUHVVDO RI JULHYDQFHV RI shareholders / security holders including complaints relating to transfer / transmission of shares / securities. defaced or destroyed. the Audit Committee held a separate meeting with the Statutory Auditors and the &KLHI . implemented by the Company. notices. The assessment broadly covers composition.WKH &KLHI . LVVXH RI GXSOLFDWH VKDUH FHUWLoFDWHV LQ UHVSHFW RI shares / debentures and other securities reported lost. The terms of reference of the Committee are: v v WR DSSURYH WUDQVIHU  WUDQVPLVVLRQ RI VKDUHV  debentures and such other securities as may be issued by the Company from time to time. to issue QHZ FHUWLoFDWHV DJDLQVW VXEGLYLVLRQ RI VKDUHV DQG UHQHZDOVSOLWRUFRQVROLGDWLRQRIVKDUHFHUWLoFDWHV v WRPRQLWRU. During the year under review. non-receipt of declared dividend / interest. WRLVVXHQHZFHUWLoFDWHVDJDLQVWVXEGLYLVLRQRIVKDUHV UHQHZDOVSOLWRUFRQVROLGDWLRQRIVKDUHFHUWLoFDWHV FHUWLoFDWHVUHODWLQJWRRWKHUVHFXULWLHV v WR LVVXH DQG DOORW ULJKW VKDUHV  ERQXV VKDUHV pursuant to a Rights Issue / Bonus Issue. The results of the self assessment are presented to the Audit Committee along with the action plan in the areas requiring improvement. v WR DXWKRUL]H WKH &RPSDQ\ 6HFUHWDU\  +HDG &RPSOLDQFHRWKHU2IoFHUVRIWKH6KDUH'HSDUWPHQW to attend to matters relating to transfer/transmission RI VKDUHV LVVXH RI GXSOLFDWH VKDUH FHUWLoFDWHV IRU shares reported lost.QWHUQDO $XGLWRU WR JHW WKHLU LQSXWV RQ VLJQLoFDQW matters relating to their respective areas of audit. v WR DXWKRUL]H WKH &RPSDQ\ 6HFUHWDU\  +HDG &RPSOLDQFHRWKHU2IoFHUVRIWKH6KDUH'HSDUWPHQW to attend to matters relating to non-receipt of annual reports. v DOO RWKHU PDWWHUV LQFLGHQWDO RU UHODWHG WR VKDUHV debentures and other securities of the Company.QWHUQDO $XGLWRU WKH &KLHI 0DQXIDFWXULQJ 2IoFHU WKH &KLHI 0DUNHWLQJ 2IoFHU DWWHQG $XGLW &RPPLWWHH Meetings. defaced or destroyed as per the laid down procedure. subject to such approval as may be required. structure and FRPPLWWHHPHHWLQJVRYHUYLHZRIWKHoQDQFLDOUHSRUWLQJ process. v WR LVVXH DQG DOORW GHEHQWXUHV ERQGV DQG RWKHU securities subject to such approvals as may be required. The Committee is governed by a Charter. v WR DSSURYH DQG PRQLWRU GHPDWHULDOL]DWLRQ RI shares / debentures / other securities and all matters incidental or related thereto. v DQ\ RWKHU PDWWHU DV PD\ EH DVVLJQHG WR WKH Committee by the Board of Directors.

In reviewing the overall remuneration of the Board of Directors. .GHQWLI\LQJSRWHQWLDOLQGLYLGXDOVIRUDSSRLQWPHQWDV Key Managerial Personnel and all ExCo Members. v Formulate and review from time to time the policy for selection and appointment of Directors. out of which all complaints have been attended / resolved.ACC Limited The composition of the Stakeholders’ Relationship Committee as at December 31. 2015. Mr Burjor D Nariman. Key Managerial Personnel and Members of the Executive Committee based on certain criteria as approved by the Board. 2015 December 7. 2015 July 16. include the following: v 88 6XFFHVVLRQ SODQQLQJ RI WKH %RDUG RI 'LUHFWRUV DQG Executive Committee. 29 complaints were received from shareholders. retain and motivate the best managerial talent. These share transfers were received by the Company on December 28.GHQWLI\LQJ DQG VHOHFWLRQ RI FDQGLGDWHV IRU appointment as Directors / Independent Directors based on certain laid down criteria. 2015 Mr Bernard Terver (Chairman) Non-Executive Leave of Absence 9 9 9 9 Mr Shailesh Haribhakti Non-Executive / Independent 9 9 Leave of Absence 9 9 Executive 9 9 9 9 9 Mr Harish Badami Mr Shailesh Haribhakti and Mr Harish Badami. the relationship of remuneration to performance is clear and meets appropriate performance benchmarks and that the remuneration involves a balance between o[HGDQGLQFHQWLYHSD\UHpHFWLQJVKRUWWHUPDQGORQJ term objectives of the Company. 2015 and details of the Members participation at the Meetings of the Committee are as under: Name of the Member Category Attendance at the Stakeholders’ Relationship Committee Meetings held on February 2. 2015 October 20. As on December 31. The terms of reference of the Committee interalia. v Review the performance of the Board of Directors. Key Managerial Personnel and Executive Committee Members. no investor grievance has remained unattended / pending for more than thirty days. The Company had ten share transfers pending as on December 31. Members of the Committee attended the Annual General Meeting of the Company. 2015. 2015. v . The Chairman of the Committee is an Independent Director and majority of the Members on the Committee are Independent Directors. v . the Committee ensures WKDW WKH UHPXQHUDWLRQ LV UHDVRQDEOH DQG VXIoFLHQW WR attract. Company Secretary & Head &RPSOLDQFHIXQFWLRQVDVWKH&RPSOLDQFH2IoFHU During the year. 2015 April 13. 1RPLQDWLRQ  5HPXQHUDWLRQ &RPPLWWHH  0DQGDWRU\ Committee The Nomination & Remuneration Committee is governed by a Charter. Key Managerial Personnel and Members of the Executive Committee and their remuneration.

e. 2015 October 20.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies The composition of the Nomination & Remuneration Committee as at December 31. v 7R SURYLGH JXLGDQFH RQ YDULRXV &65 DFWLYLWLHV WR be undertaken by the Company and to monitor its progress. 2015 Mr Ashwin Dani (Chairman) Non-Executive / Independent 9 9 9 9 Mr N S Sekhsaria Non-Executive / Independent 9 9 9 9 Mr Bernard Terver Non-Executive Leave of Absence 9 9 9 Mr Shailesh Haribhakti Non-Executive / Independent 9 Leave of Absence 9 9 Mr Farrokh Kavarana Non-Executive / Independent 9 9 9 9 Non-Executive Not Applicable Not Applicable Leave of Absence Leave of Absence Mr Eric Olsen (appointed w.07. 17. 2015 and the details of Members’ participation at the Meetings of the Committee are as under: Name of the Member Category Attendance at the CSR Committee Meeting held on July 16. 2015 December 7.e.2015) Mr Harish Badami 89 .f. a formal Committee of the Board was constituted in 2013 to oversee and give direction to the Company’s CSR activities. 17.07. The composition of the CSR Committee as at December 31. 2015 December 8.2015) As prescribed under the Act. 2015 July 16. the Chairman of the Committee was present at the Annual General Meeting of the Company. Corporate Social Responsibility (CSR) Committee Mandatory Committee Corporate Social Responsibility Committee (CSR) broadly comprises: The Company has always been mindful of its obligations vis-à-vis the communities it impacts and has been pursuing various CSR activities long before it became mandated by law. As required under the Act. 2015 and the details of Members’ participation at the Meetings of the Committee are as under: Name of the Member Category Attendance at the Nomination & Remuneration Committee Meeting held on February 2. 2015 Mr Shailesh Haribhakti (Chairman) Non-Executive / Independent Leave of Absence 9 Ms Falguni Nayar Non-Executive / Independent Leave of Absence 9 Mr Farrokh Kavarana Non-Executive / Independent 9 9 Non-Executive Not Applicable 9 Executive 9 9 Mr Bernard Terver (appointed w. The terms of reference of the v 7RUHYLHZWKHH[LVWLQJ&653ROLF\DQGWRPDNHLWPRUH comprehensive so as to indicate the activities to be XQGHUWDNHQE\WKH&RPSDQ\DVVSHFLoHGLQ6FKHGXOH VII of the Act.f.

ACC Limited During the year. v 5HYLHZLQJ WKH %XVLQHVV 5LVN 0DQDJHPHQW %50. Regulations. The Committee is governed by a Charter and its objectives and scope broadly comprises: v 2YHUVLJKW RI ULVN PDQDJHPHQW SHUIRUPHG E\ WKH operating management. the CSR Policy has been restated making it more comprehensive and in alignment with the requirements of the Act and the United Nations Sustainable Development Goals. The CSR Policy statement and the CSR Report forms part of the Board’s Report to the Members of the Company.

The Risk Management Committee was constituted by the Board of Directors in 2014. monitor. exposure. where required. 2015 9 9 9 9 Not Applicable 9 9 9 (appointed w. v 5HYLHZLQJ ULVNV DQG HYDOXDWH WUHDWPHQW LQFOXGLQJ initiating mitigation actions and ownership as per a SUHGHoQHGF\FOH v 'HoQLQJ IUDPHZRUN IRU LGHQWLoFDWLRQ DVVHVVPHQW monitoring. The Compliance Committee plays an important role in building a regime of zero tolerance to any form of non-compliance. mitigate and minimize risks as also identify business opportunities. v :LWKLQLWVRYHUDOOVFRSHDVDIRUHVDLGWKH&RPPLWWHH shall review risk trends. 2015 December 7. mitigation and reporting of risks. Risk Management Committee . which is essential for sustainable growth.e. pursuant to the requirement of the earlier Clause 49 of the Listing Agreement with the Stock Exchanges which has now been replaced by the SEBI The composition of the Risk Management Committee as at December 31.Non-Mandatory Committee Recognizing the importance of compliance with various laws and regulations. developments and their interpretation by the Courts RIODZWKDWPD\VLJQLoFDQWO\DIIHFWWKH&RPSDQ\ v UHYLHZLQJ FRPSOLDQFH ZLWK WKH SURYLVLRQV RI Competition Law and to provide guidance in regard to the development of the laws in India and abroad. v UHYLHZLQJ FRPSOLDQFH ZLWK DOO DSSOLFDEOH VWDWXWHV rules and regulations based on reports received from the CEO&MD. and Executive Committee Members and the Company Secretary & Head Compliance and recommend corrective actions. The Company has a robust risk management framework to identify.10. The terms of reference of the Committee broadly comprises: v 90 UHYLHZLQJ WKH OHJDO HQYLURQPHQW LQ ZKLFK WKH Company operates with a view to understand the implications of major legislative and regulatory . potential impact analysis and mitigation plans.Mandatory Committee Business Risk Evaluation and Management is an ongoing process within the Organization. 20. the Board of Directors constituted a Compliance Committee in 2008. v UHYLHZLQJVLJQLoFDQWOHJDOFDVHVoOHGE\DQGDJDLQVW the Company. if any.2015) Mr Harish Badami Executive Compliance Committee . policy and framework in line with local legal requirements and SEBI guidelines. 2015 and the details of Members’ participation at the Meetings of the Committee are as under: Name of the Member Category Mr Shailesh Haribhakti (Chairman) Ms Falguni Nayar Non-Executive / Independent Non-Executive / Independent Non-Executive Mr Bernard Terver Attendance at the Risk Management Committee Meeting held on October 16.f.

Copies of the Minutes of the Nomination & Remuneration Committee.acclimited. The Company’s policy on “material subsidiary” is placed on the Company’s website and can be accessed through weblink http://www. 91 .com The Code lays down the standard of conduct which is expected to be followed by the Directors and by the employees in their business dealings and in particular on matters relating to integrity in the work place.pdf The Audited Annual Financial Statements of Subsidiary Companies are tabled at the Audit Committee and Board Meetings of the Company. 2015 2015 2015 2015 9 9 9 9 Leave of Absence 9 9 9 9 9 9 9 9 Leave of Absence 9 Capex Committee . There is a Steering Committee of the Management which closely monitors the progress of the project and since no other major capex proposals were under consideration during the year. the Committee has not met during the year under review. October 20. DISCLOSURES Related Party Transactions All Transactions with related parties were in the ordinary course of business and on an arm’s length pricing basis.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies The composition of the Compliance Committee as at December 31. CODE OF BUSINESS CONDUCT The Board of Directors has approved a Code of Business Conduct which is applicable to the Members of the Board and to all employees. SUBSIDIARY COMPANIES The Company does not have any material subsidiary whose net worth exceeds 20% of the consolidated net worth of the Holding Company in the immediately preceding accounting year or has generated 20% of the consolidated income of the Company. in business practices and in dealing with stakeholders. in addition to a face-to-face training given by the Company in this regard. Strictures and Penalties No strictures or penalties have been imposed on the Company by the Stock Exchanges or by the Securities and Exchange Board of India (SEBI) or by any statutory authority on any matters related to capital markets during the last three years. Audit Committee and Board Meetings of Subsidiary Companies are given to all the Directors and tabled at the Board Meetings of the Company. The said Project has been approved by the Board and is nearing completion. The Code gives guidance through examples on the expected behaviour from an employee in a given situation and the reporting structure.(Constituted in 2010) . The 9 policy on related party transaction has been placed on the Company’s website and can be accessed through http:// www. All the Board Members and the Senior Management SHUVRQQHO KDYH FRQoUPHG FRPSOLDQFH ZLWK WKH &RGH All Management Staff were required to complete an e-learning module.Non-Mandatory Committee The Capex Committee was constituted to review the WHFKQLFDO DQG oQDQFLDO YLDELOLW\ RI ODUJH SURMHFWV DQG LQ particular the Jamul Project.com/newsite/pdf/CG/PolicyonRPT.com/newsite/pdf/CG/ Determiningmaterialsubsidiaries.acclimited. 2015 and the details of the Members’ participation at the Meetings of the Committee are as under: Name of the Member Category Mr Farrokh Kavarana (Chairman) Mr Bernard Terver Non-Executive / Independent Non-Executive Mr Shailesh Haribhakti Non-Executive / Independent Executive Mr Harish Badami Attendance at the Compliance Committee Meeting held on February 2. April 13.pdf. The Company follows a policy of “Zero Tolerance” to bribery and corruption in any form and the Board has laid down the “Anti Bribery & Corruption Directive” which forms an Appendix to the Code.acclimited. July 16. The Code has been posted on the Company’s website www.

The Annual Report of the Company. communicates with its shareholders and investors through multiple channels of communications such as dissemination of information on the on-line portal of the Stock Exchanges. from time to time and as may be required. Performance and Passion and in line with our vision of being one of the most respected companies in India. 3URKLELWLRQ RI Insider Trading) Regulations. The results are generally published in the Economic Times and Free Press Journal.com Online reporting on https:integrityline. 2015. press releases. a dedicated helpline “ACC Ethics Helpline” has been set-up which is managed by an independent professional organization. the Company is committed to the high standards of Corporate Governance and stakeholder responsibility. PREVENTION OF INSIDER TRADING . Monitoring And Reporting of 92 Trading by Insiders” and the “Code of Practices and Procedures for Fair Disclosure of Unpublished Price Sensitive Information” (ACC Code) allows the formulation of a trading plan subject to certain conditions and requires pre-clearance for dealing in the Company’s shares. The unaudited quarterly results are announced within IRUW\oYH GD\V RI WKH FORVH RI WKH TXDUWHU 7KH DXGLWHG annual results are announced within two months IURP WKH FORVH RI WKH oQDQFLDO \HDU DV UHTXLUHG XQGHU 6(%. Pursuant thereto. 5HJXODWLRQV 7KH DIRUHVDLG oQDQFLDO UHVXOWV DUH announced to the Stock Exchanges within thirty minutes from the close of the Board Meeting at which these were considered and approved. The Committee reports to the Audit Committee and the Board.acclimited. upholding the interest of consumers.holcim. the Annual Reports and uploading relevant information on its website. designated employees and connected persons. the Company has formulated and adopted a new Code for Prevention of Insider Trading. if DQ\ 7KH (95 3ROLF\ HQVXUHV WKDW VWULFW FRQoGHQWLDOLW\ LV maintained whilst dealing with concerns and also that no discrimination is meted out to any person for a genuinely raised concern.  QRWLoHG WKH 6(%. Pune 411 001 A high level Committee has been constituted which looks into the complaints raised.com and can be downloaded. The new code viz. Pursuant thereto. “Code of Internal Procedures and Conduct for Regulating. VIGIL MECHANISM / WHISTLE BLOWER POLICY In staying true to our values of Strength.ACC Limited VALUE CREATION IN COMPETITIVE ENVIRONMENT (VCCE) The Value Creation in Competitive Environment (VCCE) programme was introduced in ACC as early as 2008 and the Company has been carrying out extensive training sessions for creating awareness among relevant employees for conducting business in a fair manner. The Company Secretary & Head Compliance is responsible for implementation of the Code. the quarterly / half \HDUO\DQGWKHDXGLWHGoQDQFLDOVWDWHPHQWVDQGWKHSUHVV releases of the Company are also placed on the Company’s website www. 7KHDXGLWHGoQDQFLDOVWDWHPHQWVIRUPSDUWRIWKH$QQXDO Report which is sent to the Members within the statutory period and well in advance of the Annual General Meeting. The Marathi translation of the same is published in Maharashtra Times and Loksatta. . which are regional daily newspapers. while in possession of unpublished price sensitive information in relation to the Company and during the period when the Trading Window is closed. 2015 which came into effect from May 15. It also prohibits the purchase or sale of Company’s shares by the Directors. The Company has an EthicalView Reporting (EVR) Policy to deal with instances of fraud and mismanagement.Q -DQXDU\  6(%.com National Toll Free Number: 18002092008 Fax Number: +91(22) 6645 9575 Address: PO Box 137. All Board Directors. No personnel of the Company has been denied access to either the ACC Ethics Helpline or to the Audit Committee. designated employees and connected SHUVRQVKDYHDIoUPHGFRPSOLDQFHZLWKWKH&RGH COMMUNICATION WITH THE SHAREHOLDERS The Company. The Ethics Helpline can be contacted to report any suspected or FRQoUPHGLQFLGHQWRIIUDXGPLVFRQGXFWRQ E-Mail: acc@ethicalview.

Facility has been provided by SEBI for investors to place their complaints / grievances on a centralized web-based complaints redressal system viz. The Company also uploads on the BSE Listing Centre and on NSE NEAPS portals. GENERAL INFORMATION TO SHAREHOLDERS Financial Year : January .Corporate Overview Financial Highlights Board & Management Reports The presentations on the performance of the Company are placed on the Company’s website immediately after these are communicated to the Stock Exchanges for the EHQHoW RI WKH LQVWLWXWLRQDO LQYHVWRUV DQG DQDO\VWV DQG other shareholders. SEBI Complaints Redress System (SCORES). A separate dedicated section under ‘Corporate Governance’ on the Company’s website gives information on unclaimed dividends.December. all information required to be disclosed under Regulation 30 read with Part A of Schedule III of the SEBI Regulations including material information having a bearing on the performance / operations of the listed entity or other SULFH VHQVLWLYH LQIRUPDWLRQ $OO LQIRUPDWLRQ LV oOHG electronically on BSE’s online Portal – BSE Corporate Compliance & Listing Centre (Listing Centre) and on NSE Electronic Application Processing System (NEAPS). v $V PHQWLRQHG HDUOLHU WKH &RPSDQ\ V 6WDQGDORQH Financial Statements for the year ended 'HFHPEHUDUHXQTXDOLoHG v $V PHQWLRQHG HDUOLHU WKH &KLHI . online upload of Action Taken Reports (ATRs) by the concerned companies and online viewing by investors of actions taken on the complaint and its current status. These services include transfer / transmission / dematerialization of shares / payment of dividends / sub-division / FRQVROLGDWLRQUHQHZDORIVKDUHFHUWLoFDWHVDQGLQYHVWRU grievances. All disclosures made to the stock exchanges are also available on the Company’s website under the heading ‘Announcements’. The Company is registered with SEBI as Registrar to an Issue / Share Transfer Agent in Category II Share Transfer Agent and the registration code is INR000004124. The Company discloses to the Stock Exchanges. 2015 Investor Services The Company has an in-house Share Department located DW LWV 5HJLVWHUHG 2IoFH ZKLFK RIIHUV DOO VKDUH UHODWHG services to its Members and Investors. v 7KH &RPSDQ\ IROORZV D UREXVW SURFHVV RI communicating with the shareholders which has been explained earlier in the Report under “Means of Communication”.QWHUQDO $XGLWRU reports directly to the Audit Committee in all functional matters. the on-line portal of National Stock Exchange of India Limited. The salient features of this system are: Centralized database of all complaints. COMPLIANCE WITH NON-MANDATORY PROVISIONS The status on the compliance with the non-mandatory recommendation in the SEBI Regulations is as under: v 7KHSRVLWLRQRIWKH&KDLUPDQRIWKH%RDUGRI'LUHFWRUV and the CEO are separate. during his visits to the Company for attending meetings. An internal Management Committee comprising the CEO&MD. v 7KH &KDLUPDQ EHLQJ D 1RQ([HFXWLYH DQG . details of analysts and Financial Statements Subsidiary Companies institutional investor meetings whenever the Company’s representatives attend any meeting of the investors.QGHSHQGHQW 'LUHFWRU KDV KLV RZQ RIoFH ZKLFK LV FORVH WR WKH &RPSDQ\ V 5HJLVWHUHG 2IoFH +RZHYHU DQRIoFHLVPDGHDYDLODEOHIRUKLVXVHLIUHTXLUHGE\ him. WKH &KLHI )LQDQFLDO 2IoFHU DQG WKH &RPSDQ\ 6HFUHWDU\ has been constituted and empowered to decide on the materiality of the information for the purpose of making disclosures to the Stock Exchanges. quarterly compliance reports and other relevant information of interest to the investors / public. The Board of Directors has approved a policy for determining materiality of events for the purpose of making disclosure to the Stock Exchanges. 93 .

till 5. Plant Location The location of the Company’s Plants are given on the inside cover page of the Annual Report.m. The Company has designated an e-mail ID to enable the Members and Investors to correspond with the Company.com / dividend / general inquiries and investor grievance remaining unattended: Communication by Members Members who hold shares in dematerialized form should correspond with the Depository Participant with whom they maintain their Demat Account/s. credit of dividend through NECS.: (022) 3302 4469 Fax No. request for additional supporting documents VXFKDVFHUWLoHGFRSLHVRI3$1&DUGVDQGRWKHUSURRIRI identity and / or address. processing of unclaimed dividend. with a view to safeguard the interest of its Members and that of the Company. Bandra-Kurla Complex.ACC Limited Address for Correspondence with the Company ACC Limited Share Department “Cement House” 121. Members who hold shares in physical form should address their queries to the Company. Members are requested to indicate their DP ID & Client ID/ Ledger Folio number in their correspondence with the 94 Company and also to provide their Email addresses and telephone numbers / FAX numbers to facilitate prompt response from the Company.' 7ROO)UHH1XPEHU Telephone No. Mumbai 400 001 The National Stock Exchange of India Limited. Maharshi Karve Road.m. The toll free services will be available on all working days of the Company from 9. Bandra (East). change in bank details. Dalal Street. However.15 a. change of address. Mumbai 400 051 Stock ISIN Number Code/ for NSDL / CDSL Scrip Code (Dematerialized shares) 500410 ACC INE012A01025 . renewals  VSOLW  FRQVROLGDWLRQ RI VKDUH FHUWLoFDWHV LVVXH RI GXSOLFDWHVKDUHFHUWLoFDWHVVKRXOGEHVLJQHGE\WKHoUVW named Member as per the specimen signature registered with the Company.00 p.: (022) 6631 7458 Communication by E-mail: For transfer / transmission / s u j a t a . non-receipt of annual reports or on matters relating to the working of the Company should be addressed to the Company. c h i t r e @ subdivision / demat / loss of shares acclimited. subdivision of shares. queries relating to non-receipt of dividend. Exchange Plaza. The e-mail ID is ACC-InvestorSupport@acclimited. for queries relating to shareholding. Members are requested to ensure that correspondence for change of address. The details of the Plants along with their addresses and telephone numbers are also available on the Company’s website. MARKET INFORMATION Listing on Stock Exchanges The Company’s shares are listed on the following Stock Exchanges and the listing fees have been paid to the Exchanges: Name and Address of the Stock Exchanges BSE Limited Phiroze Jeejeebhoy Towers. Mumbai 400 020 ([FOXVLYH(0DLO. The Company may also.com The Company has also set up a toll free number 1800-3002-1001 to facilitate the Members / Investors to contact the Company.

540.011.56 1.95 1.14.00 1.145.780.65 4.32.484.683.44 September 2015 26.60 1.25 6.20 March 2015 27.337.514.409.541.703.515.383.31 1.10 1.438.12.302.68 December 2015 26.50 1.60 1.90 1.320.532.29 July 2015 28.00 1.306.677.09 April 2015 27.154.94 October 2015 26.957.68.83 1.05 5.18 February 2015 29.67 1.35.65 1.45.49 1.00 1.343.693 83.09 1.55 5.441.42.95 1.34.00 1.40 1.366.432.19 June 2015 27.58 August 2015 26.00 1.752 47.00 1.83 1.45 30000 1800 29000 1700 28000 1600 27000 1500 26000 1400 25000 Jan-15 Feb-15 Mar-15 Apr-15 May-15 BSE Sensex Jun-15 Jul-15 Aug-15 Sep-15 Oct-15 Nov-15 Dec-15 1300 ACC Share Price on BSE (Closing) BSE Sensex ACC Share Price on BSE & BSE Sensex ACC Share Price (on BSE) Close 95 .00 1.30 1.00 1.15 6.00 1.303.182.774.440.05 1.863 25.117.451 55.386.330.89.55 7.828.10 3.90 1.80 1.591.347.00 1.452.334.14 November 2015 26.989 95.410.Corporate Overview Board & Management Reports Financial Highlights Financial Statements Subsidiary Companies ACC Share Price on BSE vis-à-vis BSE Sensex January .361.16.83 1.76 May 2015 27.344.573 82.114.60 4.371 102.560.283.159 76.994 98.80 1.00 2.560.15 4.920 31.00 1.44 1.373.December 2015 Month BSE Sensex Close High Low Close No.656.877 75.62.70 5.376.351.665 84.60.54 1. of shares traded during the month Turnover ` crore ` ` ` January 2015 29.70 1.00 1.

444.94.86 October 2015 8.86.368.75 71.397 494.15 1.491.68.329.35 1.58 August 2015 7.360.515.407.65 36.387.971.300.40 71.687 907.40 61.301.45 77.762 1.30 1.45 1.935.386.00 1.678.53.88 December 2015 7.86 February 2015 8.00 1.73.350.93 May 2015 8.75 45.00 1.00 1.344.1LIW\-DQXDU\'HFHPEHU Month S & P CNX Nifty Close High Low Close ` No.767.562.433.433 1.70 67.25 38.305.541.261 621.946.408.129 1.048.00 1.85 1.53.65 1.90 November 2015 7.ACC Limited $&&6KDUH3ULFHRQ16(YLVÅYLV6 3&1.25 1.334.980 947.50 1.50 1.85 68.20 1.55 1.31 9500 1800 9000 1700 8500 1600 8000 1500 7500 1400 7000 Jan-15 Feb-15 Mar-15 Apr-15 May-15 Jun-15 S & P CNX Nifty Close 96 Jul-15 Aug-15 Sep-15 Oct-15 Nov-15 ACC Share Price (on NSE) Close Dec-15 1300 ACC Share Price on NSE (Closing) S & P CNX NIFTY ACC Share Price on NSE & S&P CNX NIFTY .10.428.320.60 46.560.10 1.33.774.49 April 2015 8.250 524.65 1.90 1.34.16 July 2015 8.80.81.35 1.20 June 2015 8.379.20 1.481.19 March 2015 8.065.00 1.032.512.85 1.444 886.181.676.40 1.90 1.948.172.346.538.366.85 1.00 1.45 1.122 1.80 1.85 1.50 1.55 61.10 1.532.373.00 1.164.74.443.433.20 1.758 636.55 1.454.28. of shares traded during the month Turnover ` crore ` ` January 2015 8.126 1.532.808.705.80 1.595.901.32 September 2015 7.00 1.336.

In cases where the core banking account details are not intimated to the Company and the Depository Participant. The old shares having face value of ` 100 are no longer tradable on the Stock Exchanges.2010 (73rd Interim) 22. the dividends for the years ended December 31.09.2008 (71st Final) 08.2010 13.2011 (74th Final) 28. Permanent Account Number (PAN) Members who hold shares in physical form are advised that SEBI has made it mandatory that a copy of the PAN card of the transferor(s).00 12.04.00 26.04.2018 31.03. SEBI Regulations also mandate Companies to credit the dividend to the Members electronically.2019 97 .00 25.07. The dates by which the dividend amounts will be transferred to IEPF are as under: Financial Year Date of Declaration Rate of Dividend per share (`) Due date for transfer to IEPF 31.Corporate Overview Financial Highlights Board & Management Reports SHARE TRANSFER SYSTEM / DIVIDEND AND OTHER RELATED MATTERS i. Share transfers Subsidiary Companies Company for exchange with shares of the face value of ` 10 each.2009 10. 2008 (71st Final) and December 31.12.2011 (74th Interim) 28.06.2009 (72nd Final) 08.50 17. from the Share Department of the Company or download the same from the Company’s website.2010 10.09.2010 (73rd Final) 13.12.12. surviving joint holders / legal heirs be furnished to the Company.2012 17. transferee(s).12.06. transmission and LVVXHRIGXSOLFDWHVKDUHFHUWLoFDWHV Payment of dividend through National Electronic Clearing Service (NECS) b. Members holding shares in dematerialized form should contact their Depository Participants (DP) in this regard. The Company will. Members holding shares in physical form may obtain a nomination form.2011 11.12.2017 31.07.2009 10.2017 31. members. while obtaining the services of transfer. in June 2016 and in September 2016 transfer to the said fund.09. ii. transposition. Share transfers for ` 10 face value shares. Nomination facility for shareholding As per the provisions of the Act. Members who hold shares in demat mode should inform their Depository Participant as well as to the Company and such of the Members holding shares in physical form should inform the Company of the core banking account details allotted to them by their bankers. in physical IRUP DUH SURFHVVHG DQG WKH VKDUH FHUWLoFDWHV DUH generally returned to the transferees within a period RI oIWHHQ GD\V IURP WKH GDWH RI UHFHLSW RI WUDQVIHU provided the transfer documents lodged with the Company are complete in all respects.12. the Company will issue dividend warrants to the Members.2016 31.00 01. facility for making nomination is available for Members in respect of shares held by them. v.12. Members are therefore urged to avail of this facility to ensure safe and speedy credit of their dividend into their Bank account through the Banks’ “Automated Clearing House”.2018 31.06.00 12. 2009 (72nd Interim) which have remained unclaimed / unpaid.2016 31. The Company provides the facility for direct credit of the dividend to the Members Bank Account. Subdivision of shares The Company had subdivided the face value of its Equity Shares from ` 100 to ` 10 in 1999.04.00 30.07. Members holding share FHUWLoFDWHVRIWKHIDFHYDOXHRI` 100 are requested to VHQGWKHFHUWLoFDWHVWRWKH6KDUH'HSDUWPHQWRIWKH Unclaimed Dividends The Company is required to transfer dividends which have remained unpaid / unclaimed for a period of seven years to the Investor Education & Protection Fund (IEPF) established by the Government. iii. Financial Statements Dividend a.06. iv.2011 20.2009 (72nd Interim) 23.

hereof. Dividends remaining unclaimed in respect of such shares shall also be held 98 in a separate suspense account and would likewise be transferred to IEPF at the end of seven years. These shares would be held by the Company on behalf of the holders of such shares in an “Unclaimed Suspense Account” to be opened with a depository.2012 11.07.05. quarterly audit of the Company’s share capital is being carried out by an independent external auditor with a view to reconcile the total share capital admitted with National Securities Depository Limited (NSDL) and Central Depository Services (India) Limited (CDSL) and held in physical form.04. the Company is in the process of dematerializing unclaimed shares which are retained with the Company.12. Pending Investors’ Grievances Any Member / Investor whose grievance has not been resolved satisfactorily.2022 Individual reminders are sent each year to those Members whose dividends have remained unclaimed for a period of seven years from the date they became due for payment.00 28.2014 15.12.2014 19.2014 (77th Final) 20. vi. in cases where unclaimed dividends have been transferred to Investor Education and Protection Fund (IEPF) for a consecutive period of seven years.07. viii.00 29. ix. The Company has sent out reminders to those 0HPEHUV ZKRVH VKDUH FHUWLoFDWHV KDYH UHPDLQHG unclaimed. The Auditors’ &HUWLoFDWH LQ UHJDUG WR WKH VDPH LV VXEPLWWHG WR BSE Limited and The National Stock Exchange of India Limited and is also placed before Stakeholders’ Relationship Committee and the Board of Directors. may kindly write to the Company Secretary & Head Compliance at WKH 5HJLVWHUHG 2IoFH ZLWK D FRS\ RI WKH HDUOLHU correspondence.00 09. Reconciliation of Share Capital Audit As required by the Securities & Exchange Board of India (SEBI). the underlying shares are also required to be transferred to IEPF.00 24.12. before transferring the monies to the Investor Education & Protection Fund (IEPF).2015 11.2013 19.2012 (75th Interim) 26.12.2014 (77th Interim) 24.07.2012 (75th Final) 05.03. .2020 31. to contact the Company immediately in the matter. As per the said Regulations. Dealing with securities which have remained unclaimed Members are hereby informed that as per Regulation 39(4) read with Schedule VI of the SEBI Regulations.2019 31. Members may note that the lawful claimant in respect of these shares / dividend will be able to claim such shares dividend from the Company till such time they remain in the Unclaimed suspense account as aforesaid.06.12.2021 31.00 20.2015 19.12.07.00 27.2013 (76th Interim) 25.12. The said Regulation has come into effect from December 1.2020 31.ACC Limited Financial Year Date of Declaration Rate of Dividend per share (`) Due date for transfer to IEPF 31. At the end of seven years.2021 31.09.2013 11. 2015.00 13.2013 (76th Final) 09.04.2022 31. with the issued and listed capital. The information on unclaimed dividend is also posted on the website of the Company as aforesaid.06.09.09. these shares shall be transferred by the Company to the IEPF. Transfer of ‘Underlying Shares’ into Investor Education and Protection Fund (IEPF) (in cases where unclaimed dividends have been transferred to IEPF for a consecutive period of seven years) Members attention is invited to Regulation 39(4) and Schedule VI of the SEBI Regulations. vii.09.2015 (78th Interim) 17.

53 106934 100.29 803311 0.11 1138435 0.84 244835 0.37 206088 0.90 2670723 1.13 687512 0.25 2354174 1.18 3326819 1.68 501-1000 4590 4.45 1967536 1. Members holding shares in physical mode are urged in their own interest to hold these shares in dematerialized form with any Depository Participant.00 Total 474465 Distribution of Shareholding as on December 31. of Shares Physical % of share capital NSDL % of share capital CDSL % of Total No.00 6914562 3.74 1791730 0. of share holders % No.61 266655 0.23 950655 0.51 187990 0.42 187745356 100.84 201-500 9521 8. 99 .00 756190 0.59 101-200 10493 9.43 2183352 1.16 340156 0.05 340939 0.81 434366 0.10 163695166 87.10 1573011 0. 2015 No of shares slab No.08 1108825 0.95 5635959 3.14 685717 0.25 232807 0.19 450100 0.40 8183879 4.18 3144877 1.24 166208064 88.41 0.90 836402 0.12 3061446 1.37 156453 0.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies Distribution of Shareholding as on December 31. 2015 The Company has entered into agreements with both National Securities Depository Limited (NSDL) and Central Depository Services (India) Limited (CDSL) whereby Members have an option to dematerialize their shares with either of the depositories.61 51-100 13489 12.39 2062798 1.77 1001-5000 3996 3.63 >10000 413 0.68 178160071 94. of % of share shares share capital capital 1-50 63991 59.36 5001-10000 441 0.

Insurance Companies - - iv.01.24.356 - 100.87. Switzerland (formerly Holcim Limited.30 Banks.77.536 - 0.842 - 12. Insurance Companies & Mutual Funds i.15 Foreign Institutional Investors 2.000 0.66.00 NRIs / Foreign Nationals Directors Public and Others TOTAL Shareholding Pattern as on December 31.63 iii. 2015 Category No. of Shares held % Promoter i.01 5.34.09 Central & State Governments 2.78 50.88. Switzerland).75 18.699 0.68 18.41. 9. Holcim (India) Private Limited ii. 100 . Holderind Investments Ltd.120 50. Mutual Funds 69.815 - 0.29 14. Financial Institutions.55 0 - 0.38. Financial Institutions 2. Banks ii.246 3.ACC Limited Shareholding Pattern as on December 31.00 3.45.52.166 - 18.28.55.. 2015 The Company is a subsidiary of Holcim (India) Private Limited and an ultimate subsidiary of LafargeHolcim Ltd.16 10.932 13.91.09.

2015 Sr.30 Promoter: Holcim (India) Private Limited 93888120 Holderind Investments Ltd. Sir Vithaldas Thackersey Marg. No. 19. no resolution has been passed through the exercise of postal ballot.00 p. Mumbai 400 020 Date Time Special Resolutions passed 20.m.13 125035151 66. conversion dates and likely impact on Equity NIL Particulars of past three Annual General Meetings AGM Financial Year 79th Calendar Year 2014 78th Calendar Year 2013 77th Calendar Year 2012 Venue Birla Matushri Sabhagar.00 p. 1 Names of the shareholders Number of shares Percentage of Capital 94429120 50. the persons who conducted the postal ballot exercise and details of the voting pattern During the year under review.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies Statement showing Shareholding of more than 1% of the Capital as on December 31.01 4 JP Morgan Sicav Investment Company (Mauritius) Limited 2546356 1. Details of Resolution passed through postal ballot.2013 3.m. No Special Resolution was passed Extraordinary General Meeting (EGM) No Extraordinary General Meeting was held during the period under reference.00 p.m.36 5 JP Morgan India Fund 2115988 1.81 3 Aberdeen Global Indian Equity (Mauritius) Limited 3768936 2.2015 3. 541000 2 Life Insurance Corporation of India 22174751 11.03. 101 .04. No Special Resolution was passed 05.2014 3.04.61 TOTAL Global Depository Receipts (GDR) / American Depository Receipts (ADR) / Warrants or any Convertible instrument. No Special Resolution was passed 09.

Mumbai 400 020 Dividend Payment Date April 20. 2016 Within sixty days from the end of the last quarter. 2016 to February 29.00 p.m.ACC Limited FINANCIAL CALENDAR 2016: Board Meeting for consideration of Accounts for February 10.m. 2016 102 . Sir Vithaldas Thackersey Marg. as stipulated under the SEBI (Listing Obligations and Disclosure Requirements) Regulations. 2015 with the Stock Exchanges For and on behalf of the Board N S Sekhsaria Chairman Mumbai February 10. Meeting Birla Matushri Sabhagar. 2016 before 3. 2016 Book Closure Dates February 24. 19. 2016 Board Meeting for consideration of unaudited :LWKLQ IRUW\ oYH GD\V IURP WKH HQG RI WKH TXDUWHU DV TXDUWHUO\ UHVXOWV IRU WKH oQDQFLDO \HDU HQGHG stipulated under the SEBI (Listing Obligations and Disclosure December 31. 2015 with the Stock Exchanges $XGLWHGUHVXOWVIRUWKHFXUUHQWoQDQFLDO\HDUHQGLQJ December 31. 2016 Requirements) Regulations.00 p. 2016 at 3. 2016 Probable date of despatch of warrants On or before April 19. 2016 WKH oQDQFLDO \HDU HQGHG 'HFHPEHU   DQG recommendation of dividend Posting of Annual Reports On or before March 19. 2016 (both days inclusive) Last date for receipt of Proxy Forms April 11. Time & Venue of the 80th Annual General April 13. Date.

the Board Members DQG WKH 6HQLRU 0DQDJHPHQW 3HUVRQQHO KDYH FRQoUPHG FRPSOLDQFH ZLWK WKH &RGH RI &RQGXFW IRU WKH \HDU HQGHG December 31.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies Compliance with Code of Business Conduct and Ethics As provided under SEBI (Listing Obligations and Disclosure Requirements) Regulations. 2015.&(5 &(2. 2015. For ACC Limited Harish Badami &KLHI([HFXWLYH2IoFHU 0DQDJLQJ'LUHFWRU  Mumbai February 10. 2016 &+.()(.9(2)).(&87.

$/2)). &+.&(5 &)2.1$1&.()).

&(57.&$7.21 :HWKHXQGHUVLJQHGLQRXUUHVSHFWLYHFDSDFLWLHVDV&KLHI([HFXWLYH2IoFHU 0DQDJLQJ'LUHFWRUDQG&KLHI)LQDQFLDO 2IoFHURI$&&/LPLWHG kWKH&RPSDQ\y.).

We further state that to the best of our knowledge and belief. b. to the Auditors and the Audit Committee: L VLJQLoFDQWFKDQJHVLIDQ\LQLQWHUQDOFRQWURORYHUoQDQFLDOUHSRUWLQJGXULQJWKH\HDU LL VLJQLoFDQWFKDQJHVLIDQ\LQWKHDFFRXQWLQJSROLFLHVGXULQJWKH\HDUDQGWKDWWKHVDPHKDVEHHQGLVFORVHGLQ WKHQRWHVWRWKHoQDQFLDOVWDWHPHQWVDQG LLL LQVWDQFHV RI VLJQLoFDQW IUDXG RI ZKLFK ZH KDYH EHFRPH DZDUH DQG WKH LQYROYHPHQW WKHUHLQ LI DQ\ RI WKH PDQDJHPHQW RU DQ HPSOR\HH KDYLQJ VLJQLoFDQW UROH LQ WKH &RPSDQ\ V LQWHUQDO FRQWURO V\VWHP RYHU WKH oQDQFLDOUHSRUWLQJ Yours faithfully Harish Badami &(2 0DQDJLQJ'LUHFWRU      Sunil Nayak &KLHI)LQDQFLDO2IoFHU Mumbai February 10. G :H DUH UHVSRQVLEOH IRU HVWDEOLVKLQJ DQG PDLQWDLQLQJ LQWHUQDO FRQWUROV IRU oQDQFLDO UHSRUWLQJ DQG WKDW ZH KDYH HYDOXDWHGWKHHIIHFWLYHQHVVRILQWHUQDOFRQWUROV\VWHPVRIWKH&RPSDQ\SHUWDLQLQJWRoQDQFLDOUHSRUWLQJRIWKH &RPSDQ\ DQG KDYH GLVFORVHG WR WKH $XGLWRUV DQG $XGLW &RPPLWWHH GHoFLHQFLHV LQ WKH GHVLJQ RU RSHUDWLRQ RI internal controls. applicable laws and regulations. based in our most recent evaluation. We have indicated. these statements together present a true and fair view of the Company’s affairs and are in compliance with existing accounting standards. of which we are aware and the steps we have taken or proposed to take to rectify these GHoFLHQFLHV e. we state that: i. 2015 and that to the best of our knowledge and belief. wherever applicable. 2016 103 . which are fraudulent.WRWKHEHVWRIRXUNQRZOHGJHDQGEHOLHIFHUWLI\WKDW D :H KDYH UHYLHZHG oQDQFLDO VWDWHPHQWV DQG WKH FDVK pRZ VWDWHPHQW IRU WKH oQDQFLDO \HDU HQGHG December 31. F :H KHUHE\ GHFODUH WKDW DOO WKH PHPEHUV RI WKH %RDUG RI 'LUHFWRUV DQG ([HFXWLYH &RPPLWWHH KDYH FRQoUPHG compliance with the Code of Business Conduct as adopted by the Company. ii. if any. illegal or violative of the Company’s Code of Business Conduct. these statements do not contain any materially untrue statement or omit any material fact or contain any statements that might be misleading. there are no transactions entered into by the Company during the year.

:HIXUWKHUVWDWHWKDWVXFKFRPSOLDQFHLVQHLWKHUDQDVVXUDQFHDVWRWKHIXWXUHYLDELOLW\RIWKH&RPSDQ\QRUWKHHIoFLHQF\ or effectiveness with which the management has conducted the affairs of the Company. adopted by the Company for ensuring the compliance of the FRQGLWLRQVRIWKH&RUSRUDWH*RYHUQDQFH.WLVQHLWKHUDQDXGLWQRUDQH[SUHVVLRQRIRSLQLRQRQWKHoQDQFLDOVWDWHPHQWV of the Company. The compliance of conditions of corporate governance is the responsibility of the management. 2015 pursuant to the Listing Agreement of the said Company with stock exchanges.: 49365 Mumbai February 10.ACC Limited AUDITORS’ CERTIFICATE To The Members of ACC Limited We have examined the compliance of conditions of corporate governance by ACC Limited. we certify that the &RPSDQ\ KDV FRPSOLHG ZLWK WKH FRQGLWLRQV RI &RUSRUDWH *RYHUQDQFH DV VWLSXODWHG LQ WKH SURYLVLRQV DV VSHFLoHG LQ Chapter IV of Securities and Exchange Board of India (Listing Obligations and Disclosure Requirements) Regulations. )RU65%& &2//3 Chartered Accountants ICAI Firm registration number: 324982E per Ravi Bansal Partner Membership No. 2015 pursuant to the Listing Agreement of the said Company with stock exchanges. Our examination was limited to procedures and implementation thereof. 2015 as stipulated in Chapter IV of Securities and Exchange Board of India (Listing Obligations and Disclosure Requirements) Regulations. In our opinion and to the best of our information and according to the explanations given to us. for the year ended on December 31. 2016 104 .

2015 to December 31.   Total number of locations where business activity is undertaken by the Company: i.com 5.com 6. E-mail id : brr. Markets served by the Company Section B: Financial Details of the Company 1. Number of international locations : Nil ii.15. Sector(s) that the Company is engaged in (industrial activity code wise): 8.acclimited. Financial Year reported : January 1. 2015 7. 9.95 Crore 2. Ordinary Portland Cement (OPC). Registered Address : Cement House 121. Name of the Company : ACC Limited 3. Maharshi Karve Road Mumbai 400 020 4.     10. Group Class Sub class 269 2694 26942 Description Manufacture of Portland Cement List three key product/services that the Company manufactures/provides (as in balance sheet): The Company manufactures cement of various kinds viz. Paid up capital (INR) : ` 187. DQG2IoFHVLQFOXGLQJ5HJLVWHUHG2IoFH5HJLRQDO 2IoFHVDQG6DOHV2IoFHV : Pan India across all markets in India.57 Crore  7RWDOSURoWDIWHUWD[HV .info@acclimited. Portland Pozzolana Cement (PPC) and Portland Slag Cement (PSC) and Ready Mixed Concrete (RMX).432.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies BUSINESS RESPONSIBILITY REPORT FOR THE FINANCIAL YEAR 2015 Section A: General Information about the Company 1.   Number of national locations             :   17 Cement Plants. Total turnover (INR) : ` 11.76 Crore  ` 591. Website : www. Corporate Identity Number (CIN) : L26940MH1936PLC002515 2. 50 Ready Mixed Concrete Plants.

    7RWDOVSHQGLQJRQ&RUSRUDWH6RFLDO5HVSRQVLELOLW\ &65.

DVSHUFHQWDJHRISURoWDIWHUWD[ .

  7KH&RPSDQ\ VWRWDOVSHQGLQJRQ&65LVRIWKHDYHUDJHQHWSURoWLQWKHSUHYLRXVWKUHHoQDQFLDO\HDUV 105 .

Partnering with an NGO.Sanrakshit Paryavaran ACC .DISHA ACC . Bulk Cement Corporation (India) Limited c. the Company has 5 subsidiaries. Punjab. 3. ACC Mineral Resources Limited b.I\HVWKHQLQGLFDWHWKHSHUFHQWDJHRIVXFKHQWLW\HQWLWLHV">/HVVWKDQ 0RUHWKDQ@ &65LQLWLDWLYHk$&&NL/DDGOLyXQGHUWKH9LG\D8WNDUVKSURMHFWLVDpDJVKLSHGXFDWLRQLQLWLDWLYHRI$&& V&65LQWKH Northern region. The project receives contributions from Cement Dealers in the Northern Region in the form of “Lakshya Points” secured by them in appreciation for their achievements of business targets from ACC.Vidya Sarathi ACC . Singhania Minerals Private Limited 2.Vidya Utkarsh ACC . ACC . d. suppliers. Rajasthan.Arogyam ACC . c. e. distributors etc) that the Company does business with. f. Himachal Pradesh. then indicate the number of such subsidiary company(s)? Business Responsibility initiatives of the parent company are applicable to all subsidiary companies. About 1.LIESA ACC . Lucky Minmat Limited d. Madhya Pradesh. National Limestone Company Private Limited e.513 girl children. The aim is to bring mainstream education for these girls and prepare them to appear for Class V exam of the State level. i. participate in WKH%5LQLWLDWLYHVRIWKH&RPSDQ\".g. g.Swavlamban ACC .Sampoorn Swachhata ACC . viz: a.ACC Limited  /LVWRIDFWLYLWLHVLQZKLFKH[SHQGLWXUHLQDERYHKDVEHHQLQFXUUHG a. 106 . The points are then redeemed E\WKHPDVoQDQFLDOLQSXWVLQWRWKLVSURMHFW The project implementation started in October 2013 and so far 50 learning centres have been set up in different parts of Uttar Pradesh. b. Does the Company have any Subsidiary Company / Companies? Yes. Haryana and Uttarakhand and teaching is continuing in these centres since then. Do the Subsidiary Company / Companies participate in the BR initiatives of the parent Company? If yes. h. Do any other entity / entities (e.Drona Section C: Other Details 1. this initiative has been undertaken to establish learning centres for girl children in the age group 6-14 years. especially those who dropped out of school and belonging to marginalized and deprived sections of the society are enrolled in these schools and are given quality primary education.

Details of Director / Directors responsible for BR: a) Details of the Director / Directors responsible for implementation of the BR Policy / Policies:  'LUHFWRU.1.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies Section D: BR Information 1.GHQWLoFDWLRQ1XPEHU '.

107 .Businesses should provide goods and services that are safe and contribute to sustainability throughout their life cycle. P3 .Businesses should respect and promote human rights. especially those who are disadvantaged.Businesses should promote the well being of all employees. No Particulars Details 1 DIN (if applicable) NA 2 Name Mr Burjor D Nariman 3 Designation &RPSDQ\6HFUHWDU\ +HDG&RPSOLDQFH 4 Telephone Number (022) 3302 4321 / 3302 4329 5 E mail Id brr.Businesses should respect. P2 .Businesses should support inclusive growth and equitable development. protect and make efforts to restore the environment. P5 .Businesses should respect the interests of and be responsive towards all stakeholders.Businesses should conduct and govern themselves with Ethics. P6 .com Principle-wise (as per NVGs) BR Policy / Policies (Reply in Y/N): The National Voluntary Guidelines (NVGs) on Social. Transparency and Accountability. Details of the BR Head: Sr. P7 %XVLQHVVHVZKHQHQJDJHGLQLQpXHQFLQJSXEOLFDQGUHJXODWRU\SROLF\VKRXOGGRVRLQDUHVSRQVLEOHPDQQHU P8 .Businesses should engage with and provide value to their customers and consumers in a responsible manner. P9 . P4 .info@acclimited. vulnerable and marginalized. Name: Mr Harish Badami 'HVLJQDWLRQ&KLHI([HFXWLYH2IoFHU 0DQDJLQJ'LUHFWRU b) 2. Environmental and Economic Responsibilities of Business UHOHDVHGE\WKH0LQLVWU\RI&RUSRUDWH$IIDLUVKDVDGRSWHGQLQHDUHDVRI%XVLQHVV5HVSRQVLELOLW\7KHVHEULHp\DUH as under: P1 .

Wellbeing of Employees Questions Product Responsibility Sr No Business Ethics ACC Limited P1 P2 P3 P4 P5 P6 P7 P8 P9 Y Y Y Y Note 2 Y Y - Y Y - Y - Y - Y - Y** Y - Y Y - N Y - Y Y Note 1 2 Has the policy been formulated in consultation with the relevant Y Y Y stakeholders? Y Y 3 Does the policy conform to any national / international standards? Y Y Note 3 Note 4 If yes. specify? (50 words) 4 Has the policy been approved by the Board? If yes...Stakeholder (QJDJHPHQW &65 Human Rights Environment Public Policy CSR Customer Relations 1 Do you have a policy / policies for.IDQVZHUWR6U1RDJDLQVWDQ\SULQFLSOHLVC1R SOHDVHH[SODLQZK\ 7LFNXSWRRSWLRQV.. has it been signed Y N Y Note 6 by MD / owner / CEO / appropriate Board Director? Y Y Y 5 'RHVWKH&RPSDQ\KDYHDVSHFLoHG&RPPLWWHHRIWKH%RDUG'LUHFWRU Y Note 7 2IoFLDOWRRYHUVHHWKHLPSOHPHQWDWLRQRIWKHSROLF\" 6 Indicate the link for the policy to be viewed online? * # 7 Has the policy been formally communicated to all relevant internal Y Y Y and external stakeholders? 8 Does the Company have in-house structure to implement the Y Y Y Y policy /policies? Note 8 Y Y Y 9 Does the Company have a grievance redressal mechanism related to the policy / policies to address stakeholders’ grievances related to the policy /policies? 10 Has the Company carried out independent audit/evaluation of the Y N Y working of this policy by an internal or external agency? Note 9 Y Note 5 Y Refer Note 10 Y # Y Refer Note 11 .

acclimited. 2013. Note 9: Compliance reports from designated employees which is audited by Statutory Auditors. Note 11: 7KH&RPSDQ\KDVDV\VWHPDWLFSURFHVVRIDVVHVVLQJFXVWRPHUQHHGVIXOoOOLQJWKHPZLWKLQQRYDWLYHSURGXFWVDQGVHUYLFHV. Note 5: Policy conforms to guidelines of Companies Act. All our projects are mapped to concerned SDGs and its related targets 1RWH$OOHPSOR\HHUHODWHGSROLFLHVDUHGLVFXVVHGDQGDSSURYHGE\WKH0DQDJHPHQW([HFXWLYH&RPPLWWHHKHDGHGE\WKH&(2 0' and its implementation monitored by Human Resources Division.pdf ** http://www. customer complaint portal. Note 10:7KH&RPSDQ\KDVDWUDFNUHFRUGRISLRQHHULQJDFKLHYHPHQWVORQJH[SHULHQFHDQGOHDGHUVKLSSRVLWLRQZKLFKKDVEHQHoWWHG the cement industry at large in initiating dialogue with the Government. no need for a formal policy has been felt. the Policy is also in conformity with the Sustainable Development Goals (SDGs).acclimited.pdf Note 1: Note 2: Note 3: Note 4: 7KHSROLF\LVHPEHGGHGLQWKH&RPSDQ\ VTXDOLW\ HQYLURQPHQWSROLFLHVZKLFKLQWHUDOLDUHODWHWRVDIH VXVWDLQDEOHSURGXFWV The policy is embedded in the Company’s Code of Business Conduct.W also has a customer complaint redressal system. However. Bureau of Indian Standards (BIS).e. In addition. 108 .com/newsite/pdf/Policy/ACCCSRPolicy_2015SignedbyMD. the Policy is also in conformity with the Sustainable Development Goals (SDGs). Note 7: At Executive Committee Meetings. HR policies and various other HR practices. 1   4 5 6 The Company has not understood the principles 7KH&RPSDQ\LVQRWDWDVWDJHZKHUHLWoQGVLWVHOILQDSRVLWLRQWRIRUPXODWHDQGLPSOHPHQWWKHSROLFLHVRQVSHFLoHGSULQFLSOHV 7KH&RPSDQ\GRHVQRWKDYHoQDQFLDORUPDQSRZHUUHVRXUFHVDYDLODEOHIRUWKHWDVN It is planned to be done within next six months It is planned to be done within next one year Any other reason (please specify) KWWSZZZDFFOLPLWHGFRPQHZVLWHoQDQFHDVS"WDJ FEF # http://www. Note 8: The Company has a redressal mechanism to address product related complaints i. This policy conforms to guidelines of Companies Act. All our projects are mapped to concerned SDGs and its related targets.com/newsite/pdf/Policy/ACCCorporate_EnvironmentPolicy2015. 2013. In addition.

1. This report constitutes the Company’s Fourth Business Responsibility Report. BRR is included in the Annual Report. risks and / or opportunities.  'RHVWKHSROLF\UHODWLQJWRHWKLFVEULEHU\DQGFRUUXSWLRQFRYHURQO\WKH&RPSDQ\"<HV1R'RHVLWH[WHQGWRWKH Group / Joint Ventures / Suppliers / Contractors / NGOs / Others? The Company considers Corporate Governance as an integral part of good management. Transparency and Accountability. provide details thereof. The Company has a Code of Business Conduct (along with an anti-Bribery and Corruption Directive) and a vigil mechanism named EthicalView Reporting Policy that are approved by the Board of Directors. the Company has been releasing the printed version every year. The Company also uses industrial/municipal hazardous waste as alternative fuel. 109 . Since 2013.com/newsite/sdevelopment. Within 3 months. out of which 57 were resolved and the balance 31 complaints are under various stages of investigation and completion. More than 1 year. vendors/service providers/customers. Blended cements viz. The Code is available on the Company’s ZHEVLWHDWWKLVZHEDGGUHVVKWWSZZZDFFOLPLWHGFRPQHZVLWHoQDQFHDVS"WDJ FEF  +RZ PDQ\ VWDNHKROGHU FRPSODLQWV KDYH EHHQ UHFHLYHG LQ WKH SDVW oQDQFLDO \HDU DQG ZKDW SHUFHQWDJH ZDV satisfactorily resolved by the management? If so. The hyper-link for viewing the Sustainability Report of the Company is http://www. The Company received 88 complaints under the EthicalView Reporting Policy. The Company uses biomass in its manufacturing process. Annually. The Company was publishing a printed version of the SD Report in a two year cycle. 3 to 6 months.acclimited. the Company releases a Sustainable Development (SD) Report every year. Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies Governance related to BR: Indicate the frequency with which the Board of Directors. 3-6 months. in about 50 words or so.asp. The Anti Bribery and Corruption Directive and the EthicalView Reporting Policy also extends to the Company’s business partners viz. These are applicable to all Board Members DQGHPSOR\HHVRIWKH&RPSDQ\DQGDOOLWVVXEVLGLDULHVDQGDQDQQXDODIoUPDWLRQLVWDNHQIURPWKHGHVLJQDWHG employees.Corporate Overview 3. Committee of the Board or CEO meet to assess the BR performance of the Company. Principle 2: Businesses should provide goods and services that are safe and contribute to sustainability throughout their life cycle. List up to 3 of your products or services whose design has incorporated social or environmental concerns. Portland Pozzolana Cement (PPC) and Portland Slag Cement (PSC). Section E: Principle-wise Performance Principle 1: Business should conduct and govern themselves with Ethics. Does the Company publish a BR or a Sustainability Report? What is the hyper-link for viewing this report? How frequently it is published? Yes.

water) has been achieved since the previous year. as the cement manufacturing process is highly energy intensive. 5. in about 50 words or so. housekeeping and the like from nearby suitable sources of supply. what steps have been taken to improve the capacity and capability of local and small vendors? The Company has a policy of procuring goods and services like horticulture. The Company’s products do not have any broad based impact on energy. including communities surrounding their place of work? If yes. Does the Company have procedures in place for sustainable sourcing (including transportation)? If yes. water. In the manufacture of clinker. what percentage of your inputs was sourced sustainably? Also. what is the percentage of recycling of SURGXFWVDQGZDVWH" 6HSDUDWHO\DV!. raw material etc) per unit of product (optional): i. Does the Company have a mechanism to recycle products and waste? If yes. provide details thereof. Has the Company undertaken any steps to procure goods and services from local and small producers. The Company encourages procurement through vendors who adopt sustainable practices. Reduction during sourcing / production / distribution achieved since the previous year throughout the value chain: Consumption per unit of production Electrical Energy (kWh/ Tonne of Cement) Thermal Energy (K Cal / kg of Clinker) CO2 Emissions (kg CO2 / Tonne of Cement) ii. Most bulk materials are transported inward by UDLO%OHQGHG&HPHQWVDUHPDQXIDFWXUHGXVLQJp\DVKVODJZKLFKDUHE\SURGXFWVZDVWHVRIRWKHULQGXVWULHV)O\ ash and slag are not environmentally friendly and need to be disposed off in a careful manner. For each such product. Yes. However. the Company takes several measures to reduce thermal and electrical energy consumption. provide the following details in respect of resource use (energy.45 80 730 730 533 526 Reduction during usage by consumers (energy. all the Company’s integrated plants are situated close to limestone mines which helps minimize transportation. 4.ACC Limited 2. 3. The Company deploys sustainable mining practices. Current Year Previous Year (January – December 2015) (January – December 2014) 84. the company utilizes Alternative Fuel and Raw Materials (AFR) which help conserve natural resources.

The location of cement plants are far away from markets. 110 . municipal and agricultural wastes as Alternative Fuels and Raw Materials (AFR) in India.$OVRSURYLGHGHWDLOVWKHUHRILQDERXWZRUGVRUVR  7KHFHPHQWPDQXIDFWXULQJSURFHVVGRHVQRWGLUHFWO\GLVFKDUJHDQ\VLJQLoFDQWHIpXHQWRUZDVWH ACC has the facility of consuming used cement bags as Alternate Fuel in some of the manufacturing units. About 85% of cement manufactured by the Company comprises blended cement which is produced using slag and p\DVKZKLFKDUHZDVWHVIURPRWKHULQGXVWULDOSURFHVVHV Recognizing the urgent need to address global problems of increasing paucity of fossil fuels and rampant practices of unsustainable waste disposal. a very low percentage of used bags get recycled at the Plants. the Company has pioneered the use of industrial.

7. Do you have an employee association that is recognized by the Management? <HV WKHUH DUH UHFRJQL]HG WUDGH XQLRQV DIoOLDWHG WR YDULRXV FHQWUDO WUDGH XQLRQ ERGLHV &RPSDQ\ V 6KRS )ORRU $VVRFLDWHVDQG2IoFH$VVRFLDWHVDUHPHPEHUVRIWKHLUUHVSHFWLYHXQLRQV 6.368 Please indicate total number of employees hired on temporary / contractual / casual basis: Sr.831 34 Total 3. 8. ACC 2. of Employees 7. 1 Child labour / forced labour / involuntary labour 2 Sexual Harassment 3 Discriminatory employment 1R RI FRPSODLQWV oOHG No of complaints pending as GXULQJWKHoQDQFLDO\HDU RQHQGRIWKHoQDQFLDO\HDU NIL NIL 1 0 NIL NIL 111 . Please indicate total number of employees: Sr. What percentage of permanent employees is members of this recognized employee association? Approximately 47% of permanent employees are members of recognized employee associations. Please indicate the number of permanent employees with disabilities: Number of permanent employees with disabilities: 29 5. Category of Employees No. No.  3OHDVH LQGLFDWH WKH QXPEHU RI FRPSODLQWV UHODWLQJ WR FKLOG ODERXU IRUFHG ODERXU LQYROXQWDU\ ODERXU VH[XDO KDUDVVPHQWLQWKHODVWoQDQFLDO\HDUDQGWKRVHSHQGLQJDVRQWKHHQGRIWKHoQDQFLDO\HDU Sr. 1. Concrete Business No.604 764 Total 2. Subcontracted Employees 0 3.929 Please indicate the number of permanent women employees: Number of permanent women employees: 332 4. Retainers / Advisors 64 2. Category No. Casual Employees 7.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies Principle 3: Businesses should promote the well-being of all employees. Third Party Employees 4. of Employees 1. No. Category of Employees 1.

 2XWRIWKHDERYHKDVWKH&RPSDQ\LGHQWLoHGWKHGLVDGYDQWDJHGYXOQHUDEOHDQGPDUJLQDOL]HGVWDNHKROGHUV"  <HVWKH&RPSDQ\KDVLGHQWLoHGWKHGLVDGYDQWDJHGYXOQHUDEOHDQGPDUJLQDOL]HGVWDNHKROGHUVZLWKWKHKHOSRI socio-demographic data of the community through base line surveys. in about 50 words or so.ACC Limited 8. Are there any special initiatives taken by the Company to engage with the disadvantaged. Some noteworthy Projects are Solar Micro Grids for household electricity supply. especially those who are disadvantaged. Permanent women employees : 36% C. The Company’s pilot initiative for energy security in remote tribal areas and educational support to dropout girl children are some of the other special initiatives undertaken to engage with the vulnerable and marginalized stakeholders. What percentage of undermentioned employees were given safety and skill up-gradation training in the last year? A. vulnerable and marginalized. 3. The Company has enhanced the access to healthcare for the community through health camps and mobile health clinics. the Company has mapped its stakeholders as a part of its stakeholder engagement strategy development process. quality education is being provided to school going children from affected families. Project DISHA for oYHWKRXVDQG\RXWKIRUPDWLRQRIDIDUPHUSURGXFHUFRPSDQ\DQGD6+*FRRSHUDWLYHIHGHUDWLRQ Principle 5: Businesses should respect and promote human rights. Casual / Temporary / Contractual employee : NIL D. Permanent employees : 68% B. vulnerable and marginalized stakeholders? If so. The Company continues to run two Anti-Retroviral Therapy (ART) centers to support people affected by HIV/AIDS through medical treatment and counselling. The Company also jointly works with the local district administration for promoting national campaigns on DOTS for TB. In addition. The Company has also supported patients by organizing them in Self Help Groups and through life skills development programmes and by providing nutritional support to HIV infected as positive cases. Malaria prevention and immunization.  +DVWKH&RPSDQ\PDSSHGLWVLQWHUQDODQGH[WHUQDOVWDNHKROGHUV"<HV1R Yes.  +RZPDQ\VWDNHKROGHUFRPSODLQWVKDYHEHHQUHFHLYHGLQWKHSDVWoQDQFLDO\HDUDQGZKDWSHUFHQWZDVVDWLVIDFWRULO\ resolved by the Management? NIL 112 . provide details thereof. Employees with disabilities : 40% Principle 4: Businesses should respect the interests of and be responsive towards all stakeholders.  'RHVWKHSROLF\RIWKH&RPSDQ\RQKXPDQULJKWVFRYHURQO\WKH&RPSDQ\RUH[WHQGWRWKH*URXS-RLQW9HQWXUHV / Suppliers / Contractors / NGOs / Others? All aspects of the human rights are inbuilt and covered under the Company’s Code of Business Conduct as well in various human resource practices / policies.

the Company has a mechanism to identify and assess potential environmental risks in its plants and in respect of its projects. Does the Company have strategies / initiatives to address global environmental issues such as climate change.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies Principle 6: Businesses should respect.com/newsite/sdevelopment. protect and make efforts to restore the environment  'RHVWKHSROLF\UHODWHGWR3ULQFLSOHFRYHURQO\WKH&RPSDQ\RUH[WHQGVWRWKH*URXS-RLQW9HQWXUHV6XSSOLHUV / Contractors / NGOs / others? The Company’s Corporate Environment Policy extends to cover the Company and its subsidiaries. global warming etc? Y/N. The hyperlink for the same is http://www. the Company is committed to reduce GHGs emissions and has a clear roadmap to achieve this. Yes. If yes. the Company has three registered projects under the Clean Development Mechanism (CDM).acclimited. 4. Does the Company identify and assess potential environmental risks? Y/N Yes. 2. provide details WKHUHRILQDERXWZRUGVRUVR$OVRLI\HVZKHWKHUDQ\HQYLURQPHQWDOFRPSOLDQFHUHSRUWLVoOHG" Yes. Does the Company have any project related to Clean Development Mechanism (CDM)? If so. Environmental &RPSOLDQFH 5HSRUW 9DOLGDWLRQ  9HULoFDWLRQ 5HSRUWV. please give hyper-link for webpage etc.asp 3.

Tamil Nadu and Rajasthan and Waste Co-processing in cement plants.asp 6. not resolved to satisfaction) DVRIHQGRIoQDQFLDO\HDU One.acclimited. three wind farms – one each in Maharashtra. Are the Emissions / Waste generated by the Company within the permissible limits given by CPCB / SPCB for the oQDQFLDO\HDUEHLQJUHSRUWHG" Yes.e. The Company is a Member of: i.  7KH &RPSDQ\ KDV WDNHQ XS VHYHUDO LQLWLDWLYHV RQ FOHDQ WHFKQRORJ\ HQHUJ\ HIoFLHQF\ DQG UHQHZDEOH HQHUJ\ such as the Waste Heat Recovery System (WHRS) at Gagal Cement Works. KDYH EHHQ oOHG &HUWLoHG (PLVVLRQ 5HGXFWLRQV 5HSRUWV were issued.com/newsite/sdevelopment. ii. 3ULQFLSOH%XVLQHVVHVZKHQHQJDJHGLQLQpXHQFLQJSXEOLFDQGUHJXODWRU\SROLF\VKRXOGGRVRLQDUHVSRQVLEOHPDQQHU 1. The hyperlink for the same is http://www.  +DVWKH&RPSDQ\XQGHUWDNHQDQ\RWKHULQLWLDWLYHVRQFOHDQWHFKQRORJ\HQHUJ\HIoFLHQF\UHQHZDEOHHQHUJ\HWF" Y/N. name only those major ones that your business deals with. the emissions/waste generated by the Company are within the permissible limits prescribed by CPCB/SPCB 7. Number of show cause / legal notices received from CPCB / SPCB which are pending (i. provide hyper-link to web page etc. Confederation of Indian Industry (CII) Federation of Indian Chambers of Commerce and Industry (FICCI) Bombay Chamber of Commerce and Industry Federation of Indian Mineral Industries (FIMI) 113 . Is your Company a member of any trade and chambers of association? If yes. iii. iv. If yes.

Energy Conservation iv.  'RHVWKH&RPSDQ\KDYHVSHFLoHGSURJUDPPHVLQLWLDWLYHVSURMHFWVLQSXUVXLWRIWKHSROLF\UHODWHGWR3ULQFLSOH" If yes.I\HVVSHFLI\WKHEURDGDUHDV GURSER[*RYHUQDQFHDQG$GPLQLVWUDWLRQ(FRQRPLF5HIRUPV. Have you advocated / lobbied through above associations for the advancement or improvement of public good? <HV1R. Others) Yes.QFOXVLYH Development Polices. Water. following are the Broad Areas: i. Sustainable Mining Practices LL :DVWH0DQDJHPHQWq&RSURFHVVLQJRIPXQLFLSDODQGLQGXVWULDOKD]DUGRXV QRQKD]DUGRXVZDVWHV iii.  <HV WKH &RPSDQ\ KDV VSHFLoF SURJUDPPHV  LQLWLDWLYHV  SURMHFWV LQ SXUVXDQFH RI LWV &65 SROLF\ 7KH &RPSDQ\ engages all sections of the host communities for developing their village through micro plans.ACC Limited 2. details thereof. Implementation RI WKHVH PLFUR SODQV  PRQLWRULQJ LV GRQH E\ WKH &RPPXQLW\ $GYLVRU\ 3DQHOV &$3. Sustainable Business Principles. Energy Security. Promotion of Concrete Roads Principle 8: Businesses should support inclusive growth and equitable development. Food Security.

e. planning of CSR activities. Quality of Education  +HDOWK 6DQLWDWLRQ  $UH WKH SURJUDPPHV  SURMHFWV XQGHUWDNHQ WKURXJK LQKRXVH WHDP  RZQ IRXQGDWLRQ  H[WHUQDO 1*2  *RYW structure / any other organization? The Company’s CSR Projects are implemented through an internal team as well as in partnership with Non-Governmental Organizations (NGOs). 114 . primarily focusing on:  /LYHOLKRRG (PSOR\DELOLW\ 2. Academic and Government Institutions. The Company has carried out CSR Projects in pursuance of inclusive development. The Company also engages third party organizations to assist in need assessment and annual evaluations through a 6RFLDO$XGLWSURFHVVEDVHGRQ35$oQGLQJV7KH&65SURMHFWSDUWLFLSDQWVLQFOXGHWKHGLVDGYDQWDJHGYXOQHUDEOHDQG marginalized sections of society. A third party Social Audit of all CSR H[SHQVHVZDVFDUULHGRXW$6RFLDO$XGLW&RPPLWWHHZDVFRQVWLWXWHGZKLFKHQJDJHGDQRUJDQL]DWLRQIRUDoHOG YLVLW WR DOO SODQW VLWHV %DVHG RQ WKH oQGLQJV RI WKH oHOG YLVLWV WKH LPSOHPHQWDWLRQ HIIHFWLYHQHVV DQG HIoFLHQF\ were mapped on a CSR performance score card which was then incorporated into the Company’s performance management system. process monitoring and evaluation. DW DOO SODQW ORFDWLRQV 7KH CAP helps at all stages of CSR interventions i. 3. Have you done any impact assessment of your initiative? Yes. the Company has conducted impact assessments of its CSR initiatives.

information sharing and participatory implementation. / Remarks (additional information) Yes. While implementing the projects.13 5 ACC .Amount in INR and details of the projects undertaken? The Company spent an amount of ` 31.94 Total 31. Initially.Arogyam 3. apart from the statutory LQIRUPDWLRQWKHNH\SURGXFWEHQHoWVDUHDOVRKLJKOLJKWHGRQWKHFHPHQWEDJ 115 .36 4 ACC .  :KDW3HUFHQWDJHRIFXVWRPHUFRPSODLQWVFRQVXPHUFDVHVDUHSHQGLQJDVRQWKHHQGRIoQDQFLDO\HDU" A total of 285 complaints were received from customers (end-consumers) in 2015. a Stakeholder Engagement Survey (SES) is carried out to meet stakeholders to obtain their feedback for future implementation of projects. which facilitate inclusive project planning. the Company follows a participatory approach in the selection of CSR initiatives.16 Crore in developmental projects as under: Sr. in respect of special products like ‘ACC F2R (Foundation to Roof) Cement’ etc. UHTXLUHG PRGLoFDWLRQV DUH FDUULHG RXW LQ RQJRLQJ LQLWLDWLYH LPSOHPHQWDWLRQ SURMHFWV 7KLV KHOSV LQ IRVWHULQJ ownership amongst local communities. 5. Principle 9: Businesses should engage with and provide value to their customers and consumers in a responsible manner.64 3 ACC . All CSR projects follow a bottom up approach to the planning process.Corporate Overview 4.16 Have you taken steps to ensure that this community development initiative is successfully adopted by the FRPPXQLW\"3OHDVHH[SODLQLQZRUGV Yes.Swavlamban 3..Vidya Sarathi 0.A. 2. out of which none (amounting to <1%) was pending as of December 31.38 6 ACC . Does the Company display product information on the product label. over and above what is mandated as per local laws? Yes / No / N.70 7 ACC . Focus Areas No. comprising representatives and opinion leaders of the community is functional at plant locations.Sanrakshit Paryavaran 3. 2015. PRA tools are used to develop village micro-plan so that entire village can participate in the process.16 9 ACC .LIESA 6.Sampoorn Swachhata 4.Vidya Utkarsh 5. Expenditure (` Crore) 1 ACC . Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies What is the Company’s direct contribution to community development projects . the CAP meets on a quarterly basis to review the progress of the projects and suggest course corrections. Annually. Stakeholder Engagement Surveys (SES) are conducted at regular intervals to identify feedback of the community.14 8 ACC .Drona 0. A Community Advisory Panel (CAP).DISHA 3.71 2 ACC .

5 of 2013 7KH'LUHFWRU*HQHUDO 6XSSO\ 'LVWULEXWLRQ. for alleged violations of the provisions of the Competition Act.IRUUHKHDULQJ3XUVXDQWWKHUHWR&&.32 crores. held the Company and the other Cement manufacturers were in contravention of Sec 3(3)(a) and 3(3)(b) r/w Sec 3(1) of the Act and imposed a total penalty of ` 6.QGLD KDG oOHG D FRPSODLQW EHIRUH WKH &RPPLVVLRQ DJDLQVW WKH &HPHQW 0DQXIDFWXUHV  Association and various cement manufacturers including the Company.KDVKHDUGDOOWKHPDWWHUVDIUHVKEHWZHHQWK  22nd January. Is tKHUH DQ\ FDVH oOHG E\ DQ\ VWDNHKROGHU DJDLQVW WKH &RPSDQ\ UHJDUGLQJ XQIDLU WUDGH SUDFWLFHV LUUHVSRQVLEOH DGYHUWLVLQJDQGRUDQWLFRPSHWLWLYHEHKDYLRXUGXULQJWKHODVWoYH\HDUVDQGSHQGLQJDVRQHQGRIoQDQFLDO\HDU" If so. 29 / 2010  %XLOGHUV  $VVRFLDWLRQ RI . The CCI based on the Report of DG.317.w Sec 3(1) of the Act and has held that the cement companies had institutionalized the system of sharing the prices. out of which ` 1.QGLD KDG oOHG D FRPSODLQW EHIRUH WKH &RPPLVVLRQ DJDLQVW WKH &HPHQW 0DQXIDFWXUHV  Association and various cement manufacturers including the Company.59 crores was levied on the Company. 52 / 2006 %XLOGHUV  $VVRFLDWLRQ RI . Case No. 2015 allowed the appeal and the matters are remanded back to CCI for rehearing.ACC Limited 3. Appeals were preferred before the Competition Appellate Tribunal (COMPAT) which were by Order dated December 11. in about 50 words or so. Haryana tender matter Reference Case No.147. for alleged violations of the provisions of the Competition Act. Case No. capacities and production among each other using the platform of CMA. 2015 allowed the appeal and the matters DUHUHPDQGHGEDFNWR&&. but has not imposed any penalty. The CCI based on the said Report held the Company and the other Cement manufacturers were in contravention of Sec 3(3)(a) and 3(3)(b) r. 2016. provide details thereof. Appeals were preferred before the Competition Appellate Tribunal (COMPAT) which were by Order dated December 11.

*RYHUQPHQWRI+DU\DQDoOHGDFRPSODLQWDOOHJLQJELGULJJLQJDJDLQVW VHYHQFHPHQWPDQXIDFWXUHUVLQFOXGLQJWKH&RPSDQ\LQDWHQGHUIRUFHPHQWpRDWHGE\WKHP7KH'*LQYHVWLJDWLRQ KDVoOHGLWVUHSRUWKROGLQJWKDWDOOWKH&HPHQW0DQXIDFWXUHUVDJDLQVWZKRPWKHLQYHVWLJDWLRQZDVLQLWLDWHGKDG ULJJHGWKHELGGLQJSURFHVV7KHREMHFWLRQVWRWKHUHSRUWRI'*DUHWREHoOHGE\0DUFKDQGKHDULQJKDV EHHQo[HGIRU$SULO 4. 116 . Customer Satisfaction Survey is carried out by the Company every year. Did your Company carry out any consumer survey / consumer satisfaction trends? Yes.

provision for tax of ` 309.85 6.28 740.720.788.09) 106.87 2.07 11.78 108.05 (5.01 1.62 6.796.32 652.82 2.16 11.63 5.36 20.00 1.57 0.465.29 9.394.441.432.723.67 (0.65 1.796.19 100.06 2.50 117 .07 11.739.23 1.524.80 22.83 119.738.14 153.02) 207.07 937.88 364.481.58 2.53 21.66 (0.09) 1.05 2.14 0.97 192.472.30 6.33 (11.598.57 Crore as compared to `1168.91 58.95 3URoWDIWHUWD[IRUWKH\HDULVQRWFRPSDUDEOHZLWKSUHYLRXV\HDUGXHWRIROORZLQJUHDVRQV (a) In the previous year. REVENUE FROM OPERATIONS (NET): Figures in ` Crore Cement and Clinker Ready Mix Concrete Sale of services (RMX) Other operating revenue TOTAL 2015 2014 Change Change% 10.01 14.40 591.738.67 9.57 5.92 - 2014 11.29 23. (b) In the current year.76 364.75 0.40 746.57 7.76 557.RIWKH&RPSDQLHV$FW $VDUHVXOWRIDERYH3URoWDIWHUWD[IRUWKH\HDULV` 591.28 1.97 257.17 783. whereas no such write backs are necessary in 2015.28) % of Revenue from operations 97.00 67.81 2.20 (33. on completion of assessments and review of certain tax positions.29 Crore in the previous \HDU 1.168.09 100.62 18.46) 41.16 11.00 2.83 10.23 Crore and provision for interest on income tax of ` 69.37 Crore had to be written back.20 1..75 21.62 (2.71 4.05 257.10) 769.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies ANALYSIS OF STANDALONE FINANCIAL The following table sets forth the breakup of the Company’s expenses as part of the Revenue from operations (Net) Figures in ` Crore 2015 Net Sales Other operating revenue Revenue from operations (net) Other income Cost of materials consumed Purchase of traded goods &KDQJHVLQLQYHQWRULHVRIoQLVKHGJRRGV work-in-progress and Stock-in-Trade (PSOR\HHEHQHoWVH[SHQVH Power and fuel Freight and Forwarding expense Finance costs Depreciation and amortization expense Other expenses (including Self Consumption of cement) 3URoWEHIRUHH[FHSWLRQDOLWHPDQGWD[ Exceptional item 3URoWEHIRUHWD[ Tax expenses 3URoWIRUWKH\HDU 11.05 % of Revenue from operations 96.59 2.135.53 20.91 3.135.14 Crore (net of tax) has been made on account of FKDQJHLQXVHIXOOLYHVRIo[HGDVVHWVLQDFFRUGDQFHZLWKWKHSURYLVLRQVRI6FKHGXOH.38) 28.26 948.31 194.82 (1.35 1.21 (255.94 1.08 0.33 82.28) 9.29 0.80 19.29 15. an additional depreciation charge of ` 173.21 268.

ACC Limited 5HYHQXHIURPRSHUDWLRQV QHW.

the Company had written back ` 69. Other operating revenue consists of accrual of incentive and subsidies from Governments under incentive schemes. Scrap sales and other Miscellaneous Income.34 Lakh Cubic Meters to 23. The Company achieved cement sales volume of 23.15 Lakh Cubic Meters. Interest on Income Tax. $FFUXDORIVDOHVWD[LQFHQWLYHVRI`&URUHSHUWDLQLQJWRWKHSHULRG$XJXVWWR0DUFKGXH to favorable order from Jharkhand High Court in current year.84 million tonnes. Due to this cash and cash equivalents is lower as compared to 2014 which has resulted into lower income from short term investments by `&URUH$OVRWKHUHKDVEHHQUHGXFWLRQLQDYHUDJHUDWHRIUHWXUQRQLQYHVWPHQWDVFRPSDUHGWRSUHYLRXV year.71) &RVWRIPDWHULDOVFRQVXPHGKDVGHFUHDVHGGXHWRIROORZLQJUHDVRQV v v v v v 118 Cement production has decreased by 1.KDVPDUJLQDOO\LQFUHDVHGGXHWRIROORZLQJUHDVRQV v v v v v Net sale of cement and clinker has declined by 2. The Company is debt free. 2WKHURSHUDWLQJUHYHQXHKDVLQFUHDVHGGXHWRIROORZLQJUHDVRQ v 2. OTHER INCOME: Figures in ` Crore Other income 2015 2014 Change Change% 119.62 million tonnes during the year as compared to 24. in early part of the year.61 Lakh Cubic Meters to 22. Ready Mixed Concrete Production has increased by 26% from 17. Slag prices has reduced by 27% as compared to previous year. .51) Other income consists of Interest on Bank deposits.739.35 268.28 (148.37 Crore towards interest on income tax relating to earlier years.24 million tonnes to 23.21 million tonnes in the previous year.38% mainly on account of temporary closure of mines in the eastern plants of Chaibasa and Bargarh and a general slow pace of economy. Gain on sale of investments and Dividend from long term investments.44 Lakh Cubic Meters.93) (55.65% from 24. COST OF MATERIALS CONSUMED: Figures in ` Crore Cost of materials consumed 2015 2014 Change Change% 1.78 1. Continuous focus on cost management also helped contain overall raw material cost. Decrease in input cost has partially offset by increase in Fly ash and Gypsum prices in the range of 4%-5%. In the previous year. write back of provision which is no longer required. Sale of Ready Mixed Concrete has increased by 28% from 18. Jamul project is funded through internal accruals.31 (48.788. Overall cost of consumption of slag has reduced by `&URUH&RVWRI$GGLWLYHV &RUUHFWLYHPDWHULDOVKDVDOVRUHGXFHGE\` 24 Crore. Net cement realization has improved marginally as compared to previous year. 2WKHULQFRPHKDVGHFUHDVHGGXHWRIROORZLQJUHDVRQV v v 3.53) (2.

42 194.91 72.16 (86.28) Purchase of traded cement has decreased by ` 108.58 108.77) (1.59 per unit in 2014. the Company has incurred ` 33 Crore towards severance cost on account of manpower rationalization.  &KDQJHVLQLQYHQWRULHVRIoQLVKHGJRRGVZRUNLQSURJUHVVDQG6WRFNLQ7UDGH Figures in ` Crore &KDQJHVLQLQYHQWRULHVRIoQLVKHGJRRGVZRUNLQ progress and Stock-in-Trade v 6.82 (47.66% The Generation cost per KW of captive power plants (CPP) in 2015 increased by 2% to ` 4.05 (11. During the year.33 (100.28 3.29 2014 121. 119 .441.20 Crore as compared to previous year mainly on account of discontinuation of sale and purchase arrangement with third party in the previous year.394. Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies PURCHASE OF TRADED GOODS Figures in ` Crore Cement Ready mix concrete TOTAL v 2015 13.28) 11. 2015 2014 Change Change% 0. mainly due to a higher landed cost of coal transported by rail and levy / increase in electricity duty on generation of power.96) 3RZHUDQGIXHOFRVWKDVGHFUHDVHGE\GXHWRIROORZLQJUHDVRQV v v v v Fuel cost for kiln has decreased due to reduction in Pet coke price and landed cost of domestic coal.44) 7KHUHLVQRVLJQLoFDQWPRYHPHQWLQFKDQJHLQLQYHQWRULHV EMPLOYEE BENEFITS EXPENSE: Figures in ` Crore (PSOR\HHEHQHoWVH[SHQVH 2015 2014 Change Change% 769.33 Change (108.20) 22.05 2.QFUHDVHLQHPSOR\HHFRVWKDVEHHQSDUWLDOO\RIIVHWE\ORZHUUHWLUHPHQWEHQHoWVSURYLVLRQ5HWLUHPHQWEHQHoWV provision in previous year was higher by ` 28 Crore due to change in discounting rate for valuation of employee EHQHoWVREOLJDWLRQ POWER AND FUEL: Figures in ` Crore Power and Fuel 2015 2014 Change Change% 2. 1RUPDOKLNHLQVDODU\ZHI$SULO .87 746.59 23. Usage of 3HWFRNHDQG$OWHUQDWLYHIXHOKDVLQFUHDVHGLQFXUUHQW\HDU &RVW%HQHoWRI` 7 Crore due to higher generation of Waste Heat Recovery System (WHRS) operation at Gagal Decrease in power and fuel cost partially offset by increase in clinker production by 1.67 per unit against ` 4.04) Change% (88.71 94.12 (PSOR\HHEHQHoWVH[SHQVHKDVLQFUHDVHGGXHWRIROORZLQJUHDVRQV v v v 7.75) 30.60 (44.Corporate Overview 4.

180.723.51 0.19 34.49 16.33 124.70 (2.91 2.32 82. FINANCE COSTS: Figures in ` Crore 2015 2014 Change Change% Interest expenses 46.55 557.88 2.57) (5.06 (12.30 393.50 43.23 94.598.46 2.48 16.94 Current year depreciation includes additional depreciation charge of ` 111.35 0.06 82.49 Crore mainly on account of long lead movement of clinker and higher volume of clinker transferred to various units.02 14.87) (37.96 2.06 557.22 20..16 45.24 68.71 652.44) (18. interest on income tax and other interest.61 Crore due to change in useful OLYHVRIWKHo[HGDVVHWVLQDFFRUGDQFHZLWKWKHSURYLVLRQRI6FKHGXOH. Freight cost on sale of Cement has gone up due to hike in railway freight by 6%.28) Interest on Income Tax 21.32 16.136.87 Crore as compared to previous year.ACC Limited 8.81 66.93 0.80 )UHLJKWDQG)RUZDUGLQJH[SHQVH On Clinker transfer 2QoQLVKHGSURGXFWV&HPHQW Ready mixed Concrete TOTAL )UHLJKWDQG)RUZDUGLQJH[SHQVHKDVLQFUHDVHGGXHWRIROORZLQJUHDVRQV v v v v 9. 10.76 (15.QFUHDVHLQIUHLJKWFRVWKDVSDUWLDOO\RIIVHWE\EHQHoWVLQURDGIUHLJKWRQDFFRXQWRIUHGXFWLRQLQGLHVHOSULFHV Freight cost on sale of Ready Mixed Concrete has gone up due to increase in volumes.RIWKH&RPSDQLHV$FW . FREIGHT AND FORWARDING EXPENSE : Figures in ` Crore 2015 2014 Change Change% 460.13 48. .79) TOTAL 67. Freight on inter unit clinker transfer has gone up by ` 66.66) Finance costs comprise interest paid to dealers on Security deposit.67 4.00 2.58 94. v Finance cost has decreased due to reduction in interest on income tax by ` 12. DEPRECIATION AND AMORTIZATION EXPENSE Figures in ` Crore Depreciation on tangible assets $PRUWL]DWLRQRQLQWDQJLEOHDVVHWV TOTAL v 120 2015 2014 Change Change% 651.

66) (3.47 (2.99 483.31 (0.34 51.90 145.76 8.82 112.27 106.13 171.92 (47.85 Change 16.54 24.67 2.77 Change% 4.23) (1.94 (9.01) 3.09 Consumption of packing material cost has decreased mainly due to decline in prices of PP granule as compared WRSUHYLRXV\HDU$YHUDJHSULFHRISDFNLQJEDJVUHGXFHGE\ Royalties on minerals v v 3XUVXDQW WR LQWURGXFWLRQ RI 7KH 0LQHV DQG 0LQHUDOV 'HYHORSPHQW DQG 5HJXODWLRQ.62) 3.23) 2.39 (10.72 90.62 129.83 141.73 33.38) (60.99 404.31) 0.42 (16.81) (11.82 75.44 1.13 112.10 (0.44 205.52 161.00 (79.524.32) 2.15) 40.82 93.33 58.91 828.65) 3.93) 4.23 25.90 (2.18 (17.80 110.66) 2472.07 29. OTHER EXPENSES: Figures in ` Crore Consumption of Stores and spares parts Consumption of packing materials Excise duty variation on opening and closing stock Rent Rates and Taxes Repairs Insurance Royalties on minerals Discount on sales $GYHUWLVHPHQW Technology and Know-how fees Miscellaneous Expenses Self-Consumption of cement TOTAL v v v v 2015 377.62 2014 361.11 (6.76 868.13) 4.47) 3.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 11.

2015. the Company has created provision amounting to ` 52 Crore towards contribution to District Mineral Foundation and National Mineral Exploration Trust (NMET). EXCEPTIONAL ITEM: Figures in ` Crore Exceptional item v 2015 153. Miscellaneous Expenses v v v During the year. 2014. Technology and Know-how fees represent the amount paid to Holcim Technology Ltd for technical support received by the Company. Fixed assets of ` 12 Crore written off in the current year. Increase in royalty rate on limestone from ` 63 to ` 80 with effect from September.17 2014 - Change 153. The Company has incurred ` 13 Crore towards severance cost for rationalization of third party manpower.. the Company has provided `&URUHIRUGLPLQXWLRQLQWKHYDOXHRILQYHVWPHQWLQ$&& Mineral Resources Limited. a wholly owned subsidiary Company. 12.WRWKH&RPSDQLHV $FWDQDGGLWLRQDO charge of `&URUHEHLQJWKHFDUU\LQJDPRXQWDVRI-DQXDU\RIo[HGDVVHWVZLWKQRUHPDLQLQJ XVHIXOOLIH 5HYLVHGDVSHU6FKHGXOH. $PHQGPHQW $FW 2015. effective from January 12.17 Change% - 3XUVXDQWWRWKHWUDQVLWLRQDO SURYLVLRQV SUHVFULEHG LQ6FKHGXOH.

121 .DVRIWKDWGDWHLVUHFRJQL]HGLQWKH6WDWHPHQWRI3URoWDQG/RVVDQG disclosed as an exceptional item.

513.597.284.23 Crore had to be written back.64 (0.93) (6.28) (6.92 1. whereas no such write backs are necessary in 2015.49 (681.75) Capital Work in progress 2.18) Non-current investments 1RQFXUUHQWLQYHVWPHQWKDVGHFUHDVHGGXHWRIROORZLQJUHDVRQV v v v During the year.475.98 (97. is nearing completion and expected to be commissioned in the second quarter of 2016.44) In the previous year..655.33 23.70 Crore disclosed under the schedule current investments.62) Current investments 1201.55 290.96 1.35) (5. NET FIXED ASSETS: Figures in ` Crore 2015 2014 Change Change% 5.63 456.914. Capital work-in-progress has gone up mainly on account of capital expenditure incurred on Jamul and Sindri project.75 (312. which comprises a new clinkering line and grinding facility together with a new grinding unit at Sindri in Jharkhand.ACC Limited 13. 14.78 Crore on account of FKDQJHLQXVHIXOOLYHVRIWKHo[HGDVVHWVLQDFFRUGDQFHZLWKWKHSURYLVLRQRI6FKHGXOH.08 (80. the company has invested ` 2.40 (33.09) 225.370.97) (5. .31) TOTAL 1. a wholly owned subsidiary Company. on completion of assessments and review of certain tax positions. an amount of ` 309.78 5.90 (16. During the year.94 7.RIWKH&RPSDQLHV$FW 2013.70 1. The ongoing expansion of project at Jamul plant in Chhattisgarh.59) 0.83 TOTAL 7.44) (68. the Company has provided `&URUHIRUGLPLQXWLRQLQWKHYDOXHRILQYHVWPHQWLQ$&& Mineral Resources Limited.50 Crore in equity shares of Oneindia BSC Private Limited. which LVDMRLQWO\FRQWUROOHGHQWLW\ZLWKHTXDOHTXLW\SDUWLFLSDWLRQZLWK$PEXMD&HPHQWV/LPLWHGDIHOORZVXEVLGLDU\ &RPSDQ\ZLWKDLPWRSURYLGHEDFNRIoFHVHUYLFHVZLWKUHVSHFWWRURXWLQHSURFHVVHV Current investments v 122 Current investment has decreased due to utilization of surplus funds in Jamul and Sindri projects.02 142. INVESTMENTS: Figures in ` Crore 2015 2014 Change Change% 274.20 0. 15.15 1282. Current portion of long term investment of ` 3. TAX EXPENSES: Figures in ` Crore Tax expenses v 2015 2014 Change Change% 192.572.90 Tangible assets Intangible assets v v Decrease in Net Tangible assets is due to additional charge of depreciation of ` 264.

82 (34.22 /RQJWHUPORDQVDQGDGYDQFHVKDVLQFUHDVHGGXHWRIROORZLQJUHDVRQV v v v 2014 855.82 Capital advance has increased by ` 92 Crore mainly due to advance given for Jamul and Sindri projects. $GYDQFHRILQFRPHWD[ 1HW.74 Change% 25.46 (8.239.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 16.073. which has been deposited in the current year and disclosed under Long-term loans and advances.38 Short-term loans and advances 349.08) 183.423. LOANS AND ADVANCES Figures in ` Crore 2015 Long-term loans and advances 1.48 Change 217.92 1. 7KH&RPSDQ\KDGUHFHLYHGDGHPDQGIURP'LVWULFW0LQLQJ2IoFHUWRZDUGVSHQDOW\IRUDOOHJHGLOOHJDOPLQLQJ activities carried out by the Company.88) 14. The aforesaid demands were challenged by the company and Writ 3HWLWLRQKDVEHHQoOHGZLWK+LJK&RXUWRI-KDUNKDQG7KHSHWLWLRQKDVEHHQDGPLWWHGVXEMHFWWRDWRNHQGHSRVLW of ` 48 Crore.56 383.84 TOTAL 1.

71 14.12 1.37 262.65 265.24 378.78) (61.02 38.30 55.11 521.89) (13.37 (0.88 (1.57 146.34) Fuel inventory was higher in the previous year due to stoppage of clinkerisation activity at Chaibasa and Bargarh plants.KDVLQFUHDVHGE\` 72.79) 75.28 3. consequent upon temporary suspension of limestone mining operations.41) (66.84 18.95 Other non-current assets have gone up due to accrual of incentive receivables from government under various incentives schemes.75 0.53 1.54 0.255.07 240. 2WKHUFXUUHQWDVVHWVKDYHJRQHXSGXHWRLQFUHDVHLQo[HGDVVHWVKHOGIRUVDOHE\` 38. OTHER ASSETS Figures in ` Crore Other non-current assets Other current assets TOTAL v v 2015 466.60 Crore.21) 0.45 Crore mainly due to reduction in cenvat input credit.32 153.31 (1.41 2014 360.20 152.21 Crore.59 Change (7.26 (8.59 40. 123 . 6KRUWWHUPORDQVDQGDGYDQFHVKDVGHFUHDVHGGXHWRIROORZLQJUHDVRQV v v $GYDQFHVIRUVXSSO\RI5DZPDWHULDOKDVJRQHGRZQE\` 26.01 241. 17.16 Change% 29.60 2014 139.08) 0.53 20.79 Crore. Balance with statutory / government authorities has decreased by ` 12.54 375.188.06) 0.97) (5. 18.99) Change% (5. INVENTORIES : Figures in ` Crore Raw Materials Work-in-Progress Finished Goods Stock-in-trade 6WRUHV 6SDUH3DUWV Packing Material Fuels TOTAL v 2015 132.68 1.27 279.02 439.25 Change 105.

77 165.92) Long-term provisions Short-term provisions TOTAL 6KRUWWHUPSURYLVLRQKDVGHFUHDVHGGXHWRIROORZLQJUHDVRQV  3URYLVLRQIRUHPSOR\HHEHQHoWVKDVGHFUHDVHGGXHWRFRQWULEXWLRQRI` 75 Crore to the fund against provision for compensated absences. Increase in Ready Mixed Concrete business trade receivable in 2015 is mainly due to increase in sales. 2014.86 639. The average collection day outstanding for Concrete business as on December 31.21 Change 3. 21.88 17.94) (294. 2015 is 65 as compared to 59 as on December 31.27 1.76 18.71 Figures in ` Crore Change Change% 42. The average collection days outstanding for cement sales as on December 31.33 759.52 30. 20.54 73.70) (69. 2015 is 6 as compared to 5 as on December 31.92 (297.053. TRADE RECEIVABLES: Trade receivables – Cement Trade receivables .93 Trade receivable for cement has increased by 17.90) The Company is debt free. Due to this Cash and bank balances is lower as compared to 2014. CASH AND BANK BALANCES: Cash and bank balances v 2015 91.52%.35 2014 244.70 484. PROVISIONS Figures in ` Crore 2015 119.94 410.79) (27.38 (31.19 2014 115.ACC Limited 19. Jamul project is funded through internal accruals.30 Figures in ` Crore Change Change% (212. v v v 3URYLVLRQIRUSURSRVHGoQDOGLYLGHQG LQFOXGLQJGLYLGHQGGLVWULEXWLRQWD[.64 17.65 196.02) Change% 3. 2014.94 937.60 2014 304.Ready Mixed Concrete TOTAL v v v 2015 287.

50 2014 - Change 35.27 Crore.46 Crore. 2014 750.00 6KRUW WHUP %RUURZLQJV FRQVLVW RI ORDQ IURP $&& 0LQHUDO 5HVRXUFHV /LPLWHG D ZKROO\ RZQHG VXEVLGLDU\ Company.1*6 Figures in ` Crore Short term borrowings v 2015 35.  6+2577(50%2552:.KDVGHFUHDVHGE\` 292.11 Increase in trade payables are in line with increase in business activities.88 Change% 16. Provision for Income Tax (Net of advance tax) has increased by ` 72. TRADE PAYABLES Figures in ` Crore Trade payables v 124 2015 874. 23.50 Change% 100. 3URSRVHGoQDOGLYLGHQGLV` 6 per Share as against ` 19 per Share in the previous year.51 .23 Change 123.

67 8.24 1.72 $GYDQFHIURPFXVWRPHUV 137.95 Crore.45 Security deposits and retention money 666.78 Statutory dues have increased due to provision of ` 52 Crore made towards contribution to District Mineral Foundation and National Mineral Exploration Trust (NMET).77 624.44 2.096.70 129.50 324.71 853. kept lien in favour of &203$7IRU&RPSHWLWLRQ&RPPLVVLRQRI.436.87 4.89 1.46 31.82 2.52 Change% (34.13 131.96) (13.27 54.81 131.00) 1HWFDVKXVHGIRULQYHVWPHQWDFWLYLWLHVKDVGHFUHDVHGPDLQO\RQDFFRXQWRIORZHUFDVKRXWpRZIRUSXUFKDVH RIo[HGDVVHWVE\` 359 Crore and refund of deposit.09 (17.94 5.17) 2014 (1.331.71 163. along-with accumulated interest. Net cash used for investing activities v 2015 (948.92 Statutory dues 378.259.11 7.77 Liability for capital expenditure 113.75 TOTAL 2.48 42. v v Other payables have increased due to increase in provision for litigations.461.70) Other payables 927.QGLD &&. Decrease in working capital by ` 58 Crore as compared to ` 43 Crore in previous year.23 16.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 24.54 9.29 6.44 8QSDLGGLYLGHQG 0DWXUHG'HSRVLW 33. OTHER CURRENT LIABILITIES Figures in ` Crore 2015 2014 Change Change% Interest accrued but not due on borrowings 2.57 4.73 1HWFDVKIURPRSHUDWLQJDFWLYLWLHVKDVLQFUHDVHGDVFRPSDUHGWRSUHYLRXV\HDUGXHWRIROORZLQJUHDVRQV v v 7KHFDVKRSHUDWLQJSURoWEHIRUHZRUNLQJFDSLWDOFKDQJHVKDVLQFUHDVHGE\` 107.04 74. CASH FLOW Figures in ` Crore 2015 2014 Change Change% 1HWFDVKpRZIURPRSHUDWLQJDFWLYLWLHV 1.69) Change 488. 25.

02) 2014 (837. In the previous year. 125 . Proceeds from short term Borrowings of ` 35.50 from subsidiary company in the current year.64) 1HWFDVKXVHGIRUoQDQFLQJDFWLYLWLHVKDVGHFUHDVHGGXHWRIROORZLQJUHDVRQV v v v Lower payment of Dividend and dividend tax by 78 Crore as compared to previous year. the Company repaid the Long term borrowings of ` 35 Crore.09) Change 156.07 Change% (18.PDWWHU 1HWFDVKXVHGIRUoQDQFLQJDFWLYLWLHV 2015 (681.

As required by section 143 (3) of the Act. 2015 (“the Order”) issued by the Central Government of India in terms of sub-section (11) of section 143 of the Act. As required by the Companies (Auditor’s report) Order. the auditor considers LQWHUQDO oQDQFLDO FRQWURO UHOHYDQW WR WKH &RPSDQ\ V SUHSDUDWLRQ RI WKH VWDQGDORQH oQDQFLDO VWDWHPHQWV that give a true and fair view in order to design audit procedures that are appropriate in the circumstances but not for the purpose of expressing an opinion on whether the Company has in place an adequate internal oQDQFLDO FRQWUROV V\VWHP RYHU oQDQFLDO UHSRUWLQJ DQG the effectiveness of such controls. the 6WDWHPHQW RI 3URoW DQG /RVV DQG &DVK )ORZ 6WDWHPHQW IRU WKH \HDU WKHQ HQGHG DQG D VXPPDU\ RI VLJQLoFDQW accounting policies and other explanatory information. relevant to the preparation and SUHVHQWDWLRQRIWKHoQDQFLDOVWDWHPHQWVWKDWJLYHDWUXH and fair view and are free from material misstatement. This responsibility also includes maintenance of adequate accounting records in accordance with the provisions of the Act for safeguarding of the assets of the Company and for preventing and detecting frauds and other irregularities. Management’s Responsibility for the Financial Statements The Company’s Board of Directors is responsible for the matters stated in Section 134(5) of the Companies Act. 2015. the accounting and auditing standards and matters which are required to be included in the audit report under the provisions of the Act and the Rules made thereunder. including the $FFRXQWLQJ6WDQGDUGVVSHFLoHGXQGHU6HFWLRQRIWKH Act. 2014. Report on Other Legal and Regulatory Requirements 1. An audit also includes evaluating the appropriateness of accounting policies used and the reasonableness of the accounting estimates made by the Company’s Directors.including the assessment of the risks of material misstatement of WKH oQDQFLDO VWDWHPHQWV ZKHWKHU GXH WR IUDXG RU HUURU In making those risk assessments. making judgments and estimates that are reasonable and prudent. implementation and maintenance of adequate LQWHUQDOoQDQFLDOFRQWUROWKDWZHUHRSHUDWLQJHIIHFWLYHO\ for ensuring the accuracy and completeness of the accounting records. selection and application of appropriate accounting policies.QGLD DV VSHFLoHG XQGHU 6HFWLRQ  . We believe that the audit evidence we have REWDLQHGLVVXIoFLHQWDQGDSSURSULDWHWRSURYLGHDEDVLVIRU RXUDXGLWRSLQLRQRQWKHVWDQGDORQHoQDQFLDOVWDWHPHQWV Opinion In our opinion and to the best of our information and according to the explanations given to us. whether due to fraud or error. and the design. as well as evaluating WKH RYHUDOO SUHVHQWDWLRQ RI WKH VWDQGDORQH oQDQFLDO statements. 2013 (“the Act”) with respect to the preparation of these VWDQGDORQHoQDQFLDOVWDWHPHQWVWKDWJLYHDWUXHDQGIDLU YLHZRIWKHoQDQFLDOSRVLWLRQoQDQFLDOSHUIRUPDQFHDQG FDVKpRZVRIWKH&RPSDQ\LQDFFRUGDQFHZLWKDFFRXQWLQJ principles generally accepted in India. the standalone oQDQFLDOVWDWHPHQWVJLYHWKHLQIRUPDWLRQUHTXLUHGE\WKH Act in the manner so required and give a true and fair view in conformity with the accounting principles generally accepted in India of the state of affairs of the Company as DW'HFHPEHULWVSURoWDQGLWVFDVKpRZVIRUWKH year ended on that date. we give in the Annexure a statement on the PDWWHUVVSHFLoHGLQSDUDJUDSKVDQGRIWKH2UGHU 2. we report that: Auditor’s Responsibility Our responsibility is to express an opinion on these VWDQGDORQHoQDQFLDOVWDWHPHQWVEDVHGRQRXUDXGLW:H have taken into account the provisions of the Act. An audit involves performing procedures to obtain audit evidence about the amounts and disclosures in WKH VWDQGDORQH oQDQFLDO VWDWHPHQWV 7KH SURFHGXUHV selected depend on the auditor’s judgment. We conducted our audit in accordance with the Standards on Auditing. read with Rule 7 of the Companies (Accounts) Rules.ACC Limited INDEPENDENT AUDITOR’S REPORT To the Members of ACC Limited Report on the Financial Statements :HKDYHDXGLWHGWKHDFFRPSDQ\LQJVWDQGDORQHoQDQFLDO statements of ACC Limited (“the Company”). which comprise the Balance Sheet as at December 31. issued by the Institute of Chartered Accountants RI .

(b) In our opinion proper books of account as required by law have been kept by the Company so far as it appears from our examination of those books. 126 (a) We have sought and obtained all the information and explanations which to the best of our knowledge and belief were necessary for the purpose of our audit. RI WKH $FW Those Standards require that we comply with ethical requirements and plan and perform the audit to obtain reasonable assurance about whether the standalone oQDQFLDOVWDWHPHQWVDre free from material misstatement. .

Corporate Overview Financial Highlights Board & Management Reports F.

 7KH %DODQFH 6KHHW 6WDWHPHQW RI 3URoW DQG /RVV DQG &DVK )ORZ 6WDWHPHQW GHDOW ZLWK E\ this Report are in agreement with the books of account. G.

2014.QYHVWRU (GXFDWLRQ DQG 3URWHFWLRQ )XQG E\ the Company. in our opinion and to the best of our information and according to the explanations given to us: Financial Statements Subsidiary Companies i. (e) On the basis of written representations received from the directors as on December 31. none RI WKH GLUHFWRUV LV GLVTXDOLoHG DV RQ 'HFHPEHU 31.)LUP5HJLVWUDWLRQ1XPEHU( per RAVI BANSAL Partner 0HPEHUVKLS1XPEHU Place: Mumbai 'DWH)HEUXDU\ 127 .QRXURSLQLRQWKHDIRUHVDLGVWDQGDORQHoQDQFLDO statements comply with the Accounting 6WDQGDUGVVSHFLoHGXQGHUVHFWLRQRIWKH$FW read with Rule 7 of the Companies (Accounts) Rules. from being appointed as a director in terms of section 164 (2) of the Act. For S R B C & CO LLP Chartered Accountants . 2015. 2014. The Company did not have any long-term contracts including derivative contracts for which there were any material foreseeable losses. The Company has disclosed the impact of SHQGLQJOLWLJDWLRQVRQLWVoQDQFLDOSRVLWLRQ LQ LWV VWDQGDORQH oQDQFLDO VWDWHPHQWV q Refer Note 36 A (a). iii. and taken on record by the Board of Directors. (f) With respect to the other matters to be included in the Auditor’s Report in accordance with Rule 11 of the Companies (Audit and Auditors) Rules. 36 B and 37 to WKHVWDQGDORQHoQDQFLDOVWDWHPHQWV ii.&$. 2015.36 A (c). . There has been no delay in transferring amounts required to be transferred to the .

including quantitative GHWDLOVDQGVLWXDWLRQRIo[HGDVVHWV E.ACC Limited ANNEXURE TO THE AUDITOR’S REPORT Annexure referred to in paragraph 1 under the heading “Report on other legal and regulatory requirements” of our report of even date Re: ACC Limited (‘the Company’) (i) (a) The Company has maintained proper records showing full particulars.

E. No material discrepancies were noticed on such YHULoFDWLRQ (ii) (a) The management has conducted physical YHULoFDWLRQRILQYHQWRU\DWUHDVRQDEOHLQWHUYDOV during the year. is reasonable having regard to the size of the Company and the nature of its assets. $OOo[HGDVVHWVKDYHQRWEHHQSK\VLFDOO\YHULoHG during the year by the management but there LVDUHJXODUSURJUDPPHRIYHULoFDWLRQZKLFKLQ our opinion.

VHFXUHG RU XQVHFXUHG WR FRPSDQLHV oUPV RU RWKHU parties covered in the register maintained under VHFWLRQRIWKH$FW$FFRUGLQJO\WKHSURYLVLRQVRI clause 3(iii)(a) and (b) of the Order are not applicable to the Company and hence not commented upon. During the course of our audit. (iv) In our opinion and according to the information and explanations given to us. for WKH SXUFKDVH RI LQYHQWRU\ DQG o[HG DVVHWV DQG IRU the sale of goods and services. (vi) We have broadly reviewed the books of account maintained by the Company pursuant to the rules made by the Central Government for the PDLQWHQDQFHRIFRVWUHFRUGVXQGHUVHFWLRQ . there is an adequate internal control system commensurate with the size of the Company and the nature of its business. we have not observed any major weakness 128 or continuing failure to correct any major weakness in the internal control system of the Company in respect of these areas. the Company has not granted any loans. (v) The Company has not accepted any deposits from the public. 7KH SURFHGXUHV RI SK\VLFDO YHULoFDWLRQ RI inventory followed by the management are reasonable and adequate in relation to the size of the Company and the nature of its business. (c) The Company is maintaining proper records of inventory and no material discrepancies were QRWLFHGRQSK\VLFDOYHULoFDWLRQ (iii) According to the information and explanations given to us.

value added tax. at the year end. (c) According to the records of the Company. wealth tax. service tax. employees’ state insurance. wealth-tax. however.RI the Companies Act. made a detailed examination of the same. wealth-tax. cess and other material statutory dues applicable to it. and are of the RSLQLRQWKDWSULPDIDFLHWKHVSHFLoHGDFFRXQWVDQG records have been made and maintained. sales-tax. related to the manufacture of Cement and Ready Mix Concrete. customs duty. We have not. employees’ state insurance. service tax. value added tax. 2013. (b) According to the information and explanations given to us. service tax. for a period of more than six months from the date they became payable. excise duty. excise duty. income-tax. cess and other material statutory dues were outstanding. the dues outstanding of income-tax. are as follows: . customs duty. custom duty. excise duty and cess on account of any dispute. sales tax. no undisputed amounts payable in respect of provident fund. sales-tax. income-tax. (vii) (a) The Company is generally been regular in depositing with appropriate authorities undisputed statutory dues including provident fund.

20 138. the amount required to be transferred to Investor (GXFDWLRQ DQG 3URWHFWLRQ )XQG LQ DFFRUGDQFH ZLWK WKH UHOHYDQW SURYLVLRQV RI WKH &RPSDQLHV $FW  RI.34  6HUYLFH7D[XQGHU)LQDQFH 2005-06 to 2012-13 $FW 7D[3HQDOW\ Interest) -  - -  Customs Duty Matters (Duty /Penalty / Interest) 2012-13 - 15.03 - - 15.57 187.03  28.98 28.12  2.03 Cess Matters 2003-04 to 2012-13 - -  26.61 22.37 383.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies (` Crore) )RUXPZKHUHGLVSXWHLVSHQGLQJ Name of Statute (Nature of Dues) Period to which the amount Relates Commissionarate Appellate authorities & Tribunal Sales Tax (Tax/Penalty/ Interest) WR   126.07 -  Central Excise Act (Duty / Penalty / Interest) WR 3.12 TOTAL High Court Supreme Total Court Amount (d) According to the information and explanations given to us.

DQGUXOHVPDGHWKHUHXQGHUKDVEHHQWUDQVIHUUHGWRVXFKIXQGZLWKLQWLPH YLLL.

7KH&RPSDQ\KDVQRDFFXPXODWHGORVVHVDWWKHHQGRIWKHoQDQFLDO\HDUDQGLWKDVQRWLQFXUUHGFDVKORVVHVLQWKH FXUUHQWDQGLPPHGLDWHO\SUHFHGLQJoQDQFLDO\HDU L[.

has been noticed or reported during the year. (x) According to the information and explanations given to us.)LUP5HJLVWUDWLRQ1XPEHU( per RAVI BANSAL Partner 0HPEHUVKLS1XPEHU Place: Mumbai 'DWH)HEUXDU\ 129 . (xii) Based upon the audit procedures performed for the purpose of reporting the true and fair view of the Standalone oQDQFLDOVWDWHPHQWVDQGDVSHUWKHLQIRUPDWLRQDQGH[SODQDWLRQVJLYHQE\WKHPDQDJHPHQWZHUHSRUWWKDWQR fraud by the Company and no material fraud on the Company. the Company has not given any guarantee for loans WDNHQE\RWKHUVIURPEDQNRUoQDQFLDOLQVWLWXWLRQV (xi) The Company did not have any term loans outstanding during the year.&$. For S R B C & CO LLP Chartered Accountants . 7KH &RPSDQ\ GLG QRW KDYH DQ\ RXWVWDQGLQJ GXHV LQ UHVSHFW RI oQDQFLDO LQVWLWXWLRQ EDQN RU GHEHQWXUH KROGHUV during the year.

1 DIN: 00276351 DIN: 06771125 '.&$.82 1.840. 2015 Particulars Note No.12     12.82   410.SEKHSARIA BERNARD TERVER ARUNKUMAR R GANDHI CEO & Managing Director Chairman Chartered Accountants Deputy Chairman Director .671. NAYAK &KLHI)LQDQFLDO2IoFHU SHAILESH V.71 304.651.57  651.33  0. HARIBHAKTI Director DIN: 00007347 ASHWIN DANI Director '. 2015 ` Crore 2014 ` Crore EQUITY AND LIABILITIES Shareholders’ funds Share capital Reserves and surplus 3 4       Non-current liabilities Deferred tax liabilities (Net) Long-term provisions 5 6    535.64    360.1 FARROKH K.30   0.71  1. NARIMAN Company Secretary FALGUNI NAYAR Director DIN: 00003633 ERIC OLSEN Director '.76     12.1 .54 3.S.1 BURJOR D.1 CHRISTOF HASSIG Director '.11 3.15     55.201.30  14.370.14 12.840.55  466.33 Current liabilities Short-term borrowings Trade payables: Due to Micro and Small Enterprises Due to others Other current liabilities Short-term provisions   TOTAL ASSETS Non-current assets )L[HG$VVHWV Tangible assets Intangible assets Capital work-in-progress Non-current investments Long-term loans and advances Other non-current assets 10 10 11 12 13 Current assets Current investments Inventories Trade receivables Cash and bank balances Short-term loans and advances Other current assets 14 15 16 17   TOTAL 6LJQLoFDQWDFFRXQWLQJSROLFLHV 2 7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRIWKHoQDQFLDOVWDWHPHQWV As per our report of even date )RUDQGRQEHKDOIRIWKH%RDUGRI'LUHFWRUVRI$&&/LPLWHG HARISH BADAMI For S R B C & CO LLP N. KAVARANA Director '.51 7 35.1 per RAVI BANSAL Partner 0HPEHUVKLS1R 0XPEDL)HEUXDU\ 130 SUNIL K.65 12.)LUP5HJLVWUDWLRQ1R( '.671.50 -  4.20  274.ACC Limited BALANCE SHEET as at December 31.

2015 Particulars 2015 ` Crore Note No. INCOME Revenue from operations (gross) Less .Excise duty Revenue from operations (net) Other Income Total Revenue EXPENSES Cost of materials consumed Purchase of traded goods &KDQJHVLQLQYHQWRULHVRIoQLVKHGJRRGV work-in-progress and stock-in-trade (PSOR\HHEHQHoWVH[SHQVH Power and fuel )UHLJKWDQG)RUZDUGLQJH[SHQVH )LQDQFHFRVWV Depreciation and amortization expense Other expenses 20 21 13.71    22 23 24   0.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies STATEMENT OF PROFIT AND LOSS for the year ended December 31.05    .240.

25   2.32 652.723.00 67.06    .

17 783. 10.871.979.14 153.20  .66) 10.135.04        (17.97 1.29 937.20 1.135.

24)   .57 (262. 591.

06 26 27   Self Consumption of Cement (net of Excise Duty) Total Expenses 11.51) 3URoWEHIRUHWD[ Tax expenses Current tax Tax adjustments for earlier years (Refer Note .51 31.168.916.43 62.23 62.` 10 each)} Basic Diluted 6LJQLoFDQWDFFRXQWLQJSROLFLHV 2014 ` Crore  .43) Deferred tax 3URoWIRUWKH\HDU Earnings per equity share ^ )DFHYDOXHRI` 10 each (Previous Year .18 3URoWEHIRUHH[FHSWLRQDOLWHPDQGWD[ Exceptional item (Refer Note .  1.29 31.

006.&$.)LUP5HJLVWUDWLRQ1R( '.1 FARROKH K.S. NAYAK &KLHI)LQDQFLDO2IoFHU SHAILESH V. NARIMAN Company Secretary FALGUNI NAYAR Director DIN: 00003633 ERIC OLSEN Director '.49 2 7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRIWKHoQDQFLDOVWDWHPHQWV As per our report of even date )RUDQGRQEHKDOIRIWKH%RDUGRI'LUHFWRUVRI$&&/LPLWHG HARISH BADAMI For S R B C & CO LLP N.1 DIN: 00276351 DIN: 06771125 '.1 per RAVI BANSAL Partner 0HPEHUVKLS1R SUNIL K.SEKHSARIA BERNARD TERVER ARUNKUMAR R GANDHI CEO & Managing Director Chairman Chartered Accountants Deputy Chairman Director .1 0XPEDL)HEUXDU\ 131 . KAVARANA Director '.1 BURJOR D.1 CHRISTOF HASSIG Director '.41 30 ` `     12. 66. HARIBHAKTI Director DIN: 00007347 ASHWIN DANI Director '.

&DVKpRZIURPRSHUDWLQJDFWLYLWLHV 1HW3URoWEHIRUH7D[ Adjustments for: Depreciation and Amortization expenses (including Exceptional item) /RVV 3URoW.ACC Limited CASH FLOW STATEMENT for the year ended December 31. 2015 Particulars A.

RQVDOHZULWHRIIRIo[HGDVVHWV 1HW.

&DVKpRZIURPLQYHVWLQJDFWLYLWLHV Loans to subsidiary companies Payment received against loan and advance given to subsidiaries 3XUFKDVHRI)L[HG$VVHWV . Other liabilities and Provisions Cash generated from operations Direct tax paid .20  30. Provision for diminution in the value of Non-current investment Non-current investment written off Gain on sale of current investments Dividend income Interest income )LQDQFHFRVWV Provision for doubtful debts and advances (Net) Bad debts written off Provision for slow and non moving Stores & Spare parts Provision no longer required written back Unrealised exchange (gain) / loss (Net) Capital Spares Consumed 2SHUDWLQJSURoWEHIRUHZRUNLQJFDSLWDOFKDQJHV Changes in Working Capital: Adjustments for Decrease / (Increase) in operating assets: Decrease / (Increase) in Trade receivable.(Net of refunds) 1HW&DVKpRZIURPRSHUDWLQJDFWLYLWLHV B.QFOXGLQJ&DSLWDOZRUNLQSURJUHVV and Capital Advances) 3URFHHGVIURPVDOHRI)L[HG$VVHWV Proceeds from sale of current investments Purchase of Investment in joint venture company Purchase of Investment in subsidiary companies Redemption / (investment) in bank deposits (having original maturity for more than 3 months) Dividend received from Associates Interest received Net cash used in investing activities 132 2015 ` Crore 2014 ` Crore  1.04)  . loans & advances and other assets Decrease / (Increase) in Inventories Adjustments for Increase / (Decrease) in operating liabilities: Increase / (Decrease) in Trade payables.15 (22.24) (2.135.45 15.

632.32 13.25)  1.13  (41.32  (10.64 0.45)  .66) (2. 67.21   4.

 .

72  .60 13.   4.

 .

524.  1.32)   .27 (217.

 .

216.63   .

1.461.24    .

70   .331. 1.

24 (2.45  .00)  22.50)   41.527.76)  (1. (75.

 .

69) .436.17)   (1. 2.04  (948.

) 2015 ` Crore 2014 ` Crore  .Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies CASH FLOW STATEMENT for the year ended December 31. 2015 (contd.

67) (113.36) (681. 35.50 (561.02)  .

51)  . (35.03) (644.

(837.64 On deposit account  (DUPDUNHGIRUVSHFLoFSXUSRVH 5HIHU1RWH .09) Net increase / (decrease) in cash and cash equivalents (167.95) (942.11 0.12 Balance with banks On current accounts  37. &DVKpRZIURPoQDQFLQJDFWLYLWLHV Interest paid Proceeds from short-term borrowings from Subsidiary Company Repayment of Long-term borrowings Dividend paid Dividend Distribution Tax paid 1HWFDVKXVHGLQoQDQFLQJDFWLYLWLHV Components of cash and cash equivalents: Cash on hand 0.08) Cash and cash equivalents at the beginning of the year Cash and cash equivalents at the end of the year     Particulars C.

EHORZ.

17)   $GG.44  Cash and cash equivalents (Refer Note . 33.QYHVWPHQWLQ0XWXDO)XQGV 5HIHU1RWH.

QYHVWPHQWLQ&HUWLoFDWHRI'HSRVLWV 5HIHU1RWH.00 $GG. 65.00 350.

45  $GG'HSRVLWZLWK+')&/LPLWHG 5HIHU1RWH. 1.132.

556. 100.04 1.99 6LJQLoFDQWDFFRXQWLQJSROLFLHV(Refer Note .QGLUHFW 0HWKRGy DV VHW RXW LQ WKH $FFRXQWLQJ6WDQGDUG $6.00 100.  7KH DERYH &DVK )ORZ 6WDWHPHQW KDV EHHQ SUHSDUHG XQGHU WKH k.00 &DVKDQG&DVKHTXLYDOHQWVLQFDVKpRZVWDWHPHQW 1.389.2) Note : 1 These balances are not available for use by the Company as they represent unpaid dividend liabilities.

KAVARANA Director '.)LUP5HJLVWUDWLRQ1R( '.RQ&DVK)ORZ6WDWHPHQW 7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRIWKHoQDQFLDOVWDWHPHQWV As per our report of even date )RUDQGRQEHKDOIRIWKH%RDUGRI'LUHFWRUVRI$&&/LPLWHG HARISH BADAMI For S R B C & CO LLP CEO & Managing Director Chartered Accountants . NARIMAN Company Secretary FALGUNI NAYAR Director DIN: 00003633 ERIC OLSEN Director '.1 CHRISTOF HASSIG Director '.1 0XPEDL)HEUXDU\ 133 .SEKHSARIA Chairman DIN: 00276351 BERNARD TERVER ARUNKUMAR R GANDHI Deputy Chairman Director DIN: 06771125 '.1 BURJOR D.1 N.S.1 FARROKH K. NAYAK &KLHI)LQDQFLDO2IoFHU SHAILESH V. HARIBHAKTI Director DIN: 00007347 ASHWIN DANI Director '.1 per RAVI BANSAL Partner 0HPEHUVKLS1R SUNIL K.&$.

QGLD7KH&RPSDQ\LVHQJDJHGLQWKHPDQXIDFWXULQJDQG selling of Cement and Ready mix concrete. 2015 1.WVVKDUHVDUHOLVWHGRQWZRVWRFNH[FKDQJHVLQ. COMPANY OVERVIEW ACC Limited (the Company) is a public limited company incorporated in India under the provision of Companies $FW. SIGNIFICANT ACCOUNTING POLICIES (i) Basis of preparation D. 2. The Company caters mainly to the domestic market.ACC Limited NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31.

QGLD . 7KHoQDQFLDOVWDWHPHQWVRIWKH&RPSDQ\KDYHEHHQSUHSDUHGLQDFFRUGDQFHZLWKWKHJHQHUDOO\DFFHSWHG DFFRXQWLQJSULQFLSOHVLQ.QGLDQ*$$3.

7KH&RPSDQ\KDVSUHSDUHGWKHVHoQDQFLDOVWDWHPHQWVWR FRPSO\LQDOOPDWHULDOUHVSHFWVZLWKWKHDFFRXQWLQJVWDQGDUGVQRWLoHGXQGHU6HFWLRQRIWKH&RPSDQLHV $FW kWKH$FWy.

UHDGWRJHWKHUZLWK5XOHRIWKH&RPSDQLHV $FFRXQWV.

5XOHV7KHoQDQFLDO statements have been prepared on an accrual basis and under the historical cost convention. E.

Estimates and underlying assumptions are reviewed on an ongoing basis. LLL. (ii) Use of estimates  7KH SUHSDUDWLRQ RI oQDQFLDO VWDWHPHQWV LQ FRQIRUPLW\ ZLWK .QGLDQ *$$3 UHTXLUHV WKH PDQDJHPHQW WR make judgments. Although these estimates are based on the management’s best knowledge of current events and actions. 7KHDFFRXQWLQJSROLFLHVDGRSWHGLQWKHSUHSDUDWLRQRIoQDQFLDOVWDWHPHQWVDUHFRQVLVWHQWZLWKWKRVHRI previous year. Any revision to accounting estimates is recognised prospectively in the current and future periods. uncertainty about these assumptions and estimates could result in the outcomes different from the estimates. estimates and assumptions that affect the reported amounts of assets and liabilities and GLVFORVXUHRIFRQWLQJHQWOLDELOLWLHVRQWKHGDWHRIWKHoQDQFLDOVWDWHPHQWVDQGUHSRUWHGDPRXQWVRIUHYHQXHV and expenses for the year.

 7DQJLEOHo[HGDVVHWV D.

The cost comprises of the purchase price (net of Cenvat and VAT credit wherever applicable) and any attributable cost of bringing the assets to its working condition for its intended use. E. if any. Subsequent expenditures related to an item of tangible asset are added to its gross ERRNYDOXHRQO\LILWLQFUHDVHVWKHIXWXUHEHQHoWVIURPWKHH[LVWLQJDVVHWEH\RQGLWVSUHYLRXVO\DVVHVVHG standard of performance. )L[HGDVVHWVDUHVWDWHGDWFRVWRIDFTXLVLWLRQRUFRQVWUXFWLRQOHVVDFFXPXODWHGGHSUHFLDWLRQDPRUWLVDWLRQ and impairment losses.

are capitalized at cost. 0DFKLQHU\VSDUHVZKLFKFDQEHXVHGRQO\LQFRQQHFWLRQZLWKDSDUWLFXODULWHPRI)L[HG$VVHWVDQGWKHXVH of which is irregular. F.

G. )L[HGDVVHWVUHWLUHGIURPDFWLYHXVHDQGKHOGIRUGLVSRVDODUHVWDWHGDWWKHORZHURIWKHLUQHWERRNYDOXH and net realisable value and are disclosed separately under “other current assets”.

 /RVVHVDULVLQJIURPWKHUHWLUHPHQWRIDQGJDLQVDQGORVVHVDULVLQJIURPGLVSRVDORIo[HGDVVHWVZKLFKDUH FDUULHGDWFRVWDUHUHFRJQLVHGLQWKH6WDWHPHQWRI3URoWDQG/RVV e) 134 Tangible assets not ready for the intended use on the date of Balance Sheet are disclosed as “Capital ZRUNLQSURJUHVVy$GYDQFHVJLYHQWRZDUGVDFTXLVLWLRQFRQVWUXFWLRQRIo[HGDVVHWVRXWVWDQGLQJDWHDFK Balance Sheet date are disclosed as Capital Advances under “Long-term loans and advances”. .

2015 (contd.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31.) LY.

 'HSUHFLDWLRQRQWDQJLEOHo[HGDVVHWV D.

 'HSUHFLDWLRQ RQ o[HG DVVHWV RWKHU WKDQ &DSWLYH 3RZHU 3ODQW UHODWHG DVVHWV &33 DVVHWV.

 LV SURYLGHG using the straight-line method and on CPP assets using the written-down value method based on their respective estimated useful lives. Estimated useful lives of assets are determined based on technical parameters / assessment. The aforesaid estimated useful lives for computing depreciation is different in following case from the XVHIXOOLIHVSHFLoHGLQ6FKHGXOH..WRWKH&RPSDQLHV$FW Particulars Plant and Equipment related to Captive Power Plant Useful Life estimated by the management 20 Years Depreciation is calculated on a pro-rata basis from the date of installation till the date the assets are sold or disposed off. E.

 0DFKLQHU\VSDUHVZKLFKDUHFDSLWDOLVHGDUHGHSUHFLDWHGRYHUWKHXVHIXOOLIHRIWKHUHODWHGo[HGDVVHW7KH ZULWWHQGRZQYDOXHRIVXFKVSDUHVLVFKDUJHGLQWKH6WDWHPHQWRI3URoWDQG/RVVRQLVVXHIRUFRQVXPSWLRQ F.

 /HDVHKROGODQGLVDPRUWL]HGRQDVWUDLJKWOLQHEDVLVRYHUWKHSHULRGRIOHDVHZKLFKLVWR\HDUV G.

 )UHHKROGODQGXVHGIRUPLQLQJLVGHSUHFLDWHGRQWKHEDVLVRITXDQWLW\RIPLQHUDOVDFWXDOO\H[WUDFWHGGXULQJ the year with respect to the estimated total quantity of extractable mineral reserves. An impairment loss is recognized wherever the carrying amount of an asset exceeds its estimated recoverable amount. Computer Software cost is amortised over a period of three years using straight-line method. A previously recognised impairment loss is increased or reversed depending on changes in circumstances. the carrying value after reversal is not increased beyond the carrying value that would have prevailed by charging usual depreciation / amortisation if there was no impairment. (vi) Impairment of assets The carrying amount of assets are reviewed at each Balance Sheet date if there is any indication of impairment based on internal / external factors. The recoverable amount is the greater of the asset’s net VHOOLQJSULFHDQGYDOXHLQXVH. Intangible assets are amortised over their estimated useful economic life. YLL.QDVVHVVLQJWKHYDOXHLQXVHWKHHVWLPDWHGIXWXUHFDVKpRZVDUHGLVFRXQWHGWR WKHLUSUHVHQWYDOXHXVLQJDSUHWD[GLVFRXQWUDWHWKDWUHpHFWVFXUUHQWPDUNHWDVVHVVPHQWVRIWKHWLPHYDOXHRI PRQH\DQGULVNVVSHFLoFWRWKHDVVHW After impairment. Gains or losses arising from derecognition of intangible assets are measured as the difference between the net GLVSRVDOSURFHHGVDQGWKHFDUU\LQJDPRXQWRIWKHDVVHWDQGDUHUHFRJQLVHGLQWKH6WDWHPHQWRI3URoWDQG/RVV when the asset is derecognised. (v) Intangible assets and amortisation Intangible assets are stated at cost of acquisition or construction less accumulated amortisation and impairment losses if any. However. depreciation / amortisation is provided on the revised carrying amount of the asset over its remaining useful life.

All other borrowing costs are recognised in the 6WDWHPHQW RI 3URoW DQG /RVV LQ WKH SHULRG WKH\ RFFXU %RUURZLQJ FRVWV FRQVLVW RI LQWHUHVW DQG RWKHU FRVWV incurred in connection with borrowing of funds. 135 . until such time the asset is substantially ready for its intended use. %RUURZLQJ&RVWV Borrowing costs directly attributable to the acquisition and construction of an asset which takes a substantial period of time to get ready for its intended use. are capitalised as a part of the cost of such assets.

2015 (contd. Current investments are carried at the lower of cost and fair value determined on an individual basis. as follows: D. On disposal of an investment. provision for diminution in value is made to recognize a decline other than temporary in the value of the investments.) (viii) Investments Investments. However.ACC Limited NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31. which are readily realizable and intended to be held for not more than one year from the GDWHRQZKLFKVXFKLQYHVWPHQWVDUHPDGHDUHFODVVLoHGDVFXUUHQWLQYHVWPHQWV$OORWKHULQYHVWPHQWVDUH FODVVLoHGDVORQJWHUPLQYHVWPHQWV+RZHYHUWKDWSDUWRIORQJWHUPLQYHVWPHQWVZKLFKDUHH[SHFWHGWREH realized within twelve months from Balance Sheet date is also presented under “Current Investments” under k&XUUHQWSRUWLRQRIORQJWHUPLQYHVWPHQWVyLQFRQVRQDQFHZLWKWKHFXUUHQWQRQFXUUHQWFODVVLoFDWLRQRI Schedule III of the Companies Act. the difference between the carrying amount and the net disposal proceeds is UHFRJQLVHGLQWKH6WDWHPHQWRI3URoWDQG/RVV (ix) Inventories Inventories are valued after providing for obsolescence. 2013. Long term investments are carried at cost.

 5DZ0DWHULDOV6WRUHV 6SDUHSDUWV3DFNLQJ0DWHULDODQG)XHOV Lower of cost and net realizable value. E. Cost is determined on a weighted average basis. materials and other items held for use in the SURGXFWLRQRILQYHQWRULHVDUHQRWZULWWHQGRZQEHORZFRVWLIWKHoQLVKHGSURGXFWVLQZKLFKWKH\ZLOOEH incorporated are expected to be sold at or above cost. However.

less estimated costs of completion and estimated costs necessary to make the sale. Cost is determined on a weighted average basis. . Excise duties deducted from turnover (gross) are the amounts that are included in the amount of turnover (gross) and not the entire amount of liability that arose during the year. Cost of Stock-in-Trade includes cost of purchase and other cost incurred in bringing the inventories to the present location and condition. as applicable. trade discounts and returns. :RUNLQSURJUHVV)LQLVKHGJRRGVDQG6WRFNLQ7UDGH Lower of cost and net realizable value. Sale of goods  136 5HYHQXHLVUHFRJQLVHGZKHQWKHVLJQLoFDQWULVNVDQGUHZDUGVRIRZQHUVKLSRIWKHJRRGVKDYHEHHQSDVVHG to the buyer. Net realizable value is the estimated selling price in the ordinary course of business. Sales exclude self-consumption of cement. Cost includes direct materials and labour and a proportion of PDQXIDFWXULQJRYHUKHDGVEDVHGRQQRUPDORSHUDWLQJFDSDFLW\&RVWRIoQLVKHGJRRGVLQFOXGHVH[FLVH duty. (x) Cash and cash equivalents &DVK DQG FDVK HTXLYDOHQWV IRU WKH SXUSRVH RI FDVK pRZ VWDWHPHQW FRPSULVH FDVK LQ KDQG FDVK DW EDQN demand deposits with banks and other short-term highly liquid investments / deposits with an original maturity of three months or less. (xi) Revenue recognition  5HYHQXHLVUHFRJQL]HGWRWKHH[WHQWWKDWLWLVSUREDEOHWKDWWKHHFRQRPLFEHQHoWVZLOOpRZWRWKH&RPSDQ\ and the revenue can be reliably measured. Sales are disclosed net of sales tax / value added tax (VAT).

Government grants and subsidies receivable against an expense are deducted from such expense. b) Where the Government grants / subsidies relates to revenue. as applicable) pro-rata over the period of the contract as and when services are rendered. (xii) Government Grants and Subsidies a) Government grants and subsidies are recognized when there is reasonable assurance that the conditions attached to them will be complied. 2015 (contd. Interest and Dividend Income Interest income is recognised on a time proportion basis taking into account the amount outstanding and the rate applicable. Dividend income is recognised when the Company’s right to receive dividend is established by the Balance Sheet date. which they are intended to compensate.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31. it is recognized as income on a systematic EDVLVLQWKHVWDWHPHQWRISURoWDQGORVVRYHUWKHSHULRGVQHFHVVDU\WRPDWFKWKHPZLWKWKHUHODWHG costs.) Income from services Revenue from services is recognised (net of service tax. and grant/subsidy will be received. F.

 *UDQWVDQGVXEVLGLHVUHFHLYDEOHDJDLQVWDVSHFLoFo[HGDVVHWLVGHGXFWHGIURPFRVWRIWKHUHOHYDQWo[HG asset. Exchange differences arising on the settlement of monetary items or on reporting Company’s monetary items at rates different from those at which they were LQLWLDOO\UHFRUGHGGXULQJWKH\HDURUUHSRUWHGLQSUHYLRXVoQDQFLDOVWDWHPHQWVDUHUHFRJQLVHGDVLQFRPHRU as expenses in the year in which they arise.QLWLDOGLUHFWFRVWVVXFKDVOHJDOFRVWVEURNHUDJHFRVWVHWFDUH UHFRJQLVHGLPPHGLDWHO\LQWKH6WDWHPHQWRI3URoWDQG/RVV (xiv) Foreign currency transactions )RUHLJQ FXUUHQF\ WUDQVDFWLRQV DUH LQLWLDOO\ UHFRUGHG DW WKH UDWHV RI H[FKDQJH SUHYDLOLQJ RQ WKH GDWH RI WUDQVDFWLRQV )RUHLJQ FXUUHQF\ PRQHWDU\ LWHPV DUH VXEVHTXHQWO\ UHSRUWHG XVLQJ WKH FORVLQJ UDWH 1RQ monetary items which are carried in terms of historical cost denominated in a foreign currency are reported using the exchange rate at the date of the transaction. d) Government grants of the nature of promoters’ contribution are credited to Capital Reserve and treated as a part of shareholders’ funds. (xiii) Leases Where the Company is the lessee /HDVHVZKHUHWKHOHVVRUHIIHFWLYHO\UHWDLQVVXEVWDQWLDOO\DOOWKHULVNVDQGEHQHoWVRIRZQHUVKLSRIWKHOHDVHG LWHP DUH FODVVLoHG DV RSHUDWLQJ OHDVHV 2SHUDWLQJ OHDVH SD\PHQWV DUH UHFRJQL]HG DV DQ H[SHQVH LQ WKH 6WDWHPHQWRI3URoWDQG/RVVRQDVWUDLJKWOLQHEDVLVRYHUWKHOHDVHWHUP Where the Company is the lessor $VVHWVVXEMHFWWRRSHUDWLQJOHDVHVDUHLQFOXGHGLQo[HGDVVHWV/HDVHLQFRPHLVUHFRJQLVHGLQWKH6WDWHPHQW RI3URoWDQG/RVVRQDVWUDLJKWOLQHEDVLVRYHUWKHOHDVHWHUP&RVWVLQFOXGLQJGHSUHFLDWLRQDUHUHFRJQLVHGDV DQH[SHQVHLQWKHVWDWHPHQWRISURoWDQGORVV. 137 .

ACC Limited NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31. 2015 (contd.) [Y.

 5HWLUHPHQWDQGRWKHUHPSOR\HHEHQHoWV D.

 6KRUWWHUPHPSOR\HHEHQHoWV 6KRUW WHUP HPSOR\HH EHQHoWV DUH UHFRJQLVHG DV DQ H[SHQVH DW WKH XQGLVFRXQWHG DPRXQW LQ WKH 6WDWHPHQWRI3URoWDQG/RVVRIWKH\HDULQZKLFKWKHUHODWHGVHUYLFHLVUHQGHUHG E.

The contribution under the schemes is recognised as an expense in the Statement RI3URoWDQG/RVVZKHQDQHPSOR\HHUHQGHUVWKHUHODWHGVHUYLFH7KHUHDUHQRRWKHUREOLJDWLRQVRWKHU than the contribution payable to the respective funds. F. 'HoQHGFRQWULEXWLRn plans 7KH &RPSDQ\ V 2IoFHU V 6XSHUDQQXDWLRQ )XQG VFKHPH VWDWH JRYHUQHG SURYLGHQW IXQG VFKHPH HPSOR\HH VWDWH LQVXUDQFH VFKHPH DQG /DERXU :HOIDUH )XQG VFKHPH DUH FRQVLGHUHG DV GHoQHG contribution plans.

if any. Actuarial gains ORVVHVDUHUHFRJQL]HGLPPHGLDWHO\LQWKH6WDWHPHQWRI3URoWDQG/RVVLQWKH\HDULQZKLFKWKH\DULVH In respect of certain employees. 'HoQHGEHQHoWSODQV 7KH &RPSDQ\ V *UDWXLW\ IXQG VFKHPH DGGLWLRQDO JUDWXLW\ VFKHPH DQG SRVW HPSOR\PHQW EHQHoW VFKHPHDUHFRQVLGHUHGDVGHoQHGEHQHoWSODQV7KH&RPSDQ\ VOLDELOLW\LVGHWHUPLQHGRQWKHEDVLVRI an actuarial valuation using the projected unit credit method as at Balance Sheet date. provident fund contributions are made to a trust administered by WKH&RPSDQ\3HULRGLFFRQWULEXWLRQVWRWKH)XQGDUHFKDUJHGWRWKH6WDWHPHQWRI3URoWDQG/RVV7KH Company has an obligation to make good the shortfall. between the return from the investment RIWKHWUXVWDQGLQWHUHVWUDWHQRWLoHGE\WKH*RYHUQPHQWRI.QGLD G.

 2WKHUORQJWHUPEHQHoWV Silver jubilee and long service awards and accumulated compensated absences which are expected to be availed or encashed beyond 12 months from the end of the year. f) )RUWKHSXUSRVHRISUHVHQWDWLRQRI'HoQHGEHQHoWSODQVDQGRWKHUORQJWHUPEHQHoWVWKHDOORFDWLRQ between short term and long term provisions has been made as determined by an actuary. . are treated as other long term HPSOR\HHEHQHoWVIRUPHDVXUHPHQWSXUSRVHV7KH&RPSDQ\ VOLDELOLW\LVGHWHUPLQHGRQWKHEDVLVRI an actuarial valuation using the projected unit credit method as at Balance Sheet date. which are expected to be availed or encashed within 12 months IURP WKH HQG RI WKH \HDU DUH WUHDWHG DV VKRUW WHUP HPSOR\HH EHQHoWV 7KH FRPSDQ\ PHDVXUHV WKH expected cost of such absences as the additional amount that it expects to pay as a result of the unused entitlement that has accumulated at the reporting date. g) ([SHQVHVLQFXUUHGWRZDUGVYROXQWDU\UHWLUHPHQWVFKHPHDUHFKDUJHGWRWKH6WDWHPHQWRI3URoWDQG Loss as and when accrue. The Company presents the entire compensated absences as a short term provisions. since employee has an unconditional right to avail the leave at any time during the year. Actuarial gains ORVVHVDUHUHFRJQL]HGLPPHGLDWHO\LQWKH6WDWHPHQWRI3URoWDQG/RVVLQWKH\HDULQZKLFKWKH\DULVH 138 e) Accumulated compensated absences.

) (xvi) Income taxes Tax expense comprises of current and deferred tax and includes any adjustments related to past periods in current and / or deferred tax adjustments that may become necessary due to certain developments or reviews during the relevant period. Deferred tax is measured based on the tax rates and the tax laws enacted or substantively enacted at the Balance Sheet date. if it is probable WKDWDQRXWpRZRIUHVRXUFHVHPERG\LQJHFRQRPLFEHQHoWVZLOOEHUHTXLUHGWRVHWWOHWKHREOLJDWLRQDQGD UHOLDEOHHVWLPDWHFDQEHPDGHRIWKHDPRXQWRIWKHREOLJDWLRQ3URYLVLRQV H[FOXGLQJUHWLUHPHQWEHQHoWV. 'HIHUUHGLQFRPHWD[HVUHpHFWWKHLPSDFWRIFXUUHQW\HDU VWLPLQJGLIIHUHQFHVEHWZHHQWD[DEOHLQFRPHDQG accounting income for the year and reversal of timing differences of earlier years. The Company writesdown the carrying amount of a deferred tax asset to the extent that it is no longer reasonably certain that VXIoFLHQWIXWXUHWD[DEOHLQFRPHZLOOEHDYDLODEOHDJDLQVWZKLFKGHIHUUHGWD[DVVHWFDQEHUHDOLVHG$Q\VXFK ZULWHGRZQLVUHYHUVHGWRWKHH[WHQWWKDWLWEHFRPHVUHDVRQDEO\FHUWDLQWKDWVXIoFLHQWIXWXUHWD[DEOHLQFRPH will be available. (xvii) Provisions and contingent liabilities A provision is recognized when the Company has a present obligation as a result of past events. 2015 (contd. Deferred tax assets are recognised only to the extent that there is reasonable certainty WKDWVXIoFLHQWIXWXUHWD[DEOHLQFRPHZLOOEHDYDLODEOHDJDLQVWZKLFKVXFKGHIHUUHGWD[DVVHWVFDQEHUHDOLVHG The carrying amount of deferred tax assets are reviewed at each Balance Sheet date.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31.QFRPHWD[$FW Current tax assets and current tax liabilities are offset when there is a legally enforceable right to set off the recognised amounts and there is an intention to settle the asset and the liability on a net basis. Current income tax is measured at the amount expected to be paid to the WD[DXWKRULWLHVLQDFFRUGDQFHZLWKWKH.

The Company does not recognize DFRQWLQJHQWOLDELOLW\EXWGLVFORVHVLWVH[LVWHQFHLQWKHoQDQFLDOVWDWHPHQWV (xviii) Earnings per share %DVLFHDUQLQJVSHUVKDUHDUHFDOFXODWHGE\GLYLGLQJWKHQHWSURoWRUORVVIRUWKH\HDUDWWULEXWDEOHWRHTXLW\ shareholders by the weighted average number of equity shares outstanding during the year. 139 . These estimates are reviewed at each Balance Sheet date and adjusted WRUHpHFWWKHFXUUHQWEHVWHVWLPDWHV $FRQWLQJHQWOLDELOLW\LVDSRVVLEOHREOLJDWLRQWKDWDULVHVIURPSDVWHYHQWVZKRVHH[LVWHQFHZLOOEHFRQoUPHGE\ the occurrence or non-occurrence of one or more uncertain future events beyond the control of the company RUDSUHVHQWREOLJDWLRQWKDWLVQRWUHFRJQL]HGEHFDXVHLWLVQRWSUREDEOHWKDWDQRXWpRZRIUHVRXUFHVZLOOEH required to settle the obligation. are not discounted to their present value and are determined based on the best estimate required to settle the obligation at the reporting date. )RUWKHSXUSRVHRIFDOFXODWLQJGLOXWHGHDUQLQJVSHUVKDUHWKHQHWSURoWRUORVVIRUWKH\HDUDWWULEXWDEOHWR equity shareholders and the weighted average number of shares outstanding during the year are adjusted for the effects of all dilutive potential equity shares. A contingent liability also arises in extremely rare cases where there is a liability that cannot be recognized because it cannot be measured reliably.

[[. The total estimate of restoration expenses is apportioned over the estimate of mineral reserves and a provision is made based on minerals extracted during the year. The actual expenses may vary based on the nature of restoration and the estimate of restoration expenditure. The total estimate of restoration expenses is reviewed periodically. 2015 (contd.) (xix) Mines Restoration Expenditure The Company provides for the estimated expenditure required to restore quarries and mines. on the basis of technical estimates.ACC Limited NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31. Mines restoration expenses is incurred on an on going basis and until the closure of the quarries and mines.

Based on the nature of products and the time between the acquisition of assets for processing and their realisation. The analysis of geographical segments is based on the areas in which major operating divisions of the Company operate. Segment Policies The Company prepares its segment information in conformity with the accounting policies adopted for SUHSDULQJDQGSUHVHQWLQJWKHoQDQFLDOVWDWHPHQWVRIWKH&RPSDQ\DVDZKROH 140 .GHQWLoFDWLRQRIVHJPHQWV The Company’s operating businesses are organized and managed separately according to the nature of products and services provided. Unallocated items Revenue. expenses. &ODVVLoFDWLRQRI&XUUHQW1RQ&XUUHQW$VVHWVDQG/LDELOLWLHV All assets and liabilities are presented as Current or Non-current as per the Company’s normal operating cycle and other criteria set out in Schedule III of the Companies Act. Inter Segment transfers Inter segment revenue has been accounted for based on the transaction price agreed to between segments which is based on current market prices. 2013. assets and liabilities which relate to the Company as a whole and not allocable to segments on reasonable basis have been included under ‘unallocated revenue / expenses / assets / liabilities’. the Company has ascertained its operating cycle as 12 months for the purpose of Current / Non current claVVLoFDWLRQRIDVVHWVDQGOLDELOLWLHV (xxi) Segment Reporting . with each segment representing a strategic business unit that offers different products and serves different markets. Allocation of common costs Common allocable costs are allocated to each segment according to the relative contribution of each segment to the total common costs.

000) Equity Shares of ` 10 each 10.00.01  50.000 (Previous Year .77.01 2.000 (Previous Year .00. iii) Equity shares held by holding company / ultimate holding and their subsidiaries Holcim (India) Private Limited.000 (Previous Year .064) Equity shares ` HDFKIXOO\SDLGGXULQJWKHSHULRGRIoYH years immediately preceding the reporting date on exercise of options granted under the employee stock option plan.120) Equity shares ` 10 each fully paid Holderind Investments Ltd.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31. iv) The Company has issued Nil (Previous Year . of shares ` Crore     Equity Shares at the end of the year     Terms / rights attached to equity shares The Company has only one class of equity shares having par value of ` 10 per share.00 100. except in case of interim dividend. The distribution will be in proportion to the number of equity shares held by the shareholders. In the event of liquidation of the Company. The dividend proposed by the Board of Directors is subject to the approval of the shareholders in the ensuing Annual General Meeting.9.50.00.00 100.54 Both these Companies are subsidiaries of LafargeHolcim Ltd (Formerly known as Holcim Ltd).22.5.243) Equity Shares of ` 10 each Subscribed & Paid-up (Previous Year .751    141 . Holding Company of Holcim (India) Private Limited 5.20  0.000) Preference Shares of ` 10 each Issued (Previous Year .93.00    0.10. Switzerland.84.060) Equity Shares of `HDFK)RUIHLWHG Amount Paid TOTAL i) ii) 2015 ` Crore 2014 ` Crore 225. wherein part consideration was received in form of employee services.41.5.87. after distribution of all preferential amounts.88.356) Equity Shares of ` 10 each fully paid $GG(Previous Year .54 0.20   Reconciliation of number of equity shares outstanding Equity Shares at the beginning of the year 2015 2014 No.000) Equity shares ` 10 each fully paid 2015 ` Crore 2014 ` Crore   0. Mauritius. of shares % holding No.18. of shares ` Crore No.38.21. the holders of equity shares will be entitled to receive remaining assets of the Company.) 3. Each holder of equity shares is entitled to one vote per share. SHARE CAPITAL Authorised Shares 22. 2015 (contd.18.00.00.41.00.. of shares % holding  50. the Holding Company (Previous Year .45.74.00 225.3.50. the ultimate holding Company. v) Details of shareholders holding more than 5% shares in the Company Holcim (India) Private Limited Life Insurance Corporation of India 2015 2014 No.

00 130.456.663.) 4.07 4.ACC Limited NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31.30 6XUSOXVLQ6WDWHPHQWRI3URoWDQG/RVV 4.663. 2015 (contd.14  %DODQFHDVSHUODVW)LQDQFLDOVWDWHPHQWV $GG3URoWIRUWKH\HDU Less .` 15)} 206.` 19)} 112.16 Interim equity dividend {amount per share ` 11 (Previous Year .00 130.65 356.52  3URSRVHGoQDOHTXLW\GLYLGHQG {amount per share ` 6 (Previous Year .64     5.00 414.525.64   .344.Appropriations TOTAL 142 4.30 2.456.72 Tax on equity dividends   Transfer to General Reserve 30. RESERVES AND SURPLUS 2015 ` Crore 2014 ` Crore Capital Reserve Securities Premium Account ` Crore     Debenture Redemption Reserve %DODQFHDVSHUODVW)LQDQFLDOVWDWHPHQWV -  Less: Transferred to General Reserve -  - - General Reserve %DODQFHDVSHUODVW)LQDQFLDOVWDWHPHQWV Add: Transferred from Debenture Redemption Reserve $GG7UDQVIHUUHGIURP6XUSOXVLQ6WDWHPHQWRI3URoWDQG/RVV 2.00  2.30 -  30.634.

46 2014 ` Crore   (0.72   31. 143 .57) 20.43 535.35)  LONG-TERM PROVISIONS 3URYLVLRQIRUHPSOR\HHEHQHoWV(Refer Note .15 (0.46 41.31) 3URYLVLRQIRUJUDWXLW\DQGVWDIIEHQHoWVFKHPHV /RQJVHUYLFHDZDUGDQGRWKHUEHQHoWSODQV Other Provisions Provision for Mines Restoration TOTAL Movement of provision during the year as required by Accounting Standard 29 : Mines Restoration Expenditure Opening provision Add: Provision during the year Less: Utilisation during the year Closing provision Mines restoration expenditure is incurred on an ongoing basis and until the closure of the mine.00 757. The actual expenses may vary based on the nature of restoration and the estimate of restoration expenditure.57 2015 ` Crore 2014 ` Crore     20. DEFERRED TAX LIABILITIES (NET) Deferred Tax Liabilities arising on account of: Depreciation and amortisation differences Deferred Tax Assets arising on account of: 3URYLVLRQIRU(PSOR\HH%HQHoWV ([SHQGLWXUHGHELWHGLQ6WDWHPHQWRI3URoWDQG/RVVEXWDOORZHGIRUWD[ purposes in the following years Provision for obsolescence of Spare Parts Others Net Deferred Tax Liabilities 6. 2015 (contd.) 5.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31. 2015 ` Crore 2014 ` Crore 652.46    2015 ` Crore  0.65 757.00 27.57 101.32    44.65 652.07 221.

) TOTAL L.50 - 2015 ` Crore 2.44 0.) 7.02   666. etc. 2015 (contd.a.77 113.50 35.QYHVWRU(GXFDWLRQDQG3URWHFWLRQ)XQG (Refer Note .34 (c)xx} TOTAL 2015 ` Crore 2014 ` Crore 35. Employees dues.44 2014 ` Crore - 33.27       The above loan is repayable on demand and carries rate of interest at 10. SHORT-TERM BORROWINGS Unsecured Loans from a related party {Refer Note .ACC Limited NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31. OTHER CURRENT LIABILITIES Interest accrued but not due on borrowings .02 324.10% p.(i) below) Unpaid dividend Unpaid Matured Deposits Statutory dues Advance from customers Security deposits and retention money Liability for capital expenditure Other payables (including Rebates to customers. 8.13   0.

 7KHUHDUHQRDPRXQWVGXHDQGRXWVWDQGLQJWREHFUHGLWHGWR.72 71. SHORT-TERM PROVISIONS 3URYLVLRQIRUHPSOR\HHEHQHoWV(Refer Note .65    356.32  .31) 3URYLVLRQIRUJUDWXLW\DQGVWDIIEHQHoWVFKHPHV Provision for compensated absences /RQJVHUYLFHDZDUGDQGRWKHUEHQHoWSODQV Other Provisions Provision for Income Tax (Net of advance tax) 3URSRVHG)LQDO'LYLGHQG Tax on proposed dividend TOTAL 144 2015 ` Crore 2014 ` Crore    16.QYHVWRU(GXFDWLRQDQG3URWHFWLRQ)XQGDVDW December 31. 2015 9.66 112.74   454.

351.` 28.04 Vehicles  2. (ii) Notes:(i) Buildings include cost of shares `(Previous Year .50 37.21 174.32  Railway Sidings 1.35   7. FIXED ASSETS Corporate Overview Subsidiary Companies NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31.46 126.12 Crore) capitalised as pre-operative expenses.27 Crore) in respect of which the transfer of title deeds to the name of the Company is under process.55 45.25 23.` 28.11 165.22 Crore (Previous Year .` 21.03 1.75 - - -    102.31 7.55     - Financial Statements Intangible Assets: TOTAL   64.16 33.51  652.72 0.72        0.01 163.51) )UHHKROG1RQ Mining Land Tangible Assets : Particulars 10. in respect of 10 (Previous Year .51 0.22 76.06 Financial Highlights    ` Crore GROSS BLOCK AT COST DEPRECIATION / AMORTISATION NET BLOCK As at Additions/ Deductions/ As at As at )RUWKH Adjustment as disclosed Deductions/ As at As at As at 01-01-2015 Adjustments Adjustments 31-12-2015 01-01-2015 Year under Exceptional item Adjustments 31-12-2015 31-12-2015 31-12-2014 (Refer Note .54 1.20  31.` 23.66 70.77 63.46 1.17 22.24 - 0.48 Crore) and accumulated depreciation `&URUH(Previous Year .36  TOTAL 0. (iv) Depreciation charge for the year includes ` 1.00 )XUQLWXUH  )L[WXUHV 1.86 Crore) and Net block of `&URUH(Previous Year .10)UHVLGHQWLDOpDWV  Computer Software 133.57 30.70  - - - 153.` 4. (iii) Plant and Equipment includes assets given on lease to Railways under “Own Your Wagons” Scheme of `  &URUH (Previous Year .73  - -  Board & Management Reports 2IoFHHTXLSPHQW   117.66 20.24  40.56 43.` 0.66 )UHHKROG0LQLQJ Land 32.64 0.) 145 .16 1.36 4.675.01 25. Plant and Equipment 14.960) in various Co-operative Housing Societies.07 0.41 134.35  4.65      - - -    7.67  Buildings include Gross block of `&URUH(Previous year .20 0.42 2.63  12.48 Crore).64        36.71   533.36 524.03  4.05 1.43   0.73 44.71 Leasehold Land Buildings 132.07     74. 2015 (contd.

120.74 0.20 - 1.33 )UHHKROG0LQLQJ Land 7.67    5.66  As at 31-12-2014     26.17    Vehicles   41.00  2.57 30.12  31.35 160.22 76.71   4.35 0.71 165.36 64.74 5.62  104.)    126.07 1.52 121.70  DEPRECIATION / AMORTISATION As at )RUWKH Deductions/ As at 01-01-2014 Year Adjustments 31-12-2014 0.47 2.52 0.64 0.14    - 0.33   47.04 43.77 1.46 104.26 2IoFHHTXLSPHQW   Intangible Assets: Computer Software TOTAL 0.64        36.07  6.23 2.17 0.33 151.55 1.13     4.13 14.16  12.03  4.36  40.00   1.66 20.24  122.27 )XUQLWXUH  )L[WXUHV TOTAL 13.35 557.146 12.351.01 163.65  10.35 10. 2015 (contd.42 2.07 - - 0. FIXED ASSETS (Contd.43 As at 01-01-2014    7.503.01 GROSS BLOCK AT COST Additions/ Deductions/ Adjustments Adjustments )UHHKROG1RQ Mining Land Tangible Assets : Particulars 10.30  Plant and Equipment Railway Sidings   Leasehold Land Buildings 14.43 ` Crore NET BLOCK As at As at 31-12-2014 31-12-2013 ACC Limited NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31.274.) .675.07 - - - -    63.

01.27 5.000 37.00 3.25. 2015 (contd.000    15.00  20.25.00.000 2.) 11.000   4.50 - -   147 .42) National Limestone Company Private Limited Less: Diminution in the value of investment (Refer Note .02   4.01.01   4.50 Crore during the year) 2014 Numbers ` Crore ` Crore  20.000 14.01 25.42) Investment in Associates Face value ` 10 each Alcon Cement Company Private Limited Asian Concretes and Cements Private Limited Aakaash Manufacturing Company Private Limited Investment in Joint Venture Face value ` 10 each Oneindia BSC Private Limited (25.25  6.25  6.000 37. NON-CURRENT INVESTMENTS (VALUED AT COST UNLESS STATED OTHERWISE) 2015 Numbers Trade Investments Unquoted equity instruments Investment in subsidiaries Face value ` 10 each Bulk Cement Corporation (India) Limited Singhania Minerals Private Limited Face value ` 100 each Lucky Minmat Limited ACC Mineral Resources Limited Less: Diminution in the value of investment (Refer Note .13 2.401 22.02 2.15   - 2.00.00.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31.000   4.27 5.000 Shares Subscribed for ` 2.00.401 22.000  3.000 14.13 2.

65   2.14) 3.36.63 Crore)} Aggregate amount of unquoted Investments Aggregate provision for diminution in value of investments *Denotes amount less than ` 50.000 23.70  37 3.000 #Amount included under the head “Current investments” (Refer Note . 2015 (contd.36.ACC Limited NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31.05 Crore (Previous Year .55     37.50.50.70 3.00. Company Limited *Gujarat Composites Limited *Rohtas Industries Limited *The Jaipur Udyog Limited 'LJYLMD\)LQOHDVH/LPLWHG *The Travancore Cement Company Limited *Ashoka Cement Limited Face value ` 5 each *The Sone Valley Portland Cement Company Limited 2014 Numbers ` Crore ` Crore 2.70 - - 3.70 274.14   .) (VALUED AT COST UNLESS STATED OTHERWISE) 2015 Numbers Non trade investments (a) Quoted equity instruments 6KLYD&HPHQW/LPLWHG )DFHYDOXH` 2 each) Less: Diminution in the value of investment (b) Investment in equity instruments (unquoted) Face value ` 10 each * Kanoria Sugar & General Mfg.) 11.000 23.000 each 5.13% Himachal Pradesh Infrastructure Development Board Bonds 37 Less: Current portion of long-term investments# TOTAL Notes (I) (II) (III) (iv) (v) 148 Aggregate amount of quoted Investments {Market value ` 17. NON-CURRENT INVESTMENTS (contd.` 9.65   4 - 4 - 60 220 120  100 50 - 60 220 120  100 50 - 100 - 100 -  Investment in Bonds (Unquoted) Face value ` 10.

71 Less: Allowance for doubtful deposits TOTAL 13. CONSIDERED GOOD.11 - 466.71  4.70  365. 2015 (contd. UNLESS OTHERWISE STATED Incentives under Government schemes and other receivables Considered good Considered doubtful Less: Provision for doubtful receivables Non-current bank balance (Refer Note .34 (c)xvii} Deposits with Government Bodies and Others Considered good Considered doubtful       250.) 12.27 Advance tax (Net of provision for tax) 305.46  -  250. OTHER NON-CURRENT ASSETS UNSECURED.71 0. UNLESS OTHERWISE STATED 2015 ` Crore 2014 ` Crore Capital Advances  206.70 Security deposits 204.17  Loans and advances to related parties {Refer Note .16    2015 ` Crore 2014 ` Crore  360.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31.30 360.17) TOTAL 149 . CONSIDERED GOOD.41  4.70  360. LONG-TERM LOANS AND ADVANCES UNSECURED.17  Advances recoverable in cash or kind 15.01 16.

59$/8(81/(6627+(5:. 2015 (contd.) 14.ACC Limited NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31.6(67$7('. CURRENT INVESTMENTS 9$/8('$7/2:(52)&267$1')$.

73 74.000 5.45 .70 73.000 20.000 17.51     - - - 10.000 20.000       171.00.11) Investment in Bonds (Unquoted) Face value ` 10.000 20.00.000 - 3.500 5.000 10.02 246.500 7.000 each 5.13% Himachal Pradesh Infrastructure Development Board Bonds .50   1.000 17.000 10.QYHVWPHQWLQ&HUWLoFDWHRI'HSRVLWV)XOO\SDLGXS (unquoted) Unit of Face value ` 1.132.QYHVWPHQWLQ0XWXDO)XQGV)XOO\SDLGXS 8QTXRWHG. 2015 Numbers Current Portion of Long Term Investment (valued at cost) (Refer Note .000 25.000 each IDBI Bank Limited +')&%DQN/LPLWHG Bank of Maharashtra Kotak Mahindra Bank Limited Andhra Bank Corporation Bank Oriental Bank Allahabad Bank Bank of India Punjab National Bank Canara Bank Union Bank of India 2014 Numbers ` Crore 37 7.500 10.500 25.

3UHPLHU/LTXLG)XQG6XSHU.00   - 25.00 50.00 45.15  .15 40.35.072  45.00 -   1.00 350.3UXGHQWLDO/LTXLG)XQG6XSHU.00 15.00 20.3*URZWK %LUOD6XQOLIH&DVK3OXV)XQG*URZWK - - 22.00  Aggregate amount of unquoted Investments 1.3*URZWK 5HOLDQFH/LTXLG)XQG*URZWK .00 40.00 15./LTXLG)XQG*URZWK / 7/LTXLG)XQG*URZWK 3UDPHULFD/LTXLG)XQG'LUHFW*URZWK 3ULQFLSDO&DVK0DQDJHPHQW)XQG*URZWK 150 ` Crore TOTAL 65.00 15.247.201.443     Unit of Face value ` 1.00 10.'%.&.RWDN)ORDWHU67*URZWK 5HOLJDUH/LTXLG)XQG*URZWK 6%.000 each .&. Unit of Face value ` 10 each +')&&DVK0DQDJHPHQW*URZWK 6XQGDUDP0RQH\)XQG*URZWK - -   55.00 40.00 1.21.134.201.00 Unit of Face value ` 100 each .

) 15. considered good Unsecured. TRADE RECEIVABLES Trade receivables outstanding for a period exceeding six months from the date they are due for payment Less: Provision for doubtful trade receivables Other Trade receivables Secured.02     2015 ` Crore 2014 ` Crore Unsecured.43 Crore (Previous Year .75 0.` 15.65 0.68 Crore)} Packing Material )XHOV {Including in transit ` 6.26  27.41 3.17 Crore)} TOTAL 16.45  47.20 240.32 )LQLVKHG*RRGV 152.43 464. considered good Unsecured.32 Crore)} Stock-in-trade Stores & Spare Parts {Including in transit `&URUH(Previous Year .41 3.01  Work-in-Progress 241.` 11.71 Raw Materials {Including in transit `&URUH(Previous Year .53  20.37  262.43   7. considered doubtful Less: Provision for doubtful trade receivables TOTAL 151 .` 16.54   410. INVENTORIES (AT COST OR NET REALISABLE VALUE WHICHEVER IS LOWER) 2015 ` Crore 2014 ` Crore 132. considered good   Unsecured.45        7. considered doubtful 27. 2015 (contd.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31.54 153.

CASH AND BANK BALANCES Cash and cash equivalents Balances with banks: On current accounts Deposits with original maturity of less than three months #On unpaid dividend account Cash on hand Other bank balances *Deposits with original maturity for more than 3 months but less than 12 months Deposits with original maturity for more than 12 months Less : Amount disclosed under other non-current asset (Refer Note .64   0.13) 3RVWRIoFHVDYLQJDFFRXQWV TOTAL 2015 ` Crore 2014 ` Crore  33.12  -  0.QFOXGHV o[HG GHSRVLW ZLWK OLHQ LQ IDYRXU RI &RPSHWLWLRQ $SSHOODWH 7ULEXQDO &203$7.01 0. 2015 (contd.11 0.11  37.11 0.01  0.ACC Limited NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31.01  304.) 17.30 .44 0.

SHORT-TERM LOANS AND ADVANCES UNSECURED.61 2014 ` Crore  1.60 140. RI ` Nil (Previous Year ` 129.11 2014 ` Crore 4.36 113. 18.54 19. CONSIDERED GOOD.75 1.00  2015 ` Crore 6.34 (c)xvi} Advances recoverable in cash or kind Other loans and advances Balances with statutory / government authorities 'HSRVLWZLWK+')&/LPLWHG TOTAL 2015 ` Crore  0.30  14.27 Crore) (Refer Note . OTHER CURRENT ASSETS UNSECURED.53   55.21 116. UNLESS OTHERWISE STATED Interest accrued on investments Other Accrued Interest )L[HGDVVHWVKHOGIRUVDOH TOTAL 152 . UNLESS OTHERWISE STATED Security deposits Loans and advances to related parties {Refer Note . CONSIDERED GOOD.37) #These balances are available for use only towards settlement of corresponding unpaid dividend liabilities.57 100.00   100.

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31. 2015 (contd. REVENUE FROM OPERATIONS Sale of products )LQLVKHGJRRGV Traded goods Sale of services Sale of products and services (gross) Less: Excise duty Sale of products and services (net) Other operating revenue Revenue from operations (net) i) Details of products sold )LQLVKHGJRRGV 1HWRI([FLVHGXW\.) 20.

75 17.07     257.66  214. Cement Ready Mix Concrete Clinker Traded Goods Cement Ready Mix Concrete ii) Details of sale of services Pumping and Conversion services Detail of other operating revenue Provision no longer required written back Sale of surplus generated power Incentives and Subsidies Miscellaneous Income TOTAL 2015 ` Crore 2014 ` Crore  112.05 204.17     257.51  664.54  364.76 364. OTHER INCOME Interest on Bank deposits Interest on Income Tax Other interest income Gain on sale of current investments Dividend from long term investments Other TOTAL 153 .37  76.22  112.07   204.13 22.432.04 1.16  2015 ` Crore 2014 ` Crore    11.45   iii) 21.47  2014 ` Crore 117.301.16 2015 ` Crore   4.36  15.37    11.24 2.41  10.17     10.41 41.

75 240.34   *includes no item which in value individually accounts for 10 percent or more of the total value of materials consumed.54 241.65 152. WORK-IN-PROGRESS AND STOCK-IN-TRADE 2015 2014 ` Crore ` Crore Inventories at the end of the year Stock-in-trade )LQLVKHG*RRGV Work-in-progress Inventories at the beginning of the year Stock-in-trade )LQLVKHG*RRGV Work-in-progress TOTAL 154 2014 ` Crore  72. 2015 (contd.01  2014 ` Crore      2015 ` Crore   353.) 22. 23.31   2014 ` Crore   346.32   . PURCHASE OF TRADED GOODS 2015 ` Crore 13. CHANGES IN INVENTORIES OF FINISHED GOODS.20  0.37 153.71   Cement Ready Mix Concrete TOTAL 24.05  134.55  114.72  132. COST OF MATERIALS CONSUMED Opening Stock Purchase and Incidental expenses Less: Closing Stock TOTAL Details of cost of materials consumed Slag Gypsum )O\$VK Cement Aggregates Others* TOTAL 2015 ` Crore  1.ACC Limited NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31.732.42  (Increase) / decrease ` Crore 0.

21  . 1.

37 153. 0.05 0.32  0.75 240.05      .

0.12  .

53  . 12.

.

06 2014 ` Crore 557.35  2015 ` Crore  404.55 0.20  2015 ` Crore 460.00 2014 ` Crore  2.61  26.51 652.23 57.32 45.32 2014 ` Crore  34.73  141.) 25.07  145.52   23.15 24.57 25.72  110.44 205.(i) & (ii) below) TOTAL 155 .76   2014 ` Crore   2.13  67.30 2.44 1.70 2.06  2015 ` Crore 651.23 0. FINANCE COSTS Interest expenses Interest on Income Tax TOTAL 28.723. DEPRECIATION AND AMORTIZATION EXPENSE Depreciation on tangible assets Amortization of intangible assets TOTAL 29. 2015 (contd.262.32  2014 ` Crore   42.13 4.13 112.62       26.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31. OTHER EXPENSES Consumption of stores and spare parts Consumption of packing materials Excise duty variation on opening and closing stock Rent Rates and taxes Repairs to building Repairs to machinery Repairs to other Items Insurance Royalties on minerals Discount on sales Advertisement Technology and Know-how fees Miscellaneous expenses (Refer Note . EMPLOYEE BENEFITS EXPENSE Salaries and Wages &RQWULEXWLRQVWR3URYLGHQWDQGRWKHU)XQGV Staff Welfare Expenses TOTAL 2015 ` Crore 667.52  2015 ` Crore 46. FREIGHT AND FORWARDING EXPENSE On Clinker transfer 2QoQLVKHGSURGXFWV TOTAL 27.204.

OTHER EXPENSES (contd.53 0.16 0.) Payment to Statutory Auditors (excluding service tax) As auditors Audit fees $XGLWIHHVIRUWD[oQDQFLDOVWDWHPHQWV Out of pocket expenses .11 0.) 29.10  3.QRWKHUPDWWHUV&HUWLoFDWLRQ TOTAL 2015 ` Crore 2014 ` Crore 3. 2015 (contd.77 i) ii) Miscellaneous expenses includes: D.53 0.01 3.30 0.12 0.ACC Limited NOTES TO THE FINANCIAL STATEMENTS for the year ended December 31.

 /RVVRQVDOHZULWHRIIRI)L[HG$VVHWV 1HW.

23 Diluted ` 31.43 62.13 Crore) (c) Non-current Investment written off of ` Nil (Previous Year . EARNINGS PER SHARE .` 4.[EPS] 1HW3URoWDVSHU6WDWHPHQWRI3URoWDQG/RVV 2015 ` Crore 2014 ` Crore         Weighted average number of equity shares for Earnings Per Share computation Shares for Basic Earnings Per Share Add: Potential diluted equity shares on account of shares in abeyance (Movement in Number of shares is on account of change in fair value of share) Number of Shares for Diluted Earnings Per Share Earnings per Share 156 )DFHYDOXHSHU6KDUH ` 10.51 62.00 10.` 30.` 15.69 Crore) 30.` 0.00 Basic ` 31.15 Crore (Previous Year .45 Crore (Previous Year .88 Crore) (b) Provision for other than temporary diminution in long term investment of ` 15.06 .

1$1&.$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 127(6727+().

31. EMPLOYEE BENEFITS: D.

E.82 Crore). 'HoQHG&RQWULEXWLRQ3ODQVq$PRXQWUHFRJQLVHGDQGLQFOXGHGLQ1RWHk&RQWULEXWLRQVWR3URYLGHQWDQG RWKHU)XQGVyRI6WDWHPHQWRI3URoWDQG/RVV`&URUH(Previous Year .` 14.

PSOHPHQWLQJ $6 (PSOR\HH %HQHoWV UHYLVHG . 'HoQHG%HQHoW3ODQVq$VSHUDFWXDULDOYDOXDWLRQRQ'HFHPEHU 7KH&RPSDQ\KDVDGHoQHGEHQHoWJUDWXLW\DGGLWLRQDOJUDWXLW\SRVWUHWLUHPHQWPHGLFDOEHQHoWSODQVDQG 7UXVWPDQDJHGSURYLGHQWIXQGSODQDVJLYHQEHORZ L (YHU\HPSOR\HHZKRKDVFRPSOHWHGPLQLPXPoYH\HDUVRIVHUYLFHLVHQWLWOHG WR JUDWXLW\ DW  GD\V VDODU\IRUHDFKFRPSOHWHG\HDURIVHUYLFHV7KHVFKHPHLVIXQGHGZLWKLQVXUDQFHFRPSDQLHVLQWKHIRUPRI TXDOLI\LQJLQVXUDQFHSROLFLHV LL (YHU\HPSOR\HHZKRKDVMRLQHGEHIRUHVW'HFHPEHUDQGVHSDUDWHVIURPVHUYLFHRIWKH&RPSDQ\RQ 6XSHUDQQXDWLRQDQGRQPHGLFDOJURXQGVLVHQWLWOHGWRDGGLWLRQDOJUDWXLW\7KHVFKHPHLV1RQ)XQGHG LLL %HQHoWV XQGHU 3RVW (PSOR\PHQW 0HGLFDO %HQHoW 3ODQV DUH SD\DEOH IRU DFWXDO GRPLFLOLDU\ WUHDWPHQW  KRVSLWDOL]DWLRQIRUHPSOR\HHVDQGWKHLUVSHFLoHGUHODWLYHV7KHVFKHPHLV1RQ)XQGHG LY 3URYLGHQWIXQGIRUFHUWDLQHOLJLEOHHPSOR\HHVLVPDQDJHGE\WKH&RPSDQ\WKURXJKWUXVWk7KH3URYLGHQW )XQG RI $&& /WGy LQ OLQH ZLWK WKH 3URYLGHQW )XQG DQG 0LVFHOODQHRXV 3URYLVLRQ $FW  7KH SODQ JXDUDQWHHV LQWHUHVW DW WKH UDWH QRWLoHG E\ WKH 3URYLGHQW )XQG $XWKRULWLHV 7KH FRQWULEXWLRQ E\ WKH HPSOR\HUDQGHPSOR\HHWRJHWKHUZLWKWKHLQWHUHVWDFFXPXODWHGWKHUHRQDUHSD\DEOHWRHPSOR\HHVDWWKH WLPHRIVHSDUDWLRQIURPWKH&RPSDQ\RUUHWLUHPHQWZKLFKHYHULVHDUOLHU7KHEHQHoWVYHVWVLPPHGLDWHO\ RQUHQGHULQJRIWKHVHUYLFHVE\WKHHPSOR\HH  7KHPLQLPXPLQWHUHVWUDWHSD\DEOHE\WKH7UXVWWRWKHEHQHoFLDULHVHYHU\\HDULVEHLQJQRWLoHGE\WKH *RYHUQPHQW7KH&RPSDQ\KDVDQREOLJDWLRQWRPDNHJRRGWKHVKRUWIDOOLIDQ\EHWZHHQWKHUHWXUQIURP WKHLQYHVWPHQWVRIWKH7UXVWDQGWKHQRWLoHGLQWHUHVWUDWH  7KH $6% *XLGDQFH RQ .

 LVVXHG E\ $FFRXQWLQJ 6WDQGDUGV%RDUG $6%.

QFOXGLQJ DGGLWLRQDO*UDWXLW\.QGLDWKH&RPSDQ\KDVREWDLQHGWKHDFWXDULDOYDOXDWLRQRI LQWHUHVWUDWHREOLJDWLRQLQUHVSHFWRI3URYLGHQW)XQGDQGWKHUHLVQRVKRUWIDOODVDW'HFHPEHUDQG 'HFHPEHU 'HoQHG%HQHoW3ODQVDVSHU$FWXDULDOYDOXDWLRQRQ'HFHPEHU *UDWXLW\ .VWDWHVWKDWEHQHoWSODQVLQYROYLQJHPSOR\HUHVWDEOLVKHGSURYLGHQWIXQGVZKLFK UHTXLUHLQWHUHVWVKRUWIDOOVWREHUHFRPSHQVHGDUHWREHFRQVLGHUHGDVGHoQHGEHQHoWSODQV$VSHUWKH *XLGDQFH1RWHIURPWKH$FWXDULDO6RFLHW\RI.

)XQGHG `&URUH I ([SHQVHUHFRJQLVHGLQWKH6WDWHPHQWRI3URoW  /RVVqIRUWKH\HDUHQGHG'HFHPEHU 1 &XUUHQW6HUYLFHFRVW  .QWHUHVW&RVW  (PSOR\HH&RQWULEXWLRQV  ([SHFWHGUHWXUQRQSODQDVVHWV  1HW$FWXDULDO *DLQV.

/RVVHV  7RWDOH[SHQVH )LJXUHVLQLWDOLFVSHUWDLQWRSUHYLRXV\HDU.

71   .  10.05  13.

57  6.99  30.51  19. (12.36)  18.11 3RVW (PSOR\PHQW 0HGLFDOEHQHoWV 3(0%.39 1RQ)XQGHG `&URUH  4.03    8.

04  0.36  . 3URYLGHQW IXQG `&URUH `&URUH  0.

07   .97  39. (0.66  19.32)   2.58  2.

51) 157 .04)  (6.51)  (25. (40.

$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.1$1&.ACC Limited 127(6727+().

76 FRQWG. 31 (03/2<((%(1().

*UDWXLW\ .QFOXGLQJ DGGLWLRQDO*UDWXLW\.

)XQGHG `&URUH II $PRXQWUHFRJQLVHGLQ%DODQFH6KHHW 1 3UHVHQWYDOXHRI'HoQHG%HQHoW2EOLJDWLRQ  )DLUYDOXHRISODQDVVHWV  )XQGHGVWDWXV^6XUSOXV 'HoFLW.

`  1HWDVVHW OLDELOLW\.

DVDW'HFHPEHU III 3UHVHQW9DOXHRI'HoQHG%HQHoW2EOLJDWLRQ 1 3UHVHQWYDOXHRI'HoQHG%HQHoW2EOLJDWLRQDW EHJLQQLQJRIWKH\HDU  &XUUHQW6HUYLFHFRVW  .QWHUHVW&RVW  (PSOR\HH&RQWULEXWLRQV  $FWXDULDO *DLQV.

/RVVHV  %HQHoWV3D\PHQWV  1HWWUDQVIHULQ RXW.

8 3UHVHQWYDOXHRI'HoQHG%HQHoW2EOLJDWLRQDW WKHHQGRIWKH\HDU .9 )DLU9DOXHRI3ODQ$VVHWV 1 3ODQDVVHWVDWWKHEHJLQQLQJRIWKH\HDU  ([SHFWHGUHWXUQRQSODQDVVHWV  &RQWULEXWLRQVE\(PSOR\HU  &RQWULEXWLRQVE\(PSOR\HH )LJXUHVLQLWDOLFVSHUWDLQWRSUHYLRXV\HDU.

158 1RQ)XQGHG `&URUH 3RVW (PSOR\PHQW 0HGLFDO EHQHoWV 3(0%.

3URYLGHQW IXQG `&URUH `&URUH  .

24  .36)  177. (188.

(11.12)  .

12)  . (11.

(85.42)   .

42)  . (85.

42)  . (85.

(6.26)   .

26)  . (6.

(6.26)  .

88  10. (492.97  27.05  13.32  .97     165.71   21.19  27.22)  520.

(22.60)   71.18  4.51  .03   8.57  6.

36  . (4.87)   4.18  0.04  0.

58  . (0.32)  2.

07  41.68  (3. (0.58)   445.67  19.97  39.96)  .

(15.43)  .

36  12.51  19. (34.26 492.80  12.75  -     -     -  447.68 .60  41.78)  188.55  40.22  149.42 6.36 85.

1$1&.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 127(6727+().$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.

31 (03/2<((%(1().76 FRQWG.

QFOXGLQJ DGGLWLRQDO*UDWXLW\. *UDWXLW\ .

9  $FWXDOEHQHoWVSDLG  1HWWUDQVIHULQ RXW.

 $FWXDULDO*DLQV /RVVHV.

)XQGHG 1RQ)XQGHG `&URUH `&URUH  . 8 3ODQDVVHWVDWWKHHQGRIWKH\HDU  $FWXDOUHWXUQRQSODQDVVHWV 7KHPDMRUFDWHJRULHVRISODQDVVHWVDVD SHUFHQWDJHRIWRWDOSODQ *RYHUQPHQWVHFXULWLHV 'HEHQWXUHVDQG%RQGV (TXLW\6KDUHV )L[HG'HSRVLWV 9.

69 *UDWXLW\  %      (IIHFWRI2QHSHUFHQWDJHSRLQWFKDQJHLQWKHDVVXPHG0HGLFDO .      2.QFUHDVH 'HFUHDVH.33   177.QpDWLRQUDWH .24   14.

QFUHDVH 'HFUHDVH.RQDJJUHJDWHVHUYLFHDQGLQWHUHVWFRVWRI3RVW (PSOR\PHQW0HGLFDOEHQHoWV .

RQ3UHVHQWYDOXHRI'HoQHG%HQHoW2EOLJDWLRQDV DW'HFHPEHU  %      3RVW (PSOR\PHQW 0HGLFDO EHQHoWV 3(0%.

3URYLGHQW IXQG `&URUH      - `&URUH  .

(15.45)  .

(34.78)  .

19  61. 21.08  520.59 3URYLGHQWIXQG   % %           2QHSHUFHQWDJH 2QHSHUFHQWDJH LQFUHDVH GHFUHDVH ` &URUH `&URUH  .

03 (0. 0.02)  .

$FWXDULDO$VVXPSWLRQV D.32 (0. 0..31) 9.

)LQDQFLDO$VVXPSWLRQV 1    'LVFRXQW5DWH ([SHFWHGUDWHRIUHWXUQRQSODQDVVHWV *UDWXLW\.

([SHFWHGUDWHRIUHWXUQRQSODQDVVHWV 3URYLGHQWIXQG.

) SD(P.31% p.a.) SD(P.90 % p.) 9.a.Y...a.Y.27% p.) )LJXUHVLQLWDOLFVSHUWDLQWRSUHYLRXV\HDU.7. (P.9.a. 6DODU\LQFUHDVHUDWH SD(P.50% p..8.Y.7% p..a.Y.

159 .

1$1&.$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.ACC Limited 127(6727+().

31 (03/2<((%(1().76 FRQWG.

E.

QGLDQ$VVXUHG/LYHV0RUWDOLW\ . 'HPRJUDSKLF$VVXPSWLRQV 1 0RUWDOLW\SUHUHWLUHPHQW .

 0RGLoHG.

8OWLPDWH .QGLDQ$VVXUHG/LYHV0RUWDOLW\ .

 0RGLoHG.

& .8OWLPDWH  0RUWDOLW\SRVWqUHWLUHPHQW 0RUWDOLW\IRUDQQXLWDQWV/.

& .XOWLPDWH 0RUWDOLW\IRUDQQXLWDQWV/.

Y.5% p.a. .)  0HGLFDOSUHPLXPLQpDWLRQ SDIRUWKHoUVW\HDUVDQGWKHUHDIWHUSD SDIRUWKHoUVW\HDUVDQGWKHUHDIWHUSD )LJXUHVLQLWDOLFVSHUWDLQWRSUHYLRXV\HDU.XOWLPDWH  7XUQRYHUUDWH SD(P.

    F.

&. %DVLVXVHGWRGHWHUPLQHH[SHFWHGUDWHRIUHWXUQRQDVVHWV   7KHH[SHFWHGUHWXUQRQSODQDVVHWVLVEDVHGRQPDUNHWH[SHFWDWLRQDWWKHEHJLQQLQJRIWKHSHULRGIRU UHWXUQVRYHUWKHHQWLUHOLIHRIWKHUHODWHGREOLJDWLRQ7KH*UDWXLW\6FKHPHLVLQYHVWHGLQ/LIH.QVXUDQFH &RUSRUDWLRQ /.

QGLD V *URXS *UDWXLW\qFXP/LIH $VVXUDQFH FDVK DFFXPXODWLRQ SROLF\ DQG +')& 6WDQGDUG/LIH V*URXS8QLW/LQNHG3ODQ)RU'HoQHG%HQHoW6FKHPH 7KH7UXVWIRUPHGE\WKH&RPSDQ\PDQDJHVWKHLQYHVWPHQWVRISURYLGHQWIXQGSODQ  G. RI .

00 Crore) WR *UDWXLW\ IXQG DQG `&URUH(Previous Year .` 9.12 Crore)WRWUXVWPDQDJHGSURYLGHQWIXQGLQWKH\HDU I.` 19. 7KH HVWLPDWHV RI IXWXUH VDODU\ LQFUHDVHV FRQVLGHUHG LQ DFWXDULDO YDOXDWLRQ WDNH DFFRXQW RI LQpDWLRQ VHQLRULW\ SURPRWLRQ DQG RWKHU UHOHYDQW IDFWRUV VXFK DV VXSSO\ DQG GHPDQG LQ WKH HPSOR\PHQW PDUNHW e) 7KH &RPSDQ\ H[SHFWV WR FRQWULEXWH `  &URUH (Previous Year .

3RVWHPSOR\PHQWGHoQHGEHQHoWSODQH[SHQVHVDUHLQFOXGHGXQGHUHPSOR\HHEHQHoWH[SHQVHVLQWKH VWDWHPHQWRI3URoWDQG/RVV         J.

 $PRXQWVIRUWKHFXUUHQWDQGSUHYLRXVIRXU\HDUVDUHDVIROORZV L.

 *UDWXLW\ )XQGHG.

`&URUH       .

 .

 .

 .

 .

     6XUSOXV GHoFLW.

 .

 .

 .

 .

 .

([SHULHQFHDGMXVWPHQWVRQSODQDVVHWV  .

 .

 .

 .

 .

     'HoQHGEHQHoWREOLJDWLRQ 3ODQDVVHWV ([SHULHQFHDGMXVWPHQWVRQSODQOLDELOLWLHV LL.

*UDWXLW\ 1RQIXQGHG.

` &URUH       .

 .

 .

 .

 .

      .

 .

 .

 .

 .

([SHULHQFHDGMXVWPHQWVRQSODQDVVHWV 1$ 1$ 1$ 1$ 1$ ([SHULHQFHDGMXVWPHQWVRQSODQOLDELOLWLHV      'HoQHGEHQHoWREOLJDWLRQ 3ODQDVVHWV 6XUSOXV GHoFLW.

 .

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 31 (03/2<((%(1().76 FRQWG.

LLL.

3RVW(PSOR\PHQW0HGLFDO%HQHoWV `&URUH 'HoQHGEHQHoWREOLJDWLRQ 3ODQDVVHWV 6XUSOXV GHoFLW.

([SHULHQFHDGMXVWPHQWVRQSODQDVVHWV ([SHULHQFHDGMXVWPHQWVRQSODQOLDELOLWLHV       .

 .

 .

 .

 .

      .

 .

 .

 .

 .

1$ 1$ 1$ 1$ 1$  .

    LY.

3URYLGHQW)XQG `&URUH  'HoQHGEHQHoWREOLJDWLRQ 3ODQDVVHWV    .

  .

  .

   .

  .

      6XUSOXV GHoFLW.

88   ([SHULHQFHDGMXVWPHQWVRQSODQDVVHWV  .   1.

   .

# ([SHULHQFHDGMXVWPHQWVRQSODQOLDELOLWLHV   .

 .

 .

# 6LQFHWKHUHLVVXUSOXVWKHVDPHKDVQRWEHHQUHFRJQLVHGLQ%DODQFH6KHHWRQO\OLDELOLW\UHFRJQLVHGLQ %DODQFH6KHHW ([SHULHQFHDGMXVWPHQWVLQIRUPDWLRQIRUWKH\HDULVQRWDYDLODEOHKHQFHQRWGLVFORVHG K.

L.89 Crore). $PRXQWUHFRJQLVHGDVDQH[SHQVHXQGHUHPSOR\HHEHQHoWH[SHQVHVLQWKHVWDWHPHQWRI3URoWDQG/RVVLQ UHVSHFWRIRWKHUORQJWHUPEHQHoWVLV`&URUH(Previous Year .` 39.

` 109. 3UHVHQWYDOXHRIFRPSHQVDWHGDEVHQFHVDW\HDUHQGLV`&URUH(Previous Year .22 Crore)'XULQJ WKH\HDUWKH&RPSDQ\KDVFRQWULEXWHG`&URUHWRWKHIXQGDJDLQVWSURYLVLRQIRUFRPSHQVDWHGDEVHQFHV M.

` 9.88 Crore)7KLVVFKHPHLVQRQIXQGHG 161 . 3UHVHQW YDOXH RI /RQJ VHUYLFH DZDUG DQG RWKHU EHQHoW SODQ REOLJDWLRQ DW \HDU HQG LV `  &URUH (Previous Year .

ACC Limited 127(6727+().1$1&.$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.

1(666(*0(176 `&URUH &HPHQW  5(9(18( ([WHUQDOVDOHV 2WKHURSHUDWLQJUHYHQXH .1* 7KH&RPSDQ\KDVGLVFORVHG%XVLQHVV6HJPHQWDVWKHSULPDU\VHJPHQW6HJPHQWVKDYHEHHQLGHQWLoHGWDNLQJLQWR DFFRXQWWKHQDWXUHRIWKHSURGXFWVWKHGLIIHULQJULVNVDQGUHWXUQVWKHRUJDQLVDWLRQVWUXFWXUHDQGLQWHUQDOUHSRUWLQJ V\VWHP7KH&RPSDQ\ VRSHUDWLRQVSUHGRPLQDQWO\UHODWHWRPDQXIDFWXUHRI&HPHQWDQG5HDG\0L[&RQFUHWH7KH H[SRUWWXUQRYHULVQRWVLJQLoFDQWLQWKHFRQWH[WRIWRWDOWXUQRYHURIWKHFRPSDQ\DQGIXUWKHUWKHULVNDQGUHWXUQV DUHQRWVLJQLoFDQWO\GLIIHUHQWIURPWKDWRI.0$5<%86.1)250$7.  6(*0(175(3257.QWHUVHJPHQWVDOHV /HVV(OLPLQDWLRQ 7RWDOUHYHQXH 5(68/7 6HJPHQWUHVXOW           .21$%28735.QGLD$VVXFKWKHUHLVRQO\RQHJHRJUDSKLFDOVHJPHQW .

 .

    5HDG\0L[&RQFUHWH        .

                   .

 .

 .

17 8QDOORFDWHGFRUSRUDWHLQFRPHQHWRII 8QDOORFDWHG H[SHQGLWXUH.55   16. 769.

QWHUHVWDQG'LYLGHQGLQFRPH ([FHSWLRQDOLWHP 5HIHU1RWH. 2SHUDWLQJ3URoW )LQDQFHFRVWV .

7D[H[SHQVHV 3URoWDIWHUWD[ 27+(5.1)250$7.21 6HJPHQWDVVHWV 8QDOORFDWHG&RUSRUDWHDVVHWV 7RWDODVVHWV 7RWDO        .

  .

 .

13  .57 991. 591.

            6HJPHQWOLDELOLWLHV 8QDOORFDWHGFRUSRUDWHOLDELOLWLHV 7RWDOOLDELOLWLHV           &DSLWDOH[SHQGLWXUH LQFOXGLQJFDSLWDO ZRUNLQSURJUHVV.

QFOXGLQJH[FHSWLRQDOLWHP. 'HSUHFLDWLRQDQG$PRUWL]DWLRQ .

2WKHUQRQFDVKH[SHQVHV                   .

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 127(6727+().$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.1$1&.

1*/($6( a) )XWXUHPLQLPXPUHQWDOSD\DEOHVXQGHUQRQFDQFHOODEOHRSHUDWLQJOHDVH L.  23(5$7.

1RWODWHUWKDQRQH\HDU LL.

 /DWHUWKDQRQH\HDUDQGQRWODWHUWKDQoYH\HDUV LLL.

18 98.07 E. /DWHUWKDQoYH\HDUV  `&URUH  `&URUH    29.31 21.

` 133.82 Crore) F. 2SHUDWLQJ OHDVH SD\PHQW UHFRJQLVHG LQ 6WDWHPHQW RI 3URoW DQG /RVV DPRXQWLQJ WR `  &URUH (Previous Year .

 *HQHUDOGHVFULSWLRQRIWKHOHDVLQJDUUDQJHPHQW L.

 /HDVHG $VVHWV *ULQGLQJ IDFLOLW\ &RQFUHWH SXPSV *RGRZQV 7UDQVLW 0L[HU )ODWV 2IoFH SUHPLVHV DQG RWKHUSUHPLVHV LL.

 )XWXUHOHDVHUHQWDOVDUHGHWHUPLQHGRQWKHEDVLVRIDJUHHGWHUPV LLL.

 7KHUH LV QR HVFDODWLRQ FODXVH LQ WKH OHDVH DJUHHPHQW 7KHUH DUH QR UHVWULFWLRQV LPSRVHG E\ OHDVH DUUDQJHPHQWV7KHUHDUHQRVXEOHDVHV LY.

6&/2685( $. $WWKHH[SLU\RIWKHOHDVHWHUPWKH&RPSDQ\KDVDQRSWLRQHLWKHUWRUHWXUQWKHDVVHWRUH[WHQGWKHWHUP E\JLYLQJQRWLFHLQZULWLQJ  5(/$7('3$57<'.

1DPHVRIWKH5HODWHGSDUWLHVZKHUHFRQWUROH[LVWV 1 /DIDUJH+ROFLP/WG )RUPHUO\NQRZQDV+ROFLP/WG.

QYHVWPHQWV/WG  +ROFLP .QGLD.  +ROGHULQG.

3ULYDWH/LPLWHG  %XON&HPHQW&RUSRUDWLRQ .QGLD.

/LPLWHG  $&&0LQHUDO5HVRXUFHV/LPLWHG  /XFN\0LQPDW/LPLWHG  1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG 8 6LQJKDQLD0LQHUDOV3ULYDWH/LPLWHG  2QHLQGLD%6&3ULYDWH/LPLWHG 1DWXUHRI5HODWLRQVKLS 8OWLPDWH+ROGLQJ&RPSDQ\ +ROGLQJ&RPSDQ\RI+ROFLP .QGLD.

3ULYDWH/LPLWHG +ROGLQJ&RPSDQ\ 6XEVLGLDU\&RPSDQ\ 6XEVLGLDU\&RPSDQ\ 6XEVLGLDU\&RPSDQ\ 6XEVLGLDU\&RPSDQ\ 6XEVLGLDU\&RPSDQ\ -RLQWYHQWXUH&RPSDQ\ ZHI$XJXVW.

%.

2WKHUV:LWKZKRPWUDQVDFWLRQVKDYHEHHQWDNHQSODFHGXULQJWKH\HDU D.

1DPHVRIRWKHU5HODWHGSDUWLHV 1DWXUHRI5HODWLRQVKLS 1 $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG $VVRFLDWH&RPSDQ\  $VLDQ&RQFUHWHVDQG&HPHQWV3ULYDWH/LPLWHG $VVRFLDWH&RPSDQ\  $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG $VVRFLDWH&RPSDQ\  /DIDUJH.QGLD3ULYDWH/LPLWHG )HOORZ6XEVLGLDU\ ZHI-XO\.

 $PEXMD&HPHQWV/LPLWHG )HOORZ6XEVLGLDU\  +ROFLP7HFKQRORJ\ 6LQJDSRUH.

3WH/WG )HOORZ6XEVLGLDU\  +ROFLP /DQND.

QGRQHVLD7EN )HOORZ6XEVLGLDU\  +ROFLP6HUYLFHV 6RXWK$VLD./WG )HOORZ6XEVLGLDU\ 8 37+ROFLP.

/LPLWHG )HOORZ6XEVLGLDU\  +ROFLP&HPHQW %DQJODGHVK.

/WG )HOORZ6XEVLGLDU\ 163 .

1$1&.$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.ACC Limited 127(6727+().

11       18      E.

1    1DPHVRIRWKHU5HODWHGSDUWLHV +ROFLP 9LHWQDP.

/WG +ROFLP 0DOD\VLD.

6'1%KG +ROFLP)RXQGDWLRQ +ROFLP3KLOLSSLQHV +ROFLP6HUYLFHV $VLD.

/WG +ROFLP*URXS6HUYLFHV/WG +ROFLP7HFKQRORJ\/WG +ROFLP7UDGLQJ3WH/WG $/-DERU&HPHQW.QGXVWULHV&R 1DWLRQDO&HPHQW)DFWRU\ +ROFLP 5RPDQLD.

6$ +ROFLP$]HUEDLMDQ +ROFLP &DQDGD.

H\0DQDJHPHQW3HUVRQQHO 1DPHRIWKH5HODWHG3DUW\ 0U+DULVK%DGDPL 0U.DXUD 0U6XQLO..1D\DN 0U%XUMRU'1DULPDQ 1DWXUHRI5HODWLRQVKLS )HOORZ6XEVLGLDU\ )HOORZ6XEVLGLDU\ (QWLW\FRQWUROOHGE\/DIDUJH+ROFLP/WG )HOORZ6XEVLGLDU\ )HOORZ6XEVLGLDU\ )HOORZ6XEVLGLDU\ )HOORZ6XEVLGLDU\ )HOORZ6XEVLGLDU\ )HOORZ6XEVLGLDU\ $VVRFLDWH&RPSDQ\RI)HOORZ6XEVLGLDU\ )HOORZ6XEVLGLDU\ )HOORZ6XEVLGLDU\ )HOORZ6XEVLGLDU\ 1DWXUHRI5HODWLRQVKLS &(2 0DQDJLQJ'LUHFWRU ZHIWK$XJXVW..QF .XOGLS.

&(2 0DQDJLQJ'LUHFWRU 8SWRWK$XJXVW.

&KLHI)LQDQFLDO2IoFHU &RPSDQ\6HFUHWDU\ &.

 7UDQVDFWLRQVZLWK6XEVLGLDU\&RPSDQLHV   ` &URUH    ` &URUH         L.

QGLD. 6DOHRI)LQLVKHG*RRGV %XON&HPHQW&RUSRUDWLRQ .

/LPLWHG LL.

5HLPEXUVHPHQWRI([SHQVHV3DLG3D\DEOH %XON&HPHQW&RUSRUDWLRQ .QGLD.

/LPLWHG $&&0LQHUDO5HVRXUFHV/LPLWHG LLL.

QGLD. 5HLPEXUVHPHQWRI([SHQVHV5HFHLYHG5HFHLYDEOH %XON&HPHQW&RUSRUDWLRQ .

/LPLWHG /XFN\0LQPDW/LPLWHG 1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG 6LQJKDQLD0LQHUDOV3ULYDWH/LPLWHG $&&0LQHUDO5HVRXUFHV/LPLWHG             LY.

5HQGHULQJRI6HUYLFHV %XON&HPHQW&RUSRUDWLRQ .QGLD.

/LPLWHG   1.63  Y.

QGLD. 5HFHLYLQJRI6HUYLFHV %XON&HPHQW&RUSRUDWLRQ .

/LPLWHG     YL.

3XUFKDVHRI)L[HGDVVHWV $&&0LQHUDO5HVRXUFHV/LPLWHG     YLL.

QWHU&RUSRUDWH'HSRVLW2WKHUDGYDQFHV $&&0LQHUDO5HVRXUFHV/LPLWHG 6LQJKDQLD0LQHUDOV3ULYDWH/LPLWHG 1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG     5.69    . .QWHUHVWUHFHLYHGRQ.

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 127(6727+().$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.1$1&.

&.

 7UDQVDFWLRQVZLWK6XEVLGLDU\&RPSDQLHV FRQWG.

 ` &URUH    ` &URUH   YLLL.

QWHUHVWRQ6KRUW7HUP/RDQ $&&0LQHUDO5HVRXUFHV/LPLWHG L[. .

91   [. .QYHVWPHQWLQ(TXLW\6KDUHVRI6XEVLGLDU\ $&&0LQHUDO5HVRXUFHV/LPLWHG 1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG    118.

QWHU&RUSRUDWH'HSRVLWV*LYHQ $&&0LQHUDO5HVRXUFHV/LPLWHG 1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG /XFN\0LQPDW/LPLWHG     75.76    [L. .

6KRUW7HUP/RDQ5HFHLYHG $&&0LQHUDO5HVRXUFHV/LPLWHG     [LL.

5HSD\PHQWRI.QWHU&RUSRUDWH'HSRVLWV2WKHUDGYDQFHVJLYHQ $&&0LQHUDO5HVRXUFHV/LPLWHG 1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG /XFN\0LQPDW/LPLWHG         [LLL.

15          [LY.QYHVWPHQWV $&&0LQHUDO5HVRXUFHV/LPLWHG 1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG 15. 3URYLVLRQPDGHIRURWKHUWKDQWHPSRUDU\GLPLQXWLRQLQWKHYDOXHRI QRQFXUUHQW.

*XDUDQWHHJLYHQRQEHKDOIRIVXEVLGLDU\FRPSDQ\ /XFN\0LQPDW/LPLWHG [Y.

*XDUDQWHHJLYHQDVDWWKHHQGRIWKH<HDU /XFN\0LQPDW/LPLWHG     [YL.

18         [YLLL.QWHU&RUSRUDWH'HSRVLWVDVDWWKHHQGRIWKH<HDU /XFN\0LQPDW/LPLWHG 1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG 6LQJKDQLD0LQHUDOV3ULYDWH/LPLWHG      1. .

2XWVWDQGLQJEDODQFHLQFOXGHGLQ7UDGHUHFHLYDEOHV %XON&HPHQW&RUSRUDWLRQ .QGLD.

/LPLWHG 6LQJKDQLD0LQHUDOV3ULYDWH/LPLWHG 1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG         [L[.

2XWVWDQGLQJEDODQFHLQFOXGHGLQ7UDGHSD\DEOHV %XON&HPHQW&RUSRUDWLRQ .QGLD.

/LPLWHG 1.69    [[.

2XWVWDQGLQJEDODQFHLQFOXGHGLQ6KRUWWHUPERUURZLQJV $&&0LQHUDO5HVRXUFHV/LPLWHG         [YLL.

2XWVWDQGLQJEDODQFHLQFOXGHGLQ/RQJWHUPORDQVDQGDGYDQFHV 1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG /XFN\0LQPDW/LPLWHG [[L.

.QWHUHVWDFFUXHGRQERUURZLQJVLQFOXGHGLQ2WKHUFXUUHQWOLDELOLWLHV $&&0LQHUDO5HVRXUFHV/LPLWHG 165 .

$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.1$1&.ACC Limited 127(6727+().

'.

QYHVWPHQWLQ(TXLW\6KDUHVRI-RLQWYHQWXUH 2QHLQGLD%6&3ULYDWH/LPLWHG  ` &URUH    `&URUH    ` &URUH 175. 7UDQVDFWLRQVZLWK-RLQWYHQWXUH&RPSDQ\ .66    ` &URUH    (.

 7UDQVDFWLRQVZLWK$VVRFLDWH&RPSDQLHV 166 L.

3XUFKDVHRI)LQLVKHG*RRGV $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG 5HIHU1RWH.

$DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG LL.

3XUFKDVHRI5DZ0DWHULDOV $VLDQ&RQFUHWHVDQG&HPHQWV3ULYDWH/LPLWHG     LLL.

6DOHRI8QoQLVKHG*RRGV $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG 5HIHU1RWH.

    LY.

6DOHRI)LQLVKHG*RRGV $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG     Y.

86    YL. 'LYLGHQG5HFHLYHG $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG $VLDQ&RQFUHWHVDQG&HPHQWV3ULYDWH/LPLWHG     9.

5HLPEXUVHPHQWRI([SHQVHV5HFHLYHG5HFHLYDEOH $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG    6.87   YLL.

16  YLLL.11 1.11 1. 5HQGHULQJRI6HUYLFHV $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG 1.

5HFHLYLQJRI6HUYLFHV $VLDQ&RQFUHWHVDQG&HPHQWV3ULYDWH/LPLWHG   51.96  L[.

2WKHUUHFRYHULHV 1HW.

$DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG   1.17  [.

99      [L. 2XWVWDQGLQJEDODQFHLQFOXGHGLQ7UDGHUHFHLYDEOHV $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG 13.

2XWVWDQGLQJEDODQFHLQFOXGHGLQ7UDGHSD\DEOHV $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG $VLDQ&RQFUHWHVDQG&HPHQWV3ULYDWH/LPLWHG         .

1$1&.$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 127(6727+().

).

 'HWDLOVRI7UDQVDFWLRQVUHODWLQJWR+ROGLQJ&RPSDQLHV 'LYLGHQGSDLG +ROFLP .QGLD.

37   *.3ULYDWH/LPLWHG +ROGHULQG.QYHVWPHQWV/WG  ` &URUH     `&URUH     ` &URUH     `&URUH       168.

 'HWDLOVRI7UDQVDFWLRQVUHODWLQJWR)HOORZ6XEVLGLDU\&RPSDQLHV L.

3XUFKDVHRI5DZ0DWHULDOV +ROFLP7UDGLQJ3WH/WG $PEXMD&HPHQWV/LPLWHG LL.

3XUFKDVHRI)LQLVKHG8QoQLVKHG*RRGV $PEXMD&HPHQWV/LPLWHG /DIDUJH.QGLD3ULYDWH/LPLWHG LLL.

3XUFKDVHRI6WRUHV 6SDUHSDUWV $PEXMD&HPHQWV/LPLWHG     LY.

6DOHRI)LQLVKHG8QoQLVKHG*RRGV $PEXMD&HPHQWV/LPLWHG /DIDUJH.QGLD3ULYDWH/LPLWHG       Y.

6DOHRI6WRUHV 6SDUHSDUWV $PEXMD&HPHQWV/LPLWHG     YL.

6DOHRI5DZ0DWHULDO $PEXMD&HPHQWV/LPLWHG     YLL.

19      YLLL. 5HQGHULQJRI6HUYLFHV $PEXMD&HPHQWV/LPLWHG 2WKHUV 38.

5HLPEXUVHPHQWRI([SHQVHV3DLG3D\DEOH $PEXMD&HPHQWV/LPLWHG 2WKHUV       L[.

5HLPEXUVHPHQWRI([SHQVHV5HFHLYHG5HFHLYDEOH $PEXMD&HPHQWV/LPLWHG +ROFLP7HFKQRORJ\ 6LQJDSRUH.

3WH/WG +ROFLP /DQND.

/WG +ROFLP 0DOD\VLD.

6'1%KG 2WKHUV             167 .

ACC Limited 127(6727+().1$1&.$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.

*.

 'HWDLOVRI7UDQVDFWLRQVUHODWLQJWR)HOORZ6XEVLGLDU\&RPSDQLHV FRQWG.

[.

5HFHLYLQJRI6HUYLFHV $PEXMD&HPHQWV/LPLWHG +ROFLP*URXS6HUYLFHV/WG +ROFLP6HUYLFHV 6RXWK$VLD.

53      [L./LPLWHG +ROFLP7HFKQRORJ\/WG 2WKHUV  ` &URUH 76.

7HFKQRORJ\DQG.QRZKRZIHHV +ROFLP7HFKQRORJ\/WG     [LL.

2XWVWDQGLQJEDODQFHLQFOXGHGLQ7UDGHUHFHLYDEOHV $PEXMD&HPHQWV/LPLWHG /DIDUJH.QGLD3ULYDWH/LPLWHG +ROFLP /DQND.

/WG 2WKHUV                                ` &URUH    `&URUH    ` &URUH       ` &URUH      [LLL.

2XWVWDQGLQJEDODQFHLQFOXGHGLQ6KRUWWHUPORDQVDQGDGYDQFHV $PEXMD&HPHQWV/LPLWHG [LY.

2XWVWDQGLQJEDODQFHLQFOXGHGLQ7UDGHSD\DEOHV $PEXMD&HPHQWV/LPLWHG +ROFLP7HFKQRORJ\/WG +ROFLP6HUYLFHV 6RXWK$VLD.

76      +./LPLWHG /DIDUJH.QGLD3ULYDWH/LPLWHG +ROFLP*URXS6HUYLFHV/WG +ROFLP7UDGLQJ3WH/WG 2WKHUV  `&URUH 68.

 'HWDLOVRI7UDQVDFWLRQUHODWLQJWR$VVRFLDWH&RPSDQ\RI)HOORZ6XEVLGLDU\ 5HQGHULQJRI6HUYLFHV 1DWLRQDO&HPHQW)DFWRU\ .

H\0DQDJHPHQW3HUVRQQHO L. 'HWDLOVRI7UDQVDFWLRQZLWK.

LL.

DXUD 8SWRWK$XJXVW. 5HPXQHUDWLRQ 0U.XOGLS..

0U+DULVK%DGDPL ZHIWK$XJXVW.

0U6XQLO.DXUD   0U+DULVK%DGDPL   3URYLVLRQ IRU FRQWULEXWLRQ WR JUDWXLW\ IXQG OHDYH HQFDVKPHQW RQ UHWLUHPHQW DQG RWKHU GHoQHG EHQHoWV ZKLFKDUHPDGHEDVHGRQDFWXDULDOYDOXDWLRQRQDQRYHUDOO&RPSDQ\EDVLVDUHQRWLQFOXGHGLQUHPXQHUDWLRQ WRNH\PDQDJHPHQWSHUVRQQHO 168 ..XOGLS.1D\DN 0U%XUMRU'1DULPDQ 2XWVWDQGLQJEDODQFHLQFOXGHGLQ2WKHU&XUUHQW/LDELOLWLHV   0U.

$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.1$1&.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 127(6727+().

 &$3.7$/$1'27+(5&200.70(176 $.

 (VWLPDWHGYDOXHRIFRQWUDFWVLQFDSLWDODFFRXQWUHPDLQLQJ WREHH[HFXWHG  `&URUH  `&URUH   %.

 )RUFRPPLWPHQWVUHODWLQJWROHDVHDUUDQJHPHQWV^5HIHU1RWH D.

` &.

 7KH &RPSDQ\ IURP WLPH WR WLPH SURYLGHV QHHG EDVHG VXSSRUW WR VXEVLGLDULHV WRZDUGV FDSLWDO DQG RWKHU UHTXLUHPHQWV  $.

$%.1*(17/.&217.7.(61273529./.QUHVSHFWRIDERYHPDWWHUVIXWXUHFDVKRXWpRZVLQUHVSHFWRIFRQWLQJHQWOLDELOLWLHVDUHGHWHUPLQDEOHRQO\RQ UHFHLSWRIMXGJPHQWVSHQGLQJDWYDULRXVIRUXPVDXWKRULWLHV E.'(')25  `&URUH  `&URUH 6DOHVWD[   &XVWRPVGHPDQG   &ODLPE\6XSSOLHUV     &ODLPVIRUPLQLQJ/HDVHUHQW   2WKHUV     a) &ODLPVQRWDFNQRZOHGJHGE\WKH&RPSDQ\ /DERXUUHODWHG 727$/ .

QFOXGLQJ *XDUDQWHH JLYHQ RQ EHKDOI RI 6XEVLGLDU\ &RPSDQ\RI`&URUH(Previous Year .QGHPQLW\*XDUDQWHHVJLYHQWR%DQNV)LQDQFLDO.12 Crore)   F. .QVWLWXWLRQV*RYHUQPHQW %RGLHV DQG RWKHUV .` 0.

QYLHZRIWKHGHPDQGEHLQJ OHJDOO\ XQMXVWLoDEOH DQG GXH WR WKH GHFLVLRQ RI WKH 0DGK\D 3UDGHVK +LJK &RXUW GLUHFWO\ RQ WKLV LVVXH WKH &RPSDQ\GRHVQRWH[SHFWDQ\OLDELOLW\LQDERYHPDWWHU 169 . 7KH&RPSDQ\KDGoOHGZULWDSSHDOSHWLWLRQVDJDLQVWWKHRUGHUVQRWLFHVRIYDULRXVDXWKRULWLHVGHPDQGLQJ `&URUH(Previous Year – ` 106.59 Crore)WRZDUGVGHPDQGRIDGGLWLRQDO5R\DOW\RQ/LPHVWRQHEDVHGRQWKH UDWLRRIWRQQHVRI/LPHVWRQHWRWRQQHRI&HPHQWSURGXFHGDWLWVIDFWRULHVLQ&KDWWLVJDUKDQGRQFHPHQW SURGXFHGYLVDYLVFRQVXPSWLRQRIOLPHVWRQHDWLWVIDFWRU\LQ7DPLO1DGX7KH0DGK\D3UDGHVK+LJK&RXUWKDV GHFLGHGWKLVPDWWHULQIDYRXURIWKH&RPSDQ\E\GLUHFWLQJWKH$XWKRULWLHVWRRQO\GHPDQG5R\DOW\EDVHGRQ TXDQWLW\RI/LPHVWRQHDFWXDOO\PLQHGDQGUHFRUGHGWKURXJKVWDWXWRU\GRFXPHQWDWLRQDQGQRWEDVHGRQDQ\UDWLR 7KH &RPSDQ\ KROGV WKH YLHZ WKDW WKH SD\PHQW RI UR\DOW\ RQ OLPHVWRQH LV FRUUHFWO\ PDGH E\ WKH &RPSDQ\ EDVHGRQWKHDFWXDOTXDQWLW\RIOLPHVWRQHH[WUDFWHGDQGIHHOVWKDWVLPLODUUHOLHIFDQDOVREHH[SHFWHGIURP WKH-XGLFLDU\DQGRU$XWKRULWLHVLQWKHFDVHVRI&KDWWLVJDUK 7DPLO1DGX8QLWV.

ACC Limited 127(6727+().$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.1$1&.

 %.

 0DWHULDO'HPDQGVDQGGLVSXWHVFRQVLGHUHGDVkUHPRWHyE\WKH&RPSDQ\ D.

 7KH&RPSDQ\KDGDYDLOHG6DOHV7D[.QFHQWLYHVLQUHVSHFWRILW VQHZ073$3ODQWDW*DJDO *DJDO.

QGXVWULDO3ROLF\7KH&RPSDQ\KDGDFFUXHG6DOHV7D[.QFHQWLYHVDJJUHJDWLQJ`&URUH7KH 6DOHV7D[$XWKRULWLHVKDGLQWURGXFHGFHUWDLQUHVWULFWLYHFRQGLWLRQVDIWHUFRPPLVVLRQLQJRIWKHXQLWVWLSXODWLQJ WKDW LQFHQWLYH LV DYDLODEOH RQO\ IRU LQFUHPHQWDO DPRXQW RYHU WKH EDVH UHYHQXH DQG SURGXFWLRQ RI *DJDO .XQGHUWKH +36WDWH.

LVDQHZXQLWDVGHFLGHGE\WKH+3+LJK&RXUWDQGFRQoUPHGE\WKH6XSUHPH&RXUWZKLOH GHWHUPLQLQJWKHHOLJLELOLW\IRU7UDQVSRUW6XEVLG\7KH'HSDUWPHQWKDGUHFRYHUHG`&URUH 7D[RI`&URUH DQGLQWHUHVWRI`&URUH. 7KH &RPSDQ\ FRQWHQGV WKDW VXFK UHVWULFWLRQV DUH QRW DSSOLFDEOH WR WKHXQLWDV*DJDO.. SULRU WR WKH FRPPLVVLRQLQJ RI *DJDO ..

DQGWKHVDPHLVDFFRXQWHGDVDQDPRXQWUHFRYHUDEOH  7KH+3+LJK&RXUWKDGLQGLVPLVVHGWKH&RPSDQ\ VDSSHDO7KH&RPSDQ\EHOLHYHVWKH+RQ EOH+LJK &RXUW VMXGJPHQWLVEDVHGRQDQHUURQHRXVXQGHUVWDQGLQJRIFHUWDLQIDFWVDQGOHJDOSRVLWLRQVDQGWKDWLWDOVR IDLOHGWRFRQVLGHUFHUWDLQNH\IDFWV7KH&RPSDQ\KDVEHHQDGYLVHGE\OHJDOH[SHUWVWKDWWKHUHLVQRFKDQJHLQ WKHPHULWVRIWKH&RPSDQ\ VFDVH%DVHGRQVXFKDGYLFHWKH&RPSDQ\oOHGD6SHFLDO/HDYH3HWLWLRQEHIRUHWKH +RQ EOH6XSUHPH&RXUWLQZKLFKLVSHQGLQJ E.

 7KH&RPSDQ\ZDVHOLJLEOHIRUFHUWDLQLQFHQWLYHV LQWKHQDWXUHRI2QH7LPH/XPSVXP&DSLWDO6XEVLG\DQG UHIXQG RILQFUHPHQWDO 9$7SDLG.

LQUHVSHFW RILWVLQYHVWPHQW WRZDUGV PRGHUQL]DWLRQ DQGH[SDQVLRQ RIWKH &KDLEDVD &HPHQW 8QLW SXUVXDQW WR FRQoUPDWLRQ UHFHLYHG XQGHU WKH 6WDWH .QGXVWULDO 3ROLF\ RI -KDUNKDQG $FFRUGLQJO\WKHFRPSDQ\KDVPDGHFODLPVIRUUHIXQGRI9$7SDLGHDFKoQDQFLDO\HDU+RZHYHUQRGLVEXUVDOV ZHUHPDGH H[FHSWDQDPRXQWRI`&URUHUHSUHVHQWLQJSDUWRIWKH2QH7LPH/XPSVXPFDSLWDO6XEVLG\&ODLP RI`&URUH.

DVWKHDXWKRULWLHVKDYHUDLVHGYDULRXVQHZFRQGLWLRQVDQGUHVWULFWLRQWKDWZHUHH[WUDQHRXVWR WKHDSSURYDOVDQGFRQoUPDWLRQVH[SUHVVO\UHFHLYHGE\WKH&RPSDQ\7KH&RPSDQ\KDGoOHGWZRZULWDSSHDOV EHIRUHWKH-KDUNKDQG+LJK&RXUWDJDLQVWWKHUHVWULFWLRQVDQGGLVSXWHVRQWKHH[WHQWRIWKHHOLJLEOHFODLPVQRZ EHLQJVRXJKWWREHHIIHFWHGUDLVHGE\WKH*RYHUQPHQW  7KH'LYLVLRQ%HQFKRIWKH-KDUNKDQG+LJK&RXUWZKLOHGHDOLQJZLWKDSSHDOVE\ERWKWKH&RPSDQ\DQGWKH 6WDWHRI*RYHUQPHQWDJDLQVWDVLQJOHEHQFKRUGHURQO\SDUWLDOO\DOORZLQJWKH&RPSDQLHVFODLPLQLW VRUGHU GDWHG)HEUXDU\KDVDOORZHGWKH&RPSDQLHV$SSHDOLQWRWDOLW\ZKLOHGLVPLVVLQJWKH*RYHUQPHQWV $SSHDO WKHUHE\ FRQoUPLQJ WKDW WKH HQWLUH DPRXQW FODLPHG E\ WKH &RPSDQ\ LV FRUUHFW DQG KHQFH SD\DEOH LPPHGLDWHO\ 3XUVXDQW WR WKLV RUGHU DFXPXODWLYHDPRXQWRI`&URUHVWDQGDFFUXHGLQWKHERRNVXSWR 'HFHPEHU  7KH*RYHUQPHQWRI-KDUNKDQGKDVoOHGDQ6/3LQWKH6XSUHPH&RXUWDJDLQVWWKHRUGHURIWKHGLYLVLRQEHQFK ZKLFKKDVEHHQDGPLWWHG.QLWVLQWHULPRUGHUWKH6XSUHPH&RXUWKDGZKLOHQRWVWD\LQJWKH'LYLVLRQ%HQFK 2UGHUKDVRQO\VWD\HGGLVEXUVHPHQWRIRIWKHDPRXQWGXH  7KH&RPSDQ\KDVDOVRSXUVXHGDFRQWHPSWSHWLWLRQoOHGLQWKH+LJK&RXUWRI-KDUNKDQGDJDLQVWQRQGLVEXUVDO RIDPRXQWVGXHE\WKH*RYHUQPHQW&RQVHTXHQWO\DVRIGDWHWKHFRPSDQ\KDVUHFHLYHG`&URUHLQSDUW GLVEXUVHPHQWIURPWKH*RYHUQPHQWRI-KDUNKDQG  7KH&RPSDQ\LVSXUVXLQJWKHPDWWHURIGLVEXUVHPHQWRIIXUWKHUDPRXQWVRXWVWDQGLQJ7KH&RPSDQ\LVRIWKH YLHZDQGDOVRKDVEHHQDGYLVHGWKDWWKHPHULWVDUHVWURQJO\LQLWVIDYRXUDQGLWH[SHFWVWKDWWKH6/3VKDOOEH UHMHFWHGXSKROGLQJWKHRUGHURIWKH'LYLVLRQEHQFKRIWKH-KDUNKDQG+&E\WKH$SH[&RXUW F.

 7KH &RPSDQ\ KDG VHW XS D FDSWLYH SRZHU SODQW C:DGL 7*  .

 LQ WKH \HDU  7KLV SODQW ZDV VROG WR 7DWD3RZHU&R/WGLQWKH\HDUDQGZDVVXEVHTXHQWO\UHSXUFKDVHGIURPLWLQWKH\HDU7KH &RPSDQ\KDGSXUFKDVHGDQRWKHUFDSWLYHSRZHUSODQW :DGL7* VHWXSE\7DWD3RZHU&R/WGLQWKH\HDU .

$RIWKH.QFRPHWD[GHSDUWPHQWKDVGLVSXWHGWKH&RPSDQ\ VFODLPRIGHGXFWLRQ  .QFRPH7D[$FW7KH.LQ%RWKWKHVHSRZHUSODQWVZHUHHOLJLEOHIRUWD[KROLGD\XQGHUWKHSURYLVLRQVRI6HFWLRQ .

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 127(6727+().$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.1$1&.

$RIWKH$FWRQWKHJURXQGWKDWWKHFRQGLWLRQVSUHVFULEHGXQGHUWKHVHFWLRQDUHQRWIXOoOOHG . XQGHU6HFWLRQ.QFDVHRI:DGL7*LQUHVSHFWRIWKHGHPDQGRI`&URUH QHWRISURYLVLRQ.

7$7DQGLQFDVHRI:DGL7*LQUHVSHFWRIWKHGHPDQGRI`&URUHZKLFKZDVVHWDVLGHE\ WKH.7$7WKH'HSDUWPHQWLVLQDSSHDODJDLQVWWKHGHFLVLRQLQIDYRXURIWKH&RPSDQ\7KH&RPSDQ\EHOLHYHV WKDWWKHPHULWVRIWKHFODLPVDUHVWURQJDQGZLOOEHDOORZHG G.WKH&RPSDQ\LVLQDSSHDO EHIRUHWKH.

 2QH RI WKH &RPSDQ\ V &HPHQW PDQXIDFWXULQJ SODQWV ORFDWHG LQ +LPDFKDO 3UDGHVK ZDV HOLJLEOH XQGHU WKH 6WDWH.QGXVWULDO3ROLF\IRUGHIHUUDORILWVVDOHVWD[OLDELOLW\DULVLQJRQVDOHRIFHPHQWPDQXIDFWXUHGLQWKHVDLG SODQW7KH([FLVHDQG7D[DWLRQGHSDUWPHQWRIWKH*RYHUQPHQWRI+LPDFKDO3UDGHVKGLVSXWHGWKHHOLJLELOLW\RI WKHFRPSDQ\WRVXFKGHIHUPHQWRQWKHJURXQGWKDWWKHFRPSDQ\DOVRPDQXIDFWXUHVDQLQWHUPHGLDWHSURGXFW YL]&OLQNHUDULVLQJLQWKHPDQXIDFWXUHRIFHPHQWDQGVXFKLQWHUPHGLDWHSURGXFWZDVLVLQWKHQHJDWLYHOLVW$ GHPDQGRI`&URUHZDVUDLVHG7KH&RPSDQ\oOHGDZULWSHWLWLRQEHIRUH+LJK&RXUWRI+LPDFKDO3UDGHVK DJDLQVWWKHGHPDQG7KHFDVHKDVEHHQDGPLWWHGDQGWKHKHDULQJLVLQSURFHVV7KH&RPSDQ\EHOLHYHVLWVFDVH LVVWURQJDQGWKHGHPDQGVKDOOQRWVXVWDLQXQGHUODZ H.

 7KH&RPSDQ\LVHOLJLEOHIRULQFHQWLYHVIRURQHRILWVFHPHQWSODQWVVLWXDWHGLQ0DKDUDVKWUDXQGHUD3DFNDJH 6FKHPHRI.QFHQWLYHVRIWKH*RYHUQPHQWRI0DKDUDVKWUD7KHVFKHPHLQWHUDOLDLQFOXGHVUHIXQGRIUR\DOW\ SDLGE\WKH&RPSDQ\RQH[WUDFWLRQRUSURFXUHPHQWRIYDULRXVUDZPDWHULDOV 0LQHUDOV.

QGXVWULHVKDVGLVSXWHGWKH&RPSDQ\ VFODLPIRUUHIXQGRIUR\DOW\RQDQHUURQHRXVWHFKQLFDOLQWHUSUHWDWLRQRI WKHVDQFWLRQOHWWHULVVXHGWRWKH&RPSDQ\WKDWRQO\WKHKLJKHURIWKHDPRXQWRI L.7KH'HSDUWPHQWRI .

9$75HIXQGDQG LL.

5R\DOW\ UHIXQGFODLPDPRXQWVHDFK\HDUVKDOOEHFRQVLGHUHG7KH&RPSDQ\PDLQWDLQVWKDWVXFKDQQXDOUHVWULFWLRQLV QRWDSSOLFDEOHDVORQJDVWKHFXPXODWLYHOLPLWRIFODLPGRHVQRWH[FHHGWKHDPRXQWRIHOLJLEOHLQYHVWPHQW7KH &RPSDQ\KDVDFFUXHGDQDPRXQWRI`&URUHWLOO'HFHPEHU `&URUHWLOO'HFHPEHU.

 RQWKLVDFFRXQW7KH&RPSDQ\KDVoOHGDQDSSHDOEHIRUHWKH%RPED\+LJK&RXUWFKDOOHQJLQJWKHVWDQGRIWKH *RYHUQPHQWZKLFKLVDGPLWWHGDQGSHQGLQJ7KH&RPSDQ\EHOLHYHVWKDWWKHPHULWVRIWKHFODLPDUHVWURQJ I.

 &RQVHTXHQW XSRQ WKH 6XSUHPH &RXUW V MXGJHPHQW LQ *RD )RXQGDWLRQ FDVH UHVWULFWLQJ WKH kGHHPHG UHQHZDOySURYLVLRQRIFDSWLYHPLQLQJOHDVHVWRWKHoUVWUHQHZDOSHULRGWKH&RPSDQ\KDGUHFHLYHGGHPDQG IURP 'LVWULFW 0LQLQJ 2IoFHU IRU `  &URUH IRU EHLQJ SHQDOW\ IRU DOOHJHG LOOHJDO PLQLQJ DFWLYLWLHV FDUULHG RXW E\ WKH &RPSDQ\ GXULQJ -DQXDU\  WR 6HSWHPEHU  7KH DIRUHVDLG GHPDQGV ZHUH FKDOOHQJHG E\ WKH&RPSDQ\DQG:ULW3HWLWLRQZLWK+LJK&RXUWRI-KDUNKDQG7KHSHWLWLRQKDVEHHQDGPLWWHGVXEMHFWWRD WRNHQGHSRVLWRI`&URUHZKLFKVKDOOEHUHIXQGDEOHLQFDVHWKHPDWWHULVGHFLGHGLQWKH&RPSDQLHVIDYRXU 7KH&RPSDQ\LVRIWKHFRQVLGHUHGYLHZEDVHGRQOHJDODGYLFHWKDWWKLVGHPDQGGRHVQRWKDYHPHULWDQGVKDOO QRWVWDQGWKHWHVWRIMXGLFLDOVFUXWLQ\FRQVLGHULQJWKDWWKHVDLGPLQLQJOHDVHVSHQGLQJ6WDWH*RYHUQPHQW V DSSURYDOKDYHEHHQDXWRPDWLFDOO\H[WHQGHGXSWR0DUFKE\0LQHVDQG0LQHUDOV 'HYHORSPHQWDQG 5HJXODWLRQ.

 $PHQGPHQW.

QGLD &&. 7KH &RPSHWLWLRQ &RPPLVVLRQ RI .$FWZLWKRXWDQ\UHFRXUVHEHLQJPDGHDYDLODEOHWRWKH6WDWH*RYHUQPHQW 37.

 LQ  KDG LPSRVHG D SHQDOW\ RI `  &URUH IRU DOOHJHG FRQWUDYHQWLRQRIWKHSURYLVLRQVRIWKH&RPSHWLWLRQ$FW WKH$FW.

2QWKH&RPSDQ\ VDSSHDO&RPSHWLWLRQ $SSHOODWH7ULEXQDO &203$7.

IRUIUHVKDGMXGLFDWLRQRIWKHLVVXHVUHODWLQJWRWKHDOOHJHGYLRODWLRQRIUHOHYDQWSURYLVLRQVRIWKH$FW IRUSDVVLQJDIUHVKRUGHU)XUWKHULQWHUPVRIWKHRUGHUWKH&RPSDQ\KDVUHFHLYHGWKHUHIXQGRIGHSRVLWDORQJ ZLWKDFFXPXODWHGLQWHUHVW 171 .DQGUHPLWWHGWKHPDWWHU WRWKH&&.YLGHLWVLQWHULPRUGHUVWD\HGWKHSHQDOW\ZLWKDFRQGLWLRQWRGHSRVLWRIWKH SHQDOW\DPRXQWZKLFKZDVGHSRVLWHG7KHDPRXQWRISHQDOW\ZDVGLVFORVHGDVDFRQWLQJHQWOLDELOLW\LQWKH oQDQFLDOVWDWHPHQWVXSWRWKHSUHYLRXV\HDU  2Q'HFHPEHUWKH&203$7YLGHLWVoQDORUGHUVHWDVLGHWKHRUGHURIWKH&&.

ACC Limited 127(6727+().$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.1$1&.

7KHSULQFLSDODPRXQWDQGWKHLQWHUHVWGXHWKHUHRQUHPDLQLQJXQSDLGWRDQ\ VXSSOLHUDVDWWKHHQGRIHDFKDFFRXQWLQJ\HDU 3ULQFLSDODPRXQWGXHWRPLFURDQGVPDOOHQWHUSULVHV   .6(6'(9(/230(17$&7  `&URUH  `&URUH a./6 2) '8(6 72 0.80 (17(535.&52 60$// $1' 0('. 38.&52 $1' 60$// (17(535.1(' 81'(5 7+( 0.QWHUHVWGXHRQDERYH   E 7KH DPRXQW RI LQWHUHVW SDLG E\ WKH EX\HU LQ WHUPV RI 6HFWLRQ  RI WKH   0LFUR6PDOODQG0HGLXP(QWHUSULVHV'HYHORSPHQW$FWDORQJZLWK WKHDPRXQWVRIWKHSD\PHQWPDGHWRWKHVXSSOLHUEH\RQGWKHDSSRLQWHG GD\GXULQJHDFKDFFRXQWLQJ\HDU F 7KHDPRXQWRILQWHUHVWGXHDQGSD\DEOHIRUWKHSHULRGRIGHOD\LQPDNLQJ   SD\PHQW ZKLFKKDYHEHHQSDLGEXWEH\RQGWKHDSSRLQWHGGD\GXULQJWKH \HDU. '(7$.6(6 $6 '().

I17(5(67.QFRUSRUDWLRQ RZQHUVKLSLQWHUHVW  2QHLQGLD%6&3ULYDWH/LPLWHG .1-2. 7KH DPRXQW RI IXUWKHU LQWHUHVW UHPDLQLQJ GXH DQG SD\DEOH HYHQ LQ WKH VXFFHHGLQJ \HDUV XQWLO VXFK GDWH ZKHQ WKH LQWHUHVW GXHV DV DERYH DUH DFWXDOO\ SDLG WR WKH VPDOO HQWHUSULVH IRU WKH SXUSRVH RI GLVDOORZDQFH DV D GHGXFWLEOH H[SHQGLWXUH XQGHU 6HFWLRQ  RI 0LFUR 6PDOO DQG 0HGLXP (QWHUSULVHV'HYHORSPHQW$FW 7KLVLQIRUPDWLRQKDVEHHQGHWHUPLQHGWRWKHH[WHQWVXFKSDUWLHVKDYHEHHQLGHQWLoHGRQWKHEDVLVRILQIRUPDWLRQ DYDLODEOHZLWKWKH&RPSDQ\ 39.QGLD  3HUFHQWDJHRI RZQHUVKLSLQWHUHVW   7KHFRPSDQ\ VVKDUHRIWKHDVVHWVOLDELOLWLHVLQFRPHDQGH[SHQVHVRIWKHMRLQWO\FRQWUROOHGHQWLW\DUHDVIROORZV   `&URUH `&URUH D. EXW ZLWKRXW DGGLQJ WKH LQWHUHVW VSHFLoHG XQGHU 0LFUR 6PDOO DQG 0HGLXP(QWHUSULVHV'HYHORSPHQW$FW G 7KHDPRXQWRILQWHUHVWDFFUXHGDQGUHPDLQLQJXQSDLGDWWKHHQGRIHDFK   DFFRXQWLQJ\HDU   e.179(1785( 'XULQJWKH\HDUWKH&RPSDQ\VXEVFULEHG(Previous Year – Nil)HTXLW\VKDUHVIRUDWRWDOFRQVLGHUDWLRQRI `&URUH(Previous Year – Nil)LQ2QHLQGLD%6&3ULYDWH/LPLWHGZKLFKLVDMRLQWO\FRQWUROOHGHQWLW\ZLWKDQHTXDO HTXLW\SDUWLFLSDWLRQZLWK$PEXMD&HPHQWV/LPLWHGDIHOORZVXEVLGLDU\&RPSDQ\ZLWKDLPWRSURYLGHEDFNRIoFH VHUYLFHVZLWKUHVSHFWWRURXWLQHSURFHVVHV  7KH&RPSDQ\KDVWKHIROORZLQJLQYHVWPHQWLQDMRLQWO\FRQWUROOHGHQWLW\ 1DPHRIWKHHQWLW\ &RXQWU\RI 3HUFHQWDJHRI .

$VVHWV 2WKHU1RQFXUUHQWDVVHWV   &DVKDQGEDQNEDODQFHV   2WKHUFXUUHQWDVVHWV   E.

/LDELOLWLHV 2WKHUFXUUHQWOLDELOLWLHV   6KRUWWHUPSURYLVLRQV   F.

.QFRPH   G.

([SHQVHV    .

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 127(6727+().$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.1$1&.

 $&&0LQHUDO5HVRXUFHV/LPLWHG $05/.

&8/$562)81+('*(')25(.QUHVSHFWRIRWKHUWKUHHEORFNVDXFWLRQLQJGDWHVKDYHQRW\HWEHHQDQQRXQFHG  3$57.13 CroreLQ1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG.DZKROO\RZQHGVXEVLGLDU\RIWKH&RPSDQ\WKURXJKLWVMRLQWYHQWXUHKDG VHFXUHGGHYHORSPHQWDQGPLQLQJULJKWVIRUIRXUFRDOEORFNVDOORWWHGWR0DGK\D3UDGHVK6WDWH0LQLQJ&RUSRUDWLRQ /WG7KHVHDOORFDWLRQVVWDQGFDQFHOOHGSXUVXDQWWRWKHRUGHURIWKH6XSUHPH&RXUWUXOLQJWKDWDOORFDWLRQRIYDULRXV FRDOEORFNVLQFOXGLQJWKHVHZDVDUELWUDU\DQGLOOHJDO7KH*RYHUQPHQWRI.` 4.32685($6$7%$/$1&(6+((7'$7( 3DUWLFXODUV 7UDGH3D\DEOH DQG2WKHUFXUUHQW OLDELOLWLHV   &XUUHQF\ )RUHLJQFXUUHQF\ ([FKDQJH `&URUH )RUHLJQFXUUHQF\ ([FKDQJH `&URUH LQ&URUH UDWH LQ&URUH UDWH &+)       86'       *%3       (85        'XULQJWKH\HDUWKH&RPSDQ\KDVSURYLGHG`&URUHLQ$&&0LQHUDO5HVRXUFHV/LPLWHG Previous year .QGLDKDVFRPPHQFHGDXFWLRQLQJSURFHVV IRUDOOVXFKEORFNVLQDSKDVHGPDQQHU7KHDXFWLRQLQJIRU%LFKDUSXUEHLQJRQHRIWKHIRXUEORFNVLVFRPSOHWHG ZLWKWKHEORFNEHLQJDZDUGHGWRWKHVXFFHVVIXOELGGHU3XUVXDQWWRDYHVWLQJRUGHULQWKLVUHJDUGSRVVHVVLRQRIWKH FRDOPLQHKDVEHHQKDQGHGRYHUWRWKHVXFFHVVIXOELGGHUZLWKZKLFKWKH&RPSDQ\LVLQGLVFXVVLRQVIRUWUDQVIHURI UHPDLQLQJDVVHWV.*1&855(1&<(.

 /.67.5(0(176.IRUGLPLQXWLRQLQWKHYDOXHRIWKHVHLQYHVWPHQWFRQVLGHULQJ WKHGLPLQXWLRQRWKHUWKDQWHPSRUDU\QDWXUH  .84 Crore)KDVQRWEHHQUHFRJQL]HGDVDSDUWRIWKH7XUQRYHUEXWKDVEHHQDGMXVWHGDJDLQVWFRVW RISXUFKDVHRIFHPHQWVRFRQYHUWHG.216 $1' '.Q WKH SUHYLRXV \HDU C7D[ DGMXVWPHQWV IRU HDUOLHU \HDUV  DJJUHJDWLQJ `  &URUH FRPSULVHV ZULWHEDFN RI SURYLVLRQIRULQFRPHWD[DULVLQJRQFRQFOXVLRQRIDVVHVVPHQWRID\HDUDQGXSRQDFRQVHTXHQWLDOUHYLHZRIWD[ SURYLVLRQVIRUXQDVVHVVHG\HDUV  7KH&RPSDQ\KDVDUUDQJHPHQWV ZLWKIHZWKLUGSDUWLHVZKHUHE\LWVHOOVFOLQNHUWRWKHPDQGSXUFKDVHV&HPHQW PDQXIDFWXUHG E\ WKHP RXW RI VXFK FOLQNHU :KLOH WKH WUDQVDFWLRQV DUH FRQVLGHUHG DV LQGLYLGXDO VDOH  SXUFKDVH WUDQVDFWLRQV IRU GHWHUPLQDWLRQ RI WD[DEOH WXUQRYHU DQG WD[ XQGHU 9$7 ODZV FRQVLGHULQJ WKH DFFRXQWLQJ WUHDWPHQW SUHVFULEHG XQGHU YDULRXV DFFRXQWLQJ JXLGDQFH UHYHQXH IRU VDOH RI VXFK FOLQNHU RI `  &URUH (Previous year .` 22.  '.1* 2%/.6&/2685( 5(48.6&/2685( 38568$17 72 6(%.*$7.

 $1' 6(&7.21  .

 2) 7+( &203$1.(6$&7 1DWXUHRIWKHWUDQVDFWLRQ ORDQV 3XUSRVHIRUZKLFKWKHORDQ  0D[LPXP  0D[LPXP JLYHQLQYHVWPHQWPDGHJXDUDQWHH JXDUDQWHHVHFXULW\LV %DODQFH %DODQFH JLYHQVHFXULW\SURYLGHG.

SURSRVHGWREHXWLOLVHGE\ GXULQJWKH GXULQJWKH WKHUHFLSLHQW <HDU <HDU `&URUH `&URUH ` &URUH ` &URUH D.

 /RDQV DQG $GYDQFHV WR ZKROO\ RZQHG6XEVLGLDULHVq $&&0LQHUDO5HVRXUFHV/LPLWHG 3URMHFW)XQGLQJ     /XFN\0LQPDW/LPLWHG :RUNLQJ&DSLWDO     1DWLRQDO/LPHVWRQH&RPSDQ\ :RUNLQJ&DSLWDO     3ULYDWH/LPLWHG 6LQJKDQLD0LQHUDOV3ULYDWH/LPLWHG :RUNLQJ&DSLWDO     E.

QYHVWPHQWVPDGHDUHJLYHQLQ1RWH  F. 'HWDLOVRI.

12 Crore) IRUWKHSXUSRVHRIUHQHZDORIPLQLQJOHDVH G. *XDUDQWHH JLYHQ RQ EHKDOI RI /XFN\ 0LQPDW /LPLWHG ZKROO\ RZQHG VXEVLGLDU\ FRPSDQ\ RI `  &URUH (Previous Year .` 0.

 7KHORDQHHVKDYHQRWPDGHDQ\LQYHVWPHQWVLQWKHVKDUHVRIWKH&RPSDQ\ 173 .

ACC Limited 127(6727+().1$1&.$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.

3(1'.7$/.3.=$7.212)(.  &$3.785( 'XULQJWKH\HDUWKH&RPSDQ\KDVFDSLWDOL]HGWKHIROORZLQJH[SHQVHVRIUHYHQXHQDWXUHWRWKHFRVWRIo[HGDVVHW FDSLWDOZRUNLQSURJUHVV &:.

6.785(.(6 21$&&58$/%$6.6 5DZ0DWHULDO 6WRUHVDQG6SDUH3DUWV &RDO &DSLWDO*RRGV 727$/  (.1)25(.&RQVHTXHQWO\H[SHQVHVGLVFORVHGXQGHUWKHUHVSHFWLYHQRWHVDUHQHWRIDPRXQWV FDSLWDOL]HGE\WKHFRPSDQ\ 2SHQLQJEDODQFH ([SHQGLWXUHGXULQJFRQVWUXFWLRQIRUSURMHFWV (PSOR\HHEHQHoWVH[SHQVH .QVXUDQFH 5DWHVDQGWD[HV 'HSUHFLDWLRQ 0LVFHOODQHRXVH[SHQVHV 727$/ /HVV&DSLWDOLVHGGXULQJWKH\HDU %DODQFHLQFOXGHGLQFDSLWDOZRUNLQSURJUHVV  `&URUH   `&URUH                   `&URUH       `&URUH       `&URUH       `&URUH       9$/8(2).)%$6.3(1'.032576&$/&8/$7('21&.*1&855(1&.

7HFKQRORJ\DQG.QRZKRZIHHV )HHVIRU7HFKQLFDOVXSSRUWVHUYLFHV &RQVXOWDQWV )HHV 2WKHUV 727$/  .

1$1&.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 127(6727+().$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.

03257('$1'.  9$/8(2).1'.*(12865$:0$7(5.$/66725(6$1'63$5(3$576&21680(' D.

PSRUWHG .QGLJHQRXV E. 5DZ0DWHULDOV .

18          `&URUH     `&URUH     ($51.6. 6WRUHVDQG6SDUH3DUWV .PSRUWHG .&+$1*( 21$&&58$/%$6.1)25(.*1(.QGLJHQRXV  `&URUH %  `&URUH                 11.1*6.

&RQVXOWDQF\6HUYLFHV 2WKHUV 727$/ 51. WR WKH &RPSDQLHV $FW  DQDGGLWLRQDOFKDUJHRI`&URUHEHLQJWKHFDUU\LQJDPRXQWDVRI-DQXDU\RIo[HGDVVHWVZLWKQR UHPDLQLQJXVHIXOOLIH DVUHYLVHG.. RI WKH &RPSDQLHV $FW  EHFRPLQJ DSSOLFDEOH WR WKH &RPSDQ\ ZHI-DQXDU\WKH&RPSDQ\KDVUHYLHZHGDQGZKHUHQHFHVVDU\UHYLVHGHVWLPDWHVRIXVHIXOOLYHVRIo[HG DVVHWV $FFRUGLQJO\ 3XUVXDQW WR WKH WUDQVLWLRQ SURYLVLRQV SUHVFULEHG LQ 6FKHGXOH .. 3XUVXDQW WR SURYLVLRQV RI 6FKHGXOH .

DVRIWKDWGDWHLVUHFRJQL]HGLQWKH6WDWHPHQWRI3URoWDQG/RVVIRUWKH\HDUHQGHG 'HFHPEHUDQGGLVFORVHGDVDQH[FHSWLRQDOLWHP  +DGWKLVFKDQJHLQWKHXVHIXOOLIHRIo[HGDVVHWVQRWEHHQPDGHGHSUHFLDWLRQIRUWKH\HDUHQGHG'HFHPEHU ZRXOGKDYHEHHQORZHUE\`&URUHDQGWKHSURoWDIWHUWD[ZRXOGKDYHEHHQKLJKHUE\`&URUH  &25325$7(62&.%.3(16(6 7KH DJJUHJDWH DPRXQW RI H[SHQGLWXUH LQFXUUHG RQ &RUSRUDWH 6RFLDO 5HVSRQVLELOLW\ DQG VKRZQ LQ WKH UHVSHFWLYH KHDGVRIDFFRXQWLVDVIROORZV 3DUWLFXODUV  `&URUH  `&URUH   0LVFHOODQHRXVH[SHQVHV 5HIHU1RWH.7<(.$/5(63216./.

  727$/   (PSOR\HHEHQHoWVH[SHQVH 5HIHU1RWH.

175 .

ACC Limited 127(6727+().1$1&.$/67$7(0(176IRUWKH\HDUHQGHG'HFHPEHU FRQWG.

1)25(.(6 2QDFFRXQWRIGLYLGHQGWRQRQUHVLGHQWVKDUHKROGHUV D. 5(0. 53.77$1&(6.*1&855(1&.

)LQDO'LYLGHQG 1RRIVKDUHKROGHUV 1RRI(TXLW\6KDUHV $PRXQWUHPLWWHG `&URUH.

<HDUWRZKLFKLWSHUWDLQV E.

QWHULP'LYLGHQG 1RRIVKDUHKROGHUV 1RRI(TXLW\6KDUHV $PRXQWUHPLWWHG `&URUH. .

'(1' 7KHoQDOGLYLGHQGSURSRVHGIRUWKH\HDULVDVIROORZV 2Q(TXLW\6KDUHVRI`HDFK $PRXQWRIGLYLGHQGSURSRVHG `&URUH.9. <HDUWRZKLFKLWSHUWDLQV   1    1    1    1           352326(''.

'LYLGHQGSHU(TXLW\6KDUH `) 55. 7KH&RPSDQ\KDVUHFHLYHGDSSURYDOIURPWKH&RPSDQ\/DZ%RDUGXQGHU6HFWLRQ .

$ &KDLUPDQ './(6+9+$5.&2/6(1 Director '..1 $581.)LUP5HJLVWUDWLRQ1R( '.1 681.$9$5$1$ Director './.9().1 $6+:.RIWKH&RPSDQLHV$FW SHUPLWWLQJWKH&RPSDQ\WRFRQWLQXHKDYLQJVW-DQXDU\VW'HFHPEHUDVLWV)LQDQFLDO<HDU 56.* Director '. &203$5$7.1 SHU5$9. Director '.80$55*$1'+.1 %(51$5'7(59(5 'HSXW\&KDLUPDQ '. &KLHI)LQDQFLDO2IoFHU 6+$.7.%$16$/ Partner 0HPEHUVKLS1R 0XPEDL)HEUXDU\ 176 166(.672)+$66.1'$1.+6$5.0$1 &RPSDQ\6HFUHWDU\ )$/*81.%+$.1 %85-25'1$5.1 (5.+. Director '.6+%$'$0.1$<$5 Director '.1 . )RU65%& &2//3 CEO & Managing Director Chartered Accountants . Director '.&$.1$<$.1 &+5.*85(6 3UHYLRXV \HDU V oJXUHV KDYH EHHQ UHJURXSHG  UHFODVVLoHG ZKHUHYHU QHFHVVDU\ WR FRQIRUP WR FXUUHQW \HDU V FODVVLoFDWLRQ 7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRIWKHoQDQFLDOVWDWHPHQWV $VSHURXUUHSRUWRIHYHQGDWH )RUDQGRQEHKDOIRIWKH%RDUGRI'LUHFWRUVRI$&&/LPLWHG +$5.1 )$552.

2014) Part “A”: Subsidiaries ` Crore Sl. 2015 NA NA NA NA NA Share capital 121.81 - - - 10 3URoW /RVV.71 0.87 0.13 8 Investments - 26. 1 Name of the Subsidiary ACC Mineral Resources Limited 2 Reporting period for the January subsidiary 01.25 2. 2015 3 Reporting currency and Exchange rate as on the last date of the relevant Financial year in the case of foreign subsidiaries 4 BulK Cement Corporation (India) Limited Lucky Minmat Limited National Limestone Company Private Limited Singhania Minerals Private Limited* January 01.70 0.02 5 Reserves and surplus (4. 2015 January 01.76 0. 2015 January 01.95) (0. 2015 January 01.64 3.03 7 Total Liabilities 4.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies Form AOC-1 STATEMENT CONTAINING SALIENT FEATURES OF THE FINANCIALS STATEMENTS OF SUBSIDIARIES. 2015 to December 31. 2015 to December 31.76 0. ASSOCIATES AND JOINT VENTURES. 2015 to December 31. 2015 to December 31.95 1.88 59.36 11.43) 14.06) (0. 2015 to December 31. Particulars No.00 0.30 - - - 9 Turnover - 18.53 (3.12) 6 Total assets 121.95 33. (PURSUANT TO FIRST PROVISO TO SUB SECTION (3) OF SECTION 129 READ WITH RULE 5 OF COMPANIES (ACCOUNTS) RULES.

45) (0.93) - - - 12 3URoW /RVV.24) (0.22) (0.52 (2.04) 11 Tax expenses 0.EHIRUHWD[ 2.94 (8.

31) (0.DIWHUWD[ 2.42 (5.45) (0.22) (0.04) 13 Proposed Dividend - - - - - 14 % of shareholding 100% 94. 177 .65% 100% 100% 100% Notes: *Singhania Minerals Private Limited are yet to commence the operation.

000 4.17 55. 2015 December 31.41 6 3URoW /RVV.QYHVWPHQWLQ$VVRFLDWHV Joint Venture (` Crore) 22. Associates Joint Venture 1DPHRI$VVRFLDWHV-RLQW9HQWXUHV Alcon Cement Company Private Limited Asian Concretes and Cements Private Limited Aakaash Manufacturing Company Private Limited Oneindia BSC Private Limited 1 Latest audited Balance Sheet Date December 31. No.401 25.000 $PRXQWRI. 2015 December 31.001 81.01.ACC Limited Part “B”: Associates and Joint Venture Sl. 2015 December 31.00.01 2.25 36.08.05 7.50 2 Extend of Holding % 40% 45% 40% 50% 3 Description of how there is VLJQLoFDQWLQpXHQFH Note (a) Note (a) Note (a) NA 4 5HDVRQZK\WKHDVVRFLDWHVMRLQW venture is not consolidated - - - - 5 Net worth attributable to shareholding as per latest audited Balance Sheet (` Crore) 10.81 6.55 1. 2015 6KDUHVRI$VVRFLDWHV-RLQW9HQWXUH held by the company on the year end 4.

Considered in Consolidation (` Crore) 3.16 (2.81 1.31 2. Not Considered in Consolidation (` Crore) 4.09) ii.19) i.12 4.25 15.10) 1RWH D.IRUWKH\HDU 8.30 6.95 8.50 (1.66 (1.

7KHUHLVVLJQLoFDQWLQpXHQFHGXHWRSHUFHQWDJH .

HARIBHAKTI Director DIN: 00007347 ASHWIN DANI Director DIN: 00009126 FARROKH K. NAYAK &KLHI)LQDQFLDO2IoFHU SHAILESH V. February 10.SEKHSARIA Chairman DIN: 00276351 BERNARD TERVER Deputy Chairman DIN: 06771125 ARUNKUMAR R GANDHI Director DIN: 00007597 SUNIL K.RIHTXLW\6KDUHFDSLWDO For and on behalf of the Board of Directors of ACC Limited. 2016 178 . HARISH BADAMI CEO & Managing Director DIN: 02298385 N. NARIMAN Company Secretary FALGUNI NAYAR Director DIN: 00003633 ERIC OLSEN Director DIN: 07238383 CHRISTOF HASSIG Director DIN: 01680305 Mumbai. KAVARANA Director DIN: 00027689 BURJOR D.S.

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies INDEPENDENT AUDITOR’S REPORT To the Members of ACC Limited Report on the Consolidated Financial Statements We have audited the accompanying consolidated oQDQFLDOVWDWHPHQWVRI$&&/LPLWHG KHUHLQDIWHUUHIHUUHG WR DV kWKH +ROGLQJ &RPSDQ\y.

 LWV VXEVLGLDULHV WKH +ROGLQJ &RPSDQ\ DQG LWV VXEVLGLDULHV WRJHWKHU UHIHUUHG WR DV kWKH *URXSy.

 LWV DVVRFLDWHV DQG MRLQWO\ FRQWUROOHG HQWLW\FRPSULVLQJRIWKHFRQVROLGDWHG%DODQFH6KHHWDVDW 'HFHPEHUWKHFRQVROLGDWHG6WDWHPHQWRI3URoW DQG /RVV DQG FRQVROLGDWHG &DVK )ORZ 6WDWHPHQW IRU WKH \HDUWKHQHQGHGDQGDVXPPDU\RIVLJQLoFDQWDFFRXQWLQJ SROLFLHV DQG RWKHU H[SODQDWRU\ LQIRUPDWLRQ KHUHLQDIWHU UHIHUUHGWRDVCWKHFRQVROLGDWHGoQDQFLDOVWDWHPHQWV .

 Management’s Responsibility for the Consolidated Financial Statements 7KH+ROGLQJ&RPSDQ\ V%RDUGRI'LUHFWRUVLVUHVSRQVLEOH IRU WKH SUHSDUDWLRQ RI WKHVH FRQVROLGDWHG oQDQFLDO VWDWHPHQWV LQ WHUPV ZLWK WKH UHTXLUHPHQW RI WKH &RPSDQLHV$FW kWKH$FWy.

QGLD LQFOXGLQJ WKH $FFRXQWLQJ 6WDQGDUGV VSHFLoHG XQGHU 6HFWLRQ  RI WKH $FW UHDG ZLWK5XOHRIWKH&RPSDQLHV $FFRXQWV.WKDWJLYHDWUXHDQGIDLU YLHZRIWKHFRQVROLGDWHGoQDQFLDOSRVLWLRQFRQVROLGDWHG oQDQFLDO SHUIRUPDQFH DQG FRQVROLGDWHG FDVK pRZV RI WKH *URXS LQ DFFRUGDQFH ZLWK DFFRXQWLQJ SULQFLSOHV JHQHUDOO\ DFFHSWHG LQ .

5XOHV7KH UHVSHFWLYH %RDUG RI 'LUHFWRUV RI WKH FRPSDQLHV LQFOXGHG LQ WKH *URXS DQG RI LWV DVVRFLDWHV DQG MRLQWO\ FRQWUROOHG HQWLW\ DUH UHVSRQVLEOH IRU PDLQWHQDQFH RI DGHTXDWH DFFRXQWLQJ UHFRUGV LQ DFFRUGDQFH ZLWK WKH SURYLVLRQV RI WKH$FWIRUVDIHJXDUGLQJRIWKHDVVHWVRIWKH*URXSDQGIRU SUHYHQWLQJDQGGHWHFWLQJIUDXGVDQGRWKHULUUHJXODULWLHV WKH VHOHFWLRQ DQG DSSOLFDWLRQ RI DSSURSULDWH DFFRXQWLQJ SROLFLHV PDNLQJ MXGJPHQWV DQG HVWLPDWHV WKDW DUH UHDVRQDEOHDQGSUXGHQWDQGWKHGHVLJQLPSOHPHQWDWLRQ DQG PDLQWHQDQFH RI DGHTXDWH LQWHUQDO oQDQFLDO FRQWURO WKDWZHUHRSHUDWLQJHIIHFWLYHO\IRUHQVXULQJWKHDFFXUDF\ DQG FRPSOHWHQHVV RI WKH DFFRXQWLQJ UHFRUGV UHOHYDQW WR WKH SUHSDUDWLRQ DQG SUHVHQWDWLRQ RI WKH oQDQFLDO VWDWHPHQWVWKDWJLYHDWUXHDQGIDLUYLHZDQGDUHIUHHIURP PDWHULDO PLVVWDWHPHQW ZKHWKHU GXH WR IUDXG RU HUURU ZKLFKKDYHEHHQXVHGIRUWKHSXUSRVHRISUHSDUDWLRQRI WKHFRQVROLGDWHGoQDQFLDOVWDWHPHQWVE\WKH'LUHFWRUVRI WKH+ROGLQJ&RPSDQ\DVDIRUHVDLG Auditor’s Responsibility 2XU UHVSRQVLELOLW\ LV WR H[SUHVV DQ RSLQLRQ RQ WKHVH FRQVROLGDWHG oQDQFLDO VWDWHPHQWV EDVHG RQ RXU DXGLW :KLOHFRQGXFWLQJWKHDXGLWZHKDYHWDNHQLQWRDFFRXQW WKH SURYLVLRQV RI WKH $FW WKH DFFRXQWLQJ DQG DXGLWLQJ VWDQGDUGVDQGPDWWHUVZKLFKDUHUHTXLUHGWREHLQFOXGHG LQ WKH DXGLW UHSRUW XQGHU WKH SURYLVLRQV RI WKH $FW DQG WKH 5XOHV PDGH WKHUHXQGHU :H FRQGXFWHG RXU DXGLW LQ DFFRUGDQFHZLWKWKH6WDQGDUGVRQ$XGLWLQJLVVXHGE\WKH .QVWLWXWH RI &KDUWHUHG $FFRXQWDQWV RI .QGLD DV VSHFLoHG XQGHU6HFWLRQ .

Q PDNLQJ WKRVH ULVN DVVHVVPHQWV WKH DXGLWRU FRQVLGHUV LQWHUQDO oQDQFLDO FRQWURO UHOHYDQW WR WKH +ROGLQJ &RPSDQ\ V SUHSDUDWLRQ RI WKH FRQVROLGDWHG oQDQFLDOVWDWHPHQWVWKDWJLYHDWUXHDQGIDLUYLHZLQRUGHU WR GHVLJQ DXGLW SURFHGXUHV WKDW DUH DSSURSULDWH LQ WKH FLUFXPVWDQFHV EXW QRW IRU WKH SXUSRVH RI H[SUHVVLQJ DQ RSLQLRQRQZKHWKHUWKH+ROGLQJ&RPSDQ\KDVLQSODFHDQ DGHTXDWHLQWHUQDOoQDQFLDOFRQWUROVV\VWHPRYHUoQDQFLDO UHSRUWLQJDQGWKHRSHUDWLQJHIIHFWLYHQHVVRIVXFKFRQWUROV $QDXGLWDOVRLQFOXGHVHYDOXDWLQJWKHDSSURSULDWHQHVVRI DFFRXQWLQJ SROLFLHV XVHG DQG WKH UHDVRQDEOHQHVV RI WKH DFFRXQWLQJ HVWLPDWHV PDGH E\ WKH +ROGLQJ &RPSDQ\ V %RDUG RI 'LUHFWRUV DV ZHOO DV HYDOXDWLQJ WKH RYHUDOO SUHVHQWDWLRQ RI WKH FRQVROLGDWHG oQDQFLDO VWDWHPHQWV :H EHOLHYH WKDW WKH DXGLW HYLGHQFH REWDLQHG E\ XV DQG WKH DXGLW HYLGHQFH REWDLQHG E\ WKH RWKHU DXGLWRUV LQ WHUPV RI WKHLU UHSRUWV UHIHUUHG WR LQ SDUDJUDSK 2WKHU 0DWWHUVEHORZLVVXIoFLHQWDQGDSSURSULDWHWRSURYLGHD EDVLVIRURXUDXGLWRSLQLRQRQWKHFRQVROLGDWHGoQDQFLDO VWDWHPHQWV Opinion .Q RXU RSLQLRQ DQG WR WKH EHVW RI RXU LQIRUPDWLRQ DQG DFFRUGLQJWRWKHH[SODQDWLRQVJLYHQWRXVWKHFRQVROLGDWHG oQDQFLDOVWDWHPHQWVJLYHWKHLQIRUPDWLRQUHTXLUHGE\WKH $FWLQWKHPDQQHUVRUHTXLUHGDQGJLYHDWUXHDQGIDLUYLHZ LQ FRQIRUPLW\ ZLWK WKH DFFRXQWLQJ SULQFLSOHV JHQHUDOO\ DFFHSWHG LQ .RIWKH$FW7KRVH6WDQGDUGVUHTXLUH WKDWZHFRPSO\ZLWKHWKLFDOUHTXLUHPHQWVDQGSODQDQG SHUIRUPWKHDXGLWWRREWDLQUHDVRQDEOHDVVXUDQFHDERXW ZKHWKHUWKHoQDQFLDOVWDWHPHQWVDUHIUHHIURPPDWHULDO PLVVWDWHPHQW $Q DXGLW LQYROYHV SHUIRUPLQJ SURFHGXUHV WR REWDLQ DXGLW HYLGHQFH DERXW WKH DPRXQWV DQG GLVFORVXUHV LQ WKH FRQVROLGDWHG oQDQFLDO VWDWHPHQWV 7KH SURFHGXUHV VHOHFWHG GHSHQG RQ WKH DXGLWRU V MXGJPHQW LQFOXGLQJ WKH DVVHVVPHQW RI WKH ULVNV RI PDWHULDO PLVVWDWHPHQW RI WKH FRQVROLGDWHG oQDQFLDO VWDWHPHQWV ZKHWKHU GXH WR IUDXG RU HUURU .QGLD RI WKH FRQVROLGDWHG VWDWH RI DIIDLUV RI WKH *URXS LWV DVVRFLDWHV DQG MRLQWO\ FRQWUROOHG HQWLW\ DV DW'HFHPEHUWKHLUFRQVROLGDWHGSURoWDQGWKHLU FRQVROLGDWHGFDVKpRZVIRUWKH\HDUHQGHGRQWKDWGDWH Report on Other Legal and Regulatory Requirements  $V UHTXLUHG E\ WKH &RPSDQLHV $XGLWRU V 5HSRUW.

 2UGHU  kWKH 2UGHUy.

QGLD LQ WHUPV RI VXEVHFWLRQ . LVVXHG E\ WKH &HQWUDO *RYHUQPHQW RI .

 RI 6HFWLRQ  RI WKH $FW EDVHG RQ WKH FRPPHQWV LQ WKH DXGLWRU V UHSRUW RI WKH +ROGLQJ FRPSDQ\ LWV VXEVLGLDULHV DVVRFLDWH FRPSDQLHV DQG MRLQWO\ FRQWUROOHGHQWLW\LQFRUSRUDWHGLQ.QGLDWRZKRPWKH 179 .

ACC Limited *URXS LWV DVVRFLDWHV DQG MRLQWO\ FRQWUROOHG HQWLW\q5HIHU1RWHV$ D.

$ F.

%DQG WRWKHFRQVROLGDWHGoQDQFLDOVWDWHPHQWV 2UGHUDSSOLHVZHJLYHLQWKH$QQH[XUHDVWDWHPHQW RQWKHPDWWHUVVSHFLoHGLQSDUDJUDSKVDQGRIWKH 2UGHUWRWKHH[WHQWDSSOLFDEOH  $VUHTXLUHGE\VHFWLRQ .

RIWKH$FWZHUHSRUWWR WKHH[WHQWDSSOLFDEOHWKDW D.

 :HWKHRWKHUDXGLWRUVZKRVHUHSRUWVZHKDYH UHOLHG XSRQ KDYH VRXJKW DQG REWDLQHG DOO WKH LQIRUPDWLRQDQGH[SODQDWLRQVZKLFKWRWKHEHVW RI RXU NQRZOHGJH DQG EHOLHI ZHUH QHFHVVDU\ IRU WKH SXUSRVH RI RXU DXGLW RI WKH DIRUHVDLG FRQVROLGDWHGoQDQFLDOVWDWHPHQWV E.

 .Q RXU RSLQLRQ SURSHU ERRNV RI DFFRXQW DV UHTXLUHG E\ ODZ UHODWLQJ WR SUHSDUDWLRQ RI WKH DIRUHVDLG FRQVROLGDWLRQ RI WKH oQDQFLDO VWDWHPHQWV KDYHEHHQNHSWVRIDUDVLWDSSHDUV IURPRXUH[DPLQDWLRQRIWKRVHERRNVDQGUHSRUWV RIWKHRWKHUDXGLWRUV F.

 7KH FRQVROLGDWHG %DODQFH 6KHHW FRQVROLGDWHG 6WDWHPHQW RI 3URoW DQG /RVV DQG FRQVROLGDWHG &DVK )ORZ 6WDWHPHQW GHDOW ZLWK E\ WKLV 5HSRUW DUH LQ DJUHHPHQW ZLWK WKH ERRNV RI DFFRXQW PDLQWDLQHGIRUWKHSXUSRVHRISUHSDUDWLRQRIWKH FRQVROLGDWHGoQDQFLDOVWDWHPHQWV G.

Q RXU RSLQLRQ WKH DIRUHVDLG FRQVROLGDWHG oQDQFLDOVWDWHPHQWVFRPSO\ZLWKWKH$FFRXQWLQJ 6WDQGDUGVVSHFLoHGXQGHUVHFWLRQRIWKH$FW UHDG ZLWK 5XOH  RI WKH &RPSDQLHV $FFRXQWV. .

 5XOHV H.

QGLDLVGLVTXDOLoHGDV RQ'HFHPEHUIURPEHLQJDSSRLQWHGDV DGLUHFWRULQWHUPVRI6HFWLRQ . 2Q WKH EDVLV RI WKH ZULWWHQ UHSUHVHQWDWLRQV UHFHLYHG IURP WKH GLUHFWRUV RI WKH +ROGLQJ &RPSDQ\ DV RQ 'HFHPEHU   WDNHQ RQ UHFRUGE\WKH%RDUGRI'LUHFWRUVRIWKH+ROGLQJ &RPSDQ\ DQG WKH UHSRUWV RI WKH DXGLWRUV ZKR DUH DSSRLQWHG XQGHU 6HFWLRQ  RI WKH $FW RI LWV VXEVLGLDU\ FRPSDQLHV DVVRFLDWH FRPSDQLHV DQG MRLQWO\ FRQWUROOHG FRPSDQ\ LQFRUSRUDWHG LQ .QGLD QRQH RI WKH GLUHFWRUV RI WKH *URXS V FRPSDQLHV LWV DVVRFLDWHV DQG MRLQWO\ FRQWUROOHG FRPSDQ\LQFRUSRUDWHGLQ.

RIWKH$FW I.

 :LWKUHVSHFWWRWKHRWKHUPDWWHUVWREHLQFOXGHG LQWKH$XGLWRU V5HSRUWLQDFFRUGDQFHZLWK5XOH RIWKH&RPSDQLHV $XGLWDQG$XGLWRUV.

QYHVWRU (GXFDWLRQ DQG 3URWHFWLRQ )XQG E\ WKH +ROGLQJ &RPSDQ\ LWV VXEVLGLDULHV DVVRFLDWHV DQG MRLQWO\ FRQWUROOHG FRPSDQ\ LQFRUSRUDWHGLQ.5XOHV  LQ RXU RSLQLRQ DQG WR WKH EHVW RI RXU LQIRUPDWLRQ DQG DFFRUGLQJ WR WKH H[SODQDWLRQV JLYHQWRXV L 180 7KH FRQVROLGDWHG oQDQFLDO VWDWHPHQWV GLVFORVHGWKHLPSDFWRISHQGLQJOLWLJDWLRQV RQLWVFRQVROLGDWHGoQDQFLDOSRVLWLRQRIWKH LL 7KH *URXS LWV DVVRFLDWHV DQG MRLQWO\ FRQWUROOHGHQWLW\GLGQRWKDYHDQ\PDWHULDO IRUHVHHDEOH ORVVHV LQ ORQJWHUP FRQWUDFWV LQFOXGLQJGHULYDWLYHFRQWUDFWV LLL 7KHUH KDV EHHQ QR GHOD\ LQ WUDQVIHUULQJ DPRXQWV UHTXLUHG WR EH WUDQVIHUUHG WR WKH .QGLD Other Matter 7KH DFFRPSDQ\LQJ FRQVROLGDWHG oQDQFLDO VWDWHPHQWV LQFOXGHWRWDODVVHWVRI`&URUHDVDW'HFHPEHU DQGWRWDOUHYHQXHVDQGQHWFDVKRXWpRZVRI` &URUHDQG` &URUHIRUWKH\HDUHQGHGRQWKDWGDWHLQ UHVSHFW RI oYH VXEVLGLDULHV ZKLFK KDYH EHHQ DXGLWHG E\ RWKHUDXGLWRUVZKRVHoQDQFLDOVWDWHPHQWVRWKHUoQDQFLDO LQIRUPDWLRQ DQG DXGLWRU V UHSRUWV KDYH EHHQ IXUQLVKHG WR XV E\ WKH 0DQDJHPHQW 7KH FRQVROLGDWHG oQDQFLDO VWDWHPHQWVDOVRLQFOXGHWKH&RPSDQ\ VVKDUHRIQHWSURoW RI `  &URUH IRU WKH \HDU HQGHG 'HFHPEHU   DVFRQVLGHUHGLQWKHFRQVROLGDWHGoQDQFLDOVWDWHPHQWVLQ UHVSHFW RI WKUHH DVVRFLDWHV ZKRVH oQDQFLDO VWDWHPHQWV RWKHU oQDQFLDO LQIRUPDWLRQ KDYH EHHQ DXGLWHG E\ RWKHU DXGLWRUV DQG ZKRVH UHSRUWV KDYH EHHQ IXUQLVKHG WR XV E\ WKH 0DQDJHPHQW 2XU RSLQLRQ RQ WKH FRQVROLGDWHG oQDQFLDOVWDWHPHQWVLQVRIDUDVLWUHODWHVWRWKHDPRXQWV DQG GLVFORVXUHV LQFOXGHG LQ UHVSHFW RI WKHVH VXEVLGLDULHV DQGDVVRFLDWHVDQGRXUUHSRUWLQWHUPVRIVXEVHFWLRQV .

 DQG .

&$.RI6HFWLRQRIWKH$FWLQVRIDUDVLWUHODWHVWR WKHDIRUHVDLGVXEVLGLDULHVDQGDVVRFLDWHVLVEDVHGVROHO\ RQWKHUHSRUWVRIVXFKRWKHUDXGLWRUV 2XURSLQLRQRQWKHFRQVROLGDWHGoQDQFLDOVWDWHPHQWVDQG RXU UHSRUW RQ 2WKHU /HJDO DQG 5HJXODWRU\ 5HTXLUHPHQWV DERYHLVQRWPRGLoHGLQUHVSHFWRIWKHDERYHPDWWHUVZLWK UHVSHFWWRRXUUHOLDQFHRQWKHZRUNGRQHDQGWKHUHSRUWV RI WKH RWKHU DXGLWRUV DQG WKH oQDQFLDO VWDWHPHQWV DQG RWKHUoQDQFLDOLQIRUPDWLRQFHUWLoHGE\WKH0DQDJHPHQW For S R B C & CO LLP Chartered Accountants .)LUP5HJLVWUDWLRQ1XPEHU( per RAVI BANSAL Partner 0HPEHUVKLS1XPEHU 3ODFH0XPEDL 'DWH)HEUXDU\ .

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies ANNEXURE TO THE AUDITOR’S REPORT Annexure referred to in paragraph 1 on Report on Other Legal and Regulatory Requirements of our report of even date 5H:LWKUHVSHFWWR$&&/LPLWHG C+ROGLQJ&RPSDQ\ .

DQG LWV VXEVLGLDULHV MRLQWO\ FRQWUROOHG HQWLW\ DQG DVVRFLDWHV LQFRUSRUDWHGLQ.QGLDDQGWRZKRPWKHSURYLVLRQVRIWKH 2UGHUDSSO\ kWKH&RYHUHG(QWLWLHVy.

ZHUHSRUWDVIROORZV L.

 D.

 7KH+ROGLQJ&RPSDQ\DQGWKH&RYHUHG(QWLWLHV KDYH PDLQWDLQHG SURSHU UHFRUGV VKRZLQJ IXOO SDUWLFXODUV LQFOXGLQJ TXDQWLWDWLYH GHWDLOV DQG VLWXDWLRQRIo[HGDVVHWV E.

 $OOo[HGDVVHWVKDYHQRWEHHQSK\VLFDOO\YHULoHG E\WKHPDQDJHPHQWRI+ROGLQJ&RPSDQ\DQGWKH FHUWDLQ&RYHUHG(QWLWLHVGXULQJWKH\HDUEXWWKHUH LVDUHJXODUSURJUDPPHRIYHULoFDWLRQZKLFKLQ RXU RSLQLRQ LV UHDVRQDEOH KDYLQJ UHJDUG WR WKH VL]H RI WKH +ROGLQJ &RPSDQ\ DQG WKH FHUWDLQ &RYHUHG(QWLWLHVDQGWKHQDWXUHRIWKHLUDVVHWV 1RPDWHULDOGLVFUHSDQFLHVZHUHQRWLFHGRQVXFK YHULoFDWLRQ )L[HG DVVHWV KDYH EHHQ SK\VLFDOO\ YHULoHG E\ WKH RWKHU &RYHUHG (QWLWLHV GXULQJ WKH \HDU DQG QR PDWHULDO GLVFUHSDQFLHV ZHUH LGHQWLoHGRQVXFKYHULoFDWLRQDVUHSRUWHGE\WKH UHVSHFWLYH DXGLWRUV ZKR DXGLWHG WKH oQDQFLDO VWDWHPHQWVRIWKHDIRUHVDLGVXEVLGLDULHVMRLQWO\ FRQWUROOHGHQWLW\DQGDVVRFLDWHV LL.

 D.

 7KHPDQDJHPHQWRIWKH+ROGLQJ&RPSDQ\DQG WKH FHUWDLQ &RYHUHG (QWLWLHV KDYH FRQGXFWHG SK\VLFDO YHULoFDWLRQ RI LQYHQWRU\ DW UHDVRQDEOH LQWHUYDOV GXULQJ WKH \HDU %XVLQHVVHV RI RWKHU &RYHUHG (QWLWLHV DV UHSRUWHG E\ WKH UHVSHFWLYH DXGLWRUV ZKR DXGLWHG WKH oQDQFLDO VWDWHPHQWV GRQRWLQYROYHLQYHQWRULHVDQGDFFRUGLQJO\WKH UHTXLUHPHQWVXQGHUSDUDJUDSK LL.

RIWKH2UGHU DUHQRWDSSOLFDEOHWRVXFKHQWLWLHV E.

 7KH SURFHGXUHV RI SK\VLFDO YHULoFDWLRQ RI LQYHQWRU\ IROORZHG E\ WKH PDQDJHPHQW DUH UHDVRQDEOHDQGDGHTXDWHLQUHODWLRQWRWKHVL]H RI WKH +ROGLQJ &RPSDQ\ DQG WKH FRQFHUQHG &RYHUHG (QWLWLHV DQG WKH QDWXUH RI WKHLU EXVLQHVVHV F.

 7KH +ROGLQJ &RPSDQ\ DQG WKH FRQFHUQHG &RYHUHG(QWLWLHVDUHPDLQWDLQLQJSURSHUUHFRUGV RILQYHQWRU\DQGQRPDWHULDOGLVFUHSDQFLHVZHUH QRWLFHGRQSK\VLFDOYHULoFDWLRQ LLL.

 $FFRUGLQJWRWKHLQIRUPDWLRQDQGH[SODQDWLRQVJLYHQ WR XV DQG DV UHSRUWHG E\ WKH RWKHU DXGLWRUV ZKR DXGLWHGWKHoQDQFLDOVWDWHPHQWVRI&RYHUHG(QWLWLHV WKH +ROGLQJ &RPSDQ\ DQG WKH &RYHUHG (QWLWLHV KDYH QRW JUDQWHG DQ\ ORDQV VHFXUHG RU XQVHFXUHG WR FRPSDQLHV oUPV RU RWKHU SDUWLHV FRYHUHG LQ WKH UHJLVWHU PDLQWDLQHG XQGHU VHFWLRQ  RI WKH &RPSDQLHV$FW$FFRUGLQJO\WKHSURYLVLRQVRI FODXVH LLL.

D.

DQG E.

RIWKH2UGHUDUHQRWDSSOLFDEOH WR WKH +ROGLQJ &RPSDQ\ DQG WKH &RYHUHG HQWLWLHV DQGKHQFHQRWFRPPHQWHGXSRQ LY.

 .QRXURSLQLRQDQGDFFRUGLQJWRWKHLQIRUPDWLRQDQG H[SODQDWLRQVJLYHQWRXVDQGDVUHSRUWHGE\WKHRWKHU DXGLWRUV ZKR DXGLWHG WKH oQDQFLDO VWDWHPHQWV RI &RYHUHG(QWLWLHVWKHUHLVDQDGHTXDWHLQWHUQDOFRQWURO V\VWHP FRPPHQVXUDWH ZLWK WKH VL]H RI WKH +ROGLQJ &RPSDQ\DQGWKH&RYHUHG(QWLWLHVDQGWKHQDWXUHRI WKHLU EXVLQHVVHV IRU WKH SXUFKDVH RI LQYHQWRU\ DQG o[HGDVVHWVDQGIRUWKHVDOHRIJRRGVDQGVHUYLFHVWR WKHH[WHQWDSSOLFDEOHWRWKHQDWXUHRIWKHEXVLQHVVRI WKH FRYHUHG HQWLWLHV 'XULQJ WKH FRXUVH RI RXU DXGLW DQG DV UHSRUWHG E\ WKH RWKHU DXGLWRUV ZKR DXGLWHG WKH oQDQFLDO VWDWHPHQWV RI &RYHUHG (QWLWLHV QR PDMRU ZHDNQHVV ZDV REVHUYHG RU FRQWLQXLQJ IDLOXUH WRFRUUHFWDQ\PDMRUZHDNQHVVLQWKHLQWHUQDOFRQWURO V\VWHP RI WKH +ROGLQJ &RPSDQ\ DQG WKH &RYHUHG (QWLWLHVLQUHVSHFWRIWKHVHDUHDV Y.

 7KH+ROGLQJ&RPSDQ\DQGWKH&RYHUHG(QWLWLHVKDYH QRWDFFHSWHGDQ\GHSRVLWVIURPWKHSXEOLF YL.

 :HRWKHUDXGLWRUVKDYHEURDGO\UHYLHZHGWKHERRNV RIDFFRXQWPDLQWDLQHGE\WKH+ROGLQJ&RPSDQ\DQG FHUWDLQ&RYHUHG(QWLWLHVWRWKHH[WHQWDSSOLFDEOHDQG UHOHYDQWSXUVXDQWWRWKHUXOHVPDGHE\WKH&HQWUDO *RYHUQPHQW IRU WKH PDLQWHQDQFH RI FRVW UHFRUGV XQGHU VHFWLRQ  .

 RI WKH &RPSDQLHV $FW  UHODWHGWRWKHPDQXIDFWXUHRI&HPHQWDQG5HDG\0L[ &RQFUHWHDQGDUHRIWKHRSLQLRQWKDWSULPDIDFLHWKH VSHFLoHGDFFRXQWVDQGUHFRUGVKDYHEHHQPDGHDQG PDLQWDLQHG 7KH GHWDLOHG H[DPLQDWLRQ RI WKH VDPH KDYH QRW EHHQ PDGH E\ XV RU VXFK RWKHU DXGLWRUV 7R WKH EHVW RI RXU NQRZOHGJH DQG DV H[SODLQHG DQG DV UHSRUWHG E\ WKH RWKHU DXGLWRUV ZKR DXGLWHG WKH oQDQFLDO VWDWHPHQWV RI RWKHU &RYHUHG (QWLWLHV WKH &HQWUDO *RYHUQPHQW KDV QRW VSHFLoHG WKH PDLQWHQDQFH RI FRVW UHFRUGV XQGHU FODXVH  .

 RI WKH &RPSDQLHV $FW  IRU WKH SURGXFWVVHUYLFHV RIRWKHU&RYHUHG(QWLWLHV 181 .

ACC Limited YLL.

 D.

 7KH +ROGLQJ &RPSDQ\ DQG WKH &RYHUHG (QWLWLHV DUH JHQHUDOO\ EHHQ UHJXODU LQ GHSRVLWLQJ ZLWK DSSURSULDWH DXWKRULWLHV XQGLVSXWHG VWDWXWRU\ GXHV LQFOXGLQJ SURYLGHQW IXQG HPSOR\HHV  VWDWH LQVXUDQFH LQFRPHWD[ VDOHVWD[ZHDOWKWD[VHUYLFHWD[FXVWRPVGXW\H[FLVHGXW\YDOXHDGGHGWD[FHVVDQGRWKHUPDWHULDOVWDWXWRU\ GXHVDVDSSOLFDEOHWRWKHUHVSHFWLYH(QWLWLHV E.

 $FFRUGLQJ WR WKH LQIRUPDWLRQ DQG H[SODQDWLRQV JLYHQ WR XV QR XQGLVSXWHG DPRXQWV SD\DEOH LQ UHVSHFW RI SURYLGHQW IXQG HPSOR\HHV  VWDWH LQVXUDQFH LQFRPHWD[ ZHDOWKWD[ VHUYLFH WD[ VDOHVWD[ FXVWRPV GXW\ H[FLVHGXW\YDOXHDGGHGWD[FHVVDQGRWKHUPDWHULDOVWDWXWRU\GXHVZHUHRXWVWDQGLQJDWWKH\HDUHQGIRUD SHULRGRIPRUHWKDQVL[PRQWKVIURPWKHGDWHWKH\EHFDPHSD\DEOHIRUWKH+ROGLQJ&RPSDQ\DQGWKH&RYHUHG (QWLWLHV  F.

 $FFRUGLQJWRWKHUHFRUGVRIWKH+ROGLQJ&RPSDQ\DQGWKH&RYHUHG(QWLWLHVDQGDVUHSRUWHGE\RWKHUDXGLWRUV ZKR DXGLWHG WKH oQDQFLDO VWDWHPHQWV RI &RYHUHG (QWLWLHV WKH GXHV RXWVWDQGLQJ RI LQFRPHWD[ VDOHVWD[ ZHDOWKWD[VHUYLFHWD[FXVWRPVGXW\H[FLVHGXW\YDOXHDGGHGWD[DQGFHVVRQDFFRXQWRIDQ\GLVSXWHDUHDV IROORZV           `&URUH.

)RUXPZKHUHGLVSXWHLVSHQGLQJ 1DPHRI6WDWXWH 1DWXUHRI'XHV.

3HULRGWRZKLFKWKH &RPPLVVLRQDUDWH $SSHOODWH DPRXQW5HODWHV DXWKRULWLHV  7ULEXQDO High &RXUW 6DOHV7D[ 7D[3HQDOW\ .QWHUHVW.

 &HQWUDO([FLVH$FW 'XW\ 3HQDOW\.QWHUHVW.

6XSUHPH Total &RXUW $PRXQW      WR      6HUYLFH7D[XQGHU)LQDQFH WR $FW 7D[3HQDOW\ .QWHUHVW.

     &XVWRPV'XW\0DWWHUV 'XW\3HQDOW\LQWHUHVW.

      &HVV0DWWHUV WR           TOTAL G.

 $FFRUGLQJWRWKHLQIRUPDWLRQDQGH[SODQDWLRQVJLYHQWRXVWKHDPRXQWUHTXLUHGWREHWUDQVIHUUHGWR.QYHVWRU (GXFDWLRQ DQG 3URWHFWLRQ )XQG LQ DFFRUGDQFH ZLWK WKH UHOHYDQW SURYLVLRQV RI WKH &RPSDQLHV $FW  RI.

QYHVWRU (GXFDWLRQ DQG 3URWHFWLRQ )XQG E\ WKH &RYHUHG (QWLWLHV LQ DFFRUGDQFH ZLWK WKH UHOHYDQW SURYLVLRQV RI WKH &RPSDQLHV$FW RI.DQGUXOHVPDGHWKHUHXQGHUKDVEHHQWUDQVIHUUHGWRVXFKIXQGZLWKLQWLPHWRWKHH[WHQWDSSOLFDEOH WRWKH+ROGLQJ&RPSDQ\$VUHSRUWHGE\WKHRWKHUDXGLWRUZKRDXGLWHGWKH)LQDQFLDO6WDWHPHQWV)LQDQFLDO .QIRUPDWLRQRI&RYHUHG(QWLWLHVWKHUHZHUHQRDPRXQWVZKLFKZHUHUHTXLUHGWREHWUDQVIHUUHGWRWKH.

DQGUXOHVPDGHWKHUHXQGHU YLLL.

7KH+ROGLQJ&RPSDQ\DQGWKHFHUWDLQ&RYHUHG(QWLWLHVKDYHQRDFFXPXODWHGORVVHVDWWKHHQGRIWKHoQDQFLDO\HDU DQGKDYHQRWLQFXUUHGFDVKORVVHVLQWKHFXUUHQWDQGLPPHGLDWHO\SUHFHGLQJoQDQFLDO\HDU7KHDFFXPXODWHGORVVHV RIFHUWDLQ&RYHUHG(QWLWLHVDWWKHHQGRIWKHoQDQFLDO\HDUDUHOHVVWKDQoIW\SHUFHQWRILWVQHWZRUWKDQGLWKDVQRW LQFXUUHGFDVKORVVHVLQWKHFXUUHQWDQGLPPHGLDWHO\SUHFHGLQJoQDQFLDO\HDU7KHDFFXPXODWHGORVVHVRIWKHFHUWDLQ &RYHUHG(QWLWLHVDWWKHHQGRIWKHoQDQFLDO\HDUDUHPRUHWKDQoIW\SHUFHQWRILWVQHWZRUWKDQGKDYHLQFXUUHGFDVK ORVVGXULQJWKH\HDUDQGLQWKHLPPHGLDWHO\SUHFHGLQJoQDQFLDO\HDU$QRWKHU&RYHUHG(QWLW\KDVEHHQUHJLVWHUHG IRUDSHULRGRIOHVVWKDQoYH\HDUVDQGKHQFHZHDUHQRWUHTXLUHGWRFRPPHQWRQZKHWKHURUQRWWKHDFFXPXODWHG ORVVHVDWWKHHQGRIWKHoQDQFLDO\HDULVoIW\SHUFHQWRUPRUHRILWVQHWZRUWKDQGZKHWKHULWKDVLQFXUUHGFDVK ORVVHVLQWKHFXUUHQWoQDQFLDO\HDUDQGLQWKHLPPHGLDWHO\SUHFHGLQJoQDQFLDO\HDU 182 .

Corporate Overview Financial Highlights Board & Management Reports L[.

 $FFRUGLQJ WR WKH LQIRUPDWLRQ DQG H[SODQDWLRQV JLYHQWRXVE\WKHPDQDJHPHQWDQGDVUHSRUWHGE\ WKH UHVSHFWLYH DXGLWRUV ZKR DXGLWHG WKH oQDQFLDO VWDWHPHQWV RI WKH FHUWDLQ &RYHUHG (QWLWLHV WKH +ROGLQJ &RPSDQ\ DQG FHUWDLQ &RYHUHG (QWLWLHV GLG QRWKDYHDQ\RXWVWDQGLQJGXHVLQUHVSHFWRIoQDQFLDO LQVWLWXWLRQ EDQN RU GHEHQWXUH KROGHUV GXULQJ WKH \HDU 2WKHU &RYHUHG (QWLWLHV DV UHSRUWHG E\ RWKHU DXGLWRUV KDYH QRW GHIDXOWHG LQ WKHLU UHSD\PHQW RI GXHV WR D oQDQFLDO LQVWLWXWLRQ EDQN RU GHEHQWXUH KROGHUV [.

 $FFRUGLQJWRWKHLQIRUPDWLRQDQGH[SODQDWLRQVJLYHQ WRXVDQGDVUHSRUWHGE\WKHUHVSHFWLYHDXGLWRUVZKR DXGLWHG WKH oQDQFLDO VWDWHPHQWV RI WKH &RYHUHG (QWLWLHVWKH+ROGLQJ&RPSDQ\DQG&RYHUHG(QWLWLHV KDYH QRW JLYHQ DQ\ JXDUDQWHH IRU ORDQV WDNHQ E\ RWKHUVIURPEDQNRUoQDQFLDOLQVWLWXWLRQVH[FHSWWKDW D &RYHUHG (QWLW\ DV UHSRUWHG E\ RWKHU DXGLWRU ZKR DXGLWHG WKH oQDQFLDO VWDWHPHQWV RI WKH VDLG HQWLW\ KDV JLYHQ DJXDUDQWHHLQUHVSHFWRIDORDQWDNHQE\ RWKHUV IURP D EDQN DQG WKH WHUPV DQG FRQGLWLRQV DUHQRWSULPDIDFLHSUHMXGLFLDOWRWKHLQWHUHVWRIWKH +ROGLQJ&RPSDQ\RUDQ\&RYHUHG(QWLWLHV [L.

 7KH +ROGLQJ &RPSDQ\ DQG WKH FHUWDLQ &RYHUHG (QWLWLHV GLG QRW KDYH DQ\ WHUP ORDQV RXWVWDQGLQJ GXULQJWKH\HDU7HUPORDQVDYDLOHGE\&RYHUHG(QWLW\ DV UHSRUWHG E\ RWKHU DXGLWRUV ZHUH DSSOLHG IRU WKH SXUSRVHIRUZKLFKWKHVDPHZHUHREWDLQHG Financial Statements Subsidiary Companies [LL.

 %DVHG XSRQ WKH DXGLW SURFHGXUHV SHUIRUPHG IRU WKH SXUSRVH RI UHSRUWLQJ WKH WUXH DQG IDLU YLHZ RI WKH FRQVROLGDWHG oQDQFLDO VWDWHPHQWV DQG DV SHU WKH LQIRUPDWLRQ DQG H[SODQDWLRQV JLYHQ E\ WKH PDQDJHPHQW DQG UHSRUWV RI WKH RWKHU DXGLWRUV ZKR DXGLWHG WKH oQDQFLDO VWDWHPHQWV  oQDQFLDO LQIRUPDWLRQ RI &RYHUHG (QWLWLHV ZKLFK ZH KDYH UHOLHGXSRQZHUHSRUWWKDWQRIUDXGE\WKH+ROGLQJ &RPSDQ\ DQG WKH &RYHUHG (QWLWLHV DQG QR PDWHULDO IUDXG RQ WKH +ROGLQJ &RPSDQ\ DQG WKH &RYHUHG (QWLWLHV KDYH EHHQ QRWLFHG RU UHSRUWHG GXULQJ WKH \HDU For S R B C & CO LLP Chartered Accountants .)LUP5HJLVWUDWLRQ1XPEHU( per RAVI BANSAL Partner 0HPEHUVKLS1XPEHU 3ODFH0XPEDL 'DWH)HEUXDU\ 183 .&$.

ACC Limited CONSOLIDATED BALANCE SHEET as at December 31.QWHUHVW 1RQFXUUHQWOLDELOLWLHV 'HIHUUHGWD[OLDELOLWLHV 1HW. 2015 3DUWLFXODUV 1RWH1R 2015 ` Crore  `&URUH EQUITY AND LIABILITIES 6KDUHKROGHUV IXQGV 6KDUHFDSLWDO 5HVHUYHVDQGVXUSOXV   0LQRULW\.

/RQJWHUPSURYLVLRQV                       12.63 &XUUHQWOLDELOLWLHV 7UDGHSD\DEOHV 'XHWR0LFURDQG6PDOO(QWHUSULVHV 'XHWRRWKHUV 2WKHUFXUUHQWOLDELOLWLHV 6KRUWWHUPSURYLVLRQV   TOTAL ASSETS 1RQFXUUHQW assets )L[HG$VVHWV 7DQJLEOHDVVHWV .1 BERNARD TERVER Deputy Chairman '.QWDQJLEOHDVVHWVXQGHUGHYHORSPHQW 1RQFXUUHQWLQYHVWPHQWV /RQJWHUPORDQVDQGDGYDQFHV 2WKHUQRQFXUUHQWDVVHWV    &XUUHQW assets &XUUHQWLQYHVWPHQWV .SEKHSARIA HARISH BADAMI CEO & Managing Director Chairman '.S.1 0XPEDL)HEUXDU\ 184 . KAVARANA Director '.1 ERIC OLSEN Director '. HARIBHAKTI Director '.&$.799.QYHQWRULHV 7UDGHUHFHLYDEOHV &DVKDQGEDQNEDODQFHV 6KRUWWHUPORDQVDQGDGYDQFHV 2WKHUFXUUHQWDVVHWV       TOTAL 6LJQLoFDQWDFFRXQWLQJSROLFLHV    7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRIWKHoQDQFLDOVWDWHPHQWV $VSHURXUUHSRUWRIHYHQGDWH )RUDQGRQEHKDOIRIWKH%RDUGRI'LUHFWRUVRI$&&/LPLWHG For S R B C & CO LLP Chartered Accountants .QWDQJLEOHDVVHWV &DSLWDOZRUNLQSURJUHVV .)LUP5HJLVWUDWLRQ1R( N.1 CHRISTOF HASSIG Director '. NARIMAN Company Secretary FALGUNI NAYAR Director '.1 '.96      12. NAYAK &KLHI)LQDQFLDO2IoFHU SHAILESH V.1 ARUNKUMAR R GANDHI Director '.799.681.681.1 BURJOR D.1 FARROKH K.1 ASHWIN DANI Director '.63                        12.96        12.1 per RAVI BANSAL Partner 0HPEHUVKLS1R SUNIL K.

2015 3DUWLFXODUV 2015 ` Crore 1RWH1R INCOME 5HYHQXHIURPRSHUDWLRQV JURVV.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies CONSOLIDATED STATEMENT OF PROFIT AND LOSS for the year ended December 31.

/HVV([FLVHGXW\ 5HYHQXHIURPRSHUDWLRQV QHW.

QFRPH Total Revenue EXPENSES &RVWRIPDWHULDOVFRQVXPHG 3XUFKDVHRIWUDGHGJRRGV &KDQJHVLQLQYHQWRULHVRIoQLVKHGJRRGV ZRUNLQSURJUHVVDQGVWRFNLQWUDGH (PSOR\HHEHQHoWVH[SHQVH 3RZHUDQGIXHO )UHLJKWDQG)RUZDUGLQJH[SHQVH )LQDQFHFRVWV 'HSUHFLDWLRQDQGDPRUWL]DWLRQH[SHQVH 2WKHUH[SHQVHV                . 2WKHU.

         .

10.986.96         .

875.54  1.98  765.53 1.119. 10.119.54  .88 929.

55   587. 575.60  .

 .

 1.67   .150.

161. 1.82         6HOI&RQVXPSWLRQRI&HPHQW QHWRI([FLVH'XW\.

Total Expenses 3URoWEHIRUHH[FHSWLRQDOLWHPDQGWD[ ([FHSWLRQDOLWHP 5HIHU1RWH.

3URoWEHIRUHWD[ 7D[H[SHQVHV &XUUHQWWD[ 7D[DGMXVWPHQWVIRUHDUOLHU\HDUV 5HIHU1RWH.

'HIHUUHGWD[ 3URoWDIWHU7D[ 6KDUHRI3URoWLQ$VVRFLDWHV 6KDUHRI SURoW.

` 10 each)} %DVLF Diluted 6LJQLoFDQWDFFRXQWLQJSROLFLHV  `&URUH 11.94  .916./RVVDWWULEXWDEOHWR0LQRULW\.QWHUHVW 3URoWIRUWKH\HDU (DUQLQJVSHUHTXLW\VKDUH ^ )DFHYDOXHRI`HDFK(Previous Year .

1 ASHWIN DANI Director '.1 N.1 FARROKH K.1 ARUNKUMAR R GANDHI Director '.42  ` `  7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRIWKHoQDQFLDOVWDWHPHQWV $VSHURXUUHSRUWRIHYHQGDWH )RUDQGRQEHKDOIRIWKH%RDUGRI'LUHFWRUVRI$&&/LPLWHG For S R B C & CO LLP Chartered Accountants .1 CHRISTOF HASSIG Director '.1 per RAVI BANSAL Partner 0HPEHUVKLS1R SUNIL K.1 BURJOR D. NARIMAN Company Secretary FALGUNI NAYAR Director '.1 ERIC OLSEN Director '.995.1 0XPEDL)HEUXDU\ 185 .&$.)LUP5HJLVWUDWLRQ1R( HARISH BADAMI CEO & Managing Director '. NAYAK &KLHI)LQDQFLDO2IoFHU SHAILESH V.S.SEKHSARIA Chairman '. KAVARANA Director '. HARIBHAKTI Director '.1 BERNARD TERVER Deputy Chairman '.       11.

ACC Limited CONSOLIDATED CASH FLOW STATEMENT for the year ended December 31. 2015 3DUWLFXODUV 2015 ` Crore  `&URUH       $ &DVKpRZIURPRSHUDWLQJDFWLYLWLHV 1HW3URoWEHIRUH7D[ $GMXVWPHQWVIRU 'HSUHFLDWLRQDQG$PRUWLVDWLRQH[SHQVHV LQFOXGLQJ([FHSWLRQDOLWHP.

/RVV 3URoW.

RQVDOHZULWHRIIRIo[HGDVVHWV 1HW.

QYHVWPHQWZULWWHQRII   *DLQRQVDOHRIFXUUHQWLQYHVWPHQWV  . 1RQFXUUHQW.

 .

QWHUHVWLQFRPH  . .

 .

)LQDQFHFRVWV   3URYLVLRQIRUGRXEWIXOGHEWVDQGDGYDQFHV 1HW.

  %DGGHEWVZULWWHQRII   3URYLVLRQIRUVORZDQGQRQPRYLQJ6WRUHV 6SDUHSDUWV    .

 .

3URYLVLRQQRORQJHUUHTXLUHGZULWWHQEDFN &DSLWDOVSDUHVFRQVXPHG   8QUHDOLVHGH[FKDQJH JDLQ.

ORVV 1HW.

 .

 .

0LVFHOODQHRXVH[SHQGLWXUHZULWWHQRII 2SHUDWLQJSURoWEHIRUHZRUNLQJFDSLWDOFKDQJHV      .

 .

  .

  &KDQJHVLQ:RUNLQJ&DSLWDO $GMXVWPHQWVIRU'HFUHDVH .QFUHDVH.

QFUHDVH.LQRSHUDWLQJDVVHWV 'HFUHDVH .

QFUHDVH.LQ7UDGHUHFHLYDEOHORDQV DGYDQFHVDQGRWKHUDVVHWV 'HFUHDVH .

QYHQWRULHV $GMXVWPHQWVIRU.LQ.QFUHDVH 'HFUHDVH.

LQRSHUDWLQJOLDELOLWLHV .QFUHDVH 'HFUHDVH.

LQ7UDGHSD\DEOHV2WKHUOLDELOLWLHVDQG3URYLVLRQV &DVKJHQHUDWHGIURPRSHUDWLRQV   'LUHFWWD[SDLG 1HWRIUHIXQGV.

 .

 .

QFOXGLQJ&DSLWDOZRUNLQSURJUHVV DQG&DSLWDO$GYDQFHV.18 B.352. &DVKpRZIURPLQYHVWLQJDFWLYLWLHV /RDQVWR-RLQW9HQWXUHV 3XUFKDVHRI)L[HG$VVHWV .456.62 1. 1HW&DVKpRZIURPRSHUDWLQJDFWLYLWLHV 1.

3URFHHGVIURPVDOHRI)L[HG$VVHWV 3URFHHGIURPVDOHRIFXUUHQWLQYHVWPHQWV 5HGHPSWLRQ LQYHVWPHQW.

LQEDQNGHSRVLWV KDYLQJRULJLQDOPDWXULW\IRUPRUHWKDQPRQWKV.

'LYLGHQGUHFHLYHGIURP$VVRFLDWHV .QWHUHVWUHFHLYHG Net cash used in investing activities 186  .

  .

 .

 .

      .

    (904.72) .05) (1.456.

2015 (contd.) 3DUWLFXODUV 2015 ` Crore  `&URUH  .Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies CONSOLIDATED CASH FLOW STATEMENT for the year ended December 31.

 .

& &DVKpRZIURPoQDQFLQJDFWLYLWLHV .QWHUHVW3DLG 5HSD\PHQWRI/RQJWHUPERUURZLQJV   .

Dividend paid  .

 .

'LYLGHQG'LVWULEXWLRQ7D[SDLG  .

 .

63) &DVKDQGFDVKHTXLYDOHQWVDWWKHEHJLQQLQJRIWKH\HDU   &DVKDQGFDVKHTXLYDOHQWVDWWKHHQGRIWKH\HDU     &RPSRQHQWVRIFDVKDQGFDVKHTXLYDOHQWV &DVKRQKDQG %DODQFHZLWKEDQNV 2QFXUUHQWDFFRXQWV   On deposit account     (DUPDUNHGIRUVSHFLoFSXUSRVH 5HIHU1RWH .28) (837.09) Net increase / (decrease) in cash and cash equivalents (163. 1HWFDVKXVHGLQoQDQFLQJDFWLYLWLHV (716.71) (941.

EHORZ.

&DVKDQGFDVKHTXLYDOHQWV 5HIHU1RWH.

  $GG.QYHVWPHQWLQ0XWXDO)XQGV 5HIHU1RWH.

  $GG.QYHVWPHQWLQ&HUWLoFDWHRI'HSRVLWV 5HIHU1RWH.

  $GG'HSRVLWZLWK+')&/LPLWHG 5HIHU1RWH.

417.   &DVKDQG&DVKHTXLYDOHQWVLQFDVKpRZVWDWHPHQW 1.55 1.581.26 6LJQLoFDQWDFFRXQWLQJSROLFLHV 5HIHU1RWH.

1RWH  7KHVHEDODQFHVDUHQRWDYDLODEOHIRUXVHE\WKH&RPSDQ\DVWKH\UHSUHVHQWXQSDLGGLYLGHQGOLDELOLWLHV  7KHDERYH&DVK)ORZ6WDWHPHQWKDVEHHQSUHSDUHGXQGHUWKHk.QGLUHFW0HWKRGyDVVHWRXWLQWKH$FFRXQWLQJ6WDQGDUG $6.

1 BURJOR D.)LUP5HJLVWUDWLRQ1R( HARISH BADAMI CEO & Managing Director '.1 FARROKH K.1 ASHWIN DANI Director '.S. NAYAK &KLHI)LQDQFLDO2IoFHU SHAILESH V.RQ&DVK)ORZ6WDWHPHQW 7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRIWKHoQDQFLDOVWDWHPHQWV $VSHURXUUHSRUWRIHYHQGDWH )RUDQGRQEHKDOIRIWKH%RDUGRI'LUHFWRUVRI$&&/LPLWHG For S R B C & CO LLP Chartered Accountants . HARIBHAKTI Director '.1 CHRISTOF HASSIG Director '.&$.1 0XPEDL)HEUXDU\ 187 .SEKHSARIA Chairman '.1 BERNARD TERVER Deputy Chairman '. NARIMAN Company Secretary FALGUNI NAYAR Director '.1 N.1 ARUNKUMAR R GANDHI Director '.1 per RAVI BANSAL Partner 0HPEHUVKLS1R SUNIL K.1 ERIC OLSEN Director '. KAVARANA Director '.

COMPANY OVERVIEW $&&/LPLWHG WKH&RPSDQ\.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31. 2015 1.

SIGNIFICANT ACCOUNTING POLICIES (i) Basis of preparation D.QGLDXQGHUWKHSURYLVLRQRI&RPSDQLHV $FW.LVDSXEOLFOLPLWHGFRPSDQ\LQFRUSRUDWHGLQ.WVVKDUHVDUHOLVWHGRQWZRVWRFNH[FKDQJHVLQ.QGLD7KH&RPSDQ\LVHQJDJHGLQWKHPDQXIDFWXULQJ DQGVHOOLQJRI&HPHQWDQG5HDG\0L[&RQFUHWH7KH&RPSDQ\FDWHUVPDLQO\WRWKHGRPHVWLFPDUNHW 2.

7KH oQDQFLDO VWDWHPHQWV RI $&& /LPLWHG WKH &RPSDQ\.

 LWV VXEVLGLDULHV WRJHWKHU kWKH *URXSy.

 DVVRFLDWHV DQG LWV MRLQWO\ FRQWUROOHG HQWLW\ KDYH EHHQ SUHSDUHG LQ DFFRUGDQFH ZLWK WKH JHQHUDOO\ DFFHSWHGDFFRXQWLQJSULQFLSOHVLQ.QGLD .QGLDQ*$$3.

7KH&RPSDQ\KDVSUHSDUHGWKHVHoQDQFLDO VWDWHPHQWVWRFRPSO\LQDOOPDWHULDOUHVSHFWVZLWKWKHDFFRXQWLQJVWDQGDUGVQRWLoHGXQGHU6HFWLRQ RIWKH&RPSDQLHV$FW kWKH$FWy.

UHDGWRJHWKHUZLWK5XOHRIWKH&RPSDQLHV $FFRXQWV.

 5XOHV7KHoQDQFLDOVWDWHPHQWVKDYHEHHQSUHSDUHGRQDQDFFUXDOEDVLVDQGXQGHUWKHKLVWRULFDO FRVWFRQYHQWLRQ     E.

7KH DFFRXQWLQJ SROLFLHV DGRSWHG LQ WKH SUHSDUDWLRQ RI oQDQFLDO VWDWHPHQWV DUH FRQVLVWHQW ZLWK WKRVHRISUHYLRXV\HDU (ii) Principles of Consolidation D.

7KH &RQVROLGDWHG )LQDQFLDO 6WDWHPHQWV FRPSULVH WKH oQDQFLDO VWDWHPHQWV RI $&& /LPLWHG WKH &RPSDQ\.

LWVVXEVLGLDULHVDVVRFLDWHVDQGMRLQWYHQWXUH5HIHUHQFHLQWKHVHQRWHVWRCWKH&RPSDQ\  RUC$&& VKDOOPHDQWRLQFOXGH$&&/LPLWHGDQGRUDQ\RILWVVXEVLGLDULHVDVVRFLDWHVMRLQWYHQWXUH FRQVROLGDWHGLQWKHVHoQDQFLDOVWDWHPHQWVXQOHVVRWKHUZLVHVWDWHG E.

QGLD. 7KH OLVW RI &RPSDQLHV ZKLFK DUH LQFOXGHG LQ FRQVROLGDWLRQ DQG WKH 3DUHQW &RPSDQ\ V KROGLQJV WKHUHLQDUHDVXQGHU Name of the Company a)      Subsidiaries %XON&HPHQW&RUSRUDWLRQ .

/LPLWHG %&&.

$&&0LQHUDO5HVRXUFHV/LPLWHG /XFN\0LQPDW/LPLWHG 1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG 6LQJKDQLD0LQHUDOV3ULYDWH/LPLWHG b)    c)  Percentage Holding 2014 2015           Associates $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG $VLDQ&RQFUHWHVDQG&HPHQWV3ULYDWH/LPLWHG $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG       Joint Venture 2QHLQGLD%6&3ULYDWH/LPLWHG   d) Joint Ventures of ACC Mineral Resources Limited  03$05/ 6HPDULD.

&RDO&RPSDQ\/LPLWHG    03$05/ %LFKDUSXU.

&RDO&RPSDQ\/LPLWHG    03$05/ 0DUNL%DUND.

&RDO&RPSDQ\/LPLWHG    03$05/ 0RUJD.

&RDO&RPSDQ\/LPLWHG   Notes :  (DFKRIWKHDERYH&RPSDQLHVLVLQFRUSRUDWHGLQ.QGLD oQDQFLDOVVWDWHPHQWVDUHGUDZQXSWR WKHVDPHUHSRUWLQJGDWHDVWKDWRIWKHSDUHQW&RPSDQ\LH'HFHPEHU  2QHLQGLD%6&3ULYDWH/LPLWHGLQFRUSRUDWHGRQ$XJXVW 188 .

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.) F. 2015 (contd.

7KH &RQVROLGDWHG )LQDQFLDO 6WDWHPHQWV RI WKH &RPSDQ\ DQG LWV 6XEVLGLDU\ &RPSDQLHV KDYH EHHQ SUHSDUHG LQ DFFRUGDQFH ZLWK WKH $FFRXQWLQJ 6WDQGDUG  $6.

 k&RQVROLGDWHG )LQDQFLDO 6WDWHPHQWVy RQ D OLQHE\OLQH EDVLV E\ DGGLQJ WRJHWKHU WKH ERRN YDOXH RI OLNH LWHPV RI DVVHWV OLDELOLWLHVLQFRPHDQGH[SHQVHV7KHLQWUDJURXSEDODQFHVLQWUDJURXSWUDQVDFWLRQVDQGXQUHDOLVHG SURoWVRUORVVHVDUHIXOO\HOLPLQDWHG       G.

7KH&RQVROLGDWHG)LQDQFLDO6WDWHPHQWVKDYHEHHQSUHSDUHGXVLQJXQLIRUPDFFRXQWLQJSROLFLHVIRU OLNHWUDQVDFWLRQVDQGRWKHUHYHQWVLQVLPLODUFLUFXPVWDQFHVDQGDUHSUHVHQWHGWRWKHH[WHQWSRVVLEOH LQWKHVDPHPDQQHUDVWKH&RPSDQ\ VVHSDUDWHoQDQFLDOVWDWHPHQWV H.

7KHH[FHVVRIFRVWWRWKH&RPSDQ\RILWVLQYHVWPHQWLQWKHVXEVLGLDULHV-RLQWO\&RQWUROOHG(QWLW\ RQWKHDFTXLVLWLRQGDWHVRYHUDQGDERYHWKH&RPSDQ\ VVKDUHRIHTXLW\LQWKHVXEVLGLDULHV-RLQWO\ &RQWUROOHG(QWLW\LVUHFRJQLVHGLQWKH&RQVROLGDWHG)LQDQFLDO6WDWHPHQWVDV*RRGZLOO2QWKHRWKHU KDQG ZKHUH WKH VKDUH RI HTXLW\ LQ WKH VXEVLGLDULHV  -RLQWO\ &RQWUROOHG (QWLW\ DV RQ WKH GDWH RI LQYHVWPHQWLVLQH[FHVVRIFRVWRILQYHVWPHQWVRIWKH&RPSDQ\LWLVUHFRJQLVHGDVk&DSLWDO5HVHUYHy DQG VKRZQ XQGHU WKH KHDG k5HVHUYHV DQG 6XUSOXVy LQ WKH &RQVROLGDWHG )LQDQFLDO 6WDWHPHQWV *RRGZLOOLVDPRUWLVHGRYHUDSHULRGRIWHQ\HDUVIURPWKHGDWHRIDFTXLVLWLRQLQYHVWPHQW I.

QWHUHVWLQWKHQHWDVVHWVRIFRQVROLGDWHGVXEVLGLDULHVLVLGHQWLoHGDQGSUHVHQWHGLQWKH FRQVROLGDWHG%DODQFH6KHHWVHSDUDWHO\IURPOLDELOLWLHVDQGHTXLW\RIWKH&RPSDQ\ VVKDUHKROGHUV 0LQRULW\LQWHUHVWLQWKHQHWDVVHWVRIFRQVROLGDWHGVXEVLGLDULHVFRQVLVWVRI D. 0LQRULW\.

 7KHDPRXQWRIHTXLW\DWWULEXWDEOHWRPLQRULW\DWWKHGDWHRQZKLFKLQYHVWPHQWLQD VXEVLGLDU\LVPDGHDQG E.

 7KHPLQRULW\VKDUHRIPRYHPHQWVLQHTXLW\VLQFHWKHGDWHSDUHQWVXEVLGLDU\UHODWLRQVKLSFDPH LQWRH[LVWHQFH J.

I WKH VXEVLGLDULHV VXEVHTXHQWO\UHSRUWVSURoWDOOVXFKSURoWVDUHDOORFDWHGWRWKHPDMRULW\LQWHUHVWXQWLOWKHPLQRULW\ V VKDUHRIORVVHVSUHYLRXVO\DEVRUEHGE\WKHPDMRULW\KDVEHHQUHFRYHUHG K. 0LQRULW\LQWHUHVW VVKDUHRI1HW3URoW/RVVIRUWKH\HDURIFRQVROLGDWHGVXEVLGLDULHVLVLGHQWLoHG DQGSUHVHQWHGVHSDUDWHO\7KHORVVHVDSSOLFDEOHWRWKHPLQRULW\LQH[FHVVRIWKHPLQRULW\LQWHUHVW LQWKHHTXLW\RIWKHVXEVLGLDU\DUHDGMXVWHGDJDLQVWWKHPDMRULW\LQWHUHVWH[FHSWWRWKHH[WHQWWKDW WKH PLQRULW\ KDV D ELQGLQJ REOLJDWLRQ WR DQG LV DEOH WR PDNH JRRG WKH ORVVHV .

QYHVWPHQWV LQ $VVRFLDWHV LQ &RQVROLGDWHG oQDQFLDO 6WDWHPHQWVy QRWLoHG XQGHU 6HFWLRQRIWKH&RPSDQLHV$FWUHDGWRJHWKHUZLWK5XOHRIWKH&RPSDQLHV $FFRXQWV. .QYHVWPHQW LQ DVVRFLDWHV ZKHUH WKH &RPSDQ\ GLUHFWO\ RU LQGLUHFWO\ WKURXJK VXEVLGLDULHV KROGV VLJQLoFDQW LQpXHQFH DUH DFFRXQWHG IRU XVLQJ HTXLW\ PHWKRG DV SHU $FFRXQWLQJ 6WDQGDUG  q k$FFRXQWLQJ IRU .

 5XOHV$FFRUGLQJO\WKHVKDUHRISURoWORVVRIWKHDVVRFLDWHFRPSDQ\ WKHORVVEHLQJUHVWULFWHG WRWKHFRVWRILQYHVWPHQW.

KDVEHHQDGGHGWRGHGXFWHGIURPWKHFRVWRILQYHVWPHQWV L.

7KHH[FHVVRIFRVWWRWKH&RPSDQ\RILWVLQYHVWPHQWLQWKHDVVRFLDWHVRQWKHDFTXLVLWLRQGDWHVRYHU DQGDERYHWKH&RPSDQ\ VVKDUHRIQHWDVVHWVLQWKHDVVRFLDWHGHVFULEHGDVJRRGZLOO2QWKHRWKHU KDQG ZKHUH WKH VKDUH RI QHW DVVHW LQ WKH DVVRFLDWH DV RQ WKH GDWH RI LQYHVWPHQW LV LQ H[FHVV RI FRVWRILQYHVWPHQWVRIWKH&RPSDQ\LWLVGHVFULEHGDV&DSLWDO5HVHUYHDQGLQFOXGHGLQWKHFDUU\LQJ DPRXQWRILQYHVWPHQWZLWKVHSDUDWHGLVFORVXUHLQWKH&RQVROLGDWHG)LQDQFLDO6WDWHPHQWV*RRGZLOO LVDPRUWLVHGRYHUDSHULRGRIWHQ\HDUVIURPWKHGDWHRIDFTXLVLWLRQLQYHVWPHQW M.

QFRPHDQG([SHQGLWXUHRIWKH-RLQWO\FRQWUROOHGHQWLW\ZKLFKDUHDFFRXQWHGRQWKHEDVLVRIWKH DXGLWHG DFFRXQWV RI WKH -RLQW YHQWXUH RQ OLQHE\OLQH EDVLV ZLWK VLPLODU LWHPV LQ WKH &RPSDQ\ V &RQVROLGDWHG)LQDQFLDO6WDWHPHQWWRWKHH[WHQWRIWKHSDUWLFLSDWLQJLQWHUHVWRIWKH&RPSDQ\DVSHU WKH-RLQW9HQWXUH$JUHHPHQWVLQDFFRUGDQFHZLWKWKH$FFRXQWLQJ6WDQGDUG $6. 7KH&RQVROLGDWHG)LQDQFLDO6WDWHPHQWVRIWKH&RPSDQ\UHpHFWLWVVKDUHRIWKH$VVHWV/LDELOLWLHV .

k)LQDQFLDO 5HSRUWLQJ RI .QWHUHVWV LQ -RLQW 9HQWXUHVy 7KH LQWUDJURXS EDODQFHV DQG LQWUDJURXS WUDQVDFWLRQV KDYHEHHQHOLPLQDWHGWRWKHH[WHQWRIWKH&RPSDQ\ VVKDUHLQWKHHQWLW\ 189 .

) (iii) Use of estimates 7KH SUHSDUDWLRQ RI oQDQFLDO VWDWHPHQWV LQ FRQIRUPLW\ ZLWK .QGLDQ *$$3 UHTXLUHV WKH PDQDJHPHQW WR PDNHMXGJPHQWVHVWLPDWHVDQGDVVXPSWLRQVWKDWDIIHFWWKHUHSRUWHGDPRXQWVRIDVVHWVDQGOLDELOLWLHV DQG GLVFORVXUH RI FRQWLQJHQW OLDELOLWLHV RQ WKH GDWH RI WKH oQDQFLDO VWDWHPHQWV DQG UHSRUWHG DPRXQWV RIUHYHQXHVDQGH[SHQVHVIRUWKH\HDU$OWKRXJKWKHVHHVWLPDWHVDUHEDVHGRQWKHPDQDJHPHQW VEHVW NQRZOHGJHRIFXUUHQWHYHQWVDQGDFWLRQVXQFHUWDLQW\DERXWWKHVHDVVXPSWLRQVDQGHVWLPDWHVFRXOGUHVXOW LQWKHRXWFRPHVGLIIHUHQWIURPWKHHVWLPDWHV (VWLPDWHV DQG XQGHUO\LQJ DVVXPSWLRQV DUH UHYLHZHG RQ DQ RQJRLQJ EDVLV $Q\ UHYLVLRQ WR DFFRXQWLQJ HVWLPDWHVLVUHFRJQLVHGSURVSHFWLYHO\LQWKHFXUUHQWDQGIXWXUHSHULRGV (iv) (v) 7DQJLEOHo[HGDVVHWV D. 2015 (contd.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.

)L[HG DVVHWV DUH VWDWHG DW FRVW RI DFTXLVLWLRQ RU FRQVWUXFWLRQ OHVV DFFXPXODWHG GHSUHFLDWLRQ  DPRUWLVDWLRQDQGLPSDLUPHQWORVVHVLIDQ\7KHFRVWFRPSULVHVRIWKHSXUFKDVHSULFH QHWRI&HQYDW DQG9$7FUHGLWZKHUHYHUDSSOLFDEOH.

DQGDQ\DWWULEXWDEOHFRVWRIEULQJLQJWKHDVVHWVWRLWVZRUNLQJ FRQGLWLRQIRULWVLQWHQGHGXVH6XEVHTXHQWH[SHQGLWXUHVUHODWHGWRDQLWHPRIWDQJLEOHDVVHWDUH DGGHGWRLWVJURVVERRNYDOXHRQO\LILWLQFUHDVHVWKHIXWXUHEHQHoWVIURPWKHH[LVWLQJDVVHWEH\RQG LWVSUHYLRXVO\DVVHVVHGVWDQGDUGRISHUIRUPDQFH E.

0DFKLQHU\VSDUHVZKLFKFDQEHXVHGRQO\LQFRQQHFWLRQZLWKDSDUWLFXODULWHPRI)L[HG$VVHWVDQG WKHXVHRIZKLFKLVLUUHJXODUDUHFDSLWDOL]HGDWFRVW F.

)L[HGDVVHWVUHWLUHGIURPDFWLYHXVHDQGKHOGIRUGLVSRVDODUHVWDWHGDWWKHORZHURIWKHLUQHWERRN YDOXHDQGQHWUHDOLVDEOHYDOXHDQGDUHGLVFORVHGVHSDUDWHO\XQGHUkRWKHUFXUUHQWDVVHWVy G.

/RVVHV DULVLQJ IURP WKH UHWLUHPHQW RI DQG JDLQV DQG ORVVHV DULVLQJ IURP GLVSRVDO RI o[HG DVVHWV ZKLFKDUHFDUULHGDWFRVWDUHUHFRJQLVHGLQWKH6WDWHPHQWRI3URoWDQG/RVV H.

7DQJLEOHDVVHWVQRWUHDG\IRUWKHLQWHQGHGXVHRQWKHGDWHRI%DODQFH6KHHWDUHGLVFORVHGDVk&DSLWDO ZRUNLQSURJUHVVy$GYDQFHVJLYHQWRZDUGVDFTXLVLWLRQFRQVWUXFWLRQRIo[HGDVVHWVRXWVWDQGLQJDW HDFK%DODQFH6KHHWGDWHDUHGLVFORVHGDV&DSLWDO$GYDQFHVXQGHUk/RQJWHUPORDQVDQGDGYDQFHVy 'HSUHFLDWLRQRQWDQJLEOHo[HGDVVHWV D.

'HSUHFLDWLRQRQo[HGDVVHWVRWKHUWKDQ&DSWLYH3RZHU3ODQWUHODWHGDVVHWV &33DVVHWV.

LVSURYLGHG XVLQJWKHVWUDLJKWOLQHPHWKRGDQGRQ&33DVVHWVXVLQJWKHZULWWHQGRZQYDOXHPHWKRGEDVHGRQ WKHLU UHVSHFWLYH HVWLPDWHG XVHIXO OLYHV (VWLPDWHG XVHIXO OLYHV RI DVVHWV DUH GHWHUPLQHG EDVHG RQ WHFKQLFDOSDUDPHWHUVDVVHVVPHQW 7KHDIRUHVDLGHVWLPDWHGXVHIXOOLYHVIRUFRPSXWLQJGHSUHFLDWLRQLVGLIIHUHQWLQIROORZLQJFDVHIURP WKHXVHIXOOLIHVSHFLoHGLQ6FKHGXOH..WRWKH&RPSDQLHV$FW Particulars 3ODQWDQG(TXLSPHQWUHODWHGWR&DSWLYH3RZHU3ODQW Useful Life estimated by the management <HDUV 'HSUHFLDWLRQLVFDOFXODWHGRQDSURUDWDEDVLVIURPWKHGDWHRILQVWDOODWLRQWLOOWKHGDWHWKHDVVHWVDUH VROGRUGLVSRVHGRII 190 E.

0DFKLQHU\ VSDUHV ZKLFK DUH FDSLWDOLVHG DUH GHSUHFLDWHG RYHU WKH XVHIXO OLIH RI WKH UHODWHG o[HG DVVHW7KHZULWWHQGRZQYDOXHRIVXFKVSDUHVLVFKDUJHGLQWKH6WDWHPHQWRI3URoWDQG/RVVRQLVVXH IRUFRQVXPSWLRQ F.

/HDVHKROGODQGLVDPRUWL]HGRQDVWUDLJKWOLQHEDVLVRYHUWKHSHULRGRIOHDVHZKLFKLVWR\HDUV G.

)UHHKROGODQGXVHGIRUPLQLQJLVGHSUHFLDWHGRQWKHEDVLVRITXDQWLW\RIPLQHUDOVDFWXDOO\H[WUDFWHG GXULQJWKH\HDUZLWKUHVSHFWWRWKHHVWLPDWHGWRWDOTXDQWLW\RIH[WUDFWDEOHPLQHUDOUHVHUYHV .

RIWKH&RPSDQLHV$FW /RQJWHUPLQYHVWPHQWVDUHFDUULHGDWFRVW+RZHYHUSURYLVLRQIRUGLPLQXWLRQLQYDOXHLVPDGHWRUHFRJQL]H DGHFOLQHRWKHUWKDQWHPSRUDU\LQWKHYDOXHRIWKHLQYHVWPHQWV&XUUHQWLQYHVWPHQWVDUHFDUULHGDWWKH ORZHURIFRVWDQGIDLUYDOXHGHWHUPLQHGRQDQLQGLYLGXDOEDVLV 2QGLVSRVDORIDQLQYHVWPHQWWKHGLIIHUHQFHEHWZHHQWKHFDUU\LQJDPRXQWDQGWKHGLVSRVDOSURFHHGVQHW RIH[SHQVHVLVUHFRJQLVHGLQWKH6WDWHPHQWRI3URoWDQG/RVV (x) Inventories .Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.QYHVWPHQWVZKLFKDUHUHDGLO\UHDOL]DEOHDQGLQWHQGHGWREHKHOGIRUQRWPRUHWKDQRQH\HDUIURPWKH GDWHRQZKLFKVXFKLQYHVWPHQWVDUHPDGHDUHFODVVLoHGDVFXUUHQWLQYHVWPHQWV$OORWKHULQYHVWPHQWVDUH FODVVLoHGDVORQJWHUPLQYHVWPHQWV+RZHYHUWKDWSDUWRIORQJWHUPLQYHVWPHQWVZKLFKDUHH[SHFWHGWR EHUHDOL]HGZLWKLQWZHOYHPRQWKVIURP%DODQFH6KHHWGDWHLVDOVRSUHVHQWHGXQGHUk&XUUHQW...QWDQJLEOH DVVHWV DUH VWDWHG DW FRVW RI DFTXLVLWLRQ RU FRQVWUXFWLRQ OHVV DFFXPXODWHG DPRUWLVDWLRQ DQG LPSDLUPHQW ORVVHV LI DQ\ .QDVVHVVLQJWKHYDOXHLQXVHWKHHVWLPDWHGIXWXUHFDVK pRZV DUH GLVFRXQWHG WR WKHLU SUHVHQW YDOXH XVLQJ D SUHWD[ GLVFRXQW UDWH WKDW UHpHFWV FXUUHQW PDUNHW DVVHVVPHQWVRIWKHWLPHYDOXHRIPRQH\DQGULVNVVSHFLoFWRWKHDVVHW $IWHULPSDLUPHQWGHSUHFLDWLRQDPRUWLVDWLRQLVSURYLGHGRQWKHUHYLVHGFDUU\LQJDPRXQWRIWKHDVVHWRYHU LWVUHPDLQLQJXVHIXOOLIH$SUHYLRXVO\UHFRJQLVHGLPSDLUPHQWORVVLVLQFUHDVHGRUUHYHUVHGGHSHQGLQJRQ FKDQJHVLQFLUFXPVWDQFHV+RZHYHUWKHFDUU\LQJYDOXHDIWHUUHYHUVDOLVQRWLQFUHDVHGEH\RQGWKHFDUU\LQJ YDOXHWKDWZRXOGKDYHSUHYDLOHGE\FKDUJLQJXVXDOGHSUHFLDWLRQDPRUWLVDWLRQLIWKHUHZDVQRLPSDLUPHQW (viii) %RUURZLQJ&RVWV %RUURZLQJ FRVWV GLUHFWO\ DWWULEXWDEOH WR WKH DFTXLVLWLRQ DQG FRQVWUXFWLRQ RI DQ DVVHW ZKLFK WDNHV D VXEVWDQWLDOSHULRGRIWLPHWRJHWUHDG\IRULWVLQWHQGHGXVHDUHFDSLWDOLVHGDVDSDUWRIWKHFRVWRIVXFK DVVHWVXQWLOVXFKWLPHWKHDVVHWLVVXEVWDQWLDOO\UHDG\IRULWVLQWHQGHGXVH$OORWKHUERUURZLQJFRVWVDUH UHFRJQLVHGLQWKH6WDWHPHQWRI3URoWDQG/RVVLQWKHSHULRGWKH\RFFXU%RUURZLQJFRVWVFRQVLVWRILQWHUHVW DQGRWKHUFRVWVLQFXUUHGLQFRQQHFWLRQZLWKERUURZLQJRIIXQGV (ix) Investments .) (vi) Intangible assets and amortisation .QYHQWRULHVDUHYDOXHGDIWHUSURYLGLQJIRUREVROHVFHQFHDVIROORZV D. 2015 (contd.QYHVWPHQWVy XQGHU k&XUUHQW SRUWLRQ RI ORQJ WHUP LQYHVWPHQWVy LQ FRQVRQDQFH ZLWK WKH FXUUHQW  QRQFXUUHQW FODVVLoFDWLRQRI6FKHGXOH.QWDQJLEOH DVVHWV DUH DPRUWLVHG RYHU WKHLU HVWLPDWHG XVHIXO HFRQRPLF OLIH &RPSXWHU6RIWZDUHFRVWLVDPRUWLVHGRYHUDSHULRGRIWKUHH\HDUVXVLQJVWUDLJKWOLQHPHWKRG *DLQVRUORVVHVDULVLQJIURPGHUHFRJQLWLRQRILQWDQJLEOHDVVHWVDUHPHDVXUHGDVWKHGLIIHUHQFHEHWZHHQWKH QHWGLVSRVDOSURFHHGVDQGWKHFDUU\LQJDPRXQWRIWKHDVVHWDQGDUHUHFRJQLVHGLQWKH6WDWHPHQWRI3URoW DQG/RVVZKHQWKHDVVHWLVGHUHFRJQLVHG (vii) Impairment of assets 7KH FDUU\LQJ DPRXQW RI DVVHWV DUH UHYLHZHG DW HDFK %DODQFH 6KHHW GDWH LI WKHUH LV DQ\ LQGLFDWLRQ RI LPSDLUPHQWEDVHGRQLQWHUQDOH[WHUQDOIDFWRUV$QLPSDLUPHQWORVVLVUHFRJQL]HGZKHUHYHUWKHFDUU\LQJ DPRXQW RI DQ DVVHW H[FHHGV LWV HVWLPDWHG UHFRYHUDEOH DPRXQW 7KH UHFRYHUDEOH DPRXQW LV WKH JUHDWHU RIWKHDVVHW VQHWVHOOLQJSULFHDQGYDOXHLQXVH.

 5DZ0DWHULDOV6WRUHV 6SDUHSDUWV3DFNLQJ0DWHULDODQG)XHOV  /RZHURIFRVWDQGQHWUHDOL]DEOHYDOXH+RZHYHUPDWHULDOVDQGRWKHULWHPVKHOGIRUXVHLQWKH SURGXFWLRQRILQYHQWRULHVDUHQRWZULWWHQGRZQEHORZFRVWLIWKHoQLVKHGSURGXFWVLQZKLFK WKH\ ZLOO EH LQFRUSRUDWHG DUH H[SHFWHG WR EH VROG DW RU DERYH FRVW &RVW LV GHWHUPLQHG RQ D ZHLJKWHGDYHUDJHEDVLV 191 .

ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.) E. 2015 (contd.

 :RUNLQSURJUHVV)LQLVKHGJRRGVDQG6WRFNLQ7UDGH /RZHU RI FRVW DQG QHW UHDOL]DEOH YDOXH &RVW LQFOXGHV GLUHFW PDWHULDOV DQG ODERXU DQG D SURSRUWLRQRIPDQXIDFWXULQJRYHUKHDGVEDVHGRQQRUPDORSHUDWLQJFDSDFLW\&RVWRIoQLVKHG JRRGV LQFOXGHV H[FLVH GXW\ &RVW RI 6WRFNLQ7UDGH LQFOXGHV FRVW RI SXUFKDVH DQG RWKHU FRVW LQFXUUHGLQEULQJLQJWKHLQYHQWRULHVWRWKHSUHVHQWORFDWLRQDQGFRQGLWLRQ&RVWLVGHWHUPLQHG RQDZHLJKWHGDYHUDJHEDVLV 1HW UHDOL]DEOH YDOXH LV WKH HVWLPDWHG VHOOLQJ SULFH LQ WKH RUGLQDU\ FRXUVH RI EXVLQHVV OHVV HVWLPDWHGFRVWVRIFRPSOHWLRQDQGHVWLPDWHGFRVWVQHFHVVDU\WRPDNHWKHVDOH (xi) Cash and cash equivalents &DVKDQGFDVKHTXLYDOHQWVIRUWKHSXUSRVHRIFDVKpRZVWDWHPHQWFRPSULVHFDVKLQKDQGFDVKDWEDQN GHPDQGGHSRVLWVZLWKEDQNVDQGRWKHUVKRUWWHUPKLJKO\OLTXLGLQYHVWPHQWVGHSRVLWVZLWKDQRULJLQDO PDWXULW\RIWKUHHPRQWKVRUOHVV (xii) Revenue recognition 5HYHQXHLVUHFRJQL]HGWRWKHH[WHQWWKDWLWLVSUREDEOHWKDWWKHHFRQRPLFEHQHoWVZLOOpRZWRWKH&RPSDQ\ DQGWKHUHYHQXHFDQEHUHOLDEO\PHDVXUHG 6DOHRIJRRGV 5HYHQXHLVUHFRJQLVHGZKHQWKHVLJQLoFDQWULVNVDQGUHZDUGVRIRZQHUVKLSRIWKHJRRGVKDYHEHHQSDVVHG WRWKHEX\HU6DOHVDUHGLVFORVHGQHWRIVDOHVWD[YDOXHDGGHGWD[ 9$7.

WUDGHGLVFRXQWVDQGUHWXUQVDV DSSOLFDEOH6DOHVH[FOXGHVHOIFRQVXPSWLRQRIFHPHQW ([FLVHGXWLHVGHGXFWHGIURPWXUQRYHU JURVV.

DUHWKHDPRXQWVWKDWDUHLQFOXGHGLQWKHDPRXQWRIWXUQRYHU JURVV.

DQGQRWWKHHQWLUHDPRXQWRIOLDELOLW\WKDWDURVHGXULQJWKH\HDU .QFRPHIURPVHUYLFHV 5HYHQXH IURP VHUYLFHV LV UHFRJQLVHG QHW RI VHUYLFH WD[ DV DSSOLFDEOH.

QWHUHVW LQFRPH LV UHFRJQLVHG RQ D WLPH SURSRUWLRQ EDVLV WDNLQJ LQWR DFFRXQW WKH DPRXQW RXWVWDQGLQJ DQGWKHUDWHDSSOLFDEOH'LYLGHQGLQFRPHLVUHFRJQLVHGZKHQWKH&RPSDQ\ VULJKWWRUHFHLYHGLYLGHQGLV HVWDEOLVKHGE\WKH%DODQFH6KHHWGDWH (xiii) Government Grants and Subsidies 192 D. SURUDWD RYHU WKH SHULRG RI WKH FRQWUDFWDVDQGZKHQVHUYLFHVDUHUHQGHUHG .QFRPH .QWHUHVWDQG'LYLGHQG.

*RYHUQPHQW JUDQWV DQG VXEVLGLHV DUH UHFRJQL]HG ZKHQ WKHUH LV UHDVRQDEOH DVVXUDQFH WKDW WKH FRQGLWLRQVDWWDFKHGWRWKHPZLOOEHFRPSOLHGDQGJUDQWVXEVLG\ZLOOEHUHFHLYHG E.

:KHUH WKH *RYHUQPHQW JUDQWV  VXEVLGLHV UHODWHV WR UHYHQXH LW LV UHFRJQL]HG DV LQFRPH RQ D V\VWHPDWLF EDVLV LQ WKH VWDWHPHQW RI SURoW DQG ORVV RYHU WKH SHULRGV QHFHVVDU\ WR PDWFK WKHP ZLWKWKHUHODWHGFRVWVZKLFKWKH\DUHLQWHQGHGWRFRPSHQVDWH*RYHUQPHQWJUDQWVDQGVXEVLGLHV UHFHLYDEOHDJDLQVWDQH[SHQVHDUHGHGXFWHGIURPVXFKH[SHQVH F.

*UDQWVDQGVXEVLGLHVUHFHLYDEOHDJDLQVWDVSHFLoFo[HGDVVHWLVGHGXFWHGIURPFRVWRIWKHUHOHYDQW o[HGDVVHW G.

*RYHUQPHQW JUDQWV RI WKH QDWXUH RI SURPRWHUV  FRQWULEXWLRQ DUH FUHGLWHG WR &DSLWDO 5HVHUYH DQG WUHDWHGDVDSDUWRIVKDUHKROGHUV IXQGV .

) (xiv) Leases :KHUHWKH&RPSDQ\LVWKHOHVVHH /HDVHV ZKHUH WKH OHVVRU HIIHFWLYHO\ UHWDLQV VXEVWDQWLDOO\ DOO WKH ULVNV DQG EHQHoWV RI RZQHUVKLS RI WKH OHDVHGLWHPDUHFODVVLoHGDVRSHUDWLQJOHDVHV2SHUDWLQJOHDVHSD\PHQWVDUHUHFRJQL]HGDVDQH[SHQVHLQ WKH6WDWHPHQWRI3URoWDQG/RVVRQDVWUDLJKWOLQHEDVLVRYHUWKHOHDVHWHUP :KHUHWKH&RPSDQ\LVWKHOHVVRU $VVHWVVXEMHFWWRRSHUDWLQJOHDVHVDUHLQFOXGHGLQo[HGDVVHWV/HDVHLQFRPHLVUHFRJQLVHGLQWKH6WDWHPHQW RI3URoWDQG/RVVRQDVWUDLJKWOLQHEDVLVRYHUWKHOHDVHWHUP&RVWVLQFOXGLQJGHSUHFLDWLRQDUHUHFRJQLVHG DVDQH[SHQVHLQWKHVWDWHPHQWRISURoWDQGORVV.QLWLDOGLUHFWFRVWVVXFKDVOHJDOFRVWVEURNHUDJHFRVWV HWFDUHUHFRJQLVHGLPPHGLDWHO\LQWKH6WDWHPHQWRI3URoWDQG/RVV (xv) Foreign currency transactions )RUHLJQ FXUUHQF\ WUDQVDFWLRQV DUH LQLWLDOO\ UHFRUGHG DW WKH UDWHV RI H[FKDQJH SUHYDLOLQJ RQ WKH GDWH RI WUDQVDFWLRQV )RUHLJQ FXUUHQF\ PRQHWDU\ LWHPV DUH VXEVHTXHQWO\ UHSRUWHG XVLQJ WKH FORVLQJ UDWH 1RQPRQHWDU\ LWHPV ZKLFK DUH FDUULHG LQ WHUPV RI KLVWRULFDO FRVW GHQRPLQDWHG LQ D IRUHLJQ FXUUHQF\ DUH UHSRUWHG XVLQJ WKH H[FKDQJH UDWH DW WKH GDWH RI WKH WUDQVDFWLRQ ([FKDQJHGLIIHUHQFHVDULVLQJRQWKHVHWWOHPHQWRIPRQHWDU\LWHPVRURQUHSRUWLQJ&RPSDQ\ VPRQHWDU\ LWHPVDWUDWHVGLIIHUHQWIURPWKRVHDWZKLFKWKH\ZHUHLQLWLDOO\UHFRUGHGGXULQJWKH\HDURUUHSRUWHGLQ SUHYLRXVoQDQFLDOVWDWHPHQWVDUHUHFRJQLVHGDVLQFRPHRUDVH[SHQVHVLQWKH\HDULQZKLFKWKH\DULVH (xvi) 5HWLUHPHQWDQGRWKHUHPSOR\HHEHQHoWV D.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31. 2015 (contd.

6KRUWWHUPHPSOR\HHEHQHoWV 6KRUW WHUP HPSOR\HH EHQHoWV DUH UHFRJQLVHG DV DQ H[SHQVH DW WKH XQGLVFRXQWHG DPRXQW LQ WKH 6WDWHPHQWRI3URoWDQG/RVVRIWKH\HDULQZKLFKWKHUHODWHGVHUYLFHLVUHQGHUHG E.

'HoQHGFRQWULEXWLRQSODQV 7KH &RPSDQ\ V 2IoFHU V 6XSHUDQQXDWLRQ )XQG VFKHPH VWDWH JRYHUQHG SURYLGHQW IXQG VFKHPH HPSOR\HH VWDWH LQVXUDQFH VFKHPH DQG /DERXU :HOIDUH )XQG VFKHPH DUH FRQVLGHUHG DV GHoQHG FRQWULEXWLRQ SODQV 7KH FRQWULEXWLRQ XQGHU WKH VFKHPHV LV UHFRJQLVHG DV DQ H[SHQVH LQ WKH 6WDWHPHQW RI 3URoW DQG /RVV ZKHQ DQ HPSOR\HH UHQGHUV WKH UHODWHG VHUYLFH 7KHUH DUH QR RWKHU REOLJDWLRQVRWKHUWKDQWKHFRQWULEXWLRQSD\DEOHWRWKHUHVSHFWLYHIXQGV F.

'HoQHGEHQHoWSODQV 7KH &RPSDQ\ V *UDWXLW\ IXQG VFKHPH DGGLWLRQDO JUDWXLW\ VFKHPH DQG SRVW HPSOR\PHQW EHQHoW VFKHPHDUHFRQVLGHUHGDVGHoQHGEHQHoWSODQV7KH&RPSDQ\ VOLDELOLW\LVGHWHUPLQHGRQWKHEDVLV RIDQDFWXDULDOYDOXDWLRQXVLQJWKHSURMHFWHGXQLWFUHGLWPHWKRGDVDW%DODQFH6KHHWGDWH$FWXDULDO JDLQVORVVHVDUHUHFRJQL]HGLPPHGLDWHO\LQWKH6WDWHPHQWRI3URoWDQG/RVVLQWKH\HDULQZKLFK WKH\DULVH .QGLD G.QUHVSHFWRIFHUWDLQHPSOR\HHVSURYLGHQWIXQGFRQWULEXWLRQVDUHPDGHWRDWUXVWDGPLQLVWHUHGE\ WKH&RPSDQ\3HULRGLFFRQWULEXWLRQVWRWKH)XQGDUHFKDUJHGWRWKH6WDWHPHQWRI3URoWDQG/RVV 7KH&RPSDQ\ KDVDQREOLJDWLRQ WRPDNHJRRGWKHVKRUWIDOOLIDQ\EHWZHHQWKHUHWXUQIURPWKH LQYHVWPHQWRIWKHWUXVWDQGLQWHUHVWUDWHQRWLoHGE\WKH*RYHUQPHQWRI.

2WKHUORQJWHUPEHQHoWV 6LOYHUMXELOHHDQGORQJVHUYLFHDZDUGVDQGDFFXPXODWHGFRPSHQVDWHGDEVHQFHVZKLFKDUHH[SHFWHG WREHDYDLOHGRUHQFDVKHGEH\RQGPRQWKVIURPWKHHQGRIWKH\HDUDUHWUHDWHGDVRWKHUORQJ WHUPHPSOR\HHEHQHoWVIRUPHDVXUHPHQWSXUSRVHV7KH&RPSDQ\ VOLDELOLW\LVGHWHUPLQHGRQWKH EDVLV RI DQ DFWXDULDO YDOXDWLRQ XVLQJ WKH SURMHFWHG XQLW FUHGLW PHWKRG DV DW %DODQFH 6KHHW GDWH $FWXDULDOJDLQVORVVHVDUHUHFRJQL]HGLPPHGLDWHO\LQWKH6WDWHPHQWRI3URoWDQG/RVVLQWKH\HDU LQZKLFKWKH\DULVH 193 .

) H.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31. 2015 (contd.

$FFXPXODWHG FRPSHQVDWHG DEVHQFHV ZKLFK DUH H[SHFWHG WR EH DYDLOHG RU HQFDVKHG ZLWKLQ  PRQWKV IURP WKH HQG RI WKH \HDU DUH WUHDWHG DV VKRUW WHUP HPSOR\HH EHQHoWV 7KH FRPSDQ\ PHDVXUHVWKHH[SHFWHGFRVWRIVXFKDEVHQFHVDVWKHDGGLWLRQDODPRXQWWKDWLWH[SHFWVWRSD\DVD UHVXOWRIWKHXQXVHGHQWLWOHPHQWWKDWKDVDFFXPXODWHGDWWKHUHSRUWLQJGDWH I.

)RUWKHSXUSRVHRISUHVHQWDWLRQRI'HoQHGEHQHoWSODQVDQGRWKHUORQJWHUPEHQHoWVWKHDOORFDWLRQ EHWZHHQ VKRUW WHUP DQG ORQJ WHUP SURYLVLRQV KDV EHHQ PDGH DV GHWHUPLQHG E\ DQ DFWXDU\ 7KH &RPSDQ\SUHVHQWVWKHHQWLUHFRPSHQVDWHGDEVHQFHVDVDVKRUWWHUPSURYLVLRQVVLQFHHPSOR\HHKDV DQXQFRQGLWLRQDOULJKWWRDYDLOWKHOHDYHDWDQ\WLPHGXULQJWKH\HDU J.

([SHQVHVLQFXUUHGWRZDUGVYROXQWDU\UHWLUHPHQWVFKHPHDUHFKDUJHGWRWKH6WDWHPHQWRI3URoWDQG /RVVDVDQGZKHQDFFUXH (xvii) Income taxes 7D[H[SHQVHFRPSULVHVRIFXUUHQWDQGGHIHUUHGWD[DQGLQFOXGHVDQ\DGMXVWPHQWVUHODWHGWRSDVWSHULRGV LQFXUUHQWDQGRUGHIHUUHGWD[DGMXVWPHQWVWKDWPD\EHFRPHQHFHVVDU\GXHWRFHUWDLQGHYHORSPHQWVRU UHYLHZVGXULQJWKHUHOHYDQWSHULRG&XUUHQWLQFRPHWD[LVPHDVXUHGDWWKHDPRXQWH[SHFWHGWREHSDLGWR WKHWD[DXWKRULWLHVLQDFFRUGDQFHZLWKWKH.QFRPHWD[$FW &XUUHQWWD[DVVHWVDQGFXUUHQWWD[OLDELOLWLHVDUHRIIVHWZKHQWKHUHLVDOHJDOO\HQIRUFHDEOHULJKWWRVHWRII WKHUHFRJQLVHGDPRXQWVDQGWKHUHLVDQLQWHQWLRQWRVHWWOHWKHDVVHWDQGWKHOLDELOLW\RQDQHWEDVLV 'HIHUUHGLQFRPHWD[HVUHpHFWWKHLPSDFWRIFXUUHQW\HDU VWLPLQJGLIIHUHQFHVEHWZHHQWD[DEOHLQFRPHDQG DFFRXQWLQJLQFRPHIRUWKH\HDUDQGUHYHUVDORIWLPLQJGLIIHUHQFHVRIHDUOLHU\HDUV 'HIHUUHG WD[ LV PHDVXUHG EDVHG RQ WKH WD[ UDWHV DQG WKH WD[ ODZV HQDFWHG RU VXEVWDQWLYHO\ HQDFWHG DW WKH %DODQFH 6KHHW GDWH 'HIHUUHG WD[ DVVHWV DUH UHFRJQLVHG RQO\ WR WKH H[WHQW WKDW WKHUH LV UHDVRQDEOH FHUWDLQW\WKDWVXIoFLHQWIXWXUHWD[DEOHLQFRPHZLOOEHDYDLODEOHDJDLQVWZKLFKVXFKGHIHUUHGWD[DVVHWVFDQ EHUHDOLVHG 7KHFDUU\LQJDPRXQWRIGHIHUUHGWD[DVVHWVDUHUHYLHZHGDWHDFK%DODQFH6KHHWGDWH7KH&RPSDQ\ZULWHV GRZQWKHFDUU\LQJDPRXQWRIDGHIHUUHGWD[DVVHWWRWKHH[WHQWWKDWLWLVQRORQJHUUHDVRQDEO\FHUWDLQWKDW VXIoFLHQWIXWXUHWD[DEOHLQFRPHZLOOEHDYDLODEOHDJDLQVWZKLFKGHIHUUHGWD[DVVHWFDQEHUHDOLVHG$Q\ VXFKZULWHGRZQLVUHYHUVHGWRWKHH[WHQWWKDWLWEHFRPHVUHDVRQDEO\FHUWDLQWKDWVXIoFLHQWIXWXUHWD[DEOH LQFRPHZLOOEHDYDLODEOH (xviii) Provisions and contingent liabilities $SURYLVLRQLVUHFRJQL]HGZKHQWKH&RPSDQ\KDVDSUHVHQWREOLJDWLRQDVDUHVXOWRISDVWHYHQWVLILWLV SUREDEOHWKDWDQRXWpRZRIUHVRXUFHVHPERG\LQJHFRQRPLFEHQHoWVZLOOEHUHTXLUHGWRVHWWOHWKHREOLJDWLRQ DQG D UHOLDEOH HVWLPDWH FDQ EH PDGH RI WKH DPRXQW RI WKH REOLJDWLRQ 3URYLVLRQV H[FOXGLQJ UHWLUHPHQW EHQHoWV.

DUHQRWGLVFRXQWHGWRWKHLUSUHVHQWYDOXHDQGDUHGHWHUPLQHGEDVHGRQWKHEHVWHVWLPDWHUHTXLUHG WRVHWWOHWKHREOLJDWLRQDWWKHUHSRUWLQJGDWH7KHVHHVWLPDWHVDUHUHYLHZHGDWHDFK%DODQFH6KHHWGDWHDQG DGMXVWHGWRUHpHFWWKHFXUUHQWEHVWHVWLPDWHV $ FRQWLQJHQW OLDELOLW\ LV D SRVVLEOH REOLJDWLRQ WKDW DULVHV IURP SDVW HYHQWV ZKRVH H[LVWHQFH ZLOO EH FRQoUPHGE\WKHRFFXUUHQFHRUQRQRFFXUUHQFHRIRQHRUPRUHXQFHUWDLQIXWXUHHYHQWVEH\RQGWKHFRQWURO RIWKHFRPSDQ\RUDSUHVHQWREOLJDWLRQWKDWLVQRWUHFRJQL]HGEHFDXVHLWLVQRWSUREDEOHWKDWDQRXWpRZRI UHVRXUFHVZLOOEHUHTXLUHGWRVHWWOHWKHREOLJDWLRQ$FRQWLQJHQWOLDELOLW\DOVRDULVHVLQH[WUHPHO\UDUHFDVHV ZKHUHWKHUHLVDOLDELOLW\WKDWFDQQRWEHUHFRJQL]HGEHFDXVHLWFDQQRWEHPHDVXUHGUHOLDEO\7KH&RPSDQ\ GRHVQRWUHFRJQL]HDFRQWLQJHQWOLDELOLW\EXWGLVFORVHVLWVH[LVWHQFHLQWKHoQDQFLDOVWDWHPHQWV 194 .

) (xix) Earnings per share %DVLFHDUQLQJVSHUVKDUHDUHFDOFXODWHGE\GLYLGLQJWKHQHWSURoWRUORVVIRUWKH\HDUDWWULEXWDEOHWRHTXLW\ VKDUHKROGHUVE\WKHZHLJKWHGDYHUDJHQXPEHURIHTXLW\VKDUHVRXWVWDQGLQJGXULQJWKH\HDU )RUWKHSXUSRVHRIFDOFXODWLQJGLOXWHGHDUQLQJVSHUVKDUHWKHQHWSURoWRUORVVIRUWKH\HDUDWWULEXWDEOHWR HTXLW\VKDUHKROGHUVDQGWKHZHLJKWHGDYHUDJHQXPEHURIVKDUHVRXWVWDQGLQJGXULQJWKH\HDUDUHDGMXVWHG IRUWKHHIIHFWVRIDOOGLOXWLYHSRWHQWLDOHTXLW\VKDUHV (xx) Mines Restoration Expenditure 7KH&RPSDQ\SURYLGHVIRUWKHHVWLPDWHGH[SHQGLWXUHUHTXLUHGWRUHVWRUHTXDUULHVDQGPLQHV7KHWRWDO HVWLPDWHRIUHVWRUDWLRQH[SHQVHVLVDSSRUWLRQHGRYHUWKHHVWLPDWHRIPLQHUDOUHVHUYHVDQGDSURYLVLRQLV PDGHEDVHGRQPLQHUDOVH[WUDFWHGGXULQJWKH\HDU0LQHVUHVWRUDWLRQH[SHQVHVLVLQFXUUHGRQDQRQJRLQJ EDVLVDQGXQWLOWKHFORVXUHRIWKHTXDUULHVDQGPLQHV7KHDFWXDOH[SHQVHVPD\YDU\EDVHGRQWKHQDWXUH RIUHVWRUDWLRQDQGWKHHVWLPDWHRIUHVWRUDWLRQH[SHQGLWXUH7KHWRWDOHVWLPDWHRIUHVWRUDWLRQH[SHQVHVLV UHYLHZHGSHULRGLFDOO\RQWKHEDVLVRIWHFKQLFDOHVWLPDWHV (xxi) &ODVVLoFDWLRQRI&XUUHQW1RQ&XUUHQW$VVHWVDQG/LDELOLWLHV $OODVVHWVDQGOLDELOLWLHVDUHSUHVHQWHGDV&XUUHQWRU1RQFXUUHQWDVSHUWKH&RPSDQ\ VQRUPDORSHUDWLQJ F\FOHDQGRWKHUFULWHULDVHWRXWLQ6FKHGXOH.GHQWLoFDWLRQRIVHJPHQWV 7KH &RPSDQ\ V RSHUDWLQJ EXVLQHVVHV DUH RUJDQL]HG DQG PDQDJHG VHSDUDWHO\ DFFRUGLQJ WR WKH QDWXUH RISURGXFWVDQGVHUYLFHVSURYLGHGZLWKHDFKVHJPHQWUHSUHVHQWLQJDVWUDWHJLFEXVLQHVVXQLWWKDWRIIHUV GLIIHUHQWSURGXFWVDQGVHUYHVGLIIHUHQWPDUNHWV7KHDQDO\VLVRIJHRJUDSKLFDOVHJPHQWVLVEDVHGRQWKH DUHDVLQZKLFKPDMRURSHUDWLQJGLYLVLRQVRIWKH&RPSDQ\RSHUDWH $OORFDWLRQRIFRPPRQFRVWV &RPPRQ DOORFDEOH FRVWV DUH DOORFDWHG WR HDFK VHJPHQW DFFRUGLQJ WR WKH UHODWLYH FRQWULEXWLRQ RI HDFK VHJPHQWWRWKHWRWDOFRPPRQFRVWV ..RIWKH&RPSDQLHV$FW%DVHGRQWKHQDWXUHRISURGXFWV DQG WKH WLPH EHWZHHQ WKH DFTXLVLWLRQ RI DVVHWV IRU SURFHVVLQJ DQG WKHLU UHDOLVDWLRQ WKH &RPSDQ\ KDV DVFHUWDLQHG LWV RSHUDWLQJ F\FOH DV  PRQWKV IRU WKH SXUSRVH RI &XUUHQW  1RQ FXUUHQW FODVVLoFDWLRQ RI DVVHWVDQGOLDELOLWLHV (xxii) Segment Reporting .. 2015 (contd.QWHUVHJPHQWUHYHQXHKDVEHHQDFFRXQWHGIRUEDVHGRQWKHWUDQVDFWLRQSULFHDJUHHGWREHWZHHQVHJPHQWV ZKLFKLVEDVHGRQFXUUHQWPDUNHWSULFHV Unallocated items 5HYHQXHH[SHQVHVDVVHWVDQGOLDELOLWLHVZKLFKUHODWHWRWKH&RPSDQ\DVDZKROHDQGDUHQRWDOORFDEOH WR VHJPHQWV RQ UHDVRQDEOH EDVLV KDYH EHHQ LQFOXGHG XQGHU CXQDOORFDWHG UHYHQXH  H[SHQVHV  DVVHWV  OLDELOLWLHV  6HJPHQW3ROLFLHV 7KH&RPSDQ\SUHSDUHVLWVVHJPHQWLQIRUPDWLRQLQFRQIRUPLW\ZLWKWKHDFFRXQWLQJSROLFLHVDGRSWHGIRU SUHSDULQJDQGSUHVHQWLQJWKHoQDQFLDOVWDWHPHQWVRIWKH&RPSDQ\DVDZKROH 195 .Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.QWHU6HJPHQWWUDQVIHUV .

QGLD.356) (TXLW\6KDUHVRI`HDFKIXOO\SDLG $GG(Previous Year .3.93.18.50.00.060)(TXLW\6KDUHVRI`HDFK)RUIHLWHG $PRXQW3DLG TOTAL i) Reconciliation of number of equity shares outstanding (TXLW\6KDUHVDWWKHEHJLQQLQJRIWKH\HDU (TXLW\6KDUHVDWWKHHQGRIWKH\HDU 2015 No.84.87.77.10.45.00. SHARE CAPITAL  `&URUH Authorised Shares (Previous Year . 2015 (contd. of shares   ` Crore    1RRIVKDUHV  `&URUH    ii) Terms / rights attached to equity shares 7KH&RPSDQ\KDVRQO\RQHFODVVRIHTXLW\VKDUHVKDYLQJSDUYDOXHRI`SHUVKDUH(DFKKROGHURIHTXLW\ VKDUHV LV HQWLWOHG WR RQH YRWH SHU VKDUH 7KH GLYLGHQG SURSRVHG E\ WKH %RDUG RI 'LUHFWRUV LV VXEMHFW WR WKH DSSURYDORIWKHVKDUHKROGHUVLQWKHHQVXLQJ$QQXDO*HQHUDO0HHWLQJH[FHSWLQFDVHRILQWHULPGLYLGHQG .ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.000)3UHIHUHQFH6KDUHVRI`HDFK 2015 ` Crore     Issued (Previous Year .000)(TXLW\6KDUHVRI`HDFK (Previous Year .243)(TXLW\6KDUHVRI`HDFK         Subscribed & Paid-up  (Previous Year .) 3.QWKHHYHQWRIOLTXLGDWLRQRIWKH&RPSDQ\WKHKROGHUVRIHTXLW\VKDUHVZLOOEHHQWLWOHGWRUHFHLYHUHPDLQLQJ DVVHWVRIWKHFRPSDQ\DIWHUGLVWULEXWLRQRIDOOSUHIHUHQWLDODPRXQWV7KHGLVWULEXWLRQZLOOEHLQSURSRUWLRQWR WKHQXPEHURIHTXLW\VKDUHVKHOGE\WKHVKDUHKROGHUV iii) Equity shares held by holding company / ultimate holding and their subsidiaries 2015 ` Crore   `&URUH  +ROFLP .18.00.22.

120)(TXLW\VKDUHV` HDFKIXOO\SDLG +ROGHULQG.9.QGLD.38.88.QYHVWPHQWV/WG0DXULWLXV+ROGLQJ&RPSDQ\RI+ROFLP .3ULYDWH/LPLWHGWKH+ROGLQJ&RPSDQ\ (Previous Year .

000)(TXLW\VKDUHV` HDFKIXOO\SDLG %RWKWKHVH&RPSDQLHVDUHVXEVLGLDULHVRI/DIDUJH+ROFLP/WG(Formerly known as Holcim Ltd)6ZLW]HUODQGWKH XOWLPDWHKROGLQJ&RPSDQ\ iv) 7KH &RPSDQ\ KDV LVVXHG 1LO (Previous Year .5.064) (TXLW\ VKDUHV `  HDFK IXOO\ SDLG GXULQJ WKH SHULRG RI oYH\HDUVLPPHGLDWHO\SUHFHGLQJWKHUHSRUWLQJGDWHRQH[HUFLVHRIRSWLRQVJUDQWHGXQGHUWKHHPSOR\HHVWRFN RSWLRQSODQZKHUHLQSDUWFRQVLGHUDWLRQZDVUHFHLYHGLQIRUPRIHPSOR\HHVHUYLFHV v) Details of shareholders holding more than 5% shares in the Company 2015 No. of shares % holding +ROFLP .   3ULYDWH/LPLWHG (Previous Year .5.41.QGLD.

QGLD   196  1RRIVKDUHV   KROGLQJ   .3ULYDWH/LPLWHG   /LIH.QVXUDQFH&RUSRUDWLRQRI.

2015 (contd.Appropriations TOTAL     197 .` 15)}   3URSRVHGoQDOHTXLW\GLYLGHQG ^DPRXQWSHUVKDUH`(Previous Year . RESERVES AND SURPLUS 2015 ` Crore  ` Crore Capital Reserve Securities Premium Account `&URUH     Debenture Redemption Reserve %DODQFHDVSHUODVW)LQDQFLDOVWDWHPHQWV   /HVV7UDQVIHUUHGWR*HQHUDO5HVHUYH     General Reserve %DODQFHDVSHUODVW)LQDQFLDOVWDWHPHQWV $GG 7UDQVIHUUHGIURPVXUSOXVLQ6WDWHPHQWRI3URoWDQG/RVV $GG 7UDQVIHUUHGIURP'HEHQWXUH5HGHPSWLRQ5HVHUYH         6XUSOXVLQ6WDWHPHQWRI3URoWDQG/RVV %DODQFHDVSHUODVW)LQDQFLDOVWDWHPHQWV       .QWHULPHTXLW\GLYLGHQG ^DPRXQWSHUVKDUH`(Previous Year .) 4.` 19)}   7D[RQHTXLW\GLYLGHQGV   7UDQVIHUWR*HQHUDO5HVHUYH     $GG3URoWIRUWKH\HDU Less .Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.

) 5. DEFERRED TAX LIABILITIES (NET) 2015  ` Crore `&URUH                 2015  ` Crore `&URUH      20.88   2015  ` Crore `&URUH     /HVV8WLOLVDWLRQGXULQJWKH\HDU  . 2015 (contd.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.

 .

LONG-TERM PROVISIONS 3URYLVLRQIRUHPSOR\HHEHQHoWV 5HIHU1RWH. &ORVLQJSURYLVLRQ   'HIHUUHG7D[/LDELOLWLHVDULVLQJRQDFFRXQWRI 'HSUHFLDWLRQDQGDPRUWLVDWLRQGLIIHUHQFHV 'HIHUUHG7D[$VVHWVDULVLQJRQDFFRXQWRI 3URYLVLRQIRU(PSOR\HH%HQHoWV ([SHQGLWXUHGHELWHGLQ6WDWHPHQWRI3URoWDQG/RVVEXWDOORZHGIRUWD[ SXUSRVHVLQWKHIROORZLQJ\HDUV 3URYLVLRQIRUREVROHVFHQFHRI6SDUH3DUWV 2WKHUV Net Deferred Tax Liabilities 6.

3URYLVLRQIRUJUDWXLW\DQGVWDIIEHQHoWVFKHPHV /RQJVHUYLFHDZDUGDQGRWKHUEHQHoWSODQV 2WKHU3URYLVLRQV 3URYLVLRQIRU0LQHV5HVWRUDWLRQ TOTAL Movement of provision during the year as required by Accounting Standard 29: 0LQHV5HVWRUDWLRQ([SHQGLWXUH 2SHQLQJSURYLVLRQ $GG3URYLVLRQGXULQJWKH\HDU 0LQHVUHVWRUDWLRQH[SHQGLWXUHLVLQFXUUHGRQDQRQJRLQJEDVLVDQGXQWLOWKHFORVXUHRIWKHPLQH7KHDFWXDOH[SHQVHV PD\YDU\EDVHGRQWKHQDWXUHRIUHVWRUDWLRQDQGWKHHVWLPDWHRIUHVWRUDWLRQH[SHQGLWXUH 198 .

OTHER CURRENT LIABILITIES 2015  ` Crore `&URUH     6WDWXWRU\GXHV   $GYDQFHIURPFXVWRPHUV   6HFXULW\GHSRVLWVDQGUHWHQWLRQPRQH\   /LDELOLW\IRUFDSLWDOH[SHQGLWXUH   2WKHUSD\DEOHV     .QYHVWRU(GXFDWLRQDQG3URWHFWLRQ)XQG 5HIHU1RWH L.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31. 2015 (contd.) 7.

EHORZ.

Unpaid dividend 8QSDLG0DWXUHG'HSRVLWV LQFOXGLQJ5HEDWHVWRFXVWRPHUV(PSOR\HHVGXHVHWF.

TOTAL  L.

QYHVWRU (GXFDWLRQ DQG 3URWHFWLRQ )XQG DV DW 'HFHPEHU         8. SHORT-TERM PROVISIONS 2015  ` Crore `&URUH       3URYLVLRQIRU.  7KHUH DUH QR DPRXQWV GXH DQG RXWVWDQGLQJ WR EH FUHGLWHG WR .QFRPH7D[ 1HWRIDGYDQFHWD[.

  3URSRVHG)LQDO'LYLGHQG       3URYLVLRQIRUHPSOR\HHEHQHoWV 5HIHU1RWH.

3URYLVLRQIRUJUDWXLW\DQGVWDIIEHQHoWVFKHPHV 3URYLVLRQIRUFRPSHQVDWHGDEVHQFHV /RQJVHUYLFHDZDUGDQGRWKHUEHQHoWSODQV 2WKHU3URYLVLRQV 7D[RQSURSRVHGGLYLGHQG TOTAL 199 .

200   *RRGZLOO TOTAL                                                                                                                                1RWHV L.

960) LQ YDULRXV &RRSHUDWLYH +RXVLQJ 6RFLHWLHV LQ UHVSHFW RI  (Previous Year . %XLOGLQJV LQFOXGH FRVW RI VKDUHV `  (Previous Year .10) UHVLGHQWLDOpDW  LL.` 4.

` 23. %XLOGLQJVLQFOXGH*URVVEORFNRI`&URUH(Previous Year .86 Crore)DQG1HWEORFNRI`&URUH(Previous Year .27 Crore)LQUHVSHFWRI ZKLFKWKHWUDQVIHURIWLWOHGHHGVWRWKHQDPHRIWKH&RPSDQ\LVXQGHUSURFHVV  LLL.` 21.

48 Crore) and DFFXPXODWHGGHSUHFLDWLRQ`&URUH(Previous Year .48 Crore)  LY.` 28.3ODQWDQG(TXLSPHQWLQFOXGHVDVVHWVJLYHQRQOHDVHWR5DLOZD\VXQGHUk2ZQ<RXU:DJRQVy6FKHPHRI`&URUH(Previous Year .` 28.

` 0.12 Crore)FDSLWDOLVHGDVSUHRSHUDWLYHH[SHQVHV  Y.'HSUHFLDWLRQFKDUJHIRUWKH\HDULQFOXGH`&URUH(Previous Year .

 *RRGZLOOLVRQDFFRXQWRI.QYHVWPHQWLQVXEVLGLDULHV            Intangible Assets: &RPSXWHU6RIWZDUH TOTAL   9HKLFOHV 2IoFHHTXLSPHQW  )XUQLWXUH  )L[WXUHV   3ODQWDQG (TXLSPHQW 5DLOZD\6LGLQJV   /HDVHKROG/DQG %XLOGLQJV   )UHHKROG0LQLQJ /DQG    Tangible Assets : )UHHKROG1RQ 0LQLQJ/DQG Particulars `&URUH GROSS BLOCK AT COST DEPRECIATION / AMORTISATION NET BLOCK As at $VDW )RUWKH $GMXVWPHQWDVGLVFORVHG 'HGXFWLRQV As at As at $VDW $VDW $GGLWLRQV 'HGXFWLRQV  $GMXVWPHQWV $GMXVWPHQWV 31-12-2015  <HDU XQGHU([FHSWLRQDOLWHP $GMXVWPHQWV 31-12-2015 31-12-2015  5HIHU1RWH.

) . 9. 2015 (contd. FIXED ASSETS ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.

) Corporate Overview Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31. )UHHKROG0LQLQJ/DQG   *RRGZLOO TOTAL  &RPSXWHU6RIWZDUH .6$7.) 201 . Board & Management Reports 2IoFHHTXLSPHQW  )XUQLWXUH )L[WXUHV   3ODQWDQG(TXLSPHQW 5DLOZD\6LGLQJV     $VDW  '(35(&.$7&267 $VDW $GGLWLRQV 'HGXFWLRQV  $GMXVWPHQWV $GMXVWPHQWV )UHHKROG1RQ0LQLQJ/DQG 7DQJLEOH$VVHWV 3DUWLFXODUV 9. 2015 (contd. FIXED ASSETS (Contd.QWDQJLEOH$VVHWV                                                         )RUWKH <HDU              'HGXFWLRQV $GMXVWPHQWV              $VDW               $VDW               $VDW  Financial Statements TOTAL   9HKLFOHV        $VDW  1(7%/2&.21 `&URUH Financial Highlights %XLOGLQJV   /HDVHKROG/DQG *5266%/2&.$7.21$0257.

NON-CURRENT INVESTMENTS 9$/8('$7&26781/(6667$7('27+(5:. 2015 (contd.6(.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.) 10.

2015 Numbers  ` Crore 1XPEHUV `&URUH Trade Investments Unquoted equity instruments .23 Crore)} $GG6KDUHRI3URoW   /HVV'LYLGHQG5HFHLYHG  .QYHVWPHQWLQ$VVRFLDWHV Face value ` 10 each $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG     ^LQFOXGHVXQDPRUWLVHG*RRGZLOORI `&URUH(Previous Year .` 5.

 .

/HVV$PRUWLVDWLRQRI*RRGZLOO  .

 .

` 8.  $VLDQ&RQFUHWHVDQG&HPHQWV3ULYDWH/LPLWHG      ^LQFOXGHVXQDPRUWLVHG*RRGZLOORI `&URUH(Previous Year .16 Crore)} $GG6KDUHRI3URoW /HVV'LYLGHQG5HFHLYHG /HVV$PRUWLVDWLRQRI*RRGZLOO     .

 .

 .

75 Crore)} $GG6KDUHRI3URoW /HVV'LYLGHQG5HFHLYHG /HVV$PRUWLVDWLRQRI*RRGZLOO 202     .  $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH /LPLWHG      ^LQFOXGHVXQDPRUWLVHG*RRGZLOORI `&URUH(Previous Year .` 1.

 .

 .

    .

) 10.) 9$/8('$7&26781/(6667$7('27+(5:. NON-CURRENT INVESTMENTS (Contd.Corporate Overview Financial Highlights Financial Statements Board & Management Reports Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31. 2015 (contd.6(.

2015 Numbers  ` Crore `&URUH 1XPEHUV Non trade investments (a) Quoted equity instruments 6KLYD&HPHQW/LPLWHG )DFHYDOXH`HDFK.

QYHVWPHQWLQ%RQGV 8QTXRWHG.  /HVV'LPLQXWLRQLQWKHYDOXHRILQYHVWPHQW        (b) Investment in equity instruments (unquoted) Face value ` 10 each .DQRULD6XJDU *HQHUDO0IJ&RPSDQ\ /LPLWHG *XMDUDW&RPSRVLWHV/LPLWHG         5RKWDV.QGXVWULHV/LPLWHG     7KH-DLSXU8G\RJ/LPLWHG     'LJYLMD\)LQOHDVH/LPLWHG 7KH7UDYDQFRUH&HPHQW&RPSDQ\/LPLWHG $VKRND&HPHQW/LPLWHG            Face value ` 5 each 7KH6RQH9DOOH\3RUWODQG&HPHQW&RPSDQ\ /LPLWHG         .

 Face value ` 10.QIUDVWUXFWXUH 'HYHORSPHQW%RDUG%RQGV  /HVV &XUUHQW SRUWLRQ RI ORQJWHUP LQYHVWPHQWV           LL.000 each +LPDFKDO3UDGHVK.00.

 $JJUHJDWHDPRXQWRIXQTXRWHG.QYHVWPHQWV   LLL.

 $JJUHJDWHSURYLVLRQIRUGLPLQXWLRQLQYDOXHRILQYHVWPHQWV   TOTAL 1RWHV  L.

63 Crore)} LY.QYHVWPHQWV  ^0DUNHWYDOXH`&URUH(Previous Year . $JJUHJDWHDPRXQWRITXRWHG.` 9.

 'HQRWHVDPRXQWOHVVWKDQ` Y.

 $PRXQWLQFOXGHGXQGHUWKHKHDGk&XUUHQWLQYHVWPHQWVy 5HIHU1RWH.

203 .

6(67$7(' 2015  ` Crore `&URUH &DSLWDO$GYDQFHV   6HFXULW\GHSRVLWV             /RDQVDQGDGYDQFHVWRUHODWHGSDUWLHV^5HIHU1RWH +.) 11. LONG-TERM LOANS AND ADVANCES 816(&85('&216.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31. 2015 (contd.'(5('*22'81/(6627+(5:.

LY`   $GYDQFHVUHFRYHUDEOHLQFDVKRUNLQG   $GYDQFHWD[ 1HWRISURYLVLRQIRUWD[.

OTHER NON-CURRENT ASSETS 816(&85('&216.6(67$7(' .     2015  ` Crore `&URUH               'HSRVLWVZLWK*RYHUQPHQW%RGLHVDQG2WKHUV &RQVLGHUHGJRRG &RQVLGHUHGGRXEWIXO /HVV$OORZDQFHIRUGRXEWIXOGHSRVLWV TOTAL 12.'(5('*22'81/(6627+(5:.QFHQWLYHVXQGHU*RYHUQPHQWVFKHPHVDQGRWKHUUHFHLYDEOHV &RQVLGHUHGJRRG &RQVLGHUHGGRXEWIXO /HVV3URYLVLRQIRUGRXEWIXOUHFHLYDEOHV 1RQFXUUHQWEDQNEDODQFH 5HIHU1RWH.

TOTAL 204 .

Corporate Overview Financial Highlights Financial Statements Board & Management Reports Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.6(. CURRENT INVESTMENTS 9$/8('$7/2:(52)&267$1')$. 2015 (contd.) 13.59$/8(81/(6667$7('27+(5:.

QYHVWPHQW YDOXHGDWFRVW. 2015 Numbers  ` Crore `&URUH 1XPEHUV &XUUHQW3RUWLRQRI/RQJ7HUP.

 5HIHU1RWH.

.QYHVWPHQWLQ%RQGV 8QTXRWHG.

QIUDVWUXFWXUH 'HYHORSPHQW%RDUG%RQGV     .000 each +LPDFKDO3UDGHVK.00.QYHVWPHQWLQ&HUWLoFDWHRI'HSRVLWV )XOO\SDLGXS XQTXRWHG. Face value ` 10.

Unit of Face value ` 1.00.QGLD       205 .QGLD     3XQMDE1DWLRQDO%DQN     &DQDUD%DQN     8QLRQ%DQNRI.000 each .'%.%DQN/LPLWHG     +')&%DQN/LPLWHG     %DQNRI0DKDUDVKWUD     .RWDN0DKLQGUD%DQN/LPLWHG     $QGKUD%DQN     &RUSRUDWLRQ%DQN     2ULHQWDO%DQN     $OODKDEDG%DQN     %DQNRI.

6(.59$/8(81/(6667$7('27+(5:.) 13.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.) 9$/8('$7/2:(52)&267$1')$. 2015 (contd. CURRENT INVESTMENTS (contd.

2015 Numbers  ` Crore `&URUH 1XPEHUV .QYHVWPHQWLQ0XWXDO)XQGV)XOO\SDLGXS 8QTXRWHG.

QVWD&DVK3OXV)XQG*URZWK Unit of Face value ` 1.QYHVWPHQWV   .3UXGHQWLDO/LTXLG)XQG6XSHU./LTXLG)XQG*URZWK     / 7/LTXLG)XQG*URZWK     3UDPHULFD/LTXLG)XQG'LUHFW*URZWK     3ULQFLSDO&DVK0DQDJHPHQW)XQG*URZWK     '63%ODFNURFN0RQH\0DQDJHU)XQG5HJXODU 3ODQ*URZWK     7DXUXV/LTXLG)XQG([LVWLQJ3ODQ6XSHU .3*URZWK     5HOLDQFH/LTXLG)XQG*URZWK     .&.3UHPLHU/LTXLG)XQG6XSHU.&.RWDN)ORDWHU67*URZWK 5HOLDQFH/LTXLG)XQG7UHDVXU\SODQ*URZWK 5HOLJDUH/LTXLG)XQG*URZWK 206   TOTAL   $JJUHJDWHDPRXQWRIXQTXRWHG.QVWLWXWLRQDO*URZWK     5HOLDQFH/LTXLG)XQG&DVK3ODQ*URZWK     Unit of Face value ` 100 each ':6.RWDN)ORDWHU6KRUW7HUP*URZWK5HJXODU3ODQ     .3*URZWK     %LUOD6XQOLIH&DVK3OXV)XQG*URZWK                 6%.'%. Unit of Face value ` 10 each +')&&DVK0DQDJHPHQW*URZWK     6XQGDUDP0RQH\)XQG*URZWK         .000 each .

&+(9(5.6$%/(9$/8(:+.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31. 2015 (contd. INVENTORIES $7&267251(75($/.6/2:(5.) 14.

68 Crore)} 3DFNLQJ0DWHULDO )XHOV ^.` 15.QFOXGLQJLQWUDQVLW`&URUH(Previous Year . TRADE RECEIVABLES 7UDGHUHFHLYDEOHVRXWVWDQGLQJIRUDSHULRGH[FHHGLQJVL[PRQWKV IURPWKHGDWHWKH\DUHGXHIRUSD\PHQW /HVV3URYLVLRQIRUGRXEWIXOWUDGHUHFHLYDEOHV 2WKHU7UDGHUHFHLYDEOHV 6HFXUHGFRQVLGHUHGJRRG 8QVHFXUHGFRQVLGHUHGJRRG 8QVHFXUHGFRQVLGHUHGGRXEWIXO /HVV3URYLVLRQIRUGRXEWIXOWUDGHUHFHLYDEOHV TOTAL 207 .17 Crore)} TOTAL 15.` 16. 2015  ` Crore `&URUH   :RUNLQ3URJUHVV   )LQLVKHG*RRGV             2015  ` Crore `&URUH 8QVHFXUHGFRQVLGHUHGJRRG   &RQVLGHUHGGRXEWIXO                       5DZ0DWHULDOV ^.QFOXGLQJLQWUDQVLW`&URUH(Previous Year .32 Crore)} 6WRFNLQWUDGH 6WRUHV 6SDUH3DUWV ^.QFOXGLQJLQWUDQVLW`&URUH(Previous Year .` 11.

CASH AND BANK BALANCES &DVKDQGFDVKHTXLYDOHQWV %DODQFHVZLWKEDQNV 2QFXUUHQWDFFRXQWV 'HSRVLWVZLWKRULJLQDOPDWXULW\RIOHVVWKDQWKUHHPRQWKV 2QXQSDLGGLYLGHQGDFFRXQW &DVKRQKDQG 2WKHUEDQNEDODQFHV 'HSRVLWVZLWKRULJLQDOPDWXULW\IRUPRUHWKDQPRQWKV EXWOHVVWKDQPRQWKV 'HSRVLWVZLWKRULJLQDOPDWXULW\IRUPRUHWKDQPRQWKV /HVV$PRXQWGLVFORVHGXQGHURWKHUQRQFXUUHQWDVVHW 5HIHU1RWH. 2015 (contd.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.) 16.

QFOXGHV o[HG GHSRVLW ZLWK OLHQ LQ IDYRXU RI &RPSHWLWLRQ $SSHOODWH 7ULEXQDO &203$7. 3RVWRIoFHVDYLQJDFFRXQWV TOTAL   2015 ` Crore  `&URUH                         .

 RI ` 1LO (Previous Year `129.27 Crore) 5HIHU1RWH.

SHORT-TERM LOANS AND ADVANCES 816(&85('&216. OTHER CURRENT ASSETS 816(&85('&216.'(5('*22'81/(6627+(5:.QWHUHVW )L[HGDVVHWVKHOGIRUVDOH TOTAL 208 .6(67$7(' 6HFXULW\GHSRVLWV $GYDQFHVUHFRYHUDEOHLQFDVKRUNLQG 2WKHUORDQVDQGDGYDQFHV %DODQFHVZLWKVWDWXWRU\JRYHUQPHQWDXWKRULWLHV 'HSRVLWZLWK+')&/LPLWHG TOTAL 2015 ` Crore    `&URUH         2015 ` Crore      `&URUH     18.6(67$7(' .'(5('*22'81/(6627+(5:.         7KHVHEDODQFHVDUHDYDLODEOHIRUXVHRQO\WRZDUGVVHWWOHPHQWRIFRUUHVSRQGLQJXQSDLGGLYLGHQGOLDELOLWLHV  17.QWHUHVWDFFUXHGRQLQYHVWPHQWV 2WKHU$FFUXHG.

QFHQWLYHVDQG6XEVLGLHV   0LVFHOODQHRXV.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.QFRPH     6DOHRISURGXFWV )LQLVKHGJRRGV 7UDGHGJRRGV 6DOHRIVHUYLFHV 6DOHRISURGXFWVDQGVHUYLFHV JURVV.) 19. 2015 (contd. REVENUE FROM OPERATIONS 2015  ` Crore `&URUH                 2015  ` Crore `&URUH         &HPHQW   5HDG\0L[&RQFUHWH             .

/HVV([FLVHGXW\ 6DOHRISURGXFWVDQGVHUYLFHV QHW.

2WKHURSHUDWLQJUHYHQXH Revenue from operations (net) i) Details of products sold )LQLVKHGJRRGV 1HWRI([FLVHGXW\.

&HPHQW 5HDG\0L[&RQFUHWH &OLQNHU 7UDGHG*RRGV ii) Details of sale of services 3XPSLQJDQG&RQYHUVLRQVHUYLFHV iii) Detail of other operating revenue 3URYLVLRQQRORQJHUUHTXLUHGZULWWHQEDFN 6DOHRIVXUSOXVJHQHUDWHGSRZHU TOTAL 209 .

) 20. PURCHASE OF TRADED GOODS &HPHQW 5HDG\0L[&RQFUHWH TOTAL 210 2015 ` Crore     `&URUH    .QFLGHQWDOH[SHQVHV /HVV&ORVLQJ6WRFN TOTAL Details of cost of materials consumed 6ODJ Gypsum )O\$VK $JJUHJDWHV &HPHQW 2WKHUV TOTAL LQFOXGHV QR LWHP ZKLFK LQ YDOXH LQGLYLGXDOO\ DFFRXQWV IRU  SHUFHQW RU PRUH RI WKH WRWDO YDOXH RI PDWHULDOV FRQVXPHG 22.QWHUHVWRQ%DQNGHSRVLWV .ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31. COST OF MATERIALS CONSUMED 2SHQLQJ6WRFN 3XUFKDVHDQG.QWHUHVWRQ. OTHER INCOME .QFRPH7D[ 2WKHULQWHUHVWLQFRPH *DLQRQVDOHRIFXUUHQWLQYHVWPHQWV 2WKHU TOTAL 2015 ` Crore        `&URUH       2015 ` Crore       `&URUH      2015 ` Crore         `&URUH        21. 2015 (contd.

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31. 2015 (contd.QFUHDVH.) 23. CHANGES IN INVENTORIES OF FINISHED GOODS. WORK-IN-PROGRESS AND STOCK-IN-TRADE 2015  Inventories at the end of the year 6WRFNLQWUDGH )LQLVKHG*RRGV :RUNLQSURJUHVV Inventories at the beginning of the year 6WRFNLQWUDGH )LQLVKHG*RRGV :RUNLQSURJUHVV TOTAL ` Crore `&URUH .

 GHFUHDVH `&URUH          .

  .

           .

  .

  .

2015 ` Crore      `&URUH     2015 ` Crore     `&URUH    2015 ` Crore     `&URUH    24. EMPLOYEE BENEFITS EXPENSE 6DODULHVDQG:DJHV &RQWULEXWLRQVWR3URYLGHQWDQGRWKHU)XQGV 6WDII:HOIDUH([SHQVHV TOTAL 25.QWHUHVWRQ.QFRPH7D[ TOTAL 211 . FINANCE COST . FREIGHT AND FORWARDING EXPENSE 2Q&OLQNHUWUDQVIHU 2QoQLVKHGSURGXFWV TOTAL 26.QWHUHVWH[SHQVHV .

) 27.QRZKRZIHHV   0LVFHOODQHRXVH[SHQVHV 5HIHU1RWHEHORZ. DEPRECIATION AND AMORTIZATION EXPENSE 2015  ` Crore `&URUH       2015  ` Crore `&URUH &RQVXPSWLRQRIVWRUHVDQGVSDUHSDUWV   &RQVXPSWLRQRISDFNLQJPDWHULDOV           5HSDLUVWRPDFKLQHU\   5HSDLUVWRRWKHU. 2015 (contd.QVXUDQFH       $GYHUWLVHPHQW   7HFKQRORJ\DQG.WHPV   .ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.

OTHER EXPENSES ([FLVHGXW\YDULDWLRQRQRSHQLQJDQGFORVLQJVWRFN 5HQW 5DWHVDQGWD[HV 5HSDLUVWREXLOGLQJ 5R\DOW\RQPLQHUDOV Discount on sales TOTAL  0LVFHOODQHRXVH[SHQVHVLQFOXGHV  D.     'HSUHFLDWLRQRQWDQJLEOHDVVHWV $PRUWL]DWLRQRILQWDQJLEOHDVVHWV TOTAL 28.

 /RVVRQVDOHZULWHRIIRI)L[HG$VVHWV 1HW.

88 Crore)  E.`&URUH(Previous Year .` 15.

69 Crore) 212 .QYHVWPHQWZULWWHQRIIRI`1LO(Previous Year .` 0. 1RQFXUUHQW.

2015 (contd.[EPS] 1HW3URoWDVSHU6WDWHPHQWRI3URoWDQG/RVV :HLJKWHGDYHUDJHQXPEHURIHTXLW\VKDUHVIRU(DUQLQJV3HU6KDUHFRPSXWDWLRQ 6KDUHVIRU%DVLF(DUQLQJV3HU6KDUH $GG3RWHQWLDOGLOXWHGHTXLW\VKDUHVRQDFFRXQWRIVKDUHVLQDEH\DQFH 0RYHPHQWLQ1XPEHURIVKDUHVLVRQDFFRXQWRIFKDQJHLQIDLUYDOXHRIVKDUH. EARNINGS PER SHARE .Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.) 29.

EMPLOYEE BENEFITS: D. 1XPEHURI6KDUHVIRU'LOXWHG(DUQLQJV3HU6KDUH (DUQLQJV3HU6KDUH )DFHYDOXHSHU6KDUH %DVLF Diluted ` ` ` 2015 ` Crore   `&URUH              30.

82 Crore) E.` 14. 'HoQHG&RQWULEXWLRQ3ODQVq$PRXQWUHFRJQLVHGDQGLQFOXGHGLQ1RWHk&RQWULEXWLRQVWR3URYLGHQWDQG RWKHU)XQGVyRI6WDWHPHQWRI3URoWDQG/RVV`&URUH(Previous Year .

 'HoQHG%HQHoW3ODQVq$VSHUDFWXDULDOYDOXDWLRQRQ'HFHPEHU  7KH&RPSDQ\KDVDGHoQHGEHQHoWJUDWXLW\DGGLWLRQDOJUDWXLW\SRVWUHWLUHPHQWPHGLFDOEHQHoWSODQVDQG 7UXVWPDQDJHGSURYLGHQWIXQGSODQDVJLYHQEHORZ L (YHU\HPSOR\HHZKRKDVFRPSOHWHGPLQLPXPoYH\HDUVRIVHUYLFHLVHQWLWOHG WR JUDWXLW\ DW  GD\V VDODU\IRUHDFKFRPSOHWHG\HDURIVHUYLFHV7KHVFKHPHLVIXQGHGZLWKLQVXUDQFHFRPSDQLHVLQWKHIRUPRI TXDOLI\LQJLQVXUDQFHSROLFLHV LL (YHU\HPSOR\HHZKRKDVMRLQHGEHIRUHVW'HFHPEHUDQGVHSDUDWHVIURPVHUYLFHRIWKH&RPSDQ\RQ 6XSHUDQQXDWLRQDQGRQPHGLFDOJURXQGVLVHQWLWOHGWRDGGLWLRQDOJUDWXLW\7KHVFKHPHLV1RQ)XQGHG LLL %HQHoWV XQGHU 3RVW (PSOR\PHQW 0HGLFDO %HQHoW 3ODQV DUH SD\DEOH IRU DFWXDO GRPLFLOLDU\ WUHDWPHQW  KRVSLWDOL]DWLRQIRUHPSOR\HHVDQGWKHLUVSHFLoHGUHODWLYHV7KHVFKHPHLV1RQ)XQGHG LY 3URYLGHQWIXQGIRUFHUWDLQHOLJLEOHHPSOR\HHVLVPDQDJHGE\WKH&RPSDQ\WKURXJKWUXVWk7KH3URYLGHQW )XQG RI $&& /WGy LQ OLQH ZLWK WKH 3URYLGHQW )XQG DQG 0LVFHOODQHRXV 3URYLVLRQ $FW  7KH SODQ JXDUDQWHHV LQWHUHVW DW WKH UDWH QRWLoHG E\ WKH 3URYLGHQW )XQG $XWKRULWLHV 7KH FRQWULEXWLRQ E\ WKH HPSOR\HUDQGHPSOR\HHWRJHWKHUZLWKWKHLQWHUHVWDFFXPXODWHGWKHUHRQDUHSD\DEOHWRHPSOR\HHVDWWKH WLPHRIVHSDUDWLRQIURPWKH&RPSDQ\RUUHWLUHPHQWZKLFKHYHULVHDUOLHU7KHEHQHoWVYHVWVLPPHGLDWHO\ RQUHQGHULQJRIWKHVHUYLFHVE\WKHHPSOR\HH  7KHPLQLPXPLQWHUHVWUDWHSD\DEOHE\WKH7UXVWWRWKHEHQHoFLDULHVHYHU\\HDULVEHLQJQRWLoHGE\WKH *RYHUQPHQW7KH&RPSDQ\KDVDQREOLJDWLRQWRPDNHJRRGWKHVKRUWIDOOLIDQ\EHWZHHQWKHUHWXUQIURP WKHLQYHVWPHQWVRIWKH7UXVWDQGWKHQRWLoHGLQWHUHVWUDWH  7KH $6% *XLGDQFH RQ .PSOHPHQWLQJ $6 (PSOR\HH %HQHoWV UHYLVHG .

 LVVXHG E\ $FFRXQWLQJ 6WDQGDUGV%RDUG $6%.

QGLDWKH&RPSDQ\KDVREWDLQHGWKHDFWXDULDOYDOXDWLRQRI LQWHUHVWUDWHREOLJDWLRQLQUHVSHFWRI3URYLGHQW)XQGDQGWKHUHLVQRVKRUWIDOODVDW'HFHPEHUDQG 'HFHPEHU 213 .VWDWHVWKDWEHQHoWSODQVLQYROYLQJHPSOR\HUHVWDEOLVKHGSURYLGHQWIXQGVZKLFK UHTXLUHLQWHUHVWVKRUWIDOOVWREHUHFRPSHQVHGDUHWREHFRQVLGHUHGDVGHoQHGEHQHoWSODQV$VSHUWKH *XLGDQFH1RWHIURPWKH$FWXDULDO6RFLHW\RI.

) 'HoQHG%HQHoW3ODQVDVSHU$FWXDULDOYDOXDWLRQRQ'HFHPEHU *UDWXLW\ . EMPLOYEE BENEFITS (Contd.QFOXGLQJ DGGLWLRQDOJUDWXLW\.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.) 30. 2015 (contd.

)XQGHG `&URUH I II ([SHQVHUHFRJQLVHGLQWKH6WDWHPHQWRI3URoW  Loss – for the year ended December 31. 2015  &XUUHQW6HUYLFHFRVW  .QWHUHVW&RVW  (PSOR\HH&RQWULEXWLRQV  ([SHFWHGUHWXUQRQSODQDVVHWV  1HW$FWXDULDO *DLQV.

/RVVHV  7RWDOH[SHQVH Amount recognised in Balance Sheet  3UHVHQWYDOXHRI'HoQHG%HQHoW2EOLJDWLRQ  )DLUYDOXHRISODQDVVHWV  )XQGHGVWDWXV^6XUSOXV 'HoFLW.

`  1HWDVVHW OLDELOLW\.

DVDW'HFHPEHU III 3UHVHQW9DOXHRI'HoQHG%HQHoW2EOLJDWLRQ  3UHVHQWYDOXHRI'HoQHG%HQHoW2EOLJDWLRQDW EHJLQQLQJRIWKH\HDU  &XUUHQW6HUYLFHFRVW  .QWHUHVW&RVW  (PSOR\HH&RQWULEXWLRQV  $FWXDULDO *DLQV.

/RVVHV  %HQHoWV3D\PHQWV  1HWWUDQVIHULQ RXW.

 3UHVHQWYDOXHRI'HoQHG%HQHoW2EOLJDWLRQDW WKHHQGRIWKH\HDU )LJXUHVLQLWDOLFVSHUWDLQWRSUHYLRXV\HDU.

214 1RQ)XQGHG `&URUH 3RVW 3URYLGHQW (PSOR\PHQW IXQG 0HGLFDOEHQHoWV 3(0%.

05  13. `&URUH `&URUH  10.71   .

36  .36)  18.99  30.04  0. (12.57  6.51  19.03    8.39  4.11  0.

66  19.97  39.07   .32)   2. (0.58  2.

04)  (6. (40.51)  .51)  (25.

(188.24  .36)  177.

12)  . (11.

12)  . (11.

(85.42)   .

(85.42)  .

42)  . (85.

26)   . (6.

(6.26)  .

(6.26)  .

32  .97     165.05  13.19  27.97  27. (492.22)  520.88  10.71   21.

18  4. (22.03   8.57  6.60)   71.51  .

04  0.18  0.36  .87)   4. (4.

32)  2. (0.58  .

97  39.68  (3.07  41. (0.58)   445.67  19.96)  .

43)  . (15.

(34.36 85.22 .42 6.78)  188.26 492.

) *UDWXLW\ . 2015 (contd.) 30. EMPLOYEE BENEFITS (Contd.QFOXGLQJ DGGLWLRQDOJUDWXLW\.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.

)XQGHG `&URUH IV Fair Value of Plan Assets  3ODQDVVHWVDWWKHEHJLQQLQJRIWKH\HDU V  ([SHFWHGUHWXUQRQSODQDVVHWV  &RQWULEXWLRQVE\(PSOR\HU  &RQWULEXWLRQVE\(PSOR\HH  $FWXDOEHQHoWVSDLG  1HWWUDQVIHULQ RXW.

 $FWXDULDO*DLQV /RVVHV.

 3ODQDVVHWVDWWKHHQGRIWKH\HDU  $FWXDOUHWXUQRQSODQDVVHWV The major categories of plan assets as a percentage of total plan *RYHUQPHQWVHFXULWLHV 'HEHQWXUHVDQG%RQGV (TXLW\6KDUHV )L[HG'HSRVLWV VI 3RVW 3URYLGHQW (PSOR\PHQW IXQG 0HGLFDOEHQHoWV 3(0%.

75   .36  12.80  12. 1RQ)XQGHG `&URUH  149.

QFUHDVH 'HFUHDVH.69 *UDWXLW\ 2015 %      Effect of One percentage point change in the assumed Medical .24  14.QpDWLRQUDWH .33  177.   2.

RQDJJUHJDWHVHUYLFHDQGLQWHUHVWFRVWRI3RVW (PSOR\PHQW0HGLFDOEHQHoWV .QFUHDVH 'HFUHDVH.

RQ3UHVHQWYDOXHRI'HoQHG%HQHoW2EOLJDWLRQDV DW'HFHPEHU )LJXUHVLQLWDOLFVSHUWDLQWRSUHYLRXV\HDU.

68  .51  19.55  40.60  41. `&URUH                 `&URUH          -  447.

45)  . (15.

(34.78)  .

59 3URYLGHQWIXQG 2015  %            One percentage increase ` Crore One percentage decrease ` Crore  0.03 . 21.08  520.19  61.

02)  0. (0.32 .

(0.31) 215 .

) 30.) VII Actuarial Assumptions: a) Financial Assumptions     'LVFRXQW5DWH ([SHFWHGUDWHRIUHWXUQRQSODQDVVHWV *UDWXLW\. 2015 (contd. EMPLOYEE BENEFITS (Contd.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.

([SHFWHGUDWHRIUHWXUQRQSODQDVVHWV 3URYLGHQWIXQG.

7% p.31% p.a. 6DODU\LQFUHDVHUDWH SD(P.27% p.) SD(P...7.Y.a..Y.) b) Demographic Assumptions  0RUWDOLW\SUHUHWLUHPHQW .8.) SD(P.Y.50% p.a.a.. (P.Y.QGLDQ$VVXUHG/LYHV0RUWDOLW\ .9.) 9.90 % p.a.

 0RGLoHG.

QGLDQ$VVXUHG/LYHV0RUWDOLW\ .8OWLPDWH .

 0RGLoHG.

8OWLPDWH  0RUWDOLW\SRVWqUHWLUHPHQW 0RUWDOLW\IRUDQQXLWDQWV/.& .

5% p.XOWLPDWH Mortality for annuitants LIC (1996-98) ultimate  7XUQRYHUUDWH SD(P.a. .Y.)  0HGLFDOSUHPLXPLQpDWLRQ SDIRUWKHoUVW\HDUVDQGWKHUHDIWHUSD SDIRUWKHoUVW\HDUVDQGWKHUHDIWHUSD )LJXUHVLQLWDOLFVSHUWDLQWRSUHYLRXV\HDU.

    F.

&.QVXUDQFH &RUSRUDWLRQ /. %DVLVXVHGWRGHWHUPLQHH[SHFWHGUDWHRIUHWXUQRQDVVHWV   7KHH[SHFWHGUHWXUQRQSODQDVVHWVLVEDVHGRQPDUNHWH[SHFWDWLRQDWWKHEHJLQQLQJRIWKHSHULRGIRU UHWXUQVRYHUWKHHQWLUHOLIHRIWKHUHODWHGREOLJDWLRQ7KH*UDWXLW\6FKHPHLVLQYHVWHGLQ/LIH.

QGLD V *URXS *UDWXLW\qFXP/LIH $VVXUDQFH FDVK DFFXPXODWLRQ SROLF\ DQG +')& 6WDQGDUG/LIH V*URXS8QLW/LQNHG3ODQ)RU'HoQHG%HQHoW6FKHPH 7KH7UXVWIRUPHGE\WKH&RPSDQ\PDQDJHVWKHLQYHVWPHQWVRISURYLGHQWIXQGSODQ  G. RI .

7KH HVWLPDWHV RI IXWXUH VDODU\ LQFUHDVHV FRQVLGHUHG LQ DFWXDULDO YDOXDWLRQ WDNH DFFRXQW RI LQpDWLRQ VHQLRULW\ SURPRWLRQ DQG RWKHU UHOHYDQW IDFWRUV VXFK DV VXSSO\ DQG GHPDQG LQ WKH HPSOR\PHQW PDUNHW H.

7KH &RPSDQ\ H[SHFWV WR FRQWULEXWH `  &URUH (Previous Year .00 Crore) WR *UDWXLW\ IXQG DQG `&URUH(Previous Year .` 19.12 Crore)WRWUXVWPDQDJHGSURYLGHQWIXQGLQWKH\HDU I.` 9.

3RVWHPSOR\PHQWGHoQHGEHQHoWSODQH[SHQVHVDUHLQFOXGHGXQGHUHPSOR\HHEHQHoWH[SHQVHVLQWKH VWDWHPHQWRI3URoWDQG/RVV         g) $PRXQWVIRUWKHFXUUHQWDQGSUHYLRXVIRXU\HDUVDUHDVIROORZV L.

 *UDWXLW\ )XQGHG.

`&URUH 2015 2014 2013 2012 2011  .

 .

 .

 .

 .

     6XUSOXV GHoFLW.

 .

 .

 .

 .

 .

([SHULHQFHDGMXVWPHQWVRQSODQDVVHWV  .

 .

 .

 .

 .

     'HoQHGEHQHoWREOLJDWLRQ 3ODQDVVHWV ([SHULHQFHDGMXVWPHQWVRQSODQOLDELOLWLHV 216 .

) LL. 2015 (contd. EMPLOYEE BENEFITS (Contd.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.) 30.

*UDWXLW\ 1RQIXQGHG.

` &URUH 2015 2014 2013 2012 2011  .

 .

 .

 .

 .

      .

 .

 .

 .

 .

([SHULHQFHDGMXVWPHQWVRQSODQDVVHWV 1$ 1$ 1$ 1$ 1$ ([SHULHQFHDGMXVWPHQWVRQSODQOLDELOLWLHV      'HoQHGEHQHoWREOLJDWLRQ 3ODQDVVHWV 6XUSOXV GHoFLW.

LLL.

3RVW(PSOR\PHQW0HGLFDO%HQHoWV `&URUH 'HoQHGEHQHoWREOLJDWLRQ 3ODQDVVHWV 6XUSOXV GHoFLW.

([SHULHQFHDGMXVWPHQWVRQSODQDVVHWV ([SHULHQFHDGMXVWPHQWVRQSODQOLDELOLWLHV 2015 2014 2013 2012 2011  .

 .

 .

 .

 .

      .

 .

 .

 .

 .

1$ 1$ 1$ 1$ 1$  .

    LY.

3URYLGHQW)XQG `&URUH 2015 'HoQHGEHQHoWREOLJDWLRQ 3ODQDVVHWV 2014 2013 2012 2011  .

  .

  .

  .

  .

      6XUSOXV GHoFLW.

     ([SHULHQFHDGMXVWPHQWVRQSODQDVVHWV  .

   .

 ([SHULHQFHDGMXVWPHQWVRQSODQOLDELOLWLHV   .

 .

 .

 6LQFHWKHUHLVVXUSOXVWKHVDPHKDVQRWEHHQUHFRJQLVHGLQ%DODQFH6KHHWRQO\OLDELOLW\UHFRJQLVHGLQ %DODQFH6KHHW ([SHULHQFHDGMXVWPHQWVLQIRUPDWLRQIRUWKH\HDULVQRWDYDLODEOHKHQFHQRWGLVFORVHG K.

 $PRXQWUHFRJQLVHGDVDQH[SHQVHXQGHUHPSOR\HHEHQHoWH[SHQVHVLQWKHVWDWHPHQWRI3URoWDQG/RVVLQ UHVSHFWRIRWKHUORQJWHUPEHQHoWVLV`&URUH(Previous Year . L.` 39.89 Crore).

22 Crore)'XULQJ WKH\HDUWKH&RPSDQ\KDVFRQWULEXWHG`&URUHWRWKHIXQGDJDLQVWSURYLVLRQIRUFRPSHQVDWHGDEVHQFHV M. 3UHVHQWYDOXHRIFRPSHQVDWHGDEVHQFHVDW\HDUHQGLV`&URUH (Previous year ` 109.

 3UHVHQW YDOXH RI /RQJ VHUYLFH DZDUG DQG RWKHU EHQHoW SODQ REOLJDWLRQ DW \HDU HQG LV `  &URUH (Previous Year ` 9.88 Crore)7KLVVFKHPHLVQRQIXQGHG 217 .

) 31.QGLD$VVXFKWKHUHLVRQO\RQHJHRJUDSKLFDOVHJPHQW INFORMATION ABOUT PRIMARY BUSINESS SEGMENTS `&URUH &HPHQW 2015 REVENUE ([WHUQDOVDOHV 2WKHURSHUDWLQJUHYHQXH .ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.QWHUVHJPHQWVDOHV /HVV(OLPLQDWLRQ Total revenue RESULT Segment result 8QDOORFDWHG FRUSRUDWH LQFRPH QHW RII 8QDOORFDWHG H[SHQGLWXUH. 2015 (contd. SEGMENT REPORTING 7KH&RPSDQ\KDVGLVFORVHG%XVLQHVV6HJPHQWDVWKHSULPDU\VHJPHQW6HJPHQWVKDYHEHHQLGHQWLoHGWDNLQJLQWR DFFRXQWWKHQDWXUHRIWKHSURGXFWVWKHGLIIHULQJULVNVDQGUHWXUQVWKHRUJDQLVDWLRQVWUXFWXUHDQGLQWHUQDOUHSRUWLQJ V\VWHP7KH&RPSDQ\ VRSHUDWLRQVSUHGRPLQDQWO\UHODWHWRPDQXIDFWXUHRIFHPHQWDQG5HDG\0L[&RQFUHWH7KH H[SRUWWXUQRYHULVQRWVLJQLoFDQWLQWKHFRQWH[WRIWRWDOWXUQRYHURIWKHFRPSDQ\DQGIXUWKHUWKHULVNDQGUHWXUQV DUHQRWVLJQLoFDQWO\GLIIHUHQWIURPWKDWRI.

QWHUHVWDQG'LYLGHQGLQFRPH ([FHSWLRQDOLWHP 5HIHU1RWH. 2SHUDWLQJ3URoW )LQDQFH&RVWV .

7D[H[SHQVHV 3URoWDIWHUWD[ OTHER INFORMATION 6HJPHQWDVVHWV 8QDOORFDWHG&RUSRUDWHDVVHWV Total assets 6HJPHQWOLDELOLWLHV 8QDOORFDWHG&RUSRUDWHOLDELOLWLHV Total liabilities &DSLWDO H[SHQGLWXUH LQFOXGLQJ FDSLWDO ZRUNLQSURJUHVV.

'HSUHFLDWLRQDQG$PRUWL]DWLRQ .QFOXGLQJH[FHSWLRQDOLWHP.

2WKHUQRQFDVKH[SHQVHV 218           .

 .

969.06 10.98 864.73 933.23   5HDG\0L[&RQFUHWH 2015       .818. 10.

10 25.09 Total 2015               . 979.

 .

 .

26  .40  900.82  949.81 11.797.16 11.17 889. 768.79 16.738.

  .

 .

10  .55 989. 575.

63       4.463.67       12.    1.96 12.378.150.681.82   4.95                   .799.

OPERATING LEASE 2015  ` Crore `&URUH       D.) 32. 2015 (contd.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.

 )XWXUHPLQLPXPUHQWDOSD\DEOHVXQGHUQRQFDQFHOODEOHRSHUDWLQJOHDVH L.

1RWODWHUWKDQRQH\HDU LL.

/DWHUWKDQRQH\HDUDQGQRWODWHUWKDQoYH\HDUV LLL.

/DWHUWKDQoYH\HDUV E.

` 133. 2SHUDWLQJ OHDVH SD\PHQW UHFRJQLVHG LQ 6WDWHPHQW RI 3URoW DQG /RVV DPRXQWLQJ WR `  &URUH (Previous Year .82 Crore) F.

 *HQHUDOGHVFULSWLRQRIWKHOHDVLQJDUUDQJHPHQW   L.

 /HDVHG$VVHWV*ULQGLQJIDFLOLW\&RQFUHWHSXPSV*RGRZQV7UDQVLW0L[HU)ODWV2IoFHSUHPLVHVDQGRWKHU SUHPLVHV       LL.

 )XWXUHOHDVHUHQWDOVDUHGHWHUPLQHGRQWKHEDVLVRIDJUHHGWHUPV LLL.

 7KHUH LV QR HVFDODWLRQ FODXVH LQ WKH OHDVH DJUHHPHQW 7KHUH DUH QR UHVWULFWLRQV LPSRVHG E\ OHDVH DUUDQJHPHQWV7KHUHDUHQRVXEOHDVHV     LY.

RELATED PARTY DISCLOSURE (A) 1DPHVRIWKH5HODWHGSDUWLHVZKHUHFRQWUROH[LVWV Nature of Relationship  /DIDUJH+ROFLP/WG )RUPHUO\NQRZQDV+ROFLP/WG. $WWKHH[SLU\RIWKHOHDVHWHUPWKH&RPSDQ\KDVDQRSWLRQHLWKHUWRUHWXUQWKHDVVHWRUH[WHQGWKHWHUP E\JLYLQJQRWLFHLQZULWLQJ 33.

8OWLPDWH+ROGLQJ&RPSDQ\  +ROGHULQG.QGLD.QYHVWPHQWV/WG +ROGLQJ&RPSDQ\RI+ROFLP .

QGLD.3ULYDWH/LPLWHG  +ROFLP .

3ULYDWH/LPLWHG +ROGLQJ&RPSDQ\  03$05/ 6HPDULD.

&RDO&RPSDQ\/LPLWHG -RLQW9HQWXUHRI$&&0LQHUDO5HVRXUFHV/LPLWHG  03$05/ %LFKDUSXU.

&RDO&RPSDQ\/LPLWHG -RLQW9HQWXUHRI$&&0LQHUDO5HVRXUFHV/LPLWHG  03$05/ 0DUNL%DUND.

&RDO&RPSDQ\/LPLWHG -RLQW9HQWXUHRI$&&0LQHUDO5HVRXUFHV/LPLWHG  03$05/ 0RUJD.

&RDO&RPSDQ\/LPLWHG -RLQW9HQWXUHRI$&&0LQHUDO5HVRXUFHV/LPLWHG  2QHLQGLD%6&3ULYDWH/LPLWHG -RLQWYHQWXUH&RPSDQ\ ZHIWK$XJXVW.

(B) 2WKHUV:LWKZKRPWUDQVDFWLRQVKDYHEHHQWDNHQSODFHGXULQJWKH\HDU (a) Names of other Related parties Nature of Relationship  $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG $VVRFLDWH&RPSDQ\  $VLDQ&RQFUHWHVDQG&HPHQWV3ULYDWH/LPLWHG $VVRFLDWH&RPSDQ\  $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG $VVRFLDWH&RPSDQ\  /DIDUJH.QGLD3ULYDWH/LPLWHG  $PEXMD&HPHQWV/LPLWHG )HOORZ6XEVLGLDU\  +ROFLP7HFKQRORJ\ 6LQJDSRUH.

3WH/WG )HOORZ6XEVLGLDU\ ZHI-XO\.

 )HOORZ6XEVLGLDU\ 219 .

ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.) Names of other Related parties Nature of Relationship  +ROFLP /DQND. 2015 (contd.

QGRQHVLD7EN )HOORZ6XEVLGLDU\  +ROFLP6HUYLFHV 6RXWK$VLD./WG )HOORZ6XEVLGLDU\  37+ROFLP.

/LPLWHG )HOORZ6XEVLGLDU\  +ROFLP&HPHQW %DQJODGHVK.

/WG )HOORZ6XEVLGLDU\  +ROFLP 9LHWQDP.

/WG )HOORZ6XEVLGLDU\  +ROFLP 0DOD\VLD.

6'1%KG )HOORZ6XEVLGLDU\  +ROFLP)RXQGDWLRQ (QWLW\FRQWUROOHGE\/DIDUJH+ROFLP/WG  +ROFLP3KLOLSSLQHV )HOORZ6XEVLGLDU\  +ROFLP6HUYLFHV $VLD.

QGXVWULHV&R )HOORZ6XEVLGLDU\  1DWLRQDO&HPHQW)DFWRU\ $VVRFLDWH&RPSDQ\RI)HOORZ6XEVLGLDU\  +ROFLP 5RPDQLD./WG )HOORZ6XEVLGLDU\  +ROFLP*URXS6HUYLFHV/WG )HOORZ6XEVLGLDU\  +ROFLP7HFKQRORJ\/WG )HOORZ6XEVLGLDU\  +ROFLP7UDGLQJ3WH/WG )HOORZ6XEVLGLDU\  $/-DERU&HPHQW.

6$ )HOORZ6XEVLGLDU\  +ROFLP$]HUEDLMDQ )HOORZ6XEVLGLDU\  +ROFLP &DQDGD.

.QF )HOORZ6XEVLGLDU\ (b) Key Management Personnel: Name of the Related Party Nature of Relationship  0U+DULVK%DGDPL &(2 0DQDJLQJ'LUHFWRU ZHIWK$XJXVW.

  0U.DXUD &(2 0DQDJLQJ'LUHFWRU 8SWRWK$XJXVW.XOGLS..

  0U6XQLO.1D\DN &KLHI)LQDQFLDO2IoFHU  0U%XUMRU'1DULPDQ &RPSDQ\6HFUHWDU\ &.

 7UDQVDFWLRQVZLWK$VVRFLDWH&RPSDQLHV (i) (ii) 2015  ` Crore `&URUH 175.66 138.24 $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG 5HIHU1RWH.

64   Purchase of Finished Goods (iii) 6DOHRI8QoQLVKHG*RRGV $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG 5HIHU1RWH.82 31.   $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG   3XUFKDVHRI5DZ0DWHULDOV 29.13 23.40 $VLDQ&RQFUHWHVDQG&HPHQWV3ULYDWH/LPLWHG   30.

220 .

2015 (contd.) (C) 7UDQVDFWLRQVZLWK$VVRFLDWH&RPSDQLHV FRQWG.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.

16   60. 2015  ` Crore `&URUH 22.48 6.34 $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG     27.96   1.11 1.86 $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG   $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG   $VLDQ&RQFUHWHVDQG&HPHQWV3ULYDWH/LPLWHG   10.80   Dividend Received 2.99 8.87     1.54 24.04 9.91 10.17 $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG   Outstanding balance included in Trade receivables 13.16 51.74 1.38       (iv) Sale of Finished Goods $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG (v) (vi) Reimbursement of Expenses Received / Receivable $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG (vii) Rendering of Services $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG (viii) Receiving of Services $VLDQ&RQFUHWHVDQG&HPHQWV3ULYDWH/LPLWHG (ix) Other recoveries (Net) (x) $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG (xi) Outstanding balance included in Trade payables $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG $DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG $VLDQ&RQFUHWHVDQG&HPHQWV3ULYDWH/LPLWHG 221 .

28 321.06 +ROFLP . 2015 (contd.QGLD.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.) (D) Details of Transactions relating to Holding Companies 2015  ` Crore `&URUH Dividend paid 283.

19 15.81   38.26     +ROGHULQG.37 $PEXMD&HPHQWV/LPLWHG   /DIDUJH.QYHVWPHQWV/WG (E) 'HWDLOVRI7UDQVDFWLRQVUHODWLQJWR)HOORZ6XEVLGLDU\&RPSDQLHV (i) (ii) $PEXMD&HPHQWV/LPLWHG (iv) 6DOHRI)LQLVKHG8QoQLVKHG*RRGV (v) (vi) 6DOHRI5DZ0DWHULDO $PEXMD&HPHQWV/LPLWHG (vii) Rendering of Services $PEXMD&HPHQWV/LPLWHG 2WKHUV 222 .26 1.14   8.QGLD3ULYDWH/LPLWHG   Sale of Stores & Spare Parts 0.72 +ROFLP7UDGLQJ3WH/WG   $PEXMD&HPHQWV/LPLWHG   3XUFKDVHRI)LQLVKHG8QoQLVKHG*RRGV 59.43 126.24 $PEXMD&HPHQWV/LPLWHG   - 0.QGLD3ULYDWH/LPLWHG   (iii) Purchase of Stores & Spare Parts 0.45 168.56 2.92 $PEXMD&HPHQWV/LPLWHG   /DIDUJH.3ULYDWH/LPLWHG     2015  ` Crore `&URUH 3XUFKDVHRI5DZ0DWHULDOV 7.92 44.

2015 (contd.) (E) 'HWDLOVRI7UDQVDFWLRQVUHODWLQJWR)HOORZ6XEVLGLDU\&RPSDQLHV FRQWG.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.

04 4. 2015  ` Crore `&URUH 2.88 $PEXMD&HPHQWV/LPLWHG   +ROFLP7HFKQRORJ\ 6LQJDSRUH.84     7.07 4.

3WH/WG   +ROFLP /DQND.

46 13./WG       Receiving of Services 76.76 $PEXMD&HPHQWV/LPLWHG   +ROFLP*URXS6HUYLFHV/WG         112.53 68.01   /DIDUJH.QGLD3ULYDWH/LPLWHG   +ROFLP /DQND.76 112.91   27.

/WG   2WKHUV   0.07   (viii) Reimbursement of Expenses Paid / Payable $PEXMD&HPHQWV/LPLWHG 2WKHUV (ix) Reimbursement of Expenses Received / Receivable +ROFLP 0DOD\VLD.18 1.

6'1%KG 2WKHUV (x) +ROFLP6HUYLFHV 6RXWK$VLD.

/LPLWHG +ROFLP7HFKQRORJ\/WG 2WKHUV (xi) 7HFKQRORJ\DQG.QRZKRZIHHV +ROFLP7HFKQRORJ\/WG (xii) Outstanding balance included in Trade receivables $PEXMD&HPHQWV/LPLWHG (xiii) Outstanding balance included in Short-term loans and advances $PEXMD&HPHQWV/LPLWHG 223 .

) (E) 'HWDLOVRI7UDQVDFWLRQVUHODWLQJWR)HOORZ6XEVLGLDU\&RPSDQLHV FRQWG.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31. 2015 (contd.

2015  ` Crore `&URUH 62.82 52.89 $PEXMD&HPHQWV/LPLWHG   +ROFLP7HFKQRORJ\/WG   +ROFLP6HUYLFHV 6RXWK$VLD.

DXUD 8SWRWK$XJXVW./LPLWHG   /DIDUJH.QGLD3ULYDWH/LPLWHG   +ROFLP*URXS6HUYLFHV/WG   +ROFLP7UDGLQJ3WH/WG   2WKHUV   2015 2014 ` Crore `&URUH Rendering of Services - 0.01 1DWLRQDO&HPHQW)DFWRU\   2015 2014 ` Crore 9.69 0U.46 `&URUH 10.XOGLS..

  0U+DULVK%DGDPL ZHIWK$XJXVW.

DXUD 0U+DULVK%DGDPL 3URYLVLRQ IRU FRQWULEXWLRQ WR JUDWXLW\ IXQG OHDYH HQFDVKPHQW RQ UHWLUHPHQW DQG RWKHU GHoQHG EHQHoWVZKLFKDUHPDGHEDVHGRQDFWXDULDOYDOXDWLRQRQDQRYHUDOO&RPSDQ\EDVLVDUHQRWLQFOXGHGLQ UHPXQHUDWLRQWRNH\PDQDJHPHQWSHUVRQQHO 224 .38 0.   0U6XQLO.XOGLS.1D\DN   0U%XUMRU'1DULPDQ   Outstanding balance included in Other Current Liabilities 0..99     (xiv) Outstanding balance included in Trade payables (F) 'HWDLOVRI7UDQVDFWLRQUHODWLQJWR$VVRFLDWH&RPSDQ\RI)HOORZ6XEVLGLDU\ (G) 'HWDLOVRI7UDQVDFWLRQZLWK.H\0DQDJHPHQW3HUVRQQHO (i) (ii) Remuneration* 0U.

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.22 03$05/ 6HPDULD. 2015 (contd.) (H) 'HWDLOVRI7UDQVDFWLRQVZLWK-RLQW9HQWXUH&RPSDQLHV (i) (ii) 2015  ` Crore `&URUH Advances given 3.82 44.

&RDO&RPSDQ\/LPLWHG   03$05/ %LFKDUSXU.

&RDO&RPSDQ\/LPLWHG   03$05/ 0DUNL%DUND.

&RDO&RPSDQ\/LPLWHG   03$05/ 0RUJD.

77 03$05/ 6HPDULD.33 2.&RDO&RPSDQ\/LPLWHG   Interest on Inter Corporate Deposit / Other advances received 1.

&RDO&RPSDQ\/LPLWHG   03$05/ %LFKDUSXU.

&RDO&RPSDQ\/LPLWHG   03$05/ 0DUNL%DUND.

22   03$05/ %LFKDUSXU.&RDO&RPSDQ\/LPLWHG     74.37 69.

&RDO&RPSDQ\/LPLWHG   03$05/ 0DUNL%DUND.

&RDO&RPSDQ\/LPLWHG     03$05/ 0RUJD.

&RDO&RPSDQ\/LPLWHG (iv) Outstanding balance in Long-term loans and advances 03$05/ 6HPDULD.

&RDO&RPSDQ\/LPLWHG 03$05/ 0RUJD.

&RDO&RPSDQ\/LPLWHG 7UDQVDFWLRQVZLWK-RLQW9HQWXUHVKDYHEHHQGLVFORVHGDWIXOOYDOXH 225 .

74 31.32 (a)} 2015 2014 ` Crore ` Crore 293.27 250.70 73. 2015 (contd.16 30. CAPITAL AND OTHER COMMITMENTS A) Estimated value of contracts in capital account remaining to be executed B) For commitments relating to lease arrangements {Refer Note .46 19.43 30.79 0.84 2015 ` Crore 2014 ` Crore 28.) 34.36 35.31 719.87 28.79 29.97 36.79 223.57 73.97 36.46 19. (A) CONTINGENT LIABILITIES NOT PROVIDED FOR - a) Claims not acknowledged by the Company Sales tax Customs demand Claim by Suppliers Labour related Claims for mining Lease rent Mines and Geology Others TOTAL b) F.87 33.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.

actually mined and recorded through statutory documentation.6 tonnes of Limestone to 1 tonne of Cement produced at its factories in Chattisgarh and on cement produced vis a vis consumption of limestone at its factory in Tamil Nadu. 226 . Government Bodies and others 279. .45 Crore (Previous Year – Nil) given by an associate company on behalf of other for the purpose of taking loan. and not based on any ratio. The Madhya Pradesh High Court has decided this matter in favour of the Company by directing the Authorities to only demand Royalty based on quantity of Limestone.59 Crore) towards demand of additional Royalty on Limestone based on the ratio of 1.QUHVSHFWRIDERYHPDWWHUVIXWXUHFDVKRXWpRZVLQUHVSHFWRIFRQWLQJHQWOLDELOLWLHVDUHGHWHUPLQDEOHRQO\RQ receipt of judgments pending at various forums / authorities.18 341. The Company holds the view that the payment of royalty on limestone is correctly made by the Company based on the actual quantity of limestone extracted. Guarantee/s given to Banks/Financial Institutions. 7KH&RPSDQ\KDGoOHGZULWDSSHDOSHWLWLRQVDJDLQVWWKHRUGHUVQRWLFHVRIYDULRXVDXWKRULWLHVGHPDQGLQJ ` 114. #Indemnity. and feels that similar relief can also be expected from the Judiciary and / or Authorities in the cases of Chattisgarh & Tamil Nadu Units.73 # includes proportionate share of guarantee amounting to ` 0. In view of the demand being OHJDOO\ XQMXVWLoDEOH DQG GXH WR WKH GHFLVLRQ RI WKH 0DGK\D 3UDGHVK +LJK &RXUW GLUHFWO\ RQ WKLV LVVXH WKH Company does not expect any liability in above matter .24 Crore (Previous Year – ` 106.

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.) 35. 2015 (contd. (B) MATERIAL DEMANDS AND DISPUTES CONSIDERED AS “REMOTE” BY THE COMPANY D.

 7KH&RPSDQ\KDGDYDLOHG6DOHV7D[.QFHQWLYHVLQUHVSHFWRILW VQHZ073$3ODQWDW*DJDO *DJDO.

QGXVWULDO3ROLF\7KH&RPSDQ\KDGDFFUXHG6DOHV7D[.XQGHUWKH +36WDWH.QFHQWLYHVDJJUHJDWLQJ`&URUH7KH 6DOHV7D[$XWKRULWLHVKDGLQWURGXFHGFHUWDLQUHVWULFWLYHFRQGLWLRQVDIWHUFRPPLVVLRQLQJRIWKHXQLWVWLSXODWLQJ WKDW LQFHQWLYH LV DYDLODEOH RQO\ IRU LQFUHPHQWDO DPRXQW RYHU WKH EDVH UHYHQXH DQG SURGXFWLRQ RI *DJDO .

. SULRU WR WKH FRPPLVVLRQLQJ RI *DJDO .. 7KH &RPSDQ\ FRQWHQGV WKDW VXFK UHVWULFWLRQV DUH QRW DSSOLFDEOH WR WKHXQLWDV*DJDO.LVDQHZXQLWDVGHFLGHGE\WKH+3+LJK&RXUWDQGFRQoUPHGE\WKH6XSUHPH&RXUWZKLOH GHWHUPLQLQJWKHHOLJLELOLW\IRU7UDQVSRUW6XEVLG\7KH'HSDUWPHQWKDGUHFRYHUHG`&URUH 7D[RI`&URUH DQGLQWHUHVWRI`&URUH.

DQGWKHVDPHLVDFFRXQWHGDVDQDPRXQWUHFRYHUDEOH  7KH+3+LJK&RXUWKDGLQGLVPLVVHGWKH&RPSDQ\ VDSSHDO7KH&RPSDQ\EHOLHYHVWKH+RQ EOH+LJK &RXUW VMXGJPHQWLVEDVHGRQDQHUURQHRXVXQGHUVWDQGLQJRIFHUWDLQIDFWVDQGOHJDOSRVLWLRQVDQGWKDWLWDOVR IDLOHGWRFRQVLGHUFHUWDLQNH\IDFWV7KH&RPSDQ\KDVEHHQDGYLVHGE\OHJDOH[SHUWVWKDWWKHUHLVQRFKDQJHLQ WKHPHULWVRIWKH&RPSDQ\ VFDVH%DVHGRQVXFKDGYLFHWKH&RPSDQ\oOHGD6SHFLDO/HDYH3HWLWLRQEHIRUHWKH +RQ EOH6XSUHPH&RXUWLQZKLFKLVSHQGLQJ E.

 7KH&RPSDQ\ZDVHOLJLEOHIRUFHUWDLQLQFHQWLYHV LQWKHQDWXUHRI2QH7LPH/XPSVXP&DSLWDO6XEVLG\DQG UHIXQG RILQFUHPHQWDO 9$7SDLG.

QGXVWULDO 3ROLF\ RI -KDUNKDQG $FFRUGLQJO\WKHFRPSDQ\KDVPDGHFODLPVIRUUHIXQGRI9$7SDLGHDFKoQDQFLDO\HDU+RZHYHUQRGLVEXUVDOV ZHUHPDGH H[FHSWDQDPRXQWRI`&URUHUHSUHVHQWLQJSDUWRIWKH2QH7LPH/XPSVXPFDSLWDO6XEVLG\&ODLP RI`&URUH.LQUHVSHFW RILWVLQYHVWPHQW WRZDUGV PRGHUQL]DWLRQ DQGH[SDQVLRQ RIWKH &KDLEDVD &HPHQW 8QLW SXUVXDQW WR FRQoUPDWLRQ UHFHLYHG XQGHU WKH 6WDWH .

QLWVLQWHULPRUGHUWKH6XSUHPH&RXUWKDGZKLOHQRWVWD\LQJWKH'LYLVLRQ%HQFK 2UGHUKDVRQO\VWD\HGGLVEXUVHPHQWRIRIWKHDPRXQWGXH  7KH&RPSDQ\KDVDOVRSXUVXHGDFRQWHPSWSHWLWLRQoOHGLQWKH+LJK&RXUWRI-KDUNKDQGDJDLQVWQRQGLVEXUVDO RIDPRXQWVGXHE\WKH*RYHUQPHQW&RQVHTXHQWO\DVRIGDWHWKHFRPSDQ\KDVUHFHLYHG`&URUHLQSDUW GLVEXUVHPHQWIURPWKH*RYHUQPHQWRI-KDUNKDQG  7KH &RPSDQ\ LV SXUVXLQJ WKH PDWWHU RI GLVEXUVHPHQW RI IXUWKHU DPRXQWV RXWVWDQGLQJ 7KH&RPSDQ\LVRIWKHYLHZDQGDOVRKDVEHHQDGYLVHGWKDWWKHPHULWVDUHVWURQJO\LQLWVIDYRXUDQGLWH[SHFWV WKDWWKH6/3VKDOOEHUHMHFWHGXSKROGLQJWKHRUGHURIWKH'LYLVLRQEHQFKRIWKH-KDUNKDQG+&E\WKH$SH[&RXUW F.DVWKHDXWKRULWLHVKDYHUDLVHGYDULRXVQHZFRQGLWLRQVDQGUHVWULFWLRQWKDWZHUHH[WUDQHRXVWR WKHDSSURYDOVDQGFRQoUPDWLRQVH[SUHVVO\UHFHLYHGE\WKH&RPSDQ\7KH&RPSDQ\KDGoOHGWZRZULWDSSHDOV EHIRUHWKH-KDUNKDQG+LJK&RXUWDJDLQVWWKHUHVWULFWLRQVDQGGLVSXWHVRQWKHH[WHQWRIWKHHOLJLEOHFODLPVQRZ EHLQJVRXJKWWREHHIIHFWHGUDLVHGE\WKH*RYHUQPHQW  7KH'LYLVLRQ%HQFKRIWKH-KDUNKDQG+LJK&RXUWZKLOHGHDOLQJZLWKDSSHDOVE\ERWKWKH&RPSDQ\DQGWKH 6WDWHRI*RYHUQPHQWDJDLQVWDVLQJOHEHQFKRUGHURQO\SDUWLDOO\DOORZLQJWKH&RPSDQLHVFODLPLQLW VRUGHU GDWHG)HEUXDU\KDVDOORZHGWKH&RPSDQLHV$SSHDOLQWRWDOLW\ZKLOHGLVPLVVLQJWKH*RYHUQPHQWV $SSHDO WKHUHE\ FRQoUPLQJ WKDW WKH HQWLUH DPRXQW FODLPHG E\ WKH &RPSDQ\ LV FRUUHFW DQG KHQFH SD\DEOH LPPHGLDWHO\ 3XUVXDQW WR WKLV RUGHU DFXPXODWLYHDPRXQWRI`&URUHVWDQGDFFUXHGLQWKHERRNVXSWR 'HFHPEHU  7KH*RYHUQPHQWRI-KDUNKDQGKDVoOHGDQ6/3LQWKH6XSUHPH&RXUWDJDLQVWWKHRUGHURIWKHGLYLVLRQEHQFK ZKLFKKDVEHHQDGPLWWHG.

 7KH &RPSDQ\ KDG VHW XS D FDSWLYH SRZHU SODQW C:DGL 7*  .

 LQ WKH \HDU  7KLV SODQW ZDV VROG WR 7DWD3RZHU&R/WGLQWKH\HDUDQGZDVVXEVHTXHQWO\UHSXUFKDVHGIURPLWLQWKH\HDU7KH &RPSDQ\KDGSXUFKDVHGDQRWKHUFDSWLYHSRZHUSODQW :DGL7* VHWXSE\7DWD3RZHU&R/WGLQWKH\HDU .

QFRPH7D[$FW7KH.LQ%RWKWKHVHSRZHUSODQWVZHUHHOLJLEOHIRUWD[KROLGD\XQGHUWKHSURYLVLRQVRI6HFWLRQ .QFRPHWD[GHSDUWPHQWKDVGLVSXWHGWKH&RPSDQ\ VFODLPRIGHGXFWLRQ 227 .$RIWKH.

QFDVHRI:DGL7*LQUHVSHFWRIWKHGHPDQGRI`&URUH QHWRISURYLVLRQ.$RIWKH$FWRQWKHJURXQGWKDWWKHFRQGLWLRQVSUHVFULEHGXQGHUWKHVHFWLRQDUHQRWIXOoOOHG . 2015 (contd.) XQGHU6HFWLRQ.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.

7$7WKH'HSDUWPHQWLVLQDSSHDODJDLQVWWKHGHFLVLRQLQIDYRXURIWKH&RPSDQ\7KH&RPSDQ\EHOLHYHV WKDWWKHPHULWVRIWKHFODLPVDUHVWURQJDQGZLOOEHDOORZHG G.WKH&RPSDQ\LVLQDSSHDO EHIRUHWKH.7$7DQGLQFDVHRI:DGL7*LQUHVSHFWRIWKHGHPDQGRI`&URUHZKLFKZDVVHWDVLGHE\ WKH.

QGXVWULDO3ROLF\IRUGHIHUUDORILWVVDOHVWD[OLDELOLW\DULVLQJRQVDOHRIFHPHQWPDQXIDFWXUHGLQWKHVDLG SODQW7KH([FLVHDQG7D[DWLRQGHSDUWPHQWRIWKH*RYHUQPHQWRI+LPDFKDO3UDGHVKGLVSXWHGWKHHOLJLELOLW\RI WKHFRPSDQ\WRVXFKGHIHUPHQWRQWKHJURXQGWKDWWKHFRPSDQ\DOVRPDQXIDFWXUHVDQLQWHUPHGLDWHSURGXFW YL]&OLQNHUDULVLQJLQWKHPDQXIDFWXUHRIFHPHQWDQGVXFKLQWHUPHGLDWHSURGXFWZDVLVLQWKHQHJDWLYHOLVW$ GHPDQGRI`&URUHZDVUDLVHG7KH&RPSDQ\oOHGDZULWSHWLWLRQEHIRUH+LJK&RXUWRI+LPDFKDO3UDGHVK DJDLQVWWKHGHPDQG7KHFDVHKDVEHHQDGPLWWHGDQGWKHKHDULQJLVLQSURFHVV7KH&RPSDQ\EHOLHYHVLWVFDVH LVVWURQJDQGWKHGHPDQGVKDOOQRWVXVWDLQXQGHUODZ H. 2QH RI WKH &RPSDQ\ V &HPHQW PDQXIDFWXULQJ SODQWV ORFDWHG LQ +LPDFKDO 3UDGHVK ZDV HOLJLEOH XQGHU WKH 6WDWH.

QFHQWLYHVRIWKH*RYHUQPHQWRI0DKDUDVKWUD7KHVFKHPHLQWHUDOLDLQFOXGHVUHIXQGRIUR\DOW\ SDLGE\WKH&RPSDQ\RQH[WUDFWLRQRUSURFXUHPHQWRIYDULRXVUDZPDWHULDOV 0LQHUDOV. 7KH&RPSDQ\LVHOLJLEOHIRULQFHQWLYHVIRURQHRILWVFHPHQWSODQWVVLWXDWHGLQ0DKDUDVKWUDXQGHUD3DFNDJH 6FKHPHRI.

QGXVWULHVKDVGLVSXWHGWKH&RPSDQ\ VFODLPIRUUHIXQGRIUR\DOW\RQDQHUURQHRXVWHFKQLFDOLQWHUSUHWDWLRQRI WKHVDQFWLRQOHWWHULVVXHGWRWKH&RPSDQ\WKDWRQO\WKHKLJKHURIWKHDPRXQWRI L.7KH'HSDUWPHQWRI .

9$75HIXQGDQG LL.

5R\DOW\ UHIXQGFODLPDPRXQWVHDFK\HDUVKDOOEHFRQVLGHUHG7KH&RPSDQ\PDLQWDLQVWKDWVXFKDQQXDOUHVWULFWLRQLV QRWDSSOLFDEOHDVORQJDVWKHFXPXODWLYHOLPLWRIFODLPGRHVQRWH[FHHGWKHDPRXQWRIHOLJLEOHLQYHVWPHQW7KH &RPSDQ\KDVDFFUXHGDQDPRXQWRI`&URUHWLOO'HFHPEHU `&URUHWLOO'HFHPEHU.

RQ WKLVDFFRXQW7KH&RPSDQ\KDVoOHGDQDSSHDOEHIRUHWKH%RPED\+LJK&RXUWFKDOOHQJLQJWKHVWDQGRIWKH *RYHUQPHQWZKLFKLVDGPLWWHG SHQGLQJ7KH&RPSDQ\EHOLHYHVWKDWWKHPHULWVRIWKHFODLPDUHVWURQJ I.

 &RQVHTXHQW XSRQ WKH 6XSUHPH &RXUW V MXGJHPHQW LQ *RD )RXQGDWLRQ FDVH UHVWULFWLQJ WKH kyGHHPHG UHQHZDOyySURYLVLRQRIFDSWLYHPLQLQJOHDVHVWRWKHoUVWUHQHZDOSHULRGWKH&RPSDQ\KDGUHFHLYHGGHPDQG IURP 'LVWULFW 0LQLQJ 2IoFHU IRU `  &URUH IRU EHLQJ SHQDOW\ IRU DOOHJHG LOOHJDO PLQLQJ DFWLYLWLHV FDUULHG RXW E\ WKH &RPSDQ\ GXULQJ -DQXDU\  WR 6HSWHPEHU  7KH DIRUHVDLG GHPDQGV ZHUH FKDOOHQJHG E\ WKH&RPSDQ\DQG:ULW3HWLWLRQZLWK+LJK&RXUWRI-KDUNKDQG7KHSHWLWLRQKDVEHHQDGPLWWHGVXEMHFWWRD WRNHQGHSRVLWRI`&URUHZKLFKVKDOOEHUHIXQGDEOHLQFDVHWKHPDWWHULVGHFLGHGLQWKH&RPSDQLHVIDYRXU 7KH&RPSDQ\LVRIWKHFRQVLGHUHGYLHZEDVHGRQOHJDODGYLFHWKDWWKLVGHPDQGGRHVQRWKDYHPHULWDQGVKDOO QRWVWDQGWKHWHVWRIMXGLFLDOVFUXWLQ\FRQVLGHULQJWKDWWKHVDLGPLQLQJOHDVHVSHQGLQJ6WDWH*RYHUQPHQW V DSSURYDOKDYHEHHQDXWRPDWLFDOO\H[WHQGHGXSWR0DUFKE\0LQHVDQG0LQHUDOV 'HYHORSPHQWDQG 5HJXODWLRQ.

 $PHQGPHQW.

7KH &RPSHWLWLRQ &RPPLVVLRQ RI .QGLD &&.$FWZLWKRXWDQ\UHFRXUVHEHLQJPDGHDYDLODEOHWRWKH6WDWH*RYHUQPHQW 36.

 LQ  KDG LPSRVHG D SHQDOW\ RI `  &URUH IRU DOOHJHG FRQWUDYHQWLRQRIWKHSURYLVLRQVRIWKH&RPSHWLWLRQ$FW WKH$FW.

2QWKH&RPSDQ\ VDSSHDO&RPSHWLWLRQ $SSHOODWH 7ULEXQDO &203$7.

DQGUHPLWWHGWKHPDWWHUWR WKH&&. YLGH LWV LQWHULP RUGHU VWD\HG WKH SHQDOW\ ZLWK D FRQGLWLRQ WR GHSRVLW  RI WKH SHQDOW\DPRXQWZKLFKZDVGHSRVLWHG7KHDPRXQWRISHQDOW\ZDVGLVFORVHGDVDFRQWLQJHQWOLDELOLW\LQWKHoQDQFLDO VWDWHPHQWVXSWRWKHSUHYLRXV\HDU  228 2Q'HFHPEHUWKH&203$7YLGHLWVoQDORUGHUVHWDVLGHWKHRUGHURIWKH&&.IRUIUHVKDGMXGLFDWLRQRIWKHLVVXHVUHODWLQJWRWKHDOOHJHGYLRODWLRQRIUHOHYDQWSURYLVLRQVRIWKH$FWIRU SDVVLQJDIUHVKRUGHU)XUWKHULQWHUPVRIWKHRUGHUWKH&RPSDQ\KDVUHFHLYHGWKHUHIXQGRIGHSRVLWDORQJZLWK DFFXPXODWHGLQWHUHVW .

DETAILS OF DUES TO MICRO AND SMALL ENTERPRISES AS DEFINED UNDER THE MICRO.) 37. 2006* 2015 ` Crore  `&URUH     E 7KHDPRXQWRILQWHUHVWSDLGE\WKHEX\HULQWHUPVRI6HFWLRQRIWKH0LFUR6PDOO DQG 0HGLXP (QWHUSULVHV 'HYHORSPHQW $FW  DORQJ ZLWK WKH DPRXQWV RI WKH SD\PHQWPDGHWRWKHVXSSOLHUEH\RQGWKHDSSRLQWHGGD\GXULQJHDFKDFFRXQWLQJ \HDU   7KHDPRXQWRILQWHUHVWGXHDQGSD\DEOHIRUWKHSHULRGRIGHOD\LQPDNLQJSD\PHQW ZKLFK KDYH EHHQ SDLG EXW EH\RQG WKH DSSRLQWHG GD\ GXULQJ WKH \HDU.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31. SMALL AND MEDIUM ENTERPRISES DEVELOPMENT ACT. 2015 (contd.

QWHUHVWGXHRQDERYH F 7KLVLQIRUPDWLRQKDVEHHQGHWHUPLQHGWRWKHH[WHQWVXFKSDUWLHVKDYHEHHQLGHQWLoHGRQWKHEDVLVRILQIRUPDWLRQ DYDLODEOHZLWKWKH&RPSDQ\ 38. EXW ZLWKRXWDGGLQJWKHLQWHUHVWVSHFLoHGXQGHU0LFUR6PDOODQG0HGLXP(QWHUSULVHV 'HYHORSPHQW$FW   G 7KHDPRXQWRILQWHUHVWDFFUXHGDQGUHPDLQLQJXQSDLGDWWKHHQGRIHDFKDFFRXQWLQJ \HDU   H 7KHDPRXQWRIIXUWKHULQWHUHVWUHPDLQLQJGXHDQGSD\DEOHHYHQLQWKHVXFFHHGLQJ \HDUV XQWLO VXFK GDWH ZKHQ WKH LQWHUHVW GXHV DV DERYH DUH DFWXDOO\ SDLG WR WKH VPDOOHQWHUSULVHIRUWKHSXUSRVHRIGLVDOORZDQFHDVDGHGXFWLEOHH[SHQGLWXUHXQGHU 6HFWLRQRI0LFUR6PDOODQG0HGLXP(QWHUSULVHV'HYHORSPHQW$FW   D 7KHSULQFLSDODPRXQWDQGWKHLQWHUHVWGXHWKHUHRQUHPDLQLQJXQSDLGWRDQ\VXSSOLHU DVDWWKHHQGRIHDFKDFFRXQWLQJ\HDU 3ULQFLSDODPRXQWGXHWRPLFURDQGVPDOOHQWHUSULVHV . $&&0LQHUDO5HVRXUFHV/LPLWHG $05/.

PARTICULARS OF UN HEDGED FOREIGN CURRENCY EXPOSURE AS AT BALANCE SHEET DATE 2015 3DUWLFXODUV 7UDGH3D\DEOH DQG2WKHUFXUUHQW OLDELOLWLHV  &XUUHQF\ Foreign currency in Crore Exchange rate ` Crore )RUHLJQ FXUUHQF\LQ &URUH ([FKDQJH UDWH `&URUH &+)       86'       *%3       (85       229 .QGLDKDVFRPPHQFHGDXFWLRQLQJSURFHVV IRUDOOVXFKEORFNVLQDSKDVHGPDQQHU7KHDXFWLRQLQJIRU%LFKDUSXUEHLQJRQHRIWKHIRXUEORFNVLVFRPSOHWHG ZLWKWKHEORFNEHLQJDZDUGHGWRWKHVXFFHVVIXOELGGHU3XUVXDQWWRDYHVWLQJRUGHULQWKLVUHJDUGSRVVHVVLRQRIWKH FRDOPLQHKDVEHHQKDQGHGRYHUWRWKHVXFFHVVIXOELGGHUZLWKZKLFKWKH&RPSDQ\LVLQGLVFXVVLRQVIRUWUDQVIHURI UHPDLQLQJDVVHWV.QUHVSHFWRIRWKHUWKUHHEORFNVDXFWLRQLQJGDWHVKDYHQRW\HWEHHQDQQRXQFHG   39.DZKROO\RZQHGVXEVLGLDU\RIWKH&RPSDQ\WKURXJKLWVMRLQWYHQWXUHKDG VHFXUHGGHYHORSPHQWDQGPLQLQJULJKWVIRUIRXUFRDOEORFNVDOORWWHGWR0DGK\D3UDGHVK6WDWH0LQLQJ&RUSRUDWLRQ /WG7KHVHDOORFDWLRQVVWDQGFDQFHOOHGSXUVXDQWWRWKHRUGHURIWKH6XSUHPH&RXUWUXOLQJWKDWDOORFDWLRQRIYDULRXV FRDOEORFNVLQFOXGLQJWKHVHZDVDUELWUDU\DQGLOOHJDO7KH*RYHUQPHQWRI.

2015 (contd.3. .QWKHSUHYLRXV\HDUC7D[DGMXVWPHQWVIRUHDUOLHU\HDUV DJJUHJDWLQJ`&URUHFRPSULVHVZULWHEDFNRISURYLVLRQ IRULQFRPHWD[DULVLQJRQFRQFOXVLRQRIDVVHVVPHQWRID\HDUDQGXSRQDFRQVHTXHQWLDOUHYLHZRIWD[SURYLVLRQVIRU XQDVVHVVHG\HDUV 41.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31.) 40.84 Crore)KDVQRWEHHQUHFRJQL]HGDVDSDUWRIWKH7XUQRYHUEXWKDVEHHQDGMXVWHGDJDLQVWFRVW RISXUFKDVHRIFHPHQWVRFRQYHUWHG 42. CAPITALIZATION OF EXPENDITURE: 'XULQJWKH\HDUWKH&RPSDQ\KDVFDSLWDOL]HGWKHIROORZLQJH[SHQVHVRIUHYHQXHQDWXUHWRWKHFRVWRIo[HGDVVHW FDSLWDOZRUNLQSURJUHVV &:.` 22. 7KH &RPSDQ\ KDV DUUDQJHPHQWV ZLWK IHZ WKLUG SDUWLHV ZKHUHE\ LW VHOOV FOLQNHU WR WKHP DQG SXUFKDVHV &HPHQW PDQXIDFWXUHG E\ WKHP RXW RI VXFK FOLQNHU :KLOH WKH WUDQVDFWLRQV DUH FRQVLGHUHG DV LQGLYLGXDO VDOH  SXUFKDVH WUDQVDFWLRQV IRU GHWHUPLQDWLRQ RI WD[DEOH WXUQRYHU DQG WD[ XQGHU 9$7 ODZV FRQVLGHULQJ WKH DFFRXQWLQJ WUHDWPHQW SUHVFULEHG XQGHU YDULRXV DFFRXQWLQJ JXLGDQFH UHYHQXH IRU VDOH RI VXFK FOLQNHU RI `  &URUH (Previous Year .

. RI WKH &RPSDQLHV $FW  EHFRPLQJ DSSOLFDEOH WR WKH &RPSDQ\ ZHI-DQXDU\WKH&RPSDQ\KDVUHYLHZHGDQGZKHUHQHFHVVDU\UHYLVHGHVWLPDWHVRIXVHIXOOLYHVRIo[HG DVVHWV $FFRUGLQJO\ 3XUVXDQW WR WKH WUDQVLWLRQ SURYLVLRQV SUHVFULEHG LQ 6FKHGXOH .. 3XUVXDQW WR SURYLVLRQV RI 6FKHGXOH .QVXUDQFH   5DWHVDQGWD[HV   'HSUHFLDWLRQ           2SHQLQJEDODQFH ([SHQGLWXUHGXULQJFRQVWUXFWLRQIRUSURMHFWV (PSOR\HHEHQHoWVH[SHQVH 0LVFHOODQHRXVH[SHQVHV TOTAL /HVV&DSLWDOLVHGGXULQJWKH\HDU %DODQFHLQFOXGHGLQFDSLWDOZRUNLQSURJUHVV 43. WR WKH &RPSDQLHV $FW  DQDGGLWLRQDOFKDUJHRI`&URUHEHLQJWKHFDUU\LQJDPRXQWDVRI-DQXDU\RIo[HGDVVHWVZLWKQR UHPDLQLQJXVHIXOOLIH DVUHYLVHG.&RQVHTXHQWO\H[SHQVHVGLVFORVHGXQGHUWKHUHVSHFWLYHQRWHVDUHQHWRIDPRXQWV FDSLWDOL]HGE\WKHFRPSDQ\ 2015 ` Crore  `&URUH     .

DVRIWKDWGDWHLVUHFRJQL]HGLQWKH6WDWHPHQWRI3URoWDQG/RVVIRUWKH\HDUHQGHG 'HFHPEHUDQGGLVFORVHGDVDQH[FHSWLRQDOLWHP +DGWKLVFKDQJHLQWKHXVHIXOOLIHRIo[HGDVVHWVQRWEHHQPDGHGHSUHFLDWLRQIRUWKH\HDUHQGHG'HFHPEHU ZRXOGKDYHEHHQORZHUE\`&URUHDQGWKHSURoWDIWHUWD[ZRXOGKDYHEHHQKLJKHUE\`&URUH 230 .

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31. CORPORATE SOCIAL RESPONSIBILITY EXPENSES: 7KH DJJUHJDWH DPRXQW RI H[SHQGLWXUH LQFXUUHG RQ &RUSRUDWH 6RFLDO 5HVSRQVLELOLW\ DQG VKRZQ LQ WKH UHVSHFWLYH KHDGVRIDFFRXQWLVDVIROORZV 2015 ` Crore 2014 ` Crore   0LVFHOODQHRXVH[SHQVHV 5HIHU1RWH. 2015 (contd.) 44.

  TOTAL   3DUWLFXODUV (PSOR\HHEHQHoWVH[SHQVH 5HIHU1RWH.

e.QVWUXFWLRQVIRU3UHSDUDWLRQRI&RQVROLGDWHG )LQDQFLDO6WDWHPHQWVWR6FKHGXOH.. total assets minus total 6KDUHLQSURoW ORVV.. $GGLWLRQDOLQIRUPDWLRQDVUHTXLUHGE\3DUDJUDSKRIWKH*HQHUDO.WRWKH&RPSDQLHV$FW 1DPHRIWKHHQWLW\LQWKH Net Assets. i.. 45.

QGLD.QGLDQ %XON&HPHQW&RUSRUDWLRQ . liabilities $VRI $PRXQW $VRI $PRXQW consolidated net `&URUH FRQVROLGDWHGSURoW `&URUH assets RUORVV 2015  2015  2015  2015  Parent $&&/LPLWHG         Subsidiaries .

/LPLWHG     .

 .

 $&&0LQHUDO5HVRXUFHV/LPLWHG .

.

 .

 .

.

 .

 /XFN\0LQPDW/LPLWHG .

.

 .

 .

.

.

.

.

1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH .

.

 .

.

.

.

.

 .

/LPLWHG 6LQJKDQLD0LQHUDOV3ULYDWH/LPLWHG .

.

 .

.

.

.

.

.

Minority interest in subsidiary .

.

 .

.

 .

 .

Associates (Investment as per the equity method) .QGLDQ $OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG .

.

 .

 .

QGLDQ 2QHLQGLD%6&3ULYDWH/LPLWHG .     $VLDQ&RQFUHWHVDQG&HPHQWV3ULYDWH         /LPLWHG $DNDDVK0DQXIDFWXULQJ&RPSDQ\         3ULYDWH/LPLWHG Joint Ventures (as per proportionate consolidation) .

  .

 .

 .

 03$05/ %LFKDUSXU.

&RDO&RPSDQ\ .

.

 .

 .

.

.

 .

 .

/LPLWHG 03$05/ 0DUNL%DUND.

&RDO&RPSDQ\ .

  .

 .

   .

 .

/LPLWHG 03$05/ 0RUJD.

&RDO&RPSDQ\/LPLWHG    .

 .

    03$05/ 6HPDULD.

&RDO&RPSDQ\    .

 .

    .

/LPLWHG TOTAL         1RWH7KHDERYHoJXUHVDUHDIWHUHOLPLQDWLQJLQWUDJURXSWUDQVDFWLRQVDQGLQWUDJURXSEDODQFHVDVDW'HFHPEHU 231 .

INCOME AND EXPENSES RELATED TO THE COMPANY’S INTEREST IN THE FIVE JOINT VENTURES COMPANIES ARE AS UNDER: 2015  ` Crore `&URUH 3DUWLFXODUV Assets )L[HG$VVHWV   /RQJWHUPORDQVDQGDGYDQFHV   &DVKDQGEDQNEDODQFHV   6KRUWWHUPORDQVDQGDGYDQFHV   2WKHUFXUUHQWDVVHWV   Liabilities 2WKHUFXUUHQWOLDELOLWLHV   6KRUWWHUPSURYLVLRQV   Income   Expenses   Note: 'XULQJWKH\HDUWKHFRPSDQ\VXEVFULEHG(Previous Year – Nil)HTXLW\VKDUHVIRUDWRWDOFRQVLGHUDWLRQRI `&URUH(Previous Year – Nil)LQ2QHLQGLD%6&3ULYDWH/LPLWHGZKLFKLVDMRLQWO\FRQWUROOHGHQWLW\ZLWKDQHTXDO HTXLW\SDUWLFLSDWLRQZLWK$PEXMD&HPHQWV/LPLWHGDIHOORZVXEVLGLDU\&RPSDQ\ZLWKDLPWRSURYLGHEDFNRIoFH VHUYLFHVZLWKUHVSHFWWRURXWLQHSURFHVVHV 47. 2015 (contd. PROPOSED DIVIDEND 7KHoQDOGLYLGHQGSURSRVHGIRUWKH\HDULVDVIROORZV 2Q(TXLW\6KDUHVRI`HDFK $PRXQWRIGLYLGHQGSURSRVHG `&URUH.) 46.ACC Limited NOTES TO THE CONSOLIDATED FINANCIAL STATEMENTS for the year ended December 31. LIABILITIES. THE AGGREGATE AMOUNTS OF ASSETS.

'LYLGHQGSHU(TXLW\6KDUH `.

2015      48 7KH&RPSDQ\KDVUHFHLYHGDSSURYDOIURPWKH&RPSDQ\/DZ%RDUGXQGHU6HFWLRQ .

SEKHSARIA Chairman '. NAYAK &KLHI)LQDQFLDO2IoFHU SHAILESH V. HARIBHAKTI Director '.1 ERIC OLSEN Director '. COMPARATIVE FIGURES 3UHYLRXV\HDU VoJXUHVKDYHEHHQUHJURXSHGUHFODVVLoHGZKHUHYHUQHFHVVDU\WRFRQIRUPWRFXUUHQW\HDU V FODVVLoFDWLRQ $VSHURXUUHSRUWRIHYHQGDWH )RUDQGRQEHKDOIRIWKH%RDUGRI'LUHFWRUVRI$&&/LPLWHG For S R B C & CO LLP Chartered Accountants .1 N.1 FARROKH K.1 ASHWIN DANI Director '.1 0XPEDL)HEUXDU\ 232 .1 per RAVI BANSAL Partner 0HPEHUVKLS1R SUNIL K.S.1 BURJOR D.)LUP5HJLVWUDWLRQ1R( HARISH BADAMI CEO & Managing Director '.1 BERNARD TERVER Deputy Chairman '.1 ARUNKUMAR R GANDHI Director '. NARIMAN Company Secretary FALGUNI NAYAR Director '.&$. KAVARANA Director '.RIWKH&RPSDQLHV$FW SHUPLWWLQJWKH&RPSDQ\WRFRQWLQXHKDYLQJVW-DQXDU\VW'HFHPEHUDVLWV)LQDQFLDO<HDU 49.1 CHRISTOF HASSIG Director '.

2015 2015 ` Crore $&&~V1HW3URoW $GG 3URUDWDVKDUHRISURoWV ORVVHV.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies CONSOLIDATED GROUP OPERATING RESULTS for the year ended December 31.

RIVXEVLGLDULHV %XON&HPHQW&RUSRUDWLRQ .QGLD.

/LPLWHG $&&0LQHUDO5HVRXUFHV/LPLWHG /XFN\0LQPDW/LPLWHG 1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG 6LQJKDQLD0LQHUDO3ULYDWH/LPLWHG $GG $GG /HVV /HVV /HVV $GG   `&URUH  (3.60)   .

 .

 .

 .

(2.56)  .

  .

161.82 2015 ` Crore   `&URUH   .60    1.       587.

  .

 .

 .

3URUDWDVKDUHRI ORVV.

RI-RLQWYHQWXUH 2QHLQGLD%6&3ULYDWH/LPLWHG 3URUDWDVKDUHRISURoWRI$VVRFLDWHV 0LQRULW\.QWHUHVWRI6XEVLGLDU\ %&&.

$PRUWLVDWLRQRI*RRGZLOORQDFTXLVLWLRQRI6XEVLGLDU\DQG .QYHVWPHQWLQ$VVRFLDWHV 'LYLGHQGUHFHLYHGIURP$VVRFLDWHV 2WKHUDGMXVWPHQWV 1HW.

2015 $&&~V1HW:RUWK $GG 1HWZRUWKDVSHU%DODQFH6KHHWRI6XEVLGLDU\&RPSDQLHV %XON&HPHQW&RUSRUDWLRQ .QGLD. CONSOLIDATED GROUP NET WORTH As At December 31.

/LPLWHG $&&0LQHUDO5HVRXUFHV/LPLWHG /XFN\0LQPDW/LPLWHG 1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG 6LQJKDQLD0LQHUDO3ULYDWH/LPLWHG $GG /HVV /HVV /HVV /HVV $GG $GG $GG /HVV 1HWZRUWKDVSHU%DODQFH6KHHWRI-RLQWYHQWXUH 2QHLQGLD%6&3ULYDWH/LPLWHG 3URUDWDVKDUHRI0LQRULW\VKDUHKROGHUVLQWHUHVWLQ WKH1HW:RUWKRI6XEVLGLDU\&RPSDQ\ $&&~VVKDUHLQSUHDFTXLVLWLRQ1HW:RUWKRI 6XEVLGLDU\&RPSDQLHV-RLQWYHQWXUH $PRUWLVDWLRQRI*RRGZLOOLQ6XEVLGLDU\&RPSDQLHV 8QUHDOLVHGSURoWRQSXUFKDVHRI)L[HG$VVHWV 'HFUHDVHLQ1HW:RUWKRI$OFRQ&HPHQW&RPSDQ\3ULYDWH/LPLWHG .QFUHDVHLQ1HW:RUWKRI$VLDQ&RQFUHWHVDQG&HPHQWV3ULYDWH/LPLWHG .QFUHDVHLQ1HW:RUWKRI$DNDDVK0DQXIDFWXULQJ&RPSDQ\3ULYDWH/LPLWHG 2WKHUDGMXVWPHQWV 1HW.

     .

166.83      .

170.69   .43      5.

 .

421.14  10.10   .    8.

 .

217.68 233 .    8.

74 (26. Government of India has completed the auction of Bicharpur Coal Block in February. GUARANTEES OR The Company has given loans to its Joint Venture Companies as well as its Holding Company under . 8. the allocation of the aforesaid coal blocks by the Ministry of Coal. DEPOSITS The Company has not accepted any deposits from the public or the Directors during the year under review.96.16. SIGNIFICANT & MATERIAL ORDERS PASSED BY THE REGULATORS OR COURTS OR TRIBUNALS IMPACTING THE GOING CONCERN STATUS OF THE COMPANY  7KHUHDUHQRVLJQLoFDQWDQGPDWHULDORUGHUVSDVVHGE\ the Regulators or Courts or Tribunals impacting the going concern status of the Company.438 3. Amortization Tax Less: Depreciation & Amortization Less: Finance Cost 3URoWEHIRUH7D[DQG Exceptional Item Exceptionl Items 3URoWEHIRUH7D[ Less: Provision for Taxation (incl.019 (3. 2014 ` - - 4.460 3. 6. Marki Barka.06) Except for the interest earned on inter corporate deposit.69.52. In terms of the 234 In accordance with the vesting order.32. PARTICULARS INVESTMENTS OF LOANS. DIVIDEND Your Directors do not recommend payment of dividend IRUWKHoQDQFLDO\HDUHQGHG'HFHPEHU TRANSFER TO RESERVE No transfer to reserves has been made during the year under review.094) 3. OPERATIONS The Company had entered into Joint Venture Agreements with Madhya Pradesh State Mining Corporation Limited (MPSMC) for development of four coal blocks (viz. 5. 2015.77.58.00.70.26. claims have been oOHGIRUUHLPEXUVHPHQWRIH[SHQVHVLQFXUUHGE\WKH Company for mines development. 2015 and the Block was allotted to the successful bidder. Morga IV and Semaria / Piparia Coal Blocks is yet to be carried out by the Ministry of Coal.56.17.ACC MINERAL RESOURCES LIMITED (AMRL) BOARD’S REPORT TO THE MEMBERS OF ACC MINERAL RESOURCES LIMITED Government of India directives. Government of India to MPSMC were cancelled.81.54. Pursuant to the Orders of the Supreme Court passed in August 2014 and September 2014.24. the Company does not have any income.34. 2015.23.540 4. The Directors take pleasure in presenting the Annual Report on the business and operations of the Company and the Audited Financial Statements for the year ended December 31.536 3.77.54.58. the Bicharpur Coal mine has been handed over to the successful bidder on April 6. there have been no material changes and commitments PDGH EHWZHHQ WKH HQG RI WKH oQDQFLDO \HDU RI WKH Company and the date of this Report. CONTINUANCE OF THE EXISTING FINANCIAL YEAR Pursuant to a favourable Order from the Company Law Board.427 3.829 2.094) 2. 14.174 .365 14.978 1.810 4.56. The Company is in discussion with the successful bidder for realization of the investment made in Bicharpur Coal Block. Government of India.31st December) as its oQDQFLDO\HDU 7.978 3. MATERIAL CHANGES AND COMMITMENTS Except as disclosed elsewhere in the Report.365 4. the Company will continue to have the calendar year (1st January . 2015 is summarized below: PARTICULARS Total Operational Income Other Income Total Income Less: Operating Expenditure 3URoWEHIRUHLQWHUHVW Depreciation. Bicharpur.86.26. Marki Barka.5. The Ministry of Coal.592 (3.73.07.66.24.019 (3.15. 9. FINANCIAL HIGHLIGHTS (Standalone)  7KHoQDQFLDOKLJKOLJKWVRI\RXU&RPSDQ\IRUWKH\HDU ended December 31. 4.58.15. 1. liability for earlier years) 1HW3URoWIRUWKH\HDU EPS .094) 52. 2015 ` The re-auction / allocation process of other three coal blocks viz.54.86. Morga IV and Semaria / Piparia) which were originally allocated by the Ministry of Coal to MPSMC.Basic & Diluted 2.

Mr Naveen &KDGKD KROGV RIoFH XSWR WKH GDWH RI WKH $QQXDO Mr Rajendra Singh Rathore who was appointed as a Director of the Company with effect from April 21. 11. 2011. Mrs Jer N Dhondy as an Additional Director of the Company with effect from $XJXVW   0UV 'KRQG\ KROGV RIoFH XS WR WKH date of the forthcoming Annual General Meeting. INTERNAL FINANCIAL CONTROLS Financial Statements Subsidiary Companies General Meeting. her candidature for appointment as a Director has been included in the Notice convening the Annual General Meeting of the Company. DIRECTORS AND KEY MANAGERIAL PERSONNEL Appointment of Directors The Board of Directors had appointed Mr Noshir H Italia and Dr I B De as Additional Directors of the Company in the category of Non-Executive / Independent Directors with effect from March 31. Accordingly. Accordingly. 2013. there is no requirement to furnish any information in Form AOC 2. 2013. the candidature of Mr N H Italia and Dr I B De for appointment as Directors in the category of Non-Executive / Independent Director have been included in the Notice convening the Annual General Meeting of the Company. his candidature for appointment as a Director has been included in the Notice convening the Annual General Meeting of the Company. CONTRACT OR ARRANGEMENT WITH RELATED PARTIES Mr Rajiv Prasad who was appointed as a Director of the Company with effect from October 24. ceased to be a Director of the Company with effect from August 03. Mr Rajendra Singh Rathore. viz. 2013. 12. 10. ceased to be a Director of the Company with effect from April 01. the details of which are mentioned in the Notes forming part of the Financial Statements. 235 . Pursuant to the provisions of Section 149 of the Companies Act. Cessation of Directorship Mr Harish Badami who was appointed as a Director of the Company with effect from October 20. 2015. 2015. The Company being a wholly owned subsidiary of $&& /LPLWHG WKH LQWHUQDO oQDQFLDO FRQWUROV RI $&& are applicable to the Company. Mr Sunil Nayak retires by rotation and being eligible offers himself for re-appointment as a Director of the Company. The Board of Directors has appointed Mr Naveen Chadha as an Additional Director of the Company with effect from October 15. Accordingly. Mr Burjor D Nariman who was appointed as a Director of the Company with effect from January 27. Mr Noshir H Italia and Dr I B De have given a declaration toWKH&RPSDQ\FRQoUPLQJWKDWWKH\ meet the criteria of independence as mentioned under Section 149(6) of the Companies Act. 2015. 2014. each for a term of oYH\HDUVUHVSHFWLYHO\3XUVXDQWWRWKHSURYLVLRQVRI Section 152(2) and Section 161 of the Companies Act. Mr Burjor D Nariman and Mr Madan Lall Narula during their respective tenures as Directors of the Company. 2015. 2013. 2013 and Rules framed thereunder. 2011. 2015. the proposal for his re-appointment has been included in the Notice convening the Annual General Meeting of the Company. ceased to be a Director of the Company with effect from April 09. 2013. Accordingly. 2015. There are no material related party transactions. ceased to be a Director of the Company with effect from April 09. In accordance with the provisions of Section 188 of the Companies Act. These are adequate and commensurate with the requirements of the Company. the Board of Directors has appointed a woman director. Mr Rajiv Prasad. 2010. ceased to be a Director of the Company with effect from April 09. Independent Directors a. Mr Madan Lall Narula who was appointed as a Director of the Company with effect from April 21. Declaration of Independence by Directors The Independent Directors of the Company. 2014. Directors Retiring by Rotation In accordance with the provisions of the Companies Act. 2015.Corporate Overview Financial Highlights Board & Management Reports the provisions of Section 186 of the Companies Act. the transactions entered into with Related Parties are in the ordinary course of business and on an arms length pricing basis. The Board has placed on record its appreciation of the valuable contribution made by Mr Harish Badami.

the Board considers WKH TXDOLoFDWLRQ H[SHULHQFH H[SHUWLVH RI WKH FDQGLGDWHVLQWKHLUUHVSHFWLYHoHOGVWKHLUSURIHVVLRQDO business standing and diversity of the Board. Independent Directors Meeting During the year under review. in addition to the above criteria. 2013. Appointment of Key Managerial Personnel During the year 2015. the Company appointed Mr Sariputta Mishra as Manager and Mr Dinesh 6RQWKDOLD DV &KLHI )LQDQFLDO 2IoFHU DQG &RPSDQ\ Secretary. 2015 and of the SURot of the Company for the year ended on that date. 2013 for safeguarding the assets of the Company and for preventing and detecting fraud and other irregularities. Both Mr Mishra and Mr Sonthalia are employees of ACC Limited. the Board of Directors decided to pay sitting fees to the Independent Directors of ` 5. July 14. During the year ended December 31. 2015. March 31.WDOLD &KDLUPDQ. During the year. the Board has carried out annual performance evaluation of its own performance. that systems to ensure compliance with the provisions of all applicable laws were in place and were adequate and operating effectively. the recommendation. 2015. LY WKDWWKHDQQXDOoQDQFLDOVWDWHPHQWVKDYHEHHQ prepared on a going concern basis. your Directors make the following statements in terms of Section 134(3)(c) of the Companies Act. 2015 and October 15. if any. six Board Meetings were held on January 20. the Independent Directors met once on October 15. 2015. 2013: L WKDW LQ WKH SUHSDUDWLRQ RI WKH DQQXDO oQDQFLDO statements for the year ended December 31. Audit Committee The Audit Committee comprises the following Members: v v v 0U 1RVKLU . 14. August 13. received from the Holding Company would also be considered. 2015. MEETINGS Board Meetings The Company held a minimum of one board meeting in every quarter.ACC MINERAL RESOURCES LIMITED (AMRL) b. the applicable accounting standards have been followed along with proper explanation relating to material departures. April 08. Appointment and Remuneration of Directors For the appointment of Directors. For appointment of Directors other than Independent Directors. The representatives of ACC on the Board of Directors of the Company are not paid sitting fees. LLL WKDW SURSHU DQG VXIoFLHQW FDUH KDV EHHQ WDNHQ for the maintenance of adequate accounting records in accordance with the provisions of the Companies Act. 2015. 2015. No other remuneration is paid to the Directors. 2015. the Holding Company. Both the Independent Directors were present for the Meeting. the directors individually.000/for each meeting of the Board and Audit Committee attended by them. Evaluation of the Board and its Committees Pursuant to the provisions of the Companies Act. 13. DIRECTORS’ RESPONSIBILITY STATEMENT To the best of their knowledge and belief and according to the information and explanations obtained by them. 2015. v. deputed as Key Managerial Personnel in the Company and no remuneration is being drawn by them separately from the Company. 236 that such accounting policies as mentioned in 1RWHRIWKH1RWHVWRWKHoQDQFLDOVWDWHPHQWV have been selected and applied consistently and judgements and estimates have been made that are reasonable and prudent so as to give a true and fair view of the state of affairs of the Company as at December 31. if any. ii. as well as the evaluation of the working of its Audit and Nomination and Remuneration Committees.

2015. Non-Executive / Independent Director Dr I B De. Non-Executive / Independent Director Mr Sunil Nayak. 2015 and October 15. 2015. 1RQ([HFXWLYH  Independent Director 'U. Audit Committee Meetings were held on April 08. Nomination & Remuneration Committee The Nomination & Remuneration Committee comprises the following Members: Mr Noshir Italia (Chairman).%'H1RQ([HFXWLYH.QGHSHQGHQW'LUHFWRU 0U6XQLO1D\DN1RQ([HFXWLYH'LUHFWRU During the year. Non-Executive Director . July 14.

Your Directors also acknowledge the recommend the re-appointment of Messrs. the & Co. the Company is required to establish an effective vigil mechanism. as Auditors of the Holding Company. August 13. Messrs. Company for the year 2016. 2014. 2013 read with Sunil K. technology absorption and foreign exchange earnings & outgo. As required under the provision of Section 139 of the 22. July 14.Corporate Overview Financial Highlights Board & Management Reports During the year. 2016 5HJLVWHUHG2IoFH Cement House 121. Chartered Accountants. PARTICULARS OF EMPLOYEES There are no employees on the rolls of the Company. would be in conformity co-operation received from the Government with the Companies Act. Mumbai 400 020 237 . 15. the information on conservation of energy. The following are the Joint Venture Companies: MP AMRL (Bicharpur) Coal Company Limited MP AMRL (Marki Barka) Coal Company Limited MP AMRL (Semaria / Piparia) Coal Company Limited MP AMRL (Morga IV) Coal Company Limited The Company holds 49% equity in each of the four joint venture companies and the balance 51% equity is held by MPSMC. 21. during the year is Nil. to undertake the Secretarial Audit of the Company. 2014. 2013 read with Rule 5(1) Statutory Auditors of the Company. Chartered Accountants. the Holding Company. has been extended to the Company. 18. if made. 19. hence there is no disclosure under Section 197(12) (ICAI Firm Registration No. TECHNOLOGY ABSORPTION AND FOREIGN EXCHANGE EARNINGS & OUTGO As no business activity was carried out. 2013. The Secretarial Audit Report is enclosed as “Annexure B”. ACKNOWLEDGEMENT Companies Act. The Company is not required to constitute a Corporate Social Reponsibility Committee. Maharshi Karve Road. The vigil mechanism viz. For and on behalf of the Board 17. EthicalView Reporting Policy of ACC Limited. Nomination & Remuneration Committee Meetings were held on April 08. the Company has obtained Your Directors take this opportunity to express ZULWWHQFRQoUPDWLRQIURP0HVVUV. 2013. 16. 2015. SECRETARIAL AUDIT Pursuant to provisions of Section 204 of the Companies Act. 2014 in the prescribed Form MGT-9 is enclosed as “Annexure A”. K S Aiyar unstinted assistance received from ACC Limited. AUDITORS Financial Statements Subsidiary Companies The Companies (Management and Administration) Rules. PARTICULARS OF CONSERVATION OF ENERGY. ANNUAL RETURN The Extract of Annual Return pursuant to Section 92(3) of the Companies Act. retire at the and 5(2) of The Companies (Appointment and conclusion of the ensuing Annual General Meeting. VIGIL MECHANISM As per the provisions of Section 177(9) of the Companies Act. Remuneration of Managerial Personnel) Rules. 2015. the Company has appointed Messrs Pramod 6 6KDK  $VVRFLDWHV D oUP RI &RPSDQ\ 6HFUHWDULHV in Practice. DETAILS OF SUBSIDIARIES / JOINT VENTURES / ASSOCIATE COMPANIES The Company does not have Subsidiary or Associate Companies. 2013 and The Companies (Appointment and Remuneration of Managerial Personnel) Rules. 2015. 2015 and October 15. Your Directors authorities. K S Aiyar & Co. 100186W) who are the of the Companies Act. 20.6$L\DU &RWKDW their grateful appreciation of the assistance and their appointment. 2013. Nayak Director DIN: 00081466 Jer N Dhondy Director DIN: 07254019 Mumbai January 25.

of Shares held at the beginning of the year (January 1. 2014] I. MGT. 2015 [Pursuant to Section 92(3) of the Companies Act.9 EXTRACT OF ANNUAL RETURN as on December 31. 1930 Name of the Company ACC Mineral Resources Limited Category / Sub Category of the Company Indian Non Government . if any Not Applicable II. Maharshi Karve Road. c) State Govt. 2013 and Rule 12(1) of the Companies (Management and Administration) Rules. Particulars of Holding. 2015) % Change % of Total during the year Shares Demat Physical Total 0 - 20 20 0 100 - - - - - - - - A.Limited by shares . Mumbai 400 020 Tel. - - - - - 12194970 12194970 100 - - - - - - - - 20 20 0 - 10 - 12195000 12195000 100 - - - 100 0 - - - 10 0 50 100 0 12194970 12194970 Directors Sub-Total (A)(1) 238 12195000 12195000 .Public Company $GGUHVVRIWKH5HJLVWHUHG2IoFHDQGFRQWDFWGHWDLOV Cement House. No: 022-33024321 No Whether Listed Company Name. Subsidiary and Associate Companies Name and address of the Company CIN / GLN ACC Limited Holding / % of Applicable Subsidiary / Shares Section Associate held Holding L26940MH1936PLC002515 Cement House 121. Shareholding Pattern (Equity Share Capital Breakup as percentage of Total Equity) i) Category . Registration and other details CIN U10100MH1930PLC001612 Registration Date July 26. of Shares held at the end of the year (December 31. 121. Address and contact details of Registrar and Transfer Agent.(s) d) Bodies Corporate e) Banks / Fl f) Any Other (specify) No. 2015) Demat Physical Total % of Total Shares - 10 10 - - - No.ACC MINERAL RESOURCES LIMITED (AMRL) ANNEXURE ‘A’ TO BOARD’S REPORT FORM No. Mumbai 400 020 100% 2(46) IV.wise Shareholding Category of Shareholders Promoters (including Promoter Group) (1) Indian a) Individuals / HUF b) Central Govt. Principal Business Activities of the Company All the Business Activities contributing 10% or more of the total turnover of the Company shall be stated: Name and Description of the main Product / Services NIC Code of the Product / Service % to total turnover of the Company 1010 NIL Mining and development of coal blocks III. Maharshi Karve Road.

Shareholding Pattern (Equity Share Capital Breakup as percentage of Total Equity) i) Category . d) State Govt.(s) e) Venture Capital Funds f) Insurance Companies g) FIIs h) Any Other (specify) Sub-Total (B)(2) Total Public Shareholding (B)=(B)(1)+(B)(2) C. 2015) No.Individuals c) Bodies Corporate d) Banks / Fl e) Any Other (specify) Sub-Total (A)(2) Total Shareholding of Promoters & Promoter Group (A)=(A)(1)+(A)(2) B. of Shares held at the beginning of the year (January 1.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies IV. Shares held by Custodian for GDRs & ADRs Grand Total (A)+(B)+(C) Physical Total 12195000 12195000 % Change % of Total during the year Shares 100 0 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 12195000 12195000 100 - 100 0 12195000 12195000 239 . Public Shareholding (1) Institutions a) Mutual Funds b) Banks / FI c) Central Govt.wise Shareholding Category of Shareholders No.Individuals b) Other . 2015) Demat Physical Total % of Total Shares Demat - 12195000 12195000 100 - - - - - - - Foreign Venture Capital Funds i) Any Other (specify) Sub-Total (B)(1) (2) Non-Institutions a) Bodies Corporate i) Indian ii) Overseas b) Individuals i) Individual Shareholders holding nominal share capital upto ` 1 lakh ii) Individual Shareholders holding nominal share capital in excess of ` 1 lakh - - - - - - - - - - - - - - - c) (2) Foreign a) NRIs . of Shares held at the end of the year (December 31.

ACC MINERAL RESOURCES LIMITED (AMRL) ii) Shareholding of Promoters (including Promoter Group) Sr. 2015) shareholding during the % of Shares No. 1 Shareholding at the beginning of the year (January 1. 2015) % of Shares No. 2015) No. of % of total year pledged / Shares shares of the Company encumbered to total shares 0 0 12194970 05 05 0 05 0 0 0 0 05 0 0 0 05 0 0 0 05 0 0 05 0 05 0 0 05 0 05 0 0 0 12195000 0 0 0 05 100 100 0 100 iii) Change in Promoters’ (including Promoter Group) Shareholding (please specify. 1 2 3 4 5 6 7 Shareholding at the beginning of the year (January 1. 2015) No. Particulars No. 31. Shareholder’s Name No. 1. of Shares % of total shares of the Company Cumulative Shareholding during the year (Jan. of % of total pledged / Shares shares encumbered to of the total shares Company ACC Limited Mr Harish Badami jointly with ACC Limited Mr Sunil Nayak jointly with ACC Limited Mr Burjor D Nariman jointly with ACC Limited Mr Rajendra Singh Rathore jointly with ACC Limited Mrs J N Dhondy jointly with ACC Limited Mr S Viswanathan jointly with ACC Limited 12194970 05 Total 12195000 100 Shareholding at the end of the year % change in (December 31. 2015 to Dec. of Shares % of total shares of the Company ACC Limited At the beginning of the year 12194970 100 Datewise increase / decrease in Promoters Shareholding during the year specifying the reasons for increase / decrease No change At the end of the year 2 05 05 0 05 0 0 Datewise increase / decrease in Promoters Shareholding during the year specifying the reasons for increase / decrease No change At the end of the year Mr Sunil Nayak jointly with ACC Limited At the beginning of the year Datewise increase / decrease in Promoters Shareholding during the year specifying the reasons for increase / decrease At the end of the year 240 100 Mr Harish Badami jointly with ACC Limited At the beginning of the year 3 12194970 05 0 No change . if there is no change) Sr.

31.2015) At the beginning of the year 05 0 Date wise Increase / (transfer): No change At the end of the year 2 05 0 05 0 Mr Sunil Nayak jointly with ACC Limited At the beginning of the year Date wise Increase / (transfer): At the end of the year 05 0 No change 241 . 31. 4 5 6 7 Board & Management Reports Financial Statements Shareholding at the beginning of the year (January 1. 2015) Name of the Director No of shares % of total shares of No of shares % of total shares of the company the company 1 Mr Harish Badami jointly with ACC Limited (ceased to be a Director with effect from 01. 2015) (Jan. Promoters and Holders of GDRs and ADRs) as on December 31. 2015) No. of Shares % of total shares of the Company 0 No change Mr Rajendra Singh Rathore jointly with ACC Limited At the beginning of the year 05 Datewise increase / decrease in Promoters Shareholding during the year specifying the reasons for increase / decrease At the end of the year Mrs J N Dhondy jointly with ACC Limited At the beginning of the year Datewise increase / decrease in Promoters Shareholding during the year specifying the reasons for increase / decrease At the end of the year Subsidiary Companies 05 0 05 0 05 0 05 0 0 No change 05 0 No change 05 0 No change iv) Shareholding Pattern of top ten Shareholders (Other than Directors. of Shares % of total shares of the Company Mr Burjor D Nariman jointly with ACC Limited At the beginning of the year Datewise increase / decrease in Promoters Shareholding during the year specifying the reasons for increase / decrease At the end of the year 05 Mr S Viswanathan jointly with ACC Limited At the beginning of the year Datewise increase / decrease in Promoters Shareholding during the year specifying the reasons for increase / decrease At the end of the year Cumulative Shareholding during the year (Jan. No.04. v) Shareholding of Directors and Key Managerial Personnel: Shareholding at the beginning of the year Cumulative Shareholding during the year Sr. 2015 to Dec. 2015: Not Applicable. (January 1.Corporate Overview Financial Highlights Sr. 1. 2015) No. Particulars No. 2015 to Dec. 1.

31. 2015 to Dec. No. Indebtedness Indebtedness of the Company including interest outstanding / accrued but not due for payment: Secured Loans excluding deposits Unsecured Loans Deposits Total Indebtedness ` Crore i) Principal Amount - - - - ii) Interest due but not paid - - - - iii) Interest accrued but not due - - - - Total (i+ii+iii) - - - - Addition - - - - Reduction - - - - Net Change - - - - i) Principal Amount - - - - ii) Interest due but not paid - - - - iii) Interest accrued but not due - - - - Total (i+ii+iii) - - - - .2015) At the beginning of the year 05 0 Date wise Increase / (transfer): No change At the end of the year Note: None of the Key Managerial Personnel hold shares in the Company.2015) At the beginning of the year 05 0 Date wise Increase / (transfer): No change At the end of the year 5 % of total shares of the company Mrs J N Dhondy jointly with ACC Limited (appointed Director with effect from 13.04.ACC MINERAL RESOURCES LIMITED (AMRL) Sr.QGHEWHGQHVVDWWKHHQGRIWKHoQDQFLDO\HDU 242 . 3 Name of the Director Shareholding at the beginning of the year Cumulative Shareholding during the year (January 1. 2015) (Jan.QGHEWHGQHVVDWWKHEHJLQQLQJRIWKHoQDQFLDO\HDU &KDQJHLQ. 2015) No of shares % of total shares of the company No of shares Mr Burjor D Nariman jointly with ACC Limited (resigned with effect from 09.08. 1.04. V.QGHEWHGQHVVGXULQJWKHoQDQFLDO\HDU .2015) At the beginning of the year 05 0 Date wise Increase / (transfer): No change At the end of the year 4 05 0 05 0 05 0 Mr Rajendra Singh Rathore jointly with ACC Limited (resigned with effect from 09.

000 65. Penalties / Punishment / Compounding of Offences: There were no penalties / punishments / compounding of offences for the year ended December 31. 2015. Nayak Director Jer N Dhondy Director 243 .000 v)HHIRUDWWHQGLQJ%RDUG&RPPLWWHH0HHWLQJV 0 0 0 v&RPPLVVLRQ 0 0 0 v2WKHUVSOHDVHVSHFLI\ 0 0 0 Total (2) 0 0 0 30. Remuneration to Other Directors: 1 Dr I B De Total Amount ` 30. 2016 Sunil K. Remuneration to Key Managerial Personnel other than MD/Manager/WTD: Kindly refer to paragraph on Key Managerial Personnel appearing at Point No. For and on behalf of the Board Mumbai January 25.000 v&RPPLVVLRQ 0 0 0 v2WKHUVSOHDVHVSHFLI\ 0 0 0 30. VII.000 65. 12 of the Board’s Report.000 35.000 65. Remuneration to Managing Director. Whole-time Directors and/or Manager: Not Applicable B.000 35.000 Particulars of Remuneration Independent Directors v)HHIRUDWWHQGLQJ%RDUG&RPPLWWHH0HHWLQJV Total (1) 2 Names of Directors Mr N H Italia Sr No.000 35. Other Non-Executive Directors Total = (1)+(2) C. Remuneration of Directors and Key Managerial Personnel: A.Corporate Overview Financial Highlights Board & Management Reports Subsidiary Companies Financial Statements VI.

(iv) Secretarial Standards issued by The Institute of Company Secretaries of India (SS-1 & SS-2). During the period. PRAMOD S. The Members. 2013 and Rule No. 1956 (‘SCRA’) and the rules made thereunder. regulations and guidelines. Pramod S. 2013 (the Act) and the rules made thereunder. (As mentioned above and listed in Annexure 1). in the manner and subject to the reporting made hereinafter. We further report thatThe Board of Directors of the Company is duly constituted with proper balance of Executive Directors. Adequate notice is given to all directors to schedule the Board Meetings. the Company has.: 334 C P No. ACC Mineral Resources Limited We have conducted the secretarial audit of the compliance of applicable statutory provisions and the adherence to good corporate practices by ACC Mineral Resources Limited (hereinafter called the Company). 9 of the Companies (Appointment and Remuneration of Managerial Personnel) Rules. 2015 [Pursuant to Section 204(1) of the Companies Act. Laws and Regulations applicable to the Company as listed in Annexure 1.: 3804 (iii) The Depositories Act. all the decisions in the Board Meetings were carried out unanimously. SHAH & ASSOCIATES FCS No. minute books. The changes in the composition of the Board of Directors that took place during the period under review were carried out in compliance with the provisions of the Act. IRUPVDQGUHWXUQVoOHGDQGRWKHUUHFRUGVPDLQWDLQHGE\ WKH&RPSDQ\IRUWKHoQDQFLDO\HDUHQGHGRQ'HFHPEHU 31. rules. papers. We further report that during the audit period there were QRVSHFLoFHYHQWVDFWLRQVKDYLQJDPDMRUEHDULQJRQWKH Company’s affairs. We have relied on the representation made by the &RPSDQ\LWV2IoFHUVDQG5HSRUWVRIWKH6WDWXWRU\$XGLWRU for systems and mechanism framed by the Company for compliances under other Acts. during the audit period covering the oQDQFLDO \HDU HQGHG RQ 'HFHPEHU   FRPSOLHG with the statutory provisions listed hereunder and also that the Company has proper Board-processes and compliance mechanism in place to the extent. Secretarial Audit was conducted in a manner that provided us a reasonable basis for evaluating the corporate conducts / statutory compliances and expressing our opinion thereon. 2016 . Non-Executive Directors and Independent Directors. Shah Partner (ii) The Securities Contracts (Regulation) Act. and a system exists for seeking and obtaining further information and FODULoFDWLRQV RQ WKH DJHQGD LWHPV EHIRUH WKH PHHWLQJ and for meaningful participation at the meeting. 244 Place: Mumbai Date: January 22. 2014] To. 1996 and the Regulations and Bye-laws framed thereunder. we hereby report that in our opinion. %DVHG RQ RXU YHULoFDWLRQ RI WKH &RPSDQ\ V ERRNV SDSHUV PLQXWH ERRNV IRUPV DQG UHWXUQV oOHG DQG other records maintained by the Company and also the LQIRUPDWLRQSURYLGHGE\WKH&RPSDQ\LWVRIoFHUVDJHQWV and authorized representatives during the conduct of secretarial audit. 2015 according to the provisions of: (i) The Companies Act. We further report that there are adequate systems and processes in the Company commensurate with the size and operations of the Company to monitor and ensure compliance with applicable laws. Agenda and detailed notes on agenda were sent at least seven days in advance. We have examined the books. MR-3 SECRETARIAL AUDIT REPORT FOR THE FINANCIAL YEAR ENDED DECEMBER 31.ACC MINERAL RESOURCES LIMITED (AMRL) ANNEXURE ‘B’ TO BOARD’S REPORT Form No.

Employees State Insurance Act. 1948 11. Income Tax Act.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies Annexure I 1. 1976 10. 1994 245 . 1952 9. Minimum Wages Act. Finance Act. 1947 8. Contract Labour (R&A) Act. Payment of Gratuity Act. Payment of Bonus Act. 1972 4. Apprentices Act. Employees’ Provident Fund Act. 1952 and Rules 2. Equal Remuneration Act. 1975 and Rules 3. 1970  (PSOR\PHQW ([FKDQJHV &RPSXOVRU\ 1RWLoFDWLRQ of vacancies) Act. Employees Provident Fund & Misc provisions Act. Professional Tax Act. Shop and Establishment Act 13. 1961 14. 1959 7. 1965 12. 1961 5.

The respective Board of Directors of the companies included in the Consolidated Financial Statements are responsible for maintenance of adequate accounting records in accordance with the provisions of the Act for safeguarding the assets of the respective companies and for preventing and detecting frauds and other irregularities. as well as evaluating the overall presentation RIWKHFRQVROLGDWHGoQDQFLDOVWDWHPHQWV Our responsibility is to express an opinion on these We have audited the accompanying Consolidated FRQVROLGDWHG oQDQFLDO VWDWHPHQWV EDVHG RQ RXU DXGLW Financial Statements of ACC MINERAL RESOURCES While conducting the audit. whether due to fraud or error. the accounting and auditing which comprises the Consolidated Balance Sheet as at standards and matters which are required to be included 31st December. the Consolidated Statement of in the audit report under the provisions of the Act and the 3URoWDQG/RVVDQGWKH&RQVROLGDWHG&DVK)ORZ6WDWHPHQW Rules made thereunder. implementation and PDLQWHQDQFHRIDGHTXDWHLQWHUQDOoQDQFLDOFRQWUROVWKDW were operating effectively for ensuring the accuracy and completeness of the accounting records. An audit involves performing procedures to obtain audit evidence about the amounts and the disclosures in WKH FRQVROLGDWHG oQDQFLDO VWDWHPHQWV 7KH SURFHGXUHV selected depend on the auditor’s judgment. which have been used for the purpose of preparation of WKHFRQVROLGDWHGoQDQFLDOVWDWHPHQWVE\WKH'LUHFWRUVRI the Company as aforesaid. and the design. we have taken into account LIMITED (the Company) and its 4 joint venture companies the provisions of the Act. IRU WKH \HDU WKHQ HQGHG DQG D VXPPDU\ RI VLJQLoFDQW We conducted our audit in accordance with the Standards accounting policies and other explanatory information RQ $XGLWLQJ VSHFLoHG XQGHU 6HFWLRQ  . relevant to the SUHSDUDWLRQDQGSUHVHQWDWLRQRIWKHFRQVROLGDWHGoQDQFLDO statements that give a true and fair view and are free from material misstatement.ACC MINERAL RESOURCES LIMITED (AMRL) INDEPENDENT AUDITORS’ REPORT The Board of Directors of ACC MINERAL RESOURCES LIMITED Report on the Consolidated Financial Statements for the year ended December 31. including the Accounting 6WDQGDUGV VSHFLoHG XQGHU 6HFWLRQ  RI WKH $FW UHDG with Rule 7 of the Companies (Accounts) Rules. 2015 Auditor’s Responsibility Management’s responsibility oQDQFLDOVWDWHPHQWV consolidated reasonable assurance about whether the consolidated oQDQFLDOVWDWHPHQWVDUHIUHHIURPPDWHULDOPLVVWDWHPHQW The Company’s Board of Directors is responsible for the SUHSDUDWLRQ RI WKHVH FRQVROLGDWHG oQDQFLDO VWDWHPHQWV in terms of the requirements of the Companies Act. 2015. 2014. 2013 (hereinafter referred to as “the Act”) that give a WUXH DQG IDLU YLHZ RI WKH FRQVROLGDWHG oQDQFLDO SRVLWLRQ FRQVROLGDWHG oQDQFLDO SHUIRUPDQFH DQG FRQVROLGDWHG FDVK pRZV RI WKH &RPSDQ\ LQFOXGLQJ LWV  MRLQW YHQWXUH companies in accordance with the accounting principles generally accepted in India. An audit also includes evaluating the appropriateness of the accounting policies used and the reasonableness of the accounting estimates made by the Company’s Board of Directors. making judgments and estimates that are reasonable and prudent. including the assessment of the risks of material misstatement RI WKH FRQVROLGDWHG oQDQFLDO VWDWHPHQWV ZKHWKHU GXH to fraud or error. the DXGLWRU FRQVLGHUV LQWHUQDO oQDQFLDO FRQWURO UHOHYDQW WR WKH &RPSDQ\ V SUHSDUDWLRQ RI WKH FRQVROLGDWHG oQDQFLDO statements that give a true and fair view in order to design audit procedures that are appropriate in the circumstances but not for the purpose of expressing an opinion on whether the Company has an adequate LQWHUQDOoQDQFLDOFRQWUROVV\VWHPRYHUoQDQFLDOUHSRUWLQJ in place and the operating effectiveness of such controls. the selection and application of appropriate accounting policies. In making those risk assessments.

the aforesaid FRQVROLGDWHG oQDQFLDO VWDWHPHQWV JLYH WKH LQIRUPDWLRQ required by the Act in the manner so required and give . RI WKH $FW KHUHLQDIWHU UHIHUUHG WR DV kWKH FRQVROLGDWHG oQDQFLDO Those Standards require that we comply with ethical statements”). requirements and plan and perform the audit to obtain 246 for the We believe that the audit evidence obtained by us is VXIoFLHQWDQGDSSURSULDWHWRSURYLGHDEDVLVIRURXUDXGLW RSLQLRQRQWKHFRQVROLGDWHGoQDQFLDOVWDWHPHQWV Opinion In our opinion and to the best of our information and according to the explanations given to us.

the &RQVROLGDWHG 6WDWHPHQW RI 3URoW DQG /RVV DQG the Consolidated Cash Flow Statement dealt with by this Report are in agreement with the relevant books of account maintained for the purpose of preparation of the consolidated oQDQFLDOVWDWHPHQWV (f) iii. proper books of account as required by law relating to preparation of the DIRUHVDLG FRQVROLGDWHG oQDQFLDO VWDWHPHQWV have been kept so far as it appears from our examination of those books. to the extent applicable. For K. 2014. none of the GLUHFWRUV RI WKH &RPSDQ\ LV GLVTXDOLoHG DV RQ 31st December. 2015. on FRQVROLGDWHGoQDQFLDOSRVLWLRQLQ1RWH  WRLWVFRQVROLGDWHGoQDQFLDOVWDWHPHQWV ii.AIYAR & Co Chartered Accountants ICAI Firm’s Registration No. that: (a) We have sought and obtained all the information and explanations which to the best of our knowledge and belief were necessary for the purposes of our audit of the aforesaid FRQVROLGDWHGoQDQFLDOVWDWHPHQWV (b) In our opinion. Report on Other Legal and Regulatory Requirements With respect to the other matters to be included in the Auditor’s Report in accordance with Rule 11 of the Companies (Audit and Auditor’s) Rules. (c) The Consolidated Balance Sheet.S. As required by the Companies (Auditor’s Report) Order. 247 . There were no amounts that were required to be transferred to the Investor Education and Protection Fund by the Company or any of the 4 joint venture companies. The Company has disclosed the pending litigations and its impact. to the extent applicable. 2016 oQDQFLDOVWDWHPHQWVFRPSO\ZLWKWKH$FFRXQWLQJ 6WDQGDUGVVSHFLoHGXQGHU6HFWLRQRIWKH$FW read with Rule 7 of the Companies (Accounts) Rules. 2015 (“the Order”). As required by Section 143(3) of the Act. issued by the Central Government of India in terms of sub-section (11) of Section 143 of the Act. 2015 from being appointed as a director in terms of Section 164 (2) of the Act. of the consolidated state of affairs of the Company as at 31st December. 38526 Place of Signature: Mumbai (d) In our opinion. the aforesaid consolidated Date: 25th January. The Company or the 4 joint venture companies did not have any long-term contracts including derivative contracts for which there were any material foreseeable losses. Financial Statements Subsidiary Companies (e) On the basis of the written representations received from the directors of the Company as on 31st December. if any. JOSHI Partner Membership No. in our opinion and to the best of our information and according to the explanations given to us: 1.Corporate Overview Financial Highlights Board & Management Reports a true and fair view in conformity with the accounting principles generally accepted in India. i. we report. 100186W RAJESH S. DQGWKHLUFRQVROLGDWHGSURoWDQGWKHLUFRQVROLGDWHGFDVK pRZVIRUWKH\HDUHQGHGRQWKDWGDWH Other Matters 7KH oQDQFLDO VWDWHPHQWV RI  MRLQW YHQWXUH FRPSDQLHV that are consolidated have been audited by us only for WKH SXUSRVH RI SUHSDULQJ WKHVH FRQVROLGDWHG oQDQFLDO statements by the Company and not as Statutory Auditors of those 4 joint venture companies. we give in the Annexure a VWDWHPHQW RQ WKH PDWWHUV VSHFLoHG LQ SDUDJUDSKV  and 4 of the Order. 2014. 2015 taken on record by the Board of Directors of the Company. 2.

including quantitative details and VLWXDWLRQRIo[HGDVVHWV  E. (i)  (ii) (iii) (iv) (v) (vi) (vii) (a) The Company and 4 joint venture companies have maintained proper records showing full particulars.ACC MINERAL RESOURCES LIMITED (AMRL) ANNEXURE TO THE AUDITORS’ REPORT Referred to in paragraph 1 on Report on Other Legal and Regulatory Requirements of our report.

b and c are not applicable. Wealth tax. (b) According to the records of the Company and 4 joint venture companies. Custom duty. there are no dues of Income tax. YLLL. In our opinion the same is reasonable having regard to the size of the Company and 4 joint venture companies DQGWKHQDWXUHRILWVo[HGDVVHWV1RPDWHULDO GLVFUHSDQFLHVZHUHQRWLFHGRQVXFKYHULoFDWLRQ The Company and 4 joint venture companies did not have any inventory so Clauses (ii) a. (c) There is no amount required to be transferred to investor education and protection fund in accordance with the relevant provisions of the Companies Act. Service tax. 1956 (1 of 1956) and rules made thereunder. Excise duty and cess which have not been deposited on account of any dispute. 7KHVH o[HG DVVHWV KDYH EHHQ SK\VLFDOO\ YHULoHG E\ WKH PDQDJHPHQW DW UHDVRQDEOH intervals during the year. Sales tax.

Custom duty. 2013. the Company and 4 joint venture companies are not liable to make any payments towards Investor Education Protection Fund. incurred cash losses during the year. the provisions of section 73 to 76 of the Companies (x) The Company and 4 joint venture companies have Act. 2013 is not applicable. Therefore LPPHGLDWHO\SUHFHGLQJoQDQFLDO\HDUWKH&RPSDQ\ the requirements of sub-clause (a) and (b) of clause LQ LWV VWDQGDORQH oQDQFLDO VWDWHPHQWV KDG (iii) are not applicable to the Company and 4 joint accumulated losses as at the year end and also had venture companies. 38526 . 2013 are not applicable. Chartered Accountants ICAI Firm’s Registration No.S. the employment of the Company and 4 joint venture companies. Service tax. Accordingly the Provident Fund and Employees’ State Insurance are not applicable to the Company. For K. as at December 31. Excise duty and cess. 7KH&RPSDQ\LQLWVVWDQGDORQHoQDQFLDOVWDWHPHQWV has accumulated loss at the end of the current The Company and 4 joint venture companies have oQDQFLDO \HDU 7KH &RPSDQ\ LQ LWV VWDQGDORQH not granted any secured or unsecured loans to any oQDQFLDO VWDWHPHQWV KDV QRW LQFXUUHG FDVK ORVV party covered in the register maintained under GXULQJ WKH FXUUHQW oQDQFLDO \HDU 'XULQJ WKH section 189 of the Companies Act. 100186W Place of Signature: Mumbai Date: 25th January. Sales tax. JOSHI Partner Membership No. 2016 RAJESH S. Therefore the requirement of maintenance of cost (xi) The Company and 4 joint venture companies did not raise any term loans during the year. The Company and 4 joint venture companies have been depositing Profession Tax and Income tax 248 dues with the appropriate authority and there were no undisputed amounts payable thereof which are outstanding. records under sub-section (l) of section 148 of the (xii) No fraud on or by the Company and 4 joint venture Companies Act. Wealth tax. companies have been noticed or reported during (a) During the year there were no employees in the year.AIYAR & Co. Further. not given any guarantees for loans taken by others The Company and 4 joint venture companies IURPDQ\EDQNRUoQDQFLDOLQVWLWXWLRQ did not engage in any manufacturing activities. (ix) The Company and 4 joint venture companies have The Company and 4 joint venture companies have QRW WDNHQ DQ\ ORDQV IURP DQ\ oQDQFLDO LQVWLWXWLRQ not accepted any deposits from public therefore or bank or by way of debentures. 4 joint venture There is an adequate internal control system companies have accumulated losses as at year end commensurate with the size of the Company and LQFXUUHQWoQDQFLDO\HDUDVZHOODVLQWKHSUHFHGLQJ 4 joint venture companies and the nature of its oQDQFLDO \HDU DQG KDYH DOVR LQFXUUHG FDVK ORVVHV EXVLQHVVIRUSXUFKDVHRIo[HGDVVHWV7KHUHLVDQR GXULQJFXUUHQWoQDQFLDO\HDUDVZHOODVLQSUHFHGLQJ continuing failure to correct major weaknesses in oQDQFLDO\HDU internal control system. 2015 for the period of more than six months from the date they became payable. based on our examination of the records maintained during the year.

74.79.392 (b) 6KRUWWHUPORDQV  advances 8 37. 2015 Particulars Financial Statements FOR THE YEAR ENDED 31ST DECEMBER 2015 Particulars As at 31-12-2014 (`) Equity and Liabilities (1) Shareholders’ Funds (a) Share Capital 3 1.170 (2) Current Assets (a) Cash and Bank Balances 7 54.86.65.43.35.05.680 III IV II Assets (1) Non Current Assets (a) Fixed Assets (i) 6 Tangible assets 2.93.66.36.30.411) 5 4.65.62.47.Corporate Overview Financial Highlights Board & Management Reports CONSOLIDATED BALANCE SHEET I Note No.78.827 16.91.391 45.99 RWKHUV 14. 2015 2014 (`) (`) - 6 7UDYHOOLQJ &RQYH\DQFH -General Charges -Diesel for DG set 7HOH&RPPXQLFDWLRQ  Electricity charges -CSR Expenditure 6DIHW\0DWHULDOV 6LWH Infrastructure -Miscellaneous Expenditure Written off Total Expenses 3URoW /RVV.486 2.948 48.58.620 (b) /RQJWHUP/RDQV  Advances -Long term Loans to JV Companies -Capital Advances -Rent in Advance -Security Deposit With 033.920 1.65.828 37.87.90.00. ended 31st ended 31st December.05.091 I II (2) Current Liabilities Other Current Liabilities TOTAL 1.27.27.21.00.25.84. As at 31-12-2015 (`) Subsidiary Companies CONSOLIDATED STATEMENT OF PROFIT & LOSS AS AT 31ST DECEMBER.000 (b) Reserves and Surplus 4 (4.75.95.506 (iii) Intangible Assets under development 16.353 TOTAL 1.97.28.660 1.29.283 12.408 - (c) Other Current Assets 9 49.94.91.92.000 1.049 24.87.90.03.21.95.75.000 34.977 1.17.41.26.QWHUHVWRQ/RDQV $GYDQFHV (ii) Interest Received on Deposit with Bank (iii) Other income Total Revenue Expenses Depreciation and Amortization Expenses Other Expenses -Interest -Rent 5DWHV 7D[HV -Audit Fees -Bank Charges &RQVXOWDQF\ OHJDO&KDUJHV 3ULQWLQJ 6WDWLRQHU\ -Security Service Expenses Note For the year For the year No.623) (6.66.631 1.180 (ii) Capital work-in-progress 23.33. December.59.660 1.21.22.21.33.654 35.06.000 1.680 5HIHU6LJQLoFDQW$FFRXQWLQJ3ROLFLHV 2WKHU([SODQDWRU\LQIRUPDWLRQ 2 V VI Revenue from Operations Other Income (i) .23.66.09.36.

EHIRUH7D[ Tax Expenses -Current Year Tax VII 3URoW /RVV.

2016 DINESH KUMAR SONTHALIA Company Secretary 249 . No.053 6. 038526 SUNIL NAYAK Director DIN: 00081466 N H ITALIA Director DIN: 00191611 Mumbai.893 7.280 1.57.780 9.76.31.428 7.59.47) The notes referred to above form an integral part of the Consolidated Financial Statements The notes referred to above form an integral part of the Consolidated Financial Statements As per our report of even date For and on behalf of the Board of ACC Mineral Resources Limited.84. 2016 DINESH KUMAR SONTHALIA Company Secretary RAJESH S.80.643 1.387 3.516 4. No.179 4.41.42.12.S.89. 25th January. For K.29.327 27.877 8. 25th January.52.04. As per our report of even date For and on behalf of the Board of ACC Mineral Resources Limited.29.01.25.215 (5.914 2.07.23.788 (5.02.77.74.375) 10 13 2 52.83.238 14.69.427 - 99.66.250 49.460 3.70.54.02.90.16.48.803 4. 100186W For K.971 1. Chartered Accountants ICAI Firm Regn.375) 1.78.98.S.900 2.88.556 1.151 4.021 1.644 25. Chartered Accountants ICAI Firm Regn.00.427 2. Aiyar & Co.54.881 13.140 4.613 2.900 3.361 16. 100186W RAJESH S.05.993 1.05.84.691 1.98.377 11.369 3.71.508 1.93.98 (44. JOSHI Partner Membership No. Aiyar & Co.96. 038526 SUNIL NAYAK Director DIN: 00081466 N H ITALIA Director DIN: 00191611 Mumbai. JOSHI Partner Membership No.641 - 1.42.IRUWKH\HDU VIII Earning per Share 5HIHU6LJQLoFDQW$FFRXQWLQJ3ROLFLHV  Other Explanatory information 3.670 5.002 3.

84.14.14.460) 14 Proceeds from issue of Share Capital - 1.48.21. 2015 For the year ended 31st December.00.55.88.596) &DVKpRZIURPLQYHVWLQJDFWLYLWLHV 9 Purchase of Fixed Assets 10 6DOH$GMXVWPHQWVRIo[HGDVVHWV 11 (Increase)/decrease in capital advances 12 Interest received Net cash used in investing activities C.138) &DVKpRZIURPoQDQFLQJDFWLYLWLHV 13 Interest paid - (5.(Net) 1HW&DVKpRZIURPRSHUDWLQJDFWLYLWLHV B.34.797) (45.15.729) 2SHUDWLQJSURoWEHIRUHZRUNLQJFDSLWDOFKDQJHV Adjustments for : 6 Other receivables 7 Other current liabilities Cash generated from operations 8 Direct Taxes .ACC MINERAL RESOURCES LIMITED (AMRL) CONSOLIDATED CASH FLOW STATEMENT FOR THE YEAR ENDED DECEMBER 31ST.95.05.87.76.677) (41.375) Adjustments for : 2 Depreciation 3 Interest Income 14.51.62.76.70.69.84.215 1HW3URoWEHIRUH7D[ (5. For the year ended 31st December.99.151 4. 2015 (`) Particulars A. 2014 (`) &DVKpRZIURPRSHUDWLQJDFWLYLWLHV 1 2.000 15 Loan to Joint Ventures - (34.08.727) (16.87.98.303 - 43.646) (6.74.540 1HWLQFUHDVH GHFUHDVH.91.02.238) 4 5 Interest Expense - 5.836) (32.250 (34.00.544 (37. 12. (7.32.84.12.971 (3.17.808) 1.810) (5.18.68.60.28.275) 1.984 (45.231 (69.301) (33.92.474) (28.70.65.47.70.67.229 (36.419) - 16.460 Miscellaneous Expenditure - 99.877 45.60.43.96.641) (1.42.50.53.66.15.61.66.53.93.000) - 76.34.

S. JOSHI Partner Membership No.01.79.415) 87. 2016 DINESH KUMAR SONTHALIA Company Secretary 250 N H ITALIA Director DIN: 00191611 .928 Cash and cash .26.24. Aiyar & Co. No. For K.LQFDVKDQGFDVKHTXLYDOHQWV (70.392 1HWFDVKXVHGLQoQDQFLQJDFWLYLWLHV equivalents .46. 100186W RAJESH S. 25th January.Opening Balance 1.26.Closing Balance 1RWHV$OOoJXUHVLQEUDFNHWVDUHRXWpRZ 2 3UHYLRXV3HULRG VoJXUHVDUHUHJURXSHGUHDUUDQJHGZKHUHYHUQHFHVVDU\ 3 Cash and Cash Equivalents is Cash and Bank Balance as per Balance Sheet. Chartered Accountants ICAI Firm Regn.464 54.977 1.25.392 38. 038526 SUNIL NAYAK Director DIN: 00081466 Mumbai. The notes referred to above form an integral part of the Balance Sheet As per our report of even date For and on behalf of the Board of ACC Mineral Resources Limited.25.

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES FORMING PART OF CONSOLIDATED FINANCIAL STATEMENTS FOR THE YEAR ENDED DECEMBER 31. CORPORATE INFORMATION (V) 2. 2015 1. Dividend income is recognized when the right to receive such dividend is established. Interest income is recognized on a time proportion basis taking into account the amount outstanding and the rate applicable. SIGNIFICANT ACCOUNTING POLICIES (I) Basis of preparation L.

 (II) 7KH oQDQFLDO VWDWHPHQWV KDYH EHHQ SUHSDUHG DQG presented under the historical cost convention on accrual basis of accounting in accordance with the accounting principles generally accepted in India and in compliance with provisions of the Companies Act. Provision for diminution in the value of long term investments is made only if such a decline is other than temporary in nature. 2013 and comply with the mandatory Accounting Standards QRWLoHGXQGHUVHFWLRQRIWKH&RPSDQLHV$FW read with Rule 7 of Companies (Accounts) Rules. Foreign currency monetary items are subsequently reported using the closing rate. The deferred tax charge or credit is recognized using current tax rates. (VIII) Income taxes Tax expense comprises of current and deferred tax. (iii) Accounting policies have been consistently applied by the Company except as stated otherwise. (VII) Foreign currency transactions Foreign currency transactions are initially recorded at the rates of exchange prevailing on the date of transactions. (ii) Financial statements are based on historical cost except where impairment is made and/or revaluation is carried out. Where there is unabsorbed depreciation or carry forward losses. Fixed Assets L. (III) Current investments are carried at lower of cost and fair market value. deferred tax assets are recognized only if there is virtual certainty of realization of assets. Long term investments are carried at cost. Non-monetary items which are carried in terms of historical cost denominated in a foreign currency are reported using the exchange rate at the date of the transaction. are recognised as income or as expenses in the year in which they arise. Exchange differences arising on the settlement of monetary items or on reporting company’s monetary items at rates different from those at which they were initially UHFRUGHG GXULQJ WKH \HDU RU UHSRUWHG LQ SUHYLRXV oQDQFLDO statements. 2014.

(ii) Intangible assets: a. 7DQJLEOH o[HG DVVHWV DUH VWDWHG DW WKH FRVW RI acquisition less depreciation. expenses for regulatory clearances. Development Expenses has been recognized as intangible assets under development and includes expenses on account of prospecting. b. exploration and evaluation of coal mines etc. . These expenses are carried forward and will be capitalized once the mine starts the commercial production.P.9. Mineral rights of coal has been recognized as intangible assets under development and valued equivalent to the Equity share capital allotted to The M. State Mining Corporation Limited (MPSMC) in lieu thereof in terms of the provisions of Joint Venture Agreements of four Joint Venture Companies.

'HSUHFLDWLRQRQWDQJLEOHo[HGDVVHWVLVSURYLGHGRQVWUDLJKW line method at the rates prescribed in schedule II of the Companies Act.P. actual results could differ from these estimates. State Mining Corporation Limited (MPSMC) for mining and development of four coal blocks allotted to MPSMC by Ministry of Coal. The company has entered into four joint ventures in the year 2009 with M. 2013 on a pro-rata basis. Other deferred tax assets are recognized only to the extent there is reasonable certainty of realization in future. Intangible assets of mine and Infrastructure Development will be amortized based on the coal extracted in proportion of the coal mine reserve of the respective coal block. Revenue recognition Dividend and Interest income The company is a wholly owned Subsidiary of ACC Limited. . Deferred tax assets/liabilities are reviewed as at each balance sheet date. 'HSUHFLDWLRQ$PRUWL]DWLRQ  (VI) Investments Use of estimates 7KH SUHSDUDWLRQ RI oQDQFLDO VWDWHPHQWV LQ FRQIRUPLW\ with generally accepted accounting principles requires management to make estimates and assumptions that affect the reported amounts of assets and liabilities and GLVFORVXUHRIFRQWLQJHQWOLDELOLWLHVDWWKHGDWHRIWKHoQDQFLDO statements and the results of operations during the reporting period end. Although these estimates are based upon management’s best knowledge of current events and actions.

there are no reportable geographical segments. in respect of which reliable estimate can be made. As the company has not yet started its commercial activities. it is probable that an RXWpRZ RI UHVRXUFHV HPERG\LQJ HFRQRPLF EHQHoW ZLOO EH required to settle the obligation. These are reviewed at each balance sheet date and adjusted WRUHpHFWWKHFXUUHQWEHVWHVWLPDWH$FRQWLQJHQWOLDELOLW\LV GLVFORVHG XQOHVV WKH SRVVLELOLW\ RI DQ RXWpRZ RI UHVRXUFHV HPERG\LQJHFRQRPLFEHQHoWLVUHPRWH (X) Segment Reporting The company operates in one business segment i. &RQWLQJHQFLHV3URYLVLRQV A provision is recognized when an enterprise has a present obligation as a result of past event. This business segment is regarded as the primary segment.e. Development and operation of coal mines. (XI) Share issue expenses are written off to the statement of 3URoWDQG/RVVLQWKH\HDULWLVLQFXUUHG 251 . Provisions are not discounted to its present value and are determined based on best estimate required to settle the obligation at the balance sheet date.

95.95.000 100% NOTE 4 : RESERVES AND SURPLUS AMRL JVC Total Total As at As at As at As at 31-12-2014 31-12-2015 31-12-2015 31-12-2015 (`) (`) (`) (`) Surplus Balance as per last accounts 3URoW /RVV.000 1.000 Issued during the year At the end of the period As at 31-12-2015 The rights.00.00.95.21.each (Prev.000 1.95.95.per share Every holder of the equity share of the Company is entitled to one vote per share held In case the company declares any dividend.000 Equity shares of `100/. after all preferential payments.21.95.2015 % held Numbers ACC Limited 31.000 - - 1.21.000 Equity Shares of `100/.000 Equity shares of `100/.95.000 1. the equity shareholders will be entitled to receive the dividend in proportion of the number of shares held by each equity shareholder.each 1.30.000 4.30.21.000 1.000 100% 1.95.00.21.2014 % held Numbers 1. In the event of liquidation of the Company. preferences and restrictions including restrictions on the distribution of dividends and the repayment of Capital.00.000 1.000 1.21. The Company is having only one class of shares i.00.ACC MINERAL RESOURCES LIMITED (AMRL) NOTES FORMING PART OF CONSOLIDATED FINANCIAL STATEMENTS FOR THE YEAR ENDED DECEMBER 31.95.95. Year 1. subscribed and fully paid : 1.21.00.00.000 1. Numbers At the beginning of the period (d) Numbers As at 31-12-2014 (`) (`) 1.000 (Prev.000 100% 1.21.21.e Equity carrying a nominal value of ` 100/.30.21.12.00.95. Year 1.each) (All the Shares are held by ACC Limited.00.000 1.000 1.each) (b) Shares issued.21.21.95. The distribution to the equity shareholders will be in proportion of the number of shares held by each shareholder. Particulars 31. the Holding Company and its nominees) (c) Reconciliation of the number of shares outstanding at the beginning and at the end of the reporting period .00.00.95.00.000 1.00.00.00.21.12.95.95.000 Equity Shares of `100/.000 1.17.95. (e) Shares in the company held by each shareholder holding more than 5 percent shares specifying the number of shares held. the equity shareholders will be entitled to receive remaining assets of the Company after the distribution to all the preferential creditors.21.000 100% 1.21.17.30.00.21.95.000 4. 2015 NOTE 3: SHARE CAPITAL : (a) As at As at 31-12-2015 31-12-2014 (`) (`) 6KDUHVDXWKRUL]HG 1.00.95.

84.817) (4.623) (6.072 (20.788 (5.71.284) 2.94.84.41.21.61.50.81.IRUWKH\HDU TOTAL 252 (3.411) (99.036) 2.22.98.43.41.94.533) (6.01.878) (3.96.41.90.52.411) .63.28.375) (1.806) (3.84.

301 2.413 6.32.284 4.816 32.824 NOTE 7 : CASH & BANK BALANCES AMRL &DVK &DVK(TXLYDOHQW Cash in hand %DQN%DODQFH&XUUHQW$FFRXQW 7'5 TOTAL JVC Total Total As at As at As at As at 31-12-2014 31-12-2015 31-12-2015 1-12-2015 (`) (`) (`) (`) 1.284 4.19.597 3.22.049 21.92.301 1.59.999 15.125 12.34.25.272 - - 6.828 44.96.20.680 2.00.977 9.095 4.66.791 3.35.161 1.743 54.28.09.362 16.53.20.216 44.41.165 1.860 28.87.40.79.26.66.58.376 1.283 1.99.25.219 1.61.180 23.65.743 54.81.150 43.107 4.63.841 15.165 48.283 12.486 6.401 79.708 1.161 32.40.00.17.87.40.58.860 1.74.000 6.66.81.636 1.165 - - - .158 - 1.1.53.073 54.53.827 42.392 253 .945 41.047 1.36.40.63.165 - .55.56.676 28.66.805 (b) Payable to Others 4.53.25.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES FORMING PART OF CONSOLIDATED FINANCIAL STATEMENTS FOR THE YEAR ENDED DECEMBER 31.828 16.59.034 55.23.53.26.34.272 2.458 - 10.548 2.055 37.28.158 1.180 24.65.92.74.575 34.927 1.66.671 17.88. Fixtures (TXLSPHQWV 47.514 Land Digital Camera Gps.27.016 1.47.18.528 3ODQW 0DFKLQHU\ 80.63.86.73.000 - - 80.599 73.855 6.46.127 2.58.759 2.40.65.120 - 2.05.07.977 28.781 5.240 14.46.98.36.165 - 6.600 2.31.818 - 6.17.821 2.26.091 NOTE 6 : FIXED ASSETS Amount in ` Nature of o[HGDVVHWV Gross Block Depreciation / Amortisation Net Block As at Additions Deductions/ As at As at Provided Deductions/ As at As at 01-01-2015 during the Adjustments 31-12-2015 01-01-2015 during the Adjustments 31-12-2015 31-12-2015 Period Period As at 31-12-2014 TANGIBLE ASSETS Furniture.65.188 8.272 - 4.403 3.78.000 95.26.00.806 1.680 1.643 3. 2015 NOTE 5 : OTHER CURRENT LIABILITIES (a) Audit Fees Payable AMRL JVC Total Total As at As at As at As at 31-12-2014 31-12-2015 31-12-2015 31-12-2015 (`) (`) (`) (`) 1.83.879 23.32.65.90.Oregon Printer Vehicle TOTAL Previous year Capital Work-InProgress INTANGIBLE ASSETS UNDER DEVELOPMENT Mine and Infrastructure Development Expenses Total Grand Total 23.286 TOTAL 4.96.22.40.59.06.65.1.806 - - 3.827 16.941 - 4.350 91.17.26.55.000 - - 48.33.49.29.165 6.04.19.28.506 16.234 54.151 4.

099 4. 11.633 32. 2015 NOTE 8 : SHORT TERM LOANS & ADVANCES Short term loan to ACC limited (Unsecured.29.90.798 8. Consequently Loss for the previous year was higher by ` 102.660 21.353 TAXATION ` 52.207 47.76. 2015.ACC MINERAL RESOURCES LIMITED (AMRL) NOTES FORMING PART OF CONSOLIDATED FINANCIAL STATEMENTS FOR THE YEAR ENDED DECEMBER 31.081 2. There is no change during the Current year. During the previous year.948 (`) 16. RELATED PARTY DISCLOSURE  $.66. 12.90.75.408 - 37.833 and Reserves and surplus were lower by a like amount as compared to its previous policy.427 (Previous year .05.768 (`) 1.47.76.90.561 21.408 (`) - NOTE 9 : OTHER CURRENT ASSETS AMRL Advances to others Advance tax (Net of provision for Tax) TDS Receivable TOTAL 10.408 - (`) 37.47.408 (`) 37.207 4.081 49.180 (`) 27.23.Nil) provision for current tax is made as at 31st December.96. JVC Total Total As at 31-12-2014 As at As at As at 31-12-2015 31-12-2015 31-12-2015 (`) 25.47. Company had changed its accounting policy in respect of share issue expenses which hitherto were written off over a period of 60 months were being written off in the year in which same is incurred.00. considered good) TOTAL AMRL JVC Total Total As at As at As at As at 31-12-2014 31-12-2015 31-12-2015 31-12-2015 (`) 37.90.922 48.05.47.09.25.47.

 3DUWLFXODUVRI+ROGLQJ-RLQW9HQWXUH&RPSDQLHV  Name of Related Party Nature of Relationship ACC Limited Holding Company MP AMRL (Semaria) Coal Company Limited Joint Venture Company (49% interest in Equity is held by AMRL) MP AMRL (Bicharpur) Coal Company Limited Joint Venture Company (49% interest in Equity is held by AMRL) MP AMRL (MarkiBarka) Coal Company Limited Joint Venture Company (49% interest in Equity is held by AMRL) MP AMRL (Morga) Coal Company Limited Joint Venture Company (49% interest in Equity is held by AMRL) %.

00.000 2 Inter Corporate Deposits Received During the Year - 75. 2014 ` 1 Opening Balance of Inter Corporate Deposit - 34. 7UDQVDFWLRQVZLWK+ROGLQJ&RPSDQ\$&&/LPLWHG Particulars 254 For the year ended December 31.50.00.17. 34.40.000 4 Inter Corporate Deposits as at the end of the year - - 5 Investment in equity shares received - 1. 2015 ` For the year ended December 31.408 - 37.34.25.48.73.47.00.000 6 Short term loan to ACC Limited 35.00.47.408 - .000 - 7 Interest on Loan (Net of TDS) 8 Closing balance of Short term loan to ACC Limited 2.90.000 3 Inter Corporate Deposits paid during the year - 109.

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES FORMING PART OF CONSOLIDATED FINANCIAL STATEMENTS FOR THE YEAR ENDED DECEMBER 31. 2015  &.

 7UDQVDFWLRQVZLWK-RLQW9HQWXUH&RPSDQLHV .

03.486 -Advance for Expenses Repaid Outstanding balance included in Long-term loans and advances 2 MP AMRL (Bicharpur) Coal Company Ltd.190 5.03.187 MP AMRL (MarkiBarka) Coal Company Ltd.46.973 Transactions during the year -Advance given for expenses 1.56.04.935 56.00. 2015 ` Particulars 1 For the year ended December 31.169 -Advance given for expenses 3.887 -Interest Charged on the above (Net of TDS) 3.206 5.Advance given for expenses -Interest Charged on the above (Net of TDS) -Advance for Expenses Repaid Outstanding balance included in Long-term loans and advances 4 - - 10. Opening Balance 2.17.340 2. 2014 ` 3URoW /RVV. 2015 ` For the year ended December 31.84.154 19.033 For the year ended December 31.40. Opening Balance Transactions during the year .504 19.70.93.67.75.843 MP AMRL (Morga) Coal Company Ltd.130 2.00.858 4.55.87. Opening Balance Transactions during the year -Advance for Expenses Repaid Outstanding balance included in Long-term loans and advances 3 - - 61.88.21.033 - 85.515 4. 2014 ` MP AMRL (Semaria) Coal Company Ltd.60.58.21.073 40.08.935 1.54.153 2.76.40.09. For the year ended December 31.376 14. Opening Balance Transactions during the year .09.41.600 10.579 56.61.299 11.206 2.60.75.82.14.376 10.85.841 2.83.75.82.607 8.075 - - 2.06.200 -Interest Charged on the above (Net of TDS) 1.65.46.Advance given for expenses -Interest Charged on the above (Net of TDS) -Advance for Expenses Repaid - - 3.15.83.88.536 48.76.64.

798 d.598 255 .284 c. The aggregate amounts of assets.11.DIWHUWD[DWLRQDVSHU6WDWHPHQWRI3URoWDQG/RVV 2.658 ` 92.53. income and expenses related to the Company’s interest in the four joint ventures companies are as under: a.52.000 13. EARNINGS PER SHARE . Income ` 2.15. Assets b.41. Liabilities : : ` 15.95.42.788 (58.498.` 100 per share) (There are no diluted equity shares and hence there is no working for diluted earnings per share) 14. 13.479 1. Expenses : : ` 34.47) Outstanding balance included in Long-term loans and advances (*) Transactions with joint venture companies have been disclosed at full value.21. liabilities.375) Weighted average number of Equity shares outstanding 1.82.98 (44.[EPS] Particulars Basic earnings per Share (Weighted Average) (face value .

ACC MINERAL RESOURCES LIMITED (AMRL) NOTES FORMING PART OF CONSOLIDATED FINANCIAL STATEMENTS FOR THE YEAR ENDED DECEMBER 31. total assets minus total liabilities As % of consolidated net assets 2015 Amount ` 2015 6KDUHLQSURoW ORVV.. Additional information as required by Paragraph 2 of the General Instructions for Preparation of Consolidated Financial Statements to Schedule III to the Companies Act.e. Name of the entity in the Net Assets. i. 2013. 2015 15.

49. WKH &RPSDQ\ KDV HIIHFWLYH VW -DQXDU\  DGRSWHG VSHFLoHG XVHIXO OLIH RI LWV o[HG DVVHWV DV SHU 6FKHGXOH .49 (18.22.93. WR WKH $FW 7KH Company has also chosen the option of considering residual value.` 1.06) (0.32. the charge for the depreciation for the year would have been lower by ` 6. and invested considerable amounts under the JVA towards tangible and investment assets.796) 100.81. In case of Bicharpur coal block.927) (23. post expiry of life of the asset.66.05.17.03 (48. the discussion with new allottee is going on for realization of the recorded net assets amount of that JV Company.225 108.375) 1RWH7KHDERYHoJXUHVDUHDIWHUHOLPLQDWLQJLQWUDJURXSWUDQVDFWLRQVDQGLQWUDJURXSEDODQFHVDVDW'HFHPEHU 16. This has been relied upon by the auditors. The court has granted stay against the said invocation of Bank Guarantee. of India.08. In accordance with the vesting order.01) 0. the auction has been completed in favour of other successful bidder (Ultratech Cement Limited (UTCL)) and the vesting order for Bicharpur coal mine has been issued by Nominated Authority.589 100.03.399) (7. Non-current investment of ` 196.36.377 1.23) 0.47 2.000 and Long term loans and advances of ` 37.00 2.89 (57.884) MP AMRL(Morga) Coal Company Limited (0.207) (16.654 are realisable/recoverable from four JV Companies.06. the Bicharpur JV Company has handed over the Bicharpur Coal mine to the new allottee on 6th April 2015. Small . where the Company had progressed with the development of the mine substantially. Had the Company followed the earlier practice. 17.072 (5.742) (68.10.00 1.788 (5.14) (16. Morga IV and Semaria/ Piparia coal blocks) which were originally allocated to MPSMCL. The estimated amount of contracts remaining to be executed on capital account and not provided for (net of advances) is Nil (Previous Year .71) MP AMRL(Marki Barka) Coal Company Limited (0. Govt.12 (56.04.44) (0.58.063) (15.52.20) (30. The above information regarding Micro.61. Pursuant to the enactment of the Companies Act.42.589) (0.53.43. 18. E :ULW 3HWLWLRQ oOHG DW 'HOKL +LJK &RXUW E\ WKH &RPSDQ\ LQ relation to compensation receivable upon vesting of land situated outside mining lease area of Bicharpur Coal Block.90. The allocations stand cancelled as per Supreme Court’s decision dated 25th August 2014 read with its order dated 24th September 2014 and fresh Auctioning of the blocks were proposed. Government of India. Morga IV and Semaria /Piparia coal blocks has not yet been carried out by the Ministry of Coal.546) (1.41. The Company had entered into Joint Venture Arrangements with MPSMCL for development and extraction of coal in relation to four coal blocks (namely Bicharpur.43. to be nil.05. 2013 (the Act). Small and Medium Enterprises have been determined to the extent such SDUWLHVKDYHEHHQLGHQWLoHGRQWKHEDVLVRILQIRUPDWLRQDYDLODEOH with the company.00.80.19 2014 Amount ` 2015 2014 2014 Parent ACC Mineral Resources Limited 102.00 12.93. 20.207) (5. The impact of above petitions could not be determined as the matter is subjudice.862) 100. 2006 to whom the company owes dues on account of principal amount together with interest and accordingly no additional disclosures have been made.22) (52.00 TOTAL 100.16. F :ULW 3HWLWLRQ oOHG DW -DEDOSXU +LJK &RXUW E\ 03 $05/ (Semaria) Coal Company Limited against invocation of Bank Guarantee by Ministry of Coal pertaining to Semaria / Piparia Coal Block. 21. As % of consolidated SURoWRUORVV 2014 2015 101.09.000). Subsequent to handing over the mines. The Re-auction/allocation process of other three coal blocks namely Marki Barka. Pending litigations by or against the Company are as under: D 256 :ULW 3HWLWLRQ oOHG DW 'HOKL +LJK &RXUW E\ WKH &RPSDQ\ LQ relation to compensation receivable upon cancellation of Bicharpur Coal Block.15.62.81.307) (0.20. 7KHUH LV QR 0LFUR 6PDOO DQG 0HGLXP HQWHUSULVHV DV GHoQHG LQ the Micro.51. .341) (0.805.51.840) MP AMRL(Semaria) Coal Company Limited (0. Medium enterprises Development Act.92) (2.91 86.14) (0.84.05.00.61. 19.24) 0. The Company considers these as fully realisable/ recoverable from the respective JV Companies once the monies are received by the said JV Companies upon reallocation/re allotment of their coal blocks to the new allocate in terms of the Coal Mines (Special Provisions) Ordinance 2014 and the model draft tender document published in this regard by the Ministry of Coal.98.137) (24. Marki Barka.194 1.272) (73.27) (0.48 1.993) Joint Ventures (as per proportionate consolidation) Indian MP AMRL(Bicharpur) Coal Company Limited (2..

 3UHYLRXV\HDUoJXUHVKDYHEHHQUHJURXSHGRUUHDUUDQJHGZKHUHYHU found necessary. Expert opinions on the relevant accounting aspects involved. In respect of the said corrigendum to the vesting order. KDYHEHHQPDGHDVWKHFRPSDQ\GRHVQRWH[SHFWDQ\VLJQLoFDQW reduction in the value it may realise towards such assets. Delhi High Court in its interim order dated 20th October 2015 has said that “no equities can be made in favour of UTCL. JOSHI Partner Membership No.Q UHVSHFW RI %LFKDUSXU FRDO EORFN WKH &RPSDQ\ KDV oOHG D ZULW petition in Delhi High Court in the month of March 2015.  . now that MPSMCL has ceased to hold any mining rights in such blocks. For and on behalf of the Board of ACC Mineral Resources Limited For K. if comes into possession of or does any other works over the VDLGODQGy7KHoQDOGHFLVLRQRIWKH+RQ EOHFRXUWLVDZDLWHG As per our report of even date Further.S. 2016 DINESH KUMAR SONTHALIA Company Secretary N H ITALIA Director DIN: 00191611 257 . 25th January. the JV Cos shall continue to only oversee the realization of the value of assets created and other expenses incurred. 038526 SUNIL NAYAK Director DIN: 00081466 Mumbai. 2015 In view of the cancellation of coal blocks and proposed re-auctioning of the same. claiming compensation based on actual expenditure incurred till 31st March DVDJDLQVWWKHFRPSHQVDWLRQDPRXQWo[HGE\0LQLVWU\RIFRDO WLOO VW 0DUFK  7KH &RPSDQ\ KDV DOVR oOHG D VHSDUDWH ZULW petition in Delhi High Court in the month of October 2015 against the issue of corrigendum to the said vesting order by Ministry of Coal dated 6th August 2015 wherein the Ministry of Coal has further vested the remaining land of Bicharpur coal block which is outside the mining lease area. Chartered Accountants ICAI Firm Regn. Consequently. No. the Company has also communicated to MPSMCL/ Ministry of Coal it’s claim for being compensated for the entire amount invested in the JV. if any. and handing over those assets to the new allottee’s. 100186W RAJESH S. 22. have been sought. the JV companies can no longer work towards its intended objects. Aiyar & Co.  1RFKDQJHLQWKHFODVVLoFDWLRQRIWKHDVVHWVRUDGMXVWPHQWVLQWKH carrying value of the assets standing in the books of Company. Hence the four JV Companies can no longer be considered to be operating as ‘Going Concerns.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES FORMING PART OF CONSOLIDATED FINANCIAL STATEMENTS FOR THE YEAR ENDED DECEMBER 31.

FINANCIAL HIGHLIGHTS  7KHoQDQFLDOKLJKOLJKWVRI\RXU&RPSDQ\IRUWKH\HDU ended December 31. 2015 is summarized below: PARTICULARS Revenue from operations (net) and Other Income 3URoW /RVV. CONTINUANCE OF THE EXISTING FINANCIAL YEAR The Directors take pleasure in presenting the Twenty fourth Annual Report on the business and operations of the Company and the Audited Financial Statements for the year ended December 31. 2015. MATERIAL CHANGES AND COMMITMENTS  ([FHSW DV GLVFORVHG HOVHZKHUH LQ WKH 5HSRUW WKHUH have been no material changes and commitments PDGH EHWZHHQ WKH HQG RI WKH oQDQFLDO \HDU RI WKH Company and the date of this Report. 1. which can DIIHFWWKHoQDQFLDOSRVLWLRQRIWKH&RPSDQ\ 7.BULK CEMENT CORPORATION (INDIA) LTD (BCCI) BOARD’S REPORT TO THE MEMBERS OF BULK CEMENT CORPORATION (INDIA) LIMITED 6.

%HIRUH7D[ 3URYLVLRQIRU7D[ &XUUHQW7D[ 'HIHUUHG7D[ 3URoW /RVV.

There are no material related party transactions. CONTRACT OR ARRANGEMENT WITH RELATED PARTIES In accordance with the provisions of Section 188 of the Companies Act. 3.36 (824.WHPV IRU WKH year 2015 was ` 304 lakh as against ` 629 lakh in the year 2014. 2013.21 121.71) 1984. the transactions entered into with Related Parties are in the ordinary course of business and on an arms length pricing basis. These are adequate considering the nature and size of the Company’s operations and are commensurate with the requirements of the Company. TRANSFER TO RESERVE No transfer to reserves has been made during the year under review. industrial relations at the Company’s unit continued to remain cordial and peaceful.15 OPERATIONS 'XULQJ WKH \HDU XQGHU UHYLHZ %&&.06 2014 ` Lakh 2331. 2013 and Rules framed thereunder.27) 629.16 1453.$IWHU7D[ %DODQFH EURXJKW IRUZDUG from previous year %DODQFHFDUULHGIRUZDUGWR %DODQFH6KHHW 2. 5. SIGNIFICANT & MATERIAL ORDERS PASSED BY THE REGULATORS OR COURTS OR TRIBUNALS IMPACTING THE GOING CONCERN STATUS OF THE COMPANY  7KHUH DUH QR VLJQLoFDQW DQG PDWHULDO RUGHUV SDVVHG by the Regulators or Courts or Tribunals impacting the going concern status of your Company.04 (15.99 1551. Accordingly. 9. DEPOSITS The Company has not accepted any deposits from the public or the directors during the year under review. . INTERNAL FINANCIAL CONTROLS  7KH &RPSDQ\ EHLQJ VXEVLGLDU\ RI $&& /LPLWHG WKH Internal Financial Controls of ACC are applicable to the Company. KDQGOHG cement volumes of 10.01 (414. 4. 10. 11. 12. PARTICULARS INVESTMENTS  OF LOANS.02 lakh tonnes as DJDLQVW  ODNK WRQQHV LQ  7KH 3URoW %HIRUH 7D[ DQG ([FHSWLRQDO . GUARANTEES OR 7KHUHDUHQRORDQVJXDUDQWHHVJLYHQRULQYHVWPHQWV made under the provisions of Section 186 of the Companies Act. 2015 ` Lakh 2090.15 212. DIVIDEND Your Directors do not recommend payment RI GLYLGHQG IRU WKH oQDQFLDO \HDU HQGHG December 31.82) 432.57) (530.31st December) as its oQDQFLDO\HDU 8. 2015. 258 Pursuant to a favourable Order from the Company /DZ %RDUG WKH &RPSDQ\ ZLOO FRQWLQXH WR KDYH WKH calendar year (1st January . INDUSTRIAL RELATIONS During the year under review.44 1984.

Cessation of Directorship  0U%XUMRU'1DULPDQZKRZDVDSSRLQWHGDVD'LUHFWRU of the Company with effect from January 29. the proposals for their re-appointment have been included in the Notice convening the $QQXDO*HQHUDO0HHWLQJRIWKH&RPSDQ\ 13.QGHSHQGHQW 'LUHFWRUV ZLWK HIIHFW IURP 0DUFK  2015. Declaration of Independence by Directors The Independent Directors of the Company. % 'H DV $GGLWLRQDO 'LUHFWRUV RI WKH &RPSDQ\ LQ WKH FDWHJRU\ RI 1RQ([HFXWLYH  . 0U 1RVKLU + . 2013 their respective candidatures for appointment as Directors has been included in the Notice convening WKH IRUWKFRPLQJ $QQXDO *HQHUDO 0HHWLQJ RI WKH Company. Subsidiary Companies Directors retiring by rotation there is no requirement to furnish any information in Form AOC2. ceased to be a Director of the Company with effect from December 11. 2013. 2015. each for a term of 5 years.QGHSHQGHQW Director has been included in the Notice convening WKH$QQXDO*HQHUDO0HHWLQJRIWKH&RPSDQ\ 7KH %RDUG RI 'LUHFWRUV KDV DSSRLQWHG 0U 1DYHHQ &KDGKD DQG 0U 5DMX 0LVUD DV $GGLWLRQDO 'LUHFWRUV of the Company with effect from October 15.WDOLDDQG'U.WDOLD DQG 'U . 2015 DQG -DQXDU\   UHVSHFWLYHO\ 0U 1DYHHQ &KDGKD DQG 0U 5DMX 0LVUD KROG RIoFH XSWR WKH GDWH RI WKH IRUWKFRPLQJ $QQXDO *HQHUDO 0HHWLQJ Pursuant to the provisions of Section 152(2) and Section 161 of the Companies Act. viz. the %RDUG  FRQVLGHUHG WKH TXDOLoFDWLRQV H[SHULHQFH H[SHUWLVHRIWKHFDQGLGDWHVLQWKHLUUHVSHFWLYHoHOGV professional and business standings and diversity RI WKH %RDUG $V UHJDUGV WKH DSSRLQWPHQW RI $&& V UHSUHVHQWDWLYHV RQ WKH %RDUG HPSOR\HHV RI WKH Holding Company in senior leadership positions YL] &(2 0' DQG ([HFXWLYH &RPPLWWHH PHPEHUV KDYLQJ H[SHUWLVH DQG H[SHULHQFH LQ WKH oHOG RI PDQXIDFWXULQJ VDOHV  PDUNHWLQJ DQG oQDQFH DQG who also oversee the operations of the Company as a dotted line reporting are generally recommended by ACC for appointment as Directors of the Company. DIRECTORS AND KEY MANAGERIAL PERSONNEL Appointment of Directors  7KH %RDUG RI 'LUHFWRUV KDG DSSRLQWHG 0U 1RVKLU + . Pursuant to the provisions of Section 152(2) and Section 161 of the &RPSDQLHV$FWWKHFDQGLGDWXUHRI0U1RVKLU +. 2015.  7KH%RDUGKDVSODFHGRQUHFRUGLWVDSSUHFLDWLRQRIWKH YDOXDEOHFRQWULEXWLRQPDGHE\0U%XUMRU'1DULPDQ DQG 0U -R\GHHS 0XNKHUMHH GXULQJ WKHLU UHVSHFWLYH tenures as Directors of the Company. Accordingly.Corporate Overview Financial Highlights Board & Management Reports In accordance with the provisions of the Companies $FW0U6XQLO1D\DNDQG0U-D\DQWD'DWWD*XSWD retire by rotation and being eligible offer themselves for re-appointment as Directors of the Compny. 259 . % 'H KDYH JLYHQ D GHFODUDWLRQWRWKH&RPSDQ\FRQoUPLQJWKDWWKH\ meet the criteria of independence as mentioned under Section 149(6) of the Companies Act.QGXVWU\DQGE\WKH 0LQLVWU\RI5DLOZD\VDQGWZR. 2013.%'HIRUDSSRLQWPHQWDV'LUHFWRUVLQ WKHFDWHJRU\RI1RQ([HFXWLYH'LUHFWRU.  0U -R\GHHS 0XNKHUMHH ZKR ZDV DSSRLQWHG DV D Director of the Company with effect from July 23.QGXVWU\WKH0LQLVWU\RI. E .WDOLD DQG 'U . the Company held one Independent 'LUHFWRUV 0HHWLQJ RQ 2FWREHU   %RWK the Independent Directors were present at WKH0HHWLQJ Appointment and Remuneration of Directors  7KH %RDUG FRPSULVHV oYH UHSUHVHQWDWLYHV RI $&& /LPLWHGWKH+ROGLQJ&RPSDQ\RQH'LUHFWRUHDFKWR be nominated by the Development Commissioner of &HPHQW. 2013.QGHSHQGHQW'LUHFWRUV0HHWLQJ As mandated under Schedule IV of the Companies Act.QGHSHQGHQW'LUHFWRUV For the appointment of Independent Directors.  Financial Statements Independent Directors a. ceased to be a Director of the Company with effect from October 15. 2010.

2015. the Company appointed 0U -LWHQGUD . 2013 for safeguarding the assets of the Company and for preventing and detecting fraud and other irregularities.  )XUWKHU WKH &RPSDQ\ DSSRLQWHG 0U 1RVKLU + . Audit Committee As per provisions of Section 177 of the Companies $FW  DQG 7KH &RPSDQLHV 0HHWLQJV RI %RDUG and its Powers) Rules 2014.WDOLD as the Chairman of the Audit Committee.KRU\ DV &RPSDQ\ 6HFUHWDU\ 0U -LWHQGUD .KRU\DUHHPSOR\HHV RI $&& /LPLWHG WKH +ROGLQJ &RPSDQ\ GHSXWHG DV . if any. the Company was required to re-constitute its Audit Committee so that WKH . 260 WKDW LQ WKH SUHSDUDWLRQ RI WKH DQQXDO oQDQFLDO statements for the year ended December 31. DIRECTORS’ RESPONSIBILITY STATEMENT To the best of their knowledge and belief and DFFRUGLQJ WR WKH LQIRUPDWLRQ DQG H[SODQDWLRQV obtained by them.%'H. LY WKDWWKHDQQXDOoQDQFLDOVWDWHPHQWVKDYHEHHQ prepared on a going concern basis. oYH%RDUG0HHWLQJVZHUHKHOGRQ-DQXDU\  0DUFK   $SULO   -XO\   and October 15. the directors individually as well as the evaluation of the ZRUNLQJRILWV$XGLWDQG1RPLQDWLRQ 5HPXQHUDWLRQ Committees.WDOLDDQG 'U. LLL WKDW SURSHU DQG VXIoFLHQW FDUH KDV EHHQ WDNHQ for the maintenance of adequate accounting records in accordance with the provisions of the Companies Act.H\ 0DQDJHULDO 3HUVRQQHO LQ WKH &RPSDQ\ DQG QR remuneration is being drawn by them separately from the Company. During the year ended December 31. Evaluation of the Board and its Committees Pursuant to the provisions of the Companies $FW  WKH %RDUG KDV FDUULHG RXW DQ DQQXDO performance evaluation of its own performance.BULK CEMENT CORPORATION (INDIA) LTD (BCCI) DXULQJWKH\HDUWKH%RDUGRI'LUHFWRUVGHFLGHGWRSD\ sitting fees of `IRUHDFKPHHWLQJRIWKH%RDUG and Audit Committee attended by the Independent Directors and the nominees of the Government RQ WKH %RDUG 7KH UHSUHVHQWDWLYHV RI $&& DUH QRW paid sitting fees.0HKUD1RQ([HFXWLYH'LUHFWRU  'U. . that such accounting policies as mentioned in 1RWHRIWKH1RWHVWRWKHoQDQFLDOVWDWHPHQWV have been selected and applied consistently DQGMXGJPHQWVDQGHVWLPDWHVKDYHEHHQPDGH that are reasonable and prudent so as to give a true and fair view of the state of affairs of the Company as at December 31.%'H1RQ([HFXWLYH. that systems to ensure compliance with the provisions of all applicable laws were in place and were adequate and operating effectively. 2015. the applicable accounting standards have EHHQ IROORZHG DORQJ ZLWK SURSHU H[SODQDWLRQ relating to material departures. v.QGHSHQGHQW'LUHFWRU  0U6XQLO1D\DN0U%XUMRU'1DULPDQDQG0U-R\GHHS 0XNKHUMHH FHDVHG WR EH 0HPEHUV RI WKH $XGLW Committee. During the year 2015.  0U 6XQLO 1D\DN LV D SHUPDQHQW LQYLWHH WR WKH Committee. 2013: L ii. No other remuneration is paid to the Directors. 15.QGHSHQGHQW'LUHFWRUVZHUHDSSRLQWHGDV 0HPEHUVRIWKH$XGLW&RPPLWWHH 14. MEETINGS Board Meetings Appointment of Key Managerial Personnel The Company held a minimum of one board meeting in each quarter.WDOLD &KDLUPDQ 1RQ([HFXWLYH  Independent Director  0U-. The Audit Committee presently comprises the following 0HPEHUV  0U 1RVKLU .QGHSHQGHQW 'LUHFWRUV IRUP D PDMRULW\ RQ WKH &RPPLWWHH3XUVXDQWWKHUHWR0U1RVKLU+. 2015 and of the loss of the Company for the year ended on that date. your Directors make the following statements in terms of Section 134(3)(c) of the Companies Act.XPDU 0V0DOLQL0HQRQDQG0V%LQLWD.XPDU DV 0DQDJHU 0V 0DOLQL 0HQRQ DV &KLHI )LQDQFLDO 2IoFHU DQG 0V %LQLWD .

Corporate Overview Financial Highlights Board & Management Reports DXULQJWKH\HDUIRXU$XGLW&RPPLWWHH0HHWLQJVZHUH held on January 20. 2015. April 07. 2015. 2015 and October 15.WDOLD &KDLUPDQ. 7KH 1RPLQDWLRQ  5HPXQHUDWLRQ &RPPLWWHH FRPSULVHVWKHIROORZLQJ0HPEHUV  0U 1RVKLU . 2015. July 14.

QGHSHQGHQW'LUHFWRU  0U+DULVK%DGDPL1RQ([HFXWLYH'LUHFWRU  'XULQJ WKH \HDU RQH 1RPLQDWLRQ  5HPXQHUDWLRQ &RPPLWWHH0HHWLQJZDVKHOGRQ2FWREHU 7KH ([WUDFW RI $QQXDO 5HWXUQ SXUVXDQW WR Section 92(3) of the Companies Act. 1RQ([HFXWLYH  Independent Director  'U.%'H1RQ([HFXWLYH. 2013 read with 7KH &RPSDQLHV 0DQDJHPHQW DQG $GPLQLVWUDWLRQ.

2013. hence there is no disclosure under Section 197(12) read with Rule 5(1) and 5(2) of The Companies $SSRLQWPHQW DQG 5HPXQHUDWLRQ RI 0DQDJHULDO Personnel) Rules. 2013. As per the provisions of Section 177(9) of the Companies Act. 6 $L\DU  &R WKDW WKHLU DSSRLQWPHQW LI PDGH ZRXOG be in conformity with the Companies Act. Your Directors recommend the re-appointment of 0HVVUV . The vigil mechanism YL] (WKLFDO9LHZ 5HSRUWLQJ 3ROLF\ RI $&& /LPLWHG WKH +ROGLQJ &RPSDQ\ KDV EHHQ H[WHQGHG WR the Company. As per The Companies (Cost Records and Audit) Amendments Rules. TECHNOLOGY ABSORPTION AND FOREIGN EXCHANGE EARNINGS & OUTGO As required under Section 134(3)(m) of the Companies Act 2013. 6 $L\DU  &R &KDUWHUHG $FFRXQWDQWV DV Auditors of the Company for the year 2016. 17. 2014. the following measures were interalia taken in the area of conservation of energy 16. COST RECORDS AND AUDIT 18. 2013. PARTICULARS OF CONSERVATION OF ENERGY. PARTICULARS OF EMPLOYEES There are no employees on the rolls of the Company. 2014. Hence there is no requirement to furnish the details of companies which have EHFRPH RU FHDVHG WR EH LWV VXEVLGLDULHV  MRLQW YHQWXUHVDVVRFLDWHFRPSDQLHVGXULQJWKH\HDU 261 . 6 $L\DU  &R &KDUWHUHG $FFRXQWDQWV (ICAI Firm Registration No 100186W) who are the Statutory Auditors of the Company. the Company is not required to maintain cost records. (QHUJ\HIoFLHQWVFUHZ&RPSUHVVRUVZHUHLQVWDOOHG in place of reciprocating Compressors and WKH +30969 /DPSV ZHUH UHSODFHG ZLWK /('/LJKWV v 7LPHU FLUFXLWV ZHUH LQVWDOOHG IRU 3ODQW /LJKWLQJ to optimise energy usage. the Company is required to establish a vigil mechanism. ANNUAL RETURN Nomination & Remuneration Committee  Financial Statements 22. the particulars in respect of conservation of HQHUJ\WHFKQRORJ\DEVRUSWLRQDQGIRUHLJQH[FKDQJH HDUQLQJV RXWJRDUHPHQWLRQHGKHUHLQEHORZ The Company is not required to constitute a Corporate Social Reponsibility Committee. the Company has REWDLQHG ZULWWHQ FRQoUPDWLRQ IURP 0HVVUV . retire at the FRQFOXVLRQ RI WKH HQVXLQJ $QQXDO *HQHUDO 0HHWLQJ As required under the provision of Section 139 of the Companies Act. 5XOHVLQWKHSUHVFULEHG)RUP0*7LVHQFORVHG DVk$QQH[XUH$y 20. v There was no technology absorption and no foreign H[FKDQJHHDUQLQJVDQGRXWJRGXULQJWKH\HDUXQGHU review. 21. read with The Companies (Accounts) Rules. 2014. DETAILS OF SUBSIDIARIES / JOINT VENTURES / ASSOCIATE COMPANIES  <RXU&RPSDQ\KDVQRVXEVLGLDULHVMRLQWYHQWXUHV associate companies. VIGIL MECHANISM Subsidiary Companies 19. AUDITORS  0HVVUV . Conservation of Energy: During the year.

QGXVWULDO3URPRWLRQ 3ROLF\0LQLVWU\RI&RPPHUFH  . W7.1D\DN-D\DQWD'DWWD*XSWD Director Director DIN: 00081466 DIN: 01571321 0XPEDL January 25. )RUDQGRQEHKDOIRIWKH%RDUG  6XQLO. . Raigad 410 218 262 .BULK CEMENT CORPORATION (INDIA) LTD (BCCI) 23. 2016 5HJLVWHUHG2IoFH Plot No.QGXVWU\ 0LQLVWU\ RI 5DLOZD\V $&& /LPLWHG DQG &RPSDQ\ V%DQNHUV<RXU'LUHFWRUVDOVRWKDQNWKRVH employees of the Holding Company who are on deputation to the Company and others for their valuable service and support during the year.DODPEROL Dist.:&. ACKNOWLEDGEMENT  <RXU 'LUHFWRUV WDNH WKLV RSSRUWXQLW\ WR H[SUHVV their grateful appreciation for the assistance and co-operation received from the Department of .

2014] I.QGLD.9 EXTRACT OF ANNUAL RETURN as on December 31. 2013 and Rule 12(1) of the Companies (Management and Administration) Rules. 2015 [Pursuant to Section 92(3) of the Companies Act.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies ANNEXURE ‘A’ TO BOARD’S REPORT FORM No. Registration and other details CIN Registration Date Name of the Company &DWHJRU\6XE&DWHJRU\RIWKH&RPSDQ\ $GGUHVVRIWKH5HJLVWHUHG2IoFHDQGFRQWDFWGHWDLOV 80+3/& 0D\ %XON&HPHQW&RUSRUDWLRQ . MGT.

65 0 %DQNV)O - - - - - - - - - Any Other (specify) - 50 50 0 - 40 40 0 0 94.842.65% 2(46) Company /0+3/& &HPHQW+RXVH0DKDUVKL.842.050 31. No. if any II.050 31. 2015) Demat Physical Total % of Total Shares Demat Physical Total % Change % of Total during the year Shares Promoters (including Promoter Group) (1) Indian a) .65 - 94.050 31.DUYH5RDG0XPEDL IV.DODPEROL'LVWULFW5DLJDG0DKDUDVKWUD Tel.842.842.2742 4285 No Not Applicable :KHWKHU/LVWHG&RPSDQ\ Name. - - - - - - - - - c) State Govt.050 263 .842.43% III. Particulars of Holding. Shareholding Pattern (Equity Share Capital Breakup as percentage of Total Equity) i) Category .842. Principal Business Activities of the Company All the Business Activities contributing 10% or more of the total turnover of the Company shall be stated: Name and Description of the main NIC Code of the % to total turnover of the Company Product / Services Product / Service 99671900 +DQGOLQJ 'LVWULEXWLRQRI&HPHQW 70.65 0 e) f) 31. No: 022 .65 - 94. Address and contact details of Registrar and Transfer Agent.QGLDQ1RQ*RYHUQPHQW/LPLWHGE\VKDUHV3XEOLF&RPSDQ\ 3ORW1R:./LPLWHG .000 31.000 Directors Sub-Total (A)(1) - 31.(s) - - - - - - - - - d) %RGLHV&RUSRUDWH - 94. 2015) No.842.:&.000 31. Subsidiary and Associate Companies Name and address of the Company CIN / GLN $&&/LPLWHG Holding / % of Applicable Subsidiary / Shares Section Associate held Holding 94.QGLYLGXDOV+8) - 0 0 0 - 10 10 0 0 b) Central Govt.842.wise Shareholding Category of Shareholders A. of Shares held at the beginning of the year (January 1. of Shares held at the end of the year (December 31.000 31.

642.842.020 - - 33. 2015) Demat (2) Foreign a) NRIs .wise Shareholding Category of Shareholders No.800. Public Shareholding (1) Institutions a) 0XWXDO)XQGV b) %DQNV).020 - - - - - - - 1.35 - - - - - - 100 - - 33.35 - 0 - 1.842.Individuals b) Other .800.800. Shareholding Pattern (Equity Share Capital Breakup as percentage of Total Equity) i) Category .35 - - 1.800.020 1.800.842.BULK CEMENT CORPORATION (INDIA) LTD (BCCI) IV.070 33.642.800.65 0 - 1.800.800. of Shares held at the end of the year (December 31.050 31.020 1.020 - 5.020 5. c) Central Govt.800.050 94. 2015) % of Total Shares Demat Physical Total % Change % of Total during the year Shares - 31.070 .35 0 - - - - - - - - - - - 5.020 1.020 1.020 1.800.35 0 - - 100 0 1. d) State Govt.65 - 31.800.020 - 5.070 - - - - 5.050 94. Shares held by Custodian for GDRs & ADRs Grand Total (A)+(B)+(C) 264 Physical Total No.642.020 1.642.(s) e) Venture Capital Funds f) Insurance Companies g) FIIs h) Foreign Venture Capital Funds i) Any Other (specify) Sub-Total (B)(1) (2) Non-Institutions a) Bodies Corporate i) Indian ii) Overseas b) Individuals i) Individual Shareholders holding nominal share capital upto ` 1 lakh ii) Individual Shareholders holding nominal share FDSLWDOLQH[FHVVRI ` 1 lakh c) Any Other (specify) Sub-Total (B)(2) Total Public Shareholding (B)=(B)(1)+(B)(2) C.Individuals c) %RGLHV&RUSRUDWH d) %DQNV)O e) Any Other (specify) Sub-Total (A)(2) Total Shareholding of Promoters & Promoter Group (A)=(A)(1)+(A)(2) B.800.842.050 31.35 - - - - - - - - - - - - - - - - - - 1.020 5.070 33. of Shares held at the beginning of the year (January 1.

65 0 31.65 10 0 10 0 0U6XQLO1D\DNMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 10 0 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH No change At the end of the year 3 31.050 94. 2015) No. 1.000 0U+DULVK%DGDPLMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH At the end of the year 10 0 No change 265 .842. Shareholding at the beginning of the year (January 1. 2015 to Dec. 2015) shareholding during the % of Shares No.Corporate Overview Financial Highlights Board & Management Reports Subsidiary Companies Financial Statements ii) Shareholding of Promoters (including Promoter Group) Sr. 2015) No. of Shares % of total shares of the Company Cumulative Shareholding during the year (Jan.842.65 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH No change At the end of the year 2 94.65 0 31.842. 31. if there is no change) Sr. Particulars No.65 0 0 2 0U 6XQLO 1D\DN MRLQWO\ ZLWK$&&/LPLWHG 10 0 0 10 0 0 0 3 0U+DULVK%DGDPLMRLQWO\ with ACC limited 10 0 0 10 0 0 0 4 0U %XUMRU ' 1DULPDQ MRLQWO\ZLWK$&&OLPLWHG 10 0 0 10 0 0 0 5 0U -D\DQWD 'DWWD*XSWD MRLQWO\ZLWK$&&OLPLWHG 10 0 0 10 0 0 0 6 0U -R\GHHS 0XNKHUMHH MRLQWO\ZLWK$&&OLPLWHG 10 0 0 10 0 0 0 31.842.000 94. of % of total pledged / Shares shares encumbered to of the total shares Company Shareholding at the end of the year % change in (December 31. 2015) % of Shares No.842.000 94. Shareholder’s Name No.842. 1 Shareholding at the beginning of the year (January 1.000 94. of % of total year pledged / Shares shares of the Company encumbered to total shares 1 $&&/LPLWHG 31.050 94.65 0 0 Total iii) Change in Promoters’ (including Promoter Group) Shareholding (please specify. of Shares % of total shares of the Company $&&/LPLWHG At the beginning of the year 31.

800. Promoters and Holders of GDRs and ADRs) as on December 31.800. 1. 2015) No. 31.800. 2015 to Dec.35 1. 2015) Name of Shareholder Central Government: The President of India The Development commission for Cement Industry 'HSXW\6HFUHWDU\0LQLVWU\RI. 31.35 10 10 0 0 10 10 0 0 1.QGXVWU\  Development Commission for Cement Industry Total No of shares % of total shares of the Company No of shares % of total shares of the Company 1.35 v) Shareholding of Directors & Key Managerial Personnel: Sr. of Shares % of total shares of the Company 0U%XUMRU'1DULPDQMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 10 0 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH No change At the end of the year 5 0 10 0 10 0 0U-D\DQWD'DWWD*XSWDMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 10 0 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH No change At the end of the year 6 10 0U-R\GHHS0XNKHUMHHMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 10 0 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH No change At the end of the year iv) Shareholding Pattern of top ten Shareholders (Other than Directors. 2015) No of shares % of total shares of the Company 10 0 No Change . 31. 1.35 1.QGXVWU\ -RLQW 6HFUHWDU\ 0LQVWU\ RI . 1.000 5.800. of Shares % of total shares of the Company Cumulative Shareholding during the year (Jan. 2015: Shareholding at the beginning of the year Cumulative Shareholding during the year (January 1.BULK CEMENT CORPORATION (INDIA) LTD (BCCI) Sr. 2015) 0U6XQLO1D\DNMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding At the end of the year No of shares % of total shares of the Company 10 0 Cumulative Shareholding during the year (Jan. 2015) No. 2015 to Dec. No.020 5. 2015) (Jan. 1 266 Name of Director Shareholding at the beginning of the year (January 1. 2015 to Dec. 4 Shareholding at the beginning of the year (January 1. Particulars No.000 5.020 5.

Corporate Overview Sr.H\0DQDJHULDO3HUVRQQHOKROGVKDUHVLQWKH&RPSDQ\ V. 2015) No of shares % of total shares of the Company Subsidiary Companies Cumulative Shareholding during the year (Jan. 31.QGHEWHGQHVVGXULQJWKHoQDQFLDO\HDU . Indebtedness .QGHEWHGQHVVRIWKH&RPSDQ\LQFOXGLQJLQWHUHVWRXWVWDQGLQJDFFUXHGEXWQRWGXHIRUSD\PHQW Secured Loans excluding deposits Unsecured Loans Deposits Total Indebtedness ` Crore i) Principal Amount - - - - ii) Interest due but not paid - - - - . 2015) At the beginning of the year 10 0 'DWHZLVH LQFUHDVH  GHFUHDVH LQ No Change Promoters Shareholding At the end of the year 10 0U-D\DQWD'DWWD*XSWDMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 10 0 'DWHZLVH LQFUHDVH  GHFUHDVH LQ No Change Promoters Shareholding At the end of the year 10 0 0 0 0U-R\GHHS0XNKHUMHHMRLQWO\ZLWK$&&/LPLWHG(resigned as Director with effect from December 11. 1. 2 3 4 5 Financial Highlights Name of Director Board & Management Reports Financial Statements Shareholding at the beginning of the year (January 1. 2015) No of shares % of total shares of the Company 0U+DULVK%DGDPLMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 10 0 'DWHZLVH LQFUHDVH  GHFUHDVH LQ No Change Promoters Shareholding At the end of the year 10 0U%XUMRU'1DULPDQMRLQWO\ZLWK$&&/LPLWHG(resigned as Director with effect from October 15. No.QGHEWHGQHVVDWWKHEHJLQQLQJRIWKHoQDQFLDO\HDU iii) Interest accrued but not due - - - - Total (i+ii+iii) - - - - Addition - - - - Reduction - - - - Net Change - - - - i) Principal Amount - - - - ii) Interest due but not paid - - - - iii) Interest accrued but not due - - - - Total (i+ii+iii) - - - - &KDQJHLQ. 2015 to Dec.QGHEWHGQHVVDWWKHHQGRIWKHoQDQFLDO\HDU 267 . 2015) At the beginning of the year 10 0 'DWHZLVH LQFUHDVH  GHFUHDVH LQ No Change Promoters Shareholding At the end of the year 10 0 1RWH1RQHRIWKH.

BULK CEMENT CORPORATION (INDIA) LTD (BCCI) VI. Whole-time Directors and/or Manager: Sr No. Remuneration of Directors and Key Managerial Personnel A. Remuneration to Managing Director. 1 Total Amount ` Name of MD/WTD/ Manager Particulars of Remuneration Gross Salary - - - - - (a) Salary as per provisions contained in Section 17(1) of the Income 7D[$FW - - - - - E.

9DOXHRISHUTXLVLWHVXV .

.QFRPH7D[$FW - - - - - F.

3URoWVLQOLHXRI6DODU\XQGHU6HFWLRQ .

000 60.000 60.QFRPH7D[$FW - - - - - 2 Stock Option - - - - - 3 6ZHDW(TXLW\ - - - - - 4 Commission - - - - - DVRISURoW - - - - - .000 30..000 v&RPPLVVLRQ - - - v2WKHUVSOHDVHVSHFLI\ - - - 30.000 v)HHIRUDWWHQGLQJ%RDUG&RPPLWWHH0HHWLQJV - - - v&RPPLVVLRQ - - - v2WKHUVSOHDVHVSHFLI\ - - - Total (2) - - - 30.000 30.000 30. specify… - - - - - Others.000 60.000 Particulars of Remuneration Independent Directors v)HHIRUDWWHQGLQJ%RDUG&RPPLWWHH0HHWLQJV Total (1) 2 Other Non-Executive Directors Total (B)= (1)+(2) 268 Names of Directors Mr N H Italia Sr No. please specify - - - - - Total (A) - - - - - 5 Ceiling as per the Act B.others. Remuneration to Other Directors: 1 Dr I B De Total Amount ` 30. .

H\0DQDJHULDO3HUVRQQHODSSHDULQJDW3RLQW1RRIWKH%RDUG V5HSRUW VII.LQGO\UHIHUWRSDUDJUDSKRQ.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies C. DIRECTORS C. COMPANY B. OTHER OFFICERS IN DEFAULT )RUDQGRQEHKDOIRIWKH%RDUG          6XQLO. Penalties / Punishment / Compounding of Offences: Type Section of the Companies Act Brief Description Details of Penalty/ Punishment/ Compounding fees imposed Authority (RD / NCLT/ COURT) Appeal made. 2016 269 . Remuneration to Key Managerial Personnel other than MD/Manager/WTD: . if any (give Details) Penalty - - - - - Punishment - - - - - Compounding - - - - - Penalty - - - - - Punishment - - - - - Compounding - - - - - Penalty - - - - - Punishment - - - - - Compounding - - - - - A.1D\DN-D\DQWD'DWWD*XSWD Director Director 0XPEDL January 25.

BULK CEMENT CORPORATION (INDIA) LTD (BCCI) AUDITOR’S REPORT TO THE MEMBERS OF BULK CEMENT CORPORATION (INDIA) LIMITED Report on The Financial Statements DQGWKH5XOHVPDGHWKHUHXQGHU:HFRQGXFWHGRXUDXGLW LQ DFFRUGDQFH ZLWK WKH 6WDQGDUGV RQ $XGLWLQJ VSHFLoHG XQGHU6HFWLRQ .

RIWKH$FW7KRVH6WDQGDUGVUHTXLUH WKDW ZH FRPSO\ ZLWK HWKLFDO UHTXLUHPHQWV DQG SODQ DQG perfRUPWKHDXGLWWRREWDLQ UHDVRQDEOH DVVXUDQFH DERXW ZKHWKHUWKHoQDQFLDOVWDWHPHQWVDUHIUHHIURPPDWHULDO PLVVWDWHPHQW :HKDYHDXGLWHGWKHDFFRPSDQ\LQJoQDQFLDOVWDWHPHQWV of BULK CEMENT CORPORATION (INDIA) LIMITED (“the &RPSDQ\y.

Q PDNLQJ PDWWHUV VWDWHG LQ 6HFWLRQ  . ZKLFK FRPSULVH WKH %DODQFH 6KHHW DV DW 'HFHPEHU   WKH 6WDWHPHQW RI 3URoW DQG /RVV DQG &DVK )ORZ 6WDWHPHQW IRU WKH \HDU WKHQ HQGHG DQG D VXPPDU\ RI VLJQLoFDQW DFFRXQWLQJ SROLFLHV DQG RWKHU H[SODQDWRU\LQIRUPDWLRQ $QDXGLWLQYROYHVSHUIRUPLQJSURFHGXUHVWRREWDLQDXGLW HYLGHQFH DERXW WKH DPRXQWV DQG WKH GLVFORVXUHV LQ WKH Management’s responsibility for the Financial oQDQFLDO VWDWHPHQWV 7KH SURFHGXUHV VHOHFWHG GHSHQG Statements RQ WKH DXGLWRU V MXGJPHQW LQFOXGLQJ WKH DVVHVVPHQW 7KH &RPSDQ\ V %RDUG RI 'LUHFWRUV LV UHVSRQVLEOH IRU WKH RI WKH ULVNV RI PDWHULDO PLVVWDWHPHQW RI WKH oQDQFLDO VWDWHPHQWV ZKHWKHU GXH WR IUDXG RU HUURU .

 RI WKH &RPSDQLHV $FW WKRVH ULVN DVVHVVPHQWV WKH DXGLWRU FRQVLGHUV LQWHUQDO  kWKH$FWy.

QGLD LQFOXGLQJ WKH $FFRXQWLQJ DQ RSLQLRQ RQ ZKHWKHU WKH &RPSDQ\ KDV LQ SODFH DQ 6WDQGDUGV VSHFLoHG XQGHU 6HFWLRQ  RI WKH $FW UHDG DGHTXDWHLQWHUQDOoQDQFLDOFRQWUROVV\VWHPRYHUoQDQFLDO ZLWK5XOHRIWKH&RPSDQLHV $FFRXQWV.ZLWKUHVSHFWWRWKHSUHSDUDWLRQRIWKHVH oQDQFLDOFRQWUROUHOHYDQWWRWKH&RPSDQ\ VSUHSDUDWLRQRI oQDQFLDOVWDWHPHQWVWKDWJLYHDWUXHDQGIDLUYLHZRIWKH WKHoQDQFLDOVWDWHPHQWVWKDWJLYHDWUXHDQGIDLUYLHZLQ oQDQFLDOSRVLWLRQoQDQFLDOSHUIRUPDQFHDQGFDVKpRZVRI RUGHU WR GHVLJQ DXGLW SURFHGXUHV WKDW DUH DSSURSULDWH LQ WKH&RPSDQ\LQDFFRUGDQFHZLWKWKHDFFRXQWLQJSULQFLSOHV WKHFLUFXPVWDQFHVEXWQRWIRUWKHSXUSRVHRIH[SUHVVLQJ JHQHUDOO\ DFFHSWHG LQ .

QGLDRIWKHVWDWHRIDIIDLUVRIWKH&RPSDQ\ DVDWVW'HFHPEHUDQGLWVSURoWDQGLWVFDVKpRZV IRUWKH\HDUHQGHGRQWKDWGDWH .5XOHV7KLV UHSRUWLQJDQGWKHRSHUDWLQJHIIHFWLYHQHVVRIVXFKFRQWUROV UHVSRQVLELOLW\ DOVR LQFOXGHV PDLQWHQDQFH RI DGHTXDWH $Q DXGLW DOVR LQFOXGHV HYDOXDWLQJ WKH DSSURSULDWHQHVV DFFRXQWLQJ UHFRUGV LQ DFFRUGDQFH ZLWK WKH SURYLVLRQV RI RI WKH DFFRXQWLQJ SROLFLHV XVHG DQG WKH UHDVRQDEOHQHVV WKH$FWIRUVDIHJXDUGLQJWKHDVVHWVRIWKH&RPSDQ\DQGIRU RI WKH DFFRXQWLQJ HVWLPDWHV PDGH E\ WKH &RPSDQ\ V SUHYHQWLQJDQGGHWHFWLQJIUDXGVDQGRWKHULUUHJXODULWLHV 'LUHFWRUVDVZHOODVHYDOXDWLQJWKHRYHUDOOSUHVHQWDWLRQRI VHOHFWLRQ DQG DSSOLFDWLRQ RI DSSURSULDWH DFFRXQWLQJ WKHoQDQFLDOVWDWHPHQWV SROLFLHV PDNLQJ MXGJPHQWV DQG HVWLPDWHV WKDW DUH UHDVRQDEOHDQGSUXGHQWDQGGHVLJQLPSOHPHQWDWLRQDQG :H EHOLHYH WKDW WKH DXGLW HYLGHQFH ZH KDYH REWDLQHG LV PDLQWHQDQFHRIDGHTXDWHLQWHUQDOoQDQFLDOFRQWUROVWKDW VXIoFLHQWDQGDSSURSULDWHWRSURYLGHDEDVLVIRURXUDXGLW ZHUHRSHUDWLQJHIIHFWLYHO\IRUHQVXULQJWKHDFFXUDF\DQG RSLQLRQRQWKHoQDQFLDOVWDWHPHQWV FRPSOHWHQHVV RI WKH DFFRXQWLQJ UHFRUGV UHOHYDQW WR WKH SUHSDUDWLRQDQGSUHVHQWDWLRQRIWKHoQDQFLDOVWDWHPHQWV Opinion WKDWJLYHDWUXHDQGIDLUYLHZDQGDUHIUHHIURPPDWHULDO .Q RXU RSLQLRQ DQG WR WKH EHVW RI RXU LQIRUPDWLRQ DQG PLVVWDWHPHQWZKHWKHUGXHWRIUDXGRUHUURU DFFRUGLQJ WR WKH H[SODQDWLRQV JLYHQ WR XV WKH DIRUHVDLG Auditor’s Responsibility 2XU UHVSRQVLELOLW\ LV WR H[SUHVV DQ RSLQLRQ RQ WKHVH oQDQFLDO VWDWHPHQWV EDVHG RQ RXU DXGLW :H KDYH WDNHQ LQWRDFFRXQWWKHSURYLVLRQVRIWKH$FWWKHDFFRXQWLQJDQG DXGLWLQJVWDQGDUGVDQGPDWWHUVZKLFKDUHUHTXLUHGWREH LQFOXGHGLQWKHDXGLWUHSRUWXQGHUWKHSURYLVLRQVRIWKH$FW 270 oQDQFLDOVWDWHPHQWVJLYHWKHLQIRUPDWLRQUHTXLUHGE\WKH $FWLQWKHPDQQHUVRUHTXLUHGDQGJLYHDWUXHDQGIDLUYLHZ LQ FRQIRUPLW\ ZLWK WKH DFFRXQWLQJ SULQFLSOHV JHQHUDOO\ DFFHSWHGLQ.

Corporate Overview Financial Highlights Board & Management Reports Report on Other Legal and Regulatory Requirements  $V UHTXLUHG E\ WKH &RPSDQLHV $XGLWRU V 5HSRUW.

 2UGHU  kWKH 2UGHUy.

QGLDLQWHUPVRIVXEVHFWLRQ . LVVXHG E\ WKH &HQWUDO *RYHUQPHQW RI.

RI VHFWLRQ  RI WKH $FW ZH JLYH LQ WKH $QQH[XUH D VWDWHPHQW RQ WKH PDWWHUV VSHFLoHG LQ SDUDJUDSKV  DQGRIWKH2UGHU  $V UHTXLUHG E\ 6HFWLRQ  .

 RI WKH $FW ZH UHSRUW that: D.

 :HKDYHVRXJKWDQGREWDLQHGDOOWKHLQIRUPDWLRQ DQG H[SODQDWLRQV ZKLFK WR WKH EHVW RI RXU NQRZOHGJH DQG EHOLHI ZHUH QHFHVVDU\ IRU WKH SXUSRVHVRIRXUDXGLW E.

 .Q RXU RSLQLRQ SURSHU ERRNV RI DFFRXQW DV UHTXLUHGE\ODZKDYHEHHQNHSWE\WKH&RPSDQ\ VR IDU DV LW DSSHDUV IURP RXU H[DPLQDWLRQ RI WKRVHERRNV Financial Statements Subsidiary Companies I.

 :LWKUHVSHFWWRWKHRWKHUPDWWHUVWREHLQFOXGHG LQ WKH $XGLWRU V 5HSRUW LQ DFFRUGDQFH ZLWK 5XOH RIWKH&RPSDQLHV $XGLWDQG$XGLWRUV.

5XOHV  LQ RXU RSLQLRQ DQG WR WKH EHVW RI RXU LQIRUPDWLRQ DQG DFFRUGLQJ WR WKH H[SODQDWLRQV JLYHQWRXV L 7KH &RPSDQ\ KDV RQH OHJDO FDVH SHQGLQJ DW WKH %RPED\ +LJK &RXUW ZLWK UHVSHFW WR 6HUYLFH 7D[ DQG 3HQDOW\ DPRXQWLQJ WR ` /DNKV 5HIHU1RWH1R.

QYHVWRU(GXFDWLRQ DQG3URWHFWLRQ)XQGE\WKH&RPSDQ\GXULQJ WKH\HDU F. LL 7KH &RPSDQ\ GLG QRW KDYH DQ\ ORQJWHUP FRQWUDFWV LQFOXGLQJ GHULYDWLYH FRQWUDFWV IRU ZKLFK WKHUH ZHUH DQ\ PDWHULDO IRUHVHHDEOH ORVVHV LLL 7KHUHZHUHQRDPRXQWVWKDWZHUHUHTXLUHG WREHWUDQVIHUUHGWRWKH.

 7KH %DODQFH 6KHHW WKH 6WDWHPHQW RI 3URoW DQG /RVVDQGWKH&DVK)ORZ6WDWHPHQWGHDOWZLWKE\ WKLV 5HSRUW DUH LQ DJUHHPHQW ZLWK WKH ERRNV RI DFFRXQW G.

 .QRXURSLQLRQWKHDIRUHVDLGoQDQFLDOVWDWHPHQWV FRPSO\ZLWKWKH$FFRXQWLQJ6WDQGDUGVVSHFLoHG XQGHU6HFWLRQRIWKH$FWUHDGZLWK5XOHRI WKH&RPSDQLHV $FFRXQWV.

&$.5XOHV For K.AIYAR & CO Chartered Accountants .S.)LUP5HJLVWUDWLRQ1XPEHU: H.

 2Q WKH EDVLV RI WKH ZULWWHQ UHSUHVHQWDWLRQV UHFHLYHGIURPWKHGLUHFWRUVDVRQVW'HFHPEHU 3ODFH0XPEDL  WDNHQRQUHFRUGE\WKH%RDUGRI'LUHFWRUV -DQXDU\ QRQH RI WKH GLUHFWRUV LV GLVTXDOLoHG DV RQ VW 'HFHPEHU  IURP EHLQJ DSSRLQWHG DV D GLUHFWRULQWHUPVRI6HFWLRQ .

RIWKH$FW  RAJESH S. JOSHI Partner 0HPEHUVKLS1XPEHU 271 .

BULK CEMENT CORPORATION (INDIA) LTD (BCCI) ANNEXURE TO THE AUDITOR’S REPORT 5HIHUUHGWRLQSDUDJUDSKRQ5HSRUWRQ2WKHU/HJDODQG5HJXODWRU\5HTXLUHPHQWVRIRXUUHSRUW D 7KH &RPSDQ\ LV PDLQWDLQLQJ SURSHU UHFRUGV  7KH&RPSDQ\KDVPDGHDQGPDLQWDLQHGFRVWDFFRXQWV DQG UHFRUGV DV VSHFLoHG XQGHU VXE VHFWLRQ .

 RI VKRZLQJ IXOO SDUWLFXODUV LQFOXGLQJ TXDQWLWDWLYH VHFWLRQRIWKH&RPSDQLHV$FW GHWDLOVDQGVLWXDWLRQRIo[HGDVVHWV 0RVW RI WKH o[HG DVVHWV KDYH EHHQ SK\VLFDOO\  D.

QFRPHWD[6DOHV VXFKYHULoFDWLRQ.Q RXU RSLQLRQ WKH SURFHGXUHV RI SK\VLFDO YHULoFDWLRQ RI LQYHQWRULHV IROORZHG E\ WKH  E.QVXUDQFH.$FFRUGLQJ WR WKH UHFRUGV RI WKH &RPSDQ\ WKH FRPSDQ\ KDVEHHQJHQHUDOO\ UHJXODU LQGHSRVLWLQJ YHULoHG E\ WKH PDQDJHPHQW GXULQJ WKH \HDU XQGLVSXWHG VWDWXWRU\ GXHV LQFOXGLQJ 3URYLGHQW DQGQRPDWHULDOGLVFUHSDQFLHVZHUHQRWLFHGRQ )XQG(PSOR\HHV6WDWH.QRXURSLQLRQWKHIUHTXHQF\RI 7D[:HDOWKWD[6HUYLFH7D['XW\RI&XVWRPV'XW\ SK\VLFDOYHULoFDWLRQRIo[HGDVVHWVLVUHDVRQDEOH RI ([FLVH 9DOXH $GGHG 7D[ &HVV DQG DQ\ RWKHU KDYLQJ UHJDUG WR WKH VL]H RI WKH &RPSDQ\ DQG VWDWXWRU\ GXHV ZLWK WKH DSSURSULDWH DXWKRULWLHV WKHQDWXUHRILWVDVVHWV %DVHG RQ RXU DXGLW SURFHGXUHV DQG DFFRUGLQJ WR D 7KH LQYHQWRULHV KDYH EHHQ SK\VLFDOO\ YHULoHG WKHLQIRUPDWLRQDQGH[SODQDWLRQVJLYHQWRXVWKHUH GXULQJ WKH \HDU E\ WKH PDQDJHPHQW .Q DUHQRDUUHDUVRIXQGLVSXWHGVWDWXWRU\GXHVZKLFK RXU RSLQLRQ WKH IUHTXHQF\ RI YHULoFDWLRQ LV UHPDLQHGRXWVWDQGLQJDVDW'HFHPEHUIRU UHDVRQDEOH D SHULRG RI PRUH WKDQ VL[ PRQWKV IURP WKH GDWH WKH\EHFDPHSD\DEOH E .

QFRPH PDQDJHPHQW DUH UHDVRQDEOH DQG DGHTXDWH 7D[RU6DOHV7D[RU:HDOWK7D[RU6HUYLFH7D[RU'XW\ LQUHODWLRQ WRWKHVL]HRIWKH&RPSDQ\ DQGWKH RI&XVWRPVRU'XW\RI([FLVHRU9DOXH$GGHG7D[RU QDWXUHRILWVEXVLQHVV &HVV WKDW KDYH QRW EHHQ GHSRVLWHG RQ DFFRXQW RI E F 7KH &RPSDQ\ KDV PDLQWDLQHG SURSHU UHFRUGV RILQYHQWRU\1RGLVFUHSDQFLHVZHUHQRWLFHGRQ YHULoFDWLRQEHWZHHQWKHSK\VLFDOVWRFNVDQGWKH ERRNVWRFNV  7KH &RPSDQ\ KDV QRW JUDQWHG DQ\ ORDQV VHFXUHG RU XQVHFXUHGWRFRPSDQLHVoUPVRURWKHUSDUWLHVFRYHUHG LQ WKH UHJLVWHU PDLQWDLQHG XQGHU 6HFWLRQ  RI WKH &RPSDQLHV $FW  $FFRUGLQJO\ VXEFODXVH D. $FFRUGLQJ WR WKH UHFRUGV RI WKH &RPSDQ\ .

 DQG E.

Q RXU RSLQLRQ DQG DFFRUGLQJ WR WKH LQIRUPDWLRQ DQG H[SODQDWLRQV JLYHQ WR XV WKHUH LV DQ DGHTXDWH LQWHUQDO FRQWURO V\VWHP FRPPHQVXUDWH ZLWK WKH VL]H RIWKH&RPSDQ\DQGWKHQDWXUHRILWVEXVLQHVVIRUWKH SXUFKDVHVRILQYHQWRU\DQGo[HGDVVHWVDQGIRUWKHVDOH RIJRRGVDQGVHUYLFHV'XULQJWKHFRXUVHRIRXUDXGLW ZH GLG QRW REVHUYH DQ\ FRQWLQXLQJ IDLOXUH WR FRUUHFW PDMRUZHDNQHVVLQLQWHUQDOFRQWUROV\VWHP  7KH&RPSDQ\KDVQRWDFFHSWHGDQ\GHSRVLWVIURPWKH SXEOLF7KHUHIRUHWKHSURYLVLRQVRIVHFWLRQWRRI WKH&RPSDQLHV$FWDUHQRWDSSOLFDEOH 272 DQ\GLVSXWHDUHDVIROORZV 1DWXUHRIGXHV 3HULRGWR which the amount UHODWHV $PRXQWV LQYROYHG GXHVWRWKH extent not GHSRVLWHG.DUHQRWDSSOLFDEOH  .

)RUXPZKHUH WKHGLVSXWHLV pending `  &(67$7q 'HQLDORI )LQDQFLDO `  /DNKV ([FO Cenvat credit \HDUV /DNKVDQG RI6HUYLFHWD[ WR LQWHUHVWDQG &RPPLVVLRQHU SHQDOW\.

DYDLOHGRQ  $SSHDOV`  LQSXWVHUYLFHV /DNKV on account of FHPHQWFOHDUHG LQEXONDVVXFK &HQYDWDYDLOHG on cement returned in EXONHUV $SUWR ` /DNKV &(67$7RUGHUHG GHQRYR 1RY DGMXGLFDWLRQ .

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies  F.

 'XULQJWKH\HDUWKHUHZDVQRDPRXQWUHTXLUHGWR  7KH&RPSDQ\KDVQRWWDNHQDQ\WHUPORDQVGXULQJWKH EHWUDQVIHUUHGWRLQYHVWRU(GXFDWLRQDQG3URWHFWLRQ \HDU IXQG LQ DFFRUGDQFH ZLWK WKH UHOHYDQW SURYLVLRQV RI WKH &RPSDQLHV $FW   RI .

S.)LUP5HJLVWUDWLRQ1XPEHU:  7KHUHDUHQRGXHVWREDQNVRUoQDQFLDOLQVWLWXWLRQVRU GHEHQWXUHKROGHUV  7KH&RPSDQ\KDVQRWJLYHQDQ\JXDUDQWHHIRUORDQV 3ODFH0XPEDL  WDNHQE\RWKHUVIURPEDQNVRUoQDQFLDOLQVWLWXWLRQV -DQXDU\  RAJESH S.&$. DQG UXOHV  1R IUDXG RQ RU E\ WKH FRPSDQ\ KDV EHHQ QRWLFHG RU UHSRUWHGGXULQJWKH\HDU PDGHWKHUHXQGHU  7KHFRPSDQ\ GRHVQRWKDYHDQ\DFFXPXODWHG ORVVHV DWWKHHQGRIWKHoQDQFLDO\HDUDQGKDVQRWLQFXUUHG FDVK ORVVHV GXULQJ WKH oQDQFLDO \HDU FRYHUHG E\ RXU DXGLWDQGWKHLPPHGLDWHO\SUHFHGLQJoQDQFLDO\HDU For K. JOSHI Partner 0HPEHUVKLS1XPEHU 273 .AIYAR & CO Chartered Accountants .

817.348.65 5.331.06 2.BULK CEMENT CORPORATION (INDIA) LTD (BCCI) BALANCE SHEET AS AT DECEMBER 31. 2015 3DUWLFXODUV EQUITY AND LIABILITIES : 6KDUHKROGHUV)XQG 6KDUH&DSLWDO 3   5HVHUYHV 6XUSOXV    4. 2015 3DUWLFXODUV 1RWH 1R 2015 ` Lakhs  `/DNKV FOR THE YEAR ENDED DECEMBER 31.QFRPH    2WKHU.36 TOTAL STATEMENT OF PROFIT AND LOSS 1RWH 1R 2015 ` Lakhs INCOME: 6DOHRI6HUYLFHV RWKHURSHUDWLQJ .090.36 Total Revenue 1RQ&XUUHQW/LDELOLWLHV 5 'HIHUUHG7D[/LDELOLWLHV 1HW.QFRPH 15   2.

785.21 /HVV([FHSWLRQDOLWHP'HSUHFLDWLRQ RISULRU\HDUVFKDUJHGRIIRQ LPSOHPHQWDWLRQRIWUDQVLWLRQDO SURYLVLRQVRI E.   `/DNKV  EXPENSE : (PSOR\HHEHQHoWVH[SHQVH     2SHUDWLQJDQG2WKHU([SHQVHV      1.93 1.702.13 629.15 304.

RI &RPSDQLHV$FW   3URoW ORVV..RI6FKHGXOH.

EHIRUHWD[ (824.89 6.85 ASSETS: 1RQ&XUUHQW$VVHWV )L[HG$VVHWV 7DQJLEOH$VVHWV  $.80 Total Expenses TOTAL 5.986.27) 629.12 959.21   &XUUHQW/LDELOLWLHV 7UDGHSD\DEOHV  2WKHU&XUUHQW/LDELOLWLHV     Depreciation TOTAL 1.043.848.

  .QWDQJLEOH$VVHWV  %.

93 3URoW ORVV.435.   &DSLWDOZRUNLQSURJUHVV /RQJ7HUP/RDQV $GYDQFHV      2.919.88 7RWDO 4.

QYHQWRULHV 11   7UDGH5HFHLYDEOH 12   &DVKDQG%DQN%DODQFHV 13   6KRUW7HUP/RDQVDQG$GYDQFHV       $VVHWVKHOGIRU'LVSRVDO TOTAL 6XPPDU\RI6LJQLoFDQW $FFRXQWLQJ3ROLFLHV  3.85 2 1HW&XUUHQW7D[ Deferred Tax  3URoW /RVV.412.89 6.92 5.01 2.848.067.986.QYHVWPHQW 10 .EHIRUHWD[DQG Exceptional items 7D[([SHQVHV Current Tax /HVV0$76HW2II$YDLOHG &XUUHQW$VVHWV &XUUHQW.

IRUWKH\HDU  .

  .

.

.

 (530.71) 432.99 .

 (DUQLQJV3HU(TXLW\6KDUH )DFH 9DOXHRI` 10 each) (Previous Year ` 10 each) %DVLFDQG'LOXWHG(DUQLQJVSHU 6KDUH `) 20 6XPPDU\RI6LJQLoFDQW$FFRXQWLQJ 3ROLFLHV 2 7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRI)LQDQFLDO6WDWHPHQWV 7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRI)LQDQFLDO6WDWHPHQWV $VSHURXU5HSRUW of even date )RUDQGRQEHKDOIRIWKH%RDUG2I'LUHFWRUV RI%XON&HPHQW&RUSRUDWLRQ .QGLD.

/LPLWHG $VSHURXU5HSRUW of even date )RUDQGRQEHKDOIRIWKH%RDUG2I'LUHFWRUV RI%XON&HPHQW&RUSRUDWLRQ .QGLD.

Chartered Accountants )LUP5HJLVWUDWLRQ 1XPEHU: JAYANTA DATTAGUPTA Director '.1 SUNIL K. NAYAK Director '. AIYAR & CO./LPLWHG FOR K.1 RAJESH S. JOSHI Partner 0HPEHUVKLS1XPEHU BINITA KHORY Company Secretary MALINI MENON Chief Financial 2IoFHU RAJESH S.1 FOR K.1 SUNIL K. S. JOSHI Partner 0HPEHUVKLS1XPEHU BINITA KHORY Company Secretary MALINI MENON Chief Financial 2IoFHU 0XPEDL-DQXDU\ 274 0XPEDL-DQXDU\ . AIYAR & CO. Chartered Accountants )LUP5HJLVWUDWLRQ 1XPEHU: JAYANTA DATTAGUPTA Director '. S. NAYAK Director '.

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies CASH FLOW STATEMENT FOR THE YEAR ENDED DECEMBER 31. 2015 3DUWLFXODUV A. 2015  ` Lakhs ` /DNKV Cash Flow from Operating Activities 1 1HW3URoW ORVV.

EHIRUHWD[ .

   .

.

$GMXVWPHQWV)RU 'HSUHFLDWLRQ LQFOXGLQJ([FHSWLRQDOLWHP.

QWHUHVW5HFHLYHG 3URYLVLRQZULWWHQEDFN /RVV 3URoW. .

RQVDOHRIDVVHWV /RVV 3URoW.

RQVDOHRI.QYHVWPHQW 2SHUDWLQJSURoWEHIRUHZRUNLQJFDSLWDOFKDQJHV  .

 .

.

  7UDGH5HFHLYDEOHV  .

3 .QYHQWRULHV .

  2WKHUUHFHLYDEOHV .

.

7UDGHSD\DEOHV 2WKHU&XUUHQW/LDELOLWLHV  .

&DVKJHQHUDWHGIURP2SHUDWLRQV   .

.

630.02 213.45 2 5  'LUHFW7D[HVUHIXQG SDLG.

Net Cash from Operating Activities B. .

 Cash Flow from Investing Activities  .QYHVWPHQWV 10 3XUFKDVHRI)L[HG$VVHWV .QYHVWPHQWV  6DOH3URFHHGV)URP.QFUHDVHLQ&DSLWDOZRUNLQ3URJUHVV &DSLWDO$GYDQFH 11 6DOHVRI)L[HG$VVHWV   .QWHUHVWUHFHLYHG  3XUFKDVHRI.

.

  .

.

90) (195.18)   1HWLQFUHDVH GHFUHDVH. Net Cash from Investing Activities   (618.

QYHVWLQJDQG)LQDQFLQJ$FWLYLWLHV  &DVKDQG&DVK(TXLYDOHQWLV&DVKDQG%DQN%DODQFHVDVSHU%DODQFH6KHHW $V3HURXUUHSRUWRIHYHQGDWH )RUDQGRQEHKDOIRIWKH%RDUGRI'LUHFWRUVRI%XON&HPHQW&RUSRUDWLRQ .LQFDVK FDVKHTXLYDOHQWV  2SHQLQJ%DODQFH   &ORVLQJ%DODQFH   Notes: $OOoJXUHVLQEUDFNHWVDUHRXWpRZ  )LJXUHVIRUWKHSUHYLRXV\HDUKDYHEHHQUHJURXSHGUHVWDWHGZKHUHYHUQHFHVVDU\WRPDNHWKHPFRPSDUDEOH  'LUHFW7D[HVSDLGDUHWUHDWHGDVDULVLQJIURP2SHUDWLQJ$FWLYLWLHVDQGDUHQRWELIXUFDWHGEHWZHHQ.QGLD.

JOSHI BINITA KHORY MALINI MENON Partner Company Secretary &KLHI)LQDQFLDO2IoFHU 0HPEHUVKLS1XPEHU 0XPEDL-DQXDU\ 275 . S. JAYANTA DATTAGUPTA SUNIL K.1 RAJESH S.1 './LPLWHG FOR K. AIYAR & CO. NAYAK Chartered Accountants Director Director )LUP5HJLVWUDWLRQ1R: '.

BULK CEMENT CORPORATION (INDIA) LTD (BCCI) NOTES TO THE FINANCIAL STATEMENTS FOR THE YEAR ENDED DECEMBER 31.QGLD. 2015 1 CORPORATE INFORMATION E) Investments  %XON &HPHQW &RUSRUDWLRQ .

QGLD DQG LQFRUSRUDWHG XQGHU WKH SURYLVLRQ RI &RPSDQLHV $FW  7KH &RPSDQ\ LV HQJDJHG LQ WKH KDQGOLQJ RI %XON &HPHQW  7KH &RPSDQ\ FDWHUV RQO\ WR WKH QHHGV RI WKH GRPHVWLFPDUNHWRIWKHSDUHQW&RPSDQ\LH0V$&&/LPLWHG  /RQJWHUP LQYHVWPHQWV DUH FDUULHG DW FRVW  +RZHYHU SURYLVLRQ IRUGLPLQXWLRQLQYDOXHLVPDGHWRUHFRJQL]HDGHFOLQHRWKHUWKDQ WHPSRUDU\ LQ WKH YDOXH RI LQYHVWPHQWV  &XUUHQW LQYHVWPHQWV DUH VWDWHGDWFRVWRUIDLUYDOXHZKLFKHYHULVORZHU F) Inventory 2 SIGNIFICANT ACCOUNTING POLICIES:  7KH &RPSDQ\ GRHV QRW FDUU\ DQ\ LQYHQWRU\ RI UDZ PDWHULDOV DQG WKHUHLVQR6WRFNRI7UDGHG)LQLVKHG*RRGVDWWKHHQGRIWKH\HDU 7KHVWRFNRIVWRUHVDQGVSDUHVLVYDOXHGDWFRVW:HLJKWHG$YHUDJH 0RYLQJ. /LPLWHG LV D OLPLWHG &RPSDQ\ GRPLFLOHG LQ .

DQGQHWUHDOL]DEOHYDOXHZKLFKHYHULVOHVV A)  L.

QGLD .QGLDQ *$$3. 7KHoQDQFLDOVWDWHPHQWVRIWKH&RPSDQ\KDYHEHHQSUHSDUHG DQG SUHVHQWHG LQ DFFRUGDQFH ZLWK WKH JHQHUDOO\ DFFHSWHG DFFRXQWLQJ SULQFLSOHV LQ .

 7KH &RPSDQ\ KDV SUHSDUHG WKHVH  oQDQFLDO VWDWHPHQWV WR FRPSO\ LQ DOO PDWHULDO UHVSHFWV ZLWK WKH $FFRXQWLQJ 6WDQGDUGV QRWLoHG  XQGHU 6HF  RI WKH &RPSDQLHV $FW   UHDG ZLWK 5XOH  RI WKH &RPSDQLHV $FFRXQWV.

5XOHV *.

QFRPH 7D[HV UHpHFW  WKH LPSDFW RI FXUUHQW WLPLQJ GLIIHUHQFHV EHWZHHQ WD[DEOH LQFRPH  DFFRXQWLQJ LQFRPH IRU WKH \HDU  UHYHUVDORIWLPLQJGLIIHUHQFHVRIHDUOLHU\HDUV  'HIHUUHG WD[ LV PHDVXUHG EDVHG RQ WKH WD[ UDWHV DQG WKH WD[ ODZVHQDFWHGRUVXEVWDQWLYHO\HQDFWHGDWWKHEDODQFHVKHHWGDWH 'HIHUUHG WD[ DVVHWV DUH UHFRJQL]HG RQO\ WR WKH H[WHQW WKDW WKHUH LV UHDVRQDEOH FHUWDLQW\ WKDW VXIoFLHQW IXWXUH WD[DEOH LQFRPH ZLOO EHDYDLODEOHDJDLQVWZKLFKVXFKGHIHUUHGWD[DVVHWFDQEHUHDOL]HG 'HIHUUHGWD[DVVHWVDUHUHYLHZHGDWHDFKEDODQFHVKHHWGDWH I) Impairment of Assets  7KHFDUU\LQJDPRXQWVRIDVVHWVDUHUHYLHZHGDWHDFK%DODQFH6KHHW GDWHLIWKHUHLVDQ\LQGLFDWLRQRILPSDLUPHQWEDVHGRQLQWHUQDO H[WHUQDOIDFWRUV$QLPSDLUPHQWORVVZLOOEHUHFRJQL]HGZKHUHYHU WKHFDUU\LQJDPRXQWRIDQDVVHWH[FHHGVLWVHVWLPDWHGUHFRYHUDEOH DPRXQW  7KH UHFRYHUDEOH DPRXQW LV JUHDWHU RI WKH DVVHW V QHW VHOOLQJ SULFH DQG YDOXH LQ XVH . (PSOR\HHV%HQHoW  7KH&RPSDQ\RSHUDWHVWKURXJKWKHHPSOR\HHVRQGHSXWDWLRQIURP WKHSDUHQWFRPSDQ\  $OO WKH HPROXPHQWV SD\DEOH WR WKHVH HPSOR\HHV DORQJ ZLWK WKH UHODWHG EHQHoWV DUH FODLPHG E\ WKH SDUHQW FRPSDQ\ DQG DUH UHLPEXUVHG 7KLV LV GLVFORVHG DV 'HSXWDWLRQ &KDUJHV LQ WKH 6WDWHPHQWRI3URoW /RVV H) Taxation  7D[H[SHQVHFRPSULVHVRI&XUUHQW'HIHUUHGWD[&XUUHQW.QFRPH7D[$FW'HIHUUHG .Q DVVHVVLQJ WKH YDOXH LQ XVH WKH HVWLPDWHG IXWXUH FDVK pRZV DUH GLVFRXQWHG WR WKH SUHVHQW YDOXH XVLQJWKHZHLJKWHGDYHUDJHFRVWRIFDSLWDO3UHYLRXVO\UHFRJQL]HG LPSDLUPHQW ORVV LV IXUWKHU SURYLGHG RU UHYHUVHG GHSHQGLQJ RQ FKDQJHVLQFLUFXPVWDQFHV -.QFRPH WD[ LV PHDVXUHG DW WKH DPRXQW H[SHFWHG WR EH SDLG WR WKH WD[ DXWKRULWLHVLQDFFRUGDQFHZLWKWKH.

 &RQWLQJHQFLHV3URYLVLRQV  3URYLVLRQV DUH UHFRJQL]HG ZKHQ WKH &RPSDQ\ KDV D SUHVHQW REOLJDWLRQDVDUHVXOWRISDVWHYHQWLWLVSUREDEOHWKDWDQRXWpRZ RI UHVRXUFHV HPERG\LQJ HFRQRPLF EHQHoW ZLOO EH UHTXLUHG WR VHWWOHWKHREOLJDWLRQLQUHVSHFWRIZKLFKDUHOLDEOHHVWLPDWHFDQEH PDGH3URYLVLRQVDUHQRWGLVFRXQWHGWRLWVSUHVHQWYDOXHDQGDUH GHWHUPLQHGEDVHGRQEHVWHVWLPDWHRIWKHH[SHQGLWXUHUHTXLUHGWR VHWWOHWKHREOLJDWLRQDWWKH%DODQFH6KHHWGDWH7KHVHDUHUHYLHZHG DWHDFK%DODQFH6KHHWGDWHDQGDGMXVWHGWRUHpHFWWKHFXUUHQWEHVW HVWLPDWH$FRQWLQJHQWOLDELOLW\LVGLVFORVHGXQOHVVWKHSRVVLELOLW\ RI DQ RXWpRZ RI UHVRXUFHV HPERG\LQJ WKH HFRQRPLF EHQHoW LV UHPRWH K) 7KH &RPSDQ\ LV HQJDJHG LQ RQO\ RQH EXVLQHVV VHJPHQW LH EXON KDQGOLQJRIFHPHQW  +HQFHRWKHUVHJPHQWDOLQIRUPDWLRQDVSHU$FFRXQWLQJ6WDQGDUG LVQRWUHTXLUHGWREHGLVFORVHG  LL.

QWHUHVW LQFRPH LV UHFRJQL]HG RQ D WLPH SURSRUWLRQ EDVLV WDNLQJ LQWR DFFRXQW WKH DPRXQW RXWVWDQGLQJ DQG WKH UDWH DSSOLFDEOH 'LYLGHQGLQFRPHLVUHFRJQL]HGZKHQWKHULJKWWRUHFHLYHGLYLGHQG LVHVWDEOLVKHGE\WKH%DODQFH6KHHWGDWH D) 276 Fixed Assets and Depreciation L.QWHUHVWDQG'LYLGHQG.QFRPH  .QGLDQ *$$3 UHTXLUHV WKH PDQDJHPHQW WR PDNH MXGJPHQWV HVWLPDWHV DQGDVVXPSWLRQVWKDWDIIHFWWKHUHSRUWHGDPRXQWVRIDVVHWVDQG OLDELOLWLHV DQG GLVFORVXUH RI FRQWLQJHQW OLDELOLWLHV RQ WKH GDWH RI WKH oQDQFLDO VWDWHPHQWV DQG UHSRUWHG DPRXQWV RI UHYHQXHV DQG H[SHQVHVIRUWKH\HDU$OWKRXJKWKHVHHVWLPDWHVDUHEDVHGRQWKH PDQDJHPHQW V EHVW NQRZOHGJH RI FXUUHQW HYHQWV DQG DFWLRQV XQFHUWDLQW\DERXWWKHVHDVVXPSWLRQVDQGHVWLPDWHVFRXOGUHVXOWLQ WKHRXWFRPHVGLIIHUHQWIURPWKHHVWLPDWHV  (VWLPDWHV DQG XQGHUO\LQJ DVVXPSWLRQV DUH UHYLHZHG RQ DQ RQJRLQJEDVLV$Q\UHYLVLRQWRDFFRXQWLQJHVWLPDWHVLVUHFRJQLVHG SURVSHFWLYHO\LQWKHFXUUHQWDQGIXWXUHSHULRGV C) Revenue Recognition  5HYHQXH DULVLQJ IURP FKDUJHV IRU %XON KDQGOLQJ RI FHPHQW LV UHFRJQL]HG EDVHG RQ WRQQDJH KDQGOHG DQG 5HEDWH RQ IUHLJKW JUDQWHG E\ WKH 5DLOZD\V LV UHFRJQL]HG EDVHG RQ WRQQDJH RI EXON FHPHQWGHVSDWFKHGIURPWKHVXSSOLHUWRWKH&RPSDQ\ VWHUPLQDO DW.DODPEROL  . 7KH DFFRXQWLQJ SROLFLHV DGRSWHG LQ WKH SUHSDUDWLRQ RI oQDQFLDO VWDWHPHQWV DUH FRQVLVWHQW ZLWK WKRVH RI SUHYLRXV \HDU B) Use of estimates  7KHSUHSDUDWLRQRIoQDQFLDOVWDWHPHQWVLQFRQIRUPLW\ZLWK.

 )L[HGDVVHWVDUHVWDWHGDWFRVWRIDFTXLVLWLRQRUFRQVWUXFWLRQ LQFOXGLQJ DWWULEXWDEOH LQWHUHVW DQG oQDQFLDO FRVW WLOO VXFK DVVHWV DUH UHDG\ IRU LWV LQWHQGHG XVH OHVV DFFXPXODWHG GHSUHFLDWLRQLPSDLUPHQWORVVHVDQGVSHFLoFJUDQWVUHFHLYHG LIDQ\ LL.

. RI WKH &RPSDQLHV$FW . 'HSUHFLDWLRQ LV SURYLGHG LQ WKH DFFRXQWV RQ WKH EDVLV RI XVHIXO OLIH RI WKH DVVHW DV SUHVFULEHG LQ 6FKHGXOH .

00.070)   TOTAL   ISSUED SUBSCRIBED AND FULLY PAID UP  %DODQFHDVSHUODVW)LQDQFLDOVWDWHPHQWV   $GG3URoW /RVV.42.10.000) 3UHIHUHQFH6KDUHVRI`10 each   TOTAL    (TXLW\ 6KDUHV 2I ` 10 each IXOO\SDLG(Previous Year-3.000 (Previous Year -1.36. 2015 NOTE -3 : SHARE CAPITAL NOTE-4 : RESERVES & SURPLUS 2015 ` Lakhs  ` /DNKV AUTHORISED  1.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE FINANCIAL STATEMENTS FOR THE YEAR ENDED 31 DECEMBER .00.10.

RIWKH\HDU .

QGXVWULHV.  TOTAL   NOTE -5 : DEFERRED TAX LIABILITIES (NET) Details of shareholders holding more than 5% of the shares of the Company and shares held by holding Company 2015  No of % of 1RRI % of Shares Holding 6KDUHV +ROGLQJ 6KDUHVKHOGE\WKH3UHVLGHQW     RI .QGLD 'HYHORSPHQW &RPPLVVLRQHU RI &HPHQW .

29 lakhs) 7KHUHDUHQR0LFUR6PDOODQG0HGLXP(QWHUSULVHVDVGHoQHGLQWKH 0LFUR 6PDOO 0HGLXP (QWHUSULVHV 'HYHORSPHQW $FW  WR ZKRP WKH&RPSDQ\RZHVGXHV7KLVLQIRUPDWLRQKDVEHHQGHWHUPLQHGWRWKH H[WHQW VXFK SDUWLHV KDYH EHHQ LGHQWLoHG RQ WKH EDVLV RI LQIRUPDWLRQ DYDLODEOHZLWKWKH&RPSDQ\7KLVKDVEHHQUHOLHGXSRQE\WKHDXGLWRUV NOTE 7 : OTHER CURRENT LIABILITIES Rights and restrictions attached to equity shares: 7KH&RPSDQ\KDVRQO\RQHFODVVRIHTXLW\VKDUHVKDYLQJSDUYDOXH of `SHUVKDUH(DFKVKDUHKROGHURIHTXLW\VKDUHVLVHQWLWOHGWR RQHYRWHSHUVKDUH. 6KDUHV+HOGE\$&&/WG     +ROGLQJ&RPSDQ\ 2015  No of Amount 1RRI $PRXQW Shares ` Lakhs 6KDUHV ` /DNKV WKH     (TXLW\ VKDUHV DW beginning of the year 6KDUHV .QWKHHYHQWRIOLTXLGDWLRQRIWKH&RPSDQ\WKH KROGHUVRIWKHHTXLW\VKDUHVZLOOEHHQWLWOHGWRUHFHLYHUHPDLQLQJ DVVHWV RI WKH &RPSDQ\ DIWHU GLVWULEXWLRQ RI DOO SUHIHUHQWLDO DPRXQWV7KHGLVWULEXWLRQZLOOEHLQSURSRUWLRQWRWKHQXPEHURI HTXLW\VKDUHVKHOGE\WKHVKDUHKROGHU G.VVXHG GXULQJ WKH     year (TXLW\ VKDUHV DW WKH HQG RI     the year (c) TOTAL  ` /DNKV       NOTE 6 : TRADE PAYABLES 7UDGH3D\DEOHV 2015  ` Lakhs ` /DNKV     Due to The Holding Company: ACC Limited ` 17.17 lakhs (Previous year ` 12.

 'HIHUUHG7D[$VVHW D.

LD.

00.000) (TXLW\6KDUHVRI` 10 each (a) 2015 ` Lakhs 6WDWXWRU\'XHV 5HWHQWLRQ'HSRVLWIURP&RQWUDFWRUV 9HQGRUV /LDELOLW\)RU&DSLWDO([SHQGLWXUH 2015  ` Lakhs ` /DNKV       2WKHU&XUUHQW/LDELOLWLHV   TOTAL   (TXLW\ VKDUHV KHOG E\ KROGLQJ FRPSDQ\  XOWLPDWH KROGLQJ DQG their subsidiaries 2015 Number of Amount shares ` Lakhs +ROGLQJFRPSDQ\ $&&/LPLWHG      1XPEHURI $PRXQW VKDUHV ` /DNKV     277 .40. TOTAL Reconciliation of No of Equity shares 2015 ` Lakhs Deferred Tax Liabilities arising on account of : 'HSUHFLDWLRQGLIIHUHQFHV (b)  ` /DNKV 6XUSOXVLQWKHVWDWHPHQWRISURoWDQGORVV  (Previous Year-3.

BULK CEMENT CORPORATION (INDIA) LTD (BCCI) NOTES TO THE FINANCIAL STATEMENTS FOR THE YEAR ENDED 31 DECEMBER .&8/$56 *5266%/2&.$7.21 As at As at $VDW $GGLWLRQV 'HOHWLRQV 31-12-2015 01-01-2015  $GMXVWPHQWV %XLOGLQJ 1(7%/2&. 2015 NOTE 8 (A) : TANGIBLE ASSETS `/DNKV 3$57. )RUWKH 7UDQVIHUWR $GMXVWPHQWV As at As at $VDW Year 3URoW /RVV 31-12-2015 31-12-2015  account due to change in WKHXVHIXO OLIHRI$VVHW               . '(35(&.

     .

   5RDGV%ULGJHV            5DLOV 6LGLQJV            :DJRQ /RFR    .

     .

   )XUQLWXUH  )L[WXUHV            2IoFH (TXLSPHQWV                        .

     .

762.&8/$56 *5266%/2&.006.41 405.58 - 16. $0257.41 4.03 6.27 4.83 5.319.07 Note 9 : LOANS & ADVANCES 2015 Non Current ` Lakhs  Current ` Lakhs Current `/DNKV 1RQ&XUUHQW `/DNKV 8QVHFXUHG&RQVLGHUHG*RRG.168.QGLDYLGHOHWWHU1R'&&.487. As at $GGLWLRQV 'HOHWLRQV As at As at )RU7KH 2Q'HOHWLRQ As at As at $VDW 01-01-2015 $GMXVWPHQWV 31-12-2015 01-01-2015 Year 'LVSRVDOV $GMXVWPHQWV 31-12-2015 31-12-2015  6RIWZDUH            TOTAL            Previous Year 10.36 1.61 1.47 - Note:7KHWHUPLQDOLVRQOHDVHKROGODQGRIWKH&HQWUDO*RYHUQPHQWLQSRVVHVVLRQRIWKH&RPSDQ\.    10.54 11.481.56 3ODQW  (TXLSPHQW 9HKLFOHV TOTAL Previous Year   9.21 1(7%/2&.6$7.WZDVVDQFWLRQHGIRUWKHSURMHFWE\WKH0LQLVWU\RI.'76XEOHDVHJUDQWHGE\&HQWUDOJRYHUQPHQWWRWKHFRPSDQ\IRU\HDUVRQ HIIHFWLYHIURP NOTE 8 (B) : INTANGIBLE ASSETS `/DNKV 3$57.13 - - 5.QGXVWU\ *RYHUQPHQWRI.86 - - 6.

54 /DNKV. (a) &DSLWDO$GYDQFHV (b) 2WKHU'HSRVLWV (c) $GYDQFHVUHFRYHUDEOHLQFDVKRULQNLQGRUIRUYDOXHWREHUHFHLYHG (d) )UHLJKW5HEDWH5HFRYHUDEOH)URP5DLOZD\V (e) $GYDQFH7D[3DLG 1HWRISURYLVLRQIRU7D[DWLRQ$PW` /DNKV Previous year ` 484.

95 /DNKV. (f) $GYDQFH)ULQJH%HQHoW7D[ 1HWRISURYLVLRQIRU7D[DWLRQ$PW` /DNKV Previous year ` 1.

                         (g) %DODQFHZLWK([FLVH&XVWRPVDQG3RUW7UXVW$XWKRULWLHVRQ&XUUHQWDFFRXQWV     (h) 3UHSDLG([SHQVHV         TOTAL 278 .

Corporate Overview Financial Highlights Board & Management Reports Subsidiary Companies Financial Statements NOTES TO THE FINANCIAL STATEMENTS FOR THE YEAR ENDED DECEMBER 31. 2015 Note 10: CURRENT INVESTMENTS 9DOXHGDW/RZHURI&RVWDQG)DLU9DOXH.

QYHVWPHQWLQ0XWXDO)XQGV)XOO\SDLGXS 8QTXRWHG. 2015 Amount ` Lakhs  Number of Units $PRXQW `/DNKV 1XPEHURI 8QLWV .

 Unit of Face Value ` 1.000 each '63%ODFNURFN0RQH\0DQDJHU)XQG5HJXODU3ODQ *URZWK2SWLRQ.

000 each 7DXUXV/LTXLG)XQG([LVWLQJ3ODQ6XSHU.   100  Unit of Face Value ` 1.QVWLWXWLRQDO *URZWK2SWLRQ.

  300        1.000 each .500      Unit of Face Value ` 1.000 each 5HOLDQFH/LTXLG)XQG7UHDVXU\SODQ*URZWK2SWLRQ Unit of Face Value ` 1.QVWD&DVK3OXV)XQG*URZWK NOTE 11 : INVENTORIES $W&RVWRU1HW5HDOLVDEOHYDOXHZKLFKHYHULVORZHU.000 each 5HOLDQFH/LTXLG)XQG&DVK3ODQ*URZWK2SWLRQ Unit of Face Value ` 100 each ':6.RWDN)ORDWHU6KRUW7HUP*URZWK5HJXODU3ODQ     TOTAL   Aggregate amount of Unquoted Investments   Unit of Face Value ` 1.

NOTE 14 : REVENUE FROM OPERATIONS 2015 ` Lakhs 2015 ` Lakhs  `/DNKV 6WRUHV 6SDUH3DUWV   /HVV$OORZDQFHIRU6ORZPRYLQJLQYHQWRU\ .

QFRPH  Due from The Holding Company: ACC Limited ` 174.97 Lakhs.QYHVWPHQW .94 Lakhs).1*5(9(18( 3URYLVLRQQRORQJHUUHTXLUHGZULWWHQEDFN   )UHLJKW5HEDWH NOTE 12 : TRADE RECEIVABLE 2015 ` Lakhs  `/DNKV REVENUE FROM OPERATIONS(NET)       2015 ` Lakhs      `/DNKV     NOTE 15 : OTHER INCOME   NOTE 13: CASH & BANK BALANCES 2015 ` Lakhs  `/DNKV 3URoWRQVDOHRI&XUUHQW.02 Lakhs )          27+(523(5$7. Maximum Outstanding Balance during the Period ` 484.  TOTAL   6$/(2)6(59.&(6 %XON+DQGOLQJ&KDUJHV 5HFRYHUHGIURP$&&OLPLWHG 5HFHLYHGIURP5DLOZD\V  `/DNKV 2WKHUV 8QVHFXUHG&RQVLGHUHG*RRG TOTAL 0LVFHOODQHRXV.QWHUHVWRQGHSRVLWV 3URoWRQ6DOHRI)L[HG$VVHWV TOTAL &DVKDQG&DVK(TXLYDOHQW &DVKRQ+DQG   %DODQFHVZLWK6FKHGXOHG%DQNVLQ&XUUHQW $FFRXQWV   TOTAL   279 .15 Lakhs : (Previous year ` 525. (Previous year `259.

2015 (III) NOTE 16 : EMPLOYEE BENEFITS EXPENSES 2015 ` Lakhs 6WDIIZHOIDUH +ROGLQJ&RPSDQ\  `/DNKV $&&/LPLWHG   'HSXWDWLRQFKDUJHV   TOTAL   2015 ` Lakhs NOTE 17 : OPERATING AND OTHER EXPENSES 2015 ` Lakhs  `/DNKV 3RZHU IXHO   5DWHV WD[HV   .QVXUDQFH   &RQVXPSWLRQRIVWRUHVDQGVSDUHV   5HSDLUVDQGPDLQWHQDQFHSODQW   5HSDLUVDQGPDLQWHQDQFHEXLOGLQJV   5HSDLUVDQGPDLQWHQDQFHRWKHUV   6HFXULW\FKDUJHV     6WDWXWRU\DXGLW   /HJDOVHUYLFHV Transactions with Related Parties during the year:  `/DNKV a) 5HQGHULQJRI6HUYLFHV LQFOXVLYH RI6HUYLFHWD[.BULK CEMENT CORPORATION (INDIA) LTD (BCCI) NOTES TO THE FINANCIAL STATEMENTS FOR THE YEAR ENDED 31 DECEMBER.

b) 'HSXWDWLRQ&KDUJHV3DLG c) 3XUFKDVHRI&HPHQW   d) 3XUFKDVHRI&RQFUHWH   e) 5HLPEXUVHPHQWRI)UHLJKW Rebate   f) 2XWVWDQGLQJEDODQFHLQFOXGHGLQ &XUUHQWDVVHWV   g) 2XWVWDQGLQJEDODQFHLQFOXGHGLQ &XUUHQWOLDELOLWLHV   h) 5HLPEXUVHPHQWRIH[SHQVHV SDLG 1HWRI5HYHUVDO.

3RZHU([SHQVHV   2WKHUV     i) 5HLPEXUVHPHQWRIH[SHQVHV received     5HPXQHUDWLRQWRDXGLWRUV Tax audit   2WKHUVHUYLFHV   2XWRISRFNHWH[SHQVHV           3URYLVLRQIRUVORZPRYLQJLQYHQWRU\ 2WKHUH[SHQVHV /RVVRQo[HGDVVHWVVFUDSSHGUHWLUHG 1HW.

TOTAL 18 Related Party Disclosures (I) Particulars of Related Parties: (II) 280 19.QFRPHy QRWLoHG XQGHU 6HFWLRQ  RI WKH &RPSDQLHV $FW  UHDG ZLWK 5XOH 1R  RI &RPSDQLHV $FFRXQWV. TAXATION 7KH &RPSDQ\ KDV EHHQ UHFRJQL]LQJ LQ WKH oQDQFLDO VWDWHPHQWV WKH GHIHUUHG WD[ DVVHWVOLDELOLWLHV LQ DFFRUGDQFH ZLWK $FFRXQWLQJ 6WDQGDUG  k$FFRXQWLQJ IRU 7D[HV RQ .

 5XOHV  'XULQJ WKH \HDU WKH &RPSDQ\ KDVFUHGLWHGWRWKH6WDWHPHQWRI3URoW /RVVDUHYHUVDORI'HIHUUHG 7D[OLDELOLW\RI`/DNKV(Previous Year reversal ` 15. EARNING PER SHARE: 3DUWLFXODUV 2015 3URoW /RVV.82 Lakhs ) 20.

DIWHUWD[DWLRQDVSHU 6WDWHPHQWRI3URoWDQGORVV `LQ/DNKV.

.

:HLJKWHGDYHUDJHQXPEHURI(TXLW\ VKDUHVRXWVWDQGLQJ 1DPHRIWKH5HODWHG3DUW\ 1DWXUHRI5HODWLRQVKLS $&&/WG +ROGLQJ&RPSDQ\ %DVLFHDUQLQJVSHU6KDUH :HLJKWHG $YHUDJH.

LQ` )DFHYDOXH` SHUVKDUH.

     .

 7KHUHDUHQRSRWHQWLDOHTXLW\VKDUHVDQGKHQFHWKHUHLVQRZRUNLQJIRU GLOXWHGHDUQLQJSHUVKDUH.

 Key Management Personnel: 1DPHRIWKH5HODWHG3DUW\ 1DWXUHRI5HODWLRQVKLS 0U-LWHQGUD.XPDU +HDG%&&.KRU\ &RPSDQ\6HFUHWDU\ . 0LVV0DOLQL0HQRQ &KLHI)LQDQFLDO2IoFHU 0UV%LQLWD.

2015 21.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies NOTES TO THE FINANCIAL STATEMENTS FOR THE YEAR ENDED 31 DECEMBER . 'XULQJ WKH \HDU ZLWK HIIHFW IURP   WKH &RPSDQ\ KDV UHYLVHGWKHFKDUJLQJRIGHSUHFLDWLRQEDVHGRQWKHSUHVFULEHGOLIHDV SHUVFKHGXOH.WRWKH&RPSDQLHV$FW&RQVHTXHQWO\ CLAIMS NOT ACKNOWLEDGED BY THE COMPANY  5DLOZD\V  6HUYLFH7D[DQG3HQDOW\  &HQWUDO([FLVH       3HQGLQJ/LWLJDWLRQVE\RUDJDLQVWWKH&RPSDQ\LVDVXQGHU D. CONTINGENT LIABILITIES NOT PROVIDED FOR: 6U 3DUWLFXODUV 1R 2015 ` Lakhs  `/DNKV 23..

 7KHFKDUJHRIGHSUHFLDWLRQIRUWKH\HDULVKLJKHUE\`  /DNKV E.

 7KH &KDUJH RI GHSUHFLDWLRQ LQ UHVSHFW RI HDUOLHU \HDUV  KDV EHHQFKDUJHGRIIWRWKHSURoWDQG/RVVDFFRXQWDVSHUPLWWHG DQGLVGLVFORVHGDVDQH[FHSWLRQDOLWHPLQWKH6WDWHPHQWRI 3URoWDQG/RVV`/DNKV F.

 .Q WKH RSLQLRQ RI WKH %RDUG RI GLUHFWRUV DQ\ RI WKH DVVHWV RWKHUWKDQo[HGDVVHWVDQGQRQFXUUHQWLQYHVWPHQWVGRQRW KDYHDYDOXHRQUHDOL]DWLRQLQWKHRUGLQDU\FRXUVHRIEXVLQHVV ORZHU WKDQ DW OHDVW HTXDO WR WKH DPRXQW DW ZKLFK WKH\ DUH VWDWHG $QDSSHDOKDVEHHQoOHGE\WKH&RPPLVVLRQHURI6HUYLFHWD[LQWKH%RPED\ +LJK&RXUWDJDLQVWWKHRUGHUHDUOLHUSDVVHGE\WKH&(67$7LQIDYRXURIWKH FRPSDQ\LQUHODWLRQWR6HUYLFHWD[DQGSHQDOW\`/DNKV 22. (VWLPDWHG DPRXQW RI FRQWUDFWV UHPDLQLQJ WR EH H[HFXWHG RQ FDSLWDODFFRXQWDQGQRWSURYLGHGIRU QHWRIDGYDQFH.

21 Lakhs). 3UHYLRXV\HDU VoJXUHVKDYHEHHQUHJURXSHGUHDUUDQJHGZKHUHYHU QHFHVVDU\WRPDNHWKHPFRPSDUDEOHZLWKWKHFXUUHQW\HDU VoJXUH )RUDQGRQEHKDOIRIWKH%RDUG2I'LUHFWRUVRI%XON&HPHQW&RUSRUDWLRQ . $V3HURXUUHSRUWRIHYHQGDWH 24.` /DNKV (Previous Year ` 134.QGLD.

1 RAJESH S. JAYANTA DATTAGUPTA SUNIL K. AIYAR & CO. NAYAK Chartered Accountants Director Director .1 '. S.JOSHI BINITA KHORY MALINI MENON Partner Company Secretary &KLHI)LQDQFLDO2IoFHU 0HPEHUVKLS1XPEHU 0XPEDL-DQXDU\ 281 ./LPLWHG FOR K.&$.)LUP5HJLVWUDWLRQ1XPEHU: '.

2015 is summarized below: PARTICULARS Revenue from operations (net) and Other Income 3URoW /RVV. FINANCIAL HIGHLIGHTS  7KHoQDQFLDOKLJKOLJKWVRI\RXU&RPSDQ\IRUWKH\HDU ended December 31. 2015.LUCKY MINMAT LIMITED (LML) BOARD’S REPORT TO THE MEMBERS OF LUCKY MINMAT LIMITED calendar year (1st January . 1.31st December) as its oQDQFLDO\HDU The Directors take pleasure in presenting the Fortieth Annual Report on the business and operations of the Company and the Audited Financial Statements for the year ended December 31.

%HIRUH7D[ 3URYLVLRQIRU7D[DWLRQ 3URoW /RVV.

14. The Government of Rajasthan has cancelled both the minor mineral lease and the major mineral leases with effect from January 29.DIWHU7D[ %DODQFH EURXJKW IRUZDUG from previous year %DODQFHFDUULHGIRUZDUGWR %DODQFH6KHHW 2.912 2014 ` 12. 2015. CONTRACT OR ARRANGEMENT WITH RELATED PARTIES In accordance with the provisions of Section 188 of the Companies Act. DIRECTORS Appointment of Directors  7KH %RDUG RI 'LUHFWRUV KDV DSSRLQWHG 0U 5DPQLN Gupta as an Additional Director of the Company with HIIHFWIURP$SULO0U*XSWDKROGVRIoFHXSWR the date of the Annual General Meeting. Accordingly. 2014 and March 05.292) (1. Accordingly.86. PARTICULARS INVESTMENTS OPERATIONS Pursuant to a favourable Order from the Company /DZ %RDUG WKH &RPSDQ\ ZLOO FRQWLQXH WR KDYH WKH 282 GUARANTEES OR 8.86. 2013. his candidature for appointment as a Director has been included in the Notice convening the Annual General Meeting of the Company.68. .28. (45.30. The Writ Petition was heard and the Court whilst setting aside the aforesaid Order directed the Company to represent its case before the Ministry of Mines.452 MATERIAL CHANGES AND COMMITMENTS  ([FHSW DV GLVFORVHG HOVHZKHUH LQ WKH 5HSRUW WKHUH have been no material changes and commitments PDGH EHWZHHQ WKH HQG RI WKH oQDQFLDO \HDU RI WKH Company and the date of this Report. Accordingly. There are no material related party transactions. there is no requirement to furnish any information in Form AOC2. 5.381) (78.55.  7KH%RDUGRI'LUHFWRUVKDVDSSRLQWHG0U5DMDW. The matter was heard and the decision of the Mining Authorities in this regard is awaited. 7KHUH DUH QR ORDQV  JXDUDQWHHV JLYHQ DQG investments made under the provisions of Section 186 of the Companies Act. 9.99. Government of Rajasthan. 4. 2013 and Rules framed thereunder.31. The Company has accordingly made representations before the appropriate Mining Authorities.904) 7. Your Directors do not recommend payment RI GLYLGHQG IRU WKH oQDQFLDO \HDU HQGHG December 31. 6. 3.55.388) (45.381) (78.31.388) (2.18.XPDU Prusty as an Additional Director of the Company with HIIHFWIURP0D\0U3UXVW\KROGVRIoFHXSWR the date of the Annual General Meeting. 2015 ` 3.123) (2. DIVIDEND CONTINUANCE OF THE EXISTING FINANCIAL YEAR LOANS. 2014 respectively and taken possession of WKH0LQHV$:ULW3HWLWLRQZDVoOHGLQWKH+LJK&RXUW for withdrawal of the Order cancelling the mining leases. the transactions entered into with Related Parties are in the ordinary course of business and on an arms length pricing basis. SIGNIFICANT & MATERIAL ORDERS PASSED BY THE REGULATORS OR COURTS OR TRIBUNALS IMPACTING THE GOING CONCERN STATUS OF THE COMPANY  7KHUHDUHQRVLJQLoFDQWDQGPDWHULDORUGHUVSDVVHG by the Regulators or Courts or Tribunals impacting the going concern status of your Company.292) There was no production and despatches during the year 2015.68.90. OF  (3.

10. MEETINGS The Company held a minimum of one board meeting in every quarter. 2015 and of the loss of the Company for the year ended on that date. LLL WKDW SURSHU DQG VXIoFLHQW FDUH KDV EHHQ WDNHQ for the maintenance of adequate accounting records in accordance with the provisions of the Companies Act. May 04. July 14. 2015. Members of the Company at the Company’s 39th Annual General Meeting had DSSURYHGWKHDSSRLQWPHQWRI0HVVUV.Corporate Overview Financial Highlights Board & Management Reports Financial Statements his candidature for appointment as a Director has been included in the Notice convening the Annual General Meeting of the Company.  7KH %RDUG KDV SODFHG RQ UHFRUG LWV DSSUHFLDWLRQ IRU the valuable contribution made by Mr Umesh Pratap. his candidature for appointment as a Director has been included in the Notice convening the Annual General Meeting of the Company. your Directors make the following statements in terms of Section 134(3)(c) of the Companies Act. 2015. 2013: L WKDW LQ WKH SUHSDUDWLRQ RI WKH DQQXDO oQDQFLDO statements for the year ended December 31. ii. Accordingly. the applicable accounting standards have been fROORZHG DORQJ ZLWK SURSHU H[SODQDWLRQ relating to material departures. 11. Mr S Viswanathan retires by rotation and being eligible offers himself for re-appointment as a Director of the Company. 2012. ceased to be a Director of the Company with effect from May 15. 2015 and October 16. if any. April 08. Mr Rajiv Prasad and Mr M G Damle during their respective tenures as Directors of the Company. 6 $L\DU  &R &KDUWHUHG $FFRXQWDQWV (ICAI Firm Registration No 100186W) who are the 6WDWXWRU\ $XGLWRUV RI WKH &RPSDQ\ KROG RIoFH until the conclusion of the ensuing Annual General Meeting of the Company and are eligible for re-appointment. 2015. During the year ended 'HFHPEHU   oYH PHHWLQJV ZHUH KHOG RQ January 21. 2015. 2013. 2015. 2015.6$L\DU &R IRUDWHUPRIoYHoQDQFLDO\HDUVLHXSWR tKHoQDQFLDO 283 . ceased to be a Director of the Company with effect from September 04. Subsidiary Companies that such accounting policies as mentioned in 1RWHRIWKH1RWHVWRWKHoQDQFLDOVWDWHPHQWV have been selected and applied consistently and judgments and estimates have been made that are reasonable and prudent so as to give a true and fair view of the state of affairs of the Company as at December 31. 2015. Nomination & Remuneration Committee or Corporate Social Responsibility Committee. 12. DIRECTORS’ RESPONSIBILITY STATEMENT To the best of their knowledge and belief and DFFRUGLQJ WR WKH LQIRUPDWLRQ DQG H[SODQDWLRQV obtained by them. AUDITORS 0HVVUV . Mr Rajiv Prasad who was appointed as a Director of the Company with effect from February 01. Mr Chadha holds RIoFHXSWRWKHGDWHRIWKH$QQXDO*HQHUDO0HHWLQJ Accordingly. 2013. ceased to be a Director of the Company with effect from April 08. 2015. 2015. that systems to ensure compliance with the provisions of all applicable laws were in place and were adequate and operating effectively. 2013.  7KH %RDUG RI 'LUHFWRUV KDV DSSRLQWHG 0U 1DYHHQ Chadha as an Additional Director of the Company with effect from October 16. LY WKDWWKHDQQXDOoQDQFLDOVWDWHPHQWVKDYHEHHQ prepared on a going concern basis. The Company is not required to constitute an Audit Committee. v. his appointment has been included in the Notice convening the Annual General Meeting of the Company. 2013 for safeguarding the assets of the Company and for preventing and detecting fraud and other irregularities. Mr Madhav G Damle who was appointed as a Director of the Company with effect from February 01. Cessation of Directorship Mr Umesh Pratap who was appointed as a Director of the Company with effect from April 13. Directors retiring by rotation In accordance with the provisions of the Companies Act.

LUCKY MINMAT LIMITED (LML) year ending December 31. 7KH &RPSDQ\ KDV REWDLQHG ZULWWHQ FRQoUPDWLRQ IURP0HVVUV. as Auditors of the Company for the year 2016. 2019. 2013. ANNUAL RETURN  There are no employees on the rolls of the Company. 2013. the DSSRLQWPHQWRIWKH$XGLWRULVUHTXLUHGWREHUDWLoHG by the Members each year at the Annual General Meeting. requisite resolution forms part of the Notice of the Annual General Meeting. would be in conformity with the Companies Act.6$L\DU &R&KDUWHUHG Accountants. +HQFHWKHUHLQQRGLVFORVXUHXQGHU6HFWLRQ . As required under the provision of the Companies Act. Your Directors recommend the UHDSSRLQWPHQWRI0HVVUV.6$L\DU &RWKDWWKHLUDSSRLQWPHQW if made. Accordingly. 13.

the information on conservation of energy. 2016 5HJLVWHUHG2IoFH *&. TECHNOLOGY ABSORPTION AND FOREIGN EXCHANGE EARNINGS & OUTGO As no business activity was carried out. technology DEVRUSWLRQDQGIRUHLJQH[FKDQJHHDUQLQJV RXWJR during the year is Nil. ACKNOWLEDGEMENT  <RXU'LUHFWRUVWDNHWKLVRSSRUWXQLW\WRH[SUHVVWKHLU DSSUHFLDWLRQ RI WKH H[FHOOHQW FRRSHUDWLRQ UHFHLYHG from the Government Authorities and Company’s %DQNHUV <RXU 'LUHFWRUV DOVR DFNQRZOHGJH WKH unstinted assistance and support received from ACC /LPLWHGWKH+ROGLQJ&RPSDQ\ 7KH ([WUDFW RI $QQXDO 5HWXUQ SXUVXDQW WR Section 92(3) of the Companies Act. PARTICULARS OF CONSERVATION OF ENERGY. 284 15. 2014.DELU0DUJ %DQL3DUN Jaipur 302 106 Rajasthan Naveen Chadha Director DIN:00191181 S Viswanathan Director DIN:02787215 . PARTICULARS OF EMPLOYEES )RUDQGRQEHKDOIRIWKH%RDUG Mumbai January 27. 16. 2013 read with Rule 5(1) and 5(2) of The Companies (Appointment and Remuneration of Managerial Personnel) Rules. 2013 read with The Companies (Management and Administration) Rules. 2014 in the prescribed Form MGT-9 is enclosed DQGPDUNHGk$QQH[XUH$y 14.RI the Companies Act.

QGLYLGXDOV+8) - 4 4 0.DUYH5RDG0XPEDL 100% 2(46) IV. 2013 and Rule 12(1) of the Companies (Management and Administration) Rules.001 - 4 4 0. chalk and shale 1. No.001 0 b) Central Govt. Registration and other details CIN Registration Date Name of the Company &DWHJRU\6XE&DWHJRU\RIWKH&RPSDQ\ $GGUHVVRIWKH5HJLVWHUHG2IoFHDQGFRQWDFWGHWDLOV 85-3/& September 8. Particulars of Holding. - - - - - - - - - c) State Govt. 1976 /XFN\0LQPDW/LPLWHG . 2015) No.999 0 e) %DQNV)O - - - - - - - - - f) Any Other (specify) - 2 2 0 - 2 2 0 0 - 325000 325000 100 - 325000 325000 100 0 Directors Sub-Total (A)(1) 285 . Shareholding Pattern (Equity Share Capital Breakup as percentage of Total Equity) i) Category .DELU0DUJ%DQL3DUN-DLSXU5DMDVWKDQ Tel. MGT. Subsidiary and Associate Companies Name and address of the Company CIN / GLN $&&/LPLWHG Holding / % of Applicable Subsidiary / Shares Section Associate held +ROGLQJ /0+3/& &HPHQW+RXVH0DKDUVKL.999 - 324994 324994 99. of Shares held at the end of the year (December 31.wise Shareholding Category of Shareholders A./ III. 2015) Demat Physical Total % of Total Shares Demat Physical Total % Change % of Total during the year Shares Promoters (including Promoter Group) (1) Indian a) .9 EXTRACT OF ANNUAL RETURN as on December 31.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies ANNEXURE ‘A’ TO BOARD’S REPORT FORM No.(s) - - - - - - - - - d) %RGLHV&RUSRUDWH 324994 324994 99. Address and contact details of Registrar and Transfer Agent.QGLDQ1RQ*RYHUQPHQW/LPLWHGE\VKDUHV3XEOLF&RPSDQ\ *&. No: 0141-2200608 No Not Applicable :KHWKHU/LVWHG&RPSDQ\ Name. Principal Business Activities of the Company All the Business Activities contributing 10% or more of the total turnover of the Company shall be stated: Name and Description of the main NIC Code of the % to total turnover of the Company Product / Services Product / Service 14107 0LQLQJ  TXDUU\LQJ RI OLPHVWRQH OLPHVKHOO kankar and other calcareous minerals including calcite. of Shares held at the beginning of the year (January 1. 2014] I. 2015 [Pursuant to Section 92(3) of the Companies Act. if any II.

Shareholding Pattern (Equity Share Capital Breakup as percentage of Total Equity) i) Category .(s) e) Venture Capital Funds f) Insurance Companies g) FIIs h) Foreign Venture Capital Funds i) Any Other (specify) Sub-Total (B)(1) (2) Non-Institutions a) Bodies Corporate i) Indian ii) Overseas b) Individuals i) Individual Shareholders holding nominal share capital upto ` 1 lakh ii) Individual Shareholders holding nominal share FDSLWDOLQH[FHVVRI` 1 lakh c) Any Other (specify) Sub-Total (B)(2) Total Public Shareholding (B)=(B)(1)+(B)(2) C.Individuals c) %RGLHV&RUSRUDWH d) %DQNV)O e) Any Other (specify) Sub-Total (A)(2) Total Shareholding of Promoters & Promoter Group (A)=(A)(1)+(A)(2) B. of Shares held at the beginning of the year (January 1. c) Central Govt. Shares held by Custodian for GDRs & ADRs Grand Total (A)+(B)+(C) 286 No. Public Shareholding (1) Institutions a) Mutual Funds b) %DQNV). d) State Govt.wise Shareholding Category of Shareholders (2) Foreign a) NRIs . 2015) % Change % of Total during the year Shares Demat Physical Total % of Total Shares Demat Physical Total - 325000 325000 100 - 325000 325000 100 0 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 325000 325000 100 - 325000 325000 100 0 .LUCKY MINMAT LIMITED (LML) IV. 2015) No. of Shares held at the end of the year (December 31.Individuals b) Other .

2015) shareholding during the No.001 100 iii) Change in Promoters’ (including Promoter Group) Shareholding (please specify. if there is no change) Sr.999 Shareholding at the end of the year % change in (December 31.000 No change 287 . (January 1. 31.Corporate Overview Financial Highlights Board & Management Reports Subsidiary Companies Financial Statements ii) Shareholding of Promoters (including Promoter Group) Sr.999 01 0.001 325000 100 99.000 0. 2015 to Dec. 2015) (Jan. Particulars Shareholding at the beginning of the year Cumulative Shareholding during the year No. of Shares % of total shares No.999 0. Shareholder’s Name No.000 01 0.999 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH No change At the end of the year 2 At the beginning of the year 01 99. of % of total % of Shares year Shares shares of the pledged / Company encumbered to total shares 0. of % of total % of Shares Shares shares pledged / of the encumbered to Company total shares 1 $&&/LPLWHG 0 324994 0 0 2 Mr Sunil Nayak jointly ZLWK$&&/LPLWHG 01 0 01 0 0 3 Mr Ramnik Gupta jointly ZLWK$&&/LPLWHG 01 0 01 0 0 4 0U%XUMRU'1DULPDQ MRLQWO\ZLWK$&&/LPLWHG 01 0 01 0 0 5 Mr S Viswanathan jointly ZLWK$&&/LPLWHG 01 0 01 0 0 6 Mr Rajesh Seth jointly ZLWK$&&/LPLWHG 01 0 01 0 0 7 Mr Rajiv Prasad jointly ZLWK$&&/LPLWHG 01 0 00 0 0 8 Mr Rajendra Singh Rathore jointly with $&&/LPLWHG 00 0 01 0 0 0 325000 0 0 Total 324994 99. 2015) No. Shareholding at the beginning of the year (January 1. 2015) No. 1. of Shares % of total shares of the Company of the Company 1 $&&/LPLWHG At the beginning of the year 324994 99.000 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH No change At the end of the year 3 324994 0U6XQGDUDSDQGLDQ9LVZDQDWKDQMRLQWO\ZLWK$&&/LPLWHG 0U6XQLO1D\DNMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH At the end of the year 01 0.

QFUHDVH WUDQVIHU. 2015 to Dec.000 01 (Transfer on July 14.000 01 0.000 00 0.000 01 0. No.000 01 0. 2015) No. 2015) No. 2015) 0U69LVZDQDWKDQMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 'DWHZLVH. of Shares % of total shares of the Company 0.000 No change 0.000 0.000 0.000 6KDUHVRI0U5DMLY3UDVDGMRLQWO\ZLWK$&&/LPLWHGKDYHEHHQWUDQVIHUUHGWR0U5DMHQGUD6LQJK5DWKRUHMRLQWO\ZLWK$&&/LPLWHGRQ-XO\ iv) Shareholding Pattern of top ten Shareholders (Other than Directors. 2015: Not Applicable. v) Shareholding of Directors and Key Managerial Personnel: Sr. 1. 1 288 Name of the Directors Shareholding at the beginning of the year (January 1. of Shares % of total shares of the Company 0U%XUMRU'1DULPDQMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 01 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH At the end of the year 0U5DMHVK6HWKMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 01 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH At the end of the year 0U5DPQLN*XSWDMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 01 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH At the end of the year 0U5DMLY3UDVDGMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 01 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH At the end of the year 0U5DMHQGUD6LQJK5DWKRUHMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 00 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH At the end of the year Cumulative Shareholding during the year (Jan. 4 5 6 7 8 Shareholding at the beginning of the year (January 1.LUCKY MINMAT LIMITED (LML) Sr.000 No change 0. 31.000 01 (Transfer on July 14. Promoters and Holders of GDRs and ADRs) as on December 31.000 No change 01 0. 2015) 0. 2015) 0. Particulars No.

000 Cumulative Shareholding during the year (Jan. 2015 to Dec. 2015) No of shares % of total shares of the company No change 01 0. 31. 1.000 . At the end of the year No of shares % of total shares of the company 01 0.

QFUHDVH WUDQVIHU. 2015) Subsidiary Companies Cumulative Shareholding during the year (Jan. 1. 31.Corporate Overview Sr.000 'DWHZLVH.04. No. 2015) No of shares % of total shares of No of shares the company 0U5DPQLN*XSWDMRLQWO\ZLWK$&&/LPLWHG(appointed with effect from 08. 2 3 Financial Highlights Name of the Directors Board & Management Reports Financial Statements Shareholding at the beginning of the year (January 1.2015) At the beginning of the year 01 0. 2015 to Dec.

QFUHDVH WUDQVIHU.000 01 'DWHZLVH.05.2015) At the beginning of the year 01 0. No change At the end of the year 01 0U5DMLY3UDVDGMRLQWO\ZLWK$&&/LPLWHG(resigned with effect from 15.

11.11. Whole-time Directors and/or Manager: Not Applicable B. Indebtedness . Penalties / Punishment / Compounding of Offences: 7KHUHZHUHQRSHQDOWLHVSXQLVKPHQWVFRPSRXQGLQJRIRIIHQFHVIRUWKH\HDUHQGHG'HFHPEHU )RUDQGRQEHKDOIRIWKH%RDUG Mumbai January 27.QGHEWHGQHVVGXULQJWKHoQDQFLDO\HDU Addition Reduction Net Change .000 0.18.744 1. % of total shares of the company 0.11. Remuneration to Managing Director.11. Remuneration of Directors and Key Managerial Personnel: A.744 1.11.18.744 1.18.000 V.18.18.744 1.11.11.QGHEWHGQHVVDWWKHEHJLQQLQJRIWKHoQDQFLDO\HDU i) Principal Amount ii) Interest due but not paid iii) Interest accrued but not due Total (i+ii+iii) &KDQJHLQ.744 - 1.18. 2015) At the end of the year 01 0. Remuneration to Key Managerial Personnel other than MD/Manager/WTD: Not Applicable VII. Remuneration to Other Directors: Not Applicable C.18.11.744 - - - - .000 (Transfer on July 14.744 - 1.QGHEWHGQHVVDWWKHHQGRIWKHoQDQFLDO\HDU i) Principal Amount ii) Interest due but not paid iii) Interest accrued but not due Total (i+ii+iii) VI.QGHEWHGQHVVRIWKH&RPSDQ\LQFOXGLQJLQWHUHVWRXWVWDQGLQJDFFUXHGEXWQRWGXHIRUSD\PHQW Secured Loans excluding deposits ` Unsecured Loans ` Deposits ` Total indebtedness ` - 1.744 - 1. 2016 Naveen Chadha Director S Viswanathan Director 289 .18.

LUCKY MINMAT LIMITED (LML) INDEPENDENT AUDITOR’S REPORT To the Members of Lucky Minmat Limited Report on the Financial Statements :HFRQGXFWHGRXUDXGLWLQDFFRUGDQFHZLWKWKH6WDQGDUGV RQ $XGLWLQJ VSHFLoHG XQGHU 6HFWLRQ  .

 RI WKH $FW 7KRVH 6WDQGDUGV UHTXLUH WKDW ZH FRPSO\ ZLWK HWKLFDO UHTXLUHPHQWV DQG SODQ DQG SHUIRUP WKH DXGLW WR REWDLQ UHDVRQDEOH DVVXUDQFH DERXW ZKHWKHU WKH oQDQFLDO VWDWHPHQWVDUHIUHHIURPPDWHULDOPLVVWDWHPHQW :HKDYHDXGLWHGWKHDFFRPSDQ\LQJoQDQFLDOVWDWHPHQWV RI/XFN\0LQPDW/LPLWHG CWKH&RPSDQ\ .

ZKLFKFRPSULVH WKH%DODQFH6KHHWDVDW'HFHPEHUWKH6WDWHPHQW RI 3URoW DQG /RVV WKH &DVK )ORZ 6WDWHPHQW IRU WKH \HDU WKHQHQGHGDQGDVXPPDU\RIWKHVLJQLoFDQWDFFRXQWLQJ $QDXGLWLQYROYHVSHUIRUPLQJSURFHGXUHVWRREWDLQDXGLW SROLFLHVDQGRWKHUH[SODQDWRU\LQIRUPDWLRQ HYLGHQFH DERXW WKH DPRXQWV DQG WKH GLVFORVXUHV LQ WKH Management’s Responsibility for the Financial Statements oQDQFLDO VWDWHPHQWV 7KH SURFHGXUHV VHOHFWHG GHSHQG 7KH &RPSDQ\ V %RDUG RI 'LUHFWRUV LV UHVSRQVLEOH IRU WKH RQ WKH DXGLWRU V MXGJPHQW LQFOXGLQJ WKH DVVHVVPHQW PDWWHUV VWDWHG LQ 6HFWLRQ  .

 RI WKH &RPSDQLHV $FW RI WKH ULVNV RI PDWHULDO PLVVWDWHPHQW RI WKH oQDQFLDO  CWKH $FW .

Q PDNLQJ oQDQFLDOVWDWHPHQWVWKDWJLYHDWUXHDQGIDLUYLHZRIWKH WKRVH ULVN DVVHVVPHQWV WKH DXGLWRU FRQVLGHUV LQWHUQDO oQDQFLDOSRVLWLRQoQDQFLDOSHUIRUPDQFHDQGFDVKpRZVRI oQDQFLDOFRQWUROUHOHYDQWWRWKH&RPSDQ\ VSUHSDUDWLRQRI WKH&RPSDQ\LQDFFRUGDQFHZLWKWKHDFFRXQWLQJSULQFLSOHV WKHoQDQFLDOVWDWHPHQWVWKDWJLYHDWUXHDQGIDLUYLHZLQ JHQHUDOO\ DFFHSWHG LQ .QGLD LQFOXGLQJ WKH $FFRXQWLQJ RUGHU WR GHVLJQ DXGLW SURFHGXUHV WKDW DUH DSSURSULDWH LQ 6WDQGDUGV VSHFLoHG XQGHU 6HFWLRQ  RI WKH $FW UHDG WKHFLUFXPVWDQFHVEXWQRWIRUWKHSXUSRVHRIH[SUHVVLQJ ZLWK5XOHRIWKH&RPSDQLHV $FFRXQWV. ZLWK UHVSHFW WR WKH SUHSDUDWLRQ RI WKHVH VWDWHPHQWV ZKHWKHU GXH WR IUDXG RU HUURU .

5XOHV7KLV DQ RSLQLRQ RQ ZKHWKHU WKH &RPSDQ\ KDV LQ SODFH DQ UHVSRQVLELOLW\ DOVR LQFOXGHV PDLQWHQDQFH RI DGHTXDWH DGHTXDWHLQWHUQDOoQDQFLDOFRQWUROVV\VWHPRYHUoQDQFLDO DFFRXQWLQJ UHFRUGV LQ DFFRUGDQFH ZLWK WKH SURYLVLRQV RI UHSRUWLQJDQGWKHRSHUDWLQJHIIHFWLYHQHVVRIVXFKFRQWUROV WKH$FWIRUVDIHJXDUGLQJWKHDVVHWVRIWKH&RPSDQ\DQGIRU $QDXGLWDOVRLQFOXGHVHYDOXDWLQJWKHDSSURSULDWHQHVVRI SUHYHQWLQJDQGGHWHFWLQJIUDXGVDQGRWKHULUUHJXODULWLHV WKH DFFRXQWLQJ SROLFLHV XVHG DQG WKH UHDVRQDEOHQHVV VHOHFWLRQ DQG DSSOLFDWLRQ RI DSSURSULDWH DFFRXQWLQJ RI WKH DFFRXQWLQJ HVWLPDWHV PDGH E\ WKH &RPSDQ\ V SROLFLHV PDNLQJ MXGJPHQWV DQG HVWLPDWHV WKDW DUH 'LUHFWRUVDVZHOODVHYDOXDWLQJWKHRYHUDOOSUHVHQWDWLRQRI UHDVRQDEOHDQGSUXGHQWDQGGHVLJQLPSOHPHQWDWLRQDQG WKHoQDQFLDOVWDWHPHQWV PDLQWHQDQFHRIDGHTXDWHLQWHUQDOoQDQFLDOFRQWUROVWKDW ZHUHRSHUDWLQJHIIHFWLYHO\IRUHQVXULQJWKHDFFXUDF\DQG FRPSOHWHQHVV RI WKH DFFRXQWLQJ UHFRUGV UHOHYDQW WR WKH SUHSDUDWLRQDQGSUHVHQWDWLRQRIWKHoQDQFLDOVWDWHPHQWV WKDWJLYHDWUXHDQGIDLUYLHZDQGDUHIUHHIURPPDWHULDO PLVVWDWHPHQWZKHWKHUGXHWRIUDXGRUHUURU :H EHOLHYH WKDW WKH DXGLW HYLGHQFH ZH KDYH REWDLQHG LV VXIoFLHQWDQGDSSURSULDWHWRSURYLGHDEDVLVIRURXUDXGLW RSLQLRQRQWKHoQDQFLDOVWDWHPHQWV Opinion .QGLDRIWKHVWDWHRIDIIDLUVRIWKH&RPSDQ\ :HKDYHWDNHQLQWRDFFRXQWWKHSURYLVLRQVRIWKH$FWWKH DVDW'HFHPEHUDQGLWVORVVDQGLWVFDVKpRZVIRU DFFRXQWLQJ DQG DXGLWLQJ VWDQGDUGV DQG PDWWHUV ZKLFK WKH\HDUHQGHGRQWKDWGDWH DUHUHTXLUHGWREHLQFOXGHGLQWKHDXGLWUHSRUWXQGHUWKH SURYLVLRQVRIWKH$FWDQGWKH5XOHVPDGHWKHUHXQGHU 290 .Q RXU RSLQLRQ DQG WR WKH EHVW RI RXU LQIRUPDWLRQ DQG DFFRUGLQJ WR WKH H[SODQDWLRQV JLYHQ WR XV WKH DIRUHVDLG Auditor’s Responsibility oQDQFLDOVWDWHPHQWVJLYHWKHLQIRUPDWLRQUHTXLUHGE\WKH 2XU UHVSRQVLELOLW\ LV WR H[SUHVV DQ RSLQLRQ RQ WKHVH $FWLQWKHPDQQHUVRUHTXLUHGDQGJLYHDWUXHDQGIDLUYLHZ oQDQFLDOVWDWHPHQWVEDVHGRQRXUDXGLW LQ FRQIRUPLW\ ZLWK WKH DFFRXQWLQJ SULQFLSOHV JHQHUDOO\ DFFHSWHGLQ.

Corporate Overview Financial Highlights Board & Management Reports Report on Other Legal and Regulatory Requirements  $V UHTXLUHG E\ WKH &RPSDQLHV $XGLWRU V 5HSRUW.

 2UGHU  CWKH 2UGHU .

 LVVXHG E\ WKH *RYHUQPHQW RI .QGLD q 0LQLVWU\ RI &RUSRUDWH $IIDLUV LQ WHUPV RI VXEVHFWLRQ .

RIVHFWLRQRIWKH$FWZHHQFORVH LQWKHDQQH[XUHDVWDWHPHQWRQWKHPDWWHUVVSHFLoHG LQSDUDJUDSKVDQGRIWKHVDLG2UGHU Financial Statements I.

 :LWKUHVSHFWWRWKHRWKHUPDWWHUVWREHLQFOXGHG LQ WKH $XGLWRU V 5HSRUW LQ DFFRUGDQFH ZLWK 5XOH RIWKH&RPSDQLHV $XGLWDQG$XGLWRUV.

5XOHV  LQ RXU RSLQLRQ DQG WR WKH EHVW RI RXU LQIRUPDWLRQ DQG DFFRUGLQJ WR WKH H[SODQDWLRQV JLYHQWRXV L 7KH &RPSDQ\ KDV GLVFORVHG WKH LPSDFW RI SHQGLQJOLWLJDWLRQVRQLWVoQDQFLDOSRVLWLRQ LQLWVoQDQFLDOVWDWHPHQWVq5HIHUQRWHWR WKHoQDQFLDOVWDWHPHQWV LL WKH &RPSDQ\ GLG QRW KDYH DQ\ ORQJWHUP FRQWUDFWV LQFOXGLQJ GHULYDWLYH FRQWUDFWV IRU ZKLFK WKHUH ZHUH DQ\ PDWHULDO IRUHVHHDEOH ORVVHV  $V UHTXLUHG E\ 6HFWLRQ  .

 RI WKH $FW ZH UHSRUW that: D.

 :HKDYHVRXJKWDQGREWDLQHGDOOWKHLQIRUPDWLRQ DQG H[SODQDWLRQV ZKLFK WR WKH EHVW RI RXU NQRZOHGJH DQG EHOLHI ZHUH QHFHVVDU\ IRU WKH SXUSRVHVRIRXUDXGLW E.

 .QYHVWRU(GXFDWLRQ DQG3URWHFWLRQ)XQGE\WKH&RPSDQ\ F.Q RXU RSLQLRQ SURSHU ERRNV RI DFFRXQW DV UHTXLUHGE\ODZKDYHEHHQNHSWE\WKH&RPSDQ\ VR IDU DV LW DSSHDUV IURP RXU H[DPLQDWLRQ RI WKRVHERRNV Subsidiary Companies LLL WKHUHZHUHQRDPRXQWVZKLFKZHUHUHTXLUHG WREHWUDQVIHUUHGWRWKH.

 7KH %DODQFH 6KHHW WKH 6WDWHPHQW RI 3URoW DQG /RVVDQGWKH&DVK)ORZ6WDWHPHQWGHDOWZLWKE\ WKLV 5HSRUW DUH LQ DJUHHPHQW ZLWK WKH ERRNV RI DFFRXQW G.

 .QRXURSLQLRQWKHDIRUHVDLGoQDQFLDOVWDWHPHQWV FRPSO\ZLWKWKH$FFRXQWLQJ6WDQGDUGVVSHFLoHG XQGHU6HFWLRQRIWKH$FWUHDGZLWK5XOHRI WKH&RPSDQLHV $FFRXQWV.

5XOHV For K. H. S. Aiyar & Co.

)LUP5HJLVWUDWLRQ1R: WDNHQRQUHFRUGE\WKH%RDUGRI'LUHFWRUV QRQH RI WKH GLUHFWRUV LV GLVTXDOLoHG DV RQ Sachin A. 2Q WKH EDVLV RI WKH ZULWWHQ UHSUHVHQWDWLRQV Chartered Accountants UHFHLYHGIURPWKHGLUHFWRUVDVRQ'HFHPEHU  . Negandhi 'HFHPEHU   IURP EHLQJ DSSRLQWHG DV D Place:0XPEDL Partner GLUHFWRULQWHUPVRI6HFWLRQ .&$.

RIWKH$FW Date:-DQXDU\ 0HPEHUVKLS1R 291 .

LUCKY MINMAT LIMITED (LML) ANNEXURE TO THE AUDITOR’S REPORT 5HIHUUHGWRLQSDUDJUDSKXQGHUWKHKHDGLQJC5HSRUWRQ LY.

Q RXU RSLQLRQ DQG DFFRUGLQJ WR WKH LQIRUPDWLRQ DQGH[SODQDWLRQVJLYHQWRXVWKHUHLVDQDGHTXDWH 2WKHU/HJDODQG5HJXODWRU\5HTXLUHPHQWV RIRXU5HSRUWRI LQWHUQDOFRQWUROV\VWHPFRPPHQVXUDWHZLWKWKHVL]H HYHQGDWHRQWKHoQDQFLDOVWDWHPHQWVIRUWKH\HDUHQGHG RI WKH &RPSDQ\ DQG WKH QDWXUH RI LWV EXVLQHVV IRU RQ'HFHPEHURI/XFN\0LQPDW/LPLWHG. .

WKHSXUFKDVHVRILQYHQWRU\DQGo[HGDVVHWVDQGIRU WKHVDOHRIJRRGVDQGVHUYLFHV'XULQJWKHFRXUVHRI L.

 D.

 7KH &RPSDQ\ KDV PDLQWDLQHG SURSHU UHFRUGV RXU DXGLW QR PDMRU ZHDNQHVV KDV EHHQ QRWLFHG LQ VKRZLQJ IXOO SDUWLFXODUV LQFOXGLQJ TXDQWLWDWLYH WKHLQWHUQDOFRQWUROV\VWHPLQUHVSHFWRIWKHVHDUHDV GHWDLOVDQGVLWXDWLRQRIo[HGDVVHWV  LL.

   E.

 7KH o[HG DVVHWV DUH SK\VLFDOO\ YHULoHG E\ WKH Y.

 management during the year and in our opinion WKH IUHTXHQF\ RI YHULoFDWLRQ LV UHDVRQDEOH KDYLQJUHJDUGWRWKHVL]HRIWKH&RPSDQ\DQGWKH QDWXUH RI LWV DVVHWV 1R PDWHULDO GLVFUHSDQFLHV ZHUHQRWLFHGRQVXFKSK\VLFDOYHULoFDWLRQ YL.

 D.

Q RXU RSLQLRQ WKH IUHTXHQF\ RI YHULoFDWLRQ LV UHDVRQDEOH YLL. 7KH LQYHQWRULHV KDYH EHHQ SK\VLFDOO\ YHULoHG GXULQJ WKH \HDU E\ WKH PDQDJHPHQW .

 E.

 7KH SURFHGXUHV RI SK\VLFDO YHULoFDWLRQ RI LQYHQWRULHV IROORZHG E\ WKH PDQDJHPHQW DUH UHDVRQDEOHDQGDGHTXDWHLQUHODWLRQWRWKHVL]H RIWKH&RPSDQ\DQGWKHQDWXUHRILWVEXVLQHVV F.

QRXURSLQLRQDQGDFFRUGLQJWRWKHLQIRUPDWLRQ DQG H[SODQDWLRQV JLYHQ WR XV WKH &RPSDQ\ LV PDLQWDLQLQJ SURSHU UHFRUGV RI LQYHQWRU\ 7KH  GLVFUHSDQFLHV QRWLFHG RQ YHULoFDWLRQ EHWZHHQ WKH SK\VLFDO VWRFNV DQG WKH ERRN UHFRUGV ZHUH QRWPDWHULDODQGKDYHEHHQSURSHUO\GHDOWZLWK LQWKHERRNVRIDFFRXQWV LLL. .

 $V LQIRUPHG WKH &RPSDQ\ KDV QRW JUDQWHG DQ\ ORDQV VHFXUHG RU XQVHFXUHG WR FRPSDQLHV oUPV RURWKHUSDUWLHVFRYHUHGLQWKHUHJLVWHUPDLQWDLQHG XQGHU 6HFWLRQ  RI WKH &RPSDQLHV $FW  $FFRUGLQJO\VXEFODXVH D.

DQG E.

RIWKH2UGHUDUH QRWDSSOLFDEOH 292 7KH &RPSDQ\ KDV QRW DFFHSWHG DQ\ GHSRVLWV IURP WKHSXEOLFWRZKLFKWKHSURYLVLRQVRIVHFWLRQRU DQ\RWKHUUHOHYDQWSURYLVLRQVRIWKH&RPSDQLHV$FW  DQG WKH &RPSDQLHV $FFHSWDQFH RI 'HSRVLW.

 5XOHVDSSO\ :H KDYH EHHQ LQIRUPHG WKDW WKH &RPSDQ\ LV QRW UHTXLUHGWRPDLQWDLQFRVWUHFRUGVXQGHUVXEVHFWLRQ .

RIVHFWLRQRIWKH&RPSDQLHV$FWZKLFK KDVEHHQUHOLHGXSRQ D.

QVXUDQFH . $FFRUGLQJ WR WKH UHFRUGV RI WKH &RPSDQ\ WKH &RPSDQ\ KDV EHHQ JHQHUDOO\ UHJXODU LQ GHSRVLWLQJ 3URYLGHQW )XQG (PSOR\HHV  6WDWH .QFRPH WD[ 6DOHV WD[ 9DOXH $GGHG WD[:HDOWKWD[6HUYLFHWD[&XVWRPGXW\([FLVH GXW\ FHVV DQG RWKHU PDWHULDO VWDWXWRU\ GXHV DSSOLFDEOHWRLWZLWKWKHDSSURSULDWHDXWKRULWLHV  $FFRUGLQJWRWKHLQIRUPDWLRQDQGH[SODQDWLRQV JLYHQ WR XV WKHUH DUH QR XQGLVSXWHG GXHV LQ UHVSHFW RI SURYLGHQW IXQG LQYHVWRU HGXFDWLRQ DQGSURWHFWLRQIXQGHPSOR\HHV VWDWHLQVXUDQFH LQFRPHWD[ ZHDOWKWD[ VHUYLFH WD[ VDOHV WD[ FXVWRPV GXW\ H[FLVH GXW\ FHVV DQG RWKHU VWDWXWRU\ GXHV ZKLFK ZHUH RXWVWDQGLQJ DW WKH \HDUHQGIRUDSHULRGRIPRUHWKDQVL[PRQWKV IURPWKHGDWHWKH\EHFDPHSD\DEOH .

Corporate Overview   Financial Highlights Board & Management Reports Financial Statements E.

 $FFRUGLQJWRWKHUHFRUGVRIWKH&RPSDQ\WKHUH [.

QFRPHWD[6DOHVWD[:HDOWKWD[ 6HUYLFHWD[&XVWRPGXW\([FLVHGXW\DQG&HVV ZKLFK KDYH QRW EHHQ GHSRVLWHG RQ DFFRXQW RI DQ\GLVSXWH [L. DUHQRGXHVRI.

 F.

 %DVHG RQ RXU H[DPLQDWLRQ RI WKH UHFRUGV PDLQWDLQHGGXULQJWKH\HDUWKH&RPSDQ\LVQRW OLDEOH WR PDNH DQ\ SD\PHQWV WRZDUGV .QYHVWRU [LL.

 (GXFDWLRQ3URWHFWLRQ)XQG YLLL.

S. 7KHDFFXPXODWHGORVVHVRIWKH&RPSDQ\H[FHHGoIW\ SHUFHQWRILWVQHWZRUWK7KH&RPSDQ\KDVLQFXUUHG FDVKORVVHVGXULQJWKHoQDQFLDO\HDUFRYHUHGE\RXU DXGLW DQG LQ WKH LPPHGLDWHO\ SUHFHGLQJ oQDQFLDO \HDU Subsidiary Companies $FFRUGLQJ WR WKH LQIRUPDWLRQ DQG H[SODQDWLRQV JLYHQWRXVWKH&RPSDQ\KDVQRWJLYHQJXDUDQWHH IRU ORDQV WDNHQ E\ RWKHUV IURP EDQN RU oQDQFLDO LQVWLWXWLRQV 7KH&RPSDQ\KDVQRWUDLVHGDQ\WHUPORDQVGXULQJ WKH\HDU $FFRUGLQJ WR WKH LQIRUPDWLRQ DQG H[SODQDWLRQV IXUQLVKHG E\ WKH PDQDJHPHQW ZKLFK KDYH EHHQ UHOLHGXSRQE\XVWKHUHZHUHQRIUDXGVRQRUE\WKH &RPSDQ\ QRWLFHG RU UHSRUWHG GXULQJ WKH FRXUVH RI RXUDXGLW For K. L[. Aiyar & Co.

 $FFRUGLQJ WR WKH LQIRUPDWLRQ DQG H[SODQDWLRQV Chartered Accountants JLYHQWRXVWKH&RPSDQ\KDVQRWWDNHQDQ\PRQH\  .&$.)LUP5HJLVWUDWLRQ1R: IURP DQ\ oQDQFLDO LQVWLWXWLRQ EDQN RU GHEHQWXUH KROGHU DQG KHQFH FODXVH  L[.

 RI WKH 2UGHU LV QRW Sachin A. Negandhi DSSOLFDEOHWRWKH&RPSDQ\ Place:0XPEDL Partner Date:-DQXDU\ Membership No: 112888 293 .

LUCKY MINMAT LIMITED (LML) BALANCE SHEET STATEMENT OF PROFIT AND LOSS AS AT DECEMBER 31.2015 3DUWLFXODUV 1RWH 1R Equity and Liabilities 6KDUHKROGHUV )XQGV 6KDUH&DSLWDO 5HVHUYHVDQG6XUSOXV FOR THE YEAR ENDED DECEMBER 31.2015 2015 `  ` 1RWH 1R 5HYHQXHIURPRSHUDWLRQV JURVV.

    .

.

48.795 1RQ&XUUHQWOLDELOLWLHV /RQJWHUPERUURZLQJ   64.626  2015 `   `   /HVV([FLVHGXW\   5HYHQXHIURPRSHUDWLRQV QHW. 19.16.

27.982 TOTAL Assets 1RQFXUUHQWDVVHWV )L[HG$VVHWV 7DQJLEOHDVVHWV    1RQFXUUHQWLQYHVWPHQWV /RQJWHUPORDQVDQGDGYDQFHV     31.99.452 EXPENSES &XUUHQWOLDELOLWLHV &XUUHQWOLDELOLWLHV 6KRUWWHUPSURYLVLRQV     76.39.04.21.46.   2WKHU.34.94.QFRPH  Total revenue   3.496   38.680    .361 2.701 95.477   30.28.912 12.

302 2.34.QWHUFRUSRUDWHGHSRVLW 7RWDO([SHQVHV 3URoW /RVV.21.019 95.982 'HSUHFLDWLRQDQGDPRUWL]DWLRQ H[SHQVH    2WKHUH[SHQVHV    .  63.52.QWHUHVWRQ.46.496     2.03.94.

EHIRUH7D[      .

 .

7D[H[SHQVHV &XUUHQWDVVHWV 7UDGHUHFHLYDEOHV &DVKDQGEDQNEDODQFHV 6KRUWWHUPORDQVDQGDGYDQFHV 2WKHUFXUUHQWDVVHWV     TOTAL 6XPPDU\RIVLJQLoFDQWDFFRXQWLQJ SROLFLHV    .

 .

%DVLF 'LOXWHG%HIRUH3ULRU3HULRG .WHP  .

 .

%DVLF 'LOXWHG$IWHU3ULRU3HULRG item  .

 .

3URoW /RVV.

IRUWKH\HDU (DUQLQJVSHUHTXLW\VKDUH )DFHYDOXH of ` HDFK.

` 100 each) 5HIHU1RWH. Previous Year .

NEGANDHI Partner 0HPEHUVKLS1R 0XPEDL-DQXDU\ 0XPEDL-DQXDU\ 294 Rajat Prusty Director .&$. Aiyar & Co.S. Chartered Accountants . 6XPPDU\RIVLJQLoFDQWDFFRXQWLQJ SROLFLHV   7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRIoQDQFLDOVWDWHPHQWV 7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRIoQDQFLDOVWDWHPHQWV $VSHURXUUHSRUWRIHYHQGDWH )RUDQGRQEHKDOIRIWKH%RDUGRI Lucky Minmat Limited $VSHURXUUHSRUWRIHYHQGDWH )RUDQGRQEHKDOIRIWKH%RDUGRI Lucky Minmat Limited For K. NEGANDHI Partner 0HPEHUVKLS1R SACHIN A. Chartered Accountants .S.)LUP5HJLVWUDWLRQ 1R: Ramnik Gupta Director For K. Aiyar & Co.)LUP5HJLVWUDWLRQ 1R: Ramnik Gupta Director Rajat Prusty Director SACHIN A.&$.

2015 3DUWLFXODUV A. 2015 `  ` CASH FLOW FROM OPERATING ACTIVITIES  1HW3URoW /RVV.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies CASH FLOW STATEMENT FOR THE YEAR ENDED DECEMBER 31.

EHIRUHWD[DWLRQ  .

 .

  $GMXVWPHQWVIRU 'HSUHFLDWLRQ .QWHUHVW5HFHLYHG 2SHUDWLQJSURoWEHIRUHZRUNLQJFDSLWDOFKDQJHV  .

 .

 .

 .

QFUHDVH. 0RYHPHQWLQ:RUNLQJ&DSLWDO  'HFUHDVH .

LQ/RQJWHUPGHSRVLW  .

QFUHDVH.   'HFUHDVH .

QFUHDVH 'HFUHDVH.LQ2WKHU&XUUHQW$VVHWV    .

LQ2WKHU/LDELOLWLHV 3URYLVLRQV   &DVKJHQHUDWHGIURPRSHUDWLRQV  .

 .

 .

 .

 .

 .

99.912 12.QWHUHVW5HFHLYHG   NET CASH FROM INVESTING ACTIVITIES 3.452 .28. .QWHU&RUSRUDWH'HSRVLWVIURP+ROGLQJFRPSDQ\  .

 NET CASH USED IN FINANCING ACTIVITIES  .

11. 18.744 1HWLQFUHDVH GHFUHDVH.

LQFDVK FDVKHTXLYDOHQWV  .

42.750      'LUHFW7D[HVSDLG 1HWRI5HIXQGV. 15.

Aiyar & Co.)LUP5HJLVWUDWLRQ1R: Ramnik Gupta Director Rajat Prusty Director SACHIN A. CASH FLOW FROM FINANCING ACTIVITIES  &DVK FDVKHTXLYDOHQWVDWWKHEHJLQQLQJRIWKH\HDU &DVK FDVKHTXLYDOHQWVDWWKHHQGRIWKH\HDU 5HIHU1RWHQRIRUGHWDLOVRI&DVK &DVKHTXLYDOHQWV 7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRIoQDQFLDOVWDWHPHQWV $VSHURXUUHSRUWRIHYHQGDWH )RUDQGRQEHKDOIRIWKH%RDUGRI/XFN\0LQPDW/LPLWHG For K.&$. NEGANDHI Partner 0HPEHUVKLS1R 0XPEDL-DQXDU\ 295 . CASH FLOW FROM INVESTING ACTIVITIES  C. NET CASH FROM OPERATING ACTIVITIES B.S. Chartered Accountants .

QDVVHVVLQJWKHYDOXHLQXVHWKHHVWLPDWHG IXWXUH FDVK pRZV DUH GLVFRXQWHG WR WKHLU 3UHVHQW YDOXH XVLQJ D SUHWD[GLVFRXQWUDWHWKDWUHpHFWVFXUUHQWPDUNHWDVVHVVPHQWVRI WKHWLPHYDOXHRIPRQH\DQGULVNVVSHFLoFWRWKHDVVHW3UHYLRXVO\ UHFRJQL]HG LPSDLUPHQW ORVV LV IXUWKHU SURYLGHG RU UHYHUVHG GHSHQGLQJRQFKDQJHVLQFLUFXPVWDQFHV /XFN\0LQPDW/LPLWHGLVDZKROO\RZQHGVXEVLGLDU\RI$&&/LPLWHG &RPSDQ\GRPLFLOHGLQ.LUCKY MINMAT LIMITED (LML) Notes to Financial Statement for the year ended December 31. 2015 1.QGLDDQGLQFRUSRUDWHGXQGHUWKHSURYLVLRQ RI&RPSDQLHV$FW7KH&RPSDQ\LVHQJDJHGLQWKHH[WUDFWLRQ RIOLPHVWRQH  6LJQLoFDQWDFFRXQWLQJSROLFLHV $. Corporate Information DPRXQW7KHUHFRYHUDEOHDPRXQWLVJUHDWHURIWKHDVVHWVQHWVHOOLQJ SULFHDQGYDOXHLQXVH.

 %DVLVRISUHSDUDWLRQ L.

 LL.

 %.

QYHQWRULHVDUHYDOXHGDIWHUSURYLGLQJIRUREVROHVFHQFHDVIROORZV 7KH DFFRXQWLQJ SROLFLHV DGRSWHG LQ WKH SUHSDUDWLRQ RI oQDQFLDO VWDWHPHQWV DUH FRQVLVWHQW ZLWK WKRVH RI SUHYLRXV \HDU 5HYHQXHUHFRJQLWLRQ 5HYHQXH LV UHFRJQL]HG WR WKH H[WHQW WKDW LW LV SUREDEOH WKDW WKH HFRQRPLFEHQHoWVZLOOpRZWRWKH&RPSDQ\DQGWKHUHYHQXHFDQ EHUHOLDEO\PHDVXUHG L. .

 6DOHRIJRRGV  5HYHQXHIURPVDOHVLVUHFRJQL]HGZKHQWKHVLJQLoFDQWULVNV DQGUHZDUGVRIRZQHUVKLSRIWKHJRRGVKDYHSDVVHGWRWKH EX\HU ZKLFK LV JHQHUDOO\ RQ GLVSDWFK RI SURGXFWV DQG LV VWDWHGQHWRIUHWXUQV LL.

 . 3DUW&..QWHUHVW  5HYHQXHLVUHFRJQL]HGRQDWLPHSURSRUWLRQEDVLVWDNLQJLQWR DFFRXQWWKHDPRXQWRXWVWDQGLQJDQGWKHUDWHDSSOLFDEOH )L[HG DVVHWV DUH VWDWHG DW FRVW RI DFTXLVLWLRQ RU FRQVWUXFWLRQ LQFOXGLQJ DWWULEXWDEOH LQWHUHVW DQG oQDQFLDO FRVWV WLOO VXFK DVVHWV DUH UHDG\ IRU LWV LQWHQGHG XVH OHVV DFFXPXODWHG GHSUHFLDWLRQ LPSDLUPHQWORVVHVDQGVSHFLoFJUDQWVUHFHLYHGLIDQ\ 'HSUHFLDWLRQ $OODVVHWVDUHGHSUHFLDWHGRQWKHVWUDLJKWOLQHPHWKRGDWWKHUDWHV SUHVFULEHGLQ6FKHGXOH.

RIWKH&RPSDQLHV$FWRQD SURUDWDEDVLV ).

 .PSDLUPHQW 7KHFDUU\LQJDPRXQWVRIDVVHWVDUHUHYLHZHGDWHDFK%DODQFH6KHHW GDWH LI WKHUH LV DQ\ LQGLFDWLRQ RI LPSDLUPHQW EDVHG RQ LQWHUQDO  H[WHUQDOIDFWRUV$QLPSDLUPHQWORVVZLOOEHUHFRJQL]HGZKHUHYHU WKHFDUU\LQJDPRXQWRIDQDVVHWH[FHHGVLWVHVWLPDWHGUHFRYHUDEOH 296 5DZ 0DWHULDOV 6WRUHV  6SDUH 3DUWV 3DFNLQJ 0DWHULDO DQG )XHOV  /RZHU RI FRVW DQG QHW UHDOL]DEOH YDOXH +RZHYHU PDWHULDOV DQGRWKHULWHPVKHOGIRUXVHLQWKHSURGXFWLRQRILQYHQWRULHV DUHQRWZULWWHQGRZQEHORZFRVWLIWKHoQLVKHGSURGXFWVLQ ZKLFKWKH\ZLOOEHLQFRUSRUDWHGDUHH[SHFWHGWREHVROGDWRU DERYHFRVW&RVWLVGHWHUPLQHGRQDZHLJKWHGDYHUDJHEDVLV LL.

 :RUNLQSURJUHVVDQG)LQLVKHGJRRGV  /RZHU RI FRVW DQG QHW UHDOL]DEOH YDOXH &RVW LQFOXGHV GLUHFW PDWHULDOV DQG ODERXU DQG D SURSRUWLRQ RI PDQXIDFWXULQJ RYHUKHDGV EDVHG RQ QRUPDO RSHUDWLQJ FDSDFLW\ &RVW RI oQLVKHGJRRGVLQFOXGHVH[FLVHGXW\&RVWLVGHWHUPLQHGRQD ZHLJKWHGDYHUDJHEDVLV  1HW UHDOL]DEOH YDOXH LV WKH HVWLPDWHG VHOOLQJ SULFH LQ WKH RUGLQDU\ FRXUVH RI EXVLQHVV OHVV HVWLPDWHG FRVWV RI FRPSOHWLRQDQGHVWLPDWHGFRVWVQHFHVVDU\WRPDNHWKHVDOH +.

QYHVWPHQWV &XUUHQW. .QYHVWPHQWVDUHVWDWHGDWORZHURIFRVWRUIDLUYDOXH/RQJ WHUP .QYHVWPHQWV DUH VWDWHG DW FRVW 3URYLVLRQ IRU GLPLQXWLRQ LQ YDOXHLVPDGHRQO\LIGHFOLQHLVRWKHUWKDQWHPSRUDU\ .

QFRPH 7D[ $FW 'HIHUUHG WD[HV UHpHFW WKH LPSDFW RI FXUUHQW \HDU WLPLQJ GLIIHUHQFHV EHWZHHQ WD[DEOHLQFRPHDQGDFFRXQWLQJLQFRPHIRUWKH\HDUDQGUHYHUVDORI WLPLQJGLIIHUHQFHVRIHDUOLHU\HDUV 'HIHUUHG WD[ LV PHDVXUHG EDVHG RQ WKH WD[ UDWHV DQG WKH WD[ ODZVHQDFWHGRUVXEVWDQWLYHO\HQDFWHGDWWKHEDODQFHVKHHWGDWH 'HIHUUHGWD[DVVHWVDUHUHFRJQLVHGRQO\WRWKHH[WHQWWKDWWKHUHLV UHDVRQDEOHFHUWDLQW\WKDWVXIoFLHQWIXWXUHWD[DEOHLQFRPHZLOOEH DYDLODEOH DJDLQVW ZKLFK VXFK GHIHUUHG WD[ DVVHWV FDQ EH UHDOLVHG .QVLWXDWLRQVZKHUHWKHFRPSDQ\KDVXQDEVRUEHGGHSUHFLDWLRQRU FDUU\IRUZDUGWD[ORVVHVDOOGHIHUUHGWD[DVVHWVDUHUHFRJQLVHGRQO\ LIWKHUHLVYLUWXDOFHUWDLQW\VXSSRUWHGE\FRQYLQFLQJHYLGHQFHWKDW WKH\FDQEHUHDOLVHGDJDLQVWIXWXUHWD[DEOHSURoWV '.QGLDQ .QFRPHWD[HV 7D[H[SHQVHFRPSULVHVRIFXUUHQWDQGGHIHUUHGWD[&XUUHQW7D[LV PHDVXUHGDWWKHDPRXQWH[SHFWHGWREHSDLGWRWKHWD[DXWKRULWLHV LQ DFFRUGDQFH ZLWK WKH . .

 )L[HGDVVHWV (.

 L.

QGLDQ *$$3 UHTXLUHV WKH PDQDJHPHQW WR PDNH MXGJPHQWV HVWLPDWHV DQGDVVXPSWLRQVWKDWDIIHFWWKHUHSRUWHGDPRXQWVRIDVVHWVDQG OLDELOLWLHV DQG GLVFORVXUH RI FRQWLQJHQW OLDELOLWLHV RQ WKH GDWH RI WKH oQDQFLDO VWDWHPHQWV DQG UHSRUWHG DPRXQWV RI UHYHQXHV DQG H[SHQVHVIRUWKH\HDU$OWKRXJKWKHVHHVWLPDWHVDUHEDVHGRQWKH PDQDJHPHQW V EHVW NQRZOHGJH RI FXUUHQW HYHQWV DQG DFWLRQV XQFHUWDLQW\DERXWWKHVHDVVXPSWLRQVDQGHVWLPDWHVFRXOGUHVXOWLQ WKHRXWFRPHVGLIIHUHQWIURPWKHHVWLPDWHV &. 8VHRIHVWLPDWHV 7KHSUHSDUDWLRQRIoQDQFLDOVWDWHPHQWVLQFRQIRUPLW\ZLWK.

 *.

QGLD . .QGLDQ*$$3.QYHQWRULHV 7KHoQDQFLDOVWDWHPHQWVRIWKHFRPSDQ\KDYHEHHQSUHSDUHG LQ DFFRUGDQFH ZLWK WKH JHQHUDOO\ DFFHSWHG DFFRXQWLQJ SULQFLSOHVLQ.

7KH&RPSDQ\KDVSUHSDUHG WKHVHoQDQFLDOVWDWHPHQWVWRFRPSO\LQDOOPDWHULDOUHVSHFWV ZLWKWKHDFFRXQWLQJVWDQGDUGVQRWLoHGXQGHUVHFWLRQRI WKH &RPSDQLHV $FW  UHDG WRJHWKHU ZLWK 5XOH  RI WKH &RPSDQLHV $FFRXQWV.

5XOHV7KHoQDQFLDOVWDWHPHQWV KDYH EHHQ SUHSDUHG RQ DQ DFFUXDO EDVLV DQG XQGHU WKH KLVWRULFDOFRVWFRQYHQWLRQ -.

 &RQWLQJHQFLHV3URYLVLRQ $ SURYLVLRQ LV UHFRJQLVHG ZKHQ DQ HQWHUSULVH KDV D SUHVHQW REOLJDWLRQDVDUHVXOWRISDVWHYHQWLWLVSUREDEOHWKDWDQRXWpRZ RI UHVRXUFHV HPERG\LQJ HFRQRPLF EHQHoW ZLOO EH UHTXLUHG WR VHWWOHWKHREOLJDWLRQLQUHVSHFWRIZKLFKDUHOLDEOHHVWLPDWHFDQEH PDGH 3URYLVLRQV DUH QRW GLVFRXQWHG WR LWV SUHVHQW YDOXH DQG DUH GHWHUPLQHGEDVHGRQEHVWHVWLPDWHUHTXLUHGWRVHWWOHWKHREOLJDWLRQ DW WKH EDODQFH VKHHW GDWH 7KHVH DUH UHYLHZHG DW HDFK EDODQFH VKHHW GDWH DQG DGMXVWHG WR UHpHFW WKH FXUUHQW EHVW HVWLPDWHV $ FRQWLQJHQWOLDELOLW\LVGLVFORVHGXQOHVVWKHSRVVLELOLW\RIDQRXWpRZ RIUHVRXUFHVHPERG\LQJWKHHFRQRPLFEHQHoWLVUHPRWH .

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 1RWHVWR)LQDQFLDO6WDWHPHQWIRUWKH\HDUHQGHG'HF &RQWG.

.

 /.

 (DUQLQJVSHUVKDUH Notes : %DVLF HDUQLQJV SHU VKDUH DUH FDOFXODWHG E\ GLYLGLQJ WKH QHW SURoW RU ORVV IRU WKH SHULRG DWWULEXWDEOH WR HTXLW\ VKDUHKROGHUV E\ WKH ZHLJKWHGDYHUDJHQXPEHURIHTXLW\VKDUHVRXWVWDQGLQJGXULQJWKH SHULRG D.

5HFRQFLOLDWLRQRIQXPEHURIHTXLW\VKDUHV 2015 Number of shares 6HJPHQW5HSRUWLQJ 1XPEHURI VKDUHVRXW VWDQGLQJDW WKHEHJLQQLQJ of the year 0.

25.%(' 3$. &XUUHQW1RQ&XUUHQW Movement during the reporting period $OODVVHWVDQGOLDELOLWLHVDUHSUHVHQWHGDV&XUUHQWRU1RQFXUUHQW DV SHU WKH &RPSDQ\ V QRUPDO RSHUDWLQJ F\FOH DQG RWKHU FULWHULD VHW RXW LQ 6FKHGXOH .6('6+$5(6 (previous year: 325. RI WKH &RPSDQLHV $FW  %DVHG RQ WKH QDWXUHRISURGXFWVDQGWKHWLPHEHWZHHQWKHDFTXLVLWLRQRIDVVHWV IRU SURFHVVLQJ DQG WKHLU UHDOLVDWLRQ WKH &RPSDQ\ DVFHUWDLQHG LWV RSHUDWLQJ F\FOH DV  PRQWKV IRU WKH SXUSRVH RI &XUUHQW  1RQ FXUUHQWFODVVLoFDWLRQRIDVVHWVDQGOLDELOLWLHV &ORVLQJ EDODQFHDW the end of the reporting Year SHARE CAPITAL 2015 `  `           $87+25.000)HTXLW\ VKDUHVRI`HDFK              7KH&RPSDQ\KDVRQO\RQHFODVVRIHTXLW\VKDUHVKDYLQJSDUYDOXH of `HDFK$OOHTXLW\VKDUHVFDUU\VLPLODUYRWLQJULJKWVRI DQGVLPLODUGLYLGHQGULJKWV  .'83 (previous year: 3.000)HTXLW\ VKDUHVRI`HDFK 68%6&5.QSURSRUWLRQWRWKHQXPEHURIHTXLW\VKDUHV KHOGE\WKHVKDUHKROGHUV F...QWKHHYHQWRIOLTXLGDWLRQRIWKH&RPSDQ\WKHKROGHUVRIHTXLW\ VKDUHV ZLOO EH HQWLWOHG WR UHFHLYH DQ\ RI WKH UHPDLQLQJ DVVHWV RI WKH &RPSDQ\ DIWHU GLVWULEXWLRQ RI DOO SUHIHUHQWLDO DPRXQWV 7KH GLVWULEXWLRQZLOOEH.

 (TXLW\ VKDUHV KHOG E\ KROGLQJ FRPSDQ\  XOWLPDWH KROGLQJ DQG their subsidiaries 2015 Number of shares $OOVKDUHVDUHKHOGE\$&&OLPLWHGWKH KROGLQJFRPSDQ\ LWV1RPLQHH.

TOTAL   $PRXQW ` E.

 Amount `  Amount ` 1XPEHU RIVKDUHV $PRXQW ` +ROGLQJFRPSDQ\ $&&/LPLWHG         G.668(' (previous year: 3.25. 5LJKWVSUHIHUHQFHVDQGUHVWULFWLRQVDWWDFKHGWRHTXLW\VKDUHV .000)HTXLW\ VKDUHVRI`HDFK 1XPEHU RIVKDUHV (TXLW\6KDUHV 7KH&RPSDQ\LVRSHUDWLQJRQO\LQRQHVLJQLoFDQWEXVLQHVVVHJPHQW LH([WUDFWLRQDQGVDOHRIOLPHVWRQHKHQFHVHJPHQWLQIRUPDWLRQ DVSHU$FFRXQWLQJ6WDQGDUGLVQRWUHTXLUHGWREHGLVFORVHG7KH &RPSDQ\LVFDWHULQJPDLQO\WRWKHQHHGRIWKHGRPHVWLFPDUNHWDV VXFKWKHUHLVQRUHSRUWDEOH*HRJUDSKLFDO6HJPHQWV 3.

'HWDLOVRIVKDUHKROGHUVKROGLQJPRUHWKDQVKDUHV 2015 Number of shares  KHOG 1XPEHU RIVKDUHV KHOG (TXLW\VKDUHV $&&/LPLWHG     297 .

LUCKY MINMAT LIMITED (LML) 1RWHVWR)LQDQFLDO6WDWHPHQWIRUWKH\HDUHQGHG'HF &RQWG.

RESERVES AND SURPLUS 2015 ` *HQHUDO 5HVHUYHV 6XUSOXVLQWKH VWDWHPHQW RISURoWDQG ORVV %DODQFH . 4.

DVSHUODVW )LQDQFLDO VWDWHPHQWV $GG3URoW  .

/RVV.

 `  CURRENT LIABILITIES 2015 `  2WKHU3D\DEOHV .IRUWKH year TOTAL 6.

 `   3URYLVLRQIRU(QYLURQPHQWDO &HVVRQ/LPHVWRQH   3URYLVLRQIRU([SHQVHV   TOTAL   2015 `  `  .

.

 .

.

 .

01.QWHUFRUSRUDWHGHSRVLWIURP +ROGLQJ&RPSDQ\   TOTAL   2WKHUV   TOTAL   NOTE . NON-CURRENT INVESTMENTS 2015 `  ` 7UDGH.2015 1(7%/2&.2015 )RUWKH<HDU As at 31.21$0257.2015 727$/ '(35(&.2015 As at 01.$7.FIXED ASSETS ).21 As at 31.12. LONG TERM BORROWING 2015 `  ` . 7.$7&267 As at 01.. As at 31.6$7.12.8.QYHVWPHQWV YDOXHGDW FRVW.12.2015 $VDW  7DQJLEOH$VVHWV %XLOGLQJV        3ODQWDQG Machinery        2IoFH HTXLSPHQW        TOTAL        Previous Year       9. SHORT TERM PROVISIONS 5.('$66(76 $PRXQWLQ ` *5266%/2&.01.

TERM LOANS AND ADVANCES 8QVHFXUHGFRQVLGHUHG*RRGXQOHVVRWKHUZLVHVWDWHG Other loans and advances $GYDQFHV3D\PHQWDJDLQVWWD[HV TOTAL 2015 `  `     . 1DWLRQDO6DYLQJ&HUWLoFDWH   TOTAL   298 10. LONG .

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 1RWHVWR)LQDQFLDO6WDWHPHQWIRUWKH\HDUHQGHG'HF &RQWG.

TRADE RECEIVABLES 15. 11. 2015 ` REVENUE FROM OPERATIONS 2015 `  `  ` 8QVHFXUHGFRQVLGHUHGJRRGXQOHVV VWDWHGRWKHUZLVH 6DOHRI3URGXFWV )LQLVKHGJRRGV6DOHRI/LPHVWRQH   5HFHLYDEOHIURPKROGLQJFRPSDQ\ 5HYHQXHIURPRSHUDWLRQV JURVV.

  2YHUVL[PRQWKV   /HVV([FLVHGXW\   2WKHUV   5HYHQXHIURPRSHUDWLRQV QHW.

QWHUHVWRQ%DQNGHSRVLWV   TOTAL   %DODQFHVZLWKEDQNV 2QFXUUHQWDFFRXQWV 'HSRVLWVZLWKRULJLQDOPDWXULW\RI OHVVWKDQWKUHHPRQWKV         17. OTHER INCOME CASH AND BANK BALANCES 2015 `  ` &DVKDQGFDVKHTXLYDOHQWV 2015 `  ` . 12.1 OTHER EXPENSES 2WKHUEDQNEDODQFHV )L[HGGHSRVLW UHFHLSWVDUHLQWKH FXVWRG\RIPLQLQJGHSDUWPHQWDV VHFXULW\WRZDUGVPLQHV.   TOTAL   16.

TOTAL 2015 ` 7UDYHOOLQJ([SHQVHV     3RZHUDQGIXHO SHORT .QWHUHVW 3HQDOW\  .TERM LOANS AND ADVANCES 2015 `  `    5R\DOWLHVGHDG5HQW   /HJDO([SHQVHV $GYDQFHVUHFRYHUDEOHLQFDVKRU kind 5DWHV 7D[HV .

    .

WHP'HPDQG)RU H[WUDFWLRQ 0LVFHOODQHRXVH[SHQVHV   6WDWLRQDU\([SHQVHV 3URIHVVLRQDO([SHQVHV  .          3ULRU3HULRG.

   8QVHFXUHGFRQVLGHUHG*RRG XQOHVVRWKHUZLVHVWDWHG 8QVHFXUHGFRQVLGHUHGJRRG  5HSDLUVWRRWKHU.  ` 727$/ $.WHPV 2WKHUPLQLQJH[SHQVHV 13.

&/8'.&(7$.7256 (.1*6(59.         2WKHUORDQVDQGDGYDQFHV $GYDQFHVUHFRYHUDEOHRUYDOXHWREH received TOTAL 3$<0(177267$78725<$8'.

2015 `  `   $VDXGLWRUV 14. $XGLWIHHV OTHER CURRENT ASSETS 2015 `  ` 8QVHFXUHGFRQVLGHUHGJRRGXQOHVV VWDWHGRWKHUZLVH $FFUXHG.QWHUHVW   TOTAL   $XGLWIHHVIRUWD[oQDQFLDOVWDWHPHQWV   2XWRISRFNHWH[SHQVHV   )RURWKHUVHUYLFHV   727$/ %.

    727$/ $%.

299 .

LUCKY MINMAT LIMITED (LML) 1RWHVWR)LQDQFLDO6WDWHPHQWIRUWKH\HDUHQGHG'HF &RQWG.

RELATED PARTY DISCLOSURE 7D[DWLRQ $. 18 .

3DUWLFXODUVRI5HODWHG3DUWLHVZKLFKFRQWURORUDUHXQGHU FRPPRQFRQWUROZLWKWKH&RPSDQ\ 1DPHRI5HODWHG3DUW\ 1DWXUHRI5HODWLRQVKLS $&&/LPLWHG +ROGLQJ&RPSDQ\ %.

 5HODWHG3DUW\7UDQVDFWLRQV 2015 ` 7UDQVDFWLRQZLWK+ROGLQJ Company &.

  ` (i) .QWHUFRUSRUDWH GHSRVLWUHFHLYHG   (ii) 7'69$76HUYLFH 7D[5R\DOW\3DLG RQEHKDOIRI/XFN\ Minmat Limited By $&&/LPLWHG   2015 ` +ROGLQJ&R$&&/LPLWHG  ` .&'7DNHQ   2WKHU3D\DEOHV   '.

QGLDQ %XUHDXRI0LQHVRI`  ($51. %DQN*XDUDQWHHKDVEHHQJLYHQE\WKHKROGLQJFRPSDQ\WR.1*63(56+$5( (36.

3URoW /RVV.

DIWHU WD[DWLRQDVSHU 6WDWHPHQWRI3URoW /RVV Weighted DYHUDJHQXPEHU RI(TXLW\6KDUHV 2XWVWDQGLQJ %DVLFHDUQLQJVSHU VKDUH ZHLJKWHG DYHUDJH.

 )DFH 9DOXHq `SHUVKDUH.

21. 7KHUHDUHQR0LFUR6PDOODQG0HGLXP(QWHUSULVHVDVGHoQHGLQ WKH 0LFUR 6PDOO 0HGLXP (QWHUSULVHV 'HYHORSPHQW $FW  WR ZKRP WKH &RPSDQ\ RZHV GXHV RQ DFFRXQW RI SULQFLSOH DPRXQW WRJHWKHU ZLWK LQWHUHVW DQG DFFRUGLQJO\ QR DGGLWLRQDO GLVFORVXUHV KDYH EHHQ PDGH 7KH DERYH LQIRUPDWLRQ KDV EHHQ GHWHUPLQHG WR WKH H[WHQW VXFK SDUWLHV KDYH EHHQ LGHQWLoHG RQ WKH EDVLV RI LQIRUPDWLRQDYDLODEOHZLWKWKH&RPSDQ\7KLVKDVEHHQUHOLHGXSRQ E\WKHDXGLWRUV 22.QYLHZRIFDUULHGIRUZDUGORVVHVWKHFRPSDQ\KDVGHIHUUHG WD[ DVVHWV KRZHYHU DV D PDWWHU RI SUXGHQFH DQG LQ YLHZ RI WKH DEVHQFHRIYLUWXDOFHUWDLQW\RIIXWXUHWD[DEOHLQFRPHWKHVDPHKDV QRWEHHQUHFRJQL]HGLQWKHoQDQFLDOVWDWHPHQWV 2015 ` . 7KH&RPSDQ\KDVQRHPSOR\HHVRQLWVSD\UROOGXULQJWKHSHULRG &ORVLQJ%DODQFHVRI5HODWHG3DUWLHV 3DUWLFXODUV 1RSURYLVLRQIRUFXUUHQWWD[LVPDGHLQYLHZRIWKHORVVHVIRUWKH \HDU.

 `  ` $IWHU3ULRU period item Before Prior 3HULRG.WHP .

.

 :LWK5HJDUGWRWKHDSSOLFDWLRQIRUUHQHZDORIFRQVHQWWRRSHUDWH PLQRU OHDVH IRU SURGXFWLRQ FDSDFLW\  7RQQHV SHU DQQXP oOHG ZLWK WKH 5DMDVWKDQ 6WDWH 3ROOXWLRQ &RQWURO %RDUG 563&%. 23.

 $GGLWLRQDO LQIRUPDWLRQ SXUVXDQW WR WKH SURYLVLRQV RI SDUDJUDSK  YLLL.Q WKH RSLQLRQ RI WKH PDQDJHPHQW DV 0LQLQJ (QJLQHHU  6LNDU KDV QRW SDVVHG WKH OHDVH UHVWRUDWLRQ RUGHUV DQG SK\VLFDO SRVVHVVLRQ RI OHDVHV UHPDLQ ZLWK WKHP WLOO GDWH QR GXHV DUH SD\DEOH RQ DFFRXQW RI OHDVHV DQG DQ\ IXUWKHU FRXUVH RIDFWLRQZLOOEHGHWHUPLQHGDIWHUUHFHLSWRIRUGHUVIURPWKHPLQ WKLVUHVSHFW 24. D VKRZ FDXVH QRWLFH ZDV UHFHLYHG IURP WKH 563&% LQ 'HFHPEHU ZKLFKZDVVXLWDEO\UHSOLHG7KHUHDIWHUWKH&RPSDQ\UHFHLYHG D QRWLFH IRU FORVXUH RI WKH PLQHV LQ )HEUXDU\  SXUVXDQW WR ZKLFKWKH&RPSDQ\KDVVWRSSHGDOOPLQLQJRSHUDWLRQVIURP0DUFK 0LQLQJ(QJLQHHU6LNDUKDVVHUYHGRUGHUIRUUHSRVVHVVLRQRI PLQHVqPDMRUOHDVHDQGPLQRUOHDVHYLGHRUGHUVGDWHG DQGUHVSHFWLYHO\7KH&RPSDQ\KDVoOHGWZRZULWSHWLWLRQV LQ WKH +LJK &RXUW RI 5DMDVWKDQ IRU FDQFHOODWLRQ RI RUGHUV DQG 7KH +RQ DEOH +LJK &RXUW KDV VHW DVLGH WKH RUGHUV RQ  .

RI3DUW%RIVFKHGXOH.RI7KH&RPSDQLHV$FWLVHLWKHU 1LORUQRWDSSOLFDEOH     ...

 .

.

 %DVLFDQG'LOXWHG(36DUHVDPH.

 3UHYLRXV\HDUoJXUHVDUHUHJURXSHGUHVWDWHGZKHUHYHUQHFHVVDU\ WRPDNHWKHP&RPSDUDEOHZLWKFXUUHQW\HDUoJXUHV $VSHURXUUHSRUWRIHYHQGDWH For K.&$. Aiyar & Co. NEGANDHI Partner 0HPEHUVKLS1R 0XPEDL-DQXDU\ 300 )RUDQGRQEHKDOIRIWKH%RDUGRI Lucky Minmat Limited Ramnik Gupta Director Rajat Prusty Director .)LUP5HJLVWUDWLRQ 1R: SACHIN A.S. Chartered Accountants . 25.

2013. FINANCIAL HIGHLIGHTS 7.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies BOARD’S REPORT TO THE MEMBERS OF NATIONAL LIMESTONE COMPANY PRIVATE LIMITED 6. SIGNIFICANT & MATERIAL ORDERS PASSED BY THE REGULATORS OR COURTS OR TRIBUNALS IMPACTING THE GOING CONCERN STATUS OF THE COMPANY  7KHUHDUHQRVLJQLoFDQWDQGPDWHULDORUGHUVSDVVHG by the Regulators or Courts or Tribunals impacting the going concern status of your Company. 2015 is summarized below: PARTICULARS INVESTMENTS  7KHUH DUH QR ORDQV  JXDUDQWHHV JLYHQ DQG investments made under the provisions of Section 186 of the Companies Act. The Directors take pleasure in presenting the Thirty Fifth Annual Report on the business and operations of the Company and the Audited Financial Statements for the year ended December 31. CONTRACT OR ARRANGEMENT WITH RELATED PARTIES PARTICULARS Revenue from operations (net) and Other Income 3URoW /RVV. 2015. 8. 1.  7KHoQDQFLDOKLJKOLJKWVRI\RXU&RPSDQ\IRUWKH\HDU ended December 31.

%HIRUH7D[ 3URYLVLRQIRU7D[DWLRQ 3URoW /RVV.

87.305) (53.246) (21.94. OPERATIONS There was no production and despatches during the year 2015.195) (98.95.746) (76. DIRECTORS 7KH %RDUG RI 'LUHFWRUV KDV DSSRLQWHG 0U 5DPQLN Gupta as an Additional Director of the Company with HIIHFWIURP$SULO0U*XSWDKROGVRIoFHXSWR WKHGDWHRIWKH$QQXDO*HQHUDO0HHWLQJ$FFRUGLQJO\ his candidature for appointment as a Director has been included in the Notice convening the Annual *HQHUDO0HHWLQJRIWKH&RPSDQ\  7KH%RDUGRI'LUHFWRUVKDVDSSRLQWHG0U5DMDW. In accordance with the provisions of Section 188 of the Companies Act. 2015 ` 2.305) (22. the transactions entered into with Related Parties are in ordinary course of business and are on an arms length pricing basis.76. GUARANTEES Appointment of Directors DIVIDEND Your Directors do not recommend payment RI GLYLGHQG IRU WKH oQDQFLDO \HDU HQGHG December 31.246) (76.183 2014 ` - (21.89. LOANS.  ([FHSW DV GLVFORVHG HOVHZKHUH LQ WKH 5HSRUW WKHUH have been no material changes and commitments PDGH EHWZHHQ WKH HQG RI WKH oQDQFLDO \HDU RI WKH Company and the date of this Report.XPDU Prusty as an Additional Director of the Company with HIIHFWIURP0D\0U3UXVW\KROGVRIoFHXSWR WKHGDWHRIWKH$QQXDO*HQHUDO0HHWLQJ$FFRUGLQJO\ his candidature for appointment as a Director has been included in the Notice convening the Annual *HQHUDO0HHWLQJRIWKH&RPSDQ\  7KH %RDUG RI 'LUHFWRUV KDV DSSRLQWHG 0U 1DYHHQ Chadha as an Additional Director of the Company ZLWKHIIHFWIURP2FWREHU0U&KDGKDKROGV RIoFHXSWRWKHGDWHRIWKH$QQXDO*HQHUDO0HHWLQJ Accordingly. 9.500) 3. There are no material related party transactions.31st December) as its oQDQFLDO\HDU MATERIAL CHANGES AND COMMITMENTS OR  CONTINUANCE OF THE EXISTING FINANCIAL YEAR 5. 2013 and Rules framed thereunder. 2015. his candidature for appointment as a Pursuant to a favourable Order from the Company /DZ %RDUG WKH &RPSDQ\ ZLOO FRQWLQXH WR KDYH WKH calendar year (1st January . Accordingly.01.94.87.89. The period for which the consent was JLYHQ WR RSHUDWH WKH &RPSDQ\ V PLQHV KDV H[SLUHG and the Company has applied for renewal of consent to operate the mines from the Rajasthan State 3ROOXWLRQ&RQWURO%RDUG OF 301 . 4.500) (22.DIWHU7D[ %DODQFH EURXJKW IRUZDUG from previous year %DODQFH FDUULHG IRUZDUG WR%DODQFH6KHHW 2. there is no requirement to furnish any information in Form AOC2.

that such accounting policies as mentioned in 1RWHRIWKH1RWHVWRWKHoQDQFLDOVWDWHPHQWV have been selected and applied consistently and judgments and estimates have been made that are reasonable and prudent so as to give a true and fair view of the state of affairs of iii. 2015.6$L\DU &R&KDUWHUHG$FFRXQWDQWV . that SURSHU DQG VXIoFLHQW FDUH KDV EHHQ WDNHQ for the maintenance of adequate accounting records in accordance with the provisions of the Companies Act. LY WKDWWKHDQQXDOoQDQFLDOVWDWHPHQWVKDYHEHHQ prepared on a going concern basis. 2015 and of the loss of the Company for the year ended on that date. Accordingly his appointment has been included in the Notice FRQYHQLQJ WKH $QQXDO *HQHUDO 0HHWLQJ RI the Company. your Directors make the following statements in terms of Section 134(3)(c) of the Companies Act. The Company is not required to constitute an Audit Committee. 2015. 2013: 302 L WKDW LQ WKH SUHSDUDWLRQ RI WKH DQQXDO oQDQFLDO statements for the year ended December 31. if made.6$L\DU &R&KDUWHUHG$FFRXQWDQWVDV$XGLWRUVRI . Directors retiring by rotation In accordance with the provisions of the Companies $FW  0U 6 9LVZDQDWKDQ UHWLUHV E\ URWDWLRQ and being eligible offers himself for appointment as a Director of the Company. Your 'LUHFWRUVUHFRPPHQGWKHUHDSSRLQWPHQWRI0HVVUV . 7KH %RDUGKDVSODFHGRQUHFRUGLWVDSSUHFLDWLRQIRU WKHYDOXDEOHFRQWULEXWLRQPDGHE\0U8PHVK3UDWDS 0U5DMLY3UDVDGDQG0U0DGKDY*'DPOHGXULQJWKHLU tenures as Directors of the Company. MEETINGS The Company held a minimum of one board meeting in every quarter. DIRECTORS’ RESPONSIBILITY STATEMENT To the best of their knowledge and belief and DFFRUGLQJ WR WKH LQIRUPDWLRQ DQG H[SODQDWLRQV obtained by them.6$L\DU &RIRUDWHUPRI oYHoQDQFLDO\HDUVLHXSWRWKHoQDQFLDO\HDUHQGLQJ December 31. 0HPEHUV RI WKH &RPSDQ\ DW WKH &RPSDQ\ V WK $QQXDO *HQHUDO 0HHWLQJ KDG DSSURYHG  WKH DSSRLQWPHQWRI0HVVUV. the appointment RI WKH $XGLWRU  LV UHTXLUHG WR EH UDWLoHG  E\ WKH 0HPEHUVHDFK\HDUDWWKH$QQXDO*HQHUDO0HHWLQJ Accordingly. Nomination & Remuneration Committee or Corporate Social Responsibility Committee. ceased to be a Director of the Company with effect from April 08. requisite resolution forms part of the 1RWLFHRIWKH$QQXDO*HQHUDO0HHWLQJ7KH&RPSDQ\ KDVREWDLQHGZULWWHQFRQoUPDWLRQIURP0HVVUV. 2013. 10. 2015 and October 16. As required under the provision of the Companies Act. AUDITORS 0HVVUV. 2015. v. ceased to be a Director of the Company with effect from September 04.NATIONAL LIMESTONE COMPANY PRIVATE LIMITED (NLCPL) the Company as at December 31. the applicable accounting standards have EHHQ IROORZHG DORQJ ZLWK SURSHU H[SODQDWLRQ relating to material departures. that systems to ensure compliance with the provisions of all applicable laws were in place and were adequate and operating effectively.6 Aiyar & Co that their appointment. Director has been included in the Notice convening WKH$QQXDO*HQHUDO0HHWLQJRIWKH&RPSDQ\ Cessation of Directorship  0U8PHVK3UDWDSZKRZDVDSSRLQWHGDVD'LUHFWRU of the Company with effect from April 13. 2012. 12. During the year ended December   VL[ PHHWLQJV ZHUH KHOG RQ -DQXDU\   $SULO   0D\   -XO\   September 04. ii.&$. 11. 2013. would be in conformity with the Companies Act. Firm Registration No 100186W) who are the Statutory $XGLWRUV RI WKH &RPSDQ\ KROG RIoFH XQWLO WKH FRQFOXVLRQ RI WKH HQVXLQJ $QQXDO *HQHUDO 0HHWLQJ of the Company and are eligible for re-appointment. ceased to be a Director of the Company with effect IURP0D\   0U0DGKDY*'DPOHZKRZDVDSSRLQWHGDVD'LUHFWRU of the Company with effect from February 01. 2015. if any. 2013. 2019. 2013 for safeguarding the assets of the Company and for preventing and detecting fraud and other irregularities.  0U5DMLY3UDVDGZKRZDVDSSRLQWHGDVD'LUHFWRURI the Company with effect from February 01. 2013.

ACKNOWLEDGEMENT  7KH ([WUDFW RI $QQXDO 5HWXUQ SXUVXDQW WR Section 92(3) of the Companies Act.Corporate Overview Financial Highlights Board & Management Reports the Company for the year 2016. ANNUAL RETURN  Financial Statements 16. 13. 2013 read with 7KH &RPSDQLHV 0DQDJHPHQW DQG $GPLQLVWUDWLRQ.

 5XOHVLQWKHSUHVFULEHG)RUP0*7LVHQFORVHG DQGPDUNHGDVk$QQH[XUH$y <RXU'LUHFWRUVWDNHWKLVRSSRUWXQLW\WRH[SUHVVWKHLU appreciation of co-operation received from the *RYHUQPHQW $XWKRULWLHV DQG &RPSDQ\ V %DQNHUV Your Directors also acknowledge the unstinted DVVLVWDQFH DQG VXSSRUW UHFHLYHG IURP $&& /LPLWHG the Holding Company.DELU0DUJ %DQL3DUN Jaipur 302 106 Rajasthan 303 . the information on conservation of energy. PARTICULARS OF EMPLOYEES There are no employees on the rolls of the Company. 14. Subsidiary Companies )RUDQGRQEHKDOIRIWKH%RDUG     1DYHHQ&KDGKD Director DIN:00191181 69LVZDQDWKDQ Director DIN:02787215 0XPEDL January 27. 2016 5HJLVWHUHG2IoFH *&. 15. PARTICULARS OF CONSERVATION OF ENERGY. TECHNOLOGY ABSORPTION AND FOREIGN EXCHANGE EARNINGS & OUTGO As no business activity was carried out. technology DEVRUSWLRQDQGIRUHLJQH[FKDQJHHDUQLQJV RXWJR during the year is Nil. 2014. Hence there is no disclosure under Section 197 (12) read with Rules 5(1) and 5(2) of The Companies $SSRLQWPHQW DQG 5HPXQHUDWLRQ RI 0DQDJHULDO Personnel) Rules.

2015 [Pursuant to Section 92(3) of the Companies Act.999 - 199998 199998 99. chalk and shale 1.NATIONAL LIMESTONE COMPANY PRIVATE LIMITED (NLCPL) ANNEXURE ‘A’ TO BOARD’S REPORT FORM No. 2015) Demat Physical Total % of Total Shares .001 0 - - - - - - - - - - - - - 199998 199998 99. 2014] I.wise Shareholding Category of Shareholders No. 1981 1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG .9 EXTRACT OF ANNUAL RETURN as on December 31./ III. MGT. of Shares held at the end of the year (December 31.999 0 - - - - - - - - - - - - - - - - - - 200000 200000 100 - 200000 200000 100 0 Promoters (including Promoter Group) (1) Indian a) e) f) Directors Sub-Total (A)(1) 304 . Principal Business Activities of the Company All the Business Activities contributing 10% or more of the total turnover of the Company shall be stated: Name and Description of the main NIC Code of the % to total turnover of the Company Product / Services Product / Service 14107 0LQLQJ  TXDUU\LQJ RI OLPHVWRQH OLPHVKHOO kankar and other calcareous minerals including calcite. No: 0141-2200608 No Not Applicable :KHWKHU/LVWHG&RPSDQ\ Name.QGLDQ1RQ*RYHUQPHQW/LPLWHGE\VKDUHV3ULYDWH&RPSDQ\ *&. Address and contact details of Registrar and Transfer Agent. Particulars of Holding.DELU0DUJ%DQL3DUN-DLSXU5DMDVWKDQ Tel. if any II.DUYH5RDG0XPEDL 100% 2(46) IV. - - - c) State Govt.QGLYLGXDOV+8) - 2 2 b) Central Govt. 2013 and Rule 12(1) of the Companies (Management and Administration) Rules.(s) - - d) %RGLHV&RUSRUDWH - %DQNV)O - Any Other (specify) A. of Shares held at the beginning of the year (January 1. Subsidiary and Associate Companies Name and address of the Company CIN / GLN $&&/LPLWHG Holding / % of Applicable Subsidiary / Shares Section Associate held Holding /0+3/& &HPHQW+RXVH0DKDUVKL.001 - 2 2 0. Registration and other details CIN Registration Date Name of the Company &DWHJRU\6XE&DWHJRU\RIWKH&RPSDQ\ $GGUHVVRIWKH5HJLVWHUHG2IoFHDQGFRQWDFWGHWDLOV 85-37& April 23. No. Shareholding Pattern (Equity Share Capital Breakup as percentage of Total Equity) i) Category . 2015) % Change % of Total during the year Shares Demat Physical Total 0.

d) State Govt. Shares held by Custodian for GDRs & ADRs Grand Total (A)+(B)+(C) No.Individuals b) Other .Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies IV.wise Shareholding Category of Shareholders (2) Foreign a) NRIs . Shareholding Pattern (Equity Share Capital Breakup as percentage of Total Equity) i) Category . of Shares held at the end of the year (December 31. of Shares held at the beginning of the year (January 1. c) Central Govt. Public Shareholding (1) Institutions a) 0XWXDO)XQGV b) %DQNV).(s) e) 9HQWXUH&DSLWDO)XQGV f) Insurance Companies g) FIIs h) )RUHLJQ9HQWXUH Capital Funds i) Any Other (specify) Sub-Total (B)(1) (2) Non-Institutions a) Bodies Corporate i) Indian ii) Overseas b) Individuals i) Individual Shareholders holding nominal share capital upto ` 1 lakh ii) Individual Shareholders holding nominal share FDSLWDOLQH[FHVVRI ` 1 lakh c) Any Other (specify) Sub-Total (B)(2) Total Public Shareholding (B)=(B)(1)+ (B)(2) C.Individuals c) %RGLHV&RUSRUDWH d) %DQNV)O e) Any Other (specify) Sub-Total (A)(2) Total Shareholding of Promoters & Promoter Group (A)=(A)(1)+(A)(2) B. 2015) % Change % of Total during the year Shares Demat Physical Total % of Total Shares Demat Physical Total - 200000 200000 100 - 200000 200000 100 0 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 200000 200000 100 - 200000 200000 100 0 305 . 2015) No.

306 .999 0 0 1 $&&/LPLWHG 2 0U 6XQLO 1D\DN MRLQWO\ ZLWK$&&/LPLWHG 01 0.999 0 199998 99.0005 0 0 200000 100 0 200000 100 0 0 Total iii) Change in Promoters’ (including Promoter Group) Shareholding (please specify.0005 0 01 0. of Shares 0U-D\DQWD'DWWD*XSWDMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 01 0. of Shares % of total shares of the Company 199998 99. 2015: Not Applicable. of Shares 199998 99.NATIONAL LIMESTONE COMPANY PRIVATE LIMITED (NLCPL) ii) Shareholding of Promoters (including Promoter Group) Sr. 2015) Shareholding at the end of the year (December 31. Promoters and Holders of GDRs and ADRs) as on December 31. 2015) % of total % of Shares shares of the pledged / Company encumbered to total shares % change in shareholding during the year No.999 01 0.0005 No change At the end of the year 0U6XQLO1D\DNMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 01 0. 31. 1 Shareholding at the beginning of the year (January 1. 2015 to Dec. if there is no change) Sr. 2015) 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH 199998 99. Shareholding at the beginning of the year (January 1.999 Cumulative Shareholding during the year (Jan.0005 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH At the end of the year No change iv) Shareholding Pattern of top ten Shareholders (Other than Directors. of Shares % of total shares of the Company % of Shares pledged / encumbered to total shares No. Shareholder’s Name No. v) Shareholding of Directors and Key Managerial Personnel: Not Applicable.0005 0 0 3 0U -D\DQWD 'DWWD*XSWD MRLQWO\ZLWK$&&/LPLWHG 01 0. 1.0005 0 01 0.0005 01 0.0005 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH No change At the end of the year 3 % of total shares of the Company $&&/LPLWHG At the beginning of the year 2 No. 2015) No. Particulars No.

328.69.450.33.236.34.236.328.31.09.09.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies V.00 Net Change - - - - i) Principal Amount - 40.00 - 2.00 - 2.09. Remuneration to Managing Director.09.33.QGHEWHGQHVVGXULQJWKHoQDQFLDO\HDU .01.564. Whole-time Directors and/or Manager: Not Applicable B.34.564.00 Addition - - - - Reduction - 1.564. Indebtedness .00 Total (i+ii+iii) - - - - . Remuneration of Directors and Key Managerial Personnel: A.QGHEWHGQHVVDWWKHEHJLQQLQJRIWKHoQDQFLDO\HDU &KDQJHLQ.00 ii) Interest due but not paid - - - - iii) Interest accrued but not due - - - - Total (i+ii+iii) - 2.QGHEWHGQHVVRIWKH&RPSDQ\LQFOXGLQJLQWHUHVWRXWVWDQGLQJDFFUXHGEXWQRWGXHIRUSD\PHQW Secured Loans excluding deposits ` Unsecured Loans ` Deposits ` Total indebtedness ` i) Principal Amount - 2. Remuneration to Key Managerial Personnel other than MD/Manager/WTD: Not Applicable VII.31.450.00 - 1.34.00 ii) Interest due but not paid - - - - iii) Interest accrued but not due - 3. 2016 307 . Remuneration to Other Directors: Not Applicable C.01.34.00 - 40.564.QGHEWHGQHVVDWWKHHQGRIWKHoQDQFLDO\HDU VI.69. Penalties / Punishment / Compounding of Offences: 7KHUHZHUHQRSHQDOWLHVSXQLVKPHQWVFRPSRXQGLQJRIRIIHQFHVIRUWKH\HDUHQGHG'HFHPEHU )RUDQGRQEHKDOIRIWKH%RDUG              1DYHHQ&KDGKD 69LVZDQDWKDQ Director Director 0XPEDL January 27.00 - 3.

NATIONAL LIMESTONE COMPANY PRIVATE LIMITED (NLCPL) INDEPENDENT AUDITOR’S REPORT To the Members of National Limestone Company Private Limited Report on the Financial Statements :HFRQGXFWHGRXUDXGLWLQDFFRUGDQFHZLWKWKH6WDQGDUGV RQ $XGLWLQJ VSHFLoHG XQGHU 6HFWLRQ  .

 RI WKH $FW 7KRVH 6WDQGDUGV UHTXLUH WKDW ZH FRPSO\ ZLWK HWKLFDO UHTXLUHPHQWV DQG SODQ DQG SHUIRUP WKH DXGLW WR REWDLQ UHDVRQDEOH DVVXUDQFH DERXW ZKHWKHU WKH oQDQFLDO VWDWHPHQWVDUHIUHHIURPPDWHULDOPLVVWDWHPHQW :HKDYHDXGLWHGWKHDFFRPSDQ\LQJoQDQFLDOVWDWHPHQWV RI 1DWLRQDO /LPHVWRQH &RPSDQ\ 3ULYDWH /LPLWHG CWKH &RPSDQ\ .

 ZKLFK FRPSULVH WKH %DODQFH 6KHHW DV DW 'HFHPEHU   WKH 6WDWHPHQW RI 3URoW DQG /RVV WKH&DVK)ORZ6WDWHPHQWIRUWKH\HDUWKHQHQGHGDQGD VXPPDU\RIWKHVLJQLoFDQWDFFRXQWLQJSROLFLHVDQGRWKHU $QDXGLWLQYROYHVSHUIRUPLQJSURFHGXUHVWRREWDLQDXGLW H[SODQDWRU\LQIRUPDWLRQ HYLGHQFH DERXW WKH DPRXQWV DQG WKH GLVFORVXUHV LQ WKH oQDQFLDO VWDWHPHQWV 7KH SURFHGXUHV VHOHFWHG GHSHQG Management’s Responsibility for the Financial Statements RQ WKH DXGLWRU V MXGJPHQW LQFOXGLQJ WKH DVVHVVPHQW 7KH &RPSDQ\ V %RDUG RI 'LUHFWRUV LV UHVSRQVLEOH IRU WKH RI WKH ULVNV RI PDWHULDO PLVVWDWHPHQW RI WKH oQDQFLDO PDWWHUV VWDWHG LQ 6HFWLRQ  .

Q PDNLQJ  CWKH $FW . RI WKH &RPSDQLHV $FW VWDWHPHQWV ZKHWKHU GXH WR IUDXG RU HUURU .

 ZLWK UHVSHFW WR WKH SUHSDUDWLRQ RI WKHVH WKRVH ULVN DVVHVVPHQWV WKH DXGLWRU FRQVLGHUV LQWHUQDO oQDQFLDOVWDWHPHQWVWKDWJLYHDWUXHDQGIDLUYLHZRIWKH oQDQFLDOFRQWUROUHOHYDQWWRWKH&RPSDQ\ VSUHSDUDWLRQRI oQDQFLDOSRVLWLRQoQDQFLDOSHUIRUPDQFHDQGFDVKpRZVRI WKHoQDQFLDOVWDWHPHQWVWKDWJLYHDWUXHDQGIDLUYLHZLQ WKH&RPSDQ\LQDFFRUGDQFHZLWKWKHDFFRXQWLQJSULQFLSOHV RUGHU WR GHVLJQ DXGLW SURFHGXUHV WKDW DUH DSSURSULDWH LQ JHQHUDOO\ DFFHSWHG LQ .QGLD LQFOXGLQJ WKH $FFRXQWLQJ WKHFLUFXPVWDQFHVEXWQRWIRUWKHSXUSRVHRIH[SUHVVLQJ 6WDQGDUGV VSHFLoHG XQGHU 6HFWLRQ  RI WKH $FW UHDG DQ RSLQLRQ RQ ZKHWKHU WKH &RPSDQ\ KDV LQ SODFH DQ ZLWK5XOHRIWKH&RPSDQLHV $FFRXQWV.

QGLDRIWKHVWDWHRIDIIDLUVRIWKH&RPSDQ\ :HKDYHWDNHQLQWRDFFRXQWWKHSURYLVLRQVRIWKH$FWWKH DVDW'HFHPEHUDQGLWVORVVDQGLWVFDVKpRZVIRU DFFRXQWLQJ DQG DXGLWLQJ VWDQGDUGV DQG PDWWHUV ZKLFK WKH\HDUHQGHGRQWKDWGDWH DUHUHTXLUHGWREHLQFOXGHGLQWKHDXGLWUHSRUWXQGHUWKH SURYLVLRQVRIWKH$FWDQGWKH5XOHVPDGHWKHUHXQGHU 308 .Q RXU RSLQLRQ DQG WR WKH EHVW RI RXU LQIRUPDWLRQ DQG DFFRUGLQJ WR WKH H[SODQDWLRQV JLYHQ WR XV WKH DIRUHVDLG Auditor’s Responsibility oQDQFLDOVWDWHPHQWVJLYHWKHLQIRUPDWLRQUHTXLUHGE\WKH 2XU UHVSRQVLELOLW\ LV WR H[SUHVV DQ RSLQLRQ RQ WKHVH $FWLQWKHPDQQHUVRUHTXLUHGDQGJLYHDWUXHDQGIDLUYLHZ oQDQFLDOVWDWHPHQWVEDVHGRQRXUDXGLW LQ FRQIRUPLW\ ZLWK WKH DFFRXQWLQJ SULQFLSOHV JHQHUDOO\ DFFHSWHGLQ.5XOHV7KLV DGHTXDWHLQWHUQDOoQDQFLDOFRQWUROVV\VWHPRYHUoQDQFLDO UHVSRQVLELOLW\ DOVR LQFOXGHV PDLQWHQDQFH RI DGHTXDWH UHSRUWLQJDQGWKHRSHUDWLQJHIIHFWLYHQHVVRIVXFKFRQWUROV DFFRXQWLQJ UHFRUGV LQ DFFRUGDQFH ZLWK WKH SURYLVLRQV RI $QDXGLWDOVRLQFOXGHVHYDOXDWLQJWKHDSSURSULDWHQHVVRI WKH$FWIRUVDIHJXDUGLQJWKHDVVHWVRIWKH&RPSDQ\DQGIRU WKH DFFRXQWLQJ SROLFLHV XVHG DQG WKH UHDVRQDEOHQHVV SUHYHQWLQJDQGGHWHFWLQJIUDXGVDQGRWKHULUUHJXODULWLHV RI WKH DFFRXQWLQJ HVWLPDWHV PDGH E\ WKH &RPSDQ\ V VHOHFWLRQ DQG DSSOLFDWLRQ RI DSSURSULDWH DFFRXQWLQJ 'LUHFWRUVDVZHOODVHYDOXDWLQJWKHRYHUDOOSUHVHQWDWLRQRI SROLFLHV PDNLQJ MXGJPHQWV DQG HVWLPDWHV WKDW DUH WKHoQDQFLDOVWDWHPHQWV UHDVRQDEOHDQGSUXGHQWDQGGHVLJQLPSOHPHQWDWLRQDQG PDLQWHQDQFHRIDGHTXDWHLQWHUQDOoQDQFLDOFRQWUROVWKDW :H EHOLHYH WKDW WKH DXGLW HYLGHQFH ZH KDYH REWDLQHG LV ZHUHRSHUDWLQJHIIHFWLYHO\IRUHQVXULQJWKHDFFXUDF\DQG VXIoFLHQWDQGDSSURSULDWHWRSURYLGHDEDVLVIRURXUDXGLW FRPSOHWHQHVV RI WKH DFFRXQWLQJ UHFRUGV UHOHYDQW WR WKH RSLQLRQRQWKHoQDQFLDOVWDWHPHQWV SUHSDUDWLRQDQGSUHVHQWDWLRQRIWKHoQDQFLDOVWDWHPHQWV WKDWJLYHDWUXHDQGIDLUYLHZDQGDUHIUHHIURPPDWHULDO Opinion PLVVWDWHPHQWZKHWKHUGXHWRIUDXGRUHUURU .

Corporate Overview Financial Highlights Board & Management Reports Report on Other Legal and Regulatory Requirements Financial Statements Subsidiary Companies H.

 2Q WKH EDVLV RI WKH ZULWWHQ UHSUHVHQWDWLRQV UHFHLYHGIURPWKHGLUHFWRUVDVRQ'HFHPEHU WDNHQRQUHFRUGE\WKH%RDUGRI'LUHFWRUV QRQH RI WKH GLUHFWRUV LV GLVTXDOLoHG DV RQ 'HFHPEHU   IURP EHLQJ DSSRLQWHG DV D GLUHFWRULQWHUPVRI6HFWLRQ .

RIWKH$FW  $V UHTXLUHG E\ WKH &RPSDQLHV $XGLWRU V 5HSRUW.

 2UGHU  CWKH 2UGHU .

QGLD q 0LQLVWU\ RI &RUSRUDWH $IIDLUV LQ WHUPV RI VXEVHFWLRQ . LVVXHG E\ WKH *RYHUQPHQW RI .

RIVHFWLRQRIWKH$FWZHHQFORVH LQWKHDQQH[XUHDVWDWHPHQWRQWKHPDWWHUVVSHFLoHG LQSDUDJUDSKVDQGRIWKHVDLG2UGHU I.

 :LWKUHVSHFWWRWKHRWKHUPDWWHUVWREHLQFOXGHG LQ WKH $XGLWRU V 5HSRUW LQ DFFRUGDQFH ZLWK 5XOH RIWKH&RPSDQLHV $XGLWDQG$XGLWRUV.

5XOHV  LQ RXU RSLQLRQ DQG WR WKH EHVW RI RXU LQIRUPDWLRQ DQG DFFRUGLQJ WR WKH H[SODQDWLRQV JLYHQWRXV  $V UHTXLUHG E\ 6HFWLRQ  .

 RI WKH $FW ZH UHSRUW that: D.

 :HKDYHVRXJKWDQGREWDLQHGDOOWKHLQIRUPDWLRQ DQG H[SODQDWLRQV ZKLFK WR WKH EHVW RI RXU NQRZOHGJH DQG EHOLHI ZHUH QHFHVVDU\ IRU WKH SXUSRVHVRIRXUDXGLW E.

 .Q RXU RSLQLRQ SURSHU ERRNV RI DFFRXQW DV UHTXLUHGE\ODZKDYHEHHQNHSWE\WKH&RPSDQ\ VR IDU DV LW DSSHDUV IURP RXU H[DPLQDWLRQ RI WKRVHERRNV F.

 7KH %DODQFH 6KHHW WKH 6WDWHPHQW RI 3URoW DQG /RVVDQGWKH&DVK)ORZ6WDWHPHQWGHDOWZLWKE\ WKLV 5HSRUW DUH LQ DJUHHPHQW ZLWK WKH ERRNV RI DFFRXQW L 7KH &RPSDQ\ KDV GLVFORVHG WKH LPSDFW RI SHQGLQJOLWLJDWLRQVRQLWVoQDQFLDOSRVLWLRQLQLWV oQDQFLDO VWDWHPHQWV q 5HIHU QRWHV  WR  WR WKHoQDQFLDOVWDWHPHQWV LL WKH &RPSDQ\ GLG QRW KDYH DQ\ ORQJWHUP FRQWUDFWV LQFOXGLQJ GHULYDWLYH FRQWUDFWV IRU ZKLFK WKHUH ZHUH DQ\ PDWHULDO IRUHVHHDEOH ORVVHV LLL WKHUH ZHUH QR DPRXQWV ZKLFK ZHUH UHTXLUHG WREHWUDQVIHUUHG WRWKH.QYHVWRU (GXFDWLRQ DQG 3URWHFWLRQ)XQGE\WKH&RPSDQ\ G.

QRXURSLQLRQWKHDIRUHVDLGoQDQFLDOVWDWHPHQWV FRPSO\ZLWKWKH$FFRXQWLQJ6WDQGDUGVVSHFLoHG XQGHU6HFWLRQRIWKH$FWUHDGZLWK5XOHRI WKH&RPSDQLHV $FFRXQWV. .

Negandhi Partner 0HPEHUVKLS1R 309 .&$. Aiyar & Co.)LUP5HJLVWUDWLRQ1R: Place: 0XPEDL Date:-DQXDU\ Sachin A. Chartered Accountants .5XOHV  For K. S.

NATIONAL LIMESTONE COMPANY PRIVATE LIMITED (NLCPL) ANNEXURE TO THE AUDITOR’S REPORT 5HIHUUHGWRLQSDUDJUDSKXQGHUWKHKHDGLQJC5HSRUWRQ 2WKHU/HJDODQG5HJXODWRU\5HTXLUHPHQWV RIRXU5HSRUWRI HYHQGDWHRQWKHoQDQFLDOVWDWHPHQWVIRUWKH\HDUHQGHG RQ 'HFHPEHU   RI 1DWLRQDO /LPHVWRQH &RPSDQ\ 3ULYDWH/LPLWHG.

L.

 D.

 7KH &RPSDQ\ KDV PDLQWDLQHG SURSHU UHFRUGV Y.

 VKRZLQJ IXOO SDUWLFXODUV LQFOXGLQJ TXDQWLWDWLYH GHWDLOVDQGVLWXDWLRQRIo[HGDVVHWV RI WKH &RPSDQ\ DQG WKH QDWXUH RI LWV EXVLQHVV IRU WKHSXUFKDVHVRILQYHQWRU\DQGo[HGDVVHWVDQGIRU WKHVDOHRIJRRGVDQGVHUYLFHV'XULQJWKHFRXUVHRI RXU DXGLW QR PDMRU ZHDNQHVV KDV EHHQ QRWLFHG LQ WKHLQWHUQDOFRQWUROV\VWHPLQUHVSHFWRIWKHVHDUHDV 7KH &RPSDQ\ KDV QRW DFFHSWHG DQ\ GHSRVLWV IURP WKHSXEOLFWRZKLFKWKHSURYLVLRQVRIVHFWLRQRU DQ\RWKHUUHOHYDQWSURYLVLRQVRIWKH&RPSDQLHV$FW  DQG WKH &RPSDQLHV $FFHSWDQFH RI 'HSRVLW.

 5XOHVDSSO\ E.

 7KH o[HG DVVHWV DUH SK\VLFDOO\ YHULoHG E\ WKH PDQDJHPHQWGXULQJWKH\HDUDQGLQRXURSLQLRQ WKH IUHTXHQF\ RI YHULoFDWLRQ LV UHDVRQDEOH YL.

 :H KDYH EHHQ LQIRUPHG WKDW WKH &RPSDQ\ LV QRW UHTXLUHGWRPDLQWDLQFRVWUHFRUGVXQGHUVXEVHFWLRQ KDYLQJUHJDUGWRWKHVL]HRIWKH&RPSDQ\DQGWKH .

RIVHFWLRQRIWKH&RPSDQLHV$FWZKLFK QDWXUH RI LWV DVVHWV 1R PDWHULDO GLVFUHSDQFLHV KDVEHHQUHOLHGXSRQ ZHUHQRWLFHGRQVXFKSK\VLFDOYHULoFDWLRQ LL.

   D.

 7KH LQYHQWRULHV KDYH EHHQ SK\VLFDOO\ YHULoHG YLL.

 D.

QVXUDQFH .Q GHSRVLWLQJ 3URYLGHQW )XQG (PSOR\HHV  6WDWH RXU RSLQLRQ WKH IUHTXHQF\ RI YHULoFDWLRQ LV . $FFRUGLQJ WR WKH UHFRUGV RI WKH &RPSDQ\ WKH &RPSDQ\ KDV EHHQ JHQHUDOO\ UHJXODU LQ GXULQJ WKH \HDU E\ WKH PDQDJHPHQW .QFRPH WD[ 6DOHV WD[ 9DOXH $GGHG UHDVRQDEOH WD[:HDOWKWD[6HUYLFHWD[&XVWRPGXW\([FLVH E.

 7KH SURFHGXUHV RI SK\VLFDO YHULoFDWLRQ RI GXW\ FHVV DQG RWKHU PDWHULDO VWDWXWRU\ GXHV LQYHQWRULHV IROORZHG E\ WKH PDQDJHPHQW DUH DSSOLFDEOHWRLWZLWKWKHDSSURSULDWHDXWKRULWLHV UHDVRQDEOHDQGDGHTXDWHLQUHODWLRQWRWKHVL]H   $FFRUGLQJWRWKHLQIRUPDWLRQDQGH[SODQDWLRQV RIWKH&RPSDQ\DQGWKHQDWXUHRILWVEXVLQHVV JLYHQ WR XV WKHUH DUH QR XQGLVSXWHG GXHV LQ F.

 .QRXURSLQLRQDQGDFFRUGLQJWRWKHLQIRUPDWLRQ UHVSHFW RI SURYLGHQW IXQG LQYHVWRU HGXFDWLRQ DQG H[SODQDWLRQV JLYHQ WR XV WKH &RPSDQ\ LV DQGSURWHFWLRQIXQGHPSOR\HHV VWDWHLQVXUDQFH PDLQWDLQLQJ SURSHU UHFRUGV RI LQYHQWRU\ 7KH LQFRPHWD[ ZHDOWKWD[ VHUYLFH WD[ VDOHV GLVFUHSDQFLHV QRWLFHG RQ YHULoFDWLRQ EHWZHHQ WD[ FXVWRPV GXW\ H[FLVH GXW\ FHVV DQG RWKHU WKH SK\VLFDO VWRFNV DQG WKH ERRN UHFRUGV ZHUH VWDWXWRU\ GXHV ZKLFK ZHUH RXWVWDQGLQJ DW WKH QRWPDWHULDODQGKDYHEHHQSURSHUO\GHDOWZLWK \HDUHQGIRUDSHULRGRIPRUHWKDQVL[PRQWKV LQWKHERRNVRIDFFRXQWV IURPWKHGDWHWKH\EHFDPHSD\DEOH LLL.

 $V LQIRUPHG WKH &RPSDQ\ KDV QRW JUDQWHG DQ\  ORDQV VHFXUHG RU XQVHFXUHG WR FRPSDQLHV oUPV RURWKHUSDUWLHVFRYHUHGLQWKHUHJLVWHUPDLQWDLQHG XQGHU 6HFWLRQ  RI WKH &RPSDQLHV $FW  $FFRUGLQJO\VXEFODXVH D.

DQG E.

RIWKH2UGHUDUH QRWDSSOLFDEOH  LY.

Q RXU RSLQLRQ DQG DFFRUGLQJ WR WKH LQIRUPDWLRQ DQGH[SODQDWLRQVJLYHQWRXVWKHUHLVDQDGHTXDWH LQWHUQDOFRQWUROV\VWHPFRPPHQVXUDWHZLWKWKHVL]H 310 E. .

QFRPHWD[6DOHVWD[:HDOWKWD[ 6HUYLFHWD[&XVWRPGXW\([FLVHGXW\DQG&HVV ZKLFK KDYH QRW EHHQ GHSRVLWHG RQ DFFRXQW RI DQ\GLVSXWH F. $FFRUGLQJWRWKHUHFRUGVRIWKH&RPSDQ\WKHUH DUHQRGXHVRI.

QYHVWRU (GXFDWLRQ3URWHFWLRQ)XQG . %DVHG RQ RXU H[DPLQDWLRQ RI WKH UHFRUGV PDLQWDLQHGGXULQJWKH\HDUWKH&RPSDQ\LVQRW OLDEOH WR PDNH DQ\ SD\PHQWV WRZDUGV .

Corporate Overview Financial Highlights Board & Management Reports Financial Statements YLLL.

  7KHDFFXPXODWHGORVVHVRIWKH&RPSDQ\H[FHHG [LL.

  oIW\SHUFHQWRILWVQHWZRUWK7KH&RPSDQ\KDV LQFXUUHG FDVK ORVVHV GXULQJ WKH oQDQFLDO \HDU FRYHUHG E\ RXU DXGLW DQG LQ WKH LPPHGLDWHO\ SUHFHGLQJoQDQFLDO\HDU L[.

  $FFRUGLQJWRWKHLQIRUPDWLRQDQGH[SODQDWLRQV JLYHQ WR XV WKH &RPSDQ\ KDV QRW WDNHQ DQ\ PRQH\ IURP DQ\ oQDQFLDO LQVWLWXWLRQ EDQN RU GHEHQWXUHKROGHUDQGKHQFHFODXVH L[.

RIWKH 2UGHULVQRWDSSOLFDEOHWRWKH&RPSDQ\ [.

 $FFRUGLQJWRWKHLQIRUPDWLRQDQGH[SODQDWLRQV JLYHQ WR XV WKH &RPSDQ\ KDV QRW JLYHQ JXDUDQWHHIRUORDQVWDNHQE\RWKHUVIURPEDQN  RUoQDQFLDOLQVWLWXWLRQV  [L.

Negandhi Partner 0HPEHUVKLS1R 311 .  Subsidiary Companies $FFRUGLQJWRWKHLQIRUPDWLRQDQGH[SODQDWLRQV IXUQLVKHG E\ WKH PDQDJHPHQW ZKLFK KDYH EHHQUHOLHGXSRQE\XVWKHUHZHUHQRIUDXGVRQ RU E\ WKH &RPSDQ\ QRWLFHG RU UHSRUWHG GXULQJ WKHFRXUVHRIRXUDXGLW For K.&$. Aiyar & Co.)LUP5HJLVWUDWLRQ1R: 7KH &RPSDQ\ KDV QRW UDLVHG DQ\ WHUP ORDQV Place:0XPEDL GXULQJWKH\HDU Date: -DQXDU\ Sachin A. S. Chartered Accountants .

2015 Note 1R 3DUWLFXODUV As at Dec 31. 2015 STATEMENT OF PROFIT AND LOSS FOR YEAR ENDED DECEMBER 31. HQGHG'HF 2015  3DUWLFXODUV Equity and Liabilities ` 6KDUHKROGHUV )XQGV 6KDUH&DSLWDO  5HVHUYHVDQG6XUSOXV     . 2015 ` $VDW'HF  ` Note For the year )RUWKH\HDU 1R ended Dec 31.NATIONAL LIMESTONE COMPANY PRIVATE LIMITED (NLCPL) BALANCE SHEET AS AT DECEMBER 31.

 .

625   1RQFXUUHQWOLDELOLWLHV /RQJ7HUP%RUURZLQJ  $.05. 1.32.27.45.379 1.

&XUUHQWOLDELOLWLHV 6KRUW7HUP%RUURZLQJ  %.

066 71.69.01.QFUHDVH.33.QFRPH    2.006 1.17.773 3.76.716 Assets 5HYHQXHIURPRSHUDWLRQV    2WKHU. 2WKHUFXUUHQWOLDELOLWLHV  6KRUWWHUPSURYLVLRQV  TOTAL       31.63.79.183 - Total revenue EXPENSES &RVWRIPDWHULDO&RQVXPHG    .

94.&'   Total Expenses 23.429 22.GHFUHDVHLQLQYHQWR ULHVRIoQLVKHGJRRGV    'HSUHFLDWLRQDQGDPRUWL]DWLRQ H[SHQVH    2WKHUH[SHQVHV    .88.QWHUHVWRQ.305  .

 .

   .

 .

1RQFXUUHQWDVVHWV 3URoW /RVV.

EHIRUH7D[ )L[HG$VVHWV 7D[H[SHQVHV  ` 3URoW /RVV.

IRUWKH\HDU 7DQJLEOHDVVHWV   /RQJWHUPORDQVDQGDGYDQFHV    15.56.111 (DUQLQJVSHUHTXLW\VKDUH )DFH YDOXHRI`HDFK.806 15.77.

(PY ` 100 each) 5HIHU1RWH.

%DVLF  .

 .

'LOXWHG  .

 .

)LUP5HJLVWUDWLRQ 1R: Ramnik Gupta Director Rajat Prusty Director SACHIN A.53. &XUUHQWDVVHWV .716 6XPPDU\RIVLJQLoFDQW DFFRXQWLQJSROLFLHV   7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRIoQDQFLDOVWDWHPHQWV 7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRIoQDQFLDOVWDWHPHQWV $VSHURXUUHSRUWRIHYHQ )RUDQGRQEHKDOIRIWKH%RDUGRI1DWLRQDO date /LPH6WRQH&RPSDQ\3ULYDWH/LPLWHG $VSHURXUUHSRUWRIHYHQ )RUDQGRQEHKDOIRIWKH%RDUGRI1DWLRQDO date /LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG  For K. NEGANDHI Partner 0HPEHUVKLS1R 0XPEDL-DQXDU\ 0XPEDL-DQXDU\ 312 Ramnik Gupta Director Rajat Prusty Director .773 3.69.76.S.AIYAR & CO. Chartered Accountants .61.17.&$.)LUP5HJLVWUDWLRQ 1R: For K.&$.01.AIYAR & CO.79.QYHQWRULHV    7UDGHUHFHLYDEOHV    &DVKDQGEDQNEDODQFHV    6KRUWWHUPORDQVDQGDGYDQFHV    2WKHUFXUUHQWDVVHWV  TOTAL 6XPPDU\RIVLJQLoFDQWDFFRXQWLQJ SROLFLHV   1.967 3.S. NEGANDHI Partner 0HPEHUVKLS1R SACHIN A. Chartered Accountants .605 1.61.

Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies CASH FLOW STATEMENT FOR THE YEAR ENDED DECEMBER 31. CASH FLOW FROM OPERATING ACTIVITIES  1HW3URoW /RVV.2015 For the year ended Dec 31 . 2015 ` 3DUWLFXODUV A.

EHIRUHWD[DWLRQ )RUWKH\HDUHQGHG 'HF `  .

 .

  $GMXVWPHQWVIRU 'HSUHFLDWLRQ .QWHUHVW5HFHLYHG 2SHUDWLQJSURoWEHIRUHZRUNLQJFDSLWDOFKDQJHV    .

 .

 .

 0RYHPHQWLQ:RUNLQJ&DSLWDO  'HFUHDVH .QFUHDVH.

QFUHDVH.LQ2WKHU&XUUHQWDVVHWV  'HFUHDVH .

QFUHDVH 'HFUHDVH.LQ/RDQV $GYDQFHV  .

LQ2WKHU/LDELOLWLHV 3URYLVLRQV &DVKJHQHUDWHGIURPRSHUDWLRQV  'LUHFW7D[HVSDLG 1HWRI5HIXQGV.

QWHUHVW5HFHLYHG NET CASH FROM INVESTING ACTIVITIES C. NET CASH USED FROM OPERATING ACTIVITIES B CASH FLOW FROM INVESTING ACTIVITIES  .QWHU&RUSRUDWH'HSRVLWVUHSDLGWR+ROGLQJ&RPSDQ\  3URFHHGVIURPLVVXHRIHTXLW\VKDUHV  . CASH FLOW FROM FINANCING ACTIVITIES  .

 .

   .

 .

   .

 .

     .

   NET CASH FROM FINANCING ACTIVITIES  .

10. 2.47.469 1HWLQFUHDVH GHFUHDVH.

LQFDVK FDVKHTXLYDOHQWV  .

22.AIYAR & CO. 1.&$.92.)LUP5HJLVWUDWLRQ1R: Ramnik Gupta Director Rajat Prusty Director SACHIN A. NEGANDHI Partner 0HPEHUVKLS1R 0XPEDL-DQXDU\ 313 .S.606     &DVK FDVKHTXLYDOHQWVDWWKHEHJLQQLQJRIWKH\HDU &DVK FDVKHTXLYDOHQWVDWWKHHQGRIWKH\HDU 5HIHU1RWH1RIRUGHWDLOVRI&DVK &DVKHTXLYDOHQWV 7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRIoQDQFLDOVWDWHPHQWV $VSHURXUUHSRUWRIHYHQGDWH )RUDQGRQEHKDOIRIWKH%RDUGRI1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG For K. Chartered Accountants .

2015 1.  Corporate Information (.NATIONAL LIMESTONE COMPANY PRIVATE LIMITED (NLCPL) Notes to Financial Statement for the year ended December 31.

.QGLD DQG LQFRUSRUDWHG XQGHU WKH SURYLVLRQ RI &RPSDQLHV $FW  7KH &RPSDQ\LVHQJDJHGLQWKHH[WUDFWLRQRIOLPHVWRQH  $OODVVHWVDUHGHSUHFLDWHGRQWKHVWUDLJKWOLQHPHWKRGDWWKH UDWHVSUHVFULEHGLQ6FKHGXOH. 3DUW&. 'HSUHFLDWLon 1DWLRQDO /LPHVWRQH &RPSDQ\ 3ULYDWH /LPLWHG LV ZKROO\ RZQHG VXEVLGLDU\ RI $&& /LPLWHG &RPSDQ\ GRPLFLOHG LQ .

RIWKH&RPSDQLHV$FW RQDSURUDWDEDVLV ).

QDVVHVVLQJWKHYDOXHLQXVHWKHHVWLPDWHGIXWXUHFDVK pRZV DUH GLVFRXQWHG WR WKHLU 3UHVHQW YDOXH XVLQJ D SUHWD[ GLVFRXQWUDWHWKDWUHpHFWVFXUUHQWPDUNHWDVVHVVPHQWVRIWKH WLPHYDOXHRIPRQH\DQGULVNVVSHFLoFWRWKHDVVHW3UHYLRXVO\ UHFRJQL]HG LPSDLUPHQW ORVV LV IXUWKHU SURYLGHG RU UHYHUVHG GHSHQGLQJRQFKDQJHVLQFLUFXPVWDQFHV 6LJQLoFDQWDFFRXQWLQJSROLFLHV $. .PSDLUPHQW  7KHFDUU\LQJDPRXQWVRIDVVHWVDUHUHYLHZHGDWHDFK%DODQFH 6KHHW GDWH LI WKHUH LV DQ\ LQGLFDWLRQ RI LPSDLUPHQW EDVHG RQ LQWHUQDO  H[WHUQDO IDFWRUV $Q LPSDLUPHQW ORVV ZLOO EH UHFRJQL]HG ZKHUHYHU WKH FDUU\LQJ DPRXQW RI DQ DVVHW H[FHHGV LWV HVWLPDWHG UHFRYHUDEOH DPRXQW 7KH UHFRYHUDEOH DPRXQWLVJUHDWHURIWKHDVVHWVQHWVHOOLQJSULFHDQGYDOXHLQ XVH.

 %DVLVRISUHSDUDWLRQ .

QGLDQ*$$3. 7KHoQDQFLDOVWDWHPHQWVRIWKHFRPSDQ\KDYHEHHQSUHSDUHG LQ DFFRUGDQFH ZLWK WKH JHQHUDOO\ DFFHSWHG DFFRXQWLQJ SULQFLSOHVLQ.QGLD .

7KHFRPSDQ\KDVSUHSDUHG WKHVHoQDQFLDOVWDWHPHQWVWRFRPSO\LQDOOPDWHULDOUHVSHFWV ZLWK WKH DFFRXQWLQJ VWDQGDUGV QRWLoHG XQGHU 6HFWLRQ  RIWKH&RPSDQLHV$FWUHDGWRJHWKHUZLWK5XOHRIWKH &RPSDQLHV $FFRXQWV.

5XOHV7KHoQDQFLDOVWDWHPHQWV KDYH EHHQ SUHSDUHG RQ DQ DFFUXDO EDVLV DQG XQGHU WKH KLVWRULFDOFRVWFRQYHQWLRQ .

 7KH DFFRXQWLQJ SROLFLHV DGRSWHG LQ WKH SUHSDUDWLRQ RI oQDQFLDO VWDWHPHQWV DUH FRQVLVWHQW ZLWK WKRVH RI SUHYLRXV \HDU %.

QGLDQ *$$3 UHTXLUHV WKH PDQDJHPHQW WR PDNH MXGJPHQWV HVWLPDWHV DQG DVVXPSWLRQV WKDW DIIHFW WKH UHSRUWHGDPRXQWVRIDVVHWVDQGOLDELOLWLHVDQGGLVFORVXUHRI FRQWLQJHQWOLDELOLWLHVRQWKHGDWHRIWKHoQDQFLDOVWDWHPHQWV DQGUHSRUWHGDPRXQWVRIUHYHQXHVDQGH[SHQVHVIRUWKH\HDU $OWKRXJK WKHVH HVWLPDWHV DUH EDVHG RQ WKH PDQDJHPHQW V EHVW NQRZOHGJH RI FXUUHQW HYHQWV DQG DFWLRQV XQFHUWDLQW\ DERXW WKHVH DVVXPSWLRQV DQG HVWLPDWHV FRXOG UHVXOW LQ WKH RXWFRPHVGLIIHUHQWIURPWKHHVWLPDWHV &. 8VHRIHVWLPDWHV  7KH SUHSDUDWLRQ RI oQDQFLDO VWDWHPHQWV LQ FRQIRUPLW\ ZLWK .

 5HYHQXHUHFRJQLWLRQ  5HYHQXHLVUHFRJQL]HGWRWKHH[WHQWWKDWLWLVSUREDEOHWKDW WKH HFRQRPLF EHQHoWV ZLOO pRZ WR WKH &RPSDQ\ DQG WKH UHYHQXHFDQEHUHOLDEO\PHDVXUHG L.

 6DOHRIJRRGV  5HYHQXHIURPVDOHVLVUHFRJQL]HGZKHQWKHVLJQLoFDQWULVNV DQGUHZDUGVRIRZQHUVKLSRIWKHJRRGVKDYHSDVVHGWRWKH EX\HU ZKLFK LV JHQHUDOO\ RQ GLVSDWFK RI SURGXFWV DQG LV VWDWHGQHWRIUHWXUQV LL.

QWHUHVW  5HYHQXHLVUHFRJQL]HGRQDWLPHSURSRUWLRQEDVLVWDNLQJLQWR DFFRXQWWKHDPRXQWRXWVWDQGLQJDQGWKHUDWHDSSOLFDEOH '. .

 )L[HGDVVHWV  314 )L[HGDVVHWVDUHVWDWHGDWFRVWRIDFTXLVLWLRQRUFRQVWUXFWLRQ LQFOXGLQJ DWWULEXWDEOH LQWHUHVW DQG oQDQFLDO FRVWV WLOO VXFK DVVHWV DUH UHDG\ IRU LWV LQWHQGHG XVH OHVV DFFXPXODWHG GHSUHFLDWLRQLPSDLUPHQWORVVHVDQGVSHFLoFJUDQWVUHFHLYHG LIDQ\ *.

QYHVWPHQWV  &XUUHQW .QYHVWPHQWV DUH VWDWHG DW ORZHU RI FRVW RU IDLU YDOXH /RQJ WHUP .QYHVWPHQWV DUH VWDWHG DW FRVW 3URYLVLRQ IRUGLPLQXWLRQLQYDOXHLVPDGHRQO\LIGHFOLQHLVRWKHUWKDQ WHPSRUDU\ +. .

QFRPH 7D[ $FW'HIHUUHGWD[HVUHpHFWWKHLPSDFWRIFXUUHQW\HDUWLPLQJ GLIIHUHQFHVEHWZHHQWD[DEOHLQFRPHDQGDFFRXQWLQJLQFRPH IRUWKH\HDUDQGUHYHUVDORIWLPLQJGLIIHUHQFHVRIHDUOLHU\HDUV  'HIHUUHGWD[LVPHDVXUHGEDVHGRQWKHWD[UDWHVDQGWKHWD[ ODZVHQDFWHGRUVXEVWDQWLYHO\HQDFWHGDWWKHEDODQFHVKHHW GDWH 'HIHUUHG WD[ DVVHWV DUH UHFRJQL]HG RQO\ WR WKH H[WHQW WKDW WKHUH LV UHDVRQDEOH FHUWDLQW\ WKDW VXIoFLHQW IXWXUH WD[DEOHLQFRPHZLOOEHDYDLODEOHDJDLQVWZKLFKVXFKGHIHUUHG WD[DVVHWVFDQEHUHDOLVHG.QVLWXDWLRQVZKHUHWKHFRPSDQ\ KDV XQDEVRUEHG GHSUHFLDWLRQ RU FDUU\ IRUZDUG WD[ ORVVHV DOOGHIHUUHGWD[DVVHWVDUHUHFRJQL]HGRQO\LIWKHUHLVYLUWXDO FHUWDLQW\VXSSRUWHGE\FRQYLQFLQJHYLGHQFHWKDWWKH\FDQEH UHDOLVHGDJDLQVWIXWXUHWD[DEOHSURoWV .QGLDQ . .QFRPHWD[HV  7D[H[SHQVHFRPSULVHVRIFXUUHQWDQGGHIHUUHGWD[&XUUHQW 7D[ LV PHDVXUHG DW WKH DPRXQW H[SHFWHG WR EH SDLG WR WKH WD[ DXWKRULWLHV LQ DFFRUGDQFH ZLWK WKH .

 &RQWLQJHQFLHV3URYLVLRQV  $ SURYLVLRQ LV UHFRJQL]HG ZKHQ DQ HQWHUSULVH KDV D SUHVHQW REOLJDWLRQ DV D UHVXOW RI SDVW HYHQW LW LV SUREDEOH WKDW DQ RXWpRZ RI UHVRXUFHV HPERG\LQJ HFRQRPLF EHQHoW ZLOO EH UHTXLUHGWRVHWWOHWKHREOLJDWLRQLQUHVSHFWRIZKLFKDUHOLDEOH HVWLPDWH FDQ EH PDGH 3URYLVLRQV DUH QRW GLVFRXQWHG WR LWV SUHVHQW YDOXH DQG DUH GHWHUPLQHG EDVHG RQ EHVW HVWLPDWH UHTXLUHG WR VHWWOH WKH REOLJDWLRQ DW WKH EDODQFH VKHHW GDWH 7KHVHDUHUHYLHZHGDWHDFKEDODQFHVKHHWGDWHDQGDGMXVWHG WRUHpHFWWKHFXUUHQWEHVWHVWLPDWHV$FRQWLQJHQWOLDELOLW\LV GLVFORVHG XQOHVV WKH SRVVLELOLW\ RI DQ RXWpRZ RI UHVRXUFHV HPERG\LQJWKHHFRQRPLFEHQHoWLVUHPRWH .

2015 -.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies Notes to Financial Statement for the year ended December 31.

 (DUQLQJVSHUVKDUH  %DVLF HDUQLQJV SHU VKDUH DUH FDOFXODWHG E\ GLYLGLQJ WKH QHW SURoW RU ORVV IRU WKH SHULRG DWWULEXWDEOH WR HTXLW\ VKDUHKROGHUV E\ WKH ZHLJKWHG DYHUDJH QXPEHU RI HTXLW\ VKDUHVRXWVWDQGLQJGXULQJWKHSHULRG .

 6HJPHQW5HSRUWLQJ  7KH &RPSDQ\ LV RSHUDWLQJ RQO\ LQ RQH VLJQLoFDQW EXVLQHVV VHJPHQWLH([WUDFWLRQDQGVDOHRIOLPHVWRQHKHQFHVHJPHQW LQIRUPDWLRQ DV SHU $FFRXQWLQJ 6WDQGDUG  LV QRW UHTXLUHG WR EH GLVFORVHG 7KH FRPSDQ\ LV FDWHULQJ PDLQO\ WR WKH QHHGRIWKHGRPHVWLFPDUNHWDVVXFKWKHUHLVQRUHSRUWDEOH *HRJUDSKLFDO6HJPHQWV /.

 .QYHQWRULHV  .QYHQWRULHV DUH YDOXHG DIWHU SURYLGLQJ IRU REVROHVFHQFH DV IROORZV L.

000)HTXLW\ VKDUHVRI`HDFK ISSUED (previous year: 2.00.00.000)HTXLW\ VKDUHVRI`HDFK $OOVKDUHVDUHKHOGE\$&&OLPLWHGWKH KROGLQJFRPSDQ\ LWV1RPLQHH.000)HTXLW\ VKDUHVRI`HDFK SUBSCRIBED & PAID-UP (previous year: 2.00.  5DZ0DWHULDOV6WRUHV 6SDUH3DUWV3DFNLQJ0DWHULDO DQG)XHOV /RZHU RI FRVW DQG QHW UHDOL]DEOH YDOXH +RZHYHU PDWHULDOVDQGRWKHULWHPVKHOGIRUXVHLQWKHSURGXFWLRQ RI LQYHQWRULHV DUH QRW ZULWWHQ GRZQ EHORZ FRVW LI WKH oQLVKHGSURGXFWVLQZKLFKWKH\ZLOOEHLQFRUSRUDWHGDUH H[SHFWHGWREHVROGDWRUDERYHFRVW&RVWLVGHWHUPLQHG RQDZHLJKWHGDYHUDJHEDVLV SHARE CAPITAL AUTHORISED SHARES (previous year: 2.

000 Notes : D. TOTAL As at Dec 31.00. 2015 ` $VDW'HF  `       2.00.00.000 2.00.

VVXHGGXULQJWKH     UHSRUWLQJSHULRG &ORVLQJEDODQFHDWWKHHQG     RIWKHUHSRUWLQJSHULRG LL. 5HFRQFLOLDWLRQRIQXPEHURIHTXLW\VKDUHV 2015 Number of shares  Amount ` 1XPEHU RIVKDUHV $PRXQW ` (TXLW\6KDUHV 1XPEHURIVKDUHV     RXWVWDQGLQJDWWKH EHJLQQLQJRIWKH\HDU .

 :RUNLQSURJUHVVDQG)LQLVKHGJRRGV  /RZHU RI FRVW DQG QHW UHDOL]DEOH YDOXH &RVW LQFOXGHV GLUHFW PDWHULDOV DQG ODERXU DQG D SURSRUWLRQ RI PDQXIDFWXULQJ RYHUKHDGV EDVHG RQ QRUPDO RSHUDWLQJ FDSDFLW\ &RVW RI oQLVKHG JRRGV LQFOXGHV H[FLVH GXW\ &RVWLVGHWHUPLQHGRQDZHLJKWHGDYHUDJHEDVLV E.

Q SURSRUWLRQ WR WKH QXPEHU RI HTXLW\ VKDUHV KHOGE\WKHVKDUHKROGHUV  0. preferences and restrictions attached to equity shares 7KH&RPSDQ\KDVRQO\RQHFODVVRIHTXLW\VKDUHVKDYLQJSDUYDOXH of `HDFK$OOHTXLW\VKDUHVFDUU\VLPLODUYRWLQJULJKWVRI DQGVLPLODUGLYLGHQGULJKWV 1HW UHDOL]DEOH YDOXH LV WKH HVWLPDWHG VHOOLQJ SULFH LQ WKHRUGLQDU\FRXUVHRIEXVLQHVVOHVVHVWLPDWHGFRVWVRI FRPSOHWLRQDQGHVWLPDWHGFRVWVQHFHVVDU\WRPDNHWKH VDOH . Rights.QWKHHYHQWRIOLTXLGDWLRQRIWKH&RPSDQ\WKHKROGHUVRIHTXLW\ VKDUHV ZLOO EH HQWLWOHG WR UHFHLYH DQ\ RI WKH UHPDLQLQJ DVVHWV RI WKH &RPSDQ\ DIWHU GLVWULEXWLRQ RI DOO SUHIHUHQWLDO DPRXQWV 7KH GLVWULEXWLRQ ZLOO EH .

 &XUUHQW1RQ&XUUHQW  3... $OO DVVHWV DQG OLDELOLWLHV DUH SUHVHQWHG DV &XUUHQW RU 1RQ FXUUHQW DV SHU WKH &RPSDQ\ V QRUPDO RSHUDWLQJ F\FOH DQG RWKHU FULWHULD VHW RXW LQ 6FKHGXOH . RI WKH &RPSDQLHV $FW %DVHGRQWKHQDWXUHRISURGXFWVDQGWKHWLPHEHWZHHQ WKHDFTXLVLWLRQRIDVVHWVIRUSURFHVVLQJDQGWKHLUUHDOLVDWLRQ WKH &RPSDQ\ DVFHUWDLQHG LWV RSHUDWLQJ F\FOH DV  PRQWKV IRU WKH SXUSRVH RI &XUUHQW  1RQ FXUUHQW FODVVLoFDWLRQ RI DVVHWVDQGOLDELOLWLHV F.

 (TXLW\ VKDUHV KHOG E\ KROGLQJ FRPSDQ\  XOWLPDWH KROGLQJ DQG their subsidiaries +ROGLQJFRPSDQ\ $&&/LPLWHG 2015  Number of Amount 1XPEHURI $PRXQW shares VKDUHV ` `         $&& OLPLWHG LV JURXS FRPSDQ\ RI /DIDUJH+ROFLP /WG 6ZLW]HUODQG WKH XOWLPDWHKROGLQJFRPSDQ\.

G.

 'HWDLOVRIVKDUHKROGHUVKROGLQJPRUHWKDQVKDUHV 2015 Number KROGLQJ of shares (TXLW\VKDUHV $&&/LPLWHG   1XPEHU KROGLQJ RIVKDUHV    315 .

RESERVES AND SURPLUS 6 . 2015 `  General Reserves Surplus in the statement RISURoWDQGORVV %DODQFHDVSHUODVW . CURRENT LIABILITIES As at Dec 31. 2015 4.NATIONAL LIMESTONE COMPANY PRIVATE LIMITED (NLCPL) Notes to Financial Statement for the year ended Dec 31.

)LQDQFLDOVWDWHPHQWV $GG3URoW /RVV.

IRU .

WKH\HDU TOTAL $VDW'HF `  As at December 31. 2015 ` 6HFXULW\GHSRVLWV .

    $GYDQFHIURPFXVWRPHUV   3URYLVLRQIRUH[SHQVHV     2WKHU3D\DEOHV .

.

.

.

.

2015 ` $VDW 'HFHPEHU  ` 2WKHU3URYLVLRQ   TOTAL         Note . 2015  ` `     $VDW 'HFHPEHU  ` TOTAL 7.$7&267 '(35(&.01.6$7.179 13.01.42. 2015 ` $VDW 'HFHPEHU  ` 10. SHORT TERM BORROWINGS &XUUHQWPDWXULWLHVRIORQJWHUPERUURZLQJV TOTAL Grand TOTAL As at $VDW December 'HFHPEHU 31.2015 1(7%/2&. 5-A .TERM LOANS AND ADVANCES As at December 31.620 7. )RUWKH As at As at $VDW <HDU 31-12-2015 31-12-2015  Tangible Assets :  )UHHKROG/DQG                )DFWRU\%XLOGLQJ         2IoFH(TXLSPHQW               13. INVENTORIES $WFRVWRUQHWUHDOLVDEOHYDOXHZKLFKHYHULVORZHU.FIXED ASSETS $PRXQWLQ` *5266%/2&.21 As at As at As at 01. PROVISIONS As at December 31.QWHUFRUSRUDWHGHSRVLWIURP+ROGLQJ &RPSDQ\ TOTAL 5 -B .$7.179 7.72.658 25.278 5.69.2015 31-12-2015 01.42.8.43. LONG TERM BORROWINGS .901  /HDVHKROG/DQG Total Previous Year 9. LONG .21 $0257.

2015 ` Other loans and advances $GYDQFHV3D\PHQWDJDLQVWWD[HV   TOTAL   )LQLVKHG*RRGV /LPHVWRQH &UXVKHG/LPHVWRQH ([SORVLYHV TOTAL 316 $VDW 'HFHPEHU  `         . As at December 31.

TRADE RECEIVABLES 15. 2015 11. 2015 ` $VDW 'HFHPEHU  ` )RUWKH \HDUHQGHG 'HFHPEHU  ` 7UDGHUHFHLYDEOHVRXWVWDQGLQJIRUDSHULRG H[FHHGLQJVL[PRQWKVIURPWKHGDWHWKH\ DUHGXHIRUSD\PHQW 6DOHRI3URGXFWV )LQLVKHGJRRGV6DOHRI&UXVKHG/LPHVWRQH  8QVHFXUHGFRQVLGHUHGJRRG )LQLVKHGJRRGV6DOHRI/LPHVWRQH   5HYHQXHIURPRSHUDWLRQV JURVV. 2015 ` REVENUE FROM OPERATIONS For the year ended December 31. As at December 31.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies Notes to Financial Statement for the year ended Dec 31.

  0RUHWKDQPRQWKV   TOTAL   12.  /HVV([FLVHGXW\   5HYHQXHIURPRSHUDWLRQV QHW.

OTHER INCOME For the year ended December 31. 2015 ` $VDW 'HFHPEHU  ` 16.   CASH AND BANK BALANCES As at December 31. 2015 ` &DVKDQGFDVKHTXLYDOHQWV %DODQFHVZLWKEDQNV 2QFXUUHQWDFFRXQWV  &KHTXHVRQKDQG      2WKHUEDQNEDODQFHV )L[HGGHSRVLW UHFHLSWVDUHLQWKHFXVWRG\ RIPLQLQJGHSDUWPHQWDVVHFXULW\WRZDUGV PLQHV.

SHORT-TERM LOANS AND ADVANCES XQVHFXUHGFRQVLGHUHG*RRGXQOHVVRWKHUZLVHVWDWHG 'HSRVLWZLWK0LQLQJGHSDUWPHQW   COST OF MATERIALS   As at December 31.QFRPHIURP6FUDS6DOH )RUWKH \HDUHQGHG 'HFHPEHU  ` )RUWKH \HDUHQGHG 'HFHPEHU  ` Inventories at the end of the year )LQLVKHG*RRGV           Inventories at the beginning of the year 14. OTHER CURRENT ASSETS 8QVHFXUHGFRQVLGHUHGJRRGXQOHVVVWDWHGRWKHUZLVH )LQLVKHG*RRGV As at December 31.  . 2015 `   $GYDQFHVUHFRYHUDEOHLQFDVKRUNLQG 8QVHFXUHGFRQVLGHUHGJRRG   3UHSDLG([SHQVHV     )RUWKH \HDUHQGHG 'HFHPEHU  ` TOTAL 6HFXULW\GHSRVLW TOTAL  For the year ended December 31.QWHUHVW   TOTAL   .QWHUHVWRQ)'5 TOTAL   $VDW 'HFHPEHU  ` 3XUFKDVHRIFUXVKHGOLPHVWRQH     18. CHANGES IN INVENTORIES OF FINISHED GOODS For the year ended December 31.QFUHDVH. 2015 `   17. 2015 `  13.  TOTAL . 2015 ` $VDW 'HFHPEHU  ` $FFUXHG.

'HFUHDVH 317 .

For the year ended December 31.NATIONAL LIMESTONE COMPANY PRIVATE LIMITED (NLCPL) Notes to Financial Statement for the year ended Dec 31.1 OTHER EXPENSE 20. 2015 ` 3RZHU IXHO )RUWKH \HDUHQGHG 'HFHPEHU  `     /RDGLQJWUDQVSRUWDWLRQ0LQHVH[SHQVHV RWKHUFKDUJHV   7UDYHOOLQJ([SHQVHV   3URIHVVLRQDO&KDUJHV   /HJDO([SHQVHV     5R\DOWLHV 6KDUHLVVXHH[SHQVHV 0LVFHOODQHRXVH[SHQVHV 7RWDO $. 2015 19.

    3DUWLFXODUVRI5HODWHG3DUWLHVZKLFKFRQWURORUDUHXQGHUFRPPRQ FRQWUROZLWKWKH&RPSDQ\ )RUWKH \HDUHQGHG 'HFHPEHU  ` 1DPHRI5HODWHG3DUW\ 1DWXUHRI5HODWLRQVKLS $&&/LPLWHG +ROGLQJ&RPSDQ\ D.

2 PAYMENT TO STATUTORY AUDITORS H[FOXGLQJVHUYLFHWD[. 7UDQVDFWLRQZLWK5HODWHG3DUW\ 7UDQVDFWLRQZLWK+ROGLQJFRPSDQ\ 19 .

For the year ended December 31. 2015 ` RELATED PARTY DISCLOSURE E.

 L.

QWHUHVW2Q.&' LL. .

 'HDG 5HQW  /DQG WD[  )%7 3DLG RQ EHKDOI RI 1DWLRQDO /LPHVWRQH &RPSDQ\ 3ULYDWH /LPLWHG%\$&&/LPLWHG LLL.

.QWHU &RUSRUDWH 5HFHLYHG LY.

VVXHRIHTXLW\VKDUHV 'HSRVLWV For the )RUWKH year ended \HDUHQGHG December 'HFHPEHU 31. 2015 $XGLWIHHVIRUWD[oQDQFLDOVWDWHPHQWV   ` 2XWRISRFNHWH[SHQVHV   )RURWKHUVHUYLFHV       As auditors 7RWDO %. . 2015  ` `         &ORVLQJ%DODQFHVRI5HODWHG3DUWLHV $XGLWIHHV   As at December 31.

7RWDO $%.

L.

&'WDNHQ   3DUWLFXODUV For the year ended December 31. ` +ROGLQJ&R$&&/LPLWHG 2WKHU3D\DEOHV   . 2015 ` )RUWKH \HDUHQGHG 'HFHPEHU  ` 3URoW /RVV.

DIWHUWD[DWLRQDVSHU 6WDWHPHQWLQ3URoW /RVV .

.

EARNINGS PER SHARE-[EPS] :HLJKWHGDYHUDJHQXPEHURI(TXLW\6KDUHV 2XWVWDQGLQJ   . 21.

 .

%DVLFHDUQLQJVSHUVKDUH ZHLJKWHG DYHUDJH.

 )DFH9DOXHq`SHUVKDUH.

%DVLFDQGGLOXWHGHDUQLQJSHUVKDUHDUHWKHVDPH.

318 $VDW 'HFHPEHU  .

 7KHUHDUHQR0LFUR6PDOODQG0HGLXP(QWHUSULVHVDVGHoQHGLQWKH0LFUR6PDOODQG0HGLXP(QWHUSULVHV'HYHORSPHQW$FWWRZKRP WKH&RPSDQ\RZHVGXHVRQDFFRXQWRISULQFLSOHDPRXQWWRJHWKHUZLWKLQWHUHVWDQGDFFRUGLQJO\QRDGGLWLRQDOGLVFORVXUHVKDYHEHHQPDGH  7KHDERYHLQIRUPDWLRQUHJDUGLQJ0LFUR6PDOODQG0HGLXP(QWHUSULVHVKDVEHHQGHWHUPLQHGWRWKHH[WHQWVXFKSDUWLHVKDYHEHHQLGHQWLoHGRQ WKHEDVLVRILQIRUPDWLRQDYDLODEOHZLWKWKH&RPSDQ\7KLVKDVEHHQUHOLHGXSRQE\WKHDXGLWRUV 24. 2015 22.QYLHZRIFDUULHGIRUZDUGORVVHVWKHFRPSDQ\KDVGHIHUUHGWD[DVVHWV KRZHYHUDVDPDWWHURISUXGHQFHDQGLQYLHZRIWKHDEVHQFHRIYLUWXDOFHUWDLQW\RIIXWXUHWD[DEOHLQFRPHWKHVDPHKDVQRWEHHQUHFRJQL]HG LQWKHoQDQFLDOVWDWHPHQWV 23.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies Notes to Financial Statement for the year ended Dec 31. &RQWLQJHQW/LDELOLW\QRWSURYLGHGIRU 'HPDQGIRUODQGWD[ 2015 <HDU $PRXQW LQ`. TAXATION  1RSURYLVLRQIRUFXUUHQWWD[LVPDGHLQYLHZRIWKHORVVHVIRUWKH\HDU. 7KH&RPSDQ\KDVQRHPSOR\HHVRQLWVSD\UROOGXULQJWKH\HDU 25.

 For the year Cumulative )RUWKH\HDU &XPXODWLYH     26. 7KH &RPSDQ\ KDV oOHG D SHWLWLRQ DJDLQVW WKH 2UGHU  1RWLFHV RI 0LQLQJ $XWKRULWLHV WRZDUGV D GHPDQG RI `   SUHYLRXV\HDU` .

Q)HEUXDU\WKH&RPSDQ\KDVUHFHLYHGD'HPDQG1RWLFHRI` IURP'0*'HSDUWPHQW.DVDGGLWLRQDO5R\DOW\RQ/LPHVWRQHH[WUDFWHGLQHDUOLHU\HDUVZKLFKLQYLHZRI&RPSDQ\LVOHJDOO\XQVXVWDLQDEOH DQGWKH&RPSDQ\GRHVQRWH[SHFWDQ\OLDELOLW\LQWKLVPDWWHU 27. .RWKSXWOL5DMDVWKDQIRU/LPHVWRQH H[WUDFWHGLQWKHSHULRGIURPWRZLWKRXWSD\PHQWRI5R\DOW\. $GGLWLRQDOLQIRUPDWLRQSXUVXDQWWRWKHSURYLVLRQVRISDUDJUDSK YLLL.QWKHRSLQLRQRIWKH0DQDJHPHQWWKLVGHPDQGLVQRWVXVWDLQDEOH DQG WKH &RPSDQ\ KDV oOHG DQ DSSHDO ZLWK $GGLWLRQDO 'LUHFWRU RI 0LQHV 'HSDUWPHQW RI 0LQHV DQG *HRORJ\ -DLSXU 5DMDVWKDQ SUD\LQJ IRU FDQFHOODWLRQRIWKHVDPHDQGKHQFHQRSURYLVLRQLVPDGHIRUWKHVDPH 28.

)LUP5HJLVWUDWLRQ 1R: Ramnik Gupta Director   Rajat Prusty Director SACHIN A.RI3DUW%RIVFKHGXOH.AIYAR & CO..S. NEGANDHI Partner 0HPEHUVKLS1R 0XPEDL-DQXDU\ 319 . Chartered Accountants . 3UHYLRXV\HDUoJXUHVDUHUHJURXSHGUHVWDWHGZKHUHYHUQHFHVVDU\WRPDNHWKHPFRPSDUDEOHZLWKFXUUHQW\HDUoJXUHV $VSHURXUUHSRUWRIHYHQGDWH )RUDQGRQEHKDOIRIWKH%RDUGRI1DWLRQDO/LPHVWRQH&RPSDQ\3ULYDWH/LPLWHG For K..RI7KH&RPSDQLHV$FWLVHLWKHU1LORUQRW DSSOLFDEOH 29.&$.

SINGHANIA MINERALS PRIVATE LIMITED (SMPL) BOARD’S REPORT TO THE MEMBERS OF SINGHANIA MINERALS PRIVATE LIMITED PDGH EHWZHHQ WKH HQG RI WKH oQDQFLDO \HDU RI WKH Company and the date of this Report. 1. 7. FINANCIAL HIGHLIGHTS  7KHoQDQFLDOKLJKOLJKWVRI\RXU&RPSDQ\IRUWKH\HDU ended December 31. 2015 is summarized below: PARTICULARS Revenue from operations (net) and Other Income 2015 ` 2014 ` - - 6. SIGNIFICANT & MATERIAL ORDERS PASSED BY THE REGULATORS OR COURTS OR TRIBUNALS IMPACTING THE GOING CONCERN STATUS OF THE COMPANY  7KHUHDUHQRVLJQLoFDQWDQGPDWHULDORUGHUVSDVVHGE\ the Regulators or Courts or Tribunals impacting the going concern status of your Company. PARTICULARS INVESTMENTS 3URoW /RVV. 2015. The Directors take pleasure in presenting the Twenty First Annual Report on the business and operations of the Company and the Audited Financial Statements for the year ended December 31.

631.648. 9. 3.159.767.a. the transactions entered into with Related Parties are in the ordinary course of business and on an arms length pricing basis. LOANS. GUARANTEES  %DODQFH FDUULHG IRUZDUG (1.00) %DODQFHEURXJKWIRUZDUG (761. The loss for the period pertains WR IHHV IRU VWDWXWRU\ DQG WD[ DFFRXQW DXGLWV DQG /LPLWHG5HYLHZVWRJHWKHUZLWKOHJDODQGVHFUHWDULDO fees incurred and for dead rent. 2013 and Rules framed thereunder. Accordingly.00) (553.00) from previous year 8.017.864. DIRECTORS CONTINUANCE OF THE EXISTING FINANCIAL YEAR Pursuant to a favourable Order from the Company /DZ %RDUG WKH &RPSDQ\ ZLOO FRQWLQXH WR KDYH WKH calendar year (1st January .00) WR%DODQFH6KHHW 2. 2013. 2015. CONTRACT OR ARRANGEMENT WITH RELATED PARTIES OPERATIONS 4.00) (207.DIWHU7D[ - - (398. There are no material related party transactions. The Company had no operations for the year ended December 31. MATERIAL CHANGES AND COMMITMENTS  ([FHSW DV GLVFORVHG HOVHZKHUH LQ WKH 5HSRUW WKHUH have been no material changes and commitments 320 In accordance with the provisions of Section 188 of the Companies Act.31st December) as its oQDQFLDO\HDU 5. 3URoW /RVV.631. 2015. there is no requirement to furnish any information in Form AOC2. The Company has received loan of `GXULQJ WKH \HDU IRU PHHWLQJ LWV H[SHQVHV IURP LWV +ROGLQJ &RPSDQ\ LH $&& /LPLWHG 7KH ORDQ DPRXQW FDUULHV an interest of 9% p.00) (761. OR 7KHUH DUH QR RWKHU ORDQV  JXDUDQWHHV JLYHQ and investments made under the provisions of Section 186 of the Companies Act. DIVIDEND Your Directors do not recommend payment RI GLYLGHQG IRU WKH oQDQFLDO \HDU HQGHG December 31.

767.00) (207.017. his candidature for appointment as a 'LUHFWRUKDVEHHQLQFOXGHGLQWKH1RWLFHFRQYHQLQJ WKH$QQXDO*HQHUDO0HHWLQJRIWKH&RPSDQ\ .%HIRUH7D[ (398.00) 3URYLVLRQIRU7D[DWLRQ OF Appointment of Directors  7KH %RDUG RI 'LUHFWRUV KDV DSSRLQWHG 0U 1DYHHQ Chadha as an Additional Director of the Company ZLWKHIIHFWIURP2FWREHU0U&KDGKDKROGV RIoFHXSWRWKHGDWHRIWKH$QQXDO*HQHUDO0HHWLQJ Accordingly.

The Company is not required to constitute an Audit &RPPLWWHH1RPLQDWLRQ 5HPXQHUDWLRQ&RPPLWWHH or Corporate Social Responsibility Committee. if any. MEETINGS The Company held a minimum of one board meeting in every quarter. ceased to be a Director of the Company with effect from April 01. that such accounting policies as mentioned in 1RWHRIWKH1RWHVWRWKHoQDQFLDOVWDWHPHQWV have been selected and applied consistently and judgements and estimates have been made that are reasonable and prudent so as to give a true and fair view of the state of affairs of the Company as at December 31. July 14. LY WKDWWKHDQQXDOoQDQFLDOVWDWHPHQWVKDYHEHHQ prepared on a going concern basis. )LUP 5HJLVWUDWLRQ 1R :. During the year ended December 31. his appointment has been included in WKH1RWLFHFRQYHQLQJWKH$QQXDO*HQHUDO0HHWLQJRI the Company. v. 2015 and December 16. 2013: L WKDW LQ WKH SUHSDUDWLRQ RI WKH DQQXDO oQDQFLDO statements for the year ended December 31. 2015. 2015. ii. 2015. four meetings were held on January 21. 0U31. 2013 for safeguarding the 12. the applicable accounting standards have EHHQ IROORZHG DORQJ ZLWK SURSHU H[SODQDWLRQ relating to material departures.\HUGXULQJ his tenure as a Director of the Company.\HUZKRZDVDSSRLQWHGDVD'LUHFWRURIWKH Company with effect from July 14. April 08. 2015. LLL WKDW SURSHU DQG VXIoFLHQW FDUH KDV EHHQ WDNHQ for the maintenance of adequate accounting records in accordance with the provisions of the Companies Act.&$. your Directors make the following statements in terms of Section 134(3)(c) of the Companies Act. 2015 and of the loss of the Company for the year ended on that date. Accordingly. 6 $L\DU  &R &KDUWHUHG $FFRXQWDQWV . 7KH%RDUGKDVSODFHGRQUHFRUGLWVDSSUHFLDWLRQ IRUWKHYDOXDEOHFRQWULEXWLRQPDGHE\0U. 11. that systems to ensure compliance with the provisions of all applicable laws were in place and were adequate and operating effectively. 2015. 2014.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Cessation of Directorship  Subsidiary Companies assets of the Company and for preventing and detecting fraud and other irregularities. Directors retiring by rotation In accordance with the provisions of the &RPSDQLHV $FW  0U 6 9LVZDQDWKDQ UHWLUHV by rotation and being eligible offers himself for re-appointment as a director of the Company. AUDITORS  0HVVUV . DIRECTORS’ RESPONSIBILITY STATEMENT To the best of their knowledge and belief and DFFRUGLQJ WR WKH LQIRUPDWLRQ DQG H[SODQDWLRQV obtained by them. 10.

321 . 6 $L\DU  &R &KDUWHUHG Accountants. the DSSRLQWPHQWRIWKH$XGLWRULVUHTXLUHGWREHUDWLoHG E\ WKH 0HPEHUV HDFK \HDU DW WKH $QQXDO *HQHUDO 0HHWLQJ $FFRUGLQJO\  UHTXLVLWH UHVROXWLRQ IRUPV SDUW RI WKH 1RWLFH  RI WKH $QQXDO *HQHUDO 0HHWLQJ 7KH &RPSDQ\  KDV  REWDLQHG ZULWWHQ FRQoUPDWLRQ IURP0HVVUV. as Auditors of the Company for the year 2016. As required under the provisions of the Companies Act. 2019. 2013. 2013. Your Directors recommend the reDSSRLQWPHQW RI 0HVVUV . ZKR DUH WKH 6WDWXWRU\ $XGLWRUV RI WKH &RPSDQ\ KROG RIoFH XQWLO WKHFRQFOXVLRQRIWKHHQVXLQJ$QQXDO*HQHUDO 0HHWLQJ RI WKH &RPSDQ\ DQG DUH HOLJLEOH IRU UH DSSRLQWPHQW 0HPEHUV RI WKH &RPSDQ\ DW WKH &RPSDQ\ V WK $QQXDO *HQHUDO 0HHWLQJ KDG DSSURYHGWKHDSSRLQWPHQWRI0HVVUV.6$L\DU &R IRUDWHUPRIoYHoQDQFLDO\HDUVLHXSWRWKHoQDQFLDO year ending December 31.6$L\DU &RWKDWWKHLUDSSRLQWPHQW if made. would be in conformity with the Companies Act.

2013 read with The &RPSDQLHV 0DQDJHPHQWDQG$GPLQLVWUDWLRQ. ANNUAL RETURN 16.SINGHANIA MINERALS PRIVATE LIMITED (SMPL) 13. ACKNOWLEDGEMENT   7KH ([WUDFW RI $QQXDO 5HWXUQ SXUVXDQW WR 6HFWLRQ 92(3) of the Companies Act.

TECHNOLOGY ABSORPTION AND FOREIGN EXCHANGE EARNINGS & OUTGO As no business activity was carried out.5XOHV LQWKHSUHVFULEHG)RUP0*7LVHQFORVHGDQG PDUNHGDVk$QQH[XUH$y 14. PARTICULARS OF CONSERVATION OF ENERGY. the information on conservation of energy. PARTICULARS OF EMPLOYEES There are no employees on the rolls of the Company. +HQFHWKHUHLVQRGLVFORVXUHXQGHU6HFWLRQ . technology DEVRUSWLRQDQGIRUHLJQH[FKDQJHHDUQLQJV RXWJR GXULQJWKH\HDULV1LO 15.

RI the Companies Act 2013 read with Rule 5(1) and 5(2) of The Companies (Appointment and Remuneration RI0DQDJHULDO3HUVRQQHO.

5XOHV 322 <RXU'LUHFWRUVWDNHWKLVRSSRUWXQLW\WRH[SUHVVWKHLU DSSUHFLDWLRQ RI WKH H[FHOOHQW FRRSHUDWLRQ UHFHLYHd IURP WKH *RYHUQPHQW $XWKRULWLHV DQG &RPSDQ\ V %DQNHUV <RXU 'LUHFWRUV DOVR DFNQRZOHGJH WKH unstinted assistance and support received from ACC /LPLWHGWKHKROGLQJ&RPSDQ\ )RUDQGRQEHKDOIRIWKH%RDUG 1DYHHQ&KDGKD 69LVZDQDWKDQ Director Director    '.1 0XPEDL January 27. 2016 5HJLVWHUHG2IoFH 3DU\DYDV%KDZDQQG)ORRU %ORFN1R-DLO5RDG$UHUD+LOOV %KRSDO 03.1 '.

.

1992 6LQJKDQLD0LQHUDOV3ULYDWH/LPLWHG . 2015 [Pursuant to Section 92(3) of the Companies Act.9 EXTRACT OF ANNUAL RETURN as on December 31.1 Registration Date 1DPHRIWKH&RPSDQ\ &DWHJRU\6XE&DWHJRU\RIWKH&RPSDQ\ $GGUHVVRIWKH5HJLVWHUHG2IoFHDQGFRQWDFWGHWDLOV 80337& August 10. MGT. 2013 and Rule 12(1) of the Companies (Management and Administration) Rules. Registration and other details &. 2014] I.QGLDQ1RQ*RYHUQPHQW/LPLWHGE\VKDUHV3ULYDWH&RPSDQ\ 3DU\DYDV%KDYDQQG)ORRU%ORFN1R-DLO5RDG$UHUD+LOOV %KRSDO 03.Corporate Overview Financial Highlights Board & Management Reports Subsidiary Companies Financial Statements ANNEXURE ‘A’ TO BOARD’S REPORT FORM No.

DUYH5RDG0XPEDL 100% 2(46) IV.QGLYLGXDOV+8) - 2 2 0. 2015) % Change during % of Total the year Shares Demat Physical Total % of Total Shares Demat Physical Total . of Shares held at the beginning of the year (January 1. of Shares held at the end of the year (December 31. Principal Business Activities of the Company All the Business Activities contributing 10% or more of the total turnover of the Company shall be stated: Name and Description of the main NIC Code of the % to total turnover of the Company Product / Services Product / Service 14107 0LQLQJ  TXDUU\LQJ RI OLPHVWRQH OLPHVKHOO kankar and other calcareous minerals including calcite. 2015) No. chalk and shale 1.010 - 2 2 0.wise Shareholding Category of Shareholders No.010 0 b) &HQWUDO*RYW - - - - - - - - - c) 6WDWH*RYW V. Subsidiary and Associate Companies Name and address of the Company CIN / GLN $&&/LPLWHG Holding / % of Applicable Subsidiary / Shares Section Associate held +ROGLQJ /0+3/& &HPHQW+RXVH0DKDUVKL.7HO1R 1R 1RW$SSOLFDEOH :KHWKHU/LVWHG&RPSDQ\ 1DPH$GGUHVVDQGFRQWDFWGHWDLOVRI5HJLVWUDUDQG Transfer Agent. if any II. Particulars of Holding. Shareholding Pattern (Equity Share Capital Breakup as percentage of Total Equity) i) Category ./ III.

005 0 - 20000 20000 100 - 20000 20000 100 0 A.985 0 e) %DQNV)O - - - - - - - - - f) Any Other (specify) - 1 1 0.005 - 1 1 0. - - - - - - - - - d) %RGLHV&RUSRUDWH - 19997 19997 99. Promoters (including Promoter Group) (1) Indian a) Directors Sub-Total (A)(1) 323 .985 - 19997 19997 99.

of Shares held at the beginning of the year (January 1.Individuals c) %RGLHV&RUSRUDWH d) %DQNV)O e) Any Other (specify) Sub-Total (A)(2) Total Shareholding of Promoters & Promoter Group (A)=(A)(1)+(A)(2) B. c) &HQWUDO*RYW d) 6WDWH*RYW V.V.SINGHANIA MINERALS PRIVATE LIMITED (SMPL) IV.QGLYLGXDOV b) Other .wise Shareholding Category of Shareholders No. of Shares held at the end of the year (December 31. Shareholding Pattern (Equity Share Capital Breakup as percentage of Total Equity) i) Category . 2015) No. Public Shareholding (1) Institutions a) 0XWXDO)XQGV b) %DQNV). 2015) Demat Physical Total % of Total Shares Demat Physical Total % Change during % of Total the year Shares (2) Foreign a) 15.

000 20.000 100 0 Any Other (specify) Sub-Total (B)(2) Total Public Shareholding (B)=(B)(1)+(B)(2) C.000 20. e) 9HQWXUH&DSLWDO)XQGV f) Insurance Companies g) FIIs - - - - - - - - - - 20000 20000 100 - 20000 20000 100 0 - - - - - - - - - h) )RUHLJQ9HQWXUH Capital Funds i) Any Other (specify) Sub-Total (B)(1) (2) Non-Institutions a) Bodies Corporate i) Indian ii) Overseas b) Individuals i) Individual Shareholders holding nominal share capital upto ` 1 lakh ii) Individual Shareholders holding nominal share FDSLWDOLQH[FHVVRI ` 1 lakh - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - c) - - - - - - - - - - - - - - - - - - - 20.000 100 - 20. Shares held by Custodian for GDRs & ADRs Grand Total (A)+(B)+(C) 324 .

005 - - 01 0. 2015 to Dec.005 01 0. 2015) No.005 0 0 4 0U3DQFKDQDWKDQ 1DWHVDQ. 2015) % of total % of Shares shares of the pledged / Company encumbered to total shares % change in shareholding during the year No.985 01 0.005 0 0 3 0U%XUMRU'1DULPDQ MRLQWO\ZLWK$&&/LPLWHG 01 0. 2015) 1RFKDQJH - - 01 0.005 0 0 20000 100 0 20000 100 0 0 Total 6KDUHV RI 0U 3 1 .1D\DNMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH At the end of the year 3 Cumulative Shareholding during the year (Jan. of Shares % of total shares of the Company % of Shares pledged / encumbered to total shares No.Corporate Overview Financial Highlights Board & Management Reports Subsidiary Companies Financial Statements ii) Shareholding of Promoters (including Promoter Group) Sr. Particulars No.005 0 01 0. 1 Shareholding at the beginning of the year (January 1. of Shares % of total shares of the Company 19997 99.985 - - $&&/LPLWHG At the beginning of the year 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH At the end of the year 2 1RFKDQJH - - 19997 99. 2015. 1. of Shares % of total shares of the Company No. 2015) Shareholding at the end of the year (December 31.\HU MRLQWO\ ZLWK $&& /LPLWHG KDYH EHHQ WUDQVIHUUHG WR 0U 6 9LVZDQDWKDQ MRLQWO\ ZLWK $&& /LPLWHG RQ October 16. Shareholder’s Name No.985 0 19997 99.005 0 01 0. Shareholding at the beginning of the year (January 1.985 0 0 1 $&&/LPLWHG 2 0U6XQLO1D\DNMRLQWO\ ZLWK$&&/LPLWHG 01 0. 31. iii) Change in Promoters’ (including Promoter Group) Shareholding (please specify. if there is no change) Sr.005 - - 0U6XQLO.005 0 0 0 0 0 5 0U69LVZDQDWKDQMRLQWO\ ZLWK$&&/LPLWHG 0 0 0 01 0. of Shares 19997 99.\HUMRLQWO\ZLWK $&&/LPLWHG 01 0.005 0U%XUMRU'1DULPDQMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH At the end of the year 1RFKDQJH - - 325 .

Promoters and Holders of GDRs and ADRs) as on December 31. 2015) (Jan.10. 1 Name of the Director Shareholding at the beginning of the year Cumulative Shareholding during the year (January 1. 2015 to Dec.2015) 0. of Shares 4 % of total shares of the Company No. 2015) No of shares % of total shares of the company 01 0.000 01 (Transfer on 16.QFUHDVH WUDQVIHU.10. 31. Particulars No. 2015) No. 2015: 1RW$SSOLFDEOH v) Shareholding of Directors and Key Managerial Personnel: Sr.005 00 0.2015) 0. 2015) 0U69LVZDQDWKDQMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 00 0.005 01 0. 31.005 'DWHZLVH. 1. 1. No. 2015 to Dec.005 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH At the end of the year 5 Cumulative Shareholding during the year (Jan.000 'DWHZLVH LQFUHDVH  GHFUHDVH LQ Promoters Shareholding during the year specifying the reasons for LQFUHDVHGHFUHDVH At the end of the year iv) Shareholding Pattern of top ten Shareholders (Other than Directors.005 0U3DQFKDQDWKDQ1. Shareholding at the beginning of the year (January 1.\HUMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 01 0. of Shares % of total shares of the Company 01 (Transfer on 16.SINGHANIA MINERALS PRIVATE LIMITED (SMPL) Sr.

005 0U69LVZDQDWKDQMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 'DWHZLVH. At the end of the year 01 (Transfer 16.10.000 01 (Transfer 16.QFUHDVH WUDQVIHU.2015) 0.005 00 0.2015) 0.10.005 01 0.

At the end of the year 326 % of total shares of the company 0U31.000 .\HUMRLQWO\ZLWK$&&/LPLWHG At the beginning of the year 2 No of shares 00 0.

QGHEWHGQHVVDWWKHHQGRIWKHoQDQFLDO\HDU VI. Penalties / Punishment / Compounding of Offences: 7KHUHZHUHQRSHQDOWLHVSXQLVKPHQWVFRPSRXQGLQJRIRIIHQFHVIRUWKH\HDUHQGHG'HFHPEHU )RUDQGRQEHKDOIRIWKH%RDUG   0XPEDL January 27.QGHEWHGQHVVGXULQJWKHoQDQFLDO\HDU .QGHEWHGQHVVDWWKHEHJLQQLQJRIWKHoQDQFLDO\HDU &KDQJHLQ.650 - - ii) Interest due but not paid - - - - iii) Interest accrued but not due - 21.222 - - ii) Interest due but not paid - - - - iii) Interest accrued but not due - - - - Total (i+ii+iii) - 744.440 - - . Remuneration of Directors and Key Managerial Personnel: A. Remuneration to Other Directors:1RW$SSOLFDEOH C.128 - - i) Principal Amount - 119.QGHEWHGQHVVRIWKH&RPSDQ\LQFOXGLQJLQWHUHVWRXWVWDQGLQJDFFUXHGEXWQRWGXHIRUSD\PHQW Secured Loans excluding deposits ` Unsecured Loans ` Deposits ` Total indebtedness ` i) Principal Amount - 744. 2016      1DYHHQ&KDGKD Director 69LVZDQDWKDQ Director 327 .222 - - Addition - 397. Remuneration to Managing Director.41. Indebtedness . Remuneration to Key Managerial Personnel other than MD/Manager/WTD:1RW$SSOLFDEOH VII.790 - - Total (i+ii+iii) - 11. Whole-time Directors and/or Manager:1RW$SSOLFDEOH B.128 - - Reduction - - - - Net Change - 397.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies V.

SINGHANIA MINERALS PRIVATE LIMITED (SMPL) INDEPENDENT AUDITOR’S REPORT To the Members of Singhania Minerals Private Limited Report on the Financial Statements :HKDYHDXGLWHGWKHDFFRPSDQ\LQJoQDQFLDOVWDWHPHQWV RI 6LQJKDQLD 0LQHUDOV 3ULYDWH /LPLWHG CWKH &RPSDQ\ .

Management’s Responsibility for the Financial Statements 7KH &RPSDQ\ V %RDUG RI 'LUHFWRUV LV UHVSRQVLEOH IRU WKH PDWWHUV VWDWHG LQ 6HFWLRQ  . ZKLFK FRPSULVH WKH %DODQFH 6KHHW DV DW 'HFHPEHU   WKH 6WDWHPHQW RI 3URoW DQG /RVV WKH &DVK )ORZ 6WDWHPHQW IRU WKH \HDU WKHQ HQGHG DQG D VXPPDU\ RI WKHVLJQLoFDQWDFFRXQWLQJSROLFLHVDQGRWKHUH[SODQDWRU\ information.

 RI WKH &RPSDQLHV $FW  CWKH$FW .

ZLWKUHVSHFWWRWKHSUHSDUDWLRQRIWKHVH oQDQFLDOVWDWHPHQWVWKDWJLYHDWUXHDQGIDLUYLHZRIWKH oQDQFLDOSRVLWLRQoQDQFLDOSHUIRUPDQFHDQGFDVKpRZVRI WKH&RPSDQ\LQDFFRUGDQFHZLWKWKHDFFRXQWLQJSULQFLSOHV JHQHUDOO\ DFFHSWHG LQ .QGLD LQFOXGLQJ WKH $FFRXQWLQJ 6WDQGDUGV VSHFLoHG XQGHU 6HFWLRQ  RI WKH $FW UHDG ZLWK5XOHRIWKH&RPSDQLHV $FFRXQWV.

5XOHV7KLV UHVSRQVLELOLW\ DOVR LQFOXGHV PDLQWHQDQFH RI DGHTXDWH DFFRXQWLQJ UHFRUGV LQ DFFRUGDQFH ZLWK WKH SURYLVLRQV RI WKH$FWIRUVDIHJXDUGLQJWKHDVVHWVRIWKH&RPSDQ\DQGIRU SUHYHQWLQJDQGGHWHFWLQJIUDXGVDQGRWKHULUUHJXODULWLHV VHOHFWLRQ DQG DSSOLFDWLRQ RI DSSURSULDWH DFFRXQWLQJ SROLFLHV PDNLQJ MXGJPHQWV DQG HVWLPDWHV WKDW DUH UHDVRQDEOHDQGSUXGHQWDQGGHVLJQLPSOHPHQWDWLRQDQG PDLQWHQDQFHRIDGHTXDWHLQWHUQDOoQDQFLDOFRQWUROVWKDW ZHUHRSHUDWLQJHIIHFWLYHO\IRUHQVXULQJWKHDFFXUDF\DQG FRPSOHWHQHVV RI WKH DFFRXQWLQJ UHFRUGV UHOHYDQW WR WKH SUHSDUDWLRQDQGSUHVHQWDWLRQRIWKHoQDQFLDOVWDWHPHQWV WKDWJLYHDWUXHDQGIDLUYLHZDQGDUHIUHHIURPPDWHULDO PLVVWDWHPHQWZKHWKHUGXHWRIUDXGRUHUURU Auditor’s Responsibility 2XU UHVSRQVLELOLW\ LV WR H[SUHVV DQ RSLQLRQ RQ WKHVH oQDQFLDOVWDWHPHQWVEDVHGRQRXUDXGLW :HKDYHWDNHQLQWRDFFRXQWWKHSURYLVLRQVRIWKH$FWWKH DFFRXQWLQJ DQG DXGLWLQJ VWDQGDUGV DQG PDWWHUV ZKLFK DUHUHTXLUHGWREHLQFOXGHGLQWKHDXGLWUHSRUWXQGHUWKH SURYLVLRQVRIWKH$FWDQGWKH5XOHVPDGHWKHUHXQGHU 328 :HFRQGXFWHGRXUDXGLWLQDFFRUGDQFHZLWKWKH6WDQGDUGV RQ $XGLWLQJ VSHFLoHG XQGHU 6HFWLRQ  .

.Q PDNLQJ WKRVH ULVN DVVHVVPHQWV WKH DXGLWRU FRQVLGHUV LQWHUQDO oQDQFLDO FRQWURO UHOHYDQW WR WKH &RPSDQ\ V SUHSDUDWLRQ RIWKHoQDQFLDOVWDWHPHQWVWKDWJLYHDWUXHDQGIDLUYLHZ LQRUGHUWRGHVLJQDXGLWSURFHGXUHVWKDWDUHDSSURSULDWHLQ WKHFLUFXPVWDQFHVEXWQRWIRUWKHSXUSRVHRIH[SUHVVLQJ DQ RSLQLRQ RQ ZKHWKHU WKH &RPSDQ\ KDV LQ SODFH DQ DGHTXDWHLQWHUQDOoQDQFLDOFRQWUROVV\VWHPRYHUoQDQFLDO UHSRUWLQJDQGWKHRSHUDWLQJHIIHFWLYHQHVVRIVXFKFRQWUROV $Q DXGLW DOVR LQFOXGHV HYDOXDWLQJ WKH DSSURSULDWHQHVV RI WKH DFFRXQWLQJ SROLFLHV XVHG DQG WKH UHDVRQDEOHQHVV RI WKH DFFRXQWLQJ HVWLPDWHV PDGH E\ WKH &RPSDQ\ V 'LUHFWRUVDVZHOODVHYDOXDWLQJWKHRYHUDOOSUHVHQWDWLRQRI WKHoQDQFLDOVWDWHPHQWV :H EHOLHYH WKDW WKH DXGLW HYLGHQFH ZH KDYH REWDLQHG LV VXIoFLHQWDQGDSSURSULDWHWRSURYLGHDEDVLVIRURXUDXGLW RSLQLRQRQWKHoQDQFLDOVWDWHPHQWV Opinion .QGLDRIWKHVWDWHRIDIIDLUVRIWKH&RPSDQ\DV DW'HFHPEHUDQGLWVORVVDQGLWVFDVKpRZVIRU the year ended on that date. RI WKH $FW 7KRVH 6WDQGDUGV UHTXLUH WKDW ZH FRPSO\ ZLWK HWKLFDO UHTXLUHPHQWV DQG SODQ DQG SHUIRUP WKH DXGLW WR REWDLQ UHDVRQDEOH DVVXUDQFH DERXW ZKHWKHU WKH oQDQFLDO VWDWHPHQWVDUHIUHHIURPPDWHULDOPLVVWDWHPHQW $QDXGLWLQYROYHVSHUIRUPLQJSURFHGXUHVWRREWDLQDXGLW HYLGHQFH DERXW WKH DPRXQWV DQG WKH GLVFORVXUHV LQ WKH oQDQFLDO VWDWHPHQWV 7KH SURFHGXUHV VHOHFWHG GHSHQG RQ WKH DXGLWRU V MXGJPHQW LQFOXGLQJ WKH DVVHVVPHQW RI WKH ULVNV RI PDWHULDO PLVVWDWHPHQW RI WKH oQDQFLDO VWDWHPHQWV ZKHWKHU GXH WR IUDXG RU HUURU .Q RXU RSLQLRQ DQG WR WKH EHVW RI RXU LQIRUPDWLRQ DQG DFFRUGLQJ WR WKH H[SODQDWLRQV JLYHQ WR XV WKH DIRUHVDLG oQDQFLDOVWDWHPHQWVJLYHWKHLQIRUPDWLRQUHTXLUHGE\WKH $FWLQWKHPDQQHUVRUHTXLUHGDQGJLYHDWUXHDQGIDLUYLHZ LQ FRQIRUPLW\ ZLWK WKH DFFRXQWLQJ SULQFLSOHV JHQHUDOO\ DFFHSWHGLQ.

Corporate Overview Financial Highlights Board & Management Reports Emphasis of Matter :HGUDZDWWHQWLRQWRQRWHWRWKHoQDQFLDOVWDWHPHQWV 7KH &RPSDQ\ KDV DFFXPXODWHG ORVVHV DQG LWV QHW ZRUWK KDV EHHQ IXOO\ HURGHG 7KH &RPSDQ\ KDV LQFXUUHG D QHW ORVV GXULQJ WKH FXUUHQW DQG SUHYLRXV \HDU DQG WKH &RPSDQ\ V FXUUHQW OLDELOLWLHV H[FHHGHG LWV FXUUHQW DVVHWV DV DW WKH EDODQFH VKHHW GDWH 7KHVH FRQGLWLRQV LQGLFDWH WKH H[LVWHQFH RI D PDWHULDO XQFHUWDLQW\ WKDW PD\ FDVW VLJQLoFDQWGRXEWDERXWWKH&RPSDQ\ VDELOLW\WRFRQWLQXH DV D JRLQJ FRQFHUQ +RZHYHU WKH oQDQFLDO VWDWHPHQWV RIWKH&RPSDQ\KDYHEHHQSUHSDUHGRQDJRLQJFRQFHUQ EDVLVIRUWKHUHDVRQVVWDWHGLQWKHVDLGQRWH 2XURSLQLRQLVQRWPRGLoHGLQUHVSHFWRIWKLVPDWWHU 5HSRUWRQ2WKHU/HJDODQG5HJXODWRU\5HTXLUHPHQWV  $V UHTXLUHG E\ WKH &RPSDQLHV $XGLWRU V 5HSRUW.

 2UGHU CWKH2UGHU .

LVVXHGE\WKH*RYHUQPHQWRI .QGLDq0LQLVWU\RI&RUSRUDWH$IIDLUVLQWHUPVRIVXE VHFWLRQ .

 RI VHFWLRQ  RI WKH $FW ZH HQFORVH LQ WKHDQQH[XUHDVWDWHPHQWRQWKHPDWWHUVVSHFLoHGLQ SDUDJUDSKVDQGRIWKHVDLG2UGHU  $V UHTXLUHG E\ 6HFWLRQ  .

 RI WKH $FW ZH UHSRUW that: D.

 :HKDYHVRXJKWDQGREWDLQHGDOOWKHLQIRUPDWLRQ DQG H[SODQDWLRQV ZKLFK WR WKH EHVW RI RXU NQRZOHGJH DQG EHOLHI ZHUH QHFHVVDU\ IRU WKH SXUSRVHVRIRXUDXGLW E.

QRXURSLQLRQSURSHUERRNVRIDFFRXQWDVUHTXLUHG E\ODZKDYHEHHQNHSWE\WKH&RPSDQ\VRIDUDVLW DSSHDUVIURPRXUH[DPLQDWLRQRIWKRVHERRNV Financial Statements Subsidiary Companies G. .

QRXURSLQLRQWKHDIRUHVDLGoQDQFLDOVWDWHPHQWV FRPSO\ ZLWK WKH $FFRXQWLQJ 6WDQGDUGV VSHFLoHG XQGHU6HFWLRQRIWKH$FWUHDGZLWK5XOHRI WKH&RPSDQLHV $FFRXQWV. .

5XOHV H.

 2Q WKH EDVLV RI WKH ZULWWHQ UHSUHVHQWDWLRQV UHFHLYHG IURP WKH GLUHFWRUV DV RQ 'HFHPEHU   WDNHQ RQ UHFRUG E\ WKH %RDUG RI 'LUHFWRUV QRQH RI WKH GLUHFWRUV LV GLVTXDOLoHG DV RQ 'HFHPEHU   IURP EHLQJ DSSRLQWHG DV D GLUHFWRULQWHUPVRI6HFWLRQ .

RIWKH$FW I.

 7KH JRLQJ FRQFHUQ PDWWHU GHVFULEHG XQGHU WKH (PSKDVLV RI 0DWWHUV SDUDJUDSK DERYH LQ RXU RSLQLRQ PD\ KDYH DQ DGYHUVH HIIHFW RQ WKH IXQFWLRQLQJRIWKH&RPSDQ\ J.

 :LWKUHVSHFWWRWKHRWKHUPDWWHUVWREHLQFOXGHGLQ WKH$XGLWRU V5HSRUWLQDFFRUGDQFHZLWK5XOHRI WKH &RPSDQLHV $XGLW DQG $XGLWRUV.

F.QYHVWRU(GXFDWLRQDQG 3URWHFWLRQ)XQGE\WKH&RPSDQ\ For K. Aiyar & Co. S. 5XOHV  LQRXURSLQLRQDQGWRWKHEHVWRIRXULQIRUPDWLRQ DQGDFFRUGLQJWRWKHH[SODQDWLRQVJLYHQWRXV L WKH &RPSDQ\ GRHV QRW KDYH DQ\ SHQGLQJ OLWLJDWLRQV ZKLFK ZRXOG LPSDFW LWV oQDQFLDO SRVLWLRQ LL WKH &RPSDQ\ GLG QRW KDYH DQ\ ORQJWHUP FRQWUDFWV LQFOXGLQJ GHULYDWLYH FRQWUDFWV IRU ZKLFK WKHUH ZHUH DQ\ PDWHULDO IRUHVHHDEOH ORVVHV LLL WKHUH ZHUH QR DPRXQWV ZKLFK ZHUH UHTXLUHG WREHWUDQVIHUUHGWRWKH.

&$. Sachin A. Negandhi Place:0XPEDL Partner Date:-DQXDU\ 0HPEHUVKLS1R 329 . 7KH %DODQFH 6KHHW WKH 6WDWHPHQW RI 3URoW DQG Chartered Accountants /RVVDQGWKH&DVK)ORZ6WDWHPHQWGHDOWZLWKE\  .)LUP5HJLVWUDWLRQ1R: WKLV 5HSRUW DUH LQ DJUHHPHQW ZLWK WKH ERRNV RI account.

SINGHANIA MINERALS PRIVATE LIMITED (SMPL) ANNEXURE TO THE AUDITOR’S REPORT 5HIHUUHGWRLQSDUDJUDSKXQGHUWKHKHDGLQJC5HSRUWRQ 2WKHU/HJDODQG5HJXODWRU\5HTXLUHPHQWV RIRXU5HSRUWRI HYHQGDWHRQWKHoQDQFLDOVWDWHPHQWVIRUWKH\HDUHQGHG RQ 'HFHPEHU   RI 6LQJKDQLD 0LQHUDOV 3ULYDWH /LPLWHG.

L.

 D.

 7KH &RPSDQ\ KDV PDLQWDLQHG SURSHU UHFRUGV VKRZLQJ IXOO SDUWLFXODUV LQFOXGLQJ TXDQWLWDWLYH GHWDLOVDQGVLWXDWLRQRIo[HGDVVHWV   E.

 7KH o[HG DVVHWV DUH SK\VLFDOO\ YHULoHG E\ WKH management during the year and in our opinion WKH IUHTXHQF\ RI YHULoFDWLRQ LV UHDVRQDEOH KDYLQJUHJDUGWRWKHVL]HRIWKH&RPSDQ\DQGWKH QDWXUH RI LWV DVVHWV 1R PDWHULDO GLVFUHSDQFLHV  ZHUHQRWLFHGRQVXFKSK\VLFDOYHULoFDWLRQ LL.

 UHVSHFW RI SURYLGHQW IXQG LQYHVWRU HGXFDWLRQ DQGSURWHFWLRQIXQGHPSOR\HHV VWDWHLQVXUDQFH .QFRPH 7D[ ZHDOWK 7D[ VHUYLFH 7D[ VDOHV 7D[ &XVWRPV 'XW\ ([FLVH 'XW\ &HVV DQG RWKHU VWDWXWRU\ GXHV ZKLFK ZHUH RXWVWDQGLQJ DW WKH \HDU HQG IRU DSHULRGRIPRUHWKDQVL[PRQWKV IURPWKHGDWHWKH\EHFDPHSD\DEOH E.

QFRPH 7D[ 6DOHV 7D[ :HDOWK 7D[6HUYLFH7D[&XVWRP'XW\([FLVH'XW\DQG &HVVZKLFKKDYHQRWEHHQGHSRVLWHGRQDFFRXQW RIDQ\GLVSXWH F. $FFRUGLQJWRWKHUHFRUGVRIWKH&RPSDQ\WKHUH DUH QR GXHV RI .

QYHVWRU (GXFDWLRQ3URWHFWLRQ)XQG 6LQFHWKH&RPSDQ\KDVQRWVWDUWHGDQ\FRPPHUFLDO RSHUDWLRQVDQGLQDEVHQFHRIDQ\LQYHQWRULHVFODXVH  LL. %DVHG RQ RXU H[DPLQDWLRQ RI WKH UHFRUGV PDLQWDLQHGGXULQJWKH\HDUWKH&RPSDQ\LVQRW OLDEOH WR PDNH DQ\ SD\PHQWV WRZDUGV .

LVQRWDSSOLFDEOHIRUWKH\HDU YLLL.

 7KHDFFXPXODWHGORVVHVRIWKH&RPSDQ\H[FHHGoIW\ SHUFHQWRILWVQHWZRUWK7KH&RPSDQ\KDVLQFXUUHG LLL.

 $V LQIRUPHG WKH &RPSDQ\ KDV QRW JUDQWHG DQ\ FDVKORVVHVGXULQJWKHoQDQFLDO\HDUFRYHUHGE\RXU ORDQV VHFXUHG RU XQVHFXUHG WR FRPSDQLHV oUPV DXGLW DQG LQ WKH LPPHGLDWHO\ SUHFHGLQJ oQDQFLDO RURWKHUSDUWLHVFRYHUHGLQWKHUHJLVWHUPDLQWDLQHG year. XQGHU 6HFWLRQ  RI WKH &RPSDQLHV $FW  $FFRUGLQJO\VXEFODXVH D.

DQG E.

RIWKH2UGHUDUH L[.

 $FFRUGLQJ WR WKH LQIRUPDWLRQ DQG H[SODQDWLRQV QRWDSSOLFDEOH JLYHQWRXVWKH&RPSDQ\KDVQRWWDNHQDQ\PRQH\ IURP DQ\ oQDQFLDO LQVWLWXWLRQ EDQN RU GHEHQWXUH LY.

 .Q RXU RSLQLRQ DQG DFFRUGLQJ WR WKH LQIRUPDWLRQ KROGHU DQG KHQFH FODXVH  L[.

 RI WKH 2UGHU LV QRW DQGH[SODQDWLRQVJLYHQWRXVWKHUHLVDQDGHTXDWH DSSOLFDEOHWRWKH&RPSDQ\ LQWHUQDOFRQWUROV\VWHPFRPPHQVXUDWHZLWKWKHVL]H RI WKH &RPSDQ\ DQG WKH QDWXUH RI LWV EXVLQHVV IRU [.

 WKHSXUFKDVHVRIo[HGDVVHWV'XULQJWKHFRXUVHRI RXU DXGLW QR PDMRU ZHDNQHVV KDV EHHQ QRWLFHG LQ WKHLQWHUQDOFRQWUROV\VWHPLQUHVSHFWRIWKLVDUHD $FFRUGLQJ WR WKH LQIRUPDWLRQ DQG H[SODQDWLRQV JLYHQWRXVWKH&RPSDQ\KDVQRWJLYHQJXDUDQWHH IRU ORDQV WDNHQ E\ RWKHUV IURP EDQN RU oQDQFLDO LQVWLWXWLRQV Y.

 7KH &RPSDQ\ KDV QRW DFFHSWHG DQ\ GHSRVLWV IURP [L.

DQ\RWKHUUHOHYDQWSURYLVLRQVRIWKH&RPSDQLHV$FW [LL. 7KH&RPSDQ\KDVQRWUDLVHGDQ\WHUPORDQVGXULQJ WKHSXEOLFWRZKLFKWKHSURYLVLRQV RIVHFWLRQ RU the year.

 $FFRUGLQJ WR WKH LQIRUPDWLRQ DQG H[SODQDWLRQV  DQG WKH &RPSDQLHV $FFHSWDQFH RI 'HSRVLW.

 IXUQLVKHG E\ WKH PDQDJHPHQW ZKLFK KDYH EHHQ 5XOHVDSSO\ UHOLHGXSRQE\XVWKHUHZHUHQRIUDXGVRQRUE\WKH YL.

 :H KDYH EHHQ LQIRUPHG WKDW WKH &RPSDQ\ LV QRW &RPSDQ\ QRWLFHG RU UHSRUWHG GXULQJ WKH FRXUVH RI UHTXLUHGWRPDLQWDLQFRVWUHFRUGVXQGHUVXEVHFWLRQ our audit. .

RIVHFWLRQRIWKH&RPSDQLHV$FWZKLFK KDVEHHQUHOLHGXSRQ YLL.

 D.

Aiyar & Co. Negandhi Partner   $FFRUGLQJWRWKHLQIRUPDWLRQDQGH[SODQDWLRQV Place:0XPEDL 0HPEHUVKLS1R JLYHQ WR XV WKHUH DUH QR XQGLVSXWHG GXHV LQ Date:-DQXDU\ 330 .&$. .QVXUDQFH . S.)LUP5HJLVWUDWLRQ1R: GXW\ FHVV DQG RWKHU PDWHULDO VWDWXWRU\ GXHV DSSOLFDEOHWRLWZLWKWKHDSSURSULDWHDXWKRULWLHV Sachin A. $FFRUGLQJ WR WKH UHFRUGV RI WKH &RPSDQ\ WKH &RPSDQ\ KDV EHHQ JHQHUDOO\ UHJXODU LQ GHSRVLWLQJ 3URYLGHQW )XQG (PSOR\HHV  6WDWH For K.QFRPH WD[ 6DOHV WD[ 9DOXH $GGHG Chartered Accountants WD[:HDOWKWD[6HUYLFHWD[&XVWRPGXW\([FLVH  .

2015 3DUWLFXODUV 1RWH As at 1R December 31.Corporate Overview Financial Highlights Board & Management Reports BALANCE SHEET as at December 31. 2015 ` $VDW 'HFHPEHU  ` EQUITY AND LIABILITIES 6KDUHKROGHUV IXQGV 6KDUHFDSLWDO 5HVHUYHVDQGVXUSOXV      .

 .

61.840 2.209 ASSETS 1RQFXUUHQWDVVHWV )L[HG$VVHWV 7DQJLEOHDVVHWV    /RQJWHUPORDQVDQGDGYDQFHV    2.598 26.88.648) (5.736 8.209 &XUUHQWDVVHWV  TOTAL 6LJQLoFDQWDFFRXQWLQJSROLFLHV for the year ended December 31.88. (9.631) 1RQFXUUHQWOLDELOLWLHV /RQJWHUPERUURZLQJV 6KRUWWHUPSURYLVLRQV          12. 2015 3DUWLFXODUV 1RWH 1R For the year ended December 31.490   17. 2015 ` 2 )RUWKH\HDUHQGHG 'HFHPEHU ` ` Revenue from RSHUDWLRQV JURVV.79.49.088 2.61.490 2.59.79.61.719 2.088 2.38.

  /HVV([FLVHGXW\   Revenue from RSHUDWLRQV QHW.

QFRPH     EXPENSES 'HSUHFLDWLRQDQG DPRUWL]DWLRQH[SHQVH TOTAL &DVKDQGEDQNEDODQFHV STATEMENT OF PROFIT AND LOSS Total Revenue &XUUHQWOLDELOLWLHV 2WKHUFXUUHQWOLDELOLWLHV Subsidiary Companies Financial Statements  )LQDQFHFRVW.   2WKHU.QWHUHVW 2WKHUH[SHQVHV        Total Expenses   3URoW /RVV.

017) (2.98.EHIRUHWD[ (3.07.767) 7D[H[SHQVHV 3URoW /RVV.07.767) &XUUHQWWD[   'HIHUUHGWD[   (3.017) (2.98.

` 10)` 5HIHU1RWH.DIWHUWD[ (DUQLQJVSHUHTXLW\ VKDUH ^ )DFHYDOXHRI` each (Previous year .

%DVLF `  .

 .

'LOXWHG `  .

 .

S.&$. Negandhi Partner 0HPEHUVKLS1R Sachin A. Aiyar & Co.)LUP5HJLVWUDWLRQ 1R: R S RATHORE Director For K. Negandhi Partner 0HPEHUVKLS1R 0XPEDL-DQXDU\ 0XPEDL-DQXDU\ S. Chartered Accountants . Chartered Accountants . VISWANATHAN Director 331 . VISWANATHAN Director Sachin A.S. 6LJQLoFDQWDFFRXQWLQJ SROLFLHV 2 7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRIWKHoQDQFLDOVWDWHPHQWV 7KHDFFRPSDQ\LQJQRWHVDUHDQLQWHJUDOSDUWRIWKHoQDQFLDOVWDWHPHQWV $VSHURXUUHSRUWRI even date )RUDQGRQEHKDOIRIWKH%RDUGRI 6LQJKDQLD0LQHUDOV3ULYDWH/LPLWHG $VSHURXUUHSRUWRI even date )RUDQGRQEHKDOIRIWKH%RDUGRI 6LQJKDQLD0LQHUDOV3ULYDWH/LPLWHG For K.)LUP5HJLVWUDWLRQ 1R: R S RATHORE Director S.&$. Aiyar & Co.

2015 )RUWKH\HDUHQGHG 'HFHPEHU ` `  . 2015 3DUWLFXODUV A. For the year ended December 31.SINGHANIA MINERALS PRIVATE LIMITED (SMPL) CASH FLOW STATEMENT for the year ended December 31.

 .

   .

 .

  CASH FLOW FROM OPERATING ACTIVITIES  1HW3URoW /RVV.

QFUHDVHLQRWKHU&XUUHQW/LDELOLWLHV  'HFUHDVHLQ6KRUWWHUPSURYLVLRQV NET CASH FROM OPERATING ACTIVITIES B.  .EHIRUHWD[DWLRQ $GMXVWPHQWVIRU .95.QWHUHVWRQORQJWHUPERUURZLQJV 2SHUDWLQJSURoWEHIRUHZRUNLQJFDSLWDOFKDQJHV 0RYHPHQWLQ:RUNLQJ&DSLWDO 2.  (1. .521)       CASH FLOW FROM INVESTING ACTIVITIES  3XUFKDVHRI)L[HG$VVHWV NET CASH FROM INVESTING ACTIVITIES C.

685) CASH FLOW FROM FINANCING ACTIVITIES  3URFHHGVIURPORQJWHUPERUURZLQJV  .70.QWHUHVWSDLGRQORQJWHUPERUURZLQJV NET CASH FROM FINANCING ACTIVITIES 1HWLQFUHDVH GHFUHDVH. (2.

LQFDVK FDVKHTXLYDOHQWV  .

Negandhi Partner 0HPEHUVKLS1R 0XPEDL-DQXDU\ 332 S.)LUP5HJLVWUDWLRQ 1R: R S RATHORE Director Sachin A.  2.191 (9.121) 21.564 2.S. Chartered Accountants . Aiyar & Co.17.670 &DVK FDVKHTXLYDOHQWVDWWKHEHJLQQLQJRIWKH\HDU   &DVK FDVKHTXLYDOHQWVDWWKHHQGRIWKH\HDU   $VSHURXUUHSRUWRIHYHQGDWH )RUDQGRQEHKDOIRIWKH%RDUGRI6LQJKDQLD0LQHUDOV3ULYDWH/LPLWHG For K. VISWANATHAN Director .&$.61.

QIRUPDWLRQV A Corporate Information  6LQJKDQLD 0LQHUDOV 3ULYDWH /LPLWHG WKH &RPSDQ\.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 1RWHVWRWKHoQDQFLDOVWDWHPHQWVIRUWKH\HDUHQGHG'HFHPEHU 1. 6LJQLoFDQWDFFRXQWLQJSROLFLHV .

QGLDDQGLQFRUSRUDWHG XQGHU WKH SURYLVLRQ RI &RPSDQLHV $FW  7KH &RPSDQ\ LVHQJDJHGLQWKHH[WUDFWLRQRIOLPHVWRQH7KH&RPSDQ\KDV QRW\HWVWDUWHGLWVRSHUDWLRQV B (iv) Investments  &XUUHQW LQYHVWPHQWV DUH FDUULHG DW WKH ORZHU RI FRVW RU IDLU YDOXH/RQJWHUPLQYHVWPHQWVDUHVWDWHGDWFRVW3URYLVLRQIRU GLPLQXWLRQ LQ WKH YDOXH RI ORQJWHUP LQYHVWPHQWV LV PDGH RQO\LIVXFKDGHFOLQHLVRWKHUWKDQWHPSRUDU\ (v) Revenue recognition  5HYHQXHLVUHFRJQL]HGWRWKHH[WHQWWKDWLWLVSUREDEOHWKDW WKH HFRQRPLF EHQHoWV ZLOO pRZ WR WKH &RPSDQ\ DQG WKH UHYHQXHFDQEHUHOLDEO\PHDVXUHG Basis of preparation D. LV D SULYDWHOLPLWHG&RPSDQ\GRPLFLOHGLQ.

 E.

  WLPHYDOXHRIPRQH\DQGULVNVVSHFLoFWRWKHDVVHW3UHYLRXVO\ UHFRJQL]HG LPSDLUPHQW ORVV LV IXUWKHU SURYLGHG RU UHYHUVHG GHSHQGLQJRQFKDQJHVLQFLUFXPVWDQFHV 7KH oQDQFLDO VWDWHPHQWV KDYH EHHQ SUHSDUHG DQG SUHVFULEHG LQ DFFRUGDQFH ZLWK WKH JHQHUDOO\ DFFHSWHG DFFRXQWLQJ SULQFLSOHV LQ .QGLDQ *$$3.QGLD .

 XQGHU KLVWRULFDO FRVW FRQYHQWLRQ RQ DQ DFFUXDO EDVLV 7KH oQDQFLDO VWDWHPHQWV RI WKH FRPSDQ\ FRPSO\ LQ DOO PDWHULDO UHVSHFWV ZLWK $FFRXQWLQJ 6WDQGDUGV QRWLoHG XQGHU VHFWLRQ  RI WKH &RPSDQLHV $FW  UHDG ZLWK UXOH  RI WKH &RPSDQLHV $FFRXQWV.

 5XOHV  DQGRWKHUUHOHYDQWSURYLVLRQVRI&RPSDQLHV$FW 6DOHRISURGXFWVDQGVHUYLFHV  5HYHQXHLVUHFRJQLVHGZKHQWKHVLJQLoFDQWULVNVDQGUHZDUGV RI RZQHUVKLS RI WKH JRRGV KDYH SDVVHG WR WKH EX\HU 6DOHV DUH GLVFORVHG QHW RI VDOHV WD[  9$7 GLVFRXQWV DQG UHWXUQV DV DSSOLFDEOH ([FLVH GXWLHV GHGXFWHG IURP WXUQRYHU JURVV.

 DUHWKHDPRXQWVWKDWDUHLQFOXGHGLQWKHDPRXQWRIWXUQRYHU JURVV.

 RI WKH &RPSDQLHV $FW 7KHFRVWRIPLQLQJOHDVHLQFOXGHGLQOHDVHKROGODQGLV WR EH DPRUWLVHG RQ WKH EDVLV RI H[WUDFWLRQ RI OLPHVWRQH LQ SURSRUWLRQWRWKHDYDLODEOHUHVHUYHVRIOLPHVWRQH (iii) Impairment of assets  7KHFDUU\LQJDPRXQWVRIDVVHWVDUHUHYLHZHGDWHDFK%DODQFH 6KHHWGDWHLIWKHUHLVDQ\LQGLFDWLRQRILPSDLUPHQWEDVHGRQ LQWHUQDOH[WHUQDOIDFWRUV$QLPSDLUPHQWORVVLVUHFRJQL]HG ZKHUHYHU WKH FDUU\LQJ DPRXQW RI DQ DVVHW H[FHHGV LWV HVWLPDWHG UHFRYHUDEOH DPRXQW 7KH UHFRYHUDEOH DPRXQW LV WKHJUHDWHURIWKHDVVHW VQHWVHOOLQJSULFHDQGYDOXHLQXVH .Q DVVHVVLQJ WKH YDOXH LQ XVH WKH HVWLPDWHG IXWXUH FDVK pRZV DUH GLVFRXQWHG WR WKHLU SUHVHQW YDOXH XVLQJ D SUHWD[ GLVFRXQWUDWHWKDWUHpHFWVFXUUHQWPDUNHWDVVHVVPHQWVRIWKH YLL. DQG QRW WKH HQWLUH DPRXQW RI OLDELOLW\ WKDW DURVH GXULQJWKH\HDU([FLVHGXWLHVLQUHVSHFWRIoQLVKHGJRRGVDUH VKRZQVHSDUDWHO\DVDQLWHPRI0DQXIDFWXULQJ([SHQVHVDQG LQFOXGHGLQWKHYDOXDWLRQRIoQLVKHGJRRGV (vi) Income taxes  7D[ H[SHQVH FRPSULVHV RI FXUUHQW DQG GHIHUUHG WD[ DQG LQFOXGHVDQ\DGMXVWPHQWVUHODWHGWRSDVWSHULRGVLQFXUUHQW DQGRUGHIHUUHGWD[SURYLVLRQVWKDWPD\EHFRPHQHFHVVDU\ GXHWRFHUWDLQGHYHORSPHQWVRUUHYLHZVGXULQJWKHUHOHYDQW SHULRG &XUUHQW LQFRPH WD[ LV PHDVXUHG DW WKH DPRXQW H[SHFWHGWREHSDLGWRWKHWD[DXWKRULWLHVLQDFFRUGDQFHZLWK WKH.QGLD  'HIHUUHG LQFRPH WD[HV UHpHFW WKH LPSDFW RI FXUUHQW \HDU V WLPLQJGLIIHUHQFHVEHWZHHQWD[DEOHLQFRPHDQGDFFRXQWLQJ LQFRPH IRU WKH \HDU DQG UHYHUVDO RI WLPLQJ GLIIHUHQFHV RI HDUOLHU\HDUV  'HIHUUHGWD[LVPHDVXUHGEDVHGRQWKHWD[UDWHVDQGWKHWD[ ODZVHQDFWHGRUVXEVWDQWLYHO\HQDFWHGDWWKH%DODQFH6KHHW GDWH 'HIHUUHG WD[ DVVHWV DUH UHFRJQLVHG RQO\ WR WKH H[WHQW WKDW WKHUH LV UHDVRQDEOH FHUWDLQW\ WKDW VXIoFLHQW IXWXUH WD[DEOHLQFRPHZLOOEHDYDLODEOHDJDLQVWZKLFKVXFKGHIHUUHG WD[DVVHWVFDQEHUHDOLVHG 7KH$FFRXQWLQJSROLFLHVKDYHEHHQFRQVLVWHQWO\DSSOLHG E\WKH&RPSDQ\DQGDUHFRQVLVWHQWZLWKWKRVHXVHGLQ WKHSUHYLRXV\HDU C Use of estimates  7KH SUHSDUDWLRQ RI oQDQFLDO VWDWHPHQWV LQ FRQIRUPLW\ ZLWK JHQHUDOO\ DFFHSWHG DFFRXQWLQJ SULQFLSOHV UHTXLUHV PDQDJHPHQW WR PDNH HVWLPDWHV DQG DVVXPSWLRQV WKDW DIIHFW WKH UHSRUWHG DPRXQWV RI DVVHWV DQG OLDELOLWLHV DQG GLVFORVXUH RI FRQWLQJHQW OLDELOLWLHV DW WKH GDWH RI WKH oQDQFLDO VWDWHPHQWV DQG WKH UHVXOWV RI RSHUDWLRQV GXULQJ WKH UHSRUWLQJ SHULRG $OWKRXJK WKHVH HVWLPDWHV DUH EDVHG XSRQPDQDJHPHQW VEHVWNQRZOHGJHRIFXUUHQWHYHQWVDQG DFWLRQVDFWXDOUHVXOWVFRXOGGLIIHUIURPWKHVHHVWLPDWHV 6LJQLoFDQWDFFRXQWLQJSROLFLHV (i) Fixed assets  7DQJLEOHo[HGDVVHWVDUHVWDWHGDWWKHFRVWRIDFTXLVLWLRQOHVV GHSUHFLDWLRQ DQG DPRUWLVDWLRQ 7KH 0LQLQJ OHDVH KDV EHHQ UHFRJQLVHGDVWDQJLEOHDVVHWV (ii) Depreciation and Amortisation  'HSUHFLDWLRQ RQ WDQJLEOH DVVHWV LV FKDUJHG RYHU WKH XVHIXO OLIH DV SUHVFULEHG XQGHU 6FKHGXOH .QGLDQ.QFRPH7D[$FWHQDFWHGLQ..

 &RQWLQJHQFLHV3URYLVLRQV  $ SURYLVLRQ LV UHFRJQLVHG ZKHQ DQ HQWHUSULVH KDV D SUHVHQW REOLJDWLRQ DV D UHVXOW RI SDVW HYHQW LW LV SUREDEOH WKDW DQ RXWpRZ RI UHVRXUFHV HPERG\LQJ HFRQRPLF EHQHoW ZLOO EH UHTXLUHGWRVHWWOHWKHREOLJDWLRQLQUHVSHFWRIZKLFKDUHOLDEOH HVWLPDWH FDQ EH PDGH 3URYLVLRQV DUH QRW GLVFRXQWHG WR LWV SUHVHQW YDOXH DQG DUH GHWHUPLQHG EDVHG RQ EHVW HVWLPDWH UHTXLUHG WR VHWWOH WKH REOLJDWLRQ DW WKH %DODQFH 6KHHW GDWH 7KHVHDUHUHYLHZHGDWHDFK%DODQFH6KHHWGDWHDQGDGMXVWHG WRUHpHFWWKHFXUUHQWEHVWHVWLPDWHV$FRQWLQJHQWOLDELOLW\LV GLVFORVHG XQOHVV WKH SRVVLELOLW\ RI DQ RXWpRZ RI UHVRXUFHV HPERG\LQJWKHHFRQRPLFEHQHoWLVUHPRWH 333 .

QIRUPDWLRQ   7KH &RPSDQ\ KDV RQO\ RQH *HRJUDSKLFDO 6HJPHQW 7KH &RPSDQ\FDWHUVPDLQO\WRWKHQHHGVRIWKHGRPHVWLFPDUNHW L[.SINGHANIA MINERALS PRIVATE LIMITED (SMPL) 1RWHVWRWKHoQDQFLDOVWDWHPHQWVIRUWKH\HDUHQGHG'HFHPEHU (viii) Earnings per share  WKH &RPSDQ\ DVFHUWDLQHG LWV RSHUDWLQJ F\FOH DV  PRQWKV IRU WKH SXUSRVH RI &XUUHQW  1RQ FXUUHQW FODVVLoFDWLRQ RI DVVHWVDQGOLDELOLWLHV %DVLF HDUQLQJV SHU VKDUH DUH FDOFXODWHG E\ GLYLGLQJ WKH QHW SURoWRUORVVIRUWKH\HDUDWWULEXWDEOHWRHTXLW\VKDUHKROGHUV E\ WKH ZHLJKWHG DYHUDJH QXPEHU RI HTXLW\ VKDUHV RXWVWDQGLQJGXULQJWKH\HDU (x) Segment Reporting  7KH &RPSDQ\ KDV RQO\ RQH EXVLQHVV VHJPHQW COLPHVWRQH H[WUDFWLRQ  DV LWV SULPDU\ VHJPHQW DQG KHQFH GLVFORVXUH RI VHJPHQWZLVHLQIRUPDWLRQLVQRWUHTXLUHGXQGHU$FFRXQWLQJ 6WDQGDUGC6HJPHQWDO.

.. RI WKH &RPSDQLHV $FW %DVHGRQWKHQDWXUHRISURGXFWVDQGWKHWLPHEHWZHHQ WKHDFTXLVLWLRQRIDVVHWVIRUSURFHVVLQJDQGWKHLUUHDOLVDWLRQ SHARE CAPITAL As at December 31. 2015 ` $VDW 'HFHPEHU  ` Authorised Shares LLL. &XUUHQW1RQ&XUUHQW  3. $OO DVVHWV DQG OLDELOLWLHV DUH SUHVHQWHG DV &XUUHQW RU 1RQ FXUUHQW DV SHU WKH &RPSDQ\ V QRUPDO RSHUDWLQJ F\FOH DQG RWKHU FULWHULD VHW RXW LQ 6FKHGXOH .

2015  No. of shares 1RRIVKDUHV $&&/LPLWHG +ROGLQJ&RPSDQ\. (TXLW\ VKDUHV KHOG E\ KROGLQJ FRPSDQ\  XOWLPDWH KROGLQJ DQG their subsidiaries As at December $VDW'HFHPEHU 31.

20. of shares  $&&/LPLWHG +ROGLQJ &RPSDQ\. 2015 $VDW'HFHPEHU (Previous Year .000)(TXLW\6KDUHV of `HDFK As at December 31.000)(TXLW\6KDUHV of `HDFKIXOO\SDLG  No.000)(TXLW\6KDUHV of `HDFK     Issued iv) (Previous Year .20.20. (Previous Year .

$OOWKHVKDUHVDUHKHOGE\$&&/LPLWHGWKH +ROGLQJ&RPSDQ\DQGLWVQRPLQHHV.

TOTAL  % holding  4. (TXLW\6KDUHVDWWKH EHJLQQLQJRIWKH\HDU Movement during the year (TXLW\6KDUHVDWWKH end of the year LL.

of shares  Details of shareholders holding more than 5% shares in the Company Subscribed & Paid-up L. 2015 $VDW'HFHPEHU Amount ` 1RRI VKDUHV  5HFRQFLOLDWLRQRIQXPEHURIHTXLW\VKDUHVRXWVWDQGLQJ No. 1RRI VKDUHV  KROGLQJ   RESERVES AND SURPLUS As at December 31.

  $PRXQW `             7KHFRPSDQ\KDVRQO\RQHFODVVRIHTXLW\VKDUHVKDYLQJSDUYDOXH of `  SHU VKDUH (DFK KROGHU RI HTXLW\ VKDUHV LV HQWLWOHG WR RQH YRWHSHUVKDUH7KHGLYLGHQGSURSRVHGE\WKH%RDUGRI'LUHFWRUVLV VXEMHFWWRWKHDSSURYDORIWKHVKDUHKROGHUVLQWKHHQVXLQJ$QQXDO *HQHUDO0HHWLQJH[FHSWLQFDVHRILQWHULPGLYLGHQG $VDW 'HFHPEHU  ` ` 6XUSOXVLQ6WDWHPHQWRI3URoWDQG/RVV %DODQFHDVSHUODVW)LQDQFLDO VWDWHPHQWV $GG3URoW /RVV.

 .IRUWKH\HDU 7HUPVULJKWVDWWDFKHGWRHTXLW\VKDUHV As at December 31. 2015 TOTAL 5.

 .

 .

 .

.

 .

Long-term borrowings As at December 31. 2015 $VDW 'HFHPEHU  ` ` 8QVHFXUHG )URP+ROGLQJ&RPSDQ\     3D\DEOHRQGHPDQG.

TOTAL 334 .

2015 $VDW 'HFHPEHU  ` ` 7'63D\DEOH   TOTAL   Other expenses ` $VDW 'HFHPEHU  ` 3URYLVLRQIRU([SHQVHV   TOTAL   *5266%/2&. 2015 )RUWKH year ended 'HFHPEHU  ` ` 6WDWXWRU\$XGLWIHHV   $XGLWIHHVIRUWD[oQDQFLDOVWDWHPHQWV   )RURWKHUVHUYLFHV   (b) Total   Total Other Expenses (a+b)   As auditors Long-term loans and advances As at December 31.1 Payment to Statutory Auditors (excluding service tax) For the year ended December 31. 2015 $VDW 'HFHPEHU  ` ` 6HFXULW\GHSRVLWV 'HSRVLWVZLWK0LQLQJ 'HSDUWPHQW.Corporate Overview Financial Highlights Board & Management Reports Financial Statements Subsidiary Companies 1RWHVWRWKHoQDQFLDOVWDWHPHQWVIRUWKH\HDUHQGHG'HFHPEHU 6. Other current liabilities 11.$7&267 As at 01-01-2015 ` /HDVHKROG/DQG As at 31-12-2015 ` $VDW  `     TOTAL     3UHYLRXV<HDU            2WKHU([SHQVHV (a) Total       11. As at December 31.

2015 $&&/LPLWHG  &ORVLQJ%DODQFHDVDW 'HFHPEHU  335 . As at 31-12-2015 ` Tangible Assets : 9. For the year ended December 31. Related Party Disclosure 3DUWLFXODUVRIUHODWHGSDUWLHVZKHUHFRQWUROH[LVWV $&&/LPLWHG (i) Opening balances of the Related Party 8QVHFXUHG&RQVLGHUHG*RRGXQOHVV RWKHUZLVHVWDWHG 10. 6HFUHWDULDO /HJDO([SHQVHV Fixed Assets 3DUWLFXODUV ` 2IoFH*HQHUDOH[SHQVHV Short-Term Provisions As at December 31. 2015 $VDW 'HFHPEHU  ` ` &DVKDQGFDVKHTXLYDOHQWV     &DVKRQKDQG TOTAL ` 1DPHRIWKH5HODWHG3DUW\ 1DPHRIWKH5HODWHG3DUW\ 1DWXUHRI5HODWLRQVKLS +ROGLQJ&RPSDQ\ 2SHQLQJ%DODQFHDVDW -DQXDU\ $&&/LPLWHG (ii) Related Party Transaction  7UDQVDFWLRQZLWK5HODWHG3DUW\ 'XULQJWKH\HDUHQGHG 'HFHPEHU /RDQUHFHLYHGGXULQJWKH\HDU  . `  7UDYHOLQJ([SHQVHV 1(7%/2&. )RUWKH year ended 'HFHPEHU  %DQN&KDUJHV 'HDG5HQW 7. 2015 8.   TOTAL   Cash and bank balances As at December 31.QWHUHVWFKDUJHGGXULQJWKH\HDU (iii) Closing Balance of Related Party 1DPHRIWKH5HODWHG3DUW\ %DODQFHVZLWKEDQNV 2QFXUUHQWDFFRXQWV 12.

[EPS] 1HW3URoWDVSHU6WDWHPHQWRI3URoWDQG/RVV For the year ended December 31. Earnings per Share . 2015 )RUWKH\HDUHQGHG 'HFHPEHU ` `  .SINGHANIA MINERALS PRIVATE LIMITED (SMPL) 1RWHVWRWKHoQDQFLDOVWDWHPHQWVIRUWKH\HDUHQGHG'HFHPEHU 13.

 .

:HLJKWHGDYHUDJHQXPEHURIHTXLW\VKDUHVIRU(DUQLQJV3HU6KDUHFRPSXWDWLRQ   1XPEHURI6KDUHVIRU'LOXWHG(DUQLQJV3HU6KDUH     %DVLF  .

 .

'LOXWHG  .

 .

 $GGLWLRQDOLQIRUPDWLRQSXUVXDQWWRSURYLVLRQVRISDUDJUDSK YLLL. 7KHUHDUHQR0LFUR6PDOODQG0HGLXP(QWHUSULVHVDVGHoQHGLQWKH0LFUR6PDOO0HGLXP(QWHUSULVHV'HYHORSPHQW$FWWRZKRPWKH &RPSDQ\RZHVGXHV  7KLVLQIRUPDWLRQKDVEHHQGHWHUPLQHGWRWKHH[WHQWVXFKSDUWLHVKDYHEHHQLGHQWLoHGRQWKHEDVLVRILQIRUPDWLRQDYDLODEOHZLWKWKH&RPSDQ\ 7KLVKDVEHHQUHOLHGXSRQE\WKHDXGLWRUV 15. (DUQLQJV3HU6KDUH )DFHYDOXHSHU6KDUH 14.

 7KHUHLVQRSHQGLQJOLWLJDWLRQE\RUDJDLQVWWKHDJDLQVWWKHFRPSDQ\DVRQGDWHRIoQDQFLDOVWDWHPHQWZKLFKFDQHIIHFWWKHoQDQFLDOV 18.RI&RPSDQLHV$FWLVHLWKHUQLORUQRWDSSOLFDEOH 16. 7KHFRPSDQ\KDVDOUHDG\DSSOLHGWR&RPSDQ\/DZ%RDUGIRUIROORZLQJFDOHQGHU\HDU-DQ'HFSHULRGLQVWHDGRI$SULO0DUFKSHULRGDVSHUWKH VHFWLRQ .RIVFKHGXOH. 7KH FRPSDQ\ KDV DFFXPXODWHG ORVVHV DV DW 'HF DQG QHW ZRUWK LV QHJDWLYH 7KH FRPSDQ\ KDV REWDLQHG VXSSRUW IURP $&& /LPLWHG C+ROGLQJ&RPSDQ\ $&&/LPLWHGDVVXULQJFRQWLQXRXVVXSSRUWWRoQDQFHWKHRSHUDWLRQVRIWKHFRPSDQ\+HQFHDFFRXQWVKDYHEHHQSUHSDUHGRQ JRLQJFRQFHUQEDVLV 17. 7KHUHKDVEHHQQRIDLOXUHWRWUDQVIHUDQ\DPRXQWOLDEOHWREHWUDQVIHUUHGWR..QYHVWRUV(GXFDWLRQDQG3URWHFWLRQ)XQG 20. 7KH&RPSDQ\GRHVQRWKDYHDQ\ORQJWHUPFRQWUDFWVLQFOXGLQJGHULYDWLYHFRQWUDFWVIRUZKLFKWKHUHZHUHDQ\PDWHULDOIRUHVHHDEOHORVVHV 19..

)LUP5HJLVWUDWLRQ 1R: R S RATHORE Director Sachin A.RI&RPSDQLHV$FW7KHDSSURYDOIRUWKHVDPHLVDZDLWHG 21. Chartered Accountants . Aiyar & Co.S. Negandhi Partner 0HPEHUVKLS1R 0XPEDL-DQXDU\ 336 S. VISWANATHAN Director .&$. 3UHYLRXVSHULRGoJXUHVDUHUHJURXSHGUHVWDWHGZKHUHYHUQHFHVVDU\ $VSHURXUUHSRUWRIHYHQGDWH )RUDQGRQEHKDOIRIWKH%RDUGRI6LQJKDQLD0LQHUDOV3ULYDWH/LPLWHG For K.

RONDWD.A National Footprint Himachal Pradesh  Punjab 7 Uttarakhand 20 Haryana    Uttar Pradesh 27 Rajasthan 11 Bihar 10  Jharkhand Gujarat  West Bengal Madhya Pradesh Chhattisgarh 19  2 Odisha Maharashtra 1 8 24 4  Telangana  21 17 Goa 18 Karnataka Andhra Pradesh 9 14 22 5HJLRQDO6DOHV2IoFHV (DVWHUQ5HJLRQ .

1RUWKHUQ5HJLRQ 1HZ'HOKL.

:HVWHUQ5HJLRQ 7KDQH.

 6RXWKHUQ5HJLRQ %HQJDOXUX.

\PRUH $&&6FKRROIRU7HFKQLFDO6NLOO'HYHORSPHQW:DGL Tamil Nadu 12 Kerala Ready Mixed Concrete (RMX) Plants Sales Units &RUSRUDWH2IoFH  0XPEDL 0DKDUDVKWUD.QGLD7KDQH0DKDUDVKWUD Training Centres $&&$&//HDGHUVKLS$FDGHP\7KDQH $&&&HPHQW7HFKQRORJ\.   7(&+32577KDQH0DKDUDVKWUD *HRF\FOH.QVWLWXWH.QVWLWXWH-DPXO 6XPDQW0RROJDRNDU7HFKQLFDO.

$&&+HOS&HQWUHV Cement Plants  %DUJDUK 2GLVKD.

 &KDLEDVD -KDUNKDQG.

 &KDQGD 0DKDUDVKWUD.

 'DPRGKDU :HVW%HQJDO.

 +3.  *DJDO.

 *DJDO.. +3.

 -DPXO &KKDWWLVJDUK.

XGLWKLQL .  .DUQDWDND.

\PRUH 03. .

Subsidiary Companies  $&&0LQHUDO5HVRXUFHV/LPLWHG  0DKDUDVKWUD.

QGLD.  %XON&HPHQW&RUSRUDWLRQ .

/LPLWHG  0DKDUDVKWUD.

  /XFN\0LQPDW/LPLWHG 5DMDVWKDQ.

 1DWLRQDO/LPHVWRQH&RPSDQ\3YW/WG  5DMDVWKDQ.

  6LQJKDQLD0LQHUDOV3YW/WG  0DGK\D3UDGHVK.

/DNKHUL 5DMDVWKDQ.

0DGXNNDUDL 71.

6LQGUL -KDUNKDQG.

DUQDWDND. 7KRQGHEKDYL .

7LNDULD 83.

 9L]DJ $3.

:DGL.DUQDWDND. .

:DGL..DUQDWDND. .

. Andaman. 2016. Nicobar and Lakshadweep islands are not shown. This map is as of February 10. It is illustrative and not drawn to scale.

ACC Limited 5HJLVWHUHG2IoFH Cement House 121. India. ZZZDFFOLPLWHGFRP . Maharshi Karve Road Mumbai 400 020.