You are on page 1of 182

12/25/2016

AdvancedLucidDreaming

Thisisthehtmlversionofthefilehttp://www.cortexel.us/awesome/uppers/Advanced_Lucid_Dreaming
The_Power_of_Supplements.pdf.
Googleautomaticallygenerateshtmlversionsofdocumentsaswecrawltheweb.

Page1

AdvancedLucidDreaming
ThePowerofSupplements
HowtoInduceHighLevelLucidDreams
&OutofBodyExperiences

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_of

1/182

12/25/2016

AdvancedLucidDreaming

WrittenByThomasYuschak
AdvancedLD,Ltd

Page2

Copyright2006ThomasYuschak
Allrightsreserved.Thisbookisprotectedbycopyright.Noportionof
thisbookmaybereproducedordistributedinanyformorbyany
means,electronicormechanical,includingphotocopy,recording,or
byanyinformationstorageandretrievalsystem,withouttheprior
writtenpermissionoftheauthor.
PublishedbyLuluEnterprises
ISBN9781430305422
Thisbookcanbepurchasedatwww.AdvancedLD.com
TheAuthorcanbecontactedat:
tyuschak@AdvancedLD.com

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_of

2/182

12/25/2016

AdvancedLucidDreaming

Page3

SpecialThanks
Thankyoutoeveryonewhomadepublishingthistextpossible.
ThankyoutoScotStridefortakingthetimetoreviewthistextandfor
providingsomanyvaluablesuggestions.
Thankyoutomybeautifulwifeandtoouramazingboysforhelping
toopenmyeyes,mymind,andmyheart.
MaythistexthelpothersgowhereIhavebeen.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_of

3/182

12/25/2016

AdvancedLucidDreaming

Page4

Disclaimer
Thistextsummarizeshowtheauthorhasusedavarietyoflegal,
nonprescriptionsupplementstoinducehighlevelluciddreamsand
outofbodyexperiences.Theauthorsuggeststhathisapproachmay
producesimilarresultsinawidevarietyofpeopleofdifferent
backgroundandculture.Theauthorstronglyrecommendshowever,
thatanyindividual,whoisinterestedinattemptinganapproachthat
utilizessupplementsforthepurposesofluciddreamenhancement
and/oroutofbodyexperiences,consultsaqualifiedphysicianbefore
addinganysupplementoranycombinationofsupplementstohis/her
diet.TheauthorandAdvancedLD,Ltd(fromhereonjointlyreferred
toasAdvancedLD)alsostronglyrecommendsthatanypersonwho
purchasesorreadsthisbookabidebythefollowing:
1.Thesupplementapproachoutlinedinthisbookisintendedfor
adultsonly.Personsundertheageof18shouldnottakeany
supplementsforanyreasonwithoutfirstconsultingwitha
qualifiedphysician.
2.AdvancedLDshallnotbeheldresponsibleinanywayforthe
misuseoftheinformationcontainedwithinthisbook.
3.AdvancedLDstronglyrecommendsthatallpersonscontact
his/herphysicianbeforestartingtheprogramoutlinedinthis
bookinordertogetadoctor'sapprovalpriortotakingany
supplementsdiscussedinthisbook.
4.AdvancedLDinsiststhatifthereaderhasanyknownor
suspectedmedicalconditions,thatmayincludebutisnot
limitedtopregnancy,heartdisease,highbloodpressure,
mentaldisorder,kidneydisorder,liverdisorder,immune
systemdisorder,historyofstroke,historyofseizure,etc,then
thereaderwillcontactaphysicianandgetaphysicians
approvalpriortotakinganyofthesupplementsdiscussedin
thisbook.
5.AdvancedLDshallnotbeheldresponsibleinanywayif
dosagesbeyondthosestatedaretakenbythereaderand
resultinnegativeeffectsonhealthand/orwellbeing.
6.AdvancedLDshallnotbeheldresponsibleinanywayifthe
profoundeffectsofluciddreamingand/oroutofbody
experienceshaveanegativeeffectonthereaderspsyche
and/ormentalhealth.Theseexperiencesareextremely
profoundandthereforethereadermustjudgeforhim/herself

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_of

4/182

12/25/2016

AdvancedLucidDreaming

Page5

orhaveaprofessionalpsychologistjudgeforhim/herwhether
ornothe/sheisreadytoundergosuchanexperience.
7.AdvancedLDmakesnoclaimsastowhatonecanaccomplish
inthelucid(oroutofbody)stateandpassesnojudgmenton
the"true"meaningoftheseexperiences.
8.Thereaderagreesnottoforward,publish,ordistributethis
bookorthedetailsheldwithin,inanyformormanner.
9.Thereaderissolelyresponsibleforattainingaphysician's
approvalbeforetakinganysupplementdiscussedinthis.

10.Thereaderassumesallliabilityifhe/shepassesthis
informationtootherswithoutfullydivulgingtherisksand
recommendationssetforthinthistext.

Page6

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_of

5/182

12/25/2016

AdvancedLucidDreaming

TableofContents
Foreword

Introduction

Part1:TheoreticalBackground
Ch1OpeningRemarks

15

Ch2ReviewoftheSleepCycle

17

Ch3ReviewoftheREMReboundEffect

20

Ch4PredominateDreamTheories

22

Ch5NeurotransmittersandDreaming

28

Part2:IndividualSupplementProfiles
Ch6ImportantDefinitions

47

Ch7Galantamine

60

Ch8CholineSupplements

66

Ch9Nicotine

75

Ch10Piracetam

81

Ch11MucunaPruriens

88

Ch12Yohimbine

94

Ch135HTP(5hydroxytryptophan)

100

Ch14Melatonin

105

Part3:AchievingHighLevelLucidDreams
Ch15AreYouReadyForThis?

111

Ch16UnderstandingtheStrategy

120

Ch17PrimaryTriggerCombination

126

Ch18CounteractingDesensitizationandTolerance

132

Ch19MultipleTriggerCombinations

142

Ch20SupportingSupplements

150

Page7

Part4:ImprovingYourOdds
Ch21DaytimePractice

156

Ch22PreparationandTransitioning

160

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_of

6/182

12/25/2016

AdvancedLucidDreaming

Ch23BreakingDowntheWall

172

Ch24KeepinganUptoDateLog

176

Ch25WhereDoIgoFromHere

178

Reference

180

Index

186

Page8
2

Foreword:
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_of

7/182

12/25/2016

AdvancedLucidDreaming

Consciousdreamingisafascinatingaspectofthehuman
mind.Notuntilthelate1970sdidthereemergeascientificproofthat
apersoncouldrecognizeandbeawaretheyweredreaming.Lucid
dreaminghascomealongwaysincethenandwecanthankGreen,
Tholey,Hearne,LaBerge,Woresly,Garfield,Blackmoreandothers
fortheiressentialcontributions.Byfarthemostvaluedcontributions
weremadebyLaBergewhohasbeenactiveinthisfieldfornearly30
years.
Manytechniquesandinnovationsforluciddreaminghave
emergedduringthistime,benefitingmanyapersonwantingto
exploretheirpersonaldreamenvironment.Presently,thetechniques
availabletoprospectiveoneironauts(dreamexplorers)include:
StateTesting,Intention,ReflectionIntention,Autosuggestion,MILD
(MnemonicInductionofLucidDreams),WBTB(WakeBackToBed),
WILD(WakeInducedLucidDreams),CAT(CycleAdjustment
Technique)andothers.Thesementaltechniquesinvolvetraining
yourmindtobecomemorecognitivelyawareduringdreaming,so
youcanbecomelucid.Inadditiontotheseentirelymental
techniques,electronictechniques,intheformofdreammasks,were
invented.TheseincludedtheDreamLight,NovaDreamerand
DreamMaker.Electronicdevicesareintendedtocuethedreamer
duringREMsleep(eitheropticallyorauditory),helpingthemto
recognizetheyaredreamingandbecomelucid.

Page9
3

Foreword

Fortunately,thereisplentyofroomforgrowthandexpansion
fromnewtechniquesandinnovations.Myownresearchinto
electronicmeansofhelpinginduceluciddreamsledtothedesignof
aluciddreaminductionsystem(LDIS).Thissystemwasmyattempt
toimproveupontheversatilityandreliabilityofadreammaskbased
onmodernelectronics,imagingtechnologyandsoftware.Aftertwo
workingprototypesandsomeveryencouragingtestresults,Ican
confidentlystatethatafirstratesystemispossible,onewhichcanbe
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_of

8/182

12/25/2016

AdvancedLucidDreaming

producedaffordablyforthedreamingconsumer.
SofarIvementionedtwoavenuesavailabletothe
oneironaut,thementalandtheelectronic.Bothoftheseapproaches
tolearningluciddreaminghavefoundtheirplaceintheoneironauts
toolbox.However,thereisathirdandexcitingavenuethatoffers
muchpotentialforgrowththisistheneurochemistryapproach.
Neurochemistryisabranchofneurosciencethatinvolvesthe
studyofthechemicalprocessesinthebrain.Bystudyingthese
processesscientistsareendeavoringtounderstandtheunderlying
molecularbasesformemory,emotions,cognition,behaviorand
diseasesofthebrainlikeAlzheimers.Someofthemoleculesbeing
studiedare:Glutamate,Histamine,GABA(GammaAminoButyric
Acid),Acetylcholine,Serotonin,Dopamine,NorepinephrineandNitric
oxide.Theseneurochemicals,andothers,areplayersinafascinating
electrochemicaldramathatrunscontinuouslyinourbrainsfrom
conceptiontodeath.
Thesameneurochemicalsthatplayimportantrolesinour
wakingstatearealsopresentinoursleepingstate.Neuroscience
hasledtoaclearerunderstandingofwhatshappeningchemicallyin
thebrainduringthesleepcycles.Chemicals,likeMelatonin,change

Page10
4

ThePowerofSupplements

duringthecourseofanormalsleepperiodandhelpmanageour
circadianrhythms.Otherchemicalsarealsopresent,invarying
amounts,duringREMsleepwhenluciddreamingmainlyoccurs.Of
thesechemicals,theneurotransmittersarethemostimportant,for
theycarrytheelectrochemicalsignalsthroughoutthebrainsneural
pathways.
Althoughthereisnoscientificstudythatlinksspecifickinds
andquantitiesofneurotransmitterstoluciddreaming,Isurmisea
relationshipdoesexist.Manytimeswouldbeoneironautswill
diligentlypracticeamentaltechnique,likeMILD,orcombineitwitha
dreammask,onlytoexperiencediscouragingresults.Sometimes
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_of

9/182

12/25/2016

AdvancedLucidDreaming

theytrymultipletechniquesandstillstruggle.Thesetechniqueswork
superblywellforsomeandabysmallyforotherstheonlydifference
maybethelevelsofcertainneurotransmittersduringREMsleep.If
thereweresomewaytosafelyboostcertainofthese
neurotransmittersduringREMsleep,thesuccessratemayrise,
turningfrustrationintojoy.
Theheadlinenewsisthereexistsawaytoincreasethese
neurotransmittersbyingestingcertaindietarysupplements.These
supplementscomprisealuciddreamingtechniquewhichItermLucid
DreamingSupplements(LDS).LDSareoverthecountervitamins
andsupplementsthataidinhelpingthebrainattainaneurochemical
statewhichisconducivetohavingaluciddream.
Notsurprisingly,LaBergehasalsodonesomeresearchinto
theseneurotransmittersandidentifiedatypeofsupplementthat
worksremarkablywellatboostingAcetylcholine(ACh)levelsby
inhibitingAcetylcholinesterase(anenzymethatbreaksdown
Acetylcholineintocholineandacetate).ThepresenceofanAChEI

Page11
5

Foreword

(AcetylcholinesteraseInhibitor)worksbyincreasingthelevelsand
activationofACh.Cholinergicneuronsareinvolvedinthesynthesis
ofAChandbelievedtomodulateourlevelofwakefulness.Taking
supplementsthateffectivelyraiseAChlevelsaffectthewakefulness
ofthedreamingbrainandhenceitsabilitytobecomemoreaware.
LaBergewasabletoclinicallyshowthatingestingcertain
AChEIsdoesimprovetheabilitytobecomelucid.Hisstudyisjust
thetipoftheicebergintheLDStechniqueandunderscoresthefact
thatcertainsupplementsfavorablyimproveanoneironautsoddsof
becominglucid.Manyoverthecountersupplementsareavailable
thataffectthevariousneurotransmittersthismakestheLDS
techniquefairlywideopentoexperimentationandrefinement.Ihave
personallytakensomeofthesesupplementsandconsequently
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

10/182

12/25/2016

AdvancedLucidDreaming

enjoyedsomelongandmemorableluciddreams.
AftercorrespondingwithThomasYuschakonhisapproachto
theLDStechniqueIamverypleasedandimpressedbyhiswork.He
hasworkedhardtoidentifyspecificsupplementsthat,whentakenat
therighttimeandinhealthydosages,canopenthedoorstomany
oneironautwhoneedhelp.Eithertakenalone,orcombinedwiththe
existingmentalandelectronictechniques,inacomplementary
manner,supplementscanrewardtheoneironautwithamore
powerfultoolbox.
Thisbookisanimportantfirststepinintroducingtothe
oneironautanewandexcitingluciddreamingtechnique:atechnique
thatpromisestomakeiteasiertoconsciouslydream,andexplorean
elusiveaspectofourinnerselves.
ScotL.Stride
Pasadena,California
October,2006

Page12
6

Introduction:
WhyIwrotethisbook:Mymaingoalinwritingthisbookis
simplytosharewhatIhavelearnedthroughpersonalexperience
aboutthepowerofnonprescriptionsupplementsinachievinghigh
levelluciddreamexperiencesand/oroutofbodyexperiences.There
isaquietmovementgrowingamongluciddreamerswhohavefound
thatcertainnaturalsubstancesprovideacatalysttoincreaseddream
memory,vividness,andlucidity.Unfortunately,thereislittle
informationavailabletoactasaguidefortheseindividuals.Thishas
ledtomuchspeculation,hearsay,andmisguidedapproachesthat
haveresultedinabsolutelynothingspectacular.Thefewwhohave
experiencedpositiveresultsoftenfindtheyfadewithtimeand
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_of 11/182

12/25/2016

AdvancedLucidDreaming

becomeinfrequentatbest.
Furthermoretherearethosewhoareputtingthereownhealthatrisk
becausetheydonotfullyunderstandingorappreciatethecorrect
approachandtheimportantfactorsonemustconsiderwhenutilizing
asupplementapproachtoluciddreaming.Whatismissingisa
comprehensiveguidethatremovestheguessworkaltogetherand
setspeopleonthecorrectpathofdevelopment.Thisbookismy
attemptatsuchaguide.

Page13
Introduction

Itismysincerebeliefthatluciddreamingcanhaveadramatic
andpositiveeffectontheglobalsocietyandcultureasawhole,and
canhelptoopenoureyestothepotentialweallholdinsideofus.In
orderforthattohappenhowever,advancedluciddreamingmust
becomeavailabletothegeneralpublic.Typicalluciddreamers
strugglewithluciddreamfrequency,length,recall,vividnessand
control.Themethodpresentedinthisbookaddressesallofthese
issuesandopensthedoorforalmosteveryonetoexperience
extremelyhighlevelluciddreams.
Atthetimeofthiswritingthereisnootherbookavailablethat
providesacomprehensivemethodofusingnatural,andgenerally
healthynonprescriptionsupplementsasameansofproducing
extremelyhighqualityandlongdurationluciddreamexperiences.
Thatsetsthisbookapartfromallothersandwillhopefullyaidin
wakingupthegeneralpublictothewondersandpowersoflucid
dreaming.

Whatthisbookisandwhatthisbookisnot:
Thisbookisnotacomprehensivelistofsupplementsthat
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

12/182

12/25/2016

AdvancedLucidDreaming

haveproventohaveapositiveimpactondreamingand/orlucid
dreaming.Therearemanysupplementsavailablewhichhavesome
effectonhowandwhatwedreamanditisnotmygoaltocreatea
longandrelativelyuselesslist.InsteadIfocusonthesupplements
thathavehadthemostprofoundeffectsonmyowndream/lucid
dreamdevelopmentand,moreimportantly,Iprovideameansof
comparingallsupplementsbythemechanismtheyuseratherthan
thenamestheyarecalled.InthiswayIprovideamethodof
comparinganyothersupplementthatonefeelsmighthavethe

Page14
8

ThePowerofSupplements

potentialtoenhanceluciddreaming.Furthermore,Ihaveincluded
sectionsthatdiscusstheeffectsofthesupplementswhentaken
individuallyaswellaswhentakenindifferentcombinations.
Thisbookisnotanoverlytechnicaltreatiseonthe
neuroscienceofsleepordreams.Althoughsomebasicconceptsand
definitionsareincludedasameansofprovidingabetter
understandingofhowsupplementscanfunctiontoincreasethe
quality,frequency,anddurationofluciddreams,Ihavepurposefully
triedtokeepthesciencetalktoaminimum.Itismygoalthatthe
readercanfullyunderstandandtakeadvantageoftheinsightsthis
bookprovides.
Thisbookisnotanauthoritativereferenceonmodernday
dreamtheoriesafascinatingtopic,butonethatisbeyondthescope
ofthistext.Iwillbrieflysummarizethetwomajorschoolsofthought
however,becausetheybothplayamajorroleindeterminingwhich
supplementsmightworkbest.
Thisbookisnotaonesizefitsallbook.Whathasprovento
workexcellentlyformemaynotberightforyou.EventhoughIwill
sharemydetailedsupplementschedule,includingexactdosesand
consumptiontimes,youshouldconsiderthisasapointofreference
only.Youwillfindthatingeneral,Ihaveplacedaveryhighregardfor
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

13/182

12/25/2016

AdvancedLucidDreaming

myownpersonalhealthandhappiness.Iexpectyoutodothesame.
Blindlyfollowingaschedulemaycauseyouharminthelongrun,soI
havetriedtoincludetheknowledgeyouneedtooptimizeyourown
supplementprogramaswellasexperiencefirsthandtheeffectsof
eachofthesupplementsdescribed.
Finally,thisbookisnotabasicluciddreamingbook.Ihave
writtenitprimarilyforexperiencedluciddreamerswhowanttotake

Page15
Introduction

theirexplorationstoahigherlevel.Ifyouhavenotyetexperienceda
luciddreamthenIstronglyencourageyoutoputthisbookdownand
gobuyoneoftheexcellentbooksaimedatgettingyoustartedinthis
wonderfulfield.Afteryouhavegoneinandseenforyourselfwhata
luciddreamreallyis,thencomebacktothisbookandtake
advantageofthemethodscontainedherein.Luciddreamingisaskill
youmustdevelopwithpracticeandmovingatthecorrectspeedwill
getyoumuchfurtherinthelongrun.

SowhatISthisbook?
ThisbookismyexperienceandmymethodofhowIhave
successfullybeenabletogeneratehighlevel,longdurationlucid
dreamsonregularbasisusingaspecificcombinationoflegal,over
thecounter,andgenerallyhealthydietarysupplements.Thisbook
notonlygivesthefinalrecipesthatworkformepersonallybutalso
detailsthemeansIusedtodeterminetheserecipessothatanyone
canintelligentlydeveloptherightcombinationsforthemselves.

LucidDreamsvsOutofBodyExperiences
Thereisconsiderabledebateabouttherelationshipbetween
luciddreamsandoutofbodyexperiences.Somepeoplebelievethat
anoutofbodyexperienceisaspecialtypeofluciddream.Iamone
ofthosepeople.Twotypesofluciddreamsareoftentalkedabout
amongenthusiasts:DILDsandWILDs.ADILD(DreamInduced
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

14/182

12/25/2016

AdvancedLucidDreaming

LucidDream)isthemoreprevalenttypeofluciddreaminwhicha
personisasleepanddreamingwhentheynoticesomethingoddand
suddenlyrealizetheyareinthemidstofadream.DILDsstartas
regularnonluciddreams.AWILD(WakeInducedLucidDream)is

Page16
10

ThePowerofSupplements

characterizedbymovingdirectlyfromtheawakestateintothedream
statewithnolossofconsciousness.Onemomentyouareconscious
inyourphysicalbodyandthenextmomentyouareconsciousinyour
dreambody.Duringthetransitionfromthephysicaltothedreamyou
canundergosomeintensesensationssuchasafeelingoffloating,
strongvibrations,and/orrapidaccelerations.Thesearethesame
sensationsthatareoftenreferredtoinmostOBEaccounts.
Furthermore,whenthetransitionfromonebodytotheotheris
complete,thereisaboutan85%chancethatyouwillfindyourself
standinginyourbedroom.Atthispointyoucanwalkaroundthe
houseatyourleisure.Atsomepointthesurroundingstransitionintoa
differentlocaleeitherspontaneouslyorbyconsciouseffort.Thistype
ofWILDisanOBEbyallclassicaldefinitionsandthemethods
describedinthisbookresultinWILDsabout90%ofthetime.To
simplifythewriting,IwillrefertoeitherluciddreamorWILDwiththe
understandingthattheexperienceissynonymouswithOBEs.

Whatisahighlevelluciddream?
Thedefinitionofluciddreamingis,inmyopinion,overlysimplistic.
AccordingtoStephenLaBerge,apopularauthorandexperimenter
onthesubject,luciddreamingisdefinedas"dreamingwhileknowing
thatyouaredreaming."Thoseexperiencedinluciddreaming
understandhowever,thatthequalityoftheexperiencecanvary
greatlyfromdreamertodreameraswellasfromdreamtodream.In
the10orsoyearsIhavebeenpracticingluciddreamingIcontinually
rankedmyexperiencesbyanumberofcriteriaincluding:durationof
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

15/182

12/25/2016

AdvancedLucidDreaming

thedream,sensoryvividness,abilitytorecalltheexperience,andthe
abilitytocontrolmyreasoning,emotions,andwillallwhilestaying

Page17
Introduction

11

activelyinvolvedwithinthedream.Anotherimportantcriterionin
advancedluciddreamingisthefrequencyinwhichyoucanenterthe
lucidstate.Hereisacomparisonofhighlevelluciddreamingto
averageluciddreaming:

UsingthesupplementapproachoutlinedinthisbookIhave2
to3nightsperweekofhighlevelluciddreaming.Thedreams
generallylastinexcessofanhourandcanoccasionallylastaslong
astwoandhalfhours.Mysensesfunctionaswellastheydoin
wakinglifeandmydreamsgenerallyincludetheuseofallmy
senses.Icontinuallyshowhighlevelsofcontrolthatincludeeasy
accesstomymemoriesfrommyphysicallife,totallackoffeareven
inthemostadversesituations,theabilitytosuccessfullycarryoutmy
dreamexperiments,andtheabilitytoeasilymanipulatemy
dreamscape.Thisisntbragging,itsthepowerthattheright
combinationofsupplementscanhaveonluciddreaming.
Furthermore,onceonecanrepeatedlyexperiencehighlevellucid

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

16/182

12/25/2016

AdvancedLucidDreaming

Page18
12

ThePowerofSupplements

dreams,theycanfocusonunlockingthesecretsthatourcontained
within.
Althoughmanyreaderswillundoubtedlybedrawntothe
sectionsofthisbookthatcoverthebestofthebestoftheavailable
dreamenhancingsupplementsorthesectionsthatdetailmy
personalandexactmethodofachievingfrequentandconsistent,
longdurationluciddreams,Irecommendreadingthisbookfromstart
tofinish.Thisbookhasawealthofinformationsoyoumaywantto
revisitthefirstfewchaptersafteryouhavefinishedthecomplete
book.Thisapproachwillgiveyouadeeperunderstandingofthe
topicandbetterprepareyoutooptimizeyourownpersonal
supplementschedule.
IfyouarenewtoluciddreamingIstronglyencourageyouto
readsomeoftheotherwonderfulbooksthatdescribethebasic
techniques.Myfavoritesare:

TheLucidDreamer
AWakingGuidefortheTravelerBetweenWorlds
ByMalcolmGodwin(1994)

&

ExploringtheWorldofLucidDreaming
ByStephenLaBergeandHowardRheingold(1990)

Ihavealsoincludedareferencesectionattheendofthis
bookwhichcontainssomeveryusefullinksandarticles.Iencourage
youtoreadasmuchaspossible.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

17/182

12/25/2016

AdvancedLucidDreaming

Page19
Introduction

13

OneFinalNote
Thesupplementsoutlinedinthisbook,enhancelucid
dreamingbyaffectingthelevelsofspecificneurotransmittersinthe
brainduringsleep.Thesesupplementsarenothallucinogensand
theyarenotcontrolledsubstances.Theyareavailableasoverthe
counterdietarysupplementsanddonotinduceanytypeofdruglike
intoxicationiftakenwhileawake.WiththeexceptionofNicotine,they
arenotaddictiveandaregenerallyconsideredtobeahealthy
additiontoyourdiet.Onegroupisknowntoincreasememory,
anothergroupisknowntoincreasefocusandattention,athirdgroup
isknowntoincreasemotivationandcreativity,andthelastgroupis
knowntoreducestress,improvemoodandincreasequalityofsleep.
Therearequiteafewsupplementsdescribedinthisbook.
Everyonehasadifferentcomfortlevelwhenitcomestotaking
supplementsanditisimportanttounderstandthatitisnotnecessary
totryeverycombinationdescribedhere.Startwithoneortwoofthe
maintriggercombinationsandbuildfromthere.

Page20

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

18/182

12/25/2016

AdvancedLucidDreaming

Part1:
TheoreticalBackground

Page21
15

1
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

19/182

12/25/2016

AdvancedLucidDreaming

OpeningRemarks
Thissectionofthebooksummarizessomeimportant
conceptsthathavebeendevelopedinthefieldofneuroscience.
Neuroscienceisafieldthatisoverflowingwithitsownterminology
anditisimportantnottoconfuseorunderminethetopicathandby
includingunnecessarydefinitionsorhighlytechnicaldiscussions.
Thatbeingsaid,therearesomeconceptsandinsightsthatare
absolutelyessentialtotheunderstandingofhownaturalsupplements
canbeusedtoenhanceluciddreaming.ThereforeIhavetriedto
keepthissectionassimpleandstraightforwardaspossibleyetstill
includeabasicunderstandingofthetopic.
IshouldalsonotethatIhavemixedfeelingsaboutthefieldof
neuroscience.Ononehanditcannotbeignoredthatthefieldis
expandingourunderstandingandknowledgeabouthowourbrains
processdataandinfluenceourthoughtsandemotions.Ontheother
handhowever,itisimpossibletoholdinhighregardafieldthatis
builtuponafoundationofdestructiveexperimentationonotherliving
animals.Thisinefficientandbarbaricapproachhighlightsourown
ignoranceandlackofrealunderstandingaswellasfully
demonstratesthegreatstridesneededinourownevolution.
Beforeintroducingsomeoftheimportanttermsandconcepts
associatedwiththeneuroscienceofsleepanddreams,weneedto
brieflyreviewthebasicsleepcycle,theREMreboundeffect,andthe
twopredominatetheoriesconcerninghowourbrainsdream.

Page22
16

ThePowerofSupplements

Aquickreviewofthesetopicswillhelpclarifytherelevanceofthe
termsandconceptspresented.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

20/182

12/25/2016

AdvancedLucidDreaming

Page23
17

2
ReviewoftheSleepCycle
Oursleepgenerallymovesincycles,firstmovingfrom
wakefulnessdownintoadeep,regenerativesleep,thencomingback
uptowardwakefulness,thenbackdownagainandsoon.Sleepers
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

21/182

12/25/2016

AdvancedLucidDreaming

generallymovethroughfourtosixofthesecyclespernight,with
eachcyclelastingbetween70and110minutes.
Eachsleepcycleisdividedintotwodistinctphases:nonREM
sleepandREMsleep.FurthermorethenonREMsleepphaseissub
dividedintofourstagesthattransitionusfromwakefulness(orREM)
intodeepsleepandthenbackupagain.Thecyclesmergeand
transitionfromonetoanotherinthesmoothcontinuumwecallsleep.
DuringthedeepeningstagesofnonREMsleepthebody
becomesincreasinglyrelaxedwithbrainwavesbecomingslowand
regularandwithbloodpressure,temperatureandmuscletoneall
decreasing.REMsleep,ontheotherhand,ischaracterizedbyan
increaseinheartandrespiratoryrate,rapidandirregulareye
movements,increasedbloodpressure,aswellasparalyzedmuscles
fromthechindown.
ThefirstcyclesofthenighttendtohaveshorterREMperiods
andlongerperiodsofdeepsleep.Thistrendreversesasthenight
goeson.ThelatercycleshavelongerREMperiodsandshorterdeep
sleepperiods.

Page24
18

ThePowerofSupplements

Bymorning,mostsleepersspendalmostalloftheirtimein
stages1,2andREMsleepwithverylittleornodeepsleep(stages3
and4).Infantsareuniqueinthattheyspendapproximately50
percentoftheirsleeptimeinREMsleep.
TheNationalInstituteofNeurologicalDisordersandStroke
providesthisdescriptionofthefivesleepstages.

Stage1(Drowsiness)Wedriftinandoutofsleepforabout5to10
minutesandcanbeawakenedeasily.Oureyesmoveveryslowly
andmuscleactivityslows.
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

22/182

12/25/2016

AdvancedLucidDreaming

Stage2(LightSleep)Oureyemovementsstopandourbrain
waves(fluctuationsofelectricalactivitythatcanbemeasuredby
electrodes)becomeslower,withoccasionalburstsofrapidwaves
calledsleepspindles.Ourheartrateslowsandbodytemperature
decreases.
Stages3and4(DeepSleep)Slowbrainwavescalleddeltawaves
begintoappear,interspersedwithsmaller,fasterwaves.ByStage4
thebrainproducesdeltawavesalmostexclusively.Itisverydifficult
towakesomeoneduringstages3and4,whichtogetherarecalled
deepsleep.Thereisnoeyemovementormuscleactivity.People
awakenedduringdeepsleepdonotadjustimmediatelyandoftenfeel
groggyanddisorientedforseveralminutesaftertheywakeup.

REMSleepDuringREMsleep,ourbreathingbecomesmorerapid,
irregular,andshallow,oureyesjerkrapidlyinvariousdirections,and
ourlimbmusclesbecometemporarilyparalyzed.Ourheartrate
increases,ourbloodpressurerises,andmalesdeveloppenile

Page25
ReviewoftheSleepCycle

19

erections.Peopletendtohavethemostvividdreamsduringthis
stageofsleep.

Neurotransmitterscontrolthesleepcycle:Ofparticular
interesttousisthatthebraincontrolsthesleep/wakecycleby
releasingvariouschemicalsinthebraincalledneurotransmitters.
Thesechemicalsactonneuronsinthebrainthatessentiallyswitch
onandoffthevariousstagesofsleepandwakefulness.Sincesleep
andwakefulnessareinfluencedbydifferentneurotransmittersignals
inthebrainfoods,medicines,andherbsthatchangethebalanceof
thesechemicalsaffectwhetherwefeelalertordrowsy,howwellwe
sleep,andhowmuchtimewespendintheREMphaseofsleepas
wellashowmuchwedream.
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

23/182

12/25/2016

AdvancedLucidDreaming

Page26
20

3
ReviewoftheREMReboundEffect
Itisaninterestingfactthatyourbodystrivestomaintaina
balancedsleepschedule.Itisverydifficulttodepriveyourbodyof
deepsleeporofREMsleep,norshouldyouwantto.Deepsleepis
stronglyassociatedwithbodyrejuvenationandisimperativefor
maintainingpropermentalandphysicalhealth.Itiswellknownthatin
timesofsicknessorinjuryyoursleepschedulewillshifttoinclude
longerandmorefrequentperiodsofdeepsleep.Thebodyishealing
itself.Itisalsowellknownthatdeprivingyourbodyofdeepsleepcan
resultinnegativeeffectsonbothyourmentalandphysicalhealth
includingaweakenedimmunesystem,increasedlevelsofagitation
andstress,andagenerallylowerfeelingofwellbeing.Asalucid
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

24/182

12/25/2016

AdvancedLucidDreaming

dreamenthusiastyoumustntsacrificeyourdeepsleepinthepursuit
ofhigherqualityluciddreams.Thisapproachisunsustainableat
best.Ifyoudepriveyourbodyofdeepandrestfulsleepononenight,
inadditiontofeelingenergydeprivedonthefollowingday,youwill
dropintolongerperiodsofdeepsleeponthenextnightinorderto
makeupforthelosttime.Anymethodofluciddreamenhancement
mustnotsacrificeyourquantityorqualityofdeepsleepifitistobe
worthanythingsignificant.

Page27
ReviewoftheREMReboundEffect

21

Thereisaninterestingcounterparttothissleep
characteristic.IfyousuppressREMsleepforaperiodoftime,your
bodywillbestronglyencouragedtomakeupforthelosttimespentin
thisstate,andthenexttimeyoufalltosleepyoumayexperiencean
effectreferredtoasREMrebound.REMreboundcanbedescribed
asprolongedperiodsofREMsleepduetopriorperiodsofREM
suppression.Thiseffectiscommonlyseenamongalcoholabusers
andmarijuanasmokers.BothalcoholandTHC(theactivechemical
inmarijuana)areknowntosuppressREMsleep.Ifhighenough
levelsofthesesubstancesareinthebloodstreamatsleeponset(a
commoncasefortheusers)REMsleepwillbesuppressed.Ifthe
userdecidestocleanouttheirsystembydiscontinuinguse,the
individualwillcommonlyexperienceseveralnightsofincreasedREM
timeandwillcommonlyexperiencelongandvividdream
experiences.Keepinmindthatthemostvividdreamexperiences(as
wellasmostluciddreams)occurduringREMsleep.Althoughthe
REMreboundeffectisasomewhatindirectmethodtoincreaseREM
time,itisstillavaluabletoolthattheluciddreamenthusiasthasat
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

25/182

12/25/2016

AdvancedLucidDreaming

theirdisposal.

Page28
22

4
PredominateDreamTheories
Thedescriptionsinthischapteraremainlybasedonanarticle
titledDREAMINGANDREMSLEEPARECONTROLLEDBY
DIFFERENTBRAINMECHANISMSwrittenbyMarkSolms,
AcademicDeptNeurosurgery,StBartholomew's&RoyalLondon
SchoolofMedicine.
Therearetwopredominatetheoriesregardingdreaming.The
firsttheorycanbecalledtheREMdreamtheory,thebrainstem
dreamtheory,orperhapsthecholinergicdreamtheory.Thesecond
theorycanbecalledtheForebraindreamtheory,thecerebral
activationdreamtheory,orperhapsthedopaminergicdreamtheory.
Thefirsttheory(whichIrefertoasthecholinergictheory)has
beenaroundsincethe1950swhenthefirstlinksbetweentheREM
sleepphaseanddreamingwerediscovered.Thetheoryquickly
developedtheconceptthatREMsleepisrequiredfordreamingto
occur.Thisbeliefwasbasedonthefactthat7095%ofnormal
subjectswhowereawakenedfromtheREMstatereportthatthey
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

26/182

12/25/2016

AdvancedLucidDreaming

havebeendreamingwhereasonly510%ofnonREMawakenings
producedsimilarreports.Inthemid1970sitwasdiscoveredthat
REMsleepwasessentiallycontrolledbyvariousmechanismslocated
inthebrainstemandthisfindingresultedinawidespreadbeliefthat
thesesamemechanismswerealsoresponsiblefordreaming.

Page29
PredominateDreamTheories

23

Specificallyitwasdeterminedthatthecholinergicbrainstem
mechanismcouldswitchonorofftheREMsleepphaseand
thereforedreamingbycontrollingthereleaseofspecific
neurotransmitters.Accordingtothistheory,REMsleep(andhence
dreaming)isswitchedonbythereleaseofaneurotransmittercalled
acetylcholine(ACh)andturnedoffbythereleaseofadifferent
neurotransmittercalledserotonin.Onecouldconcludefromthis
theorythattheneurotransmitterAChcontrolsREManddreaming.
Probablythemostdishearteningaspectofthistheoryisthatit
assumesthatcognitionplayspracticallynoroleindreaming.The
brainstemsimplycausesarandomfiringofneuronswhoseelectrical
impulsestraveltothecognitioncenterofthebrain(forebrain)where
theyarepassivelysynthesizedbyitsmemorysystemintoabestfit
forotherwiseincoherentdata.Inotherwordstherandomimpulses
makeittotheforebrainwhichtriestoforcemeaningtothem.Itisthis
processthatgeneratesdreams.Althoughthistheoryexplainsthe
illogicalandnonsensicaldreamswesometimesexperience,it
doesntcaptureatalltheluciddreamexperienceinwhichthe
dreamerdirectlyinfluencesandcontrolsthedreamplotandsetting.
Insupportofthistheory,ithasbeenshownthatdrugs/herbsthat
promotethereleaseofAChwithinthebrainstemcannotonly
generateREMsleepbutalsogeneratedreams.
Thesecondtheory(whichIrefertoasthedopaminergic
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

27/182

12/25/2016

AdvancedLucidDreaming

theory)is,inmyopinion,moresophisticated,elegant,andcomplete
thanthecholinergictheoryandissubstantiatedbyastrongclinical
basis.Thedopaminergictheorytriestofillintheholesleftbythe
cholinergictheory.Forexample,between530%ofREMawakenings
donotelicitdreamreportsandatleast510%ofnonREM

Page30
24

ThePowerofSupplements

awakeningsdoelicitdreamreportsthatareindistinguishablefrom
REMdreamreports.Accordingtothedopaminergictheory,itisthe
forebrainthatcausesdreamingtooccurandnotthebrainstem.This
assumptionhasanumberofimportantconsequences.Itiswell
knownthattheforebrainhaslittle,ifanyeffectonREMsleep.
ThereforetheconclusionmustbethatREMsleepisnotrequiredfor
dreamingtooccur.Oneoftheclinicalfactsthatprovidesthebasisfor
thistheoryisthatbrainlesionswhichoccurintheforebrainareacan
totallyhaltdreaminginanindividualwithouthavinganyaffecton
REMsleep.Itwasalsonoticedthatthelesionswhichhalted
dreamingwerelocatedinthesameregionoftheforebraintargetedin
theprefrontalleucotomy(i.e.frontallobotomy)operationsusedasa
meansofbehaviorcontrol.Ithasbeenconfirmedthat7090%of
theseoperationsyieldedcompleteornearlycompletelossof
dreaminginthesubjects.Itisthisregionofthebrainthatisrichwith
fibersconnectingfrontalandlimbicstructureswithdopaminergic
cells.Thissystemwasthetargetoftheleucotomybecauseitis
believedtocontrolthegoalseekingandpleasureseeking
mechanisms.Damagealongthissystemproducesdisorders
characterizedbyreducedinterest,reducedinitiative,reduced
imagination,andthereducedabilitytoplanahead.Thesefacts
stronglysuggestthatdreamingisgeneratedbythisdopaminecircuit.
FurtherevidencesupportingthistheoryisthatwhenLdopa(a
populardrugusedtocombatParkinsonsdiseasebyincreasingthe
levelofdopaminewithinthebrain)isadministeredtopatientsinthe
nighttimehours,dreamfrequencyandvividnessaregreatly
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

28/182

12/25/2016

AdvancedLucidDreaming

increasedeventhoughthereisnocorrespondingincreaseinREM
sleep.Furthermore,thedopaminergictheorysuggeststhatdreaming

Page31
PredominateDreamTheories

25

isnotchaoticinnaturebutrathermanifestsfromspecificandhighly
complexcognitiveprocesses.
SoifREMsleepisnotresponsiblefordreaming,howdoes
thedopaminergictheoryaddressthehighcorrelationbetweenREM
sleepanddreamreports?ThistheorysuggeststhatinsteadofREM
sleepbeingrequired,amoregeneralstateofcerebralactivation
duringsleepisrequired.REMsleepisoftenreferredtoas
paradoxicalsleepbecausethebrainisbothasleepand
simultaneouslyhighlyactivated.Thevastmajorityofdreamreports
thatoccuroutsideofREMsleepareassociatedwithstage1orstage
2sleep(i.e.verylightsleep).Allofthesestages,includingREM,line
theborderbetweendeepregenerativesleepandthewakingstate.
Thefactthatdreamingcanbeartificiallygeneratedbythe
administrationofavarietyofstimulantdrugs,includingboth
cholinergicanddopaminergicagentsisopentoasimilar
interpretation.Ofcrucialtheoreticalimportanceisthefactthat
dopaminergicagentsincreasethefrequency,vivacityanddurationof
dreamingwithoutsimilarlyaffectingthefrequency,intensityand
durationofREMsleep.Thisobservation,togetherwiththeequally
importantfactthatdamagetospecificareasofthefrontallobe
obliteratesdreamingbutsparestheREMcycle,suggestsaspecific
dopaminergic`dreamon'mechanismwhichisdissociablefromthe
cholinergic`REMon'mechanism.
Soaccordingtothedopaminergictheory,twoindependent
eventsmustoccurinordertospawnthedreamstate:Firstthe
subjectmustundergocerebralactivationduringsleep(whereREM
initiationaccountsforoneformofsuchactivation)andsecondly,the
dopaminergiccircuitslocatedintheforebrainmustalsobeengaged.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

29/182

12/25/2016

AdvancedLucidDreaming

Page32
26

ThePowerofSupplements

Whatcantheluciddreamenthusiastlearnfromthesetwo
theories?
Thesetwotheoriesprovidethebasisofthemethodoutlinedin
thisbooksoitisimportanttohighlighttheimportantfindingsasthey
relatetoourgoalofluciddreamenhancement.Thefollowinglistisa
summaryofthosefindings:
Thereleaseofspecificneurotransmittersinthebraincontrol
whichsleepstateweareinaswellasactivateourinternal
dreamingmechanism.
Foods,medicines,andherbscanimpactthelevelsofspecific
neurotransmittersinthebrain.
MostvividdreamexperiencesoccurduringREMsleepbut
canalsooccurinstage1andstage2nonREMsleep.
Theneurotransmitteracetylcholine(ACh)hastheabilityto
switchonandmaintainREMsleep.
Theneurotransmitterserotoninhastheabilitytoswitchoff
andsuppressREMsleep.
REMsleeponlyprovidesoneofthetworequirementsneeded
fordreamingtooccur.
Thesecondrequirementisthatthedopaminergiccircuitmust
beengaged.
Theneurotransmitterdopaminecanengagethedopaminergic
circuit.

Usingtheaboveguidelinesoneshouldbeabletoeasilygenerate
longdurationvividdreamexperiences.Butthereisstillsomething
missingfromtheequation.Whatisitthatdistinguishesregular
dreamingfromluciddreaming?Luciddreamingisauniquestate:the

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

30/182

12/25/2016

AdvancedLucidDreaming

Page33
PredominateDreamTheories

27

bodyisasleepyetthemindisawakeandselfaware.Inthisstatewe
areneitherfullyasleepnorarewefullyawake,wearesimultaneously
inbothstates.Ibelievethisuniquestateisachievedwhenthelevels
ofcertainneurotransmittersareincreasedbeyondwhatistypically
associatedwithsleepandmorecloselyresemblelevelsassociated
withbeingawake.Acetylcholineisakeyluciditytriggerbecause,
amongotherthings,itincreasesourwakefulness.Anotherexcellent
luciditytriggerisaneurotransmittercallednorepinephrinewhichis
mainlyassociatedwithbeingawakeratherthanwithbeingasleep.It
isalsoforthisreasonthatdopamine,whichheavilypromotes
dreaming,doesnotnecessarilypromoteluciddreaming(thisisnotto
underminetheprofoundeffectthatdopaminehasonluciddreams)
andwhyserotoninmustbeusedindirectlytoaidinluciddream
enhancement.
Beforediscussinghowsupplementscanbeusedtoadjustthe
levelsoftheseneurotransmitters,aswellasthestrategythatwe
shouldfollowinordertopromotehighlevelluciddreaming,ithelpsto
brieflysummarizetherolethateachoftheseneurotransmitters
(serotonin,acetylcholine,dopamine,andnorepinephrine)playinour
dailylives.

Page34
28
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

31/182

12/25/2016

AdvancedLucidDreaming

5
NeurotransmittersandDreaming
Ourbrainsaresimilartoacomputerinanumberofways.Our
sensesgatherinformationandinputthedataintothebrain.Thebrain
processesthedata,storesit,andproducessometypeofoutput.Just
likeacomputer,thebrainmanagesallthisbysendingmillionsoftiny
electricalimpulsesbackandforthacrossmillionsofnerveand
chemicalpathways.Thebraincontrolsandguidestheseimpulsesby
thereleaseofspecificchemicalscalledneurotransmitters.
Aneurotransmitterisanaturalchemicalinthebrain
responsiblefortransmittingmessagesfromonenervetoanother.If
youweretocomparetheroleofnervesandneurotransmitterstoan
electricalcircuit,thenerveswouldberepresentedbythecopper
wiresandtheneurotransmitterswouldberepresentedbytiny
switchesthatcandirectacurrenttospecificgroupsofwires(nerves).
Theneurotransmittersareresponsibleforactivating(ordeactivating)
specificpartsofourbrain.Bydoingso,theyareresponsiblefor
wakingusup,puttingustosleep,andmakingusdreamaswellas
playingavitalroleincontrollingourstateofmind.Ourabilitytorecall
thepast,ourlevelofalertness,aswellasouremotionalstateareall
directlyinfluencedbythelevelsofspecificneurotransmitterswithin
thebrain.
Therearefourprimaryneurotransmittersthatcontrolour
wakingandsleepcycles.Thefourprimaryneurotransmittersare:
Serotonin,Dopamine,Norepinephrine,andAcetylcholine.

Page35
NeurotransmittersandDreaming

29

Itwillbecomeclearinreadingthefollowingsectionsthat
theseneurotransmitterscontroladelicatebalancewithinyourbrain
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

32/182

12/25/2016

AdvancedLucidDreaming

andbody.Ingeneral,everythingyoueataffectsthisbalanceand
medicinesandherbscanhaveanamplifiedaffect.Boostingor
suppressinganyofthesesystemsbyexcessiveamountswill
undoubtedlyhaveanegativeimpactonyourlifeandhealth.
However,smallmodulationscanyieldprofoundbenefits.Thisisthe
basisoftreatingmostmentaldiseaseslikeAlzheimers,ADD,
depression,bipolardisorder,Schizophrenia,andmanyothers.
Forourpurposesitisbettertoerroronthesideof
conservatismandfollowtheruleofthumbthatlessisbetterand
thatexceedingtheeffectivedosagesispointless.

Serotonin(5HT):Oftheneurotransmittersthatwewilldiscuss,
serotoninplaysthemostcomplexroleinourdailylivesandprobably
themostindirectroleinluciddreamenhancement.Itistheonlyone
ofthefourthatcanactasbothanexcitatorytransmitterandan
inhibitorytransmitter.Serotoninplaysasignificantroleinboth
wakefulnessandsleep.Itisinvolvedintheregulationofmood,pain,
appetite,anddeepregenerativesleep.Serotonindeficiencieshave
beendeterminedtobeacausefordepression,certaintypesof
migraineheadaches,bipolardisorder,andanxiety.Alsolow
serotoninlevelstendtomakeitmoredifficulttofocusonesthoughts,
maybeassociatedwithpoorappetitecontrol(obesity),andarea
causeforinsomnia.
Increasedserotoninlevels,ontheotherhand,areassociated
withdecreaseddepression,decreasedanxiety,increasedrelaxation,
increaseddrowsiness,decreasedsexdrive,increasednonREM

Page36
30

ThePowerofSupplements

sleep,andsuppressedREMsleep.Drugsthatincreaseserotonin
levels,likeProzac,canrelievestressandcombatdepressionandare
amajorfocusofongoingresearch.
Ifserotoninlevelsbecometoohighhowever,onemay
experienceaphenomenonknownasSerotoninSyndrome.Thisisa
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

33/182

12/25/2016

AdvancedLucidDreaming

seriousandpotentiallylifethreateningmedicalcondition
characterizedbymentalconfusion,hypomania,agitation,headache,
coma,shivering,sweating,fever,hypertension,tachycardia,nausea,
diarrhea,muscletwitching,overresponsivereflexes,tremor,
insomnia,sleepdisruption,andunrefreshingsleep.Thissyndromeis
usuallycausedbycombiningdrugsthateachaffecttheserotonergic
systeminsimilarandamplifyingways,suchasbycombiningSt.
JohnsWort(apopularnonprescriptionherbthatcansimultaneously
boostserotonin,dopamine,andnorepinephrinelevels)withother
serotoninboostingdrugs.Withthisinmindoneshouldalwaysbe
awareofnegativedruginteractionsthatcanoccurwhencombining
varioussupplements.Informativedecisionsandconservatismarea
must.

Serotoninandsleep:Serotoninplaysanimportantroleinregulating
sleep.Aswedriftofftosleep,serotoninlevelsbegintoriseand
continuetodosoaswemovedownintothedeepeststagesofnon
REMsleep.Atthispointserotoninlevelsstarttodecreaseaswe
movefromdeepsleepbackupthroughthelighterstagesand
diminishcompletelywhenweenterREMsleep.Thereforethe
amountofserotonininyoursystemhasadirectimpactonwhich
stageofsleepyouarein.Moreserotoningenerallyimpliesdeeper

Page37
NeurotransmittersandDreaming

31

levelsofnonREMsleep.Forthisreason,serotoninboostingdrugs
arewidelyusedtocombatinsomnia.

Serotoninanddreams:Foods,medicines,andherbalsupplements
thatincreaseserotoninlevelshaverepeatedlybeenshowntocause
morevividdreams.Onemustaskhowthisispossiblesinceit
appearsthatincreasedserotoninlevelsreducethetimespentin
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

34/182

12/25/2016

AdvancedLucidDreaming

REMsleep(thestagewherethemostvividdreamstendtooccur).
Themostcommonexplanationisthatserotoninbaseddreamsare
causedbytheREMreboundeffect.Serotonindreamstendtooccur
inthemorninghourswhenthemedicationsarewearingoffand
serotoninlevelsaredropping.Thissuggeststhatduringthefirsthalf
ofthenight,whiletheselevelsareelevated,REMsleepis
suppressedandmoretimeisspentinthedeepernonREMsleep
stages.Asserotoninlevelsdrop,thebodycompensatesforthelack
ofREMsleepbymaintaininglowerlevelsforextendedperiodsof
time.ThisresultsinlongerandmoreintenseperiodsofREMsleepin
themorninghours.Eventhoughthesleepstageshavebeen
rearrangedabit(moredeepsleepinthefirsthalfofthenightand
moreREMsleepinthesecondhalfofthenight,theneteffectisa
balancednightssleep.Furthermore,ithasbeenmyexperiencethat
supplementsthatincreaseserotoninlevelstendtogeneratemore
calmandrelaxingdreams.Thereisalsoamarkedincreasein
vividnessthatisveryrefreshing.Thenegativeaspectofserotonin
dreamsisthattheyseemtobehardertorememberthanthose
relatedtotheotherneurotransmitters.Thishighlightsaninteresting
point:vividsensoryexperiencedoesnotimplyvividmemoryofthat
experience.

Page38
32

ThePowerofSupplements

Serotoninandluciddreams:Serotonincanaffectluciddreamingin
anumberofwayssomeofwhicharepositiveandsomeofwhichare
negative.Onthepositiveside,serotoninboostingsupplementscan
causeREMreboundwhichcansetupextendedperiodsofREM
sleepinthemorninghours(ormorespecifically:afterthe
supplementshavemostlywornoff).Remembermostluciddreams
occurduringREMsleep,solongerperiodsofREMcanresultinan
increasedchanceofhavingaluciddreamalongwithbeinglongerin
general.Furthermore,serotoninboostingsupplementscanincrease
yourqualityofsleep.Althoughthismaynotbeapparentyet,wewill
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

35/182

12/25/2016

AdvancedLucidDreaming

seethatsomeofthesupplementsdiscussed,significantlyincrease
thetimespentinREMsleep.Ifthesesupplementsaretakentoo
earlyinthenight,itispossibletoexperienceadrasticreductionin
deepnonREMsleep.Thiswillresultinfeelingenergydeprivedthe
nextday.Thisfeelingcanbereducedifthesetypesofsupplements
aretakenafter4or5hoursofsleepbecausealargerpercentageof
deepsleepoccursduringthefirsthalfofthenight.Furthermore,if
thesetypesofsupplementsaretakenafter4or5hoursofsleepand
ifaserotoninboostingsupplementistakenjustbeforebedtime,the
resultcanbeoneofabalancednightssleepwithextendedtime
spentinahighlevelluciddream.Thisisaveryimportantfactorto
considerwhentryingtohavehighlevelluciddreamsthreeormore
timesperweek.Ifyoursleepisnotbalancedonanyindividualnightit
willtrytorebalanceitselfonthefollowingnight(ornights).Ifyou
furtherdepriveyourselfofdeepnonREMsleep,yourbodywilltry
evenhardertorebalanceitself.Theresultisthatyoubegintofeel
moreandmoreenergydeprivedduetothisconflictyoureputting
yourbodyin.Eventuallythebodywillstarttowinandyourlucid

Page39
NeurotransmittersandDreaming

33

dreamswillsufferinbothdurationandfrequency.Althoughthisisan
indirectbenefitofserotoninboostingsupplements,itisonethat
needstobeconsideredandtakenadvantageof.
Thenegativecharacteristicofserotoninboostingsupplements
istheywillsignificantlydecreaseyouroddsofbecominglucidifthey
arestillinyoursystemduringaluciddreamattempt.Forthisreason
onemustbecarefulandthoughtfulofboththedosagesandthe
consumptiontimesofthesetypesofsupplements.Rememberthat
REMsleepisnormallyassociatedwithincreasedlevelsof
acetylcholineandreducedlevelsofserotonin.Becausethemethod
describedinthisbookdependsonmovingdirectlyfromwakefulness
intoREMsleepinordertoinitiatealuciddream,itisimportantthat
serotoninlevelsnotbetoohighduringtheattempt.
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

36/182

12/25/2016

AdvancedLucidDreaming

Serotoninandsupplements:Serotonintakenorallydoesnotpass
intotheserotonergicpathwaysofthecentralnervoussystem
becauseitdoesnotcrossthebloodbrainbarrier.However,the
aminoacidTryptophananditsmetabolite5hydroxytryptophan(5
HTP),fromwhichserotoninissynthesized,cananddocrossthe
bloodbrainbarrier.Itisbelievedthat5HTPismoreeffectivethan
Tryptophanatincreasinglevelsofserotonininsidethebrainbecause
itmorereadilycrossesthebloodbrainbarrierandbecauseitisthe
directprecursortoserotonin.Anotherinterestingsupplementthat
actsviatheserotonergicpathwayisMelatonin.Melatoninisthe
substanceinthebrainthatserotoninismetabolizedinto:Serotonin
Melatonin.TherearesomestudiesthatsuggestthatMelatonin
doesnotsuppressREMsleepalthoughIpersonallydoubtthisisthe
case.Allthreeofthesesubstancesareavailableasadietary

Page40
34

ThePowerofSupplements

supplementandallhavebeencitedascausingvividdreams.Ihave
notexperimentedwithTryptophan,buthavehadgoodsuccesswith
both5HTPandMelatonin.Thesesubstanceswillbediscussedin
detailinalatersectionofthisbook.

Dopamine:Dopamineismostfamousforitsstimulantand
pleasurableeffects,andalsoappearstoplayanimportantrolein
learningandcontrollingyourbodysmovementandbalance.
Dopamineplaysacentralroleinourbodysnaturalrewardsystem
andthereforeisacrucialfactorinmotivation.
Duetothegenerallypositivefeelingsassociatedwith
increasedlevelsofdopamine,virtuallyeverydrugofabuse,including
heroinandotheropiates,alcohol,cocaine,amphetamineand
nicotineactivatethedopaminesystemstosomedegreeoranother.
Elevateddopaminelevelstendtomakepeopleeuphoric,confident,
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

37/182

12/25/2016

AdvancedLucidDreaming

aggressive,andmorealert.Ithasevenbeensuggestedthatan
increaseindopaminelevelsresultinanenhancementinverbal
fluencyandcreativity.
Decreaseddopaminelevelstendtomakepeoplemoretired,
forgetful,andgenerallylackingdriveandvitality.Lowerthanaverage
dopaminelevelsalsocontributetolowlevelsofselfesteemand
libido.
Thereareanumberofpsychiatricdisordersassociatedwith
dopamineimbalances.Forexample,Schizophreniaisthoughttobe
caused,atleastinpart,byexcessivelevelsofdopamineand
Parkinsonsdiseasehasbeenshowntoberelatedtoasignificant
dopaminedeficiency.Mooddisorders,includingcertaintypesof

Page41
NeurotransmittersandDreaming

35

depressionarealsothoughttoberelatedtodopaminedeficiencies
withinthebrain.
Anotherinterestingandimportantfactorishowtheaging
processtakesaninevitabletollondopaminergicneuronsvia
oxidativestress.Dopaminecontentofthebrainisstableuntilaround
age45,andthendecreaseslinearlybyabout13%everydecade.
Whenthelossofdopaminereachesaround30%Parkinsonian
symptomsmaysurface.Thismayalsopartiallyexplainwhypeoplein
general,haveastrongerlustforlifeandlibidointheiryoungeryears
thanintheirelderyears.

Dopamineandsleep:Unlikeserotonin,dopaminedoesnotseemto
playamajorroleinregulatingthesleepcycleinthatthedopamine
dependentneuronsundergoonlysightmodulationsoveratwenty
fourhourperiod.

Dopamineanddreams:Someofthemostinterestingeffectson
dreamingattributedtodopaminehavecomefromreportsof
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

38/182

12/25/2016

AdvancedLucidDreaming

Parkinsonsdiseasepatientswhotakethedopamineincreasingdrug,
Ldopa,aspartoftheirtreatment.Ithasbeenshownthatincreasing
dopaminelevelsduringsleepcanhaveadramaticaffecton
dreaming,makingdreamsmorevivid,longerindurationandperhaps
morenightmarish.Thisistrueeventhoughtheincreaseddopamine
levelsdonothaveasignificantimpactonREMsleep.Theaffectof
dopamineondreamswiththecorrespondinglackofaffectonREM
sleephascausedashiftinmoderndaydreamtheories.Nolongerdo
scientistsbelievethatREMisexclusivelyrequiredorevennecessary

Page42
36

ThePowerofSupplements

fordreaming.Althoughthismaybethecase,letsnotforgetthatthe
majorityifluciddreamsdoseemtooccurinREMsleep.
Myownexperiencewithdopaminedreamshasbeen
extremelyinteresting.Dopaminedreamstendtobeactionpacked
andconsistentlycarrythethemeofhavingtoovercomesomekindof
adversary.Furthermore,dopaminedreamstendtobefully
participatoryinthatyouarealwaysactivelycaughtupintheaction
ratherthanpassivelyobservingitfromthesidelines.Whendescribing
dopaminedreamstheyoftensoundnightmarish(vampires,snakes,
gunbattles,physicalattacksarecommondreamplots)yetthe
experienceofdopaminedreamsisverydifferentfromwhatIconsider
tobeanightmare.Myemotionalstateduringadopaminedreamis
oneofextremeconfidenceandtotallylackinginfear.Eventhough
thereisalwaysanadversarypresent,thetypicalthemeisonein
whichIriseup,directlyfacetheadversary,andprevail.WhenIwake
upItendtofeeltriumphant,confident,andmotivated.

Dopamineandluciddreams:Dopamineplaysanimportantrolein
producinghighlevelluciddreamshoweverittypicallydoesntactas
aluciddreamtrigger.Bythis,Imeanthatincreasingdopaminelevels
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

39/182

12/25/2016

AdvancedLucidDreaming

inthebraindoesntseemtoresultinmorefrequentluciddream
experiences.Thatbeingsaid,increasingdopaminelevelsresultina
profoundeffectontheabilitytocontrolthedreamifyoudobecome
lucid.Theenhancedconfidenceandlackoffearthatwasprevalentin
thenonluciddopaminedreamsisalsopresentintheluciddopamine
dreams.Itisoftensaidthatyoucandoanythinginaluciddreamas
longasyoubelieveyoucan.Theincreasedconfidenceresultingfrom
dopaminegivesyouthepowertobelievethatyoureallycando

Page43
NeurotransmittersandDreaming

37

anything.Theresultisnothingshortofmiraculous!Considerthe
exampleofflying.Mostlikelyeveryluciddreamerhastakentothe
skiesatsomepointoranother.Butjustbecauseyoucanflydoesnt
meanthatyoucanflywell.Manyluciddreamerssitepoorly
controlledandclumsyexperiencesandalargenumberof
experiencesareprobablybetterdescribedasfloatingratherthan
reallyflying.Thisisnotthecasewhendopaminelevelsareelevated.
Highspeed,highprecisionsupermanstyleflyingbecomesthenorm
ratherthantheexception.Alsoconsiderthecaseofchangingyour
dreamsurroundings.Themostcommonapproachofaccomplishing
thisisfortheluciddreamertostartspinningwiththeintentionofthe
surroundingschangingtomeettheirdesires.Manyluciddreamers
strugglewiththis.Onceagaindopaminehasaprofoundeffect.Just
thespinningaloneisincredibleandeasilyoutperformsworldclass
iceskatersinspeed,acceleration,andduration.Ofcoursethebest
partiswhereyouwantedtogo,youhavearrived.Thesearejusttwo
ofthecountlessnumberofexamplesofenhanceddreamcontrol
availableviathedopaminergicpathway.

Dopamineandsupplements:Dopaminetakenorallydoesnotpass
intothedopaminergicpathwaysofthecentralnervoussystem
becauseitdoesnotcrossthebloodbrainbarrier.Theimmediate
precursortodopamineisachemicalcalledLdopaanditdoespass
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

40/182

12/25/2016

AdvancedLucidDreaming

throughthebloodbrainbarrier.TherearetwotypesofLdopaa
purifiedsyntheticformthatisavailablewithprescriptiononly,anda
naturaloccurringformthatispresentinseveralspeciesofbeans.
ThespeciesthatcontainsbyfarthehighestLdopacontentiscalled
MucunaPruriens.Thisherbisavailableasadietarysupplementand

Page44
38

ThePowerofSupplements

hasbeenstandardizedtovaryingconcentrationsofLdopacontent.
Thereareotherdopamineprecursorsthatarereadilyavailable
(namelyphenylalanineandtyrosine)butMucunaPruriensprovides
themostdirectmethodofincreasingdopaminelevels.Iwilldiscuss
MucunaPruriensindetailinalatersectionofthisbook.

Acetylcholine(ACh):Acetylcholinewasthefirstneurotransmitter
tobeidentifiedintheearly1900s.AChplaysamajorroleinthe
stimulationofmuscles,memory,thinking,learning,aswellas
regulatingsleepandcontrollingemotions.Withinthebrain,
acetylcholineisthoughttoplayamajorroleintheformation,storage,
andrecallofmemories.Duetothisfact,acetylcholineisthefocusof
anenormousamountofresearchandisthecurrentbasisforthe
treatmentofAlzheimersdiseaseanddementia.Duetoitsroleinthe
stimulationofmuscleshowever,acetylcholinehasalsobeentargeted
byseveralstrongpoisons.Forexample,Curareisapoisonthat
blocksacetylcholinereceptorsandcancauseseveremuscle
paralysis.Ontheothersideofthespectrum,sometypesofnerve
gasacttopreventthebreakdownofacetylcholineandresultin
severemusclespasms.
Slightlyelevatedacetylcholinelevelsareassociatedwith
goodmemory,abilitytolearn,andincreasedtimespentinREM
sleep.Decreasedacetylcholinelevelsareassociatedwithpoor
memory(Alzheimersdisease),inabilitytothinkclearly,poor
reasoningskills,fatigue,andsuppressedREMsleep.
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

41/182

12/25/2016

AdvancedLucidDreaming

Anotherinterestingandimportantfactisthatasweagethe
levelsofacetylcholinepresentinourbrainstendtodecrease.This
hasanegativeimpactonourabilitytorememberandeventothink

Page45
NeurotransmittersandDreaming

39

clearly.InadvancedAlzheimersdisease,wherethememoryhas
almosttotallystoppedfunctioning,acetylcholinelevelscanbeas
muchas90%lowerthannormallevels.Thereisawealthofclinical
evidencesuggestingthatpeopleshouldsupplementtheirdietswith
acetylcholineboostingnutrientsinordertohelpensureanimblemind
andhenceagoodqualityoflifeduringthesenioryears.

Acetylcholineandsleep:AChplaysamajorroleintheregulationof
sleep.AChlevelsstarttodropaswedriftofftosleepandreachtheir
lowestlevelswhenweareinthedeep,nonREMstagesofsleep.As
wemovebackuptowardREMsleep,AChlevelsincreaseandreach
levelscomparedtothewakingstateduringREMsleep.Acetylcholine
andserotoninworktogetherinaninverserelationshipinorderto
controloursleep.

DeepnonREMsleepHighSerotonin+LowAcetylcholine
REMsleepLowSerotonin+HighAcetylcholine

Thispairingofacetylcholineandserotonintoproducethe
differentsleepstageshassomeimportantimplications.To
experiencetherejuvenationofdeepnonREMsleep,itisnot
sufficienttojustboostyourserotoninlevelsbutratheritmustbe
coupledwithadecreaseinacetylcholinelevels.Toexperiencethe
dreamrichREMstateitisnotsufficienttojustboostyour
acetylcholinelevelsbutratheritmustbecoupledwithadecreasein
serotoninlevels.Thissubtlepointhasimportantimplicationswhenit
comestochoosingatimetoinitiatealuciddream.Sincethebody
triestoenterthedeep,nonREMstagesduringthefirstpartofthe
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

42/182

12/25/2016

AdvancedLucidDreaming

Page46
40

ThePowerofSupplements

nightanddoessobyincreasingserotoninlevelsinthebrain,itisbest
nottotrytoartificiallyraisetheacetylcholinelevels(viaa
supplement)duringthisperiod.Doingsodoeslittletopromotelucid
dreamingandessentiallyrobsyouofthedeepsleepyouneed.So
insteadofputtingyourbodyinconflictwithitself,itisbyfarmore
effectivetoletthebodyrestnaturallyfor4or5hoursbefore
stimulatingthecholinergicsystemwithsupplements.

Acetylcholineanddreams:Acetylcholinehasaprofoundeffecton
dreamingandthesupplementsthatboostacetylcholinelevelstendto
causelongandvividdreamexperiences.Acetylcholineplaysadual
roleindreamenhancement:increasedtimespentinREMsleep
PLUSimprovedmemoryofthedreamexperience.Therolein
memoryisoftenoverlookedwhendiscussingthedreambenefitsof
acetylcholine.Itmaybeeventhatthememoryboostplaysthebigger
rolecausingyoutosimplyrememberthedreambetter.Whetherits
thememoryboostortheREMboostthatplaysthebiggerrolein
dreamenhancementisupfordebate,butthefactthatincreasing
AChlevelsleadstolongandvividdreamexperiencescannotbe
denied.

Acetylcholineandluciddreams:Acetylcholinehasaprofound
effectonluciddreaming.ThesupplementsthatincreaseAChlevels
havetheabilitytoactuallytriggerluciddreamexperienceswhen
usedcorrectly.Theydosobyallowingyoutomovedirectlyfromthe
wakingstateintoavividdreamstatewithoutlosingconsciousness.
Recallthattherearetwokindsofluciddreamscommonlydiscussed
amongenthusiasts:DILDsandWILDs.ADILDischaracterizedby

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

43/182

12/25/2016

AdvancedLucidDreaming

Page47
NeurotransmittersandDreaming

41

thedreameralreadybeingwithinadreambeforelucidityoccurs.In
thesecasesthedreamerusuallyrecognizessomethingpeculiarand
thensuddenlybecomeawarethattheyaredreaming.AWILDis
characterizedbyanunbrokencontinuumofconsciousnessasthe
dreamermovesfromtheconsciousstateintothedreamstate.Itis
commonlystatedthatapproximately90%ofluciddreamsareDILDs
andonly10%areWILDs.OneproblemwithDILDsisitgenerally
requiresalotofpracticebeforeyougetgoodatinducingthem.Your
mindisalreadysleepinginsidethedreamandyouhavetolearnto
wakeitupinordertobecomelucid.Anotherwayofsayingitisthat
youhavealreadylostconsciousnessandnowyoumustlearntogetit
backagain.WithaWILD,ontheotherhand,yourconsciousnessis
unbroken.Thereisnohavingtodiscoveryourelucid.Youalready
arerightfromthebeginning.Ittakesthehitandmissoutoflucid
dreamingaltogether.Theproblemisthatwhenyoulaydownyour
mindtendstofalltosleepjustasfastasyourbodydoesanditcan
takeyearsofmeditationandpracticetobecomeskilledattheartof
keepingyourmindawakeandalertwhileyoutransitionintosleep.It
isanamazingtruththatsupplementsthatboostAChlevelscan
greatlyassistyouinthistransition!Thismakespossibleareversalin
luciddreamstatisticsinthatwhenusingsupplements,approximately
90%ofluciddreamscanbeWILDs.EvenifyoudontattemptWILDs,
thehigherAChlevelsincreaseselfawarenessmakingiteasierto
recognizedreamsignstherebyhavingmoreDILDs.

Acetylcholineandsupplements:Duetoitsstrongroleinretaining
memoryandkeepinganimblemind,supplementsthatboostACh
levelsinthebrainareoftenreferredtoasbrainfood.Therearethree

Page48
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

44/182

12/25/2016

AdvancedLucidDreaming

42

ThePowerofSupplements

commontypesofsupplementsavailable:thosethatform
acetylcholineinthebrain(AChprecursors),thosethatmimicthe
actionsofacetylcholineinthebrain(AChagonist),andthosethat
preventthebreakdownofacetylcholineinthebrain(AChEinhibitors).
AllthreecanbeusedasaluciddreamtriggeralthoughtheACh
precursorsseemtobesomewhatlesseffectivethaneithertheACh
agonistortheAChEinhibitors.Allthreetypeswillbediscussedina
latersection.

Norepinephrine(NE):Norepinephrine(alsocallednoradrenalin)
hascometoberecognizedasplayingasignificantroleinattention,
focus,andmemory.Specificallynorepinephrineisassociatedwith
theabilitytonotgetdistractedfromwhatyouredoingandtoalso
haveastrongworkingmemory.Forpeoplewhosufferfrom
ADD/ADHD,medicationssuchasRitalinareprescribedtohelp
increaselevelsofnorepinephrinewithinthebrain.
Withnorepinephrine,moresothanwiththeother
neurotransmitters,itisespeciallyimportanttodistinguishbetween
thenorepinephrinethatisinthebrainandthenorepinephrinethatis
intheblood.Ingeneral,norepinephrineisabrainchemicalinthat,
thebrainiswhereitisstoredandreleased.Howeverifthelevelsin
thebrainexceedacertainthreshold,thenorepinephrinebeginsto
excretefromthebrainandintothebloodstreamwhereitisthen
carriedthroughoutthebody.Thisprocessisknownasoverflow.
Whennorepinephrinegetsintothebloodstreamitactsasaflightor
fightsubstance.Itincreasesourheartbeatandrespiratoryrate,and
canfilluswithnervoustension.

Page49
NeurotransmittersandDreaming

43

Norepinephrineandsleep:Norepinephrineisnormallyassociated
withwakefulnessratherthansleep.Amphetaminesusuallyrelease
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

45/182

12/25/2016

AdvancedLucidDreaming

significantamountsofnorepinephrineandtoomuchwillmakeitvery
difficulttofalltosleep.Thisbeingsaid,onewouldexpectthat
norepinephrinelevelswoulddecreaseduringdeepsleepand
increaseasonemovestowardwakefulnessandREM.Thisisnot
quitetruebecausethenorepinephrinesystemessentiallyshutsoff
duringtypicalREMsleep.

Norepinephrineanddreams:Ingeneral,norepinephrineis
consideredtobelessrelatedtodreamingthantheotherthreetypes
ofneurotransmitters(serotonin,dopamine,andacetylcholine).
ThroughpersonalexperienceIhavefoundtheprofoundeffects
norepinephrinecanhaveondreaming.Supplementsthatboost
norepinephrinelevels(inthebrain)canproducesimilarresultsas
acetylcholineboostingsupplements.Thedreamexperiencestendto
belongandextremelyvivid.Unlikeacetylcholinehowever,
norepinephrinedoesnotseemtoinitiateREMsleepbutrather
supportsitsandprolongsit.

Norepinephrineandluciddreams:Norepinephrinecanhavea
profoundeffectonluciddreaming.Takenintherightdose,itcanact
asaluciddreamtriggerinthesamewaythatacetylcholinecan.
Norepinephrinedoesmorethanjusttriggerluciddreamshoweverit
helpsyoustayextremelylucidforverylongperiodsoftime.In
addition,itkeepsyoufocusedandalertwhileinthedreamand
greatlyenhancestheabilitytorecalldetailsandmemoriesfromyour
wakinglifewhilewithinthedream.Thisallowsyoutomaintain

Page50
44

ThePowerofSupplements

constantattentiononaccomplishinganygoals,experiments,orother
assignmentsthatyouhavepreparedforthedream.Thereare
severalkeystousingnorepinephrineboostingsupplementshowever.
Theymustbeusedinverysmalldosesandtheyaremosteffectiveif
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

46/182

12/25/2016

AdvancedLucidDreaming

takenwhennaturallyenteringREMsleep.Sincenorepinephrinedoes
notseemtoinitiateREMlikeAChdoes,thetwocanbeused
togethertoproduceanextremelyeffectiveluciddreamtrigger.

Norepinephrineandsupplements:Thereareveryfewnon
prescriptionsupplementsthatcanincreasenorepinephrinelevels
withoutsimultaneouslyaffectingserotoninanddopaminelevels.A
classofsubstancesknownasalpha2adrenergicblockersisknown
toindirectlyraisenorepinephrinelevelsinthebrainbypreventingthe
bindingofnorepinephrinetothealpha2nervecellreceptors.
Unfortunately,therearefewnaturalsupplementsavailablewithouta
prescription.Onesupplementthatisavailableisasubstancecalled
Yohimbinewhichisveryeffectiveiftakeninextremelysmalldoses.
Yohimbinewillbediscussedinalaterchapter.

Summary:Eachofthesefourneurotransmittersplaysacrucialrole
inboththewakingandsleepcycles,includingdreamingandlucid
dreaming.Wecanuseeachtoouradvantageinordertosetupthe
bestpossiblecircumstancestoobtainenhancedluciddream
experiences.

Serotonin:Playsanindirectroleinluciddreaming.Increasing
serotoninwillincreasethetimespentinnonREMsleepbyactively
suppressingREMsleep.Althoughthepathisindirect,theserotonin

Page51
NeurotransmittersandDreaming

45

systemcanstillbeusedasaluciddreamaidbyutilizingtheREM
reboundeffect.Serotonincanalsobeusedtoincreasetheoverall
qualityofsleepbyallowingthedreamertobetterbalancethetime
spentinbothnonREMandREMsleepstages.

Dopamine:Mostlikelyplaysafundamentalroleindreaming
althoughdopaminebyitselfdoesnotseemtoactasaluciddream
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

47/182

12/25/2016

AdvancedLucidDreaming

trigger.However,dopaminegreatlyincreasesthecontrolthata
dreamerhaswithinaluciddreambysubstantiallyincreasing
confidenceandmotivationlevels.

Acetylcholine:Playsamajorroleinincreasingmemoryand
promotingREMsleep.Acetylcholinecanactasaluciddreamtrigger
byallowingthedreamertomovemoreeasilyfromwaking
consciousnessdirectlyintoadream.

Norepinephrine:Thisneurotransmitterisgenerallythoughttohave
muchmoretodowiththewakingstateasopposedtothesleepstate
althoughmyexperimentshaveshownittobeavaluabletoolfor
dreamenhancement.Norepinephrinecanactasluciddreamtriggerif
takenwhennaturallyenteringREMorcanbeusedsynergistically
withACh.Norepinephrinecangreatlyenhancefocusandattention
duringaluciddream.Norepinephrinealsohelpswithremembering
yourwakinglifewithinthedreamstateandconverselyyourdream
lifewithinthewakingstate.

Page52

Part2:
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

48/182

12/25/2016

AdvancedLucidDreaming

IndividualSupplementProfiles
InthefollowingchaptersIshalldiscussthespecificoverthe
countersupplementsthathavemadethebiggestimpactonmylucid
dreamdevelopment.ThegoalofPart2istointroduceeachofthe
individualsupplementsbysummarizingtheirkeycharacteristics,
typicaldoses,possiblesideeffects,andsoon.Iwillalsocommenton
theroleeachofthesesupplementshasplayedinmyluciddream
development.
Ingeneral,pleaseexercisecautionandcommonsensewhen
itcomestotakingdietarysupplementsofanykind.Istrongly
recommendyouconsultadoctorbeforetakingsupplements,
especiallyifyouhave(orthinkyoumayhave)anymedical
conditions,oraretakingprescriptiondrugsforhealthreasons.

Page53
47

6
ImportantDefinitions
Thereareafewdefinitionsandconceptsthatarehelpfulto
understand.Keepinmindthatnotallsupplementsarecreatedequal
evenifthelabelssaytheydoexactlythesamething.Inordertohelp
understandtheirusefulness,Ilisttenkeycharacteristicsusedto
comparesupplementstoeachotherandtomyowngoalsofdream
enhancement.

BloodBrainBarrier:Usingsupplementstoenhancedreaming
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

49/182

12/25/2016

AdvancedLucidDreaming

requiresthattheyhavesomeeffectonthebrainschemistry.The
bodyregulateswhichsubstancescanpassintothebrainthrougha
systemreferredtoasthebloodbrainbarrier.Thisbarrieractsasa
typeoffilterthatonlypermitscertainsubstancestopassfromthe
bloodintothebrain.Therearemanysubstances,andthereforemany
supplements,thatdonoteasilycrossthebloodbrainbarrier.These
typesofsubstanceswillbeoflittleornouseinenhancinglucid
dreamdevelopment.Unfortunately,mostoftheneurotransmitters
themselvesdonotcrossthisbarrierandthereforetakingoraldoses
ofserotoninordopamine,forexample,willhavenoeffectonthe
serotoninordopaminelevelsinthebrain.Thesupplementsoutlined
inthisbookreadilycrossthebloodbrainbarrierandacttoincrease
neurotransmitterlevelswithinthebrainbyusingoneofseveral
mechanismsofactiondescribedbelow.

Page54
48

ThePowerofSupplements

MechanismofAction:Neurotransmitters,likeACh,donoteasily
passthroughthebloodbrainbarrier,sothesupplementsmustbe
abletoenterthebrainandthenworktoincreasetheneurotransmitter
levels.Thereareseveralmechanismsofactionthatthesupplements
canusetoaccomplishthis.Understandingthesemechanismswill
helpdeterminewhichsupplementshavethebestpotentialof
producingpositiveresults,andgiveinsightsonhowdifferent
supplementsmightworktogethersynergisticallytofurtherenhance
luciddreamdevelopment.
Thefourprimaryactionmechanismsaretheprecursor,the
agonist,theantagonist,andthereuptakeinhibitor.

Precursor:Aprecursorisasubstanceorcomponentfromwhich
anothersubstanceiscreated.Inotherwordsaprecursorisan
ingredientnecessarytoformadifferentsubstance.Forexample,
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

50/182

12/25/2016

AdvancedLucidDreaming

dopaminedoesnotcrossthebloodbrainbarrier,butseveralofits
precursorsdo.Onceadopamineprecursorcrossesthebloodbrain
barrieritisutilizedintheproductionofdopamine.Sincethe
dopamineisnowbeingproducedinsidethebrain,thebloodbrain
barriernolongerplaysarole.
Eachofthefourneurotransmittersdescribedinthisbookcanbe
directlyaffectedbyusingprecursors.Ageneralruleisthatthecloser
theprecursoristothefinalproduct,themoreefficientlyitwillwork
(assumingofcoursethatitcanpassthroughthebloodbrainbarrier).
Thefollowingsummarizestheprimaryprecursorsofserotonin,
acetylcholine,dopamineandnorepinephrine.

Page55
49

ImportantDefinitions

1.Serotoninprecursors:

Tryptophan5HTPSerotoninNAcetylSerotonin
Melatonin

Withintheserotoninsynthesislineallbutserotonin
andnAcetylserotoninpassthroughthebloodbrainbarrier
andareavailableasnonprescriptionsupplements.Since5
HTPiscloserinthechaintoserotoninitself,ittendstobethe
mostefficientprecursoratraisingserotoninlevelsinthebrain,
althoughTryptophanwouldalsobeanoption.Ascanbeseen
fromthediagram,elevatedserotoninlevelsalsoleadtoan
increaseinMelatoninalthoughsinceiteasilypassesthrough
thebloodbrainbarrier,aMelatoninsupplementisprobably
moreefficient.

2.Acetylcholineprecursors:
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

51/182

12/25/2016

AdvancedLucidDreaming

VitaminB5CoAAcetyl
CholineSupplementPhosphatidylcholineCholine
Choline+AcetylAcetylcholine

Acetylcholineisformedbyaddinganacetylgroup
ontoacholinemolecule.VitaminB5istheprimaryprecursor
neededtoformtheacetylgroup.Mostnormaldietsinclude
sufficientamountsofvitaminB5soyouprobablyhaveplenty
ofacetylgroupsinyourbrainatanygiventimethatcanbe

Page56
50

ThePowerofSupplements

usedtohelpformacetylcholine.Thisisnotthecasefor
Cholinehowever.
Onlytwotypesofcholinesupplementsefficientlycross
thethroughthebloodbrainbarrier:GPC&CDPcholine.Of
thesetwoGPCisdefinitelythebestoneforluciddream
enhancementforreasonshighlightedinchapter8.Boththese
supplementsincreaselevelsofPhosphatidylcholinewithinthe
brainwhichthenrevertsbacktocholineinordertoform
acetylcholine.

3.DopamineandNorepinephrineprecursors

PhenylalanineTyrosineLDopaDopamine
NorepinephrineEpinephrine

Dopaminedoesnotpassthroughthebloodbrain
barrierbutallthreeofitsprecursorsdo.Ofthethree,Ldopa
isbyfarthemostefficientatincreasingdopaminelevels
withinthebrain,althoughPhenylalanineandTyrosineare
possiblealternatives.PureLdopaisonlyavailableby
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

52/182

12/25/2016

AdvancedLucidDreaming

prescriptionbutthereareseveralspeciesofbeansthat
naturallycontainLdopa.Thetypethatcontainsbyfarthe
highestLdopacontentiscalledMucunaPruriens.Mucuna
Pruriensisavailableasanonprescriptionsupplement.
Asyoucanseefromtheabovediagram,dopamineis
theimmediateprecursortonorepinephrineandthereforeany
precursortodopamineisalsoaprecursortonorepinephrine.
Unlikedopaminehowever,norepinephrinecanpassthrough

Page57
ImportantDefinitions

51

bloodbrainbarrieralthoughitisavailableonlybyprescription.
Youwouldntwanttouseitanywaybecauseonceinthe
blood,norepinephrinecausesahostofundesirableside
effectssuchasrapidheartbeat,increasedbloodpressure,
hypertension,andothers.Norepinephrineisbestkeptwithin
thebrain.

Agonist:Anagonistisasubstancethatmimicstheactionsofa
neurotransmitterbybindingtothespecificreceptorsofthenaturally
occurringsubstance.Inotherwords,anagonistisatotallydifferent
chemicalthatactsinthesamewayasoneoftheneurotransmitters.
Neurotransmittersworkbybindingtospecifictypesofreceptors.The
shapeoftheneurotransmitterdetermineswhetheritcanfitintoand
bind(lock)tothereceptor.Youcanthinkofaneurotransmitterasa
keyandareceptorasalock.Thekeymusthavethecorrectshapein
ordertofitintoandactivatethelock.Anagonisthasessentiallythe
sameshapeastheneurotransmitterandthereforecanalsobindto
thereceptorandactivateit.Thereforeanagonistproducesthesame
resultastheneurotransmitteritself.Unfortunately,nonprescription
agonistsarescarce.TheonlyagonistIhaveincludedisNicotine(via
apatch).Nicotineisapowerfulacetylcholineagonistthatcan
produceexcellentluciddreamresults,butofcourse,hassome
seriousdrawbacks.Nicotinewillbecoveredindetailinchapter9.
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

53/182

12/25/2016

AdvancedLucidDreaming

Antagonist:Anantagonistisasubstancethatblockstheactionof
anothersubstance.Inkeepingwiththekeyandlockanalogy,
whereasanagonistcanfitintothelockandopenit,anantagonist
canfitintothelockbutdoesnotopenit.Insteaditblocksthecorrect

Page58
52

ThePowerofSupplements

key(agonistorneurotransmitter)fromopeningthelock.Thistypeof
actioncanindirectlyleadtoabuildupofspecificneurotransmitters
bynotlettingthembeutilized(usedup)efficiently.Alpha2
antagonists(sometimescalledalpha2receptorblockersoralpha2
adrenergicblockers)blockthereceptorsthatarenormallyusedto
controlthereleaseofnorepinephrine.Byblockingthesereceptors,
thebrainistrickedintothinkingthatthereislessnorepinephrinethan
isactuallypresentwhichresultsinthereleaseofadditional
norepinephrinewithinthebrain.Yohimbineisanalpha2antagonist
andwillbediscussedinchapter12.

ReuptakeInhibitor:Areuptakeinhibitorisasubstancethat
preventsthebreakdownoftheneurotransmitterallowingittostayin
yoursystemlonger.Sincetheneurotransmitteriscontinuouslybeing
produced,areuptakeinhibitorcanincreasetheamountofthe
neurotransmitterinyoursystembyhavingyourbodycreateitfaster
thanitisbreakingitdown.Reuptakeinhibitorsareprobablythe
doctorsfavoritechoiceincombatingalargenumberofmental
disorderssuchasdepression,ADD,andAlzheimersdisease.
Althoughmostreuptakeinhibitorsareprescriptionbasedtherearea
fewthatareavailableasoverthecountersupplements.Oneofthem
inparticular,Galantamine,isapowerfulsubstanceforluciddream
enhancement.Galantaminewillbediscussedindetailinchapter7.
Youshouldbecarefulwithreuptakeinhibitors,particularly
substancescalledMAOinhibitors.Monoamineoxidase(MAO)isa
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

54/182

12/25/2016

AdvancedLucidDreaming

chemicalthathelpsbreakdownserotonin,dopamine,and
norepinephrine.ThereforeaMAOinhibitor,blocksMAOfrom
breakingdownthesesubstancesleadingtoincreasesinallthree

Page59
ImportantDefinitions

53

neurotransmitterssimultaneously(inmoreorlessequalamounts).
Therearethreedisadvantagesinusingthisapproachforluciddream
enhancement.First,youlosedirectcontroloverhowmuchofeach
individualneurotransmitterisadjusted.Secondly,yougenerallydont
wanttoboostserotoninlevelsatthesametimethatyouboost
dopamineornorepinephrinelevels.SerotonindecreasesREM.Only
aftertheserotoninwearsoffisitpossibletoexperienceaREM
reboundeffect.Thirdly,MAOinhibitorstendtocausemanydrug
interactionswhichmeansyouneedtobeextracarefulwhen
combiningthesesubstanceswithothermedicines,herbs,oreven
somefoodsbecauseitispossibletoexperienceapotentially
dangerousreaction.ThereasonIpointthisoutisbecauseMAO
inhibitorsareverycommonandareoccasionallytalkedaboutby
luciddreamenthusiasts.HerbssuchasSt.JohnsWort,Passion
Flower,Nutmeg,LicoriceRootandmanyothersareconsideredMAO
inhibitorsandhavebeensitedaspotentialluciddreamenhancing
substances.Myapproachisbasedonfindingindividualsupplements
foreachofthefourindividualneurotransmittersandthereforeI
generallytrytostayawayfromMAOinhibitors.

Summary:Ihaveintroducedfourprimarymechanismsofaltering
neurotransmitterconcentrationsinthebrain:precursors,agonists,
antagonists,andreuptakeinhibitors.Weshalllearnhowtomake
useofeachofthesemechanismsinordertoproduceexceptional
luciddreamexperiences.

Timetopeakplasmalevels:Aftertakenorally,asupplement
mustpassfromthestomachintothebloodstream.Ingeneral,the
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

55/182

12/25/2016

AdvancedLucidDreaming

Page60
54

ThePowerofSupplements

concentrationofthesupplementinthebloodstartsatzero(atthe
timethedoseistaken),thengraduallyrisestosomemaximum
concentrationafteraperiodoftime,andthenstartstodecreaseback
towardszero.Thetimetopeakplasmalevelisthetimeittakes,
startingatthetimeyouswallowthepill,forthebloodconcentrations
toreachthemaximumstate.Thisconceptisextremelyimportant
whendecidingthebesttimetotakethesupplements.Ingeneral,you
wantthemaximumconcentrationtobereachedatthetimeoflucid
dreaminduction.Somesubstancesreachpeakplasmalevelsina
shortamountoftime(i.e.lessthan1hour)whileothersmaytake
muchlonger.

Eliminationhalflife:Thisistheamountoftimeittakesthe
plasmaconcentrationofasupplementtobecutinhalf.Forexample,
Ldopa(aprecursortodopamine)reachesitspeakplasmalevelin1
to1.5hoursafteringestion.Similarly,theplasmaconcentrationiscut
inhalfabouteveryninetyminutesthereafter.Onehourafteringestion
thepeakconcentrationisreachedninetyminuteslaterthe
concentrationisonehalfanotherninetyminutesandthepeak
concentrationisonequarterofitsmaximumlevelninetyminutes
latertooneeighthandsoon.Theeliminationhalflifeisessentiallya
measureofhowlongasubstanceremainsinyoursystem.AsIwill
pointoutinchapter18,inordertominimizedesensitizationand
toleranceissuesitisbesttoadoptofphilosophyoflettingthevarious
supplementstotallyclearoutofyoursystemaftereachluciddream
attempt.BytotallyclearoutIamimplyingthatthelevelofeach
supplementhasdroppedto3%orlessofitsmaximumvalue.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

56/182

12/25/2016

AdvancedLucidDreaming

Page61
55

ImportantDefinitions

Becauseofthisfact,wheneverpossibleIrecommendfinding
supplementswithshorteliminationhalflives.

ConcentrationCurve:Plottingthetimetopeakplasmaleveland
eliminationhalflifeinformationonacurvegivesagoodvisual
representationoftherelationshipbetweentimeandplasma
concentrationforaparticularsupplement.Thesecurvesprovidea
wealthofinformationaswewillseeintheupcomingchapters.The
followingconcentrationcurveisanexampleforGalantamine(an
AChEinhibitorthatboostsacetylcholinelevelsinthebrain).

ConcentrationcurveforGalantaminewithPeakPlasmatime=1hrandeliminationhalflife=7
hr

ThisconcentrationcurvevisuallyshowshowGalantamineis
quicklyabsorbedintothebloodstreamandthat~48hoursare
requiredbeforeitisessentiallyclearedfromthebody.

TherapeuticdoseThetherapeuticdoseisdefinedasthedoseofa
drugthatisrequiredtoachieveadesiredresult.Thetherapeutic
doserequiredforluciddreamdevelopmentisgenerallylessthanthe

Page62
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

57/182

12/25/2016

AdvancedLucidDreaming

56

ThePowerofSupplements

therapeuticdoseassociatedwiththemorecommonlycitedreasons
thesupplementsareused.Thisisgoodbecausesideeffectsand
druginteractionsarealmostalwaysdiminishedatsmallerdoses.

Toxicity,SideEffectsandtheTherapeuticIndex:Practically
everysubstanceknowntomanistoxicinlargeenoughdoses.The
sameistrueofsideeffects.Theimportantpointistounderstandthe
severityandfrequencyofthesideeffectsatthetherapeuticdose.
Thetherapeuticindexisonetoolusedtotrytounderstandthe
relationshipbetweenthedoseandthesideeffects.Thetherapeutic
indexisdefinedastheratiobetweentheminimumeffectivedoseand
maximumtolerateddoseofadrug.Ifthetherapeuticindexisgreater
thanonethenfewsideeffectsoccur.Iftheratioisequaltoorless
thanonethensideeffectswillalmostdefinitelyoccur.Ofcourse
anotherimportantmeasureistheseverityofthesideeffectswhich
canrangefrombarelynoticeabletolifethreatening.

Druginteractions:Adruginteractionisdefinedastheactionof
onedrugonthemetabolism,effect,ortoxicityofanotherdrug.
Sometimesdrugstakenindividuallyareverywelltoleratedbutwhen
takentogetherproduceunwantedeffects.Ofcourse,sometimestwo
drugscanactharmoniouslywitheachotherandprovideagreater
benefitthanwhentakenindividually.SinceIcommonlycombine
supplementsitisveryimportanttobeawareofanydruginteractions
thatcouldoccur(bothgoodandbad).ThisisonereasonIhavetried
tofindsupplementsthatmoreorlessfunctionononlyoneofthefour
neurotransmitters.Thisapproachallowsforbetteroverallcontroland
fewerinteractions.Asstatedbefore,someinteractionsarebeneficial

Page63
ImportantDefinitions

57

anddesired.Forexamplethesynergythatiscreatedbycombining
anAChprecursorwithanAChEinhibitorproducesextremelygood
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

58/182

12/25/2016

AdvancedLucidDreaming

oddsoftriggeringaluciddream.Themostimportantpointto
rememberistostayinformed.Manufactures,bylaw,mustdisclose
allknowndruginteractions.Particularlywhenstrivingforasynergistic
combination,alwaysstartatlowdosesinordertoseejusthow
synergisticitis.

ToleranceandDesensitization:Toleranceanddesensitization
arerelatedbutarenotsynonymouswitheachother.Where
desensitizationisaphysiologicalphenomenon,tolerancecanbe
moreofalearnedphenomena.Somesupplementscanleadtoa
desensitizationofthevariousneurotransmitterreceptorsites.Should
thisoccur,itwouldbenecessarytotakealargerdoseinordertoget
thesameeffect.Alargerdoseleadstofurtherdesensitizationwhich
inturnrequiresanotherincreaseindose.Ifthiscycleisallowedto
continueonewouldeventuallyreachthedoseatwhichnegativeside
effectsstarttooccur.Atthispointthesupplementisnolonger
effective.
Toleranceisalittledifferent.Forexample,ifsomeonedrinks
acupofcoffeebeforebedtime,theywillmostlikelylieawakefor
severalhoursuntiltheeffectsofthecaffeinewearoff.Caffeineworks
byblockingtheactionofachemicalcalledadenosine.Adenosineisa
differenttypeofneurotransmitterthantheonesdiscussedinthis
bookbutitisbelievedtobethemainsleepneurotransmitter.Ithas
beendemonstratedthatcaffeine,unlesstakeninverylargedoses
overlongperiodsoftime,doesnotleadtothedesensitizationof
adenosinereceptors.Yet,ifonecontinuestodrinkacupofcoffee,

Page64
58

ThePowerofSupplements

nightafternightbeforebedtime,eventuallyonestartstofalltosleep
withoutmuchdifficulty.Thislearnedbehaviorispartofournatural
adaptationprocess.Therearealsoevenlesstangibletypesof
tolerance.Forexample,thefirsttimeyoutakeasupplementthatyou
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

59/182

12/25/2016

AdvancedLucidDreaming

believewillcauselucidity,itverylikelywill.Thisisbasedonastrong
expectationofsuccessalongwithastrongemotionalcomponent.As
yourepeattheexperimentnightafternight,eventuallyyour
expectationsandemotionsstarttonormalizeandthesupplement
losesitseffectiveness(eventhoughphysiologicallyitisstillworking).
Fortunatelythereareafewsimpleguidelinesyoucanfollow
toavoiddesensitizationandtolerance.Ihavebeenverysuccessfulin
notbuildingupatoleranceorallowingdesensitizationtotakeplace.
Thisisanextremelyimportanttopicfortheluciddreamerandan
entirechapterisdedicatedtothemethodsthatworkbest.

Dreamenhancementthresholdandtheluciditytrigger:The
Dreamenhancementthreshold(DET)isatermusedtorepresentthe
effectivenessofdifferentdosagesofaparticularsupplementat
enhancingdreams.Itisasubjectivemeasuremeanttodocumentthe
minimumdosageofasupplementthathasanundeniableeffecton
dreamvividnessandrecall.Theapproachistoexperimentwith
varyingdosagesofaparticularsubstanceandrecordhowthelevels
impactdreamvividnessandrecall(aswellasmanyotherfactors).
WhenIreachadosethathasapositiveeffectonmydreaming,Iflag
itashavingpassedtheDET.Thisinformationisusefulincomparing
theoveralleffectivenessofdifferentsupplementsandaswellas
optimizingafinalsupplementschedule.

Page65
ImportantDefinitions

59

AluciditytriggerisanothertermIdefinedtorepresentthe
effectivenessofaparticularsupplementintriggeringaluciddream.
Notallofthesubstancesincludedinthisbookareluciditytriggers,
norshouldtheybe.Thereismoretoadvancedluciddreamingthan
justhavingaluciddream.Triggersare,ofcourse,extremely
importantbutsoisdreamcontrolandhavingtheabilitytoreason
withinthedream.
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

60/182

12/25/2016

AdvancedLucidDreaming

Page66
60

7
Galantamine

GeneralDescription:GalantamineisclassifiedasanAChE
inhibitor.Acetylcholinesterase(AChE)isthesubstancethatbreaks
downacetylcholinewithinthebrain.Byinhibitingthisbreakdown,
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

61/182

12/25/2016

AdvancedLucidDreaming

acetylcholinecanbuildtoincreasedlevels.Galantamine(aswellas
otherAChEinhibitors)isthesubjectofintenseresearchbecauseof
itsapparentabilitytoincreasememoryandactuallyimprove
Alzheimersdiseasesymptoms.NotonlydoesGalantamineinhibit
thebreakdownofacetylcholine,thereisalsoevidencethatitactsas
anacetylcholineagonistaswell.ThismeansthatGalantaminegives
adoubleboosttotheapparentlevelsofAChwithinthebrain.
Rememberthatacetylcholineisatitshighestlevelsduring
wakefulnessandREMsleep.ByincreasingAChlevelsyouwilltend
togodirectlyintoREMwhenyoufalltosleepprovidedthatyoudont
putyourbodyinconflict.Thenormalsleepcyclebeginsbymoving
quicklyintothedeeper(nonREM)stagesofsleep.Taking
Galantamineisnotnearlyaseffectiveiftakenbeforebedtimeas
opposedtoafter4or5hoursofsleep.Bytakingitbeforebedtime
youaretryingtoforceyourbodyintoREMwhenitwantstoenter
deepsleep.Youroddsofbecominglucidaregreatlyreducedand
youareessentiallydeprivingyourselfofqualitysleep.

Page67
Galantamine

61

Whentakenafter4or5hoursofsleepGalantaminecanactas
luciditytriggerinthatitallowsyoutomovedirectlyfromwakefulness
intoadreamstatewithanunbrokenconsciousness.Thismakes
GalantaminehighlyeffectiveatproducingWILDs.Oneofthe
characteristicsthatmakesGalantaminesoeffectiveisthatitis
rapidlyabsorbedbythebody.

MechanismofAction:GalantamineisanAChE
(acetylcholinesterase)inhibitor.Acetylcholinesteraseisthechemical
thatbreaksdownacetylcholineinthebrain.ThereforeGalantamine
causestheacetylcholinewithinthebraintoincrease,bycausingthe
braintomanufactureAChfasterthanitisbeingbrokendown.There
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

62/182

12/25/2016

AdvancedLucidDreaming

issomeevidencesuggestingthatgalantaminealsoactsasan
acetylcholineagonist.

ConcentrationCurve:Galantamineischaracterizedbyquick
absorptionandarelativelylongeliminationhalflife.Itreachesits
peakplasmaleveljust60minutesafteringestedbuttakesabout48
hourstobecompletelyflushedfromyousystem.

Page68
62

ThePowerofSupplements

ConcentrationcurveforGalantaminewithPeakPlasmatime=1hrandeliminationhalflife=7hr

EffectonDreams:Galantaminehasaprofoundimpacton
dreaming.Galantaminewillcauseextremelyvividandlongdreams.If
theGalantamineisallowedtofullyclearfromyoursystem(i.e.only
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

63/182

12/25/2016

AdvancedLucidDreaming

takeiteveryothernightorless)dreamsseemtobenormaland
pleasant(especiallyifusingPiracetamtocounterdesensitization
seechapter10).IfGalantamineisnotallowedtocompletelyclearout
ofthebodyand/oriftolerance/desensitizationstartstooccur,dreams
canbecomemoremovielike,bazaar,andperhapsnightmarish(kind
oflikemorbidPicassoimages).Thisisanexcellentmarkerthatyou
needtotakesometimeofffromusingthesubstanceandfrom
stimulatingthecholinergicsystemingeneral.Thiscanbetotally
avoidedifluciddreamattemptsarekepttoaneveryotherdaybasis
orlessandifPiracetamisusedtocountertheeffectsofGalantamine
directlyfollowingaluciddreamattempt(seechapters10&18).

EffectonLucidDreams:AsIhavementioned,Galantaminecanbe
usedasaluciddreamtrigger.Thereareseveralothersubstances

Page69
Galantamine

63

thatcanalsotriggerlucidity(Nicotine,GPC,andsmalldosesof
Yohimbine)butItendtofavorGalantamineforanumberofreasons.

SideEffects:Therearenumeroussideeffectslistedfor
Galantamine:Nausea,vomiting,diarrhea,dizziness,decreased
appetiteandweightloss.Thesearealldoserelatedhowever.Dueto
itspositiveimpactonmemory,Galantamineiscommonlytakento
reducetheeffectsofAlzheimersdiseaseatdosesupto24mgper
day.Luciddreamenthusiastwillfindthatnomorethan8mgare
necessarytotriggeraluciddream.Atthe8mgdoselevelthatIuseI
havenoticedthreemainsideeffects:
1.Igetsomestrangenoisescomingfrommystomach.Thisis
moreinterestingthanannoying.
2.Itispossibletogetmusclecrampsand/orspasms.There
havebeenseveraloccasionswhereIwakeupafteralucid
dreamandwhenIstandupIgetanimmediatecharleyhorse
inoneorbothofmycalves.Thishashappenedmaybe2or3
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

64/182

12/25/2016

AdvancedLucidDreaming

percentofthetime.Thecrampsgoawayquicklybutthe
musclecanfeeltenseformorethanadayfollowingacramp.
3.Energydrainedonthefollowingday.Galantaminewillgivea
considerableboosttoyourcholinergicsystemandcaninturn
depriveyouofthedeeprejuvenatingsleepstages.Itismuch
bettertotakeGalantamineafterabout4or5hoursofsleep.
Thiswillgreatlyimproveyouroddsofbecominglucidandalso
allowyourbodytogetthedeepsleepitneedsinthefirstpart
ofthenight.Thiscanbefurtherenhancedbytaking5HTP
priortogoingtosleep.The5HTPsuppressesREMinthe
firsthalfofthenightandisjustaboutwornoffwhen

Page70
64

ThePowerofSupplements

Galantamineistaken.Galantaminesuppressesdeepsleepin
thesecondhalfofthenight.Theresultisamoreorless
balancednightssleep.Thisapproachhasmadeahuge
differenceinhowIfeelfollowinganightusingGalantamine.

Dosage:Ihavealmostexclusivelyused8mgcapsules.Morethan
thatisnotnecessaryandshouldbeavoidedinordertominimize
tolerance/desensitizationandavoidanynegativesideeffects.Ihave
alsoexperimentedwith4mgandstillexperiencedextremelyvivid
dreamsalthoughIcurrentlyuse8mgregularly.

SpecialNotes:NoticethatGalantamineremainsinyoursystemfor
about48hours.Thismeansthatyouracetylcholinelevelsare
boostedwellbeyondthetimeyousetasideforluciddreaming.This
canleadtotoleranceanddesensitizationissues.Onecanavoidthis
iftheyfollowthedetailedschedulelaidoutinchapters17,18,&19.
ThereareseveralformsofGalantamineavailable:pure
Galantamine,GalantaminecombinedwithaformCholineand
Galantaminecombinedwithothersupplements.Forreasonsthatwill
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

65/182

12/25/2016

AdvancedLucidDreaming

becomeclearinthenextchapter,Irecommendcombining
GalantaminewithCholineeitherasapreformulatedmixtureortaken
individually.TrytoavoidpurchasingGalantaminethatispremixed
withsupplementsotherthanCholine.
AlsobeawarethatthereisanotherAChEinhibitorthatis
availablewithoutaprescription.ThissubstanceisHuperzineAand
hasbeenusedinChinesemedicineforaverylongtime.Atthe
presenttimeIhavenotdoneanyexperimentswiththissubstancebut
itmaybeanalternativetogalantamine.

Page71
Galantamine

65

Summary:IuseGalantamineasaluciddreamtrigger.Forthisto
workGalantamineshouldbetakenafter4or5hoursofqualitydeep
sleep.SinceGalantaminetakesafull48hourstocompletelyclear
outofyoursystem,itshouldnotbetakenontwoconsecutivenights.
Ifdreamsbecomemovielikeand/orbazaarconsidertakingafew
daysoff.Piracetamcanbeuseddirectlyfollowingaluciddream
attempttocounteracttheeffectsofGalantamineandreduce
sensitivitytotoleranceand/ordesensitization.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

66/182

12/25/2016

AdvancedLucidDreaming

Page72
66

8
CholineSupplements
GeneralDescription:CholineisverycloselyrelatedtothevitaminB
familyandisconsideredanessentialnutrientbytheUSFoodand
DrugAdministration(FDA).TherearemanykindsofCholine
supplementsavailable:CholineSalts(CholineCitrate&Choline
Bitartrate),Lecithin(phosphatidylcholine),CDPCholine,GPC
(Glycerophosphocholine),andothers.Oftheavailableforms,the
CholinesaltsandGPChaveproventobeespeciallyusefulforlucid
dreamenhancement.

CholineSalts:
BothCholineBitartrateandCholineCitratearepartofgroupof
substancesreferredtoasCholinesalts.Whenyouseeasupplement
thatissimplycalledCholine,mostlikelyitiseitherthebitartrateor
citratevariety.Thesetwotypesarethemostcommonandmostin
expensiveformsofCholinesupplementavailable.Althoughthesalts
passthroughthebloodbrainbarrier,itisoftensaidthattheydoso
inefficiently.Theirtransportiscontrolledbytheconcentration
gradientbetweenthebloodandthebrainandnormallythebrainhas
highenoughconcentrationsofCholinetoallowonlyasmallfraction
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

67/182

12/25/2016

AdvancedLucidDreaming

ofthesupplementstoenter.Howeverifbrainconcentrationsare
lower,Cholineistransportedmoreefficiently.

Page73
CholineSupplements

67

Onceinthebrain,freeCholineisquicklyconvertedintoacetylcholine
andthereforelowlevelsofCholinetranslateintolowlevelsofACh
andvisaversa.SinceduringthenonREMstagesofsleep,
acetylcholinelevelsarelowerthannormal,transportoffreeCholine
isimprovedifavailable.
TheadvantagethattheCholinesaltshaveisthattheyare
morequicklyabsorbedbythebody.Thisallowsthemtobeused
synergisticallywithGalantamine.Inadditiontotheoveralllevelof
AChinthebrain,animportantfactorininitiatingaWILDistherateof
increaseofacetylcholine.GalantamineinhibitsthebreakdownofACh
butdoesnotincreasetheproductionofit.Addingoneofthesaltscan
jumpstarttheaccumulationprocessbyproducingAChatafaster
rate.Thisnoticeablyincreasestheoddsofbecominglucidandcan
intensifythetransitioningprocess(seechapter22)fromwhatis
normallyexperiencedwithGalantaminealone.

GPC:
AlthoughtheCholinesaltscanjumpstarttheaccumulationprocess,
theyquicklylosethereefficiencyastheconcentrationofACh
increases.Tokeeptheaccumulationprocessgoing,adifferenttype
ofsupplementisrequiredonethatdoesnotdependonlowlevelsof
ACh.OnlytwotypesofCholinesupplementsareknowntocrossthe
bloodbrainbarrierefficientlyundernormalconditions:CDPcholine
andGPC.Bothsupplementsactasaprecursortoacetylcholine,but
ofthetwo,GPCissuperiorwhenitcomestoluciddream
enhancement.TherearethreereasonsGPCispreferred:

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

68/182

12/25/2016

AdvancedLucidDreaming

Page74
68

ThePowerofSupplements

1.ThetimetopeakplasmalevelsforGPCis3hours.Whereas
thetimetopeakplasmalevelsofCDPcholineis6hours.
2.TheeliminationhalflifeofGPCis~1.5hours.Theelimination
halflifeofCDPcholineis~4.5hours.
3.IhavesuccessfullyusedGPCasaluciddreamtriggerbut
CDPcholinehasnevertriggeredaluciddreamformeor
evenhadmuchofanimpactondreamingatall.AlsoGPC
workssynergisticallywithGalantaminetogiveexcellentodds
ofbecominglucidwhereasCDPcholinedidnthaveany
noticeableimpact.

Ifyouaretryingtoincreaseyourmemory,bothsupplementsmay
workthesame.However,ifyouaretryingtodevelophighquality
luciddreams,GPChasclearadvantages.ThefactthatCDPcholine
hassuchalongtimeuntilthepeakplasmalevelsarereachedmakes
itfarfromidealfortheluciddreamer.TouseCDPcholine,onewould
mostlikelyneedtotakeitbeforebedtimesothepeakplasmalevels
wouldarriveatthetimeoftheluciddreamattempt.Althoughthismay
seemlikeaviableapproach,considerwhatishappeningtothe
qualityofdeepsleepinthehoursbeforetheattempt.Acetylcholine
levelswouldbeslowlyandsteadilyrisingwhilethebodyistryingto
maintainthelowlevelsneededforthedeeprejuvenatingsleep
stages.Theresultisadecreaseinsleepquality.
GPCstandsforGlycerophosphocholinebutithasalsobeen
called

Choline

Alfoscerate,

Alphoscerate,

Lalpha

Glycerylphosphorylcholine,andalphaGPC.GPChasbeenused
extensivelyinItalyandotherpartsofEuropebuthasonlyrecently
becomeavailableintheUnitedStates.Duetothisfact,mostofthe

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

69/182

12/25/2016

AdvancedLucidDreaming

Page75
CholineSupplements

69

researchhascomeoutofEurope.TheEuropeanresearchisvery
impressiveandGPChasbeenshowntoimprovecognitivefunction
forbothyoungandoldinseveralstudies.Somestudieshaveshown
GPCtobejustaseffectiveasDonezepilandsuperiorto
Rivastigmine(bothareprescriptionAChEinhibitors)inrelievingthe
symptomsofAlzheimersdisease.FurthermoreGPCisextremely
welltoleratedandhasnoserioussideeffectsatthetherapeutic
dosages.

MechanismofAction:Cholinesupplementsareprecursorsto
acetylcholineandcauseacetylcholinelevelstorisebyallowingthe
braintoproducemore.

ConcentrationCurve:BecauseCholineisfoundnaturallyinmany
foodsources,ithasbeendifficulttofindpeakplasmatimestudiesfor
thestandardforms(i.e.theCholinesalts).Severalstudiessuggest
thattheCholinesaltsaremetabolizedfasterthantheotherforms
(GPCandCDP).OnestudymentionsthatCholineBitartrateis
absorbedmorethantwiceasfastasfastasGPCandhasthesame
eliminationhalflife.GPChasaneliminationhalflifeof90minutes
andtakesabout3hourstoreachitspeakplasmalevels.Basedon
thisinformation,IhaveassumedthatCholineBitartratereachespeak
plasmatimesinaboutanhourandalsohasa90minuteelimination
halflife.Duetothesimilarityinstructureandmetabolicpathwaysitis
probablethatCholineCitrateismetabolizedinthesamewayas
CholineBitartrate.

Page76
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

70/182

12/25/2016

AdvancedLucidDreaming

70

ThePowerofSupplements

ConcentrationcurveforGPCwithPeakPlasmatime=3hrandeliminationhalflife=1.5hr

ConcentrationcurveforCholineBitartratewithestimatedPeakPlasmatime=1hrand
eliminationhalflife=1.5hr

EffectonDreams:GPChasaprofoundimpactondreamingand
causesdreamstobeexceptionallyvividandlong.Ihavenothadany
bazaarornightmarishdreamsusingGPCbuthavenottrieditwithout
followingupwithPiracetamtoavoiddesensitizationissues.

Page77
CholineSupplements

71

Cholinesaltsdonothavemuchofanimpactondreaming
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

71/182

12/25/2016

AdvancedLucidDreaming

unlesstheyarecombinedwithGalantamineinwhichcasetheycan
intensifytheactionofGalantamine.

EffectonLucidDreams:CombiningaCholinesaltwith
GalantamineincreasestheoddsofexperiencingaWILD.Iconsider
theGalantamine/Cholinecombinationtobethefundamentallucidity
triggerfromwhichallothersarederived.
GPChasaprofoundeffectonluciddreamingandcanbe
usedeitherasatriggerorasasupportforGalantamine.Ifitisused
asatrigger,ithastheadvantagethatitiseasiertofallbacktosleep
thanwhenusingeitherGalantamineorYohimbine.Thisisprimarily
duetothelongertimeittakestoreachpeakplasmalevels.The
negativesideofthisisitdoesnotlenditselfaswelltoWILDsandall
myluciddreamsusingGPCbyitselfhavebeenDILDs.
WhenusingGalantamine/CholineandGPCtogetherIhavea
veryhighsuccessrateinbecominglucid.Thiscombinationworks
incrediblysynergisticallytogether.Interestinglythiscombinationalso
hasatendencytogivemyluciddreamsasoundtrackinthatIhear
musicplaying(sometimesveryloudly)duringthedream.Nicotine(an
AChagonist)hasasimilareffectbutofcoursealsohassomeserious
drawbacks(seechapter9).

SideEffects:Bothtypesofsupplementsareextremelywell
tolerated.MostGPCstudiesavailablereportonlymildsideeffectsin
asmallpercentageofthepeopletakingthesupplement.Theside
effectsgenerallyincludednauseaandinsomnia.Ihavenonoticeable

Page78
72

ThePowerofSupplements

sideeffectwithdosesupto1200mgofGPCorwithupto1000mg
ofaCholinesalt.

Dosage:ThedosageusedformostoftheGPCstudieswas1200
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

72/182

12/25/2016

AdvancedLucidDreaming

mgtakenoncedaily.IhavetakenGPCbyitselfatdosesof900mg
and1200mgandhavecombineditwithGalantamineatdosesof600
mg,900mg,and1200mg.Ihavehadluciddreamsunderallof
theseconditions,butthe900mgdosehadlesssuccessthanthe
1200mgdosewhenGPCwastakenalone.
Cholineisconsideredanessentialnutrientandthe
recommendeddailyallowanceis425mg/dayforwomenand550
mg/dayformen.ThemaximumsafelevelofCholinehasbeensetat
3.5grams/day.Forluciddreamenhancement400800mgshould
besufficient.Itypicallyuse500mgofCholineBitartratein
combinationwith8mgofGalantamine.
WhenaddingGPCtotheGalantamine/Cholinemix,a600mg
doseofGPCimprovestheoddsofbecominglucidandnoticeably
increasesthelengthoftheluciddream.Atdosesof900mgand
1200mgIexperiencedintenseperiodsofacceleration(seechapter
22)andmusicplayingduringmyluciddreams.Themusicseemsto
belouderwiththe1200mgdose.

SpecialNotes:Inordertoformacetylcholinetwoingredientsare
needed:Choline+Acetyl.CholinesupplementsprovidetheCholine
butwheredoesyourbodygettheAcetylgroupfrom?Theansweris
fromvitaminB5.MostdietsincludeplentyofvitaminB5butitis
probablynotabadideatosupplementyourdietwithagood
multivitamintakeninthemorning(notatthetimeofaluciddream

Page79
CholineSupplements

73

attempt).IdidsomeexperimentstakingvitaminB5intheformof
Panteteine(activatedformofB5)atthetimeoftheluciddream
attemptbutIdontrecommendititmakesitveryhardtofalltosleep
andmyotherexperimentshaveshownthatIdontneedit(althoughI
dogetB5inmyregulardiet).

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

73/182

12/25/2016

AdvancedLucidDreaming

VitaminB5CoAAcetyl
GPCphosphatidylcholineCholine
Choline+AcetylAcetylcholine

Summary:GPCandtheCholinesalts(bitartrateandcitrate)are
excellentsupplementstosupportluciddreaming.Combininga
CholinesaltwithGalantamineincreasestheoddsofexperiencinga
WILDandisthefoundationofallothercombinationsdescribedinthis
book.GPCcanbeusedtotriggerluciddreamsalthoughIgenerally
experienceDILDsinsteadofWILDswhenIuseGPCalone.My
favoritewaytouseGPCisincombinationwithGalantamine/Choline
taken4or5hoursaftergoingtobed.WhenIuseGPCthiswayIfind
600mgisoptimum(althoughIoccasionallyuse900mg).GPCand
Galantamine/Cholinegivemeahighsuccessrateatbecominglucid.
Note,IdonotusethemonconsecutivenightsandusePiracetam
immediatelyfollowingmyluciddreams(seechapter10).BothGPC
andtheCholinesaltsareextremelywelltoleratedandhavefew
noticeablesideeffects.

Page80
74

ThePowerofSupplements

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

74/182

12/25/2016

AdvancedLucidDreaming

Page81
75

9
Nicotine
GeneralDescription:Nicotineisaverycontroversialsubstance.
PersonallyIonlyuseNicotineonrareoccasion,butitwasoneofthe
firstsubstancesIexperimentedwith,andbecauseIhavehadsome
profoundresults,itmustbeincludedhereinordertobecomplete.
Nicotineisavailableviaapatchorchewinggumasanoverthe
counteraidtohelpquitsmoking.Nicotineactsasanacetylcholine
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

75/182

12/25/2016

AdvancedLucidDreaming

agonistwhichmeansithasessentiallythesameeffectsas
acetylcholineinsidethebrainanditquicklyandefficientlycrossesthe
bloodbrainbarrier.AlthoughNicotinedoesnotcausecancer,itis
addictivewhenusedregularlyandistoxiceveninsmalldoses.More
importantly,Nicotinecausesbothshorttermandlongterm
desensitizationoftheacetylcholinereceptorsandsincethese
receptorsarecrucialforluciddreamingitiswisenottotakethisfact
lightly.Warningsaside,Nicotinecanhaveaprofoundeffectonlucid
dreamingwhenused(1)onrareoccasions(2)insmalldosesand(3)
whenaproactivemethodisutilizedtocounteractdesensitization.
NicotineproduceseffectssimilartoGPCinthatitcanbeusedto
triggerluciddreamsanditalsoworkssynergisticallywith
Galantamine.AlthoughmyexperiencehasshownthatNicotineis
significantlymoreeffectivethanGPC,Nicotinecanhavefargreater
sideeffectssogreatercaremustbetakenincontrollingthedose.

Page82
76

ThePowerofSupplements

MechanismofAction:Nicotineisanagonistforacetylcholinewhich
meansthatitentersthebrainandactsinthesamemanneras
acetylcholine.

ConcentrationCurve:IfNicotineisadministeredviaapatch,the
concentrationcurvelookssomewhatdifferentthanthoseoforally
administeredsupplements.Whenapatchisapplied,plasmalevelsof
Nicotinerisesfairlylinearlyuntilthepeakplasmalevelsarereached
andthenslowlydropsovertheremainderoftheday(whilethepatch
iseffective),andthendropsmuchmorequicklyafterthepatchis
removed.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

76/182

12/25/2016

AdvancedLucidDreaming

ConcentrationcurveforaNicotinePatchwhenusedforanantismokingaid.

Althoughthisisatypicalcurveforauserwhoistryingtoquit
smokingitisnotatypicalcurveforsomeonewhoonlyusesa
Nicotinepatchtopromoteluciddreaming.Becauseoftherapid
desensitizationthatcanoccurwhenusingNicotineitiswisetoonly
wearthepatchduringtheluciddreamattemptandthenremoveit

Page83
77

Nicotine

immediately.Forexample,thepatchcanbeappliedat4AMjustprior
tohavinganLDandthenremovedat7AMjustafterwakingupfrom
theluciddream.Thisapproachisamustifyouwanttobeableto
consistentlyachieveremarkableresults.Thefollowingconcentration
curvecomparesthetypicalusertotheluciddreamenthusiast.

ConcentrationcurveforNicotinePatchforuseasaluciddreamsupplement

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

77/182

12/25/2016

AdvancedLucidDreaming

Nicotine(viathepatch)ischaracterizedbyrelativelyslow
absorption(~7.5hourstoreachpeakplasmalevels)counteredwitha
shorteliminationhalflife(~2hours).

EffectonDreams:Nicotinehasaprofoundimpactondreaming.
NonlucidNicotinedreamsseemabitmoredisturbingthanthose
producedbyeitherGPCorGalantamineandthevisualvividnessis
sometimeslacking.

Page84
78

ThePowerofSupplements

EffectonLucidDreams:AlthoughNicotinecantriggerlucid
dreamsbyitselfitisincrediblyeffectivewhencombinedwith
Galantamine.IfIhadonewordtodescribetheinfluenceofNicotine
onmyluciddreamsitwouldbemusic.EspeciallywhenNicotineis
combinedwithGalantamine,myluciddreamsseemtohavea
soundtrackfullofwonderfulandtotallyoriginalmusic.

SideEffects:OfallthesupplementsIhavetried,Nicotinehasthe
worstsideeffects.Thesecanbemanagedhowever,ifthepatchis
lowdoseandonlywornduringtheluciddreamattempt.Ingeneral,
toomuchNicotinemakesyoufeelill.Thesideeffectsgenerallylisted
are:dizziness,nausea,sorethroat,dryorwateringmouth,watering
eyes,headache,constipation,andskinirritation(wherepatchis
worn).WhenIfirststartedusingNicotineasaluciddreamaidIwould
putthepatchonpriortogoingtobed.Afterafulleighthoursof
wearingthepatchIwouldfeelandlooksick.Mycomplexionwas
literallygreen.ThiswentawayhoweverwhenIstartedputtingthe
patchonataround4AMandthenremovingitataboutthreehours
later.NotonlydidthesideeffectsgoawaybutIhadbetterresults
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

78/182

12/25/2016

AdvancedLucidDreaming

andbetterqualityofsleep.

Dosage:Nicotinepatchestypicallycomeinthreestrengths:7mg,
14mg,and21mg.Ihavetriedthe14mgand7mgvariety.Theyboth
workwellbutthe7mgresultsinfarfewersideeffects.Thedose
generallyrepresentstheaveragetotaldosereleasedovera24hour
period(or16hourperioddependingonthebrand).

Page85
Nicotine

79

SpecialNotes:ApossiblealternativetoNicotinepatchesisNicotine
gum.Thegumgivesalargerdoseinashorterperiodoftimebut
wearsofffaster.IhavenotdoneanyexperimentationwithNicotine
gum.

Summary:Nicotinedoesnotcausecancer(thetarincigarettesis
theculpritthere)howeveritisaddictiveandextremelytoxicforsmall
childrenandpets.Practicallyspeaking,ifyouweretouseaNicotine
patchsolelyasanaidforluciddreaming,youwouldmostlikelynever
becomeaddictedandifyoutakepropercareinkeepingthepatches
awayfromchildrenyouwillnotneedtoworryaboutaccidentally
poisoninganybody.Ifyouusethelowestdosepatch(7mg)andkeep
itonforonlyafewhoursyoumostlikelywillnotnoticeanyserious
sideeffects.ThereisanimportantreasonnottouseNicotinevery
oftenhowever,andthatisbecauseiscausesrapiddesensitizationof
yournicotinicreceptors(onetypeofacetylcholinereceptor):definitely
notforeveryday(orevenonceaweekusage).Personally,Irarely
useNicotinethesedaysbecauseofthisfactandbecauseGPC
producessimilarresults.IwilladmitthatNicotinecanhavea
profoundeffectontheabilitytohaveluciddreams.Ifyouaregoingto
considerusingNicotineIstronglyrecommendthatyoufollowupby
usingthenootropicPiracetam(seethenextchapter)inordertohelp
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

79/182

12/25/2016

AdvancedLucidDreaming

counteractdesensitization.

Page86
80

ThePowerofSupplements

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

80/182

12/25/2016

AdvancedLucidDreaming

Page87
81

10
Piracetam
GeneralDescription:Piracetamisaveryimportantsubstancethe
luciddreamerhasattheirdisposal,butnotforthereasonsyoumight
think.Piracetamdoesnotenhancedreaming(orluciddreaming)at
allinfactithasproventosignificantlysuppressdreaming.Ifyou
wouldliketoprovethistoyourselftakeahealthydoseofPiracetam
alongwithGalantamine(whichhasaprofoundeffectondreaming)
andseeifyoucanevenrememberhavinganydreams.Piracetam
however,reducesdesensitizationoftheacetylcholinereceptorsand
forthisreasonitallowsformorefrequentluciddreamattemptswhen
usedcorrectly.
PiracetamisinaclassofdrugscalledNootropics.Nootropicsare
typicallydefinedassmartdrugsbecausetheyarebelievedtohave
apositiveimpactonyourbrainaswellasonyourabilitytothinkand
remember.Theyarealsodefinedashavinganextremelylowtoxicity
whichmeansthattheyaresafetotakeeveninlargedoses.Notall
NootropicsarecreatedequalhoweverandPiracetamistheonlyone
thatIhavefoundinwhichthereisanabundantamountresearchon
howitaffectsthecholinergicsystem(acetylcholine).Piracetamis
thoughttocauseacetylcholinetobeusedupmoreefficientlyand
mayevenincreaseacetylcholinereceptordensity.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

81/182

12/25/2016

AdvancedLucidDreaming

Page88
82

ThePowerofSupplements

FurthermorePiracetamhasbeenshowntocounteractthe
desensitizationofthenicotinicreceptorswhencarbacholisused(a
powerfulAChagonistthatquicklydesensitizesAChreceptors).This
makesPiracetamanextremelypowerfultoolfortworeasons:

1.BothGalantamineandGPCboostacetylcholinelevelsand
stayinyoursystemwellbeyondthetimeittakestoattempta
luciddream.Itisbesttocounteractthiseffectassoonasthe
luciddreamattempthasended.Piracetamallowsyoutodo
this.(Seechapter18fordetails).
2.Nicotineisknowntocausebothshorttermandlongterm
desensitizationofthenicotinicreceptors.Piracetamhasbeen
showntocounteractthisdesensitization.

AnotheradvantagetousingPiracetamisthatwhileitisprotecting
youracetylcholinereceptorssoyoucankeephavinghighlevel
dreams,thereisevidencethatitmakesyousmarterwhiledoingso.
PiracetamhasbeenwidelyusedandstudiedinEuropeandAsia
howevertheUShasdonefairlylittleresearch.TheFDAhasnot
approvedPiracetambutthatdoesntmeanitisillegaltobuyinthe
US.Itisperfectlylegaltopurchaseuptoathreemonthsupplyof
PiracetamforyourownuseandthereareseveralUScompaniesthat
currentlystockit.Ihaveincludedseveralarticlesinthereference
sectionyoushouldreadtolearnaboutallofthebenefitsof
Piracetam.
Keepinmindoneextremelyimportantpoint.Itisbesttonothave
anyPiracetaminyoursystematthetimeofluciddreamattempt.This
willbeexplainedindetailinPart3ofthisbook.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

82/182

12/25/2016

AdvancedLucidDreaming

Page89
83

Piracetam

ConcentrationCurve:Piracetamischaracterizedbyquick
absorptionandarelativelylongeliminationhalflife.Piracetamis
moreorlesscompletelyoutofyoursystemafterabout30hours.This
informationisimportanttounderstandbecausePiracetamshouldnot
beinyoursystematthetimeofaluciddreamattempt.

ConcentrationcurveforPiracetamwithPeakPlasmatime=1.5hrandeliminationhalflife=5hr

ConcentrationcurveforPiracetam&Galantamineoverlapping(Galantamineattime=0,
followedbysingledoseofPiracetamattime=4hrs)

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

83/182

12/25/2016

AdvancedLucidDreaming

Page90
84

ThePowerofSupplements

EffectonDreams:Inhibitsdreamingandrememberingdreams.
Piracetamisnotusedtoenhancedreamingbutrathertocounteract
desensitizationandtolerancecausedbytheotheracetylcholine
boostingsupplements.

EffectonLucidDreams:Piracetamhasanegativeimpactonlucid
dreamingifitisinyoursystematthetimeoftheattempt.Itistheonly
substancethatIknowofthathasbeenclinicallyproventocounteract
desensitization.Whenusedcorrectlyitcanincreasethefrequencyat
whichyoucanattemptaluciddreamusingtheGalantamine,GPC,
and/orNicotine.

SideEffects:Piracetam,aswithmostnootropics,isknownas
havinganalmosttotallackoftoxicity.Thismeansitcausesno
significantsideeffectsevenatextremelyhighdoses.Ifalargedose
istakenhowever(morethan3000mginaday),itisrecommendedto
rampdownthedosageratherthantoabruptlystoptakingit.
Piracetamincreasesbloodflowtoyourbrainandifyoutakealarge
singledoseyoumayexperienceaheadachewhenitwearsoffdueto
thereconstrictingofthebloodvessels.Thiscanbetotallyavoidedif
thedoseisspreadoutandrampeddowninsteadoftakingasingle
largedose.Seechapter18formoredetailsabouthowtotake
Piracetam.

Dosage:Mostreferencescalloutadailydoseof24004800mgper
dayasamaximumrecommendeddose.Themaximumdosedoes
notcorrespondtothedoseatwhichnegativesideeffectsoccurbut

Page91
Piracetam

85

rathertothemaximumdosethatseemstobenefittheuser.There
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

84/182

12/25/2016

AdvancedLucidDreaming

havebeenseveralstudiesthatshowthattakingmorethan4800mg
ofPiracetamproduceslesspositiveeffectsonmemory.Furthermore
theoptimumdosemaybeagerelated.Onestudyshowedthatthe
optimumdoseforyoungerpeoplewas2400mg/dayandwas4800
mg/dayforolderpeople.Humanstudieshavebeendonewithdaily
dosesupto20gramsperdayandanimalstudieshavebeenwith
hugedose/weightratios.Itypicallytake2400mginasingledose
immediatelyfollowingaluciddreamattempt.Thisallowsmeto
successfullycounteracttoleranceanddesensitizationanddoesnot
leadtoaheadache.

SpecialNotes:TheFDAhasnotapprovedtheuseofPiracetamas
ameansofcombatingmentalillnesses.ThisdoesnotmeanUS
doctorsdisputetheeffectsPiracetamhasonthecholinergicsystem.
Thesestudiesarewelldocumented.TheFDAalsodoesnotclaim
thatPiracetamhasanynegativesideeffects.Thelackofapproval
correspondswiththebeliefthatthereisnotenoughevidencetoshow
thatPiracetamworksasaviablemeansofcombatingcertainmental
illnesses.Asluciddreamers,ourprimarygoalistoguardagainst
desensitizationandtoleranceanymentalenhancementsareafringe
benefit.ThefactthattheFDAhasnotapprovedPiracetammaybea
blessingindisguisebecauseiftheFDAweretoapprovePiracetamit
wouldmostlikelybeavailablebyprescriptiononly.AlsoPiracetamis
partofafamilyofsubstancescalledracetams.Alloftheracetams
workinsimilarwayandthereforeotherfamilymembers,suchas
AniracetamandOxiracetam,mayalsoguardagainstdesensitization
andtoleranceeffects.Ofthethreehowever,Ihavefoundmore

Page92
86

ThePowerofSupplements

clinicalresearchpertainingtoPiracetamregardingitspositiveeffects
oncholinergicsystem.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

85/182

12/25/2016

AdvancedLucidDreaming

Summary:Piracetamplaysanimportantyetindirectroleinlucid
dreamdevelopment.Itisusedtocounteractthedesensitizationthat
mayoccurwhenusingothercholinergicsupplementssuchas
Galantamine,GPC,andNicotine.ItisimportantnothavePiracetam
inyoursystematthetimeofaluciddreamattempt.Itisalso
importanttorampdownthedosagetoavoidexperiencinga
headacheiflargedailydosesaretaken.Thedetailsofhowto
properlyusePiracetamarecoveredinchapter18.

Page93
87

11
MucunaPruriens
GeneralDescription:MucunaPruriensisabeanproducingplant
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

86/182

12/25/2016

AdvancedLucidDreaming

thathasbeenusedinAyurveda(Indianmedicine)forover4500
years.Thisisoneofthefewknownplantsthatnaturallycontainsa
chemicalcalledLdopa.Althoughdopaminedoesnotcrosstheblood
brainbarrier,Ldopadoesanditistheimmediateprecursorto
dopamine.ThisfactmakesMucunaPrurienshighlyeffectiveat
increasingdopaminelevelswithinthebrain.Therearemanyof
reasonstosupplementyourdietwithalittleLdopaevenifyouarent
interestedinluciddreaming.Dopamineisvitallyimportantin
sustainingyourmotorskillsandasweageourdopaminelevelsdrop
significantly.Parkinsondiseaseisanextremecaseofthisinwhich
movementisseverelyrestrictedduetothelossofproperdopamine
functionality.ThefirstlineofdefenseinParkinsondiseaseisLdopa.
SupplementingyourdietwithLdopacontainingsubstancescanhelp
keepyouactiveandfeelingyoung.Inaddition,dopaminemakesyou
feelgoodandplaysamajorroleindevelopingconfidenceand
motivation.Soevenifluciddreamsarentyourgoal,Ldopa
containingsupplementscanprobablydoyousomegood.Ofcourse
whenitcomestodreaming,dopamineplaysamajorroleinthatitis
believedthedopaminenetworkmustbeengagedfordreamingto
occurinthefirstplace.

Page94
88

ThePowerofSupplements

WhenitcomestoluciddreamingLdopa(viaMucunaPruriens)
boostsyourabilitytocontrolthedreamlikenoothersubstanceIve
encountered.
MucunaPruriensoffersanotherbenefitoverthesyntheticL
dopathatiscommonlyprescribedintheUS.SyntheticLdopamust
betakenwithadifferentchemicalcalledCarbidopa.Carbidopais
requiredtokeeptheLdopafrombeingsynthesizedintodopamine
beforeitcrossesthebloodbarrier.Sincedopaminecannotcrossthis
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

87/182

12/25/2016

AdvancedLucidDreaming

barrier,iftheLdopaisconvertedtodopaminetooearlyitdoesnot
makeitintothebrainandthereforedoesyounogood.Furthermore,
thenegativesideeffectsofLdopaaretypicallyduetothedopamine
thatiscreatedinthegutratherthaninthebrain.MucunaPruriens
doesnotrequireCarbidopaforreasonsthatarenotfullyunderstood,
buttherearenumerousstudiesshowingthatMucunaPruriensisas
effectiveasthesyntheticLdopa/Carbidopapair.Thisallowsfor
lowerdosesofLdoparesultinginalowerchanceofnegativeside
effects.

MechanismofAction:MucunaPruriensnaturallycontainsthe
chemicalLdopa.Ldopaistheimmediateprecursortodopamine.
IncreasingtheamountofLdopainthebrainleadstoanincreasein
theproductionofdopamine.

ConcentrationCurve:MucunaPruriensischaracterizedbyquick
absorptionandashorteliminationhalflife.Itreachesitspeakplasma
levelsjust90minutesafteryoutakeitandispracticallyoutofyour
systemafter12hours.

Page95
89

MucunaPruriens

ConcentrationcurveforMucunaPrurienswithPeakPlasmatime=1.5hrandeliminationhalf
life=1.5hr

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

88/182

12/25/2016

AdvancedLucidDreaming

EffectonDreams:Ldopainknowntocausevividdreamsandso
doesMucunaPruriens.Ingeneralhowever,thedoseneedstobein
thetherapeuticrangefortreatingParkinsonsdiseasebeforeamajor
impactondreamingisobserved.Myownexperimentshaveshown
thataround400mgofLdopa(viaMucunaPruriens)areneededto
stimulateadopaminedream.Dopaminedreamsarefascinatingand
aremypersonalfavoritetypeofnonluciddream.Theyarealways
extremelyactionpackedandfullyparticipatory(meaningthatthe
dreamerisfullycaughtupintheactionratherthanjustobservingit).
Thereseemstoacommonthemetodopaminedreams:thedreamer
isputinsomekindofthreateningsituationandmustovercomesome
typeofadversary.Ontheoutside,thesedreamsoftensoundlike
nightmares,butontheinsidetheyareusuallycharacterizedbya
strongfeelingofconfidenceandatriumphantrushoncethedreamer
hasprevailed.Ifindthesetypesofdreamsthoroughlyenjoyable
althoughtheymaynotbeforeverybody.

Page96
90

ThePowerofSupplements

EffectonLucidDreams:TheeffectofMucunaPruriensonlucid
dreamingisindirectyetprofound.MucunaPruriensdoesnotactasa
luciddreamtrigger.FurthermoreifalargedoseofMucunaistaken
withGalantamine,theoddsofbecominglucidseemtobesomewhat
reduced.TherearesomestudiesthatsuggestthatLdopacan
actuallysuppressREM.However,ifasmalldoseofMucunaistaken
withGalantamine(oroneoftheothertriggers)oriflargerdosesare
takensometimebeforethetrigger,theresultsarealmost
unbelievable.ThedopamineboostthatiscausedbyMucuna
Pruriensleadstoasignificantincreaseinconfidencelevel.This
increaseinconfidenceleadstoatotallackoffearandaprofound
boostintheabilitytocontrolthedream.
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

89/182

12/25/2016

AdvancedLucidDreaming

TherearenoothersupplementsIhavefoundthathavethis
effect.Advancedflyingispossible,movingthroughwallsorother
objectsseemsincrediblynatural,andchangingyourdreamscapeis
mademucheasier.

SideEffects:MucunaPruriensisnewtotheWestbuthasbeen
usedforcenturiesinotherpartsoftheworld.HighdosesofMucuna
Prurienscancauseoverstimulation,increasedbody
temperature,insomnia,andnausea.Therearesomestudiesthat
suggestitmayleadtoanincreasedriskofbirthdefectssoitshould
notbetakenwhenpregnant.

Dosage:ThereisnodailysuggesteddoseforMucunaPruriens
althoughmostcompanieslistasuggesteddoseof200300mgofL
dopaperday(thecorrespondingMucunadosagedependsonthe%

Page97
MucunaPruriens

91

standardization).Thereisanimportantruleofthumbthatcanbe
usedtodefinethemaximumallowabledose.Parkinsondisease
patientsareoftenonmassivedosesofLdopaanditiswellknown
thatafterseveralyearsoftreatmenttheyaresubjecttoacondition
referredtoasdyskinesias.Dyskinesiasisaconditiondescribedby
sudden,involuntary,jerkymovements.Mostphysiciansnowcapthe
maximumdoseofLdopaatnomorethan600mg/dayandifpossible
keepthedoseat400mgorloweroverthefirst35yearsinorderto
reducetheriskofdyskinesias.TypicallyIuse80200mgofLdopa
(viaMucunaPruriens)incombinationwithothersupplementsforthe
purposeofluciddreamenhancement.

SpecialNotes:MucunaPruriensisavailableinseedformoras
standardizedextracts.Theseedscanvarysubstantiallyfromseedto
seedastotheconcentrationofLdopasoIdontrecommendusing
them.Thestandardizedextractsareavailablein10%,30%,and50%
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

90/182

12/25/2016

AdvancedLucidDreaming

Ldopaconcentrations.Istronglyrecommendthelower
concentrations.Ihavetriedboththe10%and50%formsandhave
muchbetterresultswiththe10%extractatequivalentLdopadoses.
RememberthatsyntheticLdopaisprescribedwithCarbidopain
ordertokeeptheLdopafromprematurelysynthesizinginto
dopamine.MucunaPrurienshasproventobeeffectivewithoutthe
useofCarbidopa.AstheconcentrationofLdopaincreases,the
concentrationoftheothercompoundsthatmimictheCarbidopa
decreaseandyouarepronetomorenegativesideeffectsandless
impactondreaming.Thisknowledgeisfrompersonalexperience.At
500mgofLdopaIhaveexperiencedvividdreamsandnoside

Page98
92

ThePowerofSupplements

effectsusingthe10%form,butatthesamedoseusingthe50%form
Isufferednauseaandnoticednoimpactondreaming.

VitaminB6shouldnotbetakensimultaneouslywithMucuna
Pruriens(oranyLdopacontainingsubstance).VitaminB6isthe
ingredientnecessarytosynthesizeLdopaintodopamine.Ifthereare
largeamountsofB6presentinyourdigestivetrackwhenyoutake
Mucuna,theLdopamaybeconvertedtooearlyandhencenotbe
abletocrossthebloodbrainbarrier.

Summary:MucunaPruriensdoesnotactasaluciddreamtrigger
butcangreatlyincreasecontrolwhencombinedwithGalantamineor
otherluciddreamtriggers.Supermanstyleflying,movingthrough
objects,andchangingthedreamscapeallbecomemuchmore
natural,straightforwardandeasywhen80200mgofLdopa(via
MucunaPruriens)istakenwithGalantamine(or1hourpriorsee
chapter19fordetails).NoothersupplementthatIhavefoundhas
madesuchalargeimpactondreamcontrolasMucunaPruriens.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

91/182

12/25/2016

AdvancedLucidDreaming

Page99
93

12
Yohimbine
GeneralDescription:Yohimbineisprobablythemostcontroversial
substanceIregularlyuse.Yohimbineistheprimaryactiveingredient
inYohimbeBarkwhichisatreenativetoAfrica.Althoughitwas
initiallyusedbyweightlifterstoincreasebloodflowduringaworkout,
itisprimarilyusedtodaytocombatmaleimpotence.Although
YohimbineisclassifiedasamildMAO(MonoamineOxidase)
inhibitor,itsmainfunctionisasanalpha2adrenergicantagonist.
Thisfunctionblocksnorepinephrinefrombindingwithalpha2
receptorsandresultsinanincreaseinnorepinephrinelevelsinthe
brain.Atthedosetypicallytakenforimpotence,thelevelsof
norepinephrinebuildupsomuchinthebrainthataphenomenon
occursreferredtoasoverflow.Overflowistheprocesswhere
norepinephrineflowsfromthebrainthroughthebloodbrainbarrier
andintothebloodstream.Itisthehighlevelsofnorepinephrineinthe
blood(notthebrain)thatcanbeusedbetocounteractimpotencebut
alsocauseahostofnegativesideeffects.Keepinmindthatanother
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

92/182

12/25/2016

AdvancedLucidDreaming

namefornorepinephrineisnoradrenalinwhichisthedirectprecursor
toadrenaline(alsocalledepinephrine).Thesesubstancesare
referredtoasfightorflightsubstancesbecausetheyareresponsible
forthatnervoustensionyougetrightbeforeaconfrontation.

Page100
94

ThePowerofSupplements

Whenintheblooditiscommontoexperiencesweatypalmsandfeet,
increasedheartrateandpressure,butterfliesinyourstomach,a
slightacheinyourjoints,anxiousness,andsoon.Asluciddream
enthusiastsweneitherneednorwantforoverflowtooccur.This
requiresasignificantreductionindosefromwhatiscommonlyused.
Wheninthebrain,norepinephrineimprovesmood,alertness,focus,
aswellasworkingmemoryandhasproventohaveprofoundeffect
ondreamingandluciddreaming.Ihavefoundtheidealdosetobe
~1/20ofthedosetypicallyfoundinsinglepill.Sincemylucid
dreamingmethodconsistsofattemptsonaneveryotherdaybasis,it
wouldtakeoveramonthbeforeIwoulduseupasingledose
(assumingthatIusedYohimbineoneveryattempt,whichIdont).At
thesesmalldosestwofactsstandout:(1)Isuffernonegativeside
effectsand(2)theeffectondreamingandluciddreamingis
profound.AnothermisconceptionisthatYohimbineisamaleonly
herb.ThisisnotthecaseandstudieshaveshownthatYohimbine
hasessentiallythesameeffectsonmenandwomenwithnoincrease
inrisk.

MechanismofAction:Yohimbineisanalpha2adrenergic
antagonist.Thealpha2receptorsareresponsibleforcontrollingthe
productionofnorepinephrinewithinthebrain.Whenthealpha2
receptorsareantagonizedthebrainnaturallyproducesmore
norepinephrinewithinthebrain.
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

93/182

12/25/2016

AdvancedLucidDreaming

ConcentrationCurve:Yohimbineischaracterizedbyquick
absorptionandashorteliminationhalflife.Itreachesitspeakplasma

Page101
95

Yohimbine

leveljust1hourafteryoutakeitandispracticallyoutofsystemafter
only5hours.

ConcentrationcurveforYohimbinewithPeakPlasmatime=1hrandeliminationhalflife=40
minutes

EffectonDreams:Yohimbinehasaprofoundeffectondreaming.
Dreamvividnessandmemoryareperhapsevenbetterthanwiththe
acetylcholineboostingsupplements.Howeversleepispossibleonly
withverysmalldoses.ThedreamsIhavehadusingYohimbinehave,
forthemostpart,beenverypleasingalthoughIhavefeltsome
anxietyduringthedreamsifthedoseisgreaterthanabout1mg.
ThereisonesubtlepointthatIhavenoticedwithYohimbine:itdoes
notseemtoinitiateREMsleep,butrathermustworkinconjunction
withit.DuringnormalREMsleepthenorepinephrinesystem
essentiallyshutsoffandhavingelevatednorepinephrinelevelsdoes
littletopushyouintoadreamstate.However,ifyouarenaturally
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

94/182

12/25/2016

AdvancedLucidDreaming

enteringadreamstatethedreamsbecomemuchmorevividand
strongifnorepinephrinelevelsareincreased.Thisimpliesthat

Page102
96

ThePowerofSupplements

Yohimbineismuchmoreeffectivewhentakenintheearlymorning
hourswhenmuchmoretimeisspentnaturallyinREMsleep.

EffectonLucidDreams:IconsiderYohimbinetobeoneofthe
mostpowerfulsupplementsavailableforluciddreamdevelopment.
Yohimbinecanbeusedasaluciddreamtriggeriftakenunderthe
rightconditionsandactsmuchthesamewayasGalantamineinthis
respect.ThedownsideofusingYohimbineasatrigger,isthatyou
mustbenaturallyenteringREMsleepverysoonafteryoutakeit.
Alsothedosesthatworkbestastriggersareincrediblyclosetothe
dosethatwillcauseinsomnia.Forthesereasons,Icommonlyuse
Galantamineasthemaintriggerandmuchsmallerdosesof
Yohimbineasacomplimentarysubstance.Whenusedinthiswaythe
resultsareremarkable.GalantamineinitiatesREMsleepwhich
initiatestheeffectsoftheYohimbine.Oncelucidthenorepinephrine
improvesattention,focus,andworkingmemory(atypeofshortterm
memory)farmorethanwithGalantaminealone.These
characteristicssignificantlyboosttheabilitytoreasonwithinthe
dream.Themindstayscleareranddoesnotgetaseasilydistracted.
Thisallowsonetogodeeperintothedreamworldinordertosearch
forhiddenpotentialandknowledge.Italsoimprovestheconnection
betweenthedreammemoryandthephysicalmemory.Withinthe
dream,memoriescanberecalledandevenrelivedmucheasierthan
withoutit.Thisimprovedconnectionalsohelpstoensurethatyou
carryoutyourentiresetofdreamexperimentswhilewithinthe
dream.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

95/182

12/25/2016

AdvancedLucidDreaming

Page103
Yohimbine

97

SideEffects:AtthedosesIrecommendsideeffectsareextremely
rare,butkeepinmindthateveryoneisdifferent.Ifoverflowshould
occur(asignyouneedtoreducethedose)youmayfeelhot,
experienceincreasedheartrateandpressure,feelanervousachein
yourjointsaswellasexperiencesweatypalmsandfeet.Inmore
extremecasesanxiety,tremors,dizziness,andvomitingmaybe
experienced.Yohimbinemaytriggeranxietyorpanicattacksinprone
individuals.AnoverdoseofYohimbinemaybedeadlywatchoutfor
salivation,enlargedpupils,irregularheartbeat,andlowblood
pressure.Anoverdoseneedstobetreatedimmediatelyby
emergencymedicalprofessionals.

Dosage:Iconsiderthe9mgdoseofYohimbinethatistypically
includedinasinglecapsuleasinsanelyhigh.ThefirstdoseItook
was3mgandIexperiencedsignificantoverflow.Forme,overflow
typicallystopsatabout1.5mghoweveritisliterallyimpossibletofall
tosleeponthishighofdose.Atabout0.751mg,Yohimbinecan
beusedasaluciddreamtrigger.TouseYohimbinesynergistically
withGalantamine,Itypicallyuse0.350.5mg.Usinga0.35dose
impliesthatyoudivideasingle9mgtabletinto~25pieces.

SpecialNotes:Yohimbineisavailableasanoverthecounterthe
supplement.ItissoldeitheraspureYohimbeBarkorasamore
concentratedformthatiseitherstandardizedto2%,4%,or8%
Yohimbine.RememberthatitistheYohimbinethatboosts
norepinephrine.Allofthestandardizedformsusuallycontain9mgof
Yohimbinepertablet.IdontrecommendbuyingthepureYohimbe
BarkbecauseyoudontknowexactlyhowmuchYohimbineisin

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

96/182

12/25/2016

AdvancedLucidDreaming

Page104
98

ThePowerofSupplements

eachcapsuleandinfactitcanvarygreatlyfromcapsuletocapsule.I
preferthe8%Yohimbineformbecauseitcomesinasolidtablet
insteadofapowderfilledcapsule.Thismakesiteasiertocutitinto
smallerpiecesusingarazorbladeratherthantryingtodivideupa
powder.

Summary:Yohimbineisanalpha2adrenergicantagonistwhich
meansthatitcanboostnorepinephrinelevelsinthebrain.Typical
dosesare2025timestoostrongfortheluciddreamenthusiast
whichwillrequiredividingupthetabletintomuchsmallerpieces.
Yohimbinecanactasluciddreamtriggeraroundadoseof1mgbut
thisborderlinesonadosethatcancauseinsomnia.Using0.5mgor
lesssimultaneouslywithGalantaminecanproduceextremelyhigh
levelluciddreams.Thiscombinationseemstoworkbetterthanall
otherswhenthegoalisasearchforknowledgewithinthedream.
Thiscombinationalsoseemstomakeyourphysicalmemoriesmore
accessiblewithinthedream.

Page105
99
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

97/182

12/25/2016

AdvancedLucidDreaming

13
5HTP(5hydroxytryptophan)
GeneralDescription:5hydroxytryptophan(5HTP)istheimmediate
precursorofserotoninandwhileserotonindoesnotcrosstheblood
brainbarrier,5HTPdoes.Duetoitsabilitytoincreaseserotonin
levelswithinthebrain,5HTPhasbeenusedforavarietyof
therapeuticpurposesthatincludecombatingdepression,reducing
stressandanxiety,promotingsleep,andfightingoffcertaintypesof
migraineheadaches.Ithasalsobeenusedtosuppressappetites.In
general,thereportssurrounding5HTParepositivebutkeepinmind
that5HTPhasonlybeenavailableintheUSsinceforashorttime
(since1994)althoughithasbeenusedinEuropefordecades.
Concerningluciddreamdevelopment,5HTPplaysanimportant
yetindirectrole.AsIwillpointoutinpartthree,5HTPandMelatonin
bothplayauniquerole.Using5HTPcorrectlywillaccomplishthe
following:

1.Improvetheoverallqualityofsleeponthenightsthatyou
attempttoachievehighlevelluciddreams.
2.Increasechanceofsuccessofhavingaluciddreambytaking
advantageoftheREMreboundeffect.
3.Increasethelengthofaluciddreambytakingadvantageof
theREMreboundeffect.

Page106
100

ThePowerofSupplements

4.Increaseabilitytofalltosleepaftertakingmorestimulating
substancessuchasGalantamineorYohimbine(seepart3for
details).
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

98/182

12/25/2016

AdvancedLucidDreaming

MechanismofAction:5HTPistheimmediateprecursorto
serotonin.5HTPsupplementsresultsinincreaselevelsofserotonin
inthebrainbymakingavailabletherequiredchemicalstoproduce
serotonin.

ConcentrationCurve:5htpischaracterizedbyquickabsorption
andashorteliminationhalflife.Thesepropertiesmakeitidealto
takejustbeforegoingtosleep.Itreachesitspeakplasmalevelsjust
90minutesafteryoutakeitandhasreducedtojustabout12%
concentrationafter6hoursofsleep(~4sleepcycles).

Concentrationcurvefor5HTPwithPeakPlasmatime=1.5hrandeliminationhalflife=1.5hr

Page107
5HTP(5hydroxytryptophan)

101

EffectonDreams:5HTPhasapositiveeffectondreamlengthand
quality.Dreamenhancementdueto5HTPismostlikelyduetoREM
suppressionfollowedbyREMreboundandthisresultsinincreased
dreamvividnessinthemorninghoursasthesubstanceiswearing
off.5HTPquicklyincreasesserotoninlevelsthatbringondeepand
restfulsleep.Duetotheshorthalflifehowever,the5HTPis
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_o

99/182

12/25/2016

AdvancedLucidDreaming

practicallyoutofyoursystemafter5or6hours(assumingyoudont
takealargedose).ThisresultsinincreasedREMtimeintheearly
morninghourswhichproducesmorevividdreams.Furthermore,I
havefoundthatthedreamvividness,especiallythevisualaspect,is
extremelyclear.Ihavealsofoundthatwhentaking5HTPbyitself,I
ampronetoexperiencecalmandrefreshingdreams.Althoughthe
dreamvividnessishigh,mydreamrecallisabitfuzzy.SometimesI
findthatIactmorelikeanobserverthananactiveparticipantin
dreamsthatarebroughtaboutby5HTP.

EffectonLucidDreams:5HTPplaysasupportingroleinlucid
dreamdevelopment.ThemainreasonIuse5HTPistoincreasemy
overallqualityofsleeponnightsthatIattempttohaveluciddreams.I
accomplishthisbytaking100150mgof5HTPjustbeforebedtime.
Thisincreasesmyserotoninlevelsandhelpstohavemoretime
spentinthedeepnonREMsleepstagesduringthefirsthalfofthe
night.WhenIwakeupafter4or5hoursIamalmostalways
dreaming.Ithentakethesupplementsthattriggerluciddreaming
andgobacktobed.AfterseveralhoursofintenseluciddreamsI
climboutofbedandfeelrefreshedandrejuvenated.

Page108
102

ThePowerofSupplements

SideEffects:Themostcommonsideeffectsof5HTParenausea
andgastrointestinaldistress.Thenauseaproblemcanberesolved
bystartingatalowdoseandthengraduallyincreasingit.Evenwhen
largedosesaretakentheproblemtendstodiminishovertime.
PersonallyIhaveneverexperiencedanynegativesideeffectswith5
HTP.Itypicallyuse100150mgtakenatorjustbeforebedtime.
5HTPshouldnotbetakenwithprescriptionantidepressants
(thisincludesSt.JohnsWort)withoutthedirectconsultationofa
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

100/182

12/25/2016

AdvancedLucidDreaming

doctor.Manyoftheseantidepressantsactbyalsoincreasing
serotoninlevelsandthereforecouldmagnifytheeffectsandpossibly
leadtopotentiallydangerousconditionknownasSerotonin
Syndrome.Duetotheshorttimethissupplementhasbeenavailable
therearenotalotofstudiesthathaveinvestigatedthelongterm
effectsoftaking5HTP.

Dosage:Thereisnomaximumrecommendeddoseassociatedwith
5HTP.However,areasonabledoserangeisprobablybetween50
and300mg.Fortreatingdepressiondosesupto500mgdailyare
used.Atthelowerdosessideaffectsarerare.

SpecialNotes:YoushouldnottakevitaminB6with5HTPasitmay
catalyzethereactiontoserotonininthegutratherthaninthebrain.
Rememberthatserotonindoesnotpassthroughthebloodbrain
barrierandsoyouwanttokeepthe5HTPintactuntilthebarrierhas
beencrossed.Thereissomespeculation(althoughnoclinical
researchthatIcouldfind)thattheorizesbuildingupserotonininthe
bloodratherthaninthebraincouldcauseheartdamage.Thistheory
hasnotbeenconfirmedordeniedbutshouldnotbeanissueunless

Page109
5HTP(5hydroxytryptophan)

103

youaretakinglargeamountsofvitaminB6simultaneouslywith5
HTP.

Summary:5HTPistheimmediateprecursortoserotonin.Increased
serotoninlevelsleadtoastateofcalmrelaxationandhavebeen
shownclinicallytosuppressREMsleepbyfavoringthedeeper,non
REMstages.Since5HTPhasashorteliminationhalflife,itcanbe
takenjustbeforebedtimeforthepurposeofsuppressingREMsleep
andincreasingthetimespentinnonREMsleep.Asthedosewears
off,REMreboundoccursandisusuallyaccompaniedbymorevivid
dreamexperiences.Ifaluciddreamtrigger(suchasGalantamine)is
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

101/182

12/25/2016

AdvancedLucidDreaming

takenatthistime,thereisanincreaseinoddsofbecominglucid.
Also,sinceluciddreamtriggersusuallysuppressnonREMsleepin
favorofREMsleep,5HTPcanacttobalancetheamountoftime
spentineachphaseduringthenightwhichresultsinamore
balancednightssleep.Bymaintainingbalancedsleeppracticesyou
willnotfeelenergydeprivedfollowingaluciddreamattemptandcan
increasethefrequencyofluciddreamattempts.

Page110
104

14
Melatonin
GeneralDescription:Melatoninisahormonethatisreleasedfrom
thepinealglandandisthoughttohelpusfalltosleep.Since
Melatoninproductionisenhancedindarknessanddecreasedbylight
exposureitisoftensaidthatMelatoninhassomecontroloverour
circadianrhythmandhastheabilitytoresetourinternalclocks.For
thisreason,Melatoninissometimesusedtoreducejetlag.Although
Melatoninissynthesizedfromserotoninand5HTPissynthesizedto
serotonin,theybothhaveasimilareffectonsleep:bothcanhelpyou
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

102/182

12/25/2016

AdvancedLucidDreaming

falltosleepandbothcancausevividdreamsasthedosesare
wearingoff.ForthisreasonMelatoninisapossiblealternativeto5
HTPalthoughItendtouseitforadifferentpurpose.
TherearethreecharacteristicsthatmakeMelatoninmy
secondchoiceforsuppressingREM.FirstofallMelatoninhasan
extremelyshorthalflife.Sincemelatoninshalflifeisonly40
minutes,onehastotakeaprettylargedosetosuppressREMfor4
or5hours.Iestimatethat3mgwouldbenecessarytosuppress
REMforfourhours.Secondly,Ifinditdifficulttofalltobacktosleep
aftertheMelatoninhaswornoff.Thirdly,Iexperiencemorevivid
dreamsusing5HTPthanIdousingMelatonin.
ThereishoweveranotherwaytouseMelatoninthatmaybe
advantagestosome.Researchhasshownthatonly0.3mgof
Melatoninisnecessarytoinducesleep.

Page111
105

Melatonin

Atthislowdose,REMsleepisnotsuppressedandtherefore
MelatonincanbeusedsimultaneouslywithGalantamine(orother
supplements)iffallingbacktosleepisaproblem.WhenIused
YohimbineastheluciditytriggerIwouldoftenuseverysmalldoses
ofMelatonintoaidinfallingtosleep.Thisprovedtobeafairly
successfulmethod.Thetimeittooktofalltosleepwasdecreasedby
abouthalfandfurthermore,Iwasmuchmorerelaxedwhileawake
andwaitingforsleeponset.Forthistowork,itisimportanttokeep
thedoselow,asIdidnoticeareducedchanceinbecominglucid
evenat0.5mgofMelatonin.

MechanismofAction:SerotoninistheprecursortoMelatonin
thereforeMelatoninsupplementsprobablydontdomuchtoserotonin
levels.However,MelatonincanhelptofallasleepandsuppressREM
sleep.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

103/182

12/25/2016

AdvancedLucidDreaming

ConcentrationCurve:Melatoninischaracterizedbyquick
absorptionandashorteliminationhalflife.Itreachesitspeakplasma
leveljust60minutesafteryoutakeitandisessentiallyoutofyour
systemafter6hours(~4sleepcycles).

Page112
106

ThePowerofSupplements

ConcentrationcurveforMelatoninwithPeakPlasmatime=1hrandeliminationhalflife=40min

EffectonDreams:Melatoninhasbeenshownclinicallytoincrease
thetimespentinREMsleepinthemorninghours(asthedoseis
wearingoff).ItistheorizedthatthisphenomenaisduetoaREM
reboundeffect.Ihavefound5HTPtoproducemorevividdreams
thanMelatoninbutthereareplentyofpeoplewhohavecommented
onincreaseddreamvividnessanddurationbyusingMelatonin.As
with5HTPIfinditmoredifficulttorememberthedetailsofthe
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

104/182

12/25/2016

AdvancedLucidDreaming

dreamthanIdowhenusingtheacetylcholineornorepinephrine
boostingsupplements.

EffectonLucidDreams:IuseMelatoninassupportingsupplement.
WhenIamtakingaluciddreammixthatIknowcausesinsomnia,I
willsometimesadd0.3mgofMelatonintohelpmefallasleep.Atthis
smalldose,REMisnotsuppressedandonecanmaintainexcellent
oddsofbecominglucid.

Page113
Melatonin

107

SideEffects:Therearenoknownserioussideeffectsofusing
Melatoninsupplementsalthoughlongtermsideeffectshavenot
beenstudied.SomepeoplewhohavetakenMelatoninhavereported
sleepiness,headache,a"heavyhead"feeling,stomachdiscomfort,
depressionorfeelinghungover.Thereareanimalstudiesthat
suggestthatlargedosesofMelatonincaninterferewithfertility.

Dosage:WhenusingMelatonin,lessisbetterinmyopinion.There
aretabletsavailablein1,2,3and5mgdoses.Thereisnomaximum
dailydosesuggestedalthoughthelongtermseffectsofMelatonin
arelargelyunknown.Mytypicaldoseis~0.33mg(a1mgtabletcut
intothreepieces).Idonothowever,useMelatoninonanykindof
regularbasis.

Summary:Melatoninisahormonethatisformedfromserotonin.It
hasthepotentialtosuppressREMsleepandcanbeusedasasleep
aid.Ifindthat5HTPissuperiortoMelatoninforthepurposeof
producingvividdreamexperiencesandIfinditdifficulttofallbackto
sleepaftertheMelatoninhaswornoff.Mypreferredwaytouse
Melatoninisinverysmalldoses(<0.5mg)asanaidtofalltobackto
sleepaftertakingsomeofthemorestimulatingluciddream
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

105/182

12/25/2016

AdvancedLucidDreaming

supplements.

Page114
108

ThePowerofSupplements

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

106/182

12/25/2016

AdvancedLucidDreaming

Page115

Part3:
AchievingHighLevelLucidDreams

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

107/182

12/25/2016

AdvancedLucidDreaming

Page116
110

15
AreYouReadyForThis?
IrememberthefirstdayIwentparachutinglikeitwas
yesterday.Iarrivedatthedropzoneat7:30AMwithastomachfullof
butterflies.CanIdothis?Iwondered.Mymindwasfullof
excitement,anticipation,doubt,andfear.Ithenproceededtogo
throughadetailedfourhourlongclassthatwentrepeatedlyover
exactlywhattodoineverypossiblesituation.TimeandtimeagainI
wentthroughtheexactdetailsofhowtoclimboutoftheplaneand
hangfromthewing,howtoarchmybackandletgo,howtostay
mentallyalertwhilefalling,howtohandleanyoneofdozensof
potentialproblemsthatmightoccur,howtosteermychuteandkeep
mybearings,andfinallyhowlandsothatIdidntgethurt.Attheend
oftheclasstheinstructorcamearoundtoeachoneofusandasked,
Areyoureadyforthis?IansweredwithaconfidentYes.Ifelt
ready,reallyready.
Butthenithappened,Iputonmyparachute,walkedoutinto
themiddleofalargegrassyfieldandclimbedintothesmallCessna.
MyfirstimpressionoftheplanewasthatofanoldVWBeetlewith
wingsandthenaftertheenginestartedIrevisedmyimpressiontobe
thatofanoldVWBeetlewithwingsthatneededatuneup.My
stomachstartedtoacheandmymusclesandjointsfeltweakand
uncomfortable.Wetookoffandproceededtoflyincirclesaroundthe
dropzone.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

108/182

12/25/2016

AdvancedLucidDreaming

Page117
AreYouReadyForThis?

111

Ilookednervouslyoutofthewindowandwatchedaseach
circletookushigherandhigher.Thejumpaltitudewas~3500ftand
suddenlytheenginesquietedandpilot/jumpmasteropenedhis
windowtoletinablastofwindandthenmotionedformetomove
forwardtothedoor.TosaythatIwasoverflowingwithfearisabitof
anunderstatementbutImanagedtokeepmyselftogetherandcrawl
tothedoor.Openthedoorshoutedthejumpmaster.Iturnedthe
knobandthedoorflewopenwithamightythrush.Thejumpmaster
lockedthedoorinplaceandthenbellowedthenextcommand,
Position!heshouted.Inhindsight,InowunderstandthatIwasin
partialshockandmyfearhadturnedtototalnumbnessasIplaced
myfootoutonthe3inchby10inchstepprotrudingfromthesideof
theplane.Myfootwasfollowedbymyhandthatgrabbedontothe
strutconnectingthewingtotheplane.TheviewwasamazingbutI
couldntenjoyit.Ihadalwaysconsideredmyselftobescaredof
heights,butIwassohighthatitdidntevenseemtoberealandallI
feltwasnumbness.Thenmysecondhandfollowed.Islideboth
handsoutalongthestrutasIsteppedfullyoutoftheplane.Thewind
noiseandpressurewereintense.ThenIletmyfeethangoutinthe
openairbehindme.Itsmucheasiertohangfromthewingofaplane
thanyoumightthink,iffornootherreasonthanthedeathgripthat
youimposeonthestrut.Ilookedintheplaneknowingthattherewas
noturningback.
Thejumpmasterlookedmeintheeyeandgavethethumbs
up.WiththatsignalIturnedmyheadforwardandlookedupata
smallreddotpaintedontheundersideofthewingandletgo.The
nextseveralsecondsareatotalblurofwhichIonlyrememberavivid
sightoftheplanerapidlydiminishinginsizefollowedbyaseriesof

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

109/182

12/25/2016

AdvancedLucidDreaming

Page118
112

ThePowerofSupplements

jerks.Imalive!Ialmostcried.ThenIheardavoicecomingfromthe
radioIwaswearingaroundmyneck.Yahhoo!Nicejump.Yourlines
areabittwistedsoyourgoingtohavetokickyourselfoutthevoice
said.What?Ilookedup,OhmyGod!Theseriesoflinesthat
connectedmyharnesstotheparachuteweretwistedaroundeach
otherkeepingtheslider,asmallpieceoffabricthatlocksthechute
open,fromslidingintoplace.Iwasalmostpanickingasthethoughts
racedthroughmyheadWhatdoIdo,whatdoIdo?Asifoncuethe
voiceinradiosaidagain,Youregoingtohavetokickyourselfout.
ThememorycamebackandIproceededtokickmylegsoutinabig
circularmotion.Thisgotmespinningaroundandarounduntilthe
cordsfullyuntwistedandthesliderslideintoplace.Ibreathedthe
biggestsighofreliefthatispossibleforalivingbeing.Forthefirst
timeIreallylookeddown.ThereIwassuspendedabout2500feet
abovetheground.Theonlysoundwasthatofthewind.Thefarms
belowlookedonlylikerectanglesofvarioussizesandshadesof
green.Thetreesremindedmeoftinypiecesofbroccolispread
acrossaplate.Reachupandreleaseyourbrakesshoutedthe
voiceintheradio.Ilookedupandcouldseethetwosteeringropes
thatwereVelcrodintotheslowbrakeposition.Thehandleswere
about15abovethewhiteknucklegripthatIwasusingtoholdonto
themainlines.Isuddenlyrealizedthattheonlythingreallyholding
meintheharnessweretwonylonstripsthatwrappedaroundmy
legs.IfthosebreakImgoingtofallrightoutofthischute,Ithought
andonceagainIwasovercomebyfear.Ilookedupagain,Calm
down.Ireachedupwithonehandandreleasedthebrakefollowed
bytheother.AtthispointIcouldbegintosteerthechuteandmy
stressfinallystartedtotransformintopureandintenseenjoyment.I

Page119
AreYouReadyForThis?

113

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

110/182

12/25/2016

AdvancedLucidDreaming

letoutaseriesofyahhoosthatweresoloudthattheycouldbe
clearlyheardontheground(orsoIwastold).Iglideddown,
performingaseriesofcircles,bothverylargeandsomeverytight
untilIdroppedgentlyontheground.Alrightmaybeitwasntsogentle
butIhaddoneitandlivedtotalkaboutit.
Thepointofthisstoryistounderstandthatnoamountof
intellectualortechnicaltrainingcouldhavepreparedmeforthereal
experienceofjumpingoutofanairplane.Thesameistrueoflucid
dreaming,ingeneral,andespeciallyforthesupplementapproachto
luciddreaming.Therearetwotypesofluciddreamsthatare
popularlyrecognized:DILDsandWILDs.DILDreferstoalucid
dreamthatstartsasanormal(nonlucid)dream.Inthiscasethe
dreamertypicallyrecognizesthatsomethingisntquiterightand
thensuddenlybecomesawarethattheyaredreaming.Ithasbeen
reportedthat~90%ofallluciddreamsareDILDsandonly10%are
WILDs.UsingthesupplementapproachIfindtheoppositetobetrue
wellover90%areWILDs.WILDreferstoaphenomenonofmoving
directlyfromwakingconsciousnessintoadreamwithtotalcontinuity.
Theactualtransitionfromthephysicalworldtothedreamworldcan
beeverybitasintenseasjumpingoutofanairplane.Forthisreason
IcansaywithconfidencethatIcannotfullyprepareyouforthe
experience.Icanonlyletyouknowaboutmyexperiences,what
mightoccurtoyou,andtoletyouknowthatothershavegonebefore
andcrossedbetweenworldsandlivedtotalkabout.

TypicalExperiences:Thefollowingparagraphssummarizethefour
typesoftransitionsthatmakeupthemajorityofmysupplement

Page120
114

ThePowerofSupplements

inducedWILDs.Ihavelistedtheminorderfromthemostgentleto
themostintense.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

111/182

12/25/2016

AdvancedLucidDreaming

1.Themostgentletransitionsaretheonesinwhichthedream
worldcomestomeratherthanmegoingtothedreamworld.
Imagesstartforminginthemindandbecomeincreasingly
detailedandcomplex.Suddenlythereisafullydetailed
dreamenvironmentthatfillsmymind.Atthispoint,Iamonly
anobserverandamnotfullyintegratedintoeithertheplotor
thefabricofthedream.Theactualtransitioncanbeswiftand
surprising.Thedreamseemstowraparoundyouandyou
suddenlyfindyourselfstandinginafullyanimateddream
world.Asanexampleconsiderthefollowingexperiencethat
occurredtome.Iwaslyingonmyrightsidewitheyesclosed
andwaitingpatientlyformyluciddreamtostart.Imagesof
varyingdetailwerefloatinginandoutofmyawareness.An
imageformedthatstartedasdarkimpressionslackingin
shapeanddetail.Colorsstartedtobecomericherandthe
imagesbegantotakeonfamiliarandrecognizableshapes.
Theimagesstartedasdiscreteandseparated,butthen
startedtoformasinglecomplexview.Itwasaroom.I
watchedobjectscomeintofocus:abed,abookshelffilled
withbooks,toysscatteredonthefloor.Thenanotherform
startedtoappear.Theformtransitionedfromaslewofcolors
intoaboyaboutsevenyearsoldstandinginfrontofme.The
detailsbecameincreasinglyclearer.Theboycameinto
perfectfocus.Strippedshirt,brownhairandpalecomplexion
arejustafewofthedetails.Suddenlytheboyturnedhishead

Page121
AreYouReadyForThis?

115

andlookedmedirectlyinmymindseyeasthoughfullyaware
Iwasthere.HislookwassopiercingthatitsurprisedmeandI
backedup.ThenInoticedthatIhadreallybackedup!Itwas
atthispointthatIbecameawareofmydreambodyandfound
myselfstandingintheroomfacingthechild.Fromtherethe
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

112/182

12/25/2016

AdvancedLucidDreaming

lucidexperiencebegan.Thistypeoftransitioningexperience
accountsforabout10%ofmyWILDs.

2.Moreoftenthedreamdoesnotcometothedreamerbutthe
dreamermustgotothedream.Thisismuchmoreprofound.
Themostgentleofthesetypesoftransitionsgenerallystarts
asafeelingoffloating,oratleastascertainpartsofyour
bodyasfloating,whicharedistinctandseparatefromthe
physicalbody.Afteralittlepracticewiththisfeelingyoulearn
thatyourmindhasinfactalreadyformedyourdreambody
anditislyinginamoreorlesscoincidentpositionwithyour
physicalbody.Yourawarenesshasalreadystartedtoshiftto
thedreamworldbuthasdonesotactilelyratherthanvisually.
Inthesecasesitispossibletoguideyourdreambodyaway
fromyourphysicalbodyandthenyoujustneedtostandup
andwalkaway.Nowcomesthedebateaboutoutofbody
experiencesandluciddreams.TypicallywhenIgetupand
walkawayIaminmybedroom.Icanwalkaroundthehouse
asIpleaseuntilmysurroundingstransformintoadifferent
localeeithernaturallyorbyaconsciouseffort.WasIwalking
aroundmyphysicalhouseoradreamrepresentationofmy
physicalhouse?AlthoughIcantsaywith100%certainty,I
believethelatter.Ibelievethatitisverynaturalforthemind

Page122
116

ThePowerofSupplements

tocreateadreamrepresentationoftheplacethatyou
physicallylaiddownunderthissetofcircumstances.Your
consciousnessremainedunbrokenduringthetransition.Your
consciousnessrememberscominginandlyingdownonyour
bed.Soitisnaturalthatyourconsciousnessbelievesyouare
stillthereonceyouenterthedream.Inluciddreamingitsall
aboutbelief.Ifyoureallybelieveit,itisrealwithinalucid
dream.SincemyconsciousnessiscontinuousandbecauseI
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

113/182

12/25/2016

AdvancedLucidDreaming

amcertainIlaiddownonmybed,whenIstandupandwalk
awayImustbewalkingawayfrommybed.Ifyoufollowthe
programoutlinedinthisbookyoucandecideforyourself
becauseyouwillundoubtedlyexperiencethisphenomenon.
Thistypeofexperienceaccountsforabout40%ofmy
WILDS.

3.Thethirdtypeoftransitionisquitecommonandcanbevery
intense.Onceagainconsciousnessremainsunbrokenbut
thistimeIexperiencewhatIrefertoasintenseaccelerations
asameansofmovingintothedreamworld.Thisisalmost
alwaysjustatactilesensationthatinvolvesmybodysuddenly
acceleratinginaparticulardirectionatincrediblespeeds.The
velocitycanvarygreatlyfromexperiencetoexperiencebut
canbefasterandmorerealisticthanyoucanpossibly
imagine.FurthermoreImaysuddenlystoporchange
directioninatotallyunpredictableway.Inthebeginningyou
willprobablyhavenocontroloverthisbutafterawhileyou
caninfluenceitabit.Oncetheshockfactorofthiseventhas
wornoffyouwillmostlikelyreallyenjoytheexperience(at

Page123
AreYouReadyForThis?

117

leastIdo)butthefirstfewtimesmightreallyfreakyouout.
Dontletitscareyou,itisnaturalandithappensallofthe
time.NowwhenIfeeltheaccelerationsstartingIgetasmile
onmydreambodysfaceandtrytoprolongtheexperienceby
pushingmyselftofasterandfasterspeeds.SometimeIfeela
textureunderneathme,likeIambeingdraggedacrossthe
ground(dontworryitneverhurts).Thereisalsoaless
common,butthoroughlyenjoyable,typeofaccelerationthat
hasoccurredasIwastryingtorolloutofmyphysicalbody
justastheaccelerationsstarted.Theresultwasaspinthat
theTasmaniadevilwouldhavebeenproudof.Generally
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

114/182

12/25/2016

AdvancedLucidDreaming

whentheaccelerationstopsIeitherfindmyselfinadreamor
inmybedroominwhichIjustgetupandwalkaway.Thistype
ofexperienceaccountsforabout45%ofmyWILDs.

4.Thelasttypeoftransitionhasonlyoccurredtometwiceand
thereforeisveryrare.Itinvolvesasenseofvibrationthat
startsatthebackofmyheadandspineandgrowsincredibly
intenseasitmovestowardsthefrontofmyhead.Itslike
walkingbackwardsthroughanelectriccurtain.Thereareno
wordsthatcanexplaintheintensityoftheexperience.Both
timeswereaccompaniedbyasenseofparalysisand
althoughthesensationonlylastedforabout20secondsitis
lifechanging.Thesensationsstartmildandthengrowmore
intenseinanexponentialmanneruntilyourverysoulisbeing
shakenloosefromthephysicalworld.Then,inaninstant,the
sensationtotallyvanishes.Atthispointyouarefreetogetup
andwalkintothedreamworld.

Page124
118

ThePowerofSupplements

Itwouldbefoolishtothinkthatthesearetheonlytypesof
transitionsthatoccurtheyaremerelytheonlyonesIhavepersonally
experienced.Itwouldbeequallyfoolishforyoutothinkthatan
intellectualaccountoftheseexperiencescancomeclosetocapturing
therealexperienceofthesetransitions.Theyarealllifechanging.
Advancedluciddreamingisnotforthemeekandtimid,youare
movingintoavirtuallyunknowndimensionthatiseverybitasrealas
thephysical.Althoughyoushouldntbescaredoftheunknown,you
shouldalwaysmaintaintheverydeepestrespectforit.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

115/182

12/25/2016

AdvancedLucidDreaming

Page125
119

16
UnderstandingtheStrategy
Usingsupplementstoachievehighlevelluciddreamingrequires
astrategyifonewantstomaximizetheoddsofbecominglucidwhile
alsomaximizingthefrequencyofattempts.ThestrategythatIhave
developedissimpleandeffective.Inthemostgeneralsensethe
strategycanbebrokendownintofourelements:

Placehealthandwellbeingfirst.
Maintainhighqualityandbalancedsleep.
Achievehighlevelluciddreams.
Counteracttheeffectsofdesensitization
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

116/182

12/25/2016

AdvancedLucidDreaming

andtolerance.

Letstakeadeeperlookateachoneoftheseelements.

Placehealthandwellbeingfirst:IfollowacoupleofrulesthatI
nevercompromisewhenitcomestohealthandsupplements.

1.Alwaysstartwithasmalldoseandthenincreaseitonlytothe
pointofeffectiveness.
2.Neverexceedthemaximumrecommendeddailydose(asset
byclinicalresearch).

Page126
120

ThePowerofSupplements

3.Alwaystakesupplementsindividuallyfirstbeforecombining
themwithothersupplements.
4.Alwaystrackandrecordanysideeffectsnomatterhowsmall
theymaybe,rememberingthatsideeffectscanbephysical,
mental,and/oremotional.

Maintainhighqualityandbalancedsleep:Sleepistoooftenan
afterthoughtinourlivesyetishasaprofoundeffectonourqualityof
life.Iamafather,ahusband,afulltimeemployee,awriter,a
homeowner,aluciddreamer,andmuchmore.Attimestryingto
manageeverythingseemsbothimpossibleandimpractical.Even
withabusyschedulehowever,Idonotsacrificemysleep,nordoI
sleepmylifeaway.Istrivefor78hoursofsleepatleastfivenightsa
weekandItrytoneverdropbelowsixhours.Moresleepisntneeded
butlesssleepindetrimentaltoourphysical,mentalandemotional
health.Forhealthydreaming,youneed78hoursofsleeppernight.
Thiswillnotonlyimproveyourstatemindbutalsogreatly
improveyouroddsofbecominglucid.Achievingfrequent,highlevel
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

117/182

12/25/2016

AdvancedLucidDreaming

luciddreamswilldemandsomeshiftsinthewayyousleep.Hereare
somesimplerulestofollowthathaveproventoworkextremelywell.

1.Alwayssleep45hoursbeforeattemptingtohavealucid
dream
2.Donotattemptluciddreamsonnightsthatyoufeelphysically,
mentally,oremotionallyexhausted.
3.Ifattemptingthreeofmorenightsofluciddreamingperweek,
activelysuppressREMsleepinthehoursbeforeeach
attempt.

Page127
UnderstandingtheStrategy

121

Qualitysleepisprobablythemostoftenoverlooked,yet
extremelyimportantaspectofluciddreampractice.Sleepresearch
hasshownthatwhenwefirstfalltosleepafteranactiveday,we
naturallyandquicklydropintodeepnonREMsleep.Therearefew,if
any,welldocumentedreportsofluciddreamsoccurringduringthe
deepsleepstages.Alsokeepinmindthatsupplementswhichactas
luciddreamtriggersdonotletyougointothedeepstagesofsleep
thisisoneofthereasonswhytheyworksowell.Takingacetylcholine
boostingsupplementsornorepinephrineboostingsupplementsatthe
beginningofnightisnotpracticalnoraneffectivemeansofinducing
luciddreams.Whenthisisdonethebodyisplacedinastateof
conflictthebodywantsdeepsleepbutthesupplementswontallow
it.TheresultisnoluciddreamANDpoorqualityofsleep.
Rememberthatdeepsleepisassociatedwithelevatedserotonin
levelsandlowacetylcholineandnorepinephrinelevels.Byallowing
yourselftosleepfourorfivehoursbeforetakingaluciddream
trigger,youareallowingyourbodytocompleteaboutthreefullsleep
cycles.Thisistheturningpointwherethebodystartstofavorthe
REMsleepstageinsteadofthedeepsleepstagesinnaturalsleep.
Whenatriggeristakenatthistimeitworksmoresynergisticallywith
thebodyinsteadofputtingthebodyinastateofconflict.Thereis
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

118/182

12/25/2016

AdvancedLucidDreaming

sometimespentindeepnonREMsleepduringthesecondhalfof
thenight,andtakingthesesupplementswillsuppressitwellbeyond
whatisnatural.Forthisreason,onemightfeelsomewhatenergy
deprivedfollowinganightofsupplementinducedluciddreaming.
ThiscanbealmosttotallyavoidedifREMissuppressedinthefirst
halfofthenight.Forexample,ifamodestdoseof5HTPistakenjust
beforebedtime,theserotoninlevelsinthebrainwillbeelevated.The

Page128
122

ThePowerofSupplements

doseworkssynergisticallywiththebrainbecauseitwantsdeepsleep
inthefirsthalfofthenightandincreasedserotoninlevelsare
associatedwithdeepsleep.Whereasthebrainnaturallyhassome
shortperiodsofREMsleep,the5HTPwillacttosuppressthemby
continuouslycrossingthebloodbrainbarrierandconvertinginto
serotonin,thereforemaintainingamoreorlessconstantdeepsleep.
Asthe5HTPwearsoff,thebrainwillwanttomakeupforthelost
timespentinREMandwillsuppresssomeofthenonREMsleepin
theearlymorninghours.Ifaluciddreamtriggeristakenatthis
transitionpoint,theresultwillbemoreorlessasplityetbalanced
nightssleep:deepnonREMsleepinthefirsthalfofthenightand
REM(luciddream)sleepinthesecondhalf.Notonlydoesthisresult
inarestfulnightssleepbutitcanalsonoticeablyextendthelengthof
yourluciddreams.
Finallydontforegoyourcommonsenseinthesearchoflucid
dreams.Ifyouarephysically,mentallyoremotionallyexhausted,
takethenightoffandgetsomerest.Thesameistrueifyouareill.In
thesecasesyourbodywillrequiremoredeepsleepthanusualand
youshouldletyourbodyhealitself.

Achievehighlevelluciddreams:Therearemoreelements
involvedinachievingahighlevelluciddreamthanjusttakinga
supplement.SomuchsothatIhavededicatedanentirepartofthis
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

119/182

12/25/2016

AdvancedLucidDreaming

booktothesubject(seePart4:IncreasingYourOdds).Themost
importantelement,withoutadoubt,istohavetherightstateofmind.
Althoughitistruethatyouhavetowantittohappeninordertohave
anychanceofsuccess,youmustexpectittohappenifyouwantto
getyoursuccessrateupabove90%.Oneofthemainreasonsmy

Page129
UnderstandingtheStrategy

123

successissoextremelyhighisthatIknowthatIwillhavealucid
dreamonthenightsItrytodoso.OfcourseoneofthereasonsIam
sosureisthatIvehadmanysuccessfulattemptsonwhichtobuild
myconfidence.
Thenextimportantelementistotaketherightcombinationof
supplementsattherighttime.Ifyoufollowtheprogramoutlinedin
thenextfewchapters,youwillquicklyfindwhatworksforyouand
whatdoesnt.
Thethirdelementispatience.Inahighlevelluciddreamyou
areneitherfullyasleepnorareyoufullyawakeortoputitanother
way,youaresimultaneouslyasleepandawake.Thelucidstateisa
borderlinestatelocatedbetweentheclassicaldefinitionofsleepand
wakefulness.Thereforethetriggersthatworkbestdonotlend
themselvestoeasilyfallingtosleep,norshouldthey.Animportant
keytosuccessistoliequietlyandjustbepatient.Thereisnorush.
Havefaiththatthedreamswillcome.Thistakesabitofgettinguse
to.Donttalktoyourself.Dontanalyzethesituation.Dontkeepflip
floppingpositions.Remainrelaxedandlietherepatiently.Ihave
developedafewexercisesdesignedtomovesomeonefrom
wakefulnessintothelucidstate.Theseexerciseshavemadeabig
impactonmysuccessrateandwillbeexplainedinPart4ofthis
book.
Finallythereisanarttomakingtheactualtransitionintothe
dream.Theexperienceoftransitioningfromthephysicalintothe
dreamisaweinspiringandlifechanging.Inthebeginningyoumay
havenightswhereyougorighttotheedgebutjustmissthe
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

120/182

12/25/2016

AdvancedLucidDreaming

transition.Usuallythishappensbecauseyougettooexcitedand
wakeyourselfup.Dontletitfrustrateyou.Itgetsmucheasieraftera

Page130
124

ThePowerofSupplements

fewsuccessesarebehindyou.Aftersomepracticeyouwillfindthat
youcanbringyourselfoutofaluciddreamandthengobackinmany
timesduringasinglenight.

Counteracttheeffectsofdesensitizationandtolerance:The
goalisnotjusttohaveoneortwoluciddreams,itstohavehighlevel
luciddreamsfrequentlyandforyearstocome.Desensitizationand
toleranceareveryrealphenomenaandshouldnotbe
underestimated.Fortunatelythereareafewtechniquesthatwork
extremelywellandshouldbeincorporatedrightfromthebeginning.I
willexplainthesetechniquesindetailinchapter18,butthe
philosophycanbesummarizedas:

Donttakealargerdosethannecessarytogettheresult.
Alwaysletthesupplementsclearoutofyoursystem.
Ifthesupplementsstayinyoursystemwellbeyondthetime
oftheluciddream,activelycounteracttheireffectsifpossible.
Donttakethesamecombinationtwiceinarow(i.e.alternate
betweenseveralcombinations).
Ifnecessarytakesometimeoff.

FollowingthissimplephilosophyIamabletohavehighlevellucid
dreamsonaneveryothernightbasiswithpracticallyguaranteed
success.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

121/182

12/25/2016

AdvancedLucidDreaming

Page131
125

17
PrimaryTriggerCombination
IhavelistedeightdifferentsupplementsthatIhaveusedwith
successinmyownpersonalluciddreamdevelopment.Sowhere
shouldyoustartyourownluciddreamdevelopment?Thebestwayto
inducealuciddreamusingsupplementsistouseoneoftheproven
luciddreamtriggers.Recallthatthetriggersdomorethanjust
increasedreamvividnessandrecalltheyactuallypromotelucid
dreaming.Luciddreamtriggersworkbyallowingyoutomovefrom
thewakingstatedirectlyintothedreamstate(WILD)orbypromoting
enhancedreasoningskillsthatallowyoutorecognizeyourdream
signs(DILD).Inpart2,fourluciddreamtriggerswereidentified:
Galantamine,GPC,Nicotine,andYohimbine.Yohimbineincreases
norepinephrinelevelsandtheotherthreeincreaseacetylcholine
levels.Hereismyadvice:

DontstartwithYohimbine:Yohimbineisprovingtobeonethe
mostadvancedsupplementsinmyowndevelopmentbutitnotthe
beststartingplace.AlthoughIhavefoundYohimbinetobea
successfultrigger,itismoredifficulttousethantheothers.
YohimbinedoesnotinitiateREMsleepandthereforerequiresthat
younaturallyenterREMsleepshortlyaftertakingit.Thisrequires
thatyouhaveagoodunderstandingofyoursleepcycleinorderto
useiteffectively.TheotherdisadvantagewithYohimbineisthatthere
isafinelinebetweenasuccessfulluciddreamandinsomnia.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

122/182

12/25/2016

AdvancedLucidDreaming

Page132
126

ThePowerofSupplements

Tocomplicatetheissue,youremotionalstatecannoticeably
affecttheoptimumdosage.Ifyoufeelanyexcitementoranticipation
duringanattemptyourbrainwillnaturallyproducemore
norepinephrine.Youmayfindthatthesamedosethatworkedonone
nightleadstoinsomniaonthenext.ForthesereasonsIdont
recommendusingYohimbineastheprimarytrigger.

DontstartwithNicotine:IrarelyusenicotinethesedaysbutIhave
hadverygoodsuccesswithit.OnecouldeasilyuseNicotineasa
startingpointforluciddreamdevelopment.Ofallthesupplements
discussed,Nicotinehasthemostnoticeablesideeffects.Ithasbeen
showntorapidlycauseshorttermdesensitizationofthenicotinicACh
receptorsandcaneventuallyleadtolongterm(i.e.permanent)
desensitization.Thesereceptorsarecrucialforluciddreamingso
bestnottodesensitizethem.
ThisleavesGalantamineandGPC.Rememberthat
GalantamineinhibitsthebreakdownofAChandGPCisaprecursor
toACh.Thetwoworkverywelltogether(asIwilldiscussinchapter
19).IrecommendstartingwithGalantaminebasedonthefactthatit
isincrediblyeffectiveandbecauseIhavemuchmoreexperience
usingitthanIdowithGPC.GPChastheadvantageofbeing
extremelywelltoleratedbutithasthedisadvantageofalongertime
untilpeakplasmalevelsarereachedyoumayfalltosleeptooearly.
Ifthisshouldhappenyouwillneedtobecomelucidfromwithinthe
dream(i.e.DILD)insteadofmovingdirectlyfromwakefulnessinto
thedream(i.e.WILD).

Page133
PrimaryTriggerCombination

127

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

123/182

12/25/2016

AdvancedLucidDreaming

StartwithGalantamine:TheveryfirstnightItriedGalantamine,I
hadaluciddreamthatwasalmostanhourlong.Itisanextremely
effectivetrigger.GalantamineismosteffectiveifaCholine
supplementisusedincombinationwithit.Recallfromchapters7&8
thatwhenCholineiscombinedwithGalantamine,AChlevelsrise
morequickly,increasingyouroddsofmovingdirectlyintoREM
(dream)sleep.ThetypeofCholineshouldbeeitherCholine
BitartrateorCholineCitrateandcanbepurchasedeitherpremixed
withGalantamineorasaseparatesupplement.Dontbuy
GalantaminethatispartofamemorymixorthathasMelatonin
mixedinyouwilljustbeconfusingtheissue.Irecommendadoseof
48mgofGalantaminecombinedwith250500mgofCholine.I
recommendagainsthigherdosesofGalantaminebecausetheriskof
sideeffectscomeintoplayaroundthe1216mglevel.Iusethe
Galantamine/Cholinemixastheprimarytriggercombinationon
whichallothercombinationsarebuilt.

Procedureforinducingyourfirstsupplementbasedlucid
dream:Suggestionsonhowtohaveasuccessfulluciddreamusing
theGalantamine/Cholinetrigger.
1.DonotconsumeAlcoholontheeveningpriortotheattempt.
Asingleglassofwinewithdinnermaybealright,butkeepit
toaminimum.
2.Gotobedaround10:30PM.
3.Sleeppeacefullyuntil3:30AMandgetup.Itisbetterifyou
canwakeyourselfupnaturallywithouttheuseofanalarm
clockbutifyoumustuseonesetthevolumejustloudenough
tobeeffective.

Page134
128

ThePowerofSupplements

4.Getupandgotothetoiletthentake48mgofGalantamine
and250500mgofCholineBitartrateorCholineCitratewitha
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

124/182

12/25/2016

AdvancedLucidDreaming

cupofwater.
5.Ifyoufeeloverlygroggy,stretchalittle(nomorethanabout
fiveminutes).Rememberthatyoudonotwanttofall
immediatelybacktosleep.Youwanttotransitionintosleep
afterthesupplementshavestartedworking.
6.Liebackinbed.Irecommendlyingonyourbackwithyour
handsbyyourside.Makesureyourecomfortable.
7.Whenyoufirstliedowngooveryourintentionsthreetimes.
Tellyourselfsomethinglike,ThenextthingIwillexperience
willbeadream.Iwillrecognizethedreamstateandbecome
lucid.WhileIaminthedreamIwill(fillinwhateveryouwant
todohere)andsoon.
8.Afteryougooverthisthreetimesquietthemind.Whenever
youfindthatyouarethinkingtoyourselfjustcasuallystop.
Dontgetfrustratedifyoufindyourinternalvoicekeeps
talking,justkeeplettingitgowithoutpayingmuchattentionto
it.
9.Afterabouttwentyminutesturnontoyourside.TheTibetan
dreamyogasuggeststhatmenshouldsleepontheirright
sideandwomenshouldsleepontheirleftside.TheTibetans
believethatformen,lyingontherightsideslightly
compressesthebodysrightsideenergychannel.This
suppressesnegativeemotionsandencourageswisdomprana
(vitalenergy)toflowintheleftchannel.Theoppositeistrue
forwomen.Sleepingonmyrightsidehasprovenvery
effective.

Page135
PrimaryTriggerCombination

129

10.Nowjustcalmlyrelaxandbepatient.

Itverywellmaytakeyouoveranhourtofalltosleepthefirstfew
timesyoutrythis.ThisisduetotheAChlevelsbuilding,combined
withyourownexcitement(excitementincreasesnorepinephrine
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

125/182

12/25/2016

AdvancedLucidDreaming

levels).Itdoesbecomeeasierafterafewsuccessfulattempts.Just
keeplyingtherecalmlyandpatientlywaitingforthedreamtocome.
Youmaystarttoexperienceagentlethrobbingsensationinyour
head.Dontgettooexcitedifthishappens.Justrelaxandwait.Once
youseeimagescomingandgoinginyourmindyouwillknowyouare
gettingclose.Remainpassive,relaxandwait.Themoreyoucan
controlyourexcitementthebetteryourchancesareofsuccessand
thesoonertheluciddreamwillcome.Theimageswillstartto
becomemorefrequentandmorevivid.Youmaystarttoexperiencea
vibrationinyourheadandneck,orafeelingoffloating.Dontget
excited.Justrelaxandwait.Atthispointatransitionwilllikelyoccur.
Rememberthatthetransitionscancomeinmanyforms.Ifthe
vibrationsgetverystrongorifyousuddenlyexperienceanincredible
sensationofacceleration,youareprobablyalreadyinyourdream
bodyandcanjustgetupandwalkaway.However,forthefirstfew
attemptsyoushouldnotgetup.Insteadjustkeeplyingthere
patiently.Thiswillresultinadreamformingwithyouinsideitand
fullyaware.
Afteryouhavegoneinandexploredabit,Isuggestyou
consciouslywakeyourselfup.Thisisaseasyasjustdecidingtodo
sofromwithinthedream.Thiswillhelpkeepthememoriesfreshand
vivid.Thengetupandwriteeverythingdown.

Page136
130

ThePowerofSupplements

Manypeoplewillbesuccessfulontheirfirstattempt.Ifyourenot,
dontworryaboutit,youllgetthefeelofitafterafewattempts.
Whetheryouresuccessfulornot,waitatleastfourdaysbeforetrying
again.Timewillworkinyourfavorhere.Istronglyrecommendnot
takingGalantamineontwoconsecutivenightsbecauseyouarenot
givingitenoughtimetocompletelyclearoutofyoursystem.This
maycausetoleranceissuesinthefuture.Followthisroutineuntilyou
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

126/182

12/25/2016

AdvancedLucidDreaming

haveexperiencedatleastfivehighlevelluciddreams.Atthispoint
youarereadytoadvancetothemultipletriggercombinations
outlinedinthefollowingchapters.

Page137
131

18
CounteractingDesensitizationandTolerance
Desensitizationandtolerance,althoughrelated,donotmean
thesamething.Whereasdesensitizationismainlyaphysiological
effect,toleranceinvolvespsychologicalaspectscoupledtoboth
directandindirectphysiologicaleffects.Thenetresultisthesame
however:Thesupplementsjustdontworkaswellastheyuseto.
Afterexperiencingatleastfivehighlevelluciddreamsusing
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

127/182

12/25/2016

AdvancedLucidDreaming

themethodoutlinedinthepreviouschapteryoumayhavenoticed
twosubtlebutimportantchanges.First,thegentlethrobbinginyour
headprobablyisntasstrongasitwasthefirsttimeyoutried
Galantamine.Second,youprobablycanfalltosleepmucheasier
thanyoucouldafterthefirstfewattempts.Bothoftheseeventsare
relatedtotolerance.Thethrobbingseemstooccurduetotherapidly
increasinglevelsofacetylcholineinsideyourbraincausedby
Galantamine.Afterafewtimes,thebodyismoretoleranttothisrapid
fluctuation.Thetimeittakestogotosleepismorecontrolledbyyour
reactionsandexpectations.Strongexcitementandanticipationcause
norepinephrinetobereleasedinthebrainatthesametimethat
GalantamineisactingtoincreaseAChlevels.Thismakesfallingto
sleepmuchmoredifficultthantheGalantaminedoesonitsown.

Page138
132

ThePowerofSupplements

Also,sincenorepinephrinealsocanactasaluciddream
trigger(seeYohimbine),yourownexcitementcanactuallyincrease
youroddsofsuccessandevenmakeanytransitioningsensations
moreintensethanGalantaminewillcauseonitsown.Alittlebitof
toleranceistobeexpected,isnatural,andcanbehandledquite
easily.
Desensitization,ontheotherhand,mustbeavoided.
Desensitizationisaphysiologicalevent.Galantaminecauses
increasedlevelsofacetylcholinetobepresentinthebrainforupto
48hoursafteryoutakeadose.Thisincreasedconcentrationcan
literallycausethereceptorsthattheacetylcholinebindswithtostart
tolosetheirsensitivity.Thismeansthatinordertohavethesame
physiologicaleffectyouwillneedtoincreasetheacetylcholinelevels
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

128/182

12/25/2016

AdvancedLucidDreaming

evenfurther(i.e.takealargerdoseofGalantamine)inordertoget
thesameeffectasyouhadwiththeinitialdoses.Thelargerdose
causesfurtherdesensitizationandhenceaviciouscyclecontinues
untilonereachesahighenoughdosethatnegativesideeffectsbegin
tosurface.FortunatelyclinicalstudiesshowthatGalantaminedoes
notcauselongtermdesensitization.Shorttermdesensitizationcan
becounteredbylettingthelevelofacetylcholinewithinthebrain
returntoitsnormalstateforsomeperiodoftimebeforetaking
anotherdose.
Ihavebeensuccessfulinavoidingtoleranceanddesensitization
byfollowingasimpleandeffectivestrategy:

Donttakealargerdosethannecessarytogettheresult.There
isnopointintakingexcessivedosesofanysupplement.Going
beyondthedoserequiredtoproducethedesiredeffectwillultimately

Page139
CounteractingDesensitizationandTolerance

133

leadtomorerapidtolerancebuildupanddesensitization.AlthoughI
oftenrefertospecificdosesthatworkwellforme,keepinmindthatI
determinedthesedosesbyaratherrigoroustrialanderrorperiod.
DuringthisperiodItookonlyonesupplementpernightateither11
PMorat4AMinordertorecordtheeffectsthatithadonmydreams.
Istartedatverylowdosesandoftenhadtocutupasinglepillin
manysmallpiecestogettowhatIconsideredtobeasuitable
startingpoint.Ithenworkedmywayuptofindthedoselevelsthat
startedtohaveaprofoundeffectonmydreams.ThenwhenIstarted
combiningsupplementsIreducedthedosesandstartedtoagain
builduptoseewhatworked.Althoughthiswasapainstaking
exerciseityieldedawealthofinformationabouthoweachofthese
supplementscanbeusedtoproducesomeamazingluciddreams
andalsowhatdoselevelsworkbestforme.Iwouldntexpectthatmy
optimumdoseisequaltoyouroptimumdose.Itisagoodideato
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

129/182

12/25/2016

AdvancedLucidDreaming

startatthelowendofthedoserangethatIhaveincludedinmy
recommendations,andprobablyanevenbetterideatocutthose
dosesinhalfandbuildupfromthereinordertooptimizeyourown
doselevels.Bykeepingthedosagestoaminimum,youare
minimizingtheswinginyourbrainsneurotransmitterlevels.By
keepingthisswingtomoreofatilt,youareensuringthattheentire
systemstaysbalancedandrobust.Swingingtoofarcannotonlylead
tophysicalsideeffects,butcanalsoleadtomoodswingsoreven
scatteredthoughts.

Alwaysletsupplementstotallyclearoutofyoursystem.By
lettingthesupplementsclearoutofyoursystem,youareallowing
yourbodytoreturntoitsnormalstateandforallofthe

Page140
134

ThePowerofSupplements

neurotransmitterstoreturntotheirnormallevelswithinthebrain.
Returningtothenormalstateforsomeperiodoftimeisanexcellent
waytoguardagainstshorttermdesensitizationandthereforeensure
thatthesupplementskeepworkingastheyshould.Thequestionthat
mustbeaskedishowlongdoesthebodyneedtostayinitsnatural
statebeforetheshorttermdesensitizationisdiminished?Thisis
complicatedquestionthatdependsonmanyfactorsandreallyhasno
simpleanswer,butmyapproachhasbeentoletthebodyremainin
thenormalstateforatleastaslongasthesupplementwasinthe
body.
Forthemostpart,allofthesupplementscontainedinthis
bookhavesufficientlyclearedoutofthebodyafterabouttwelve
hours.Byusingtheruleabove,thiswouldimplythatthese
supplementscouldbetakenonadailybasis:12hoursinthebody
plus12hoursoutofthebody.Themajorexceptiontothisis
Galantaminewhichtakesabout48hourstoclearoutofthebody.
ThisimpliesthatGalantamineshouldnotbetakenmorefrequently
thanonceeveryfourdaysinordertoavoidanyshortterm
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

130/182

12/25/2016

AdvancedLucidDreaming

desensitizationproblems.

Ifthesupplementsstayinyoursystemwellbeyondthetimeof
theluciddream,activelycounteracttheireffectsifpossible.The
fourdayruleforGalantamineworksverywellformeandIhaveseen
mysuccessratedropifItrytoshortenthetimebetweenattempts.
Thatis,untilIactivelystartedtryingtocounteractitseffectsassoon
asmyluciddreamended.Piracetamisaveryusefulsubstanceto
helpnormalizethecholinergicsystem.Therehavebeenmany
studiesthatshowPiracetamhelpsoptimizetheefficiencywithwhich

Page141
135

CounteractingDesensitizationandTolerance

acetylcholineisusedup.Someofthesestudiesindicatethat
Piracetamcancounteractbothshorttermandlongterm
desensitizationoftheAChreceptorsbycounteractingtheeffectsof
thedrugsthatarecausingthedesensitizationtooccur.Galantamine
causesacetylcholinelevelstoincreasebyblockingthesubstance
thatisresponsibleforbreakingitdown.SinceGalantamineisinyour
systemforuptofortyeighthoursitisreasonabletobelievethatyour
acetylcholinelevelsarehigherthannormalforthisperiodoftime.
Higherthannormalacetylcholinelevelsleadtoshortterm
desensitization.Piracetamsfunctionisnottobreakdown
acetylcholinelikeacetylcholinesterasedoes(recallthatGalantamine
inhibitsacetylcholinesterase),butinsteaditisthoughttousethe
acetylcholinetohelpformandmaintainmemories.Byusingupthe
extraacetylcholinethatGalantamineproduces,Piracetamhelps
maintainlowerlevelsofacetylcholinethanwouldbemaintained
under

the

influence

of

Galantamine

alone.

The

Piracetam/Galantaminecombinationresultsinamorenormallevelof
acetylcholineinthebrainandthereforethereislessofachancefor
desensitizationtooccur.Withlessdesensitization,Galantaminecan
betakenmoreoften.
AsIstatedinchapter10however,Piracetamseemsto
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

131/182

12/25/2016

AdvancedLucidDreaming

effectivelycounteractGalantaminespotentialtotriggeralucid
dream.ThislastpointistakensolelyfrommyownexperiencebutI
have,onnumerousoccasions,triedtousePiracetamorthe
Piracetam/Galantaminecombinationtoinducealuciddreamwithno
success.Furthermoreitseemsasthoughmydreamrecallis
particularlybadifIhavesignificantamountsofPiracetaminmy
systemandsoforthisreasonIrecommendmakingsurethat

Page142
136

ThePowerofSupplements

Piracetamisclearedoutofyoursystembeforeattemptingthenext
luciddream.
Thereareafewkeypointstounderstandinordertounderstand
howtousePiracetamtocombatdesensitization.

1.AlthoughPiracetamisknowntobeextremelysafeevenat
verylargedoses,itisimportanttorampdownadosewhen
usingitifyouplantotakemorethan3000mginasingleday.
OneofPiracetamsfunctionsistoincreasebloodflowtothe
brain.Thisincreasedbloodproducessomeofthebenefitsof
usingPiracetambutcanleadtoaheadacheifthePiracetam
suddenlywearsoffandthebloodflowbecomesmore
constricted.Thiscanbecompletelyavoidedifyouspreadout
thedoseofPiracetamthroughouttheday.
2.Piracetamhasarelativelylonghalflifeatfivehours.This
requiresabout36hourstocompletelyclearoutofthesystem.
3.TherecommendeddailydoseofPiracetamis24004800mg.
Thisdoserangehasbeenshownclinicallytohavethe
optimumeffectonmemoryenhancement.Piracetamusually
comesin800mgcapsulesso36capsulesperdayare
recommended.
4.Piracetamshouldbetakenimmediatelyfollowingalucid
dreamattempt.ThisisthetimewhenAChlevelsareattheir
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

132/182

12/25/2016

AdvancedLucidDreaming

peakandthereforethemostcriticaltimetocounter
desensitization.Irecommendtaking2400mgofPiracetamas
soonasyouwakeupfromanattempt.Ihaveexperimented
with2400mg/dayand4800mg/day.Bothdoselevelsseem
equallyeffectiveandthereforeIfavorasingledosejustafter

Page143
CounteractingDesensitizationandTolerance

137

awakening.Ifyouplanontakingahigherdoseyoucanadd
800mgapproximatelyeveryfivehours.Thisapproachwill
allowbloodconcentrationstograduallydecrease,avoidinga
possibleheadache.
Thefollowinggraphshowstheoverlapofa4800mgdoseof
PiracetamwithasingledoseofGalantamine.ThePiracetamis
spreadthroughoutthedaywith2400mgtakenuponawakeningand
then800mgtakeneveryfivehoursthereafter.Noticethattheoverall
concentrationofPiracetamisgraduallybeingreducedintheblood
streamandthatbothsupplementsarecompletelyclearedoutofthe
bodyafter48hours.

OverlapofPiracetamdosewiththatofGalantamine.IntheabovegraphGalantaminewas
takenat3AM,2400mgofPiracetamwastakingat8AM,800mgofPiracetamwastakeneach
at1PM,6PMand11PM.

Donttakethesamecombinationtwiceinarow(i.e.alternate
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

133/182

12/25/2016

AdvancedLucidDreaming

betweenseveralsuccessfulcombinations).Ifyoutaketheexact
samecombinationofsupplementseverytimeyoutrytohavealucid

Page144
138

ThePowerofSupplements

dreamyourbodystartstogetusetoit.Thisisaformoftolerance.
Themindmaybecometoolackadaisicalandaftersometimeyou
maynoticetheeffectivenessstartingtowane,especiallyifyouare
makingattemptsmorethantwiceaweek.ThebestmethodIhave
foundtokeepthingsfreshistomixitupabit.Iregularlyuse
Galantamine/Cholineastheprimarytriggercombinationhowever,on
onenightImightaddsomeMucunaPruriensandthenonthenext
attemptImayaddsomeYohimbine,maybeafterthatItry
Galantamine/CholinebyitselforwithalittleGPC.Thepointisthat
mybodyneverquiteknowswhatIamgoingtothrowatitandthis
keepsthingsfresh.IalsokeepdetailedrecordsofeachattemptsoI
cangobackandseewhatcombinationsregularlyproducethemost
astoundingresults.Bymixingthingsup,thebodyneverreallyadapts
andmyluciddreamsremainextremelystrong.

Keepyourexpectationshigh.Dontunderestimatethepowerof
yourmind.IrememberthefirstveryhighlevelluciddreamIhad.
Therewerenosupplementsinvolved.Ihadmaybetwodozenlowto
mediumlevelluciddreamexperiencesthatwerespreadoutover
severalyearsoftrying.OnthisparticularnightItookthetrashoutside
andlookedupatthesky.Theskywasclearandtheairwascrisp.I
couldseeSaturnandJupiterdefiningtheeclipticthatledtoamoon
thatwasabout90%full.InaninstantIwaspositivethatIwasgoing
tohavealuciddreamthatnight.Mycertaintyisdifficulttoexplainbut
itwasbothsincereandtotal.WhenIlaiddownthatnightIfeltatease
andrelaxed.Myluciddreamthatnightwasimmenselyprofound,long
andmarkedbyexcellentdreammanipulationskills.AfterthatnightI
triedtorecapturethatcertaintyonmanyoccasionsbutIonly
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

134/182

12/25/2016

AdvancedLucidDreaming

Page145
CounteractingDesensitizationandTolerance

139

sincerelyfeltiteverysooften.EachtimeIdidfeelithowever,I
succeededinhavingaluciddream.Nowwithsupplements,things
aremucheasierbuttheroleofthemindshouldnotbeneglected.
Youneedtowantit,notjustalittlebit,butwitheverythingyouhave,
asthoughyourownfuturedependedonbecominglucidthat
particularnight.Morethanwantingit,youneedtoexpectittobe
sureofittonotsettleforanythingless.Whenyourehavinghigh
levelluciddreamsmultipletimesperweek,therewillbethosetimes
thatyourheartjustisntinit.Youmaybetired,oryoumaynothave
plannedoutanythingspecial,oryourmindmayjustbepreoccupied
withsomethingelse.Inthesecases,doyourselfafavorandtakethe
nightoff.Keepyourmindfocusedonthegoalofbecominglucidand
yoursuccessratewillbemuchhigherthanifyoujustwakeupat4
AMtotakeapillandthengobacktosleep.

Ifnecessarytakesometimeoff.Forwhateverreasonsometimes
thesupplementsjustdontwork.Thiscouldbefromtoleranceor
desensitizationormaybejustbeduetosomethinggoingoninyour
life.Whenthisoccursyoushouldtakeacoupleextradaysoffbefore
tryingagain.Twoextradaysseemstodoaworldofgood.Duringthe
timeoff,focusonwhatitisyouwanttoachieveduringyournextlucid
dreamandletyourbodyjustsleepnaturally.SinceIoftenexperience
intenseaccelerationswhentransitioningintoadream,Iusethisasa
markerforeffectiveness.Iftheaccelerationsseemlessintensethan
usualIwillusuallytakeanextradayoffbeforetryingagain.The
sameistrueifmydreamrecallseemstobedroppingoff.Tomethis
isamuchbetterapproachthantowaituntilIdontsucceedinhaving
aluciddreamatall.Thereisnothingwrongwithtakingabreakfrom

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

135/182

12/25/2016

AdvancedLucidDreaming

Page146
140

ThePowerofSupplements

timetotime.Thiswillhelpkeepthequalityofthelucidexperiences
exceptionallyhigh.

Page147
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

136/182

12/25/2016

AdvancedLucidDreaming

141

19
MultipleTriggerCombinations
Hopefullybynowyouhavedevelopedafirsthand
understandingofthepowertheGalantamine/Cholinecombination
hasastheprimaryluciddreamtrigger.Inthischapterwebuildupon
thatpowertoformfourincrediblyeffectivetriggercombinations.The
reasonthesecombinationsaresoeffectiveistheyincludemorethan
onetrigger.Whenmultipletriggersarecombined,thelikelihoodof
experiencingaluciddreamisincreased.Inaddition,dreamlength
andmentalclarityarebothpositivelyinfluenced.
InPart2,Iidentifiedfoursupplementsasluciddream
triggers:Galantamine,GPC,Nicotine,andYohimbine.Eachofthe
combinationsinthischapterincludestheprimarytriggercombination
(Galantamine/Choline)andaddsoneormoreoftheothertriggersin
ordertoenhancetheresult.

ThePrimaryTrigger:
Aswaspointedoutinchapter17,GalantamineandCholine
combinetoformtheprimaryluciddreamtrigger.Ihaveincludedit
hereforeasyreferenceandcomparisontothemultipletrigger
combinations.Eachtriggerdescriptionincludesasummarytableand
concentrationchart.Thesummarytablehighlightsthesupplements
used,theeffectivedoserange(includingthedoseItypicallyuse),
andthebesttimetotakethesupplements.

Page148
142

ThePowerofSupplements

Theconcentrationcurvesgiveavisualrepresentationofhow
thesupplementsworktogetheronatimebasisandshowthewindow
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

137/182

12/25/2016

AdvancedLucidDreaming

ofopportunityforexperiencingaluciddream.Theconcentration
curvefortheprimarytriggershowsthatCholineplaysasignificant
roleinthefirsthourandthendropsoffquickly.Itworkssynergistically
withGalantaminetoquicklybuildupAChlevelsthatimproveyour
oddsofbecominglucid.

ConcentrationCurveforthePrimaryTriggerCombination(Galantamine+Choline)

TheExtendedPlayTrigger:
ThiscombinationaddsGPCtotheprimarytrigger.SinceGPC
efficientlycrossesthebloodbrainbarrierandtakesthreehoursto
reachpeakplasmalevels,itpicksupwhereCholineleavesoff:
Acetylcholineconcentrationsrisetoahigherlevelandstayelevated

Page149
MultipleTriggerCombinations

143

foralongerperiodoftime.Thiscanresultinextremelylonglucid
dreams.Twohoursormoreisnotuncommon.Furthermore,this
combinationisverywelltoleratedattheeffectivedoselevelandI
haveneverexperiencednegativesideeffectswhenusingit.Youcan
expectastrongtransitionandpossiblyhearingmusicduringthe
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

138/182

12/25/2016

AdvancedLucidDreaming

courseofthedream.Ifthemusicistooloud,reducethedoseofthe
GPCforthenextattempt.

ConcentrationCurvefortheExtendedPlayTriggerCombination(Galantamine+Choline+
GPC)

Page150
144

ThePowerofSupplements

TheSoundtrackTrigger:
ThiscombinationaddsNicotine(viaapatch)totheprimary
trigger.AlthoughNicotinehasanumberofnegativecharacteristics,
whencombinedwithGalantamineitcanproducephenomenallucid
dreams.Extremelystrongtransitionsarepossibleandexpectavivid
memoryofthedream.Someofmyfavoriteluciddreamsdeveloped
fromthiscombination.Inadditiontovisualandtactilevividness,
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

139/182

12/25/2016

AdvancedLucidDreaming

thesedreamscanbecharacterizedashavingaheightenedauditory
sense.OnmanyoccasionsIhaveexperiencedasoundtracktomy
dreamsthatcanbedescribedaswonderfulandoriginal.Tosome
degree,IhavealsoexperiencedthisphenomenausingGPC,butwith
Nicotinethemusicseemstobettermatchmymoodandthedream
plot.Negativesideeffectscanbeavoidedifalowdosepatchis
placedonafterfourorfivehoursofsleepandimmediatelyremoved
uponawakening.DuetotheshorttermdesensitizationthatNicotine
causeshowever,Itypicallytakeafullsevendaysofffrom
supplementsafterusingthiscombination.

Page151
MultipleTriggerCombinations

145

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

140/182

12/25/2016

AdvancedLucidDreaming
ConcentrationCurvefortheSoundtrackTriggerCombination(Galantamine+Choline+
Nicotine)

ThePowerofReasonTrigger:
ThiscombinationaddsYohimbinetotheprimarytrigger.
WhenYohimbineisusedcorrectlyitcanproduceextremelyhigh
levelluciddreams.Wheresomeoftheothercombinationsmay
increasedreamlength,Yohimbinecanincreasetheabilitytothink
whilewithinadream.Advancedluciddreaminginvolvesmorethan
justhavingaluciddreamitinvolvesmovingthroughthedreamwith
aclearmindsothatyoucanconsciouslygodeeperintothe
experience.Extremelysmalldosesareallthatarerequiredinfact,
smalldosesaretheoptimum.Therightdosewillbeonethatdoes
notsignificantlyincreasethetimeittakestofalltosleep.Toolargeof
dosewillextendthetimeittakestofalltosleepbeyondtheoptimum
timeoftheothersupplements.Thiscombinationcancauseextremely
strongtransitions.

Page152
146

ThePowerofSupplements

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

141/182

12/25/2016

AdvancedLucidDreaming

ConcentrationCurveforthePowerofReasonTriggerCombination(Galantamine+Choline+
Yohimbine)

TheTrifectaTrigger:
ThiscombinationaddsbothGPCandYohimbinetothe
primarytrigger.ItistheonlytripletriggercombinationIhave
included.Transitionsareintensesobeprepared.Asistrueforany
combinationthatleadstolonglucidexperiences,youmaywantto
consciouslybringyourselfoutofthedreamfromtimetotimeand
thengobackin.Thiswillhelptoremembermoreofthedetailsofthe
entiredream.

Page153
MultipleTriggerCombinations

147

ConcentrationCurvefortheTrifectaTriggerCombination
(Galantamine+Choline+Yohimbine+GPC)

HowtousetheMultipleTriggerCombinations:
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

142/182

12/25/2016

AdvancedLucidDreaming

Theprocedureoutlinedonpage127givesagoodoutlineof
basicstepsusedtoinduceluciddreams.Part4ImprovingYour
Oddsgoesintothemoredetailandincludesmanyusefultipsand
techniques.IfyouarenotusingPiracetamimmediatelyfollowingyour
attempts,youshouldtakeatleastfournightsoffbetweentries.You
mayfindyourneedfive,six,orevensevennightsoffinordertoget
consistentresults.IfyouuseNicotine,Irecommendyouwaitafull
sevendaysbeforemakinganotherattempt.IfyouusePiracetam,
rememberthatitisveryimportanttotakethefirstdoseimmediately
afterawakeningfromanattempt.WhenusingPiracetam,youshould
takeatleastonenightoffbetweenattemptsandyoumayfindthat
twooreventhreenightsoffarerequiredforconsistentresults.

Page154
148

20
SupportingSupplements
ThischaptersummarizeshowtouseMucunaPruriens,
Piracetam,5HTP,andMelatonintosupportandenhancelucid
dreaming.

IncreasingDreamControl:MucunaPruriens
Whenusedcorrectly,MucunaPrurienscanhaveastrong
effectonluciddreams.Itdoessobyincreasingdopaminelevelsin
thebrainwhichleadstoastateofincreasedconfidence,motivation,
andanalmosttotallackoffearfromwithinthedreamstate.Withthis
emotionalboost,practicallyanythingispossible.Previously,I
mentionedthepositiveeffectsMucunaPrurienshasonflyingand
changingthedreamscape,butitseffectsgofurtherthanthat.Ihave
walkedintoaragingfireandabsorbedtheenergyoftheflames,
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

143/182

12/25/2016

AdvancedLucidDreaming

createdathunderstormandguidedlightningboltsintomyhands,
stoodonthetracksasaspeedingtrainpassedrightthroughme,and
climbedamountaintothesummit,thenjustcasuallysteppedoffthe
edge,andmuchmore.MucunaPrurienscancreateatrueadventure
inyourluciddreams.Thatbeingsaid,Mucunacanbealittletrickyto
use.LargedosesofMucuna(100mgormoreofLdopa)takenwitha
triggerwillreduceyouroddsofbecominglucid(althoughyouwill
mostlikelyexperienceextremelyvividdreams).

Page155
SupportingSupplements

149

Smallerdoseswillgiveyouanedgebutmaynothaveasbig
asimpactoncontrolasthelargerdosesdo.Oneprovensolutionisto
takeMucunaanhourorsopriortotakingthetrigger.
MucunaPrurienscanbeaddedtoanyofthetrigger
combinationslistedpreviously.IfyouaregoingtotaketheMucuna
simultaneouslywiththetriggeryoushouldtakeadosethatcontains
lessthan100mgofLdopa(seechapter11).Ifyouwanttotrya
largerdose(100200mgLdopa),youshouldtakeitanhourorso
beforetakingthetrigger.Youcaneithersleeporstayawakeforthe
hourbetweendoses.Thefollowingtablesshowthetwomethodsof
combiningMucunaPrurienswiththeprimarytriggercombination.

CounteractingDesensitizationandTolerance:Piracetam
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

144/182

12/25/2016

AdvancedLucidDreaming

Piracetamcanincreasethefrequencyyoucantake
supplementsandsucceedinhavingaluciddream.Without
Piracetam,oneortwonightsperweekareaboutthelimit.With
Piracetam,threeorfournightsperweekarepossible.Evenwith
Piracetamhowever,youmayhavetotakeafewextradaysofffrom
everysooften.Itsbesttokeepyourdreamscheduleflexible.For
example,Imighthavethreeorfournightsofluciddreaminginone
particularweek.IfInoticethatmytransitionsarebecomingweaker

Page156
150

ThePowerofSupplements

asthedaysgoby,IknowthatIamapproachingadryspell.Inorder
togetbacktowhereIstartedIwillgenerallytakeafewextranights
offbeforemakinganotherattempt.Youwillneedtouseyourown
judgmentastowhatworksbestforyou.
ThedetailsofusingPiracetamweredescribedearlier(See
chapter18),butrememberthatforPiracetamtobemosteffective,
youshouldtakeadoseimmediatelyafterwakingupfromeach
attempt.ThisallowsPiracetamtocounterAChlevelswhentheyare
attheirhighestandthereforekeepsdesensitizationtoaminimum.

ImprovingQualityofSleep:5HTP
5HTPcanbeusedasameansofsuppressingREMsleepin
thefirsthalfofthenight.ThisallowsyoutohavelongernaturalREM
periodsduringthetimethatyouareattemptingaluciddream.Italso
helpsbalanceyoursleep.Thisisespeciallyimportantifyouare
attemptingtohavemultiplenightsperweekofsupplementinduced
luciddreaming.Thetriggerscanoftenleaveyoufeelingfatiguedthe
nextday,evenwhentheyaretakenafter4or5hoursofsleep.When
thetriggersareprecededby5HTP,youroverallsleepisofahigher
qualityandyoufeelmuchmorerefresheduponawakening.
Thefollowingtableandconcentrationchartshowhow5HTP
isusedinaccordancewiththeprimarytriggercombination.The
optimumdoseof5HTPwillbetheonethatresultsinthemostvivid
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

145/182

12/25/2016

AdvancedLucidDreaming

dreamsafterfourorfivehoursofsleep.5HTPcanprecedeanyof
thetriggercombinations.

Page157
SupportingSupplements

151

CounteractingInsomnia:Melatonin
Ifyoufindthatyouhavetroublefallingbacktosleepafter
takinganyoneofthetriggercombinations,youmayconsideradding
alittleMelatonintothemix.ThetestingIdidshowedthatasmallof
doseofMelatonin(<0.5mg)couldcutthetimetofallbacktosleepin
halfandstillmaintainhighoddsofhavingasuccessfulluciddream.
Largerdoseshelpmefalltosleepfaster,butgenerallyreducedmy
oddsofsuccess.Theidealtimetofalltosleepaftertakingthetrigger
supplementsis4060minutes.Thisisthetimethatmostofthe
triggersarereachingtheirmaximumplasmalevelsandtendstobe
thetimethestrongesttransitionsoccur.Ifyoufindyouarestaying
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

146/182

12/25/2016

AdvancedLucidDreaming

awakemuchlongerthanthisduringanattempt,thenMelatoninmay
actuallyincreaseyouroddsofsuccessbylettingyoufalltosleep

Page158
152

ThePowerofSupplements

closertotheoptimumtime.ThefollowingtableshowshowMelatonin
canbeusedinaccordancewiththeprimarytriggercombination.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

147/182

12/25/2016

AdvancedLucidDreaming

Page159

Part4:
ImprovingYourOdds
NowIwilldiscussseveralstrategiesthatyoucanuseto
greatlyimproveyouroddsofbecominglucid,lengthenthetimespent
inthelucidstate,andincreasethecontrolyouhaveoverthedream.
Someofthesepracticeshavebeenknowntoluciddreamersforover
ageneration,otherswereadaptedfrommyqigongpractice,anda
fewweredevelopedbymoreorlesshitandmissexperimentation
tacticsduringmyownluciddreamdevelopment.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

148/182

12/25/2016

AdvancedLucidDreaming

Page160
154

21
DaytimePractice
Thefirstfacttheluciddreamerisforcedtoacceptisthatthe
dreamworldiseverybitasdetailedandrealasthephysicalworld.
Oncethisisrealized,onesooncomestorealizethesecondfactthe
physicalworldiseverybitassubjectiveandinsubstantialasthe
dreamworld.Thesetworealizationscannotbefullyintellectualized
andmustbeexperiencedfirsthandinordertograsptheprofound
natureofluciddreamingandalsoofbeingphysicallyawake.
InmyluciddreamexperiencesIhavefoundtherearetwo
primarytypesofdreamcharacters:theignorantandthealive.The
ignorantcharactersaremoreorlessmindless,justplayingouttheir
roleinthedreamandhavingnoabilitytoactuallythink.Their
ignorancebecomesfullyapparentwhenyou,inafullylucidstate,
attempttohaveaconversationwiththem.Askthemaquestionthat
requiresthoughtorselfreflectionandtheyaredumbfounded.Even
thesimplestquestionslike,Whatareyouthinkingabout?,Tellme
aboutyourself.,orWhatisyourname?willyieldamindlessand
emptyresponse.
Thereishoweveratotallydifferenttypeofcharacter.They
tendtobefullyanimatedandcanexpresstheirownopinionsthat
mayberemarkablydifferentfromyourown.Theyhavetheabilityto
adaptandtothinkontheirfeetandcansometimesevenoutsmart
youinagameofwits.

Page161
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

149/182

12/25/2016

AdvancedLucidDreaming

155

DaytimePractice

Whenweareinadreambutarenotlucid,weresemblethe
firsttypeofcharacter,theignorant.Wereunawareofwhatwere
doingwejustdoit.Wedontthinkwedontrecognizethethingswe
shouldwearejustactingoutapartinaplayweknownothingabout.
Whenwearepresentinthedreaminfulllucidityontheotherhand,
weresemblethesecondtypeofcharacter.Wearealiveandknow
thesituation.Wecanleadandtakecontrolofthesituation.Wehave
transformedourselvesfrompuredeterminists,whotakenoreal
responsibility,intoexamplesoffreewillbyactivelyguidingthe
situationandthereforeourlives.
Afterthisisfullyexperiencedandrealizedinthedreamstate
onemaystarttonoticeasimilarcharacterizationinthephysical
state.Considerthetimeswefollowthroughwithourdailyactivitiesin
amechanicalmanner,blindlygoingaboutsomeactivityforwhatever
reason.Rememberthatthegoalistobecomelucid,notjustinthe
dreamstatebutalsointhephysicalstateandalsorememberthat
maintaininglucidityinonestatehelpsinachievinglucidityintheother
state.Oneshouldstrivetobealiveandlucidineveryinstantinthe
physicalaswellasinthedream.
OftenwhenIfirstenteraluciddreamInoticethatalthoughI
amwalkingabout,myvisionisquitehazyandblurred.Ihavelearned
thatbypayingverycloseattentiontothedetailssurroundingmeand
bylookingintothingsinsteadofjustlookingatthem,myvision
suddenlysnapsintoclearandvividfocus.Thesameprinciplecanbe
appliedduringwakinglife.Lucidityisnotaspecialtypeofdream
phenomenaitisaspecialtypeoflifephenomena.
Inadditiontoconstantlystrivingforlucidityoneshould
constantlybeconsideringwhethertheyarecurrentlyinthedream

Page162
156

ThePowerofSupplements

stateorthephysicalstate.Itisnotagiventhatyouareawakeandin
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

150/182

12/25/2016

AdvancedLucidDreaming

thephysicalstateatanygivenmoment.Thedreamworldcanbe
everybitasmundaneasthephysicalandthephysicalworldcanbe
everybitasexcitingasthedream.Bothworldscancomewith
exquisitedetailandbeautyorperhapsblandnessandugliness.The
trueluciddreamerknowsthatthetwoworldscannotbeeasily
distinguishedwithjustaglanceorpassingthought.Youmaythink
youaredefinitelyawake,butletmeassureyouthattherearemany
timesthatyouareabsolutelypositiveyouawakebutinsteadarefully
engagedinadream.Simpletestscanbedonetohelpyou
distinguishthedifferenceandyoushouldgetintothehabitof
carryingoutthesetestsonafrequentbasis.
Itisafalseassumptionthatthedreamworldhasnorules.Infact,
notonlydorulesexistbutthetwoworldshavemuchincommon.For
example,therearenonewcolorsinthedreamworldinfactthere
arenonewsensationsofanykindinthedreamworld.Gravitydoes
existinthedreamworlditisjustthatyouhavetheabilityto
manipulateit.Paincanexistinthedreamworldaswellboth
emotionalandphysical.Solidsubstancesexistinthedreamworldit
isjustthatyouhavetheabilitytotranscendthem.Theonlytwo
significantdifferencesarethat:

1.Itiseasiertomanipulateyoursurroundingsinthedream
world.
2.Formostofusthephysicalworldismorebasedonrepeating
cyclesthanthedreamworld.Yesterdaymaynotbethat
differentfromtoday(Igotup,tookashower,drovetowork,
atelunch,drovehome,playedwiththekids,atedinner,then

Page163
DaytimePractice

157

wenttobed).Thedreamworldhowever,seemstobemoreor
lessfreefromcycles.Everyexperienceisanewanddifferent
setofcircumstances.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

151/182

12/25/2016

AdvancedLucidDreaming

Itiswisetokeepthesethingsinmindasyoumovethroughthe
physicalandintothedreamandthenbacktothephysical.
Continuallytestyourstate.Doesthisplacelookfamiliar?AmI
supposedtobehere?WhatwasIdoingtenminutesago?Ifthereis
anyhintthatsomethingisntquiteasyouwouldexpect,tryhovering
offthegroundalittlebit,orchangingthecolorofthegrass,or
walkingthroughawall,oranythingelseuntilyouareabsolutely
convincedthatyouknowwhichstateyouarein:thephysicalorthe
dream.Continualpracticeofthiswillspilloverintothedreamandis
remarkablyeffectiveatwakingyouupwithinthedream.
Therealfirststepinadvancedluciddreamingistosetyour
intentiontobecomefullylucidinbothstatesandtocontinuallyprove
toyourselfwhichstateyouinatanygiventime.

Page164
158

22
PreparationandTransitioning
IfyouchoosetotrysomeofthetechniquesIpresentedinthis
bookyouwillundoubtedlyfindtherearesomeverysubtlefactorsthat
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

152/182

12/25/2016

AdvancedLucidDreaming

ultimatelydeterminewhetherornotyouaresuccessful.Thischapter
summarizeswhatIhavelearnedthroughcountlessluciddream
attempts(bothsuccessfulandunsuccessful)astowhathasthe
biggestimpactofactuallymakingitinandachievingasuccessful
WILD.
1.Createapeacefulenvironment.
Sleeptimeshouldbepeacefulandfreeofdistractions.
Whenyouareontheedgethatseparateswakefulnessfrom
theluciddreamthelastthingyouneedistohavesomething
fromtheexternalworldgrabyourattention.Noisecanbebig
factor.Atfourinthemorningthequietestsoundcancapture
yourmindandbecomeanannoyingnuisance.Youmaywant
towearearplugswhenattemptingtohavealuciddreamor
perhapsevenamaskoveryoureyes.Themoreyoucan
isolateyourselffromyourexternalsensesthebetteryour
chancesofquicklyenteringthedream.
2.Dontsacrificeyourqualityofsleep.
Ihaveseenithappen.Peoplecangettoocarried
awaywithluciddreamingobsessedwithit.Itsnew,itscool,
anditmayholdthekeytomanysecretslockedawaywithin
thesubconscious,butitisnotworthsacrificingyourhealth.

Page165
PreparationandTransitioning

159

Withoutgoodhealth,youhavenothing.Poorsleepusually
carrieswithitanumberoframifications.Youmaynotbethe
besthusbandorwifethatyoucould,orthebestfatheror
mother,orthebestemployee,orthebestanything.Itmay
takeatollonyourhappiness,peaceofmind,andonthe
strengthofyourimmunesystem.Dontgodownthatpath.Itis
possibletohavefrequenthighlevelluciddreamsandstill
maintainabalancedsleepschedule.Ifirmlybelieveeveryone
shouldtakeatleastonenightoffbetweenluciddream
attempts.Notonlydoesthisallowyoutofullydigestyourlast
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

153/182

12/25/2016

AdvancedLucidDreaming

luciddreamandproperlyprepareforthenextone,butby
takinganightoffyouallowyourbodycatchuponwhatever
sleepitneeds.
3.Wakingupjusttherightamount.
Inmyownpractice,Ihavefocusedondevelopingthe
abilitytoconsistentlyachieveWILDs.Thetriggersdescribed
inthisbookalsoincreasetheoddsofachievingDILDsand
dependingonwhetheryouaregoingforaWILDoraDILD
willinfluencewhatyoudojustafteryoutakethesupplements.
IfyoufavorDILDs,yourgoalwillbetoavoidinsomniaby
fallingbacktosleepsoonaftertakingthesupplements.You
shouldwakeup,gotothetoilet,takethesupplements,lie
backdown,andrelax.Thelesstimeyoureup,thebetterthe
oddsoffallingquicklybacktosleep.Avoidturningonbright
lights.Avoidclimbingupordownstairsandanyotheractivity
thatmightincreaseyourheartrate.Someofthese
supplementsstarttoworkfastandthelongeryoureawake,
themoredifficultitwillbetofallbacktosleep.Purposely

Page166
160

ThePowerofSupplements

avoidbecomingtooalertandlearntostayinarelaxedstate.
Thesearethekeystoquicklygettingbacktosleep.
WILDsrequireadifferentapproach.Youshould
neitherwakeuptoomuchnorfalltosleeptooearly.Fallto
sleeptooearlyandthesupplementswontbeworking
adequatelytoassistyouwiththetransition.Wakeuptoo
muchandyoucouldenduplyinginbedforhourswith
insomnia.Fallingtosleep4060minutesaftertakingthe
supplementsisideal.ItiswithinthistimeframeIfindthe
transitionstobethemostvibrantandthedurationoflucid
dreamstobethelongest.Myapproachistowakeup,goto
thetoilet,takethesupplementsandliebackdown.Justasin
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

154/182

12/25/2016

AdvancedLucidDreaming

thecaseoftheDILD,Itrytonottobecometooalertandhope
tomaintainafeelingofdrowsiness.Istayrelaxed,butinstead
ofhopingtofallquicklybacktosleep,Igentlyremindmyself
ofwhatmydreamgoalsare.Justpriortonoddingoff,I
slightlyopenmyeyesjustenoughtoletsomeambientlight
entermyfieldofvision.Theopeningofmyeyesissoslight
thatanobserverwouldlikelynotnoticeitatall.Ithenrelax
andletmyeyesnaturallycloseandrelax.Irepeatthisonceor
twicemore.EachtimeIgetclosetolosingconsciousnessI
crackopenmyeyesforonlyaninstant.Bythistimefivetoten
minuteshavepassedsincetakingthesupplements.Ithen
casuallyandsleepilypracticeanexerciseIcallarmsand
legsqigongfollowedbyseededvisualizations.Bothof
theseexercisesaredescribedbelow.DuringtheseexercisesI
continuetocrackmyeyesopenanytimeIfeelIamaboutto
falltosleep.WiththisapproachIcanstayrightontheborder

Page167
PreparationandTransitioning

161

thatseparateswakefulnessfromsleepuntilatransition
occurs.
4.Quietingthemind.
Thebiggestinfluencethatkeepsyoufromfallingback
tosleepafteryouhavetakenasupplementisthatannoying
littlevoiceinyourheadthatjustwontseemtoshutup.Right
afteryouliebackdownitisagoodideatospendfiveorten
minutesgoingoverwhatitisthatyouwanttoaccomplishin
thedream,butafterthatyouneedtoturnoffthevoice.This
canbeabittricky.Youmightfindyourselfwonderingwhat
timeitis,orwonderingifthesupplementsarestartingtowork,
orcomplainingaboutyourbodyposition,orwhatever.The
factisthatthelongeryoutalktoyourself,thelongeryouare
goingtostayawake.Sinceyourmindisawakeitwantstobe
active,andthinkinginwordsseemstobeitsfirstchoiceof
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

155/182

12/25/2016

AdvancedLucidDreaming

activity.Youwillneedtolearnhowtoquietthemind.The
easiestwayistoletyourmindgetcaughtupinsomeother,
nonverbalactivityliketactileorvisualexercises.Buteven
thenthevoicewillcomethroughagainandagainandtryto
winoveryourattention.Ignoreitandletitgo.Thebiggest
mistakeyoucanmakeistogetfrustrated.Calmnessand
patiencearewordstolivebyinthissituation.Simplygoback
tothetactileorvisualexercisethatyouweredoinganddont
giveitanotherthought.
5.Loosingthebody(Armsandlegsqigong).
Anexcellentwaytoquietthemindandprepareforthe
transitionfromthephysicalstatetotheluciddreamstateisto
dotactileexercise.Tactileexercisesareonesthatinvolve

Page168
162

ThePowerofSupplements

imaginingthesensationofmotion.Theyareanalogousto
visualizationsexceptthattheymakeuseofthesenseoftouch
insteadofthesenseofsight.Rememberthatabout90%of
myluciddreamsusingsupplementsinvolvemegettingup
andwalkingawayfrommyphysicalbodyfullyintegrated
withinadreambody.Byusingtactileexercises,youare
preparingthemindforthistypeoftransition.Ihavetriedmany
typesoftactileexercises:walking,running,climbing,spinning,
floating,etcbuttheonesthatworkbestformearetheones
inwhichIimaginepartofmydreambodyslippingoutofmy
physicalbodyandthenslippingbackinandthenrepeating
thisoverandoveragain.Myfavoriteoftheseexercisesisone
inwhichIimagineeithermyarmsorlegs(orboth)floating
downwardoneachexhaleandthenrisinguponeachinhale.
Forexample,asIexhaleabreath,Ifeelmylegsbendatthe
kneeforcingmyimaginaryfeetandcalvestorotatedownward
andleavemyphysicalbody.Bytheendoftheexhalemy
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

156/182

12/25/2016

AdvancedLucidDreaming

imaginarykneehasrotatedafullninetydegreessuchthatmy
imaginaryfeetaredanglingbelowmybody.Ontheinhale,I
rotatemyimaginarykneeintheoppositedirectioninorderto
raisemyimaginarylegsbackup.BytheendoftheinhaleI
havebroughtmyimaginarylegsallthewayupandeven
slightlythroughmyphysicallegssothattheyaresuspended
abovemybody.IkeeprepeatingthisoverandoveragainasI
liethere.Anothervariantistovisualizemyarmsbendingat
theshoulderinasimilarmannerortodobothmyarmsand
legstogether.Iusuallylieonmybackwhiledoingthis
exerciseanddoitforabout1020minutes.AfterthatIroll

Page169
PreparationandTransitioning

163

overontomyrightsideanddoseededvisualization
exercisesuntilthedreamstarts.
6.Initiating(butnotforcing)visualization(Seededvisualizations)
AtthispointIamveryclosetosleepandthe
supplementsarestartingtowork.Nowitstimetotrytoget
thedreamstarted.Activevisualizationdoesnotworkforme
becausethefocusittakestoactivelyvisualizesomething
endsupkeepingmeawake.Purelypassivevisualization
doesntworkverywelleither,becausesometimestheimages
dontcomeandIenduphearingmythoughtsinstead.What
worksbestiswhatIcallseededvisualizations.Aseeded
visualizationisonethatIactivelystartbutthenimmediately
letgoandpassivelyletitdeveloponitsown.Insteadof
activelytryingtokeepavisualizationgoing,Ijustkeepon
droppingseedsuntiltheytakeoffontheirown.Thistechnique
isveryeffective.Imightvisualizeaplace,anobject,ora
personjustlongenoughtoreallyseetheimageandthenIlet
go.Ifnothinghappensafteralittlewhile,Idoitagainand
againandsoon.Theseflashesofvisualizationtendtomake
otherflashesstarttohappenthatgraduallygetlongerin
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

157/182

12/25/2016

AdvancedLucidDreaming

duration.ItgetstothepointthatIdropaseedandendup
almostenteringadreambutthencomeout.ThenIseed
anotheroneandalmostenteradreambutthencomeout.
ThenIseedanotheroneandbeforeyouknowitIamcaught
upinatransitionfromthephysicalstateintotheluciddream
state.

Page170
164

ThePowerofSupplements

7.Patience
ThemethodthatIhavedescribeddefinitelyrequires
patience.Alwaysremaincalmandrelaxed.Dontallow
yourselftogetanxiousevenifyouhavebeenlyingawakefar
toolong.Justrelax.Thedreamswillcome.Assoonasyour
patiencewearsthin,youwillundoubtedlystarttalkingto
yourselfandcomplaining.Thiswillfurtherreduceyour
chancesofsuccess.Justliethereandrelaxandthedreams
willcome.
8.Transitioning
Transitioningreferstotheexperienceofmovingfrom
thephysicalstateintothedreamstatewithacontinuous,
unbrokenthreadofconsciousness.Whenyouexperiencea
transition,youdonotloseyouridentitynordoyouloseyour
memorynordoyoulosetrainofthought:notevenforasplit
second.Itisacontinuumofconsciousness.Transitioning
fromthephysicalstateintothedreamstateisoneofthemost
profoundexperiencessomeonecanachieve.Themethodsin
thisbookleadtoWILDs.Wakeinducedluciddreamsinclude
aconscioustransitionfromthephysicalstateintothedream
state.ThistypeoftransitioniswhattheTibetandreamyogis
strivefor.Itisoftenreferredtoasanoutofbodyexperience,
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

158/182

12/25/2016

AdvancedLucidDreaming

anastraljourneyorperhapsaspiritquest.Althoughthe
experienceofthistypeoftransitionisidenticalforallofthese
systems,thebeliefstructuresthatsupportitcanbevery
differentfromoneanother.Luciddreamersbelieveitisa
transitionintoadream.Onceinsidethedreamyoucanbetter
tapintothesubconsciousthatmayholdmanyyettobe

Page171
PreparationandTransitioning

165

discoveredsecrets.TheTibetansbelievethatthetransitionis
arehearsalfordeathsothatonecanlearntomaintain
awarenessafterthephysicallifeceaseswiththehopeof
breakingtheendlesscycleofreincarnation.Theoutofbody
believersperceiveittobeonebodyleavinganotherthe
astralbodybeingofafinertypeofenergywhichhasthe
abilitytowalkthephysicalearthorentertheastralplanes.
Thespiritquestpractitionersbelieveittobeajourneyfor
knowledgeorhealingpurposes,oneinwhichyoumay
encounterancientancestorsorgreatteachersthatpossess
metaphysicabilities.Maybeoneofthemright,maybenoneof
themareright,ormaybeallofthemareright.Idoknowthat
theexperiencewillchangeyourlifeforeverandthatitisatthe
fingertipsofeverybodywhofollowsthemethodsinthisbook.
Althoughtheexperiencecanneverbefully
intellectualized,Ihavelearnedafewtricksofthetradethat
mayassistyou.Thissectionsummarizesthemethodthat
consistentlyworksforme.
i.

Learntorecognizewhenatransitionisaboutto
occur:
Thereareseveralsignsyouwillrecognizeasyou
getmorepractice.Thefirstsignisthatdreamimagery
getsstrongerandlengthier.Whenyouarecontinually
seedingyourvisualization,therecomesapointwhere
theystarttotakeoff.Youarealmostdrawnintothe

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

159/182

12/25/2016

AdvancedLucidDreaming

dreambutthenyoucomeout,thenalmostinagain,
andthenout.Thesecondsignisthatyoumay
experienceintensevibrationsorasensationofsudden

Page172
166

ThePowerofSupplements

acceleration.Bothoftheseexperiencescanbe
overwhelming,especiallyifyoureanovice.Theycan
lastforaminuteormorewhichmayseemlikean
eternity.Myadviceistosimplyenjoytheride.Donttry
tomove.Dontgetscaredorpanicky.Justliethere
andtrytorelax.
ii.

Relax:
Ifyouarenewtothesensationsoftransitioning,
theideaofbeingabletorelaxmayseemalittle
comicalor,attheveryleast,impractical.Howeverif
yougettootense,orstarttopanic,ortrytomove,the
sensationswilljustsuddenlystopandyouwillbelying
inyourbedupsetthatyoumissedagreatopportunity.
Henceyoureallyneedtolearntorelaxduringthe
experience.Hereareafewguidelinesthatmighthelp:
Dontstarttakingtoyourself.Sayingthingslike,
OhmyGod,orHoly$*&@,orevenStaycalm,
isntgoingtohelpyoumakeitintothedreamstate.
Yourbreathingshouldbesmoothandsteady,but
trynottofocusonit.Justdoacausalandpassing
checktomakesureyourbreathingiscalm.
Focusonthesensationsandsoakinthe
experience.Toputitanotherway:Enjoyit.

iii.

Feelthenaturalsensationfirst:
Astheexperienceisendingyoumayfeellikeparts
ofyourbodyarefloating.Itisverycommonformeto
feelasifmylegsarestartingtofloatupwardstowards

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

160/182

12/25/2016

AdvancedLucidDreaming

theceiling.SometimesIalsofeelasthoughmyentire

Page173
PreparationandTransitioning

167

bodyisstartingtorolloverorperhapsonearmis
slowlyrising.Thefeelingisveryauthentic.Thefloating
isgentleasthoughgravityhasjuststoppedaffecting
partofthebody.Thepartofthebodythatisdoingthe
floatingalsofeelstotallyauthentic.Ifyourlegsfeelas
thoughtheyarerisingtowardtheceiling,itisnotas
thoughanimaginarysetoflegsisrisingwhilethe
physicallegslieonthebed.Therearenottwosetsof
legsinthisexperience,onlyonesetexistandthatis
thesetdoingthefloating.Asfarasyourexperienceis
concerned,yourphysicallegsnolongerexist.
iv.

Leadthenaturalsensationaway:
Theinitialfloatingfeelingoccursnaturally.Itisnot
asthoughyoutriedtoimagineit.Itjusthappens.Dont
bringyourattentionbacktophysicalbody.For
example,ifyoufeelyourlegsfloatingup,dontbring
yourattentiondowntothebedwhereyourlegsare
supposedtobeinanefforttoseewhetherornot
yourreallegsarefloating.Doingthiswillmostlikely
endtheexperienceandyouwouldhavemisseda
greatopportunity.Insteadleadyourlegsfurtheraway
inthesamedirectionthattheyfeelliketheyregoing.
Hereiswherethearmsandlegsqigongexercisepays
off.Whileyouwerepracticingthisyoufeltyourlegs
floatingdownontheexhaleandthenguidedthem
backupontheinhale.Nowintheexactsamemanner
asinthatexercise,keepguidingyourfloatinglegs
furtherandfurtherinthesamedirectiontheyare

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

161/182

12/25/2016

AdvancedLucidDreaming

Page174
168

ThePowerofSupplements

floatingin.Sincethelegsarenaturallyattachedtothe
restofthebody,astheymovefurtherawaytheyend
upcarryingtherestofyourbodywiththem(whereat
thispointyourbodyisyourdreambody).Itisreally
thateasy.Forexample,mylegsstarttofloatup
naturallyandIthenIcarrythemupwardsomyentire
bodyispulledupwardfollowingthem.ThenIguide
themdowntothefloorsothatIendupstandinginthe
middleoftheroom.Anotherexample,Ifeelmybody
naturallystarttorollandIcarrythemotionforwardso
thatIrollawayfromwhereIwassleepingandthen
standupinthemiddleoftheroom.
v.

Keepgoing:
Onceyoureout,keepgoing.Thetransitionis
usuallymostlyorpurelytactile.Thismeansyoufeelit
butyoudontseeorhearit.Onceyougetout,your
senseoftouchisvividandalivebutyourothersenses
needtobecleanedupabitbeforeyoucandomuch.
Sinceyoursenseoftouchisallyouarerelyingonat
hispoint,itisagoodideatokeepitgoingbystarting
towalkforward.Asyoudosoyoumaynoticeyour
visionstartingtoevolve.Mineisusuallyveryhazyand
blurryatthispoint.TherearetwoexercisesIdothat
havebeenverysuccessfulinsnappingmyvisioninto
vividfocus.Thefirstexerciseistolookverycloselyat
objectsandtrytoseethesmalldetails.Keepmoving
butkeeplookingatthingsandnoticethetinyfeatures
inthem.Theotherexerciseistojustjumpupand

Page175
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

162/182

12/25/2016

AdvancedLucidDreaming

PreparationandTransitioning

169

downabitwhileyouarelookingatwhateverisinfront
ofyou.Thiskeepsyoumovingbutnotmovingforward
sothatthesameobjectstaysinfrontofyouuntilit
finallysnapsintofocus.Itusuallytakesabout10to20
jumpsbeforemysightisclearandvivid.Atthispoint
youmaynoticethatyouarestandinginyourbedroom
andcanwalkaboutyourhouseatyourleisure.The
detailisincredibleandcanbetotallyconvincingthat
youreallyarewalkingaroundyourphysicalhouse.I
tendtobelieveitisadreamduplicateofthehouse.
ButIwillleaveitforyoutodecideforyourself.Iget
boredwalkingaroundadarkhouseat4AMsoI
usuallyventureoutside.OnceoutsideIeither
consciouslychangemylocationorithappens
spontaneouslyandtheluciddreamgoesonfrom
there.
Anotherformofthistypeofexit,thatisperhaps
easierforthenovicetosuccessfullycomplete,
involvesrotatingyourbody.Onceyoufeelpartofyour
bodystarttofloatinanydirection,guidethatpart
aroundinalargecircularmotionsoyourlegsare
pulledaroundtotheheadboardofthebed,continuing
backthefootboard,backtotheheadboardandsoon.
Whendonecorrectly,thiswillgenerateatotally
authenticsensationofrotation.Youdontneedtoturn
fast,justkeepthemotiongoingforaslongasyoucan.
Whenyoustopyouwillfindthatyouarefullywithin
thedream.

Page176
170

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

163/182

12/25/2016

AdvancedLucidDreaming

23
BreakingDowntheWall
Thereisawallthatdividesthephysicalworldfromthedream
world.Thisdivisionisthefundamentalfeaturethatkeepsusallfrom
enteringtheluciddreamstatereadilyandeasily.Thedivisionis
mysterious,dauntingandhistoricallyhasonlybeencrossedbyafew
luckyortalentedpeople.Theinformationhereinopensupthis
experiencetopracticallyanyonewhoiswillingandabletotry,and
theexperienceallowsustoask,Whatisitthatcreatesthiswallin
thefirstplace?Onepopularansweristhatthiswalliscreatedbya
lossofconsciousnesswhenwegotosleepwesimplylose
consciousnessandtheegoceasestoexist.Ihaveseriousdoubts
aboutthistheory.Inmyviewitisnotconsciousnessthatfailsus,itis
ourmemory.Nomemoryresultsinalossofidentitybutnotlackof
consciousness.Basedonpersonalexperience,Idonotagreewith
eitherdreamtheorypresentedinthebeginningofthisbook.Ibelieve
wearecontinuallydreamingthroughoutthenight.Ibelieveour
consciousnessisalwayscontinuousduringeveryinstantofour
existence.Ibelieveitisourmemorythatbreaksdownduringsleep
leavinguswithalmostcompleteamnesia.Itisnocoincidencethat
thebestluciddreamtriggersarepowerfulmemoryboosters.Todays
dreamtheoriesarebasedonthepremisethatwhenpeopleare
awakenedfromdeepsleep,theydontremembertheirdreams.

Page177
BreakingDowntheWall

171

Researchersextrapolatethistomeanthattheydontdream
duringdeepsleep,asiftheabilitytorememberandtheabilityto
experiencewerethesamething.TheTibetansbelieveitispossible
toholdontoconsciousnessduringdeepsleepandtoactually
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

164/182

12/25/2016

AdvancedLucidDreaming

rememberitwhenyouwakeup.Ifwearetobecomethebestthatwe
canbecomewithourluciddreamdevelopment,wemustlearnhowto
breakdownthiswall.Ihavedevelopedanexercisethatisdesigned
todojustthat.
Mostpeoplerarelyremembertheirdreams.Nightafternight
weenteradreamworldfilledwithadventureandmystery,yet
morningaftermorningwehaveabsolutelynorecollectionofit.Most
luciddreamenthusiastskeepadreamjournaltotrytobreakdown
thiswall.TryingtorememberyourdreamsdoeshelpandIdokeep
anactiveanduptodatedreamjournal.Thereisanotherexercise
however,thatisatleasttentimesasbeneficial.Thewallthatdivides
thedreamfromthephysicalistwosidedandjustasitisdifficultto
rememberyourdreamsinthephysicalitisequallydifficultto
rememberthephysicalinyourdreams.
AtthebeginningofeveryluciddreamIpracticeafewminutes
ofphysicalrecall.Ihavefoundthat,whenusingthesupplement
approachtoluciddreaming,factualkindsofinformationareeasyto
recall,mucheasierthanwhennosupplementsareused.Thisis
probablybecausebothacetylcholineandnorepinephrineboost
memoryandthebestluciddreamtriggerseitherboostacetylcholine
ornorepinephrinelevelswithinthebrain.Informationlikemyname,
address,familymembersnamesandbirthdays,evenmycreditcard
numberareeasilyshoutedout.Thechallengecomeswhendealing
withexperientialmemories.TryingtorememberanythingthatIdid

Page178
172

ThePowerofSupplements

thatdayismuchmoredifficult.Askyourselfwhatyouhadfor
breakfastandyoumayfindyourselfstandingthereinthedreamwith
yourmouthhangingopensayinguhhhhhhhh.Thisabilitycanbe
drasticallyimprovedwithpractice,andasitimprovesyouwillfind
yourselfhavingmoreandmorehighlevelluciddreams,evenon
nightswhennosupplementsareused.TheapproachIuseistothink
aboutaspecificeventthatIwanttorememberasIamgettingready
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

165/182

12/25/2016

AdvancedLucidDreaming

toenteraluciddream.Ipurposelydonttrytorememberorrehearse
allofthedetailsIjusttrytoplacetheeventfirmlyinmymind.Then
whenIgettothepointthatIamseedingmyvisualization,Idosoby
givingmyselfshortvisualsnapshotsofdifferentpartsofthememory.
AfterIenterthelucidstateIkeepseedingthedreamwiththesame
kindofvisualsnapshots.Thistransformsthedreamintoa
reenactmentofthememory.Itisanamazingexperience.Ifleft
unattendedthedreamwillnaturallygooffonsometangentbutifyou
keepdroppingtheseedsitcansnapthedreambacktoactingoutthe
memory.Thisundeniablyleadstothebestrecallofanyevent
becauseyouactuallyreliveitinsteadofjustrememberit.Doingthis
exerciseonaregularbasisactivelybreaksdownthewallthat
separatesthetwostates.Youwillfindthatyouareremembering
dreamsingreatdetailevenonthenightsthatyoudontuse
supplementsandyouwillfindthatyoucanstarttorecallmoreand
moreofthedetailsfromyourphysicallifewhileinthedream.When
youreallystarttorememberyourphysicallifewhileindream,you
naturallystarttohaveluciddreamsmuchmoreoften.Itbecomes
easytorecognizethedreamstate.Thisexercisealsohasa
significantimpactondreamrecall.Understandthatvividsensory
experienceandvividrecallarenotsynonymous.Performingthis

Page179
BreakingDowntheWall

173

exercisewhileyouarealsoactivelytryingtorememberyourdreams
whenyouawake,actstobreakdownthewallfrombothsidesand
oncethewallstartstofall,luciditygoeswayup.

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

166/182

12/25/2016

AdvancedLucidDreaming

Page180
174

24
KeepinganUptoDateLog
Beyondjustkeepingadreamjournal,youshouldkeepanupto
datelogthatdocumentsthedetailsofeachattemptyoumakeat
becominglucid.Afterjustadozenorsohighlevelluciddreams,you
cangainagreatmanyinsightsbygoingoverthedetailsofeachtrial.
Thelogwillhighlightstatisticaltrendsandshowyouwhat
combinationsworkthebestandhowthevariouscombinationsaffect
theluciddream.Irecommendthatyouincludethefollowing
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

167/182

12/25/2016

AdvancedLucidDreaming

information:
Date
Thesupplementsthatyoutook
Thedoseofeachsupplement
Thetimethatyoutookthesupplements
Howmanyhoursofsleepyouhadbeforeyoutookeach
supplement
Whetherornotyouweredreamingwhenyouwokeuptotake
thesupplements
Anyotherimportantnotesaboutthesupplements
Whatexercisesyoudidwhenyoufirstlaydownaftertaking
thesupplements
Howlongittooktofalltobacktosleeporenterthelucid
dream
Whatyoursleeppositionwas.
Detailsaboutthetransitionintothedream

Page181
KeepinganUptoDateLog

175

Didyourfeelaccelerations,vibrations,orfloatiness.Ifsorank
theintensity
Ranktheresultingdreamquality
Rankyourabilitytorecallthedream
Rankyourvisualvividness
Rankyourtactilevividness
Rankyourauditoryvividness
Rankyourparticipationlevel(i.e.didyoujustobservethe
dreamorwereyouactivelyinvolved)
Rankyourluciditylevel
WasitaDILDoraWILD
Rankyourabilitytocontrolyourreasoningwithinthedream.
Rankyourabilitytocontrolyouremotionswithinthedream.
Rankyourabilitytocontrolyourwillwithinthedream
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

168/182

12/25/2016

AdvancedLucidDreaming

Noteiftherewereanyphysicalsideeffects
Noteiftherewereanymentalsideeffects
Noteiftherewereanyemotionalsideeffects(crying,
laughing,etc)
Listsomegeneralnotesabouttheexperience
Summarizethedream
Listanylessonslearnedortheoriesthatcameoutofthe
dream.

Althoughthelistmayseemextensive,itonlytakesaboutten
totwentyminutestofilloutifyousetupasimplespreadsheet.Thisis
agreatwaytoarchiveyourdevelopmentthatgoesfarbeyondjust
keepingadreamjournal.

Page182
176

25
WhereDoIgoFromHere?
Hopefullythisbookwillopenuptheworldofhighlevellucid
dreamingtoamuchwideraudience.Butnowthatyoucanhavehigh
levelluciddreams,thenwhat?Isadreamjustadreamoristhere
moretoitthanthat?Canweuncoverandtapintoourownhidden
potentials?Canwefindanswersconcerninglife,death,andwhy
werehere?Thepotentialsareenormousbuttheterritoryisalmost
entirelyunmapped.Oncehighlevelluciddreamsbecomecommon
place,thentherealadvancementwillstarttohappen.Canweheal
ourselvesorothersfromwithinadream?Canwepurposefullyenter
anotherpersonsdream?Canwebringbackknowledgefromthe
dreamstateintothephysicalstate?Thenextseveraldecadesshould
provetobeenormouslyexcitingandrichwithdiscovery.Ilook
forwardtobeingpartofthatexperienceandIhopeyouwillto.
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

169/182

12/25/2016

AdvancedLucidDreaming

Pleasevisitwww.AdvancedLD.comandletmeknowhowyou
aredoingandfeelfreetoaskanyquestionsthatyoumighthave.
Alsowatchthewebsitefornewdiscoveriesconcerningthe
supplementapproachandIinviteyoujoinsomeoftheresearch
studiessponsoredonthesite.Ifyouneedhelplocatinganyofthe
supplements

referred

to

in

this

book,

visit

www.AdvancedLD.com\links.htmlandfindlinkstoallofthe
distributorsthatIregularlyuseplusonesthathavebeen
recommendedtome.

Page183
WhereDoIgoFromHere?

177

Ifyouenjoyedthisbook,watchforupcomingpublicationsthat
willfocusonadvancedluciddreamingtechniquesandapplications.
Alsofeelfreetoemailmewithquestionsandcomments.

GoodLucktoAll!
ThomasYuschak
tyuschak@AdvancedLD.com

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

170/182

12/25/2016

AdvancedLucidDreaming

Page184
178

References
1.TheoreticalBackgroundReferences
a.SleepCycle
i.http://www.sleepdisorderchannel.com/stages/
ii.http://en.wikipedia.org/wiki/Sleep#Sleep_physi
ology

b.REMRebound
c.DreamTheories
i.http://www.psychoanalysis.org.uk/solms4.htm
ii.http://psych.ucsc.edu/dreams/Library/domhoff_
2001a.html
iii.http://www.bbsonline.org/Preprints/OldArchive/
bbs.solms.html
iv.http://serendip.brynmawr.edu/bb/neuro/neuro0
1/web1/MillerJ.html
d.Neurotransmitters
i.http://web.umr.edu/~rhall/neuroscience/03_sle
ep/sleepneuro.pdf
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

171/182

12/25/2016

AdvancedLucidDreaming

ii.http://www.ifisiol.unam.mx/Brain/trnsmt.htm
iii.http://www.benbest.com/science/anatmind/ana
tmd10.html
iv.http://bipolar.about.com/cs/neurotrans/l/aa0007
_msngrs.htm

Page185
179

Reference

v.http://thedea.org/yourbrain.html
vi.http://www.neurosci.pharm.utoledo.edu/MBC3
320/nicotinic.htm
vii.http://www.raysahelian.com/dopamine.html
2.IndividualSupplementReferences
a.Galantamine
i.http://www.galantamine.cc/research/galantami
neresearch38.htm
ii.http://www.galantamine.cc/galantamine12.htm
iii.http://www.galantamine.cc/galantamine6.htm
iv.http://www.galantamine.cc/galantamine11.htm
v.http://www.galantamine.cc/research/galantami
neresearch27.htm
vi.http://www.galantamine.cc/research/galantami
neresearch11.htm
vii.http://www.galantamine.cc/galantamine17.htm
viii.http://www.galantamine.cc/galantamine24.htm
ix.http://www.galantamine.cc/galantamine10.htm
x.http://www.birf.info/home/bi
tools/qlinks_memo.html#Galantamine
xi.http://www.galantamine.cc/galantamine9.htm
b.GPC(Glycerophosphocholine)
i.http://www.dockidd.com/pdf2/GPCMindBody,4
_14_05.pdf
ii.http://www.dockidd.com/pdf2/GPCasInjectable,
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

172/182

12/25/2016

AdvancedLucidDreaming

4_14_05.pdf
iii.http://www.pdrhealth.com/drug_info/nmdrugpro
files/nutsupdrugs/lal_0153.shtml

Page186
180

ThePowerofSupplements

iv.http://www.lef.org/magazine/mag2003/jul2003_
abs_03.html
c.Nicotine
i.http://www.medsafe.govt.nz/profs/Datasheet/n/
Nicotrolpatch.htm
ii.http://www.quitworks.org/docs/PharmoGuide_s
mall.pdf
iii.http://science.howstuffworks.com/nicotine4.htm
iv.http://www.as.uky.edu/Biology/faculty/cooper/B
io401G/nicotineDesen.pdf
v.http://cds.ismrm.org/ismrm
2001/PDF2/0538.pdf
vi.http://www.blackwell
synergy.com/doi/pdf/10.1046/j.1471
4159.1994.63020561.x
vii.http://jp.physoc.org/cgi/content/abstract/553/3/
857
viii.http://www.drugs.com/Nicotine/index.html
ix.http://www.trdrp.org/research/PageGrant.asp?
grant_id=1853
d.Piracetam
i.http://www.bulknutrition.com/?ingredients_id=4
1
ii.http://www.bulknutrition.com/a87_Brain_Food_
_Piracetam_II.html
iii.http://www.ceri.com/noot.htm
iv.http://emc.medicines.org.uk/emc/assets/c/html/
http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

173/182

12/25/2016

AdvancedLucidDreaming

displaydoc.asp?documentid=16509

Page187
181

Reference

v.http://www.antiaging
systems.com/a2z/nootropics.htm
vi.http://www.ceri.com/pira97.htm
vii.http://www.lef.org/prod_hp/abstracts/piracetam
.html
viii.http://www.piracetam.com/
ix.http://www.worldhealth.net/p/1010,2056.html
x.http://www.piracetam.com/piracetam12.htm
xi.http://www.piracetam.com/piracetam26.htm
xii.http://www.piracetam.com/piracetam11.htm
e.MucunaPruriens&LDopa
i.http://www.parkinson.org/site/pp.asp?c=9dJFJ
LPwB&b=184301
ii.http://www.raintree.com/velvetbean.htm
iii.http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?c
md=Retrieve&db=PubMed&list_uids=1547820
6&dopt=Abstract
iv.http://www.healthyeatingclub.com/APJCN/Volu
me2/vol2.2/kempster.htm
v.http://www.neuroskills.com/tbi/motor.shtml
vi.http://www.neurology.org/cgi/content/abstract/6
1/7/1008
vii.http://www.raysahelian.com/mucunapruriens.ht
ml
viii.http://www3.interscience.wiley.com/cgi
bin/abstract/109672614/ABSTRACT?CRETRY
=1&SRETRY=0

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

174/182

12/25/2016

AdvancedLucidDreaming

Page188
182

ThePowerofSupplements

f.Yohimbine
i.http://en.wikipedia.org/wiki/Norepinephrine
ii.http://www.biopsychiatry.com/yohimin.htm
iii.http://www.biopsychiatry.com/yohimbine.htm
iv.http://www.biopsychiatry.com/norad.htm
v.http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?c
md=Retrieve&db=PubMed&list_uids=6100759
&dopt=Abstract
vi.http://www.raysahelian.com/yohimbe.html
vii.http://jcp.sagepub.com/cgi/content/abstract/34/
5/418
viii.http://www.general
anaesthesia.com/alpha2.html
g.5HTP(5hydroxytryptophan)
i.http://www.raysahelian.com/5htp.html
ii.http://www.healthyplace.com/communities/depr
ession/treatment/alternative/brain_chemistry_2
.asp
iii.http://www.biopsychiatry.com/5htp.html
iv.http://web.mit.edu/dick/www/pdf/989.pdf
v.http://www.life
enhancement.com/article_template.asp?ID=31
4
vi.http://www.holistic
online.com/remedies/Sleep/sleep_ins_melatoni
nand5HTP.htm
vii.http://www.1fast400.com/i60_5HTP.html

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

175/182

12/25/2016

Page189

AdvancedLucidDreaming

183

Reference

h.Melatonin
i.http://web.mit.edu/newsoffice/1999/melatonin
1103.html
ii.http://www.holistic
online.com/remedies/Sleep/sleep_ins_melatoni
nand5HTP.htm
iii.http://www.charm.net/~profpan/armitage.html
iv.http://jcem.endojournals.org/cgi/content/abstra
ct/89/1/128
v.http://www.raysahelian.com/melatonin.html
3.Desensitizationandtolerance
a.http://cds.ismrm.org/ismrm2001/PDF2/0538.pdf
b.http://www.as.uky.edu/Biology/faculty/cooper/Bio401G
/nicotineDesen.pdf
c.http://www.blackwell
synergy.com/doi/pdf/10.1046/j.1471
4159.1994.63020561.x
d.http://www.currentseparations.com/issues/152/cs15
2d.pdf
e.http://jp.physoc.org/cgi/content/abstract/553/3/857
f.http://www.trdrp.org/research/PageGrant.asp?grant_id
=1853
g.http://www.piracetam.com/piracetam12.htm
4.Misc
a.http://members.aol.com/atracyphd/syndrome.htm
b.http://www.clevelandclinic.org/health/health
info/docs/0900/0929.asp?index=5580&src=news

Page190

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

176/182

12/25/2016

AdvancedLucidDreaming

Index
5
5htp,33,49,100,101,102,103,104,
105,107,108,122,184
5HTP,2,33,49,63,100,101,102,103,
104,105,107,123,150,152,184
5hydroxytryptophan,2,33,100,184

A
acceleration,37,72,118,130,168
accelerations,10,117,140,177
Acetyl,49,72,73
acetylcholine,23,27,33,38,39,40,42,
43,48,50,51,55,60,61,64,67,69,
72,75,76,79,81,82,84,96,107,
122,126,130,132,133,136,173
Acetylcholine,26,27,28,38,39,40,41,
45,49,68,73,81,144
Acetylcholinesterase,60,61
ACh,23,26,38,39,40,41,57,60,61,
82,127,132,136
AChagonist,42
AChprecursors,42
AChE,42,55,57,60,61,64,69
AChEinhibitor,55,57,60,64
AChEinhibitors,42,60,69
ADD,29,42,52
Adenosine,57
ADHD,42
adrenaline,94
agonist,42,48,51,60,61,75,76,82
alert,19,34,41,43,111
alertness,28,95
alfoscerate,68
alpha2,44,52,94,95,99
alpha2adrenergicblockers,44,52
Alpha2antagonists,52
alpha2receptorblockers,52
alpha2receptors,94,95
alphaGPC,68
alphoscerate,68

Alzheimers,29,38,39,52,60,63,69
Amphetamines,43
Aniracetam,86
antagonist,48,51,94,95,99
anxiety,29,96,98,100
appetite,29,63
attention,13,42,44,45,97,129,157,
160,163,169
awakestate,10
Ayurveda,88

B
balancedsleep,104,161
bind,51
bipolardisorder,29
Bitartrate,66,69,129
bloodbrainbarrier,33,37,47,48,49,
75,94,103,123
BloodBrainBarrier,47
bloodbrainbarrier,33
brain,13,18,19,23,24,25,26,28,29,
33,35,36,37,38,40,41,42,43,44,
47,48,49,50,51,52,53,55,60,61,
75,76,81,85,88,89,93,94,95,99,
100,101,103,122,127,132,133,
134,135,136,137,173,184
brainlesions,24
brainstemdreamtheory,22
BreakingDowntheWall,3,172

C
Caffeine,57
Carbidopa,89,92
CDPcholine,50
CDPcholine,67,68
CDPCholine,66
centralnervoussystem,33,37
cerebralactivation,22,25
cerebralactivationdreamtheory,22
chemical,21,28,37,42,51,52,57,61,
88,89

Page191
Index
chemicals,19,28,101
choline,49,50,66,68,72
Choline,2,49,50,64,66,67,69,70,71,
72,73,128,129,139,142,143,144,
146,147,148
CholineBitartrate,66,69,72,128
CholineCitrate,66,69,128

Dreamenhancementthreshold,58
dreamjournal,173,176,177
dreamrecall,102,136,141,174
dreamstate,10,25,45,61,129,157,
158,166,168,174,178
dreamtheory,22,172
dreams,8,9,11,15,23,31,32,35,36,

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

177/182

12/25/2016

AdvancedLucidDreaming

Cholinesalts,66,69,73
CholineSupplements,2,66
cholinergic,22,23,25,40,62,63,81,
85,86,135
cholinergicdreamtheory,22
cholinergictheory,22,23
circadianrhythm,105
cognition,23
concentration,54,55,76,77,92,101,
133,138
concentrationcurve,55
ConcentrationCurve,55,61,69,76,
83,89,95,101,106
confidence,36,45,88,91,114,124
confident,34,36,111
conflict,32,40,60,122
consciousness,10,40,45,61,114,
117,166,172
creativity,13,34

D
deepsleep,17,18,20,30,31,32,40,
43,60,63,122,172
dementia,38
depression,29,35,52,100,103,108,
184
desensitization,54,57,58,62,64,65,
71,75,76,79,81,82,84,85,86,120,
125,127,132,133,134,135,136,
137,140
DILD,9,40,114,127,177
DILDs,9,40,71,73,114
donezepil,69
dopamine,24,26,27,30,34,35,36,37,
43,44,45,47,48,50,52,54,88,89,
90,91,92,93,181
Dopamine,28,34,35,36,37,45,50,
88,90
dopaminelevels,34,35,36,38,47,88
dopaminergic,22,23,25,26,35,37
dopaminergicdreamtheory,22
dopaminergictheory,23,25
Dosage,64,72,78,85,92,98,103,108

40,41,43,58,62,65,70,72,77,78,
81,82,84,90,96,102,114,122,124,
134,166,172,173,174,178,180
drug,13,24,30,34,35,53,55,56,181
druginteractions,30,53,56
dyskinesias,92

E
earplugs,160
eliminationhalflife,55,68,69,104
eliminationhalflife,54,55,61,62,70,
77,83,89,90,95,96,101,106,107
Eliminationhalflife,54
emotionalstate,28,36
emotions,10,15,38,58,177
Epinephrine,50
ExtendedPlayTrigger,143,144

F
fear,11,36,91,111,112
flightorfight,42
floating,10,37,115,116,130,164,168,
169
fly,37,111
flying,37,91,93
focus,7,12,13,29,30,38,42,45,95,
97,115,140,157,165,168,170,179
focused,43,140
forebrain,23,24,25
Forebraindreamtheory,22
frequency,7,8,11,24,25,33,56,84,
104,120
frontallobotomy,24

G
galantamine,61,62,63,65,68,71,72,
73,75,77,78,81,82,84,86,91,93,
97,98,99,101,104,106,126,127,
128,129,131,132,133,135,136,
138,139,142,181

Page192
ThePowerofSupplements
Galantamine,2,52,55,60,61,62,63,
64,84,133,136,181
gastrointestinaldistress,103
Glutamate,3
Glycerophosphocholine,68,181
glycerylphosphorylcholine,68
GPC,50,63,66,67,68,69,70,71,72,
73,75,77,79,82,84,86,126,127,
139,142,144,145,147,148,181

157,160,161,163,165,171,172,
173,176
luciddreamtriggers,93,104,122,126,
172,173
luciddreaming,4,7,8,10,11,12,13,
15,26,27,32,40,43,44,59,64,71,
73,75,76,79,81,84,88,91,95,102,
114,117,119,120,121,122,127,
156,159,160,173,178
luciddreams,4,7,8,9,12,20,21,27,
32,36,40,43,68,71,72,73,75,78,

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

178/182

12/25/2016

AdvancedLucidDreaming

headache,30,78,85,86,108,137
headaches,29,100
health,4,6,8,20,29,46,120,121,160,
185
highlevel,4,6,7,9,10,11,27,32,36,
68,82,99,100,120,121,123,124,
125,131,132,139,161,174,176,
178
HuperzineA,64

I
inhibitors,42,52,53
insomnia,29,30,31,72,91,97,99,107
Insomnia,153

L
Lalphaglycerylphosphorylcholine,68
Ldopa,24,35,37,50,54,88,89,90,
91,92,93
LDopa,50,183
LDS,4,5
Lecithin,66
lesions,24
LicoriceRoot,53
log,176
longduration,7,9,12,26
longtermdesensitization,133
luciddream,4,6,7,9,10,20,21,23,
26,27,29,32,33,36,39,40,42,43,
44,45,46,47,48,50,51,52,53,54,
56,57,59,62,63,65,67,68,73,77,
78,81,82,83,84,86,90,91,92,93,
95,97,98,99,100,102,104,107,
108,114,115,117,121,122,123,
124,125,126,127,128,130,133,
135,136,139,140,142,155,156,

79,88,99,100,102,114,116,120,
121,122,123,125,131,132,134,
139,140,161,164,166,174,176,
178
lucidity,6,27,41,58,59,61,63,106,
157,175,177
luciditytrigger,27

M
MAO,52,94
MAOinhibitors,52
MechanismofAction,48,61,69,76,
89,95,101,106
mechanisms,22,24,47,48,53
melatonin,100,105,106,107,108,128,
184,185
Melatonin,2,33,49,105,106,107,108,
150,153,185
memories,11,38,43,97,99,130,136,
173
memory,6,13,23,31,38,39,40,41,
42,45,60,63,68,95,96,97,113,
128,166,172,173
MILD,2,4
mind,3,21,27,28,30,39,41,47,82,
94,97,98,100,111,115,116,121,
122,123,129,130,134,139,159,
160,161,163,174
Monoamineoxidase,52
mood,13,29,95,134
Mooddisorders,34
motivation,13,34,45,88
Mucunapruriens,89,91
MucunaPruriens,2,37,50,88,89,90,
91,92,93,183
MultipleTrigger,2,142,148
musclecramps,63
muscleparalysis,38
musclespasms,38

Page193
Index
music,71,72,78,144

N
nausea,30,72,78,91,93,103
Nausea,63
neurons,19,23,35,136
neuroscience,8,15,180
Neuroscience,15
neurotransmitter,19,23,26,27,28,38,
45,47,48,51,52,53,57,134
neurotransmitters,13,19,23,26,27,
28,29,31,42,43,44,47,48,51,52,
53,56,57,135
Neurotransmitters,2,19,28,51,180
Nicotine,2,13,51,63,71,75,76,77,

PassionFlower,53
peakplasmalevels,54,68,71,76,77,
89,101,127
phenylalanine,38,50
Phenylalanine,50
phosphatidylcholine,49,50,73
physicalstate,45,157,158,163,165,
166,178
physicalworld,114,118,156,158,172
pinealgland,105
piracetam,62,71,73,81,82,83,85,86,
135,136,137,138,183,185
Piracetam,2,62,65,73,79,81,82,83,
84,85,86,135,136,137,138,148,
150,151,152,182
plasmaconcentration,54

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

179/182

12/25/2016

AdvancedLucidDreaming

78,79,82,84,86,126,127,142,145,
146,148,182
nicotinegum,79
nicotinepatches,79
nicotinicreceptors,82
nightmare,36
nightmares,90
nightmarish,35,36,62,71
nonREMsleep,17,26,30,31,32,39,
102,104,123
nootropics,84,183
Nootropics,81
noradrenalin,42,94
norepinephrine,27,30,42,43,44,48,
50,52,94,95,98,99,107,122,126,
127,130,132,173
Norepinephrine,28,42,43,44,45,50,
51,97,184
Nutmeg,53

O
OBE,10
orally,33,37,53,76
outofbodyexperiences,4,6,9,116
overflow,42,44,94,98
Overflow,94
oxidativestress,35
Oxiracetam,86

P
Panteteine,73
Parkinsonsdisease,24,34,35,90
Parkinsonian,35

poison,38
PowerofReason,146,147
precursor,33,37,48,49,50,54,57,67,
69,88,89,94,100,101,104,106,
127
precursors,38,42,48,49,50,53
prefrontalleucotomy,24
PrimaryTrigger,2,126,142,143
Prozac,30
psychiatricdisorders,34

Q
qigong,155,163,169
qualityofsleep,13,32,45,122

R
racetams,86
receptor,51,52,81
relax,130,166,168
relaxation,29,104
REM,2,15,17,18,19,20,21,22,23,
25,26,29,30,31,32,33,35,38,39,
40,43,44,45,53,60,64,91,100,
102,104,105,106,107,108,121,
122,180
REMdreamtheory,22
REMrebound,15,21,31,32,45,53,
100,102,104,107
REMsleep,17,18,21,22,24,25,30,
31,32,33,35,38,39,43,44,104,
123
reuptakeinhibitor,52
reuptakeinhibitor,48

Page194
ThePowerofSupplements
Ritalin,42

S
schizophrenia,29
Schizophrenia,34
seededvisualization,165
Seededvisualizations,165
sensation,118,130,164,167,168,169,
171
senses,11,28,160,170
serotonin,23,27,29,30,31,32,33,35,
39,43,44,47,48,49,52,100,101,
102,103,104,105,106,108,122
Serotonin,26,28,29,30,31,32,33,39,
44,49,53,103,106
serotoninsyndrome,30,103
sideeffects,51,56,57,63,64,69,71,
75,78,79,85,86,89,92,94,98,103,
108,121,127,128,133,134,177
SideEffects,56,63,71,78,84,91,98,

suppressREMsleep,21
suppressed,21,30,31,38,106,107,
122

T
tactileexercise,163
tactileexercises,164
tactilesensation,117
theories,8,15,22,26,35,172,177
therapeuticdose,55
therapeuticindex,56
TherapeuticIndex,56
timetopeakplasmalevel,54,55
Timetopeakplasmalevels,53
tolerance,54,57,58,62,64,65,84,85,
86,120,125,131,132,133,134,139,
140,185
Tolerance,2,57,132
toxic,56,75,79
Toxicity,56

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

180/182

12/25/2016

AdvancedLucidDreaming

103,108
sleep,8,13,15,17,18,19,20,21,22,
23,24,25,26,27,28,29,30,31,32,
33,35,38,39,40,41,43,44,45,57,
60,63,65,68,71,73,78,96,98,100,
101,102,104,105,106,107,108,
120,121,122,123,124,127,129,
130,132,140,160,161,163,165,
172,176,180,184,185
sleepcycle,15,60
SoundtrackTrigger,145,146
spinning,37,113,164
St.JohnsWort,30,53,103
stagesofsleep,19,39,60,122
strategy,27,120,133
supplement,4,5,6,7,8,11,12,32,33,
37,39,40,44,49,50,53,54,55,58,
59,71,72,73,77,88,93,98,103,
107,114,122,123,128,133,135,
139,163,173,176
supplements,4,6,7,8,9,11,12,13,
15,27,30,31,32,33,37,40,41,43,
44,46,47,48,49,50,52,53,54,56,
57,58,66,68,76,78,84,86,88,91,
92,96,97,101,102,106,107,108,
120,121,122,124,125,126,127,
132,134,135,138,139,140,163,
164,173,176
suppress,21,26,33,81,91,100,104,
105,106,108,121,122

transition,10,17,41,114,115,117,
118,123,124,129,130,144,163,
165,166,167,170,176
transitions,115,116,119,130
transmitter,29
TrifectaTrigger,147,148
trigger,13,27,36,40,42,43,45,58,59,
61,63,65,68,71,73,75,78,91,93,
97,98,99,102,104,106,122,126,
128,131,133,136,139,142,143,
145,146,147,150,151,152,153
triggers,59,91,124
tryptophan,33
Tryptophan,33,49
tyrosine,38,50
Tyrosine,50

V
vibration,118,130
vibrations,10,130,167,177
vision,157,170
visualize,164,165
vitaminB5,49,72
VitaminB5,49,73
vitaminB6,93,103
vivid,19,21,26,31,34,35,40,43,62,
64,70,90,93,102,104,105,107,
108,112,130,157,170,174
vividdream,21,26,40,104,108

Page195
Index
vividdreams,19,31,34,64,90,93,
102,105,107
vividness,6,7,10,24,31,58,77,96,
102,107,177

W
wakefulness,17,19,27,29,33,43,60,
124,127,160
WBTB,2
weightloss,63
WILD,9,41,114,127,160,177

WILDs,9,40,61,71,73,114,115,116,
118,166
workingmemory,42

Y
YohimbeBark,94,98
yohimbine,71,94,96,97,98,101,106,
126,139,184
Yohimbine,2,44,52,63,94,95,96,97,
98,99,126,133,184

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

181/182

12/25/2016

AdvancedLucidDreaming

Page196

http://webcache.googleusercontent.com/search?q=cache:4oBcBiOiBkgJ:www.cortexel.us/awesome/uppers/Advanced_Lucid_DreamingThe_Power_

182/182