You are on page 1of 129

Peran Keluarga Dalam Perkembangan Pendidikan Anak

Melihat fenomena sekarang ini keluarga masa kini sangat berbeda dengan keluarga jaman dulu. Dalam hubungan
keluarga, semua orang mengalami perubahan yang sangat hebat khususnya mereka yang tinggal dikota. Gambaran
mengenai ikatan dan fungsi keluarga sangat berbeda antara keluarga yang berada di tengah segala kemewahan materi
dengan keluarga di daerah yang belum mengalami dan menikmati hasil kemajuan IPTEK.
Keluarga jaman dulu yang belum terpengaruh penggantian tenaga manusia dengan tenaga mesin masih memiliki
banyak fungsinya dan ikatan kekeluarganya sangat kuat. Masing-masing dalam anggota keluarga mempunyai peranan
yang sangat penting dalam roda kehidupan serta dibutuhkan oleh anggota lainya. Sebaliknya keluarga masa kini sudah
banyak kehilangan fungsi dan artinya. Fungsi pendidikan sudah diserahkan pada lembaga-lembaga pendidikan seperti
sekolah. Sehingga tugas orang tua dalam hal memperkembangkan segi intelek anak menjadi jauh lebih ringan.
Hal itu disebabkan peralatan yang serba modern dan mengganti tenaga manusia dengan tenaga mesin sehingga
menimbulkan tenaga manusia tidak dibutuhkan lagi. Misalnya orang tua memantau anaknya cukup melalui handphone
atau tidak secara langsung. Sehingga kesatuan dan keutuhan dalam keluarga dianggap sebagai bayangan saja.
Hubungan antar pribadi dalam keluarga semakin jauh dan melemah.
Padahal keutuhan dalam keluarga dan keserasian yang menguasai dirumah merupakan salah satu faktor penting.
Demikian pula tokoh ayah dan ibu dalam rumah sebagai pengisi pendidikan yang pertama harus melakukan tugas ini
dengan penuh tanggung jawab dalam suasana kasih sayang antara pengasuh (orang tua) dengan yang diasuh (anak).
Bila lingkungan si anak bertambah luas, maka lebih banyak tokoh yang akan menjadi obyek peniruan dalam rangka
pengisian pendidikanya itu. Apabila suatu lingkungan sulit untuk dikendalikan pengaruhya terhadap perkembangan si
anak. Maka keluarga harus mencari lingkungan lain yang diperkirakan menguntungkan dan tidak akan menyesatkan.
Tetapi lebih efektif adalah meletakkan dasar-dasar yang kuat dalam diri anak tentang pendidikan yang baik.
Keluarga dalam hal ini mempunyai fungsi tidak hanya sebagai pelaku penerus keturunan saja. Namun fungsi keluarga
sebagai lingkungan pendidikan yang pertama dan utama karena anak mengenal pendidikan pertama kali adalah di
lingkungan keluarga (Sayekti, 1980:21). Dalam lingkungan keluarga segala sikap dan tingkah laku kedua orang tua
sangat berpengaruh terhadap perkembangan anak karena ayah dan ibu merupakan pendidikan dalam kehidupan nyata.
Tingkah laku orang tua akan diamati anak tidak sebagai teori melainkan sebagai pengalaman bagi anak yang akan
mempengaruhi sikap dan tingkah laku anak.
Pendidikan dalam keluarga ini menjadi dasar bagi perkembangan dan pendidikan pada saat berikutnya. Di mana
pendidikan dalam keluarga ini meliputi pendidikan yang disengaja, misalnya tingkah laku orang tua, hubungan orang
tua, suasana keluarga, tanpa disadari lebih berpengaruh bagi jiwa anak daripada pendidikan yang disengaja. Dengan
demikian keluarga mempunyai peranan amat penting dan merupakan titik tolak bagi pendidikan selanjutnya.
Dengan pendidikan yang utuh tersebut akan mengembangkan kualitas kepribadian anak dan mampu
mengaktualisasikan potensi-potensi dirinya secara menyeluruh. Dan kualitas sumberdaya manusia ( SDM ) yang
demikian sebenarnya yang dibutuhkan sekarang dan masa datang, yakni kualitas sumberdaya manusia yang meliputi ;
kreatifitas yang kuat, produktifitas yang tinggi, kepribadian yang tangguh, kesadaran sosial yang besar, keimanan dan
ketaqwaan kepada Tuhan Yang Maha Esa ( Muhammad Tholchah Hasan 1990 : 43 ).
Dasar kepribadian seseorang anak terbentuk sebagai hasil perpaduan antara warisan sifat, bakat orang tua dan
lingkungan di mana dia berada dan berkembang. Lingkungan pertama yang mula-mula memberikan pengaruh yang
dalam adalah lingkungan keluarganya sendiri.
Dari anggota keluarga tersebut yaitu ayah, ibu, dan saudara-saudaranya, anak memperoleh segala kemampuan dasar
baik intelektual dan sosial. Kepribadian yang terbentuk secara tidak wajar, tidak matang, akan menyebabkan
timbulnya kekacauan dalam kepribadian anak. Sehingga bimbingan orang tua terhadap anaknya nampak jelas terlihat
arti hubungan orang tua dengan anak.

Keluarga sebagai wadah berlangsungnya sosialisasi. Proses sosialisasi yaitu proses dimana anggota-anggota keluarga
mendapat pendidikan untuk mengenal, memahami, mentaati dan menghargai kaidah-kaidah serta nilai-nilai yang
berlaku (Soejono Soekanto, 1990:2).
Proses sosialisasi menurut Vembrianto adalah sebagai berikut:
1.
Proses sosialisasi adalah proses belajar yaitu proses akomodasi, dimana individu menahan, mengubah impulsimpuls dalam dirinya danmengambil opera cara hidup atau kehidupan masyarakat.
2 Dalam proses sosialisasi individu mempelajari kebiasaan. Sikap, ide-ide, pola-pola, nilai, tingkah
standar tingkah laku dalammasyarakat.

laku, dan

3.
Semua sifat dan kecakapan yang dipelajari dalam proses sosialisasi itu disusun dan dikembangkan sebagai
kesatuan sistem dalam diri pribadinya.
Adapun pentingnya peranan keluarga dalam proses sosialisasi anak menurut Vembrianto adalah sebagai berikut:
1.
Keluarga merupakan kelompok kecil yang anggota-anggotanya berinteraksi secara face to face secara tetap,
dalam keluarga yang demikian perkembangan anak dapat diikutu dengan seksama oleh orang tua dan penyesuaian
secara pribadi dalam hubungan sosial lebih mudah terjadi.
2.
Orang motivasi yang kuat untuk mendidik anak karena anak merupakan buah cinta kasih hubungan suami
isteri. Anak merupakan perluasan biologi dan sosial orang tuanya. Motivasi yang kuat akan melahirkan hubungan
emosional orang tua dengan anak.
3.
Karena hubungan sosial dalam keluarga bersifat relatif tetap, maka orang tua memiliki peranan yang penting
terhadap sosialisasi anak
(Sayekti, 1980:24)
Keluarga juga berfungsi sebagai perlindungan dan pemeliharaan terhadap anggota keluarga, terutama terhadap anakanak yang masih kecil. Tugas dan tanggung jawab orang tua mengenai pemeliharaan fisik akan semakin berkurang
setelah anak menjadi dewasa. Namun demikian keluarga tidak hanya memberikan perlindungan dan pemeliharaan
fisik tetapi juga perlindungan psikis dan ekonomi terhadap anggotanya. Seperti pendapat yang dikemukakan oleh
Harton dan Hunt.
Jadi keluarga terhadap anggotanya memberikan perlindungan dan pemeliharaan mengenai jasmani dan rohani.
Kebutuhan jasmani meliputi kebutuhan pangan, sandang dan papan. Sedangkan kebutuhan psikis meliputi
perlindungan dan pemeliharaan pada semua anggota keluarga misalnya kebutuhan, kasih sayang, rasa aman
pendidikan dan sebagainya.
Keluarga berfungsi sebagai dasar yang menunjukkan kedudukan atau status bagi anggota-anggotanya. Keluarga
mewariskan kedudukan kepada anak-anaknya, karena kelahiran anggota keluarga biasanya dihubungkan dengan
sistem status sosialnya. Status sosial seseorang dapat berubah melalui perkawinan dan usaha-usaha seseorang. Dengan
melalui perkawinan diantara dua orang individu yang mempunyai status atau kedudukan yang berbeda maka akan
terjadi naiknya atau turunnya ststus seseorang.
Keluarga berfungsi untuk memenuhi kebutuhan yang bersifat religi yaitu kebutuhan yang berhubungan dengan
kekuatan yang ada di luar diri manusia, kebutuhan untuk berhubungan dengan sang pencipta (Bimo Walgito,1984:10).
Orang tua dalam keluarga merupakan orang yang bertanggung jawab pada pembinaan terhadap anak-anaknya. Orang
tua termasuk pendidik yang utama atau primer, karena dengan kesadaran yang mendalam serta dasar cinta kasih yang
mendalam orang tua mendidik anak-anaknya dengan penuh tanggung jawab dan kesabaran dan sebagian besar waktu
anak-anak adalah bersama orang tua (Sutari Imam Barnadib, 1982:61). Dari berbagai definisi di atas, bahwa perhatian
orang tua pada anak: adalah perhatian yang diberikan orang tua (ayah dan ibu) yang memiliki ikatan darah perkawinan
atau adopsi terhadap anak yang menjadi tanggung jawabnya untuk tumbuh dan berkembang. Perhatian orang tua
tersebut meliputu aspek: biologi, sosial, psikologis, ekonomi, pendidikan dan sebagainya.
2

Kebutuhan dasar manusia akan kasih sayang dapat dipenuhi dalam keluarga. Hubungan cinta kasih yang dibina
seseorang menjadi dasar perkawinan yang dapat menumbuhkan hubungan afeksi bagi semua anggota keluarga yang
dibinanya. Apabila rasa cinta kasih di dalam keluarga dapat dirasakan oleh semua anggota keluarga maka anngota
keluarga akan merasakan kesenangan kegembiraan dan ketentraman dan akan merasa kerasan/betah tinggal di rumah.
Dengan kemampuan keluarga memberikan rasa aman, tenteram dan damai akan terjalin hubungan persaudaraan dan
persahabatan berdasar cinta kasih sayang. Maka keluarga merupakan tempat rekreasi bagi anggota-anggota keluarga.
Bahwa fungsi keluarga tidak akan berjalan lancar bila tidak ada komunikasi dalam keluarga. Komunikasi merupakan
suatu kegiatan terus menerus yang dilakukan orang untuk saling berhubungan dengan orang lain, khususnya pada
waktu berhadapan muka. Sehingga komunikasi orang tua dengan anak memegang peranan penting dalam membina
hubungan keduanya, hal ini dapat dilihat dengan nyata, misalnya : membimbing, membantu mengarahkan,
menyayangi, menasehati, mengecam, mengomando, mendikte, dan lain sebagainya.
Orang tua yang kurang bisa berkomunikasi dengan anaknya akan menimbulkan kerenggangan atau konflik hubungan,
sebaliknya orang tua yang dapat menerima anaknya sebagaimana adanya, maka si anak cenderung dapat tumbuh,
berkembang, membuat perubahan-perubahan yang membangun, belajar memecahkan masalah-masalah, dan secara
psikologis semakin sehat, semakin produktif, kreatif dan mampu mengaktualisasikan potensi sepenuhnya.
Jadi kesimpulanya bahwa kehidupan anak dalam sebuah keluarga akan sejahtera dan bahagia bila orang tua (ayah dan
ibu) benar-benar menyadari dirinya sebagai orang tua dan bertanggung jawab pada semua anaknya. Anak yang
diperhatikan dan dididik dengan benar akan tumbuh dan berkembang sesuai dengan perkembangan usia anak.
Sehingga pada akhirnya anak dapat dewasa, mandiri, dan bertanggung jawab dalam kehidupannya kelak. Peran serta
orang membimbing anak dalam keluarga amat diperlukan anak dalam perjalanan hidupnya.
Perkembangan pendidikan anak sangat dipengaruhi oleh beberapa faktor misalnya lingkungan keluarga, fasilitas
belajar, keadaan fisik anak dan lain-lainnya. Dalam keluarga seorang anak dididik dan dibina, tumbuh dan
berkembang sesuai dengan nilai-nilai yang ditanamkan orang tua. Nilai-nilai yang tertanam dalam diri seorang anak
akan sangat mempengaruhi perkembangan pendidikan anak.
Peran keluarga kepada keluarga memiliki peranan penting dalam menanamkan nilai-nilai kehidupan pada anak.
Pendidikan keluaraga mempunyai arti penting bagi pertumbuhan dan perkembangan pribadi anak. Orang tua/ keluarga
menjadi peletak dasar bagi kesiapan anak-anaknya agar memiliki proses belajar yang baik sehingga mampu
berprestasi di dalam belajar dan dalam hidupnya. Karena belajar merupakan kebutuhan hidup sesuai dengan istilah
long live education(belajar seumur hidup). Dengan demikian jelas bahwa perkembangan pendidikan anak dapat
dipengaruhi oleh peran keluarga dalam membina dan memimbing anak dalam lingkungan keluarga.
DAMPAK PERCERAIAN BAGI PERKEMBANGAN PSIKOLOGIS ANAK
Perkawinan adalah dipersatukannya dua pribadi dalam suatu ikatan formal melalui catatan sipil dan juga diabadikan di
hadapan Allah sesuai dengan agama yang disetujui kedua belah pihak. Adanya masalah dalam perkawinan merupakan
alasan perceraian yang umum diajukan oleh pasangan suami istri. Alasan tersebut kerap diajukan manakala kedua
pasangan atau salah satunya merasakan ketimpangan dalam perkawinan yang sulit diatasi sehingga mendorong
mereka untuk mempertimbangkan perceraian.
Pengertian Perceraian adalah cerai hidup antara pasangan suami istri sebagai akibat dari kegagalan mereka
menjalankan obligasi peran masing-masing. Dalam hal ini perceraian dilihat sebagai akhir dari suatu ketidakstabilan
perkawinan dimana pasangan suami istri kemudian hidup terpisah dan secara resmi diakui oleh hukum yang berlaku.
Perceraian merupakan terputusnya keluarga karena salah satu atau kedua pasangan memutuskan untuk saling
meninggalkan sehingga mereka berhenti melakukan kewajibannya sebagai suami istri.
Latar Belakang Terjadinya Perceraian
Kata cerai bukan berarti hanya menyangkut kedua belah pihak pasangan saja, yaitu ayah dan ibu. Sayangnya, tidak
banyak dari pasangan yang memperhatikan bagaimana dan apa yang sedang terjadi pada anak ketika proses perceraian
akan dan sedang berlangsung. Kadangkala, perceraian adalah satu-satunya jalan bagi orangtua untuk dapat terus
menjalani kehidupan sesuai yang mereka inginkan. Namun apapun alasannya, perceraian selalu menimbulkan akibat
3

buruk pada anak, meskipun dalam kasus tertentu perceraian dianggap merupakan alternatif terbaik daripada
membiarkan anak tinggal dalam keluarga dengan kehidupan pernikahan yang buruk.
Jika memang perceraian adalah satu-satunya jalan yang harus ditempuh dan tak terhindarkan lagi, apa tindakan terbaik
yang harus dilakukan oleh orangtua (Mama dan Papa) untuk mengurangi dampak negatif perceraian tersebut bagi
perkembangan mental anak-anak mereka. Dengan kata lain bagaimana orangtua menyiapkan anak agar dapat
beradaptasi dengan perubahan yang terjadi akibat perceraian.
Sebelum perceraian terjadi, biasanya didahului dengan banyak konflik dan pertengkaran. Kadang-kadang
pertengkaran tersebut masih bisa ditutup-tutupi sehingga anak tidak tahu, namun tidak jarang anak bisa melihat dan
mendengar secara jelas pertengkaran tersebut.
Pertengkaran orangtua, apapun alasan dan bentuknya, akan membuat anak merasa takut. Anak tidak pernah suka
melihat orang tuanya bertengkar, karena hal tersebut hanya membuatnya merasa takut, sedih dan bingung.
Kalau sudah terlalu sering melihat dan mendengar pertengkaran orangtua, anak dapat mulai menjadi pemurung. Oleh
karena itu sangat penting untuk tidak bertengkar di depan anak-anak.
Pandangan anak terhadap perceraian orang tua.
Perceraian bagi anak adalah tanda kematian keutuhan keluarganya, rasanya separuh diri anak telah hilang, hidup
tak akan sama lagi setelah orang tua mereka bercerai dan mereka harus menerima kesedihan dan perasaan kehilangan
yang mendalam. Contohnya, anak harus memendam rasa rindu yang mendalam terhadap ayah/ibunya yang tiba-tiba
tidak tinggal bersamanya lagi.
Dalam sosiologi, terdapat teori pertukaran yang melihat perkawinan sebagai suatu proses pertukaran antara hak dan
kewajiban serta penghargaan dan kehilangan yang terjadi diantara sepasang suami istri.
Karena perkawinan merupakan proses integrasi dua individu yang hidup dan tinggal bersama, sementara latar
belakang sosial-budaya, keinginan serta kebutuhan mereka berbeda, maka proses pertukaran dalam perkawinan ini
harus senantiasa dirundingkan dan disepakati bersama.
Banyak pertanyaan dari orangtua mengenai pada usia berapakah perpisahan dan perceraian orangtua memiliki dampak
buruk yang minim bagi anak? Benarkah justru di usia balita paling baik, karena anak belum banyak terpapar pada
kehidupan orangtuanya?
Jawabannya secara umum adalah tidak ada usia terbaik. Namun demikian, sesungguhnya dampak perceraian pada
anak-anak bervariasi sesuai dengan usia dan tahapan perkembangan psikologis mereka. Orangtua perlu memahami
dampak dan kebutuhan yang berbeda dari anak-anak mereka.
Dampak perceraian terhadap perkembangan psikologis anak.
Dampak pada anak-anak pada masa ketidakharmonisan, belum sampai bercerai namun sudah mulai tidak harmonis:
1. Anak mulai menderita kecemasan yang tinggi dan ketakutan.
2. Anak merasa terjepit di tengah-tengah. Karena dalam hal ini anak sulit sekali memilih papa atau mama.
3. Anak sering kali mempunyai rasa bersalah.
4. Kalau kedua orang tuanya sedang bertengkar, itu memungkinkan anak bisa membenci salah satu orang tuanya.
Perkembangan psikologis anak korban perceraian.
a. Arti Keluarga Bagi Anak
4

Bagi anak keluarga sangatlah penting. Keluarga sebagai tempat untuk berlindung, memperoleh kasih sayang. Peran
keluarga sangatlah penting untuk perkembangan anak pada masa-masa yang mendatang, baik secara psikologi
maupun secara fisik. Tanpa keluarga anak akan merasa sendiri, tidak ada tempat untuk berlindung.
b. Kondisi Psikologis Anak Akibat Perceraian
Masa ketika perceraian terjadi merupakan masa yang kritis buat anak, terutama menyangkut hubungan dengan
orangtua yang tidak tinggal bersama. Berbagai perasaan berkecamuk di dalam bathin anak-anak. Pada masa ini anak
juga harus mulai beradaptasi dengan perubahan hidupnya yang baru. Hal-hal yang biasanya dirasakan oleh anak ketika
orangtuanya bercerai adalah:
- Merasa tidak aman (insecurity).
- Tidak diinginkan atau ditolak oleh orang tuannya yang pergi.
- Marah Sedih dan kesepian.
- Kehilangan, merasa sendiri, menyalahkan diri sendiri sendiri sebagai penyebab orangtua bercerai.
Perasaan-perasaan ini dapat menyebabkan anak tersebut, setelah dewasa menjadi takut gagal dan takut menjalin
hubungan dekat dengan orang lain. Beberapa indikator bahwa anak telah beradaptasi adalah: Menyadari dan mengerti
bahwa orang tuannya sudah tidak lagi bersama dan tidak lagi berfantasi akan persatuan kedua orang tua, Dapat
menerima rasa kehilangan, Tidak marah pada orang tua dan tidak menyalahkan diri sendiri, menjadi dirinya sendiri.
c. Cara Membangkitkan Motivasi dan Harapan Anak Korban Perceraian.
Bagi anak-anak mempunyai keluarga yang utuh adalah hal yang sangat membahagiakan. Mereka tidak pernah
membayangkan bahwa akan ada perceraian dalam keluarganya. Keadaan psikologi anak akan sangat terguncang
karena adanya perceraian dalam keluarga. Mereka akan sangat terpukul, kehilangan harapan, cenderung menyalahkan
diri sendiri atas apa yang terjadi pada keluarganya. Sangat sulit menemukan cara agar anak-anak merasa terbantu
dalam menghadapi masa-masa sulit karena perceraian orangtuanya. Sekalipun ayah atau ibu berusaha memberikan
yang terbaik yang mereka bisa, segala yang baik tersebut tetap tidak dapat menghilangkan kegundahan hati anakanaknya. Beberapa psikolog menyatakan bahwa bantuan yang paling penting yang dapat diberikan oleh orangtua yang
bercerai adalah mencoba menenteramkan hati dan meyakinkan anak-anak bahwa mereka tidak bersalah. Yakinkan
bahwa mereka tidak perlu merasa harus ikut bertanggung jawab atas perceraian orangtuanya. Hal lain yang perlu
dilakukan oleh orangtua yang akan bercerai adalah membantu anak-anak untuk menyesuaikan diri dengan tetap
menjalankan kegiatan-kegiatan rutin di rumah. Jangan memaksa anak-anak untuk memihak salah satu pihak yang
sedang cekcok serta jangan sekali-sekali melibatkan mereka dalam proses perceraian tersebut. Hal lain yang dapat
membantu anak-anak adalah mencarikan orang dewasa lain seperti bibi atau paman, yang untuk sementara dapat
mengisi kekosongan hati mereka setelah ditinggal ayah atau ibunya. Maksudnya, supaya anak-anak merasa
mendapatkan topangan yang memperkuat mereka dalam mencari figur pengganti ayah ibu yang tidak lagi hadir seperti
ketika belum ada perceraian.
d. Peran Orang Tua Terhadap Perkembangan Psikologi Anak.
Perceraian selalu berdampak buruk dan terasa amat pahit bagi anak-anak. Dan ini jelas menorehkan perasaan sedih
serta takut pada diri anak.
Alhasil, ia tumbuh dengan jiwa tidak sehat. Berikut ini beberapa saran untuk mengatasi kesedihan anak dalam
melewati proses perceraian orang tuanya:
- Dukung anak Anda untuk mengungkapkan perasaan mereka, baik yang positif maupun negatif, mengenai apa yang
sudah terjadi.
- Sangatlah penting bagi orang tua yang akan bercerai ataupun yang sudah bercerai untuk memberi dukungan kepada
anak-anak mereka serta mendukung mereka untuk mengungkapkan apa yang mereka pikirkan dan rasakan. Dalam hal
ini Anda tidak boleh melibatkan perasaan Anda. Seringkali terjadi, perasaan akan kehilangan salah satu orang tua
5

akibat perceraian menyebabkan anak-anak menyalahkan salah satu dari kedua orang tuanya (atau kedua-duanya) dan
mereka merasa dikhianati. Jadi, anda harus betul-betul siap untuk menjawab setiap pertanyaan yang akan diajukan
anak anda atau keprihatinan yang mereka miliki.
- Beri kesempatan pada anak untuk membicarakan mengenai perceraian dan bagaimana perceraian tersebut
berpengaruh pada dirinya. Anak-anak yang usianya lebih besar, tanpa terduga, bisa mengajukan pertanyaan dan
keprihatinan yang berbeda, yang tidak pernah terpikirkan sebelumnya olehnya. Meski mengejutkan dan terasa
menyudutkan, tetaplah bersikap terbuka.
c. Cara Membangkitkan Motivasi dan Harapan Anak Korban Perceraian.
Bagi anak-anak mempunyai keluarga yang utuh adalah hal yang sangat membahagiakan. Mereka tidak pernah
membayangkan bahwa akan ada perceraian dalam keluarganya. Keadaan psikologi anak akan sangat terguncang
karena adanya perceraian dalam keluarga. Mereka akan sangat terpukul, kehilangan harapan, cenderung menyalahkan
diri sendiri atas apa yang terjadi pada keluarganya. Sangat sulit menemukan cara agar anak-anak merasa terbantu
dalam menghadapi masa-masa sulit karena perceraian orangtuanya. Sekalipun ayah atau ibu berusaha memberikan
yang terbaik yang mereka bisa, segala yang baik tersebut tetap tidak dapat menghilangkan kegundahan hati anakanaknya.
Beberapa psikolog menyatakan bahwa bantuan yang paling penting yang dapat diberikan oleh orangtua yang bercerai
adalah mencoba menenteramkan hati dan meyakinkan anak-anak bahwa mereka tidak bersalah. Yakinkan bahwa
mereka tidak perlu merasa harus ikut bertanggung jawab atas perceraian orangtuanya. Hal lain yang perlu dilakukan
oleh orangtua yang akan bercerai adalah membantu anak-anak untuk menyesuaikan diri dengan tetap menjalankan
kegiatan-kegiatan rutin di rumah.
Jangan memaksa anak-anak untuk memihak salah satu pihak yang sedang cekcok serta jangan sekali-sekali
melibatkan mereka dalam proses perceraian tersebut. Hal lain yang dapat membantu anak-anak adalah mencarikan
orang dewasa lain seperti bibi atau paman, yang untuk sementara dapat mengisi kekosongan hati mereka setelah
ditinggal ayah atau ibunya. Maksudnya, supaya anak-anak merasa mendapatkan topangan yang memperkuat mereka
dalam mencari figur pengganti ayah ibu yang tidak lagi hadir seperti ketika belum ada perceraian.
d. Peran Orang Tua Terhadap Perkembangan Psikologi Anak.
Perceraian selalu berdampak buruk dan terasa amat pahit bagi anak-anak. Dan ini jelas menorehkan perasaan sedih
serta takut pada diri anak.
Alhasil, ia tumbuh dengan jiwa tidak sehat. Berikut ini beberapa saran untuk mengatasi kesedihan anak dalam
melewati proses perceraian orang tuanya:
- Dukung anak Anda untuk mengungkapkan perasaan mereka, baik yang positif maupun negatif, mengenai apa yang
sudah terjadi.
- Sangatlah penting bagi orang tua yang akan bercerai ataupun yang sudah bercerai untuk memberi dukungan kepada
anak-anak mereka serta mendukung mereka untuk mengungkapkan apa yang mereka pikirkan dan rasakan. Dalam hal
ini Anda tidak boleh melibatkan perasaan Anda. Seringkali terjadi, perasaan akan kehilangan salah satu orang tua
akibat perceraian menyebabkan anak-anak menyalahkan salah satu dari kedua orang tuanya (atau kedua-duanya) dan
mereka merasa dikhianati. Jadi, anda harus betul-betul siap untuk menjawab setiap pertanyaan yang akan diajukan
anak anda atau keprihatinan yang mereka miliki.
- Beri kesempatan pada anak untuk membicarakan mengenai perceraian dan bagaimana perceraian tersebut
berpengaruh pada dirinya. Anak-anak yang usianya lebih besar, tanpa terduga, bisa mengajukan pertanyaan dan
keprihatinan yang berbeda, yang tidak pernah terpikirkan sebelumnya olehnya. Meski mengejutkan dan terasa
menyudutkan, tetaplah bersikap terbuka.
- Bila Anda merasa tidak sanggup membantu anak, minta orang lain melakukannya. Misalnya, sanak keluarga yang
dekat dengan si anak.
6

- Adalah wajar bagi anak-anak bila memiliki berbagai macam emosi dan reaksi terhadap perceraian orang tuanya. Bisa
saja mereka merasa bersalah dan menduga-duga, merekalah penyebab dari perceraian. Anak-anak marah dan merasa
ketakutan. Mereka khawatir akan ditelantarkan oleh orang tua yang bercerai.
- Ada anak-anak yang sanggup untuk menyuarakan perasaan mereka, hal ini tergantung dari usia dan perkembangan
mereka. Sementara, sebagian lagi tidak dapat berkata-kata. Ada yang marah dan depresi. Untuk anak-anak usia
sekolah, jelas sekali perceraian mengakibatkan turunnya nilai pelajaran mereka di sekolah. Walaupun untuk beberapa
lama anak-anak akan berusaha mati-matian menghadapi perceraian orang tuanya, pengaruh nyata dari perceraian
biasanya dirasakan anak berusia 2 tahun ke atas.
- Jangan menjelek-jelekan mantan pasangan di depan anak walaupun Anda masih marah atau bermusuhan dengan
bekas suami. Hal ini merupakan salah satu yang sulit untuk dilakukan tapi Anda harus berusaha keras untuk
mencobanya. Jika hal itu terus saja Anda lakukan, anak akan merasa, ayah atau ibunya jahat, pengkhianat, atau
pembohong. Nah, pada anak tertentu, hal itu akan menyebabkan ia jadi dendam dan trauma untuk menikah karena
takut diperlakukan serupa.
- Anak-anak tidak perlu merasa mereka harus bertindak sebagai "penyambung lidah" bagi kedua orang tuanya.
Misalnya, Anda berujar, "Bilang, tuh, sama ayahmu, kamu sudah harus bayaran uang sekolah."
- Minta dukungan dari sanak keluarga dan teman-teman dekat. Orang tua tunggal memerlukan dukungan. Dukungan
dari keluarga, sahabat, pemuka agama, dapat membantu Anda dan anak untuk menyesuaikan diri dengan perpisahan
dan perceraian. Hal lain yang juga dapat menolong adalah memberi kesempatan kepada anak-anak untuk bertemu
dengan orang lain yang telah berhasil melewati masa-masa perceraian dengan baik.
- Bilamana mungkin, dukung anak-anak agar memiliki pandangan yang positif terhadap kedua orang tuanya.
Walaupun pada situasi yang baik, perpisahan dan perceraian dapat sangat menyakitkan dan mengecewakan bagi
kebanyakan anak-anak. Dan tentu saja secara emosional juga sulit bagi para orang tua.
e. Persiapan Orang Tua Dalam Kaitannya dengan Kondisi Psikologis Anak Sebelum Memutuskan untuk Bercerai.
Berhasil atau tidaknya seorang anak dalam beradaptasi terhadap perubahan hidupnya ditentukan oleh daya tahan
dalam dirinya sendiri, pandangannya terhadap perceraian, cara orangtua menghadapi perceraian, pola asuh dari si
orangtua tunggal dan terjalinnya hubungan baik dengan kedua orangtuanya. Bagi orangtua yang bercerai, mungkin
sulit untuk melakukan intervensi pada daya tahan anak karena hal tersebut tergantung pada pribadi masing-masing
anak, tetapi sebagai orangtua mereka dapat membantu anak untuk membuatnya memiliki pandangan yang tidak buruk
tentang perceraian yang terjadi dan tetap punya hubungan baik dengan kedua orangtuanya. Di bawah ini adalah
beberapa saran yang sebaiknya dilakukan orangtua agar anak sukses beradaptasi, jika perpisahan atau perceraian
terpaksa dilakukan:
- Begitu perceraian sudah menjadi rencana orangtua, segeralah memberi tahu anak bahwa akan terjadi perubahan
dalam hidupnya, bahwa nanti anak tidak lagi tinggal bersama Mama dan Papa, tapi hanya dengan salah satunya.
- Sebelum berpisah ajaklah anak untuk melihat tempat tinggal yang baru (jika harus pindah rumah). Kalau anak akan
tinggal bersama kakek dan nenek, maka kunjungan ke kakek dan nenek mulai dipersering. Kalau ayah/ibu keluar dari
rumah dan tinggal sendiri, anak juga bisa mulai diajak untuk melihat calon rumah baru ayah/ibunya.
- Di luar perubahan yang terjadi karena perceraian, usahakan agar sisi-sisi lain dan kegiatan rutin sehari-hari si anak
tidak berubah. Misalnya: tetap mengantar anak ke sekolah atau mengajak pergi jalan-jalan.
- Jelaskan kepada anak tentang perceraian tersebut. Jangan menganggap anak sebagai anak kecil yang tidak tahu apaapa, jelaskan dengan menggunakan bahasa sederhana. Penjelasan ini mungkin perlu diulang ketika anak bertambah
besar.
- Jelaskan kepada anak bahwa perceraian yang terjadi bukan salah si anak.

- Anak perlu selalu diyakinkan bahwa sekalipun orangtua bercerai tapi mereka tetap mencintai anak. Ini sangat
penting dilakukan terutama dari orangtua yang pergi, dengan cara: berkunjung, menelpon, mengirim surat atau kartu.
Buatlah si anak tahu bahwa dirinya selalu diingat dan ada di hati orangtuanya.
- Orangtua yang pergi, meyakinkan anak kalau ia menyetujui anak tinggal dengan orangtua, dan menyemangati anak
agar menyukai tinggal bersama orangtuanya itu.
- Orangtua yang tinggal bersama anak, memperbolehkan anak bertemu dengan orangtua yang pergi, meyakinkan anak
bahwa dia menyetujui pertemuan tersebut dan menyemangati anak untuk menyukai pertemuan tersebut.
- Kedua orangtua, merancang rencana pertemuan yang rutin, pasti, terprediksi dan konsisten antara anak dan orangtua
yang pergi. Kalau anak sudah mulai beradaptasi dengan perceraian, jadwal pertemuan bisa dibuat dengan fleksibel.
Penting buat anak untuk tetap bisa bertemu dengan kedua orangtuanya. Tetap bertemu dengan kedua orangtua
membuat anak percaya bahwa ia dikasihi dan inginkan. Kebanyakan anak yang membawa hingga dewasa perasaanperasaan ditolak dan tidak berharga adalah akibat kehilangan kontak dengan orangtua yang pergi.
- Tidak saling mengkritik atau menjelekkan salah satu pihak orangtua di depan anak.
- Tidak menempatkan anak di tengah-tengah konflik.
- Tidak menjadikan anak sebagai senjata untuk menekan pihak lain demi membela dan mempertahankan diri sendiri.
Misalnya mengancam pihak yang pergi untuk tidak boleh lagi bertemu dengan anak kalau tidak memberikan
tunjangan; atau tidak diperbolehkan untuk bertemu dengan anak supaya pihak yang pergi merasa sakit hati, sebagai
usaha membalas dendam.
- Tetap mengasuh anak bersama-sama dengan mengenyampingkan perselisihan. Memperkenankan anak untuk
mengekspresikan emosinya. Beresponlah terhadap emosi anak dengan kasih sayang, bukan dengan kemarahan atau
celaan. Karena itu dalam mempersiapkan perceraian, ada beberapa hal yang harus dipersiapkan terutama tentang
psikologi anak. Satu diantaranya adalah menjelaskan alasan dari perceraian itu sendiri. Intinya, anak ingin sesuatu
yang pasti. Kalau perceraian memang tidak bisa dihindari, orang tua harus menjelaskan kepada anak. Kumpulkan
antara anak, ayah, dan ibu.
Orang tua di sini harus menjelaskan keputusan mereka, Kalau orang tua menghadapi anak balita, jelaskan dengan
bahasa yang harus bisa dimengerti oleh mereka. Jelaskan juga bahwasanya meski bercerai, kasih sayang kedua orang
tua tidak akan putus. Kedua belah pihak juga menjelaskan tentang materi yang akan tetap diberikan kepada anak.
Jangan juga memberi harapan palsu kepada anak. Harapan palsu di sini maksudnya adalah berjanji bahwasanya kedua
orang tua mungkin suatu saat akan kembali hidup bersama. Jika janji ini sampai diucapkan, anak akan terus
mengingatnya. Masalah perceraian yang sedang dihadapi oleh orang tua tentunya juga akan membuat anak terus
memikirkan kondisi yang sedang menimpa kedua orang tuanya. Jangankan anak yang masih usia kecil, mereka yang
sudah usia besar pun ada juga yang akan mencetuskan pemikiran bahwasanya perceraian itu adalah karena kesalahan
mereka. Orang tua harus menerangkan kepada anak bahwasanya ini bukan kesalahan mereka. Ini untuk menghindari
perasaan terpukul dari anak.
Agar anak tidak terus menerus merasa bersalah, tetap berikan perhatian yang tidak berubah dari kedua belah pihak
orang tua. Intinya biar bagaimanapun, dalam kasus perceraian, orang tua harus ingat bagaimana perasaan dan
kepentingan anak. Jadi sebelum kata cerai, pikirkan dahulu apa yang lebih baik dan buruk apa yang akan terjadi.
Orang tua juga harus tetap menguasai emosi, perasaan, maupun pikiran. Meski telah berpisah bukan berarti anak
hanya boleh memilih satu orang tua dan mencurahkan serta menerima kasih sayang dari satu orang tua juga.
Bagaimanapun anak butuh ayah dan ibu. Jangan putuskan hubungan anak dengan orang tua yang satunya.
Di sini, butuh pula kepekaan orang tua untuk mengerti apa yang dibutuhkan anak akan perasaannya. Orang tua yang
memiliki hak asuh anak boleh memberitahukan tentang pasangannya namun bukan berarti menjelek-jelekkannya.
Kalau kita memburuk-burukkan mantan pasangan kita, anak jadi ada dalam posisi dituntut untuk memilih. Biarkan
mereka melihat dan tahu sendiri sehingga bisa mengambil keputusan sendiri.
8

Begitu besar dampak negatif bagi anak akibat perceraian, sehingga Rasulullah saw. bersabda: Sesuatu yang halal tapi
dibenci Allah adalah perceraian [H.R. Abu Daud dan Hakim].
MITOS yang beredar di masyarakat menyebutkan, anak dari orang tua tunggal akan tumbuh
menjadi anak nakal dan pemberontak. Anggapan itu tak selamanya benar, karena setiap anak
memiliki
kesempatan
yang
sama
untuk
sukses.
Sejatinya, siapa pun tidak ingin menjadi single parent, baik itu karena bercerai maupun
meninggal dunia. Repotnya mendidik anak sendiri mulai memberi makan, perhatian,
pergaulan, sampai pendidikannya sudah pasti ada di pikiran kita. Namun, kalau memang
sudah takdir digariskan Tuhan harus mengalami hal tersebut, Anda sudah harus siap
menjalankannya.
Banyak yang beranggapan, anak yang orang tuanya berpisah akan tumbuh menjadi pribadi
yang broken home atau pemberontak. Sepertinya pernyataan tersebut sudah harus
ditinggalkan.
Penelitian terbaru menunjukkan, anak yang terlahir dari pasangan yang harmonis maupun
bercerai sama-sama memiliki kesempatan untuk berhasil dalam pendidikan dan
kehidupannya kelak. Penelitian yang dilakukan seorang profesor Ohio State University,
Amerika Serikat berusaha menentang pemikiran konvensional bahwa orang tua yang masih
lengkap dalam sebuah keluarga selalu yang terbaik untuk anak-anak. Orang tua tunggal yang
kembali menikah atau tinggal bareng bersama pasangan tanpa menikah mungkin lebih
mengganggu
anak,
sama
seperti
bercerai.
Berdasarkan studi ini, memang kami tidak dapat mengatakan dengan pasti bahwa
pernikahan akan menjadi solusi terbaik bagi anak dari orang tua tunggal, terutama ketika
pernikahan itu sudah tidak sehat dan bukan yang terakhir, kata Claire Kamp Dush, asisten
profesor bidang pembangunan manusia dan ilmu tentang keluarga di Ohio State, Amerika
Serikat.
Hanya dalam lingkungan keluarga berkulit hitam, Kamp Dush menemukan keuntungan
tersendiri pada anak-anak yang hidup dengan dua orang tua lengkap dibanding hanya satu
sosok orang tua. Anak-anak negro dari keluarga yang harmonis terlihat memiliki nilai tes
membaca dan matematika yang lebih baik dibanding yang terlahir dari orang tua single
parent.
Sebaliknya, terlepas dari ras apa pun, anak-anak dari keluarga bercerai ternyata
mendapatkan nilai yang juga tinggi dari segi akademis dan kepribadian dibanding anak dari
keluarga yang masih lengkap. Hasil penelitian menunjukkan bahwa kunci agar anak tumbuh
dengan sehat, yaitu dia tidak berasal dari keluarga bercerai atau perubahan lain dalam
keluarga, baik orang tua tunggal maupun keluarga utuh, kata Kamp Dush seperti dikutip
laman
babycenter.
com.
Lalu, bagaimana bisa bertahan mengasuh anak sebagai seorang single parent? Memang hal
itu tidak mudah karena Anda harus berperan sebagai ayah dan ibu sekaligus. Mendidik anak
bersama pasangan saja sudah cukup sulit, apalagi harus dijalankan seorang diri. Namun,
banyak contoh di dunia seorang single parent yang berhasil membesarkan anaknya hingga
sukses
dalam
kehidupannya.
Yang paling penting adalah Anda harus tetap memenuhi kebutuhan dasar Anda sendiri
terlebih dahulu. Rutin makan, istirahat, dan memanjakan diri harus menjadi prioritas.
Perhatian kepada diri sendiri memang mudah untuk diabaikan, terutama jika Anda tidak
memiliki
mitra
untuk
membantu
kegiatan
rumah
tangga
Anda.
Saya biasanya harus membayar perhatian (ke kegiatan rumah tangga) untuk memastikan
kalau saya sudah cukup makan, kata Rachel Sarah, penulis buku dan pembuat blog Single
Mom Seeking. Saya juga belajar bagaimana pentingnya mendapatkan cukup tidur, yang
9

berarti membuat banyak pekerjaan rumah saya terlupakan. Rumah pun menjadi berantakan,
tapi
saya
harus
membuat
kesusahan
itu
berlalu,
tuturnya.
Sarah juga sesekali menyelipkan olahraga ringan dalam setiap kegiatannya. Contohnya, dia
tidak membawa mobil ketika pergi ke supermarket, tetapi membawa anaknya dalam kereta
dorong dan berjalan kaki untuk berbelanja. Anda juga harus tetap bersosialisasi dengan
lingkungan sekitar. Jika Anda berlaku individualistis saat mengajak anak ke tempat bermain di
mana banyak pasangan membawa anaknya, tentu akan membuat Anda cepat tua.
Berbagi dengan ayah atau ibu dengan kisah serupa mungkin akan membantu Anda kuat
menghadapi hidup. Ketika suami teman saya bekerja lembur, kami biasanya berkumpul
untuk makan malam. Kadang-kadang kedua bayi kami menangis bersamaan. Namun,
setidaknya kami melalui halhal menggembirakan secara bersama- sama, kata Sarah.
Jika Anda mengalami kesulitan mencari teman, pertimbangkan untuk bergabung dengan
organisasi pendukung orang tua tunggal. Silakan kunjungi laman Parents Without Partners,
cek grup di Facebook, komunitas BabyCenter, dan berbagai situs jaringan sosial lainnya yang
banyak tersebar di internet. Atau hubungi perkumpulan wanita atau grup gereja di kota Anda.
Kalaupun tidak ada, Anda dapat membentuknya sendiri. Membentuk sebuah komunitas
sendiri berguna untuk memberikan dukungan emosional dan rasa memiliki dengan sesama
anggota.
BAB
PENDAHULUAN

A..
Latar
Belakang
dan
Masalah
Problematika kehidupan keluarga kian lama kian kompleks seiring spirit perubahan zaman dan paradigma berpikir
individu maupun komunitas tertentu terhadap hakikat atau esensi sebuah perkawinan. Perkawinan adalah kegiatan
yang sakral. Konsep itu selalu memandang lembaga sosial tersebut dari sudut pandang filsafat- teologis sehingga tidak
jarang melahirkan benturan konsep, antara ruang yang transenden dan interpretasi menurut rasio manusia. Namun,
gejolak zaman terus menggugat hakikat atau esensi sebuah perkawinan manakala manusia mengalami kegetiran
hidup yang menuntut adanya sebuah rumusan baru atau sebuah rekonstruksi pemahaman yang lebih seimbang.
Himpitan
ekonomi,
tranformasi
budaya,
politik
merupakan
bentuk-bentuk
gugatan
terhadap
cara
pandang
di
atas.
Simpul-simpul permasalahan sebuah rumah tangga yang tidak dapat diurai secara jelas dapat menyebabkan keretakan
sebuah kebersamaan yang serius yaitu ,perceraian. Perceraian kemudian melahirkan babak kehidupan baru seperti
terjadinya peran baru yang disebut single parent. Realitas sosial itu kemudian menjadi sebuah guratan impresi ketika
diciptakan kembali oleh pengarang (novelis) dengan bakat kepengarangannya. Karya sastra tersebut selanjutnya
dimaknai sebagai lembaga sosial yang tampil sebagai corong perwakilan gagasan bagi sebuah nilai yang belum
semuanya memasyarakat.
B.
Rumusan
Masalah
Dalam makalah yang kami susun kami mencoba akan membahas tentang single parent dalam kesehatan reproduksi
dan single parent dalam kehidupan umum.
C.
Tujuan
Berdasarkan rumusan masalah tersebut di atas penulis merumuskan tujuan pokok sebagai berikut :
1. Untuk lebih mengetahui lebih jauh lagi tentang pengaruh single parent terhadap kesehatan reproduksi dan pengaruh
single
paret
dalam
kehidupan
umum
2. Untuk memenuhi salah satu tugas dari Dosen Mata Kuliah.

BAB
PEMBAHASAN

II

A.
Konsep
Keluarga
Konsep keluarga bukan lagi kaku secara teori konvensional bahwa keluarga terdiri dari ayah, ibu dan anak-anak
10

kandung.
Keluarga adalah unit terkecil dari masyarakat yang terdiri atas kepala keluarga dan beberapa orang yang berkumpul
dalam suatu atap dalam keadaan saling ketergantungan. (depkes RI 1998)
B.

Fungsi pendidikan

Fungsi

keluarga
Fungsi
Fungsi
Fungsi
Fungsi

menurut
sosial
sosial

WHO
biologis
psikologis
budaya
ekonomi

C.
Sosiologi
Keluarga
Gagasan lahirnya ilmu sosiologi keluarga berawal dari momentum revolusi Perancis 1789 yang diikuti perubahan
mendalam pada hubungan keluarga. Perubahan-perubahan itu jauh lebih ekstrim tatkala dunia dilanda perang dunia
Ke-II di mana pemimpin negara-negara yang sedang menuju tahap/era industrialisasi, mengeluarkan undang-undang
baru yang bertujuan membentuk pola-pola keluarga yang lebih sesuai dengan tuntutan kehidupan kota dan industri
(Hasyim,2004:3).
Sosiologi keluarga memandang bahwa setiap keluarga ialah fungsi pengantara masyarakat besar. Daya tahan sebuah
keluarga terletak pada pemenuhan kebutuhan-kebutuhannya, baik yang bersifat primer maupun yang bersifat tersier,
seperti produksi dan pembagian makanan, perlindungan terhadap kaum muda dan tua, yang sakit dan yang
mengandung, persamaan hukum, pengembangan generasi muda dalam kehidupan sosial, dan lain sebagainya
(Hasyim,
2004:
3).
Revolusi industri yang terjadi telah membawa perubahan-perubahan yang sangat signifikan. Di satu sisi revolusi
industri membawa dampak positif bagi perkembangan ilmu dan pertumbuhan ekonomi, di sisi lain revolusi industri
membawa imbas negatif yang begitu dahsyat. Etos-etos tradisi terancam tercabut dari akarnya dan kecemasan yang
mendalam akan semakin hilangnya kekuasaan dan wibawa gereja dan kerukunan hidup (Ihromi,2004:3). Pola-pola
keluarga tradisional yang mapan memperoleh kesaksian yang dahsyat. Kerukunan hidup keluarga terkoyak. Goode
mengemukakan satu contoh fenomena sosial yang melanda keharmonisan keluarga sebagai dampak revolusi industri
dan perkotaan. Seperempat sampai sepertiga pasangan yang menikah akan bercerai, mereka tidak menjunjung tinggi
nilai monogami. Kinsey memperkirakan bahwa setengah dari semua laki-laki yang telah menikah melakukan
hubungan kelamin di luar perkawinan, tetapi barangkali sebagian besar dari mereka percaya akan manfaat kesetiaan.
(Hasyim,
2004:12)
Revolusi industri, pola keluarga konjunal serta masalah urbanisasi menjadi variabel utama yang menggerogoti
kerukunan keluarga sekalipun perkawinan itu dibangun berdasarkan cinta dan kesetiaan. Terhadap fenomena itu
Goode menyatakan sebagai contoh di Amerika, hampir semua perkawinan pertama didasarkan atas hubungan cinta
dan jarang yang akan mengakui bahwa mereka menikah dengan seseorang yang tidak dicintainya. (Hasyim ,
2004:13).
Fenomena tentang perceraian dan peran single parent tidak hanya menarik perhatian para pakar sosiologi untuk
dijadikan objek kajian ilmiah, namun seorang sastrawan yang handal seperti La Vyrle Spencer merekam realitas itu ke
dalam bentuk yang lebih unik, yang dikemas dalam kandungan estetika yang tinggi dan menjadi sebuah novel sebagai
corong perwakilan bagi selaksa nilai yang mengkristal dalam wilayah kehidupannya.
D.
Definisi
Single
Parents
Single parent adalah seorang ayah atau seorang ibu yang memikul tugasnya sendiri sebagai kepala keluarga sekaligus
ibu rumah tangga. Orang tua tunggal atau biasa disebut dengan istilah single parent adalah orang tua yang hanya
terdiri dari satu orang saja, dimana didalam rumah tangga ia berperan sebagai ibu dan juga berperan sebagai ayah.
Saat ini keluarga orang tua tunggal memiliki serangkaian masalah khusus. Hal ini disebabkan karena hanya ada satu
orang tua yang membesarkan anak. Bila diukur dengan angka mungkin lebih sedikit sifat positif yang ada dalam diri
suatu keluarga dengan satu orang tua dibandingkan dengan keluarga dengan orang tua tunggal. Orang tua tunggal ini
menjadi lebih penting bagi anak dan perkembangannya karena orang tua tunggal ini tidak mempunyai pasangan untuk
saling
menopang.
Pilihan untuk menjadi orang tua tunggal adalah pilhan yang sangat berat, walaupun demikian daripada aborsi dan
menambah beban dosa, mereka lebih ikhlas menjadi oarng tua tunggal. Untuk iini mereka juga harus siap menerima
reaksi dari orang tua, keluarga dan dikucilkan entah untuk sementara atau untuk selamanya. Belum lagi menjadi
gunjingan maupun dicibirkan oleh teman, tetangga maupun rekan kerja. Untuk menjalani semua itu dibutuhkan
kekuatan hati dan daya juang yang tinggi, termasuk mengikis perasaan dendam kepada silelaki notabene ayah dari
anaknya sendiri. Sedangkan bagi perempuan yang sudah menikah siap atau tidak predikat janda dengan anak yang
disandangnya. Untuk menjadi orang tua tunggal itu tidaklah mudah.
11

E.
Penyebab
Orang
Tua
Tunggal
Ada dua jenis kategori orang tua tunggal yaitu yang sama sekali tidak pernah menikah dan sempat atau pernah
menikah. Mereka menjadi orang tua tunggal bisa saja disebabkan, karena ditinggal mati lebih awal oleh pasangan
hidupnya, ataupun akibat perceraian atau bisa juga ditinggal oleh sang kekasih yang tidak mau bertanggung jawab atas
perbuatannya, dan kebanyakan terjadi dikalangan remaja yang terlibat dalam pergaulan bebas. Penyebab single parent
antara
lain
:

Perceraian

Kematian

Kehamilan
diluar
nikah
Bagi seorang wanita atau laki-laki yang tidak mau menikah, kemudian mengadopsi anak orang lain (majalah ayah
bunda)
Seorang ibu dapat menjadi orang tua tunggal mungkin karena kematian suaminya atau perceraian, dan beberapa ibu
tentu tidak pernah menikah lagi, termasuk mereka yang memilih memlih menjadi ibu tunggal. Saat ini percerraian
menjadi cara yang umum untuk menjadi orang tua tunggal. Ibu yang bercerai lebih banyak mengalami kesulitan dalam
masalah kekuasaan dan kedisiplinan. Beberapa ibu menjelaskan tentang beratnya mengemban tugas tersebut. Para ibu
ini mulai terpaksa mulai bekerja diluar rumah untuk pertama kalinya guna memenuhi kebutuhan keuangan
keluarganya dengan gaji pertama yang tidak begitu banyak. Beberapa diantaranya juga tidak dapat lagi
menggantungkan
kebutuhan
keuangan
dan
emosonalnya
kemantan
suaminya.
George Levinger mengambil 600 sampel pasangan suami-istri yang mengajukan perceraian dan mereka paling sedikit
mempunyai satu orang anak di bawah usia 14 tahun. Levinger menyusun sejumlah kategori keluhan yang diajukan,
yaitu:
(1) pasangannya sering mengabaikan kewajiban rumah tangga dan anak, seperti jarang pulang ke rumah, tidak ada
kepastian waktu berada di rumah, serta tidak adanya kedekatan emosional dengan anak dan pasangan;
(2) masalah keuangan (tidak cukupnya penghasilan yang diterima untuk menghidupi keluarga dan kebutuhan rumah
tangga);
(3)
adanya
penyiksaan
fisik
terhadap
pasangan;
(4)
pasangannya
sering
berteriak
dan
mengeluarkan
kata-kata
kasar
serta
menyakitkan;
(5)
tidak
setia,
seperti
punya
kekasih
lain
dan
sering
berzina
dengan
orang
lain;
(6)
sering
mabuk
dan
judi;
(7)
ketidakcocokan
dalam
melaksanakan
hubungan
seksual;
(8)
keterlibatan/
campur
tangan
dan
tekanan
sosial
dari
pihak
kerabat
pasangannya;
(9)
kecurigaan,
kecemburuan
serta
ketidakpercayaan
dari
pasangannya;
(10) berkurangnya perasaan cinta sehingga jarang berkomunikasi, kurangnya perhatian dan kebersamaan di antara
pasangan;
(11) tuntutan yang dianggap berlebihan sehingga pasangannya sering menjadi tidak sabar, tidak ada toleransi dan
dirasakan terlalu menguasai; (melalui Ihromi, 2004; 155)
F.
Dampak
orang
tua
tunggal
terhadap
kehidupan
wanita
termasuk
reproduksi
Ibu yang bercerai ataupun wanita yang memutuskan untuk menjadi ibu tunggal seringkali terlalu dibebani dengan
masalah ekonomi, mereka cenderung tidak memliki uang untuk menikmati hidup, dan tak bisa memikirkan dirinya
sendiri karena terlalu banyak pikiran yang tercurah untuk anak-anaknya. Adapun dampak terhadap tarhadap
reproduksinya yaitu kebutuhan seksual oarng tua tunggal tidak terpenuhi, sehingga terkadang merka berfikir untuk
mencari pendamping hidup ataupun sekedar mmencari pelarian, namun adapula sebgian wanita yang merasa trauma
dengan
lelaki
sehingga
mreka
lebih
cendrung
menyukai
sesame
jenisnya.
Banyak ibu tunggal saat ini belum pernah menikah. Peningkatan jumlah perempuan menghabiskan 20-an mereka
membangun diri dalam karir mereka dan tidak serius keinginan anak-anak sampai mereka mencapai usia 30-an. Pada
saat itu mereka mungkin merasa bahwa jika mereka menunggu sampai mereka bertemu jodoh yang cocok, mungkin
terlalu terlambat untuk melahirkan anak. Ide memiliki anak di luar perkawinan juga menjadi lebih luas diterima oleh
wanita
yang
lebih
muda.
Beberapa wanita yang memilih untuk ibu tanpa perkawinan memilih untuk menjadi hamil dengan cara inseminasi
buatan. Tetapi banyak menemukan bahwa beberapa dokter tidak mau artifisial membuahi seorang wanita yang belum
menikah. Beberapa yang memilih inseminasi buatan benar-benar tidak ingin menjadi emosional terlibat dengan ayah
dari anak dan merasa ini akan dihindari jika mereka tahu dia. Lainnya, terutama perempuan lesbian, memilih
inseminasi buatan hanya karena tidak memerlukan hubungan pribadi dengan pasangan laki-laki. Yang lain ingin
membesarkan anak sendiri dan takut bahwa jika mereka tahu ayah, ia kemudian bisa membuat klaim pada anak.
Beberapa wanita yang menginginkan anak tanpa menikah memilih mitra yang bersedia untuk ayah anak dengan tanpa
pamrih. Lain setuju ayah diakui akan terlibat dalam kehidupan anak walaupun orang tua tidak akan menikah.
Apapun pilihan mereka, bagaimanapun, ibu-ibu ini bebas untuk membesarkan anak-anak mereka sesuai dengan ide12

ide mereka sendiri dan nilai-nilai, dan mereka menuai banyak manfaat orangtua. Di sisi lain, mereka melakukan
tanggung jawab yang berat dan risiko kesepian pengasuhan tanpa mitra dengan siapa untuk berbagi baik beban dan
waktu yang baik. Untuk alasan ini, dukungan kelompok untuk ibu tunggal tersebut telah mulai musim semi upsetidaknya di beberapa kota besar (dan juga di Internet).
G.
Peran
Seks
dalam
Perkawinan
Seks memegang peran penting dalam sebuah perkawinan. Pasangan suami-istri membutuhkan seks sebagai sarana
untuk memenuhi kebutuhan biologis mereka dan sarana untuk menghasilkan generasi baru. Berdasarkan berbagai
survei di Amerika, % dari perceraian yang terjadi diberikan kepada wanita. Fenomena ini menggambarkan
konsep/paradigma wanita dalam memandang arti perkawinan yang lebih besar bagi mereka dari pada laki-laki,
ketergantungan mereka dan kepuasan untuk penyesuaian diri terhadap kehidupan itu sendiri (Goode, 2004; 196).
Sebaliknya, terdapat satu pengembangan penelitian yang menemukan bahwa para suami lebih sering melakukan
perceraian. Argumentasinya adalah hampir semua waktu, energi dan tenaga suami dihabiskan di luar rumahnya.
Kesempatan atau keadaan demikian membuka peluang kepada suami untuk terlibat dalam tingkah laku yang rentan
terhadap keharmonisan keluarganya. Suami boleh saja menjalin banyak persahabatan dengan lawan jenisnya.
Akibatnya, terjadi jarak atau kurangnya keterikatan kepada rumahnya sebagaimana halnya, istrinya, dan lebih banyak
kemungkinan untuk memperoleh kegembiraan hiburan, dan juga kesibukan di luar rumah. (Goode, 2004: 197).
Goode lebih lanjut menjelaskan bahwa norma-norma persamaan hak modern, kelakuan sang suami itu mungkin
membuat sang istri tidak bahagia. Sementara, bagi sang suami, istrinya tidak mempunyai banyak kekuasaan/otoritas
untuk mengendalikan atau memaksanya agar mengikuti kemauannya. Sang istri pada permulaan, sedikit kemungkinan
menginginkan perceraian, sedangkan sang suami kemungkinan merasa bersalah untuk menuntut hal itu. Hasilnya ialah
bahwa laki-laki mungkin mengembangkan pola tingkah laku yang menimbulkan celaan, kutukan dan pelecehan bagi
sang istri sebagai bagian dari memuncaknya pertengkaran antar keduanya yaitu membuat dirinya tidak disukai, ia
menimbulkan dalam diri istrinya (dengan sengaja atau tidak) keinginan untuk memutuskan hubungan perkawinan
(2004; 197).
H.
Dampak
Perceraian
terhadap
Mantan
Pasangan
Suami

Istri
Menurut Karim, konsekuensi utama yang ditanggung oleh mantan pasangan suami-istri pasca perceraian adalah
masalah penyesuaian kembali terhadap peranan masing-masing serta hubungan dengan lingkungan sosial (social
relationship)
(melalui
Ihromi,
2004:156).
Goode mengamati proses penyesuaian kembali (readjustment) dalam hal perubahan peran sebagai suami-istri dan
memperoleh peran baru. Perubahan lain adalah perubahan hubungan sosial ketika mereka bukan lagi sebagai pasangan
suami-istri. Penyesuaian kembali ini termasuk upaya mereka yang bercerai untuk menjadi seseorang yang mempunyai
hak dan kewajiban individu, jadi tidak lagi sebagai mantan suami atau mantan istri (melalui Karim, 2004:156).
Krantzler menyatakan perceraian bagi kebanyakan orang dipandang sebagai masa transisi yang penuh kesedihan,
artinya masyarakat atau komunitas sekitar ikut berperan sebagai wasit atau pengadilan dalam menilai perceraian itu
sebagai
sesuatu
yang
tidak
patut
(melalui
Karim,
2004:157).
Waller menilai pasca perceraian sebagai masa yang kurang dan hilang dalam kehidupan pasangan suami-istri yang
bercerai. Seseorang pada masa ini dilanda perasaan ambivalen antara melihat perceraian sebagai sesuatu yang
membahagiakan dan membebaskan dan munculnya rasa sedih mengenang kebersamaan pada masa-masa indah dulu
(melalui Karim, 2004:157). Sementara, Scanzoni dan Scanzoni (lewat Karim) menilai setelah perceraian seseorang
tidak perlu bersedih dan tidak perlu menghampiri kembali mantan pasangannya. Alasannya adalah perceraian itu
sendiri menandakan rasa benci dan ketidaksenangan hidup bersama lagi (melalui 2004:157).
Terdapat dua hal utama yang menjadi fokus pengamatan Goode terhadap pasangan suami istri yang bercerai yaitu
perubahan-perubahan yang terjadi di dalam hubungan sosial di mana mereka bukan lagi sebagai pasangan suami istri
serta
peran
sebagai
suami
atau
istri
dan
memperoleh
peran
baru
(2004:
165)
Mel Krantzler (lewat Ihromi 2004), seorang konsultan masalah perceraian mengamati bahwa perceraian merupakan
sebuah masa transisi yang penuh kesedihan. Masa penuh kesedihan atau kedukaan apabila dikaitkan dengan harapanharapan masyarakat. Apabila masyarakat memandang perceraian sebagai sesuatu yang tidak patut, maka dalam
proses penyatuan kembali, seseorang akan merasakan beratnya tantangan yang harus dihadapi karena perceraian.
Perceraian antara pasangan suami-istri menghasilkan dampak lain yaitu masalah penyesuaian kembali terhadap
peranan masing-masing serta hubungan dengan lingkungan sosial (social relationship), (Goode lewat Ihromi, 2005:
156)
Scanzoni and Scanzoni kemudian membuat sintesa atas konsep-konsep pemikiran Krantzler (lewat Ihroni 2004: 157)
dalam tulisan creative Divorce. Menurut Kranztler perceraian memberikan peluang kepada seseorang untuk
memperoleh pengalaman-pengalaman serta kreativitas baru guna mengisi kehidupan menjadi lebih baik dan
menyenangkan dari sebelumnya. Krantzler berpendapat bahwa perceraian tidak harus diartikan sebagai kegagalan
yang membawa kesedihan bagi seseorang. Untuk menguatkan pandangannya, ia mengutip tulisan Herman Hesse
13

(penulis puisi dan novel) yang pernah mengalami perceraian sebanyak dua kali yaitu Be ready bravely and without
remorse
to
fin
now
light
that
old
ties
cannot
give'
Scanzoni and Scanzoni (lewat Ihroni 2004) mengatakan pasca perceraian seseorang tidak perlu bersedih dan tidak
perlu mengharapkan kembali mantan pasangannya. Alasannya adalah perceraian itu sendiri menandakan adanya rasa
benci dan tidak senang hidup bersama lagi. Perceraian tidak harus ditangisi dan seseorang tidak perlu membenamkan
dirinya dalam kesedihan atau kedukaan secara berlebihan karena kehilangan banyak yang pernah dimilikinya dan
dirasakannya selama hidup bersama pasangannya. Scanzoni dan Scanzoni kembali mendengarkan, mantan pasangan
suami istri seyogyanya menyadari bawah kebersamaan dan saling ketergantungan diantara mereka telah berakhir.
I.
Masalah
orang
tua
tunggal
Masalah utama bagi orang tua tunggal khususnya bagi wanita yaitu pada masalah ekonomi, dan bagi pria mereka lebih
cenderuung mengalami kesulitan menjadi seorang ibu, yang tidak terbiasa mengerjakan pekerjaan rumah tangga. Bagi
wanita yang bersatatus ibu tunggal, yang diakibatkan oleh pergaulan bebas ataupun karena korban perkosaan, mereka
cenderung sulit menerima kehadiran anaknya, belum siap menerima kenyataan bahwa dirinya kini sudah berstatus ibu,
cibiran tetangga, dan masalah-masalah yang timbul selanjutnya yang beerhubungan dengan status anaknya, bahkan
mungkin pertanyaan anaknya yang ingin mengetahui dimana ayah mereka. Hl inilah yang membuat sebagian besar
wanita mengalami depresi yang menyandang sebagai ibu tunggal. Namun tidak semua pula para ibu tunggal yang
berfikiran seperti itu, misalnya salah satu selebriti papan atas yang mengaku siap menjadi orang tua tunggal, dan siap
menerima segala konsekuensinya sebagai ibu tunggal dan baginya ia menikmati perannya sebagai ibu walaupun tanpa
adanya sesosok ayah untuk anaknya.
J.
Penaggulangan
orang
tua
tunggal
Orang tua tunggal bisa tetap bahagia menjalani hidup ini dengan tetap menggunakan pendekatan yang positif. Dengan
menjadikan hsl-hsl ysng positif dalam hidup menjadi pemicunya, maka kebahagiaan tersebut juga bisa didapatkan.
Barikut ini beberapa hal yang bisa dilakukan oleh orang tua tunggal agar tetap bisa bahagia :
Focus pada anak-anak. Jika anak-anak adalah pusat kehidupan anda, dengan sendirinya anak-anak tersebuta akan
menhetahui
dan
merespons
apapun
yang
terjadi
pada
diri
orang
tuanya.
Mengenal diri sendiri. Ini adalah waktu yang tepat untuk mengenal diri sendiri dan merasa nyaman dengan
kesendirian tinggalkan segala pikiran yang negative tentang kesendidrian dan berlatihlah untuk merasa cukup nyaman
dengan
diri
sendiri.
Libatkan anak-anak dalam mencerminkan peran orang tua yag hilang. Dalam hal ini bukan berarti harus menemukan
pengganti dari seorang ibu atau ayah, tapi bisa dengan membuata anak dekat dengan paman, bibi atau kakek dan
nenek
untuk
mengisi
kekosongan
salah
satu
orang
tua.
Biarkan anak-anak tahu bahwa dirinya dapat melengkapkan hidup anda. Jika anda percaya bahwa anda tetap bisa
bertahan tanpa seorang laki-laki atau seorang perempuan disamping anda maka anak-anakpun akan mempercayai itu.
Karena
anak
adalah
cerminan
oleh
apa
yang
dirasakan
oleh
orang
tuanya.
Memahami bahwa anda tidak bisa menjadi segalanya bagi anak-anak. Dengan memahami hal tersebut akan membuat
merasa tidak terlalu tertekan namun bukan berarti anak-anak tidak bisa kasih saying yang sempurna. Kasih saying bisa
didapatkan dari saudara atau orang-orang terdekat anda.
K.
Dampak
Single

Fungsi

Fungsi perlindungan

Parent

Dikaitkan
seksual
Fungsi
Fungsi
Fungsi
Fungsi
Fungsi

Dengan

Fungsi
dan

Keluarga
:
reproduksi
sosialisasi
ekonomi
budaya
edukasi
agama

L.
Hal-Hal
Yang
Perlu
Dilakukan
Oleh
Single
Parent
1.
Keterbukaan
Menyandang status single parent (janda/duda) sebenarnya bukanlah suatu hal yang harus ditutup-tutupi. Ketika
masyarakat menilai status itu dengan prasangka negatif, sebagian orang justru bisa menunjukan bahwa menjadi single
parent
justru
bukan
sesuatu
yang
buruk.
2.
Mengisi
waktu
Sebagai manusia biasa, kehilangan pasangan hidup bisa menimbulkan rasa kesepian, rasa kesendirian yang mendalam
biasanya muncul ketika dia sedang dilanda masalah.

14

3.
Membuka
diri
untuk
masa
depan
Berbagi cerita dengan orang-orang yang bernasib sama adalah salah satu terapi yang bisa dilakukan untuk mengurangi
tekanan psikologis. Kegiatan ini juga dilakukan oleh mereka yang tidak siap menjalani statusnya sebagai single parent
(janda/duda). Melalui komunitas berbagi ini mereka dapat membuka diri untuk pergaulan meski tetap masih memilihmilih teman.
Adapun hal-Hal Yang Harus Diperhatikan Oleh Single Parent Berkaitan Dengan Anaknya, antaralain :
Selain berharap ayah dan ibunya berumur panjang, anak-anak mengharapkan kedua orang tuanya itu senantiasa hadir
ditengah-tengah
mereka
Terjadinya kesepahaman antara suami dan isteri dalam berbagai hal yang berhungan dengan kehidupan pribadi dapat
berpengaruh
pada
diri
anak
Terdapatnya sistem dan aturan yang sama dalam membina rumah tangga dan mendidik anak bukan berarti
meniadakan
sistem
dan
aturan
yang
lain
Tersedianya berbagai perlengkapan rumah tangga tentunya untuk kehidupan yang wajar dan tidak bermegahmegahan
Adanya rasa kasih sayang yang bersumber dari keyakinan dan keimanan, inilah yang akan mempersatukan suami
dan isteri dengan anggota keluarga yang lain
M.
Dilema
anak
Selain berbagi kiat cara menghadapi stigma sosial, komunitas tersebut juga dapat saling memberikan masukan tentang
bagaimana menjadi orang tua tunggal, untuk selalu terbuka dengan anaknya dalam berbagai masalah. Dampak bagi
mental
Anak
Ketidakhadiran ayah bagi anak perempuan tidak memberi dampak yang besar dibandingkan dengan ketidakhadiran
ayah
pada
anak
laki-laki.
Jangan mengevaluasi anak dengan kata-kata yang negatif sehingga anak-anak kehilangan kepercayaan diri
Libatkan dia dengan lingkungan keluarga yang memiliki anak laki-laki dan izinkan dia untuk mengambil keputusan
atas nama dan untuk dirinya sendiri
N.
Dampak
Single
Parent
Bagi
Perkembangan
Anak
Tidak dapat melaksanakan fungsi sosialnya dengan baik sehingga anak kurang dapat berinteraksi dengan lingkungan,
menjadi
minder
dan
menarik
diri
Pada anak single parent dengan ekonomi rendah, biasanya nutrisi tidak seimbang sehingga menyebabkan
pertumbuhan
dan
perkembangan
terganggu
Single parent kurang dapat menanamkan adat istiadat dan murung dalam keluarga, sehingga anak kurang dapat
bersopan santun dan tidak meneruskan budaya keluarga, serta mengakibatkan kenakalan karena adanya
ketidakselarasan
dalam
keluarga
Dibidang pendidikan, single parent sibuk untuk mencari nafkah sehingga pendidikan anak kurang sempurna dan
tidak
optimal
Dasar pendidikan agama pada anak single parent biasanya kurang sehingga anak jauh dari nilai agama
Single parent kurang bisa melindungi anaknya dari gangguan orang lain, dan bila dalam jangka waktu lama, maka
akan menimbulkan kecemasan pada anak atau gangguan psikologis yang sangat berpengaruh pada perkembangan
anak
O.
6
Karakter
Dalam
Keluarga
Single
Parent
Yang
Prima

Adanya
kualitas
waktu
yang
dihabiskan
bersama
dalam
anggota
keluarga.
Memberikan perhatian lebih, termasuk dalam hal-hal kecil, seperti meninggalkan pesan yang melukiskan perhatian
dari
orang
tua

Keluarga
yang
prima
adalah
keluarga
yang
saling
komitmen
satu
sama
lainnya
Menghormati satu sama lain, contohnya : dengan mengucapkan atau mengekspresikan rasa sayang kepada anakanak, mengucapkan terima kasih pada saat anak-anak selesai melakukan tugas yang diberikan

Kemampuan
berkomunikasi
penting
dalam
membangun
keluarga
yang
prima
Kondisi krisis dan stress dianggap sebagai tahapan kesempatan untuk terus berkembang
P.
Pentingnya
Konseling
Agar
Dapat

Menyesuaikan
diri
terhadap

Penerimaan
ibu
dan
anak
dalam
lingkaran

Masuk
dalam
lingkungan
keluarga/masyarakat
secara
Upaya menyatukan kembali keluarga, bagi keluarga mereka yang ditelantarkan suami/ayah

:
lingkungan
keluarga
wajar
15


BAB
KESIMPULAN

III

Secara umum single parents berdampak pada tidak berjalannya fungsi keluarga, yang antara lain :

Fungsi
seksual
dan
reproduksi

Fungsi
sosialisasi

Fungsi
ekonomi

Fungsi
budaya

Fungsi
edukasi

Fungsi
agama

Fungsi
perlindungan
Dalam hal kesehatan reproduksi, single parents berdampak pada kebutuhan seksual oarng tua tunggal tidak terpenuhi,
sehingga terkadang merka berfikir untuk mencari pendamping hidup ataupun sekedar mmencari pelarian, namun
adapula sebgian wanita yang merasa trauma dengan lelaki sehingga mreka lebih cendrung menyukai sesame jenisnya.

ASPEK-ASPEK DALAM PEMBANGUNAN RUMAH SUSUN SEDERHANA SEWA


(RUSUNAWA) DITINJAU DARI UNDANG-UNDANG NOMOR 20 TAHUN 2011 TENTANG
RUMAH SUSUN
BAB I
PENDAHUL UAN
A.

Latar Belakang

Salah satu cita-cita perjuangan bangsa Indonesia adalah terwujudnya masyarakat yang adil
dan makmur berdasarkan Pancasila dan UUD 1945, seiring dengan tujuan pembangunan
nasional adalah mewujudkan kesejahteraan lahir dan batin bagi seluruh rakyat Indonesia
secara adil dan merata. Salah satu unsur pokok kesejahteraan rakyat adalah terpenuhinya
kebutuhan perumahan, yang merupakan kebutuhan dasar bagi setiap warga negara Indonesia
dan keluarganya, sesuai harkat dan martabatnya sebagai manusia.[1] Perumahan sangat
berpengaruh dalam pembentukan kepribadian bangsa. Perumahan tidak hanya dilihat sebagai
sarana kebutuhan hidup, tetapi perumahan merupakan salah satu kebutuhan dasar manusia,
yang berfungsi dalam mendukung terselenggaranya pendidikan, keluarga, persemaian
budaya, peningkatan kualitas generasi yang akan datang dan berjati diri serta menciptakan
tatanan hidup yang baik di dalam masyarakat.
Di Indonesia, kebutuhan terhadap perumahan juga telah mengalami peningkatan,
sebagaimana yang terjadi pada masyarakat dunia, terutama pada masyarakat perkotaan, di
mana populasi penduduknya sangat besar, sehingga memaksa pemerintah maupun swasta
untuk melaksanakan pembangunan, terutama di bidang perumahan. Pembangunan
perumahan merupakan salah satu hal penting dalam strategi pengembangan wilayah, yang
menyangkut aspek-aspek yang luas di bidang kependudukan, dan berkaitan erat dengan
pembangunan ekonomi dan kehidupan sosial dalam rangka pemantapan ketahanan nasional.
Terkait hal tersebut maka pembangunan perumahan dan pemukiman sebagaimana yang
tertuang ditujukan untuk ;[2]
1.
Memenuhi kebutuhan rumah sebagai salah satu kebutuhan dasar manusia, dalam
rangka peningkatan dan pemerataan kesejahteraan rakyat.
2.
Mewujudkan pemukiman yang layak dalam lingkungan yang sehat, aman, teratur.
3.
Memberi arah pada pertumbuhan wilayah dan persebaran penduduk yang rasional.
4.
Menunjang pembangunan di bidang ekonomi, sosial, budaya dan bidang lainnya.
Dengan demikian sasaran pembangunan perumahan dan pemukiman adalah untuk
menciptakan lingkungan dan ruang hidup manusia yang sesuai dengan kebutuhan hidup yang
16

hakiki, yaitu agar terpenuhinya kebutuhan akan keamanan, perlindungan, ketenangan,


pengembangan diri, kesehatan dan keindahan serta kebutuhan lainnya dalam pelestarian
hidup manusiawi.
Untuk memenuhi kebutuhan rakyat akan perumahan dan pemukiman yang dapat terjangkau
oleh masyarakat yang berpenghasilan rendah dan/ atau untuk memenuhi tuntutan atau
pemenuhan pola hidup modern berupa bangunan pasar modern dan pemukiman modern,
pemerintah selalu dihadapkan pada permasalahan keterbatasan luas tanah yang tersedia
untuk pembangunan terutama di daerah perkotaan yang berpenduduk padat. Demi
meningkatkan daya guna dan hasil guna tanah yang jumlahnya terbatas tersebut, terutama
bagi pembangunan perumahan dan pemukiman, serta mengefektifkan penggunaan tanah
terutama di daerah-daerah yang berpenduduk padat, maka perlu adanya pengaturan,
penatan dan penggunaan atas tanah, sehingga bermanfaat bagi masyarakat banyak. Apalagi
jika di hubungkan dengan hak asasi, maka tempat tinggal (perumahan dan pemukiman)
merupakan hak bagi setiap warga Negara, sebagaimana diatur dalam pasal 28H ayat (1)
UUD 1945 yang berbunyi : Setiap orang berhak hidup sejahtera lahir dan batin, bertempat
tinggal, dan mendapatkan lingkungan hidup yang baik dan sehat serta berhak memperoleh
layanan kesehatan.
Dan sesuai dengan ketentuan Undang-Undang Republik Indonesia Nomor 4 Tahun 1992
Tentang Perumahan dan Permukiman pada Pasal 5 Ayat 1 yang berbunyi: Setiap warga
Negara mempunyai hak untuk menempati dan/atau menikmati dan/atau memiliki rumah
rumah yang layak dalam lingkungan yang sehat, aman, serasi dan teratur.
Pembangunan rumah susun adalah suatu cara yang jitu untuk memecahkan masalah
kebutuhan dari pemukiman dan perumahan pada lokasi yang padat, terutama pada daerah
perkotaan yang jumlah penduduk selalu meningkat, sedangkan tanah kian lama kian terbatas
serta sebagai upaya pemerintah guna memnuhi masyarakat perkotaan akan papan yang
layak dalam lingkungan yang sehat. Pembangunan rumah susun tentunya juga dapat
mengakibatkan terbukanya ruang kota sehingga menjadi lebih lega dan dalam hal ini juga
membantu adanya peremajaan dari kota, sehingga makin hari maka daerah kumuh berkurang
dan selanjutnya menjadi daerah yang rapih, bersih, dan teratur. Pengertian rumah susun
menurut UU No. 20 Tahun 2011 tentang Rumah Susun (UU Rusun) adalah bangunan gedung
bertingkat yang dibangun dalam suatu lingkungan yang terbagi dalam bagianbagian yang
distrukturkan secara fungsional, baik dalam arah horizontal maupun vertikal dan merupakan
satuan-satuan yang masing-masing dapat dimiliki dan digunakan secara terpisah, terutama
untuk tempat hunian yang dilengkapi dengan bagian bersama, benda bersama, dan tanah
bersama.
Rumah susun tersebut terdiri dari dua bagian yaitu rumah susun sederhana milik dan rumah
susun sederhana sewa. Praktek di masyarakat, banyak masyarakat yang masih belum mampu
membuat rumah sendiri, sehingga pemerintah mendirikan rumah susun bagi masyarakat
yang belum mampu memiliki rumah sendiri dengan cara menyewakannya. Menyewa rumah
tentu saja memiliki keterbatasan-keterbatasan dan laranganlarangan, terutama terbatas
waktu yang harus dipenuhi oleh calon penyewa atau penghuninya dan adanya hak dan
kewajiban masing-masing apabila penghuni tersebut tidak memenuhi peraturan tersebut
maka pihak pengelola akan memberikan sanksi.
Masyarakat yang ingin tinggal di rumah susun sewa terlebih dahulu harus membicarakan
dengan pihak pengelola atau dalam hal ini diperlukan adanya perjanjian sewa-menyewa
rumah tinggal antara pihak penyewa dengan pihak yang menyewakan. Pihak yang
menyewakan tidak diwajibkan menjamin si penyewa terhadap rintangan-rintangan dalam
penggunaan dan kenikmatannya yang diperoleh atau dilakukan oleh orang-orang pihak ke
tiga atau adanya peristiwa-peristiwa tanpa mengajukan suatu hak atas penyewa untuk
melakukan tuntutan atas penyimpangan perjanjian sewa-menyewa rumah. Gangguan
gangguan dengan peristiwa-peristiwa itu harus ditanggulangi oleh si penyewa. Sipenyewa
terikat dengan kewajiban melakukan pembetulan-pembetulan kecil apabila selama disewa
mengalami kerusakan.
17

Berdasarkan uraian diatas, maka penulis tertarik untuk membuat karya tulis dalam bentuk
makalah dengan judul ASPEK-ASPEK DALAM PEMBANGUNAN RUMAH SUSUN
SEDERHANA SEWA (RUSUNAWA) DITINJAU DARI UNDANG-UNDANG NOMOR 20
TAHUN 2011 TENTANG RUMAH SUSUN.
B.

Perumusan Masalah

1.
Apakah aspek-aspek yang perlu diperhatikan dalam pembangunan Rumah Susun
Sederhana Sewa (Rusunawa)?
2.
Apakah kendala-kendala yang dihadapi dalam pembangunan Rumah Susun Sederhana
Sewa (Rusunawa)?
C.

Tujuan Penelitian

1.
Untuk mengetahui aspek-aspek dalam pembangunan Rumah Susun Sederhana Sewa
(Rusunawa).
2.
Untuk mengetahui kendala-kendala dalam pembangunan Rumah Susun Sederhana
Sewa (Rusunawa).
BAB
PEMBAHASAN
A.

II

Aspek-aspek dalam pembangunan Rumah Susun Sedehana Sewa

Rusunawa, adalah bangunan gedung bertingkat yang dibangun dalam suatu lingkungan yang
terbagi dalam bagian-bagian yang distrukturkan secara fungsional dalam arah horizontal
maupun vertikal dan merupakan satuan-satuan yang masingmasing digunakan secara
terpisah, status penguasaannya sewa serta dibangun dengan menggunakan dana Anggaran
Pendapatan dan Belanja Negara dan/atau Anggaran Pendapatan dan Belanja Daerah dengan
fungsi utamanya sebagai hunian. Rusunawa dapat diartikan sebagai berikut, bangunan
gedung bertingkat yang dibangun di suatu lingkungan baik dalam arah horisontal maupun
vertikal dan merupakan satuan-satuan yang digunakan secara terpisah, status
penguasaannya sewa dengan fungsi utamanya sebagai hunian.
Aspek-aspek dalam pembangungan Rusunawa antara lain:[3]
1.
Aspek Kontribusi Calon Penghuni
Dalam Inpres nomor 05/1990 tentang Peremajaan Pemukiman Kumuh di atas Tanah Negara,
disebutkan bahwa dalam menentukan lokasi pemukiman kumuh yang akan diremajakan,
disamping harus sesuai dengan Pola Dasar Rencana Pembangunan Daerah dan/atau Rencana
Umum Tata Ruang Kota (RUTRK), perlu ada pendekatan kepada masyarakat setempat agar
masyarakat berperan secara aktif dalam proses peremajaan tersebut. Sedangkan dalam
Kepmenpera nomor 06/KPTS/1994 tentang Pedoman Umum Pembangunan Perumahan
Bertumpu Pada Kelompok, disebutkan bahwa pembangunan perumahan yang bertumpu pada
masyarakat adalah pola pembangunan yang mendudukan masyarakat (individu/kelompok)
sebagai pelaku utama dan penentu dimana semua keputusan dan tindakan pembangunan
didasarkan pada aspirasi masyarakat, kepentingan masyarakat, Kemampuan masyarakat,
Upaya masyarakat.
2.
Aspek Keselamatan
Lampiran Menteri Pekerjaan Umum nomor 05/PRT/M/2007 tentang Pedoman Teknis
Pembangunan Rumah Susun Sederhana Bertingkat Tinggi menyebutkan struktur bangunan
rumah susun sederhana bertingkat tinggi harus direncanakan secara terinci sehingga pada
kondisi pembebanan maksimum yang direncanakan, apabila terjadi keruntuhan kondisi
strukturnya masih memungkinkan penghuni menyelamatkan diri. Rumah merupakan
wadah/penampungan yang tujuan utamanya adalah meneduhi dan melindungi penghuni dan
isinya.
3.
Aspek Iklim
Di dalam lampiran Menteri Pekerjaan Umum nomor 05/PRT/M/2007 tentang Pedoman Teknis
Pembangunan Rumah Susun Sederhana Bertingkat Tinggi dikatakan sebagai berikut:
a.
Ventilasi Alami
18

Bangunan rusuna bertingkat tinggi harus mempunyai bukaan permanen, kisi-kisi pada pintu
dan jendela dan/atau bukaan permanen yang dapat dibuka untuk kepentingan ventilasi
alami.
b.
Pencahayaan Alami
Bangunan rusuna bertingkat tinggi harus mempunyai bukaan untuk pencahayaan alami yang
optimal, disesuaikan dengan fungsi bangunan hunian dan fungsi masing-masing ruang di
dalamnya. Pembangunan perumahan sangat berkaitan dengan iklim dimana bangunan
tersebut dibangun.
4.
Aspek Budaya
Rumah adalah suatu lembaga bukan hanya struktur, yang dibuat untuk berbagai tujuan yang
kompleks. Karena membangun suatu rumah merupakan suatu gejala budaya, maka bentuk
dan pengaturan ini sangat dipengaruhi oleh budaya lingkungan pergaulan dimana bangunan
tersebut berada.
5.
Aspek Keterjangkauan
Sesuai PERMENPERA omor 18/PERMEN/M/2007 menyebutkan kriteria penetapan tarif
rusunawa harus terjangkau oleh masyarakat menengah bawah khususnya MBR dengan
besaran tarif tidak lebih besar 1/3 dari penghasilan, sedangkan kriteri besaran tarif
ditetapkan dengan diferensiasi dan subsidi silang antar kelompok tarif penghuni. Menurut
Turner, permintaan efektif bila rumah tangga memiliki akses pilihan yang nyata dan
seimbang antara harga dan pendapatan. Suatu keluarga dikatakan mampu membayar sewa
rumah (ataupun angsuran sewa beli) jika persentase pengeluaran untuk sewa rumah
ditambah biaya utilitas dasar, pajak dan asuransi adalah 20 sampai dengan 30% dari total
pendapatan.
6.
Ketersediaan Sarana dan Prasarana
Perumahan bukan merupakan tempat perlindungan atau hanya fasilitas rumah tangga saja,
tetapi terdiri dari sejumlah fasilitas, servis, dan utilitas yang menghubungkan individu dengan
keluarganya untuk berkumpul dan bermasyarakat pada daerah yang tumbuh dan
berkembang.
Kriteria Rusunawa yang Sesuai untuk Permukiman Kembali (Resettlement), antara lain:
a.
Alasan utama masyarakat tinggal, yaitu karena dekat dengan tempat kerja. Lokasi
hunian yang dekat dengan tempat kerja membuat penyewa lebih memilih berjalan kaki ke
lokasi kerja. Hal ini dilakukan untuk menghemat pengeluaran. Dengan melihat kondisi ini,
maka penempatan lokasi rusunawa harus berada dalam radius jangkauan pejalan kaki
menuju tempat kerja dan tempat melakukan aktifitas harian.
b.
Dalam menentukan luas hunian sebaiknya menggunakan luas hunian tempat asal
sebagai luas minimum. Atau menggunakan standar luas Pusdiklat 7,2 m2/org atau standar
Kepmen PU 9m2/org. Untuk mengatasi keberagaman luas hunian maka sebaiknya
menggunakan modul fleksibel (kelipatan 3). Hunian perlu dilengkapi dengan fasilitas pribadi
berupa ruang tidur, km/wc dan dapur.
c.
Tingkat interaksi antar warga Rusunawa yang sangat tinggi.
Untuk mengakomodasi kebiasaan ini, maka bentuk koridor yang bisa digunakan adalah
koridor tengah. Koridor ini harus di bangun di semua lantai tingkatannya agar proses interaksi
secara horisontal tetap terjaga. Lebar koridor tengah yang dapat diterapkan adalah 2,4 m
(20% dari luas keseluruhan sarusunawa di masing-masing lantai). Sedangkan akses secara
vertikal yaitu tangga yang berfungsi tidak hanya mempermudah penghuni berpindah dari
lantai satu ke lantai lainnya (sebagai akses keluar-masuk) dengan berjalan kaki, tapi juga
berfungsi sebagai tempat interaksi penghuni secara vertikal maupun horisontal. Untuk itu
lebar tangga minimal dapat memuat 2 orang. Lebar tangga yang disyaratkan minimal 1,20 m.
Di setiap lantai perlu juga disediakan ruang bersama, sebagai tempat sosialisasi.
d.
Kondisi permukiman di lokasi penelitian, menunjukan semua hunian memiliki ventilasi.
Untuk itu penghawaan di rusunawa harus memiliki bukaan permanen yang cukup besar
menghadap arah ruang terbuka dan teras. Bukaan permanen udara paling sedikit adalah 5%
dari luas lantai sarusunawa. Untuk penerangan alami, perlu penyediaan jendela-jendela yang
besarnya cukup. Luas jendela paling sedikit 15% dari luas lantai sarusuna untuk menerangi
ruang-ruang yang ada di dalamnya. Orientasi jendela dan ventilasi harus sama.
e.
Jika dilihat penghasilan rata-rata, maka masyarakat pengguna rusunawa adalah
mereka yang dikelompokkan ke dalam masyarakat berpenghasilan rendah (MBR). Untuk itu
19

biaya sewa satuan rusunawa untuk setiap keluarga adalah maksimal sekitar 1/3 bagian dari
pendapatan per bulan.
f.
Dalam suatu lingkungan rusunawa harus tersedia prasarana untuk
memberikan kemudahan bagi penghuni. Prasarana-prasarana yang harus disediakan antara
lain berupa :
1.
Jalan
Klasifikasi jalan pada lingkungan rusunawa perlu disesuaikan dengan lokasi dimana rusunawa
itu dibangun.
2.
Air Minum
Lingkungan rusunawa ini harus menyediakan sumber air bersih bagi penghuninya. Sumber air
bersih ini sedapat mungkin disediakan per unit atau per lantai dan tidak secara sentral untuk
seluruh area rusunawa. Kebutuhan air bersih dari tiap rumah tangga yaitu 100 liter/hari untuk
setiap anggota keluarga, dengan kualitas jernih, tidak berasa dan tidak berbau.
3.
Air Limbah
Lingkungan rusunawa harus memiliki sarana pengolahan air limbah, baik yang berasal dari air
bekas cucian, mandi ataupun kakus. Karena rusunawa memiliki fungsi yang hampir sama
dengan perumahan, maka air limbah rumah tangga pengelolaannya cukup dengan
menyediakan septic tank dan sumur resapan.
4.
Pembuangan Sampah
Dari hasil pengamatan, salah satu kebiasaan masyarakat tepian sungai adalah membuang
sampah di sungai. Agar rusunawa tetap terjaga kebersihannya, maka sarana pembuangan
sampah harus diperhitungkan dalam perencanaan dan perancangan rusunawa terkait dengan
kesehatan lingkungan.
5.
Jaringan Listrik
Pada lingkungan rusunawa pasokan listrik diperhitungkan dengan standar minimal 450 VA per
hunian.
Pembangunan Rusunawa/ Rumah Susun Sederhana Sewa bertujuan menyediakan rumah
layak huni bagi seluruh keluarga Indonesia, khususnya MBR yang belum mempunyai
kemampuan untuk meemnuhi kebutuhan rumahnya melalui kepemilikan, dengan target 20101014 sebanyak 380 TB, dan pembangunan yang telah terlaksana sebanyak 49 TB pada tahun
2010 dan 143 TB 2011 pada tahun 2011.
Pembangunan Rusunawa salah satunya dapat dilakukan dengan pola Unit Pelaksana Teknis
(UPT) yang didasarkan pada kemampuan atau besarnya penghasilan penghuni, bagi
masyarakat berpenghasilan rendah dengan pendapatan maximum sebesar upah minimum
kabupaten/kota (UMK) diarahkan oleh Pemerintah melalui APBN/ APBD yang tidak
mengharapkan pengembalian investasi.
B.

Kendala-kendala dalam Pembangunan Rumah Susun Sederhana Sewa

Pengadaan perumahan di perkotaan dalam jumlah besar bagi masyarakat berpenghasilan


rendah di negara-negara berkembang merupakan persoalan yang cukup kompleks dan
menghadapi banyak kendala. Menurut Bambang Panudju dalam bukunya yang berjudul
Pengadaan Perumahan Kota dengan Peran Serta Masyarakat Berpenghasilan Rendah, yang
dikutip oleh R. Lisa Suryani dan Amy Marisa, kendala-kendala secara garis besar adalah
sebagai berikut: [4]
1.
Kendala pembiayaan.
Hampir seluruh negara berkembang memiliki kemampuan ekonomi nasional yang rendah
atau sangat rendah. Sebagian besar anggaran biaya pemerintah yang tersedia untuk
pembangunan dialokasikan untuk kegiatan-kegiatan yang menunjang perbaikan ekonomi
seperti industri, pertanian, pengadaan infrastruktur, pendidikan. Dan sebagainya. Anggaran
pemerintah untuk pengadaan perumahan menempati prioritas yang rendah sehingga setelah
dipakai untuk membayar makanan, pakaian, keperluan sehari-hari dan lainlain, hanya sedikit
sekali yang tersisa untuk keperluan rumah. Sementara itu harga rumah terus meningkat
sehingga pendapatan penduduk semakin jauh di bawah harga rumah yang termurah
sekalipun.
20

2.
Kendala ketersediaan dan harga lahan.
Lahan untuk perumahan semakin sulit di dapat dan semakin mahal, di luar jangkauan
sebagian besar anggota masyarakat. Meskipun kebutuhan lahan sangat mendesak, terutama
untuk pengadaan perumahan bagi masyarakat berpenghasilan rendah, usaha-usaha positif
dari pihak pemerintah di negaranegara berkembang untuk mengatasi masalah tersebut
belum terlihat nyata. Mereka cenderung menolak kenyataan bahwa masyarakat
berpenghasilan rendah memerlukan lahan untuk perumahan dalam kota dan mengusahakan
lahan untuk kepentingan mereka.
3.
Kendala ketersediaan prasarana untuk perumahan.
Ketersediaan prasarana untuk perumahan seperti jaringan air minum, pembuangan air
limbah, pembuangan sampah dan transportasi yang merupakan persyaratan penting bagi
pembangunan perumahan. Kurangnya pengembangan prasaranan, terutama jalan dan air
merupakan salah satu penyebab utama sulitnya pengadaan lahan untuk perumahan di
daerah perkotaan.
4.
Kendala bahan bangunan dan peraturan bangunan.
Banyak negara berkembang belum mampu memproduksi bahan-bahan bangunan tertentu
seperti semen, paku, seng gelombang , dan lain-lain. Barang-barang tersebut masih perlu
diimpor dari luar negeri sehingga harganya berada di luar jangkauan sebagian besar anggota
masyarakat. Selain itu, banyak standar dan peraturan-peraturan bangunan nasional di
negara-negara berkembang yang meniru negara-negara maju seperti Inggris, Jerman, atau
Amerika Serikat yang tidak sesuai dan terlalu tinggi standarnya bagi masyarakat negaranegara berkembang. Kedua hal tersebut menyebabkanvpengadaan rumah bagi atau oleh
masyarakat berpenghasilan rendah sulit untuk dilaksanakan.
BAB III
PENUTUP
A.

Kesimpulan

Berdasarkan hasil pembahasan dan penelitian sebagaimana telah di uraiakan pada bab
sebelumnya maka dapat disimpulkan bahwa dalam melakukan pembangunan rumah susun
sederhana sewa (rusunawa) harus memperhatikan beberapa aspek, yakni :
1.
Aspek Kontribusi Calon Penghuni
Dalam menentukan lokasi pemukiman kumuh yang akan diremajakan, disamping harus
sesuai dengan Pola Dasar Rencana Pembangunan Daerah dan/atau Rencana Umum Tata
Ruang Kota (RUTRK), perlu ada pendekatan kepada masyarakat setempat agar masyarakat
berperan secara aktif dalam proses peremajaan tersebut.
2.
Aspek Keselamatan
Pembangunan Rumah Susun Sederhana Bertingkat Tinggi menyebutkan struktur bangunan
rumah susun sederhana bertingkat tinggi harus direncanakan secara terinci sehingga pada
kondisi pembebanan maksimum yang direncanakan, apabila terjadi keruntuhan kondisi
strukturnya masih memungkinkan penghuni menyelamatkan diri.
3.
Aspek Iklim
4.
Aspek Budaya
Rumah adalah suatu lembaga bukan hanya struktur, yang dibuat untuk berbagai tujuan yang
kompleks. Karena membangun suatu rumah merupakan suatu gejala budaya, maka bentuk
dan pengaturan ini sangat dipengaruhi oleh budaya lingkungan pergaulan dimana bangunan
tersebut berada.
7.
Aspek Keterjangkauan
Penetapan tarif rusunawa harus terjangkau oleh masyarakat menengah bawah khususnya
MBR dengan besaran tarif tidak lebih besar 1/3 dari penghasilan, sedangkan kriteri besaran
tarif ditetapkan dengan diferensiasi dan subsidi silang antar kelompok tarif penghuni.
5.
Ketersediaan Sarana dan Prasarana
Perumahan bukan merupakan tempat perlindungan atau hanya fasilitas rumah tangga saja,
tetapi terdiri dari sejumlah fasilitas, servis, dan utilitas yang menghubungkan individu dengan
keluarganya untuk berkumpul dan bermasyarakat pada daerah yang tumbuh dan
berkembang.
21

B.

Saran

a.
Diharapkan pada masa yang akan datang baik pemerintah maupun perusahaan swasta
dalam melakukan pembangunan Rusunawa dapat terlebih dahulu memperhatikan aspekaspek dalam pembangunan.
b.
Diharapkan juga pembangunan Rusunawa akan lebih efketif dan efisien baik bagi
pemerintah maupun masyarakat.
Rumah Susun adalah bangunan gedung bertingkat yang dibangun dalam suatu lingkungan yang
terbagi dalam bagian-bagian yang distrukturkan secara fungsional dalam arah horisontal maupun
vertikal dan merupakan satuan-satuan yang masing-masing dapat dimiliki dan digunakan secara
terpisah terutama untuk tempat hunian yang dilengkapi dengan bagian bersama, benda bersama
dan tanah bersama
Jadi bisa dikatakan bahwa rumah susun merupakan suatu pengertian yuridis arti bangunan gedung
bertingkat yang senantiasa mengandung sistem kepemilikan perseorangan dan hak bersama, yang
penggunaannya bersifat hunian atau bukan hunian. Secara mandiri ataupun terpadu sebagai satu
kesatuan sistem pembangunan. @Reza Muzay Blog
atau Rumah Susun adalah bangunan yang dibangun untuk menampung sekumpulan manusia yang
terorganisir kedalam suatu wadah dengan pertimbangangan kehidupan manusia hidup secara layak secara
horizontal dan vertikal dengan sistem pengelolaan yang menganut konsep kebersamaan
Kilasan saat ini adalah perihal Latar Belakang adanya bangunan bertingkat, serta Sistem
kepemilikan
individual
pada
rumah
susun.
A.

Latar

Belakang

adanya

bangunan

bertingkat.

Pemukiman dan perumahan adalah merupakan kebutuhan utama/primer yang harus dipenuhi oleh
manusia. Perumahan dan pemukiman tidak hanya dapat dilihat sebagai sarana kebutuhan hidup, tetapi
lebih jauh adalah proses bermukim manusia dalam rangka menciptakan suatu tatanan hidup untuk
masyarakat dan dirinya dalam menampakkan jati diri. Pengaturan perihal perlunya perumahan dan
pemukiman telah diarahkan pula oleh GBHN (Garis Besar Haluan Negara) yang telah menekankan
pentingnya untuk meningkatkan dan memperluas adanya pemukiman dan perumahan yang layak baik
seluruh masyarakat dan karenanya dapat terjangkau seluruh masyarakat terutama yang berpenghasilan
rendah.
Untuk selanjutnya dalam rangka untuk peningkatan daya guna dan hasil guna tanah bagi
pembangunan perumahan dan pemukiman, serta meningkatkan efektifikas dalam penggunaan tanah
terutama pada lingkungan/daerah yang padat penduduknya, maka perlu dilakukan penataan atas tanah
sehingga pemanfaatan dari tanah betul-betul dapat dirasakan oleh masyarakat banyak. Berkaitan dengan
hal tersebut, maka mulai terpikirkan untuk melakukan pembangunan suatu bangunan yang digunakan
untuk hunian untuk kemudian atas bangunan dimaksud dapat digunakan secara bersama-sama dengan
masyarakat lainnya, sehingga terbentuklah adanya rumah susun.
Pembangunan rumah susun adalah suatu cara yang jitu untuk memecahkan masalah kebutuhan dari
pemukiman dan perumahan pada lokasi yang padat, terutama pada daerah perkotaan yang jumlah
penduduk selalu meningkat, sedangkan tanah kian lama kian terbatas. Pembangunan rumah susun
tentunya juga dapat mengakibatkan terbukanya ruang kota sehingga menjadi lebih lega dan dalam hal ini
juga membantu adanya peremajaan dari kota, sehingga makin hari maka daerah kumuh berkurang dan
selanjutnya menjadi daerah yang rapih,bersih, dan teratur. Peremajaan kota telah dicanangkan oleh
pemerintah melalui Instruksi Presiden Nomor 5 Tahun 1990, tentang peremajaan pemukiman kumuh yang
berada di atas tanah negara. Menindaklanjuti dari Instruksi Presiden tersebut, maka pada tanggal 7 Januari
1993, telah diterbitkan adanya surat edaran dengan Nomor: 04/SE/M/1/1993, yang menginstruksikan
kepada seluruh Gubernur Kepala Daerah Tingkat I dan Bupati/Walikotamadya Kepada Daerah Tingkat II
untuk melaksanakan pedoman umum penanganan terpadu atas perumahan dan pemukinan kumuh, yang
antara lain dilakukan dengan peremajaan dan pembangunan rumah susun. @ Reza Muzay Blog
Konsep pembangunan yang dilakukan atas rumah susun yaitu dengan bangunan bertingkat, yang
dapat dihuni bersama, dimana satuan-satuan dari unit dalam bangunan dimaksud dapat dimiliki secara
22

terpisah yang dibangun baik secara horizontal maupun secara vertikal. Pembangunan perumahan yang
demikian itu sesuai dengan kebutuhan masyarakat.
Landasan Hukum dari Pembangunan Rumah Susun adalah dengan adanya Undang-Undang Nomor
16 Tahun 1985, tentang Rumah Susun, yang telah memberikan landasan hukum bagi penyelenggaraan
pembangunan rumah susun di Indonesia, serta adanya tiga peraturan Menteri Dalam Negeri yaitu
Peraturan Menteri Dalam Negeri Nomor 14 Tahun 1975, tentang pendaftaran hak-hak atas tanah
kepunyaan bersama dan pemilikan bagian-bagian bangunan yang ada di atasnya serta penerbitan
sertifikatnya, Peraturan Menteri Dalam Negeri Nomor 14 Tahun 1977 tentang penyelanggaraan tata usaha
pendaftaran tanah mengenai hak atas tanah yang dipunyai bersama dan pemilikan bagian-bagian
bangunan yang ada di atasnya, serta Peraturan Menteri Dalam Negeri Nomor 10 Tahun 1983,tentang tata
cara permohonan dan pemberian izin penerbitan sertifikat hak atas tanah kepunyaan bersama yang
disertai dengan pemilikan secara terpisah bagian-bagian pada bangunan bertingkat.
Peraturan Menteri Dalam Negeri tersebut telah memberikan landasan hukum untuk dapat memiliki
secara individu atas bagian-bagian dari bangunan di atas tanah yang dimiliki bersama sebelum
diterbitkannya
Undang-undang
rumah
susun.
Selain ketentuan di atas ada ketentuan lain yaitu Peraturan Pemerintah Nomor 4 Tahun 1988, tentang
rumah
susun
yang
telah
diundangkan
pada
tanggal
26
April
1988.
B.

Sistem

kepemilikan

individual

pada

rumah

susun.

Sistem bangunan/gedung bertingkat yang ruang-ruangnya dapat dipakai secara individual sudah
lama dikenal dan dilaksanakan di berbagai kota-kota besar di Indonesia, di mana pemegang hak atas
tanah tersebut adalah sekaligus merupakan pemilik gedung. Awalnya hanyalah ada hubungan sewa
menyewa antara pemilik tanah dan sekaligus pemilik bangunan dengan para pemakai dari ruang-ruang
dalam bangunan/gedung bertingkat tersebut.
Dengan adanya Undang-undang Rumah Susun telah memperkenalkan untuk kemudian
menjalankan adanya lembaga kepemilikan baru sebagai hak kebendaanm yaitu adanya hak milik satuan
atas rumah susun (HMSRS) yang terdiri dari hak perorangan atas unit satuan rumah susun dan hak atas
tanah bersama, atas benda bersama, serta atas bagian bersama, yang kesemuannya merupakan satu
kesatuan yang tidak terpisahkan dengan satuan-satuan yang bersangkutan.
Konsep dasar yang melandasari dari HMSRS adalah berpangkal dari teori tentang kepemilikan atas
suatu benda, bahwa benda/bangunan dapat dimiliki oleh seseorang, dua orang, atau bahkan lebih, yang
dikenal
dengan
istilah
pemilikan
bersama.
Pemilikan bersama atas suatu benda/bangunan pada intinya dikenal adanya dua macam kepemilikan yaitu
kepemilikan bersama yang terikat dan kepemilikan bersama yang bebas.
Pemilikan bersama yang terikat yaitu adanya ikatan hukum yang terlebih dahulu ada di antara para
pemilik benda bersama, misalnya pemilikan bersama yang terdapat pada harta perkawinan. Para pemilik
bersama tidak dapat secara bebas melakukan pemindahan haknya kepada orang lain tanpa adanya
persetujuan dari pihak lainnya, atau selama suami dan isteri masih dalam ikatan perkawinan tidak
memungkinkan untuk melakukan pembagian ataupun pemisahan harta perkawinan (kecuali adanya
perjanjian kawin).
Pemilikan bersama yang bebas adalah dimaksudkan bahwa setiap para pemilik bersama tidak
terdapat ikatan hukum terlebih dahulu, selain dari hak bersama menjadi pemilik dari suatu benda.
Sehingga dalam hal ini adanya kehendak secara bersama-sama untuk menjadi pemilik atas suatu benda
yang untuk digunakan secara bersama-sama. Bentuk kepemilikan bebas inilah yang di sebut dan dikenal
dengan kondominium. @Reza Muzay Blog

23

Persoalan urbanisasi di Jawa Barat dinilai sudah memprihatinkan. Hal ini terlihat dari kepadatan penduduk di
sejumlah wilayah perkotaan.
Wakil Ketua Komisi V DPRD Jabar, Yomanius Untung mengatakan, persoalan tersebut terjadi karena tidak meratanya
pertumbuhan ekonomi di Jabar. Pertumbuhan ekonomi di Jabar masih terpusat di sejumlah kota besar seperti
Bandung, Bogor, dan Bekasi.
Urbanisasi tidak bisa dielakan selama terjadi ketimpangan ekonomi. Pembangunannya tidak merata, ujar Untung di
Gedung DPRD Jabar, Bandung, Rabu (8/7).
Untung menilai, masyarakat pedesaan kehilangan harapan jika selamanya tinggal di desa. Pasalnya, desa identik
dengan bidang pertanian dan dipandang tidak bisa memberi kehidupan yang layak bagi warga. Selain itu, kebijakan
pemerintah yang bertujuan untuk menekan urbanisasi tidak ada. Pembangunan hanya dilakukan terpusat di beberapa
daerah.
Urbanisasi ini berangkat dari daerah pertanian ke daerah industri. Selama kebijakannya tidak mampu mencukupi titik
ekonomi baru, memang (urbanisasi) akan terus terjadi, paparnya.
Karena itu,dalam mengatasi persoalan urbanisasi pemerintah harus serius dan memiliki strategi yang ampuh dalam
melakukan pemerataan pembangunan, salah satunya dengan berpihak kepada pembangunan pedesaan.
Sebagai contoh, lanjut dia, untuk jangka panjang, pemerintah harus memberi insentif yang maksimal bagi daerah
pertanian. Hal itu sangat penting agar pertanian kembali menjadi pilihan utama bagi masyarakat.
Program membuka lahan sawah baru itu sudah bagus. Tinggal ditambah penunjang lainnya, ucapnya seraya
menyebut jika pertanian bisa menjadi alternatif warga dalam mencari penghasilan, urbanisasi akan terkendali secara
alamiah.
Selama itu tidak terjadi, urbanisasi akan tetap terjadi, tambahnya. Adapun untuk program jangka pendek, menurut
Untung, pemerintah harus berupaya menciptakan desa agar mandiri.
Segala potensi desa yang ada harus teroptimalkan sehingga mampu memberi penghidupan yang layak bagi warga.
Terlebih, dengan adanya bantuan dana yang masuk ke desa secara rutin mulai tahun ini, kemandirian desa mutlak
harus tercipta.
Upaya-upaya untuk mendorong masyarakat agar berwirausaha, untuk bisa survive di daerahnya masing-masing.
Mengadakan pelatihan wirausaha, selain tentu pembangunan infrastruktur, katanya.
Hal serupa diungkapkan Wakil Gubernur Jabar Deddy Mizwar. Menurut dia, urbanisasi terjadi karena pembangunan
didesa tidak menjanjikan apa-apa bagi masyarakat.
Sehingga, kata Deddy, masyarakat lebih tertarik mencari penghidupan didaerah industri seperti Bekasi, dan Karawang.
Sehingga, pemerintah kabupaten/kota harus lebih kreatif dalam membangun daerahnya masing-masing.
Deddy pun menilai, adanya bantuan dana ke seluruh desa harus menjadi momentum yang tepat untuk meningkatkan
pembangunan didesa.

24

Bisa untuk mengembangkan pariwisata. Ini tantangan untuk pemerintah (kabupaten/kota), kata Deddy di Gedung
Sate, Selasa (7/7).
Kendati begitu, kata Deddy, tidak ada yang bisa menghalang-halangi warga melakukan urbanisasi. Menurutnya,
pemerintah di daerah perkotaan tidak bisa melarang warga desa yang datang ke kota untuk mencari penghidupan.
Paling operasi yustisia. Siapa yang bisa melarang? Kecuali kalau di daerahnya ada pembangunan yang memberi
kehidupan, pungkasnya. (red/hum)
Pertambahan penduduk yang dipengaruhi oleh tingginya jumlah pendatang, [6] mengakibatkan permasalahan serius
yakni kemacetan yang sekarang tidak hanya terjadi di Jalan Sudirman dan Stalkuda, namun telah meluas ke jalan
arteri lainnya. Penduduk mengeluhkan kondisi Balikpapan yang macet apalagi pada saat jam-jam sibuk, pagi hari
ketika hendak pergi kerja dan sekolah maupun di sore hari ketika kembali ke rumah. Semua persimpangan maupun
jalan arteri perkotaan mengalami kemacetan. [7]
Kekurangan Tempat Pembuangan Akhir
Besarnya pertumbuhan penduduk berakibat menumpuknya sampah di Tempat Pembuangan Akhir (TPA). Dalam satu
hari saja, tercatat sebanyak 350 ton sampah masuk ke TPA Manggar, sehingga memaksa Pemerintah Balikpapan untuk
mencari lahan baru. Zona yang terpakai di TPA Manggar diperkirakan hanya bisa bertahan sampai tahun 2016. [8]
Kriminalitas
Seiring bertambahnya penduduk, lapangan pekerjaan menjadi sempit, tingkat stres tinggi, mengakibatkan kehilangan
kendali sehingga membuat angka kriminalitas (kejahatan) pencurian kendaraan di Balikpapan tertinggi se-Kaltim. [9]
Sekcam (Sekretaris Camat) Balikpapan Tengah dan Kasi (Kepala Seksi) Trantib Damai menyatakan bahwa pendatang
menimbulkan kerawanan akan terjadinya hal-hal yang tidak diinginkan, tindak kejahatan serta buronan polisi yang
sangat meresahkan penduduk.[10]
Pengemis Menjamur
Suasana lalu lintas di Jalan Sudirman
Sejumlah pengemis yang merupakan pendatang, menyerbu titik-titik keramaian seperti Balikpapan Permai (BP),
Kampung Baru, pasar, tempat ibadah dan wisata. Pengemis juga meminta-minta di rumah penduduk dengan dalih
menjual buku atau sumbangan pembangunan masjid.
Mereka mengaku bahwa pendapatannya meminta-minta di Balikpapan jauh lebih tinggi dibanding di Jawa. Di
Balikpapan, mereka bisa mendapat uang sebanyak Rp 5.000,00 hingga mencapai Rp 10.000,00 sedangkan di Jawa
mereka mendapat lima ratus sampai seribu rupiah. Kebanyakan dari pengemis masuk ke Balikpapan dengan pesawat
ketimbang kapal.[11]
Ekologi
Kawasan hutan kota di Perumahan Wika terancam rusak akibat berdirinya 45 bangunan pondokan liar yang dihuni
oleh ratusan pendatang yang mencari kerja di Balikpapan. Satu diantaranya merupakan bangunan permanen dan
berukuran cukup besar, terdapat pula bangunan kolam dan kandang ayam. Sebelumnya, hutan tersebut sudah dipagari
oleh pemerintah Balikpapan namun dirusak oleh penghuni pondokan tersebut. [12]
Keterbatasan Lahan Pemakaman
Terbatasnya lahan pemakaman (kuburan) seiring dengan semakin bertambahnya penduduk dan banyaknya
pemakaman yang ditutup, membuat Pemerintah Balikpapan segera merencanakan pelebaran lahan pemakaman
bertahap di Km 15.

25

Sepuluh pemakaman telah ditutup karena lahannya telah penuh, salah satunya pemakaman di Gunung Guntur. [13]
Namun, pemakaman di Km 15 berlokasi di dekat Sungai Wain, sehingga limbah orang meninggal mengotori sungai
yang menjadi sumber kehidupan penduduk Balikpapan.[14]
Banjir dan Kebakaran
Kebakaran memusnahkan perusahaan busa Indomas Sakti dengan kerugian ditaksir mencapai
miliaran rupiah. Karena padatnya pemukiman warga, belasan unit mobil pemadam dikerahkan
agar api tak meluas.[15]
Dengan jumlah penduduk yang semakin meningkat, musibah banjir dan kebakaran akan terus menghantui Balikpapan.
Kasi Trantib Damai, menyatakan upaya siaga satu sebagai langkah antisipasi hal-hal yang tidak diinginkan. [16]
Pada tahun 2012, musibah kebakaran didominasi oleh kebakaran bangunan sebanyak 63 kasus, kebakaran hutan
sebanyak 26 kasus, kebakaran gardu sebanyak 10 kasus dan kebakaran kendaraan sebanyak 2 kasus, dengan kerugian
sebanyak puluhan miliar.[17]
Kasus Demam Berdarah
Jumlah penduduk saat ini yang mencapai 600 ribu jiwa lebih serta kepadatan penduduk yang besar, menjadikan
Balikpapan memiliki kasus demam berdarah tertinggi di Kaltim dan potensi kasus demam berdarah yang cukup besar.
Pada tahun 2013 sampai akhir April saja, demam berdarah sudah merenggut nyawa 4 jiwa, dari 400 lebih kasus.
Sedangkan tahun sebelumnya, kasus demam berdarah merenggut nyawa 3 jiwa, dari 1.045 kasus. [18][19]
Walaupun intensitas hujan rendah, DKK (Dinas Kesehatan kota) Balikpapan tetap menyatakan waspada terhadap
demam berdarah, menjalankan pengasapan (fogging), penyelidikan epidemiologi, lomba bebas jentik, lomba jumantik
(juru pemantau jentik) teladan, lomba kesehatan dan menyelenggarakan penyuluhan-penyuluhan kebersihan dan
kesehatan. Kesemua hal tersebut dilakukan agar penduduk dapat memahami cara memberantas jentik di
lingkungannya.[20]
Peningkatan Anggaran
Dr. Azahari, perakit bom kelompok Jemaah Islamiyah.
Kenaikan jumlah penduduk membuat KPU (Komisi Pemilihan Umum) Balikpapan harus memaksimalkan keamanan
dan kelancaran pelaksanaan Pemilihan Gubernur dengan membuat TPS-TPS baru. Jumlah TPS (Tempat Pemungutan
Suara) yang semula sebanyak 1.150 TPS, bertambah menjadi 1.288 TPS. Untuk membuat TPS-TPS baru tersebut,
KPU Balikpapan membutuhkan tambahan dana sebanyak Rp 1 miliar lebih. [21]
Terorisme
Kejadian ledakan bom 8 Januari yang dilakukan oleh pendatang membuat situasi Balikpapan menjadi tidak kondusif.
Pelaku merakit bom tabung berbahan serbuk belerang dan korek api yang meledak di rumah kontrakan di Klandasan.
Pelaku tersebut bernama Sujono alias Sugiono yang terkait dengan kelompok Jemaah Islamiyah (Dr. Azahari).
Ditemukan beberapa dokumen terkait dengan kelompok tersebut, berisi tentang cara merakit bom; Nidhom Asasi
berisi 15 bab dan 34 pasal mengenai ajaran terorisme, cara pembuatan bom dan latihan menembak yang pernah
ditemukan di rumah pelaku Bom Bali; serta aturan kelompok tersebut.[22]
Operasi Kependudukan
Kendaraan operasi POLPP Balikpapan
Sebagian penduduk mulai menggiatkan kegiatan siskamling (sistem keamanan lingkungan) dengan memeriksa setiap
indekos yang ditempati pendatang.[23] PolPP (Polisi Pamong Praja) Balikpapan di hari jadinya yang ke-63 juga
menyatakan akan mulai mengintensifkan razia pendatang di seluruh indekos yang ada di wilayah Balikpapan. [24]

26

Di Balteng (Balikpapan Tengah), PolPP berhasil menjaring 27 pendatang dari berbagai indekos (kos-kosan). KTP luar
Balikpapan milik pendatang tersebut disita dan disampaikan surat untuk menjalani persidangan kemudian. Dua warga
yang tidak memiliki KTP diangkut aparat menuju kantor PolPP Balikpapan untuk dimintai keterangan lebih lanjut. [25]
Di Balikpapan Permai (BP), PolPP merazia pendatang di kos-kosan terutama di belakang Bank BII. Kesemua
penghuni kos-kosan tersebut merupakan pendatang yang dikirim ke Balikpapan menjadi pekerja Tempat Hiburan
Malam (THM). Seluruh KTP luar Balikpapan disita dan diberi surat untuk menjalani persidangan.
Di pesisir pantai, Manggarsari, Jalan Mulawarman dan Manggar, PolPP melakukan patroli razia pendatang dengan
memeriksa KTP di setiap rumah. [26] Dari kesemua wilayah tersebut hingga Bekapai, 69 KTP luar Balikpapan disita
oleh aparat, pendatang diinterogasi dan diberi surat untuk menjalani persidangan sesuai tanggal yang ditetapkan. [26][27]
Pemerintah Balikpapan melalui kecamatan gencar melakukan razia pendatang di berbagai wilayah. Di Balikpapan
Utara, pemerintah melalui aparat gabungan menggelar razia pendatang, terutama yang menempati indekos dan rumah
sewa. Aparat berhasil menciduk puluhan pendatang dan menyita ponsel warga yang sama sekali tidak memiliki
identitas.[28]
Di Balteng, pemerintah menggelar razia melalui aparat gabungan secara rutin dengan fokus sasaran utama indekos
maupun rumah pondokan yang ditempati pendatang. Aturan kependudukan Balikpapan yang ketat ditujukan untuk
menjaga keamanan dan ketertiban penduduk, membuat aparat gabungan melakukan razia secara rutin dan tidak hanya
pada waktu-waktu tertentu.[10]
Di Balikpapan Selatan, pemerintah Balikpapan menggelar razia pendatang bekerja sama dengan TNI dan Kepolisian
Balikpapan mengincar pendatang di indekos dan rumah kontrakan, berhasil menjaring sebanyak 62 pendatang.
Tertangkap 3 warga sama sekali tidak memiliki identitas sehingga aparat menyita ponsel Blackberry sebagai jaminan.
Razia ini telah direncanakan sebelumnya mengingat momen lebaran Idul Fitri kerap dijadikan kesempatan pendatang
untuk masuk ke Balikpapan. 62 pendatang yang tertangkap razia kemudian disidang di Gedung Nasional
menghadirkan pihak Kejaksaan dan Pengadilan serta disanksi sesuai peraturan kota. Sebelumnya, aparat telah
melakukan razia serupa di pelabuhan Semayang pada waktu arus balik mudik. Kedua razia tersebut merupakan upaya
untuk menjaga kondusifitas dan keamanan Balikpapan.[29]
Di Telagasari, jajaran kelurahan bekerjasama dengan Ketua RT dan Trantib mengantisipasi pendatang dengan
menggelar razia KTP menyasar rumah sewa dan pondokan juga dengan mengaktifkan siskamling. Hal itu dilakukan
untuk menjaga keamanan lingkungan dan mengantisipasi tindakan kriminal yang bisa sewaktu-waktu terjadi.[30]
URBANISASI,DAMPAKDANSTRATEGIKEBIJAKAN
A.Pengantar
Urbanisasimerupakansalahsatugejalayangbanyakmenarikperhatiandewasaini karena tidakhanyaberkaitan
denganmasalahdemografi,tetapijugamempunyaipengaruhpentingterhadapprosespertumbuhanekonomi(Davis,
1987,Pernia,1984dalamKebanT.Y,1990).Dalambatasbatastertentuurbanisasidapatmendorongpembangunan
tetapi sebaliknya dapat juga menghambat pembangunan. Hubungan yang positif antara tingkat urbanisasi suatu
negara,dengantingakatpendapatanperkapitanegarayangbersangkutan,halinididukungolehdataempirispada
beberapa negara sehingga memberikan keyakinan bahwa urbanisasi mempunyai peran yang penting dalam
pembangunanberimplikasibahwadalamrangkamempercepatprosespembangunan,urbanisasidiperlukan.
Adapendapatlaindimanatidakmenerimahipotesisitersebut,iaberpendapatbahwaprosesyangtidakterkendalikan
justru akan menimbulkan berbagai akibat negatif, baik terhadap negara secara keseluruhan maupun terhadap
penduduk kota serta daerah terbelakang, dimana proses urbanisasi yang berlebihan menunjukkan adanya spatio
demographicimbalanceatauseringdikenaldenganistilahoverurbanizationataupseudourbanization(Smith,1988,
dalamKebanT.Y,1990)danurbanprimacydimanatimbulnyadominasikotabesarterhadapkotakotakecilsehingga
tidakberkembang,dimanaprosesiniseringdianggapsebagaipenghambatpembangunan.
27

B.PengertianUrbanisasi
Sebelum menjawab tentang faktorfaktor apa yang mempengaruhi terjadinya urbanisasi dan dampak yang
ditimbulkan,sertastrategikebijakannyaterlebihdahuluditerangkantentangapayangdimaksuddenganurbanisasi.
MenurutKebanT.YdalamPoungsomleedanRoss(1992),urbanisasimerupakansuatugejalayangcenderungdilihat
dari sisi demografis sematamata, hal ini sebenarnya kurang tepat karena urbanisasi dapat dilihat secara
multidimensional.Disampingdimensidemografis,urbanisasijugadapatdilihatdariprosesekonomipolitik(Drakakis
Smith,1988),modernisasi(Schwab,1982)danlegal(administrasi).
Dilihatdarisegipendekatandemografisurbanisasidapatdiartikansebagaiprosespeningkatankonsentrasipenduduk
diperkotaan sehingga proporsi penduduk yang tinggal diperkotaan secara keseluruhan meningkat, dimana secara
sederhanakonsentrasitersebutdapatdiukurdariproporsipendudukyangtinggaldiperkotaan,kecepatanperubahan
proporsitersebutataukadangkadangperubahanjumlahpusatkota.
Dari pendekatan ekonomi politik, urbanisasi dapat didefinisikan sebagai transformasi ekonomi dan sosial yang
ditimbulkan sebagai akibat dari pengembangan dan ekspansi kapitalisme (DrakikisSmith,1988). Sedangkan dari
konteksmoderinisasi,urbanisasidapatdipandangsebagaiperubahandariorientasitradisionalkeorientasimodern
tempatterjadidifusimodal,teknologi,nilainilai,pengelolaankelembagaandanorientasipolitikdariduniabarat
(kota)kemasyarakattradisional(desa).
Sedangkan konteks legal, urbanisasi dapat dilihat dari pengembangan kota/kotamadya yang telah ada. Kotakota
tersebutsecarahukummemilikibatasadministrasitertentu,danhanyadapatberubahmelaluisuatuaturanlegal
formal. Konteks ini berbeda dengan konteks fungsional batasbatas kotanya lebih ditentukan oleh fungsi atau
karakteritiklokasi.
Everet S. Lee (1976) mendefinisikan pengertian migrasi dalam arti luas yaitu perubahan tempat tinggal secara
permanentidakadapembatasanjarakperpindahandansifatnyasertasetiapmigrasimempunyaitempatasal,tempat
tujuandanadanyarintanganyangmenghambat/rintangan.
Adapun faktorfaktor sehingga terjadi urbanisasi dimana faktor sosial ekonomi di daerah asal yang tidak
memungkinkanuntukmemenuhikebutuhan(needs)seseorangmenyebabkanorangtersebutinginpergikedaerahlain
yang dapat memenuhi kebutuhan tersebut. Jadi antara daerah asal dan daerah tujuan terdapat perbedaan nilai
kefaedahanwilayah (placeutility).Dimanadaerahtujuanharusmempunyainilaikefaedahanyanglebihtinggijika
dibandingkan dengan daerah asal untuk dapat menimbulkan mobilisasi penduduk. Ada beberapa kekuatan yang
menyebabkanorangterikatpadadaerahasal danadajugakekuatanyangmendorongoranguntukmeninggalkan
daerahasal(Mitchell,1961).Kekuatanyangmengikatoranguntuktinggaldidaerahasaldisebutkekuatansentripetal
(centripetal forces) dapat berupa ikatan kekeluargaan, hubungan sosial, pemilikan tanah, dan sebagainya dan
kekuatanyangmendorongoranguntukmeninggalkandaerahasaldisebutkekuatansentrifugal (centrifugalforces)
dapatberupalapanganpekerjaanyangterbatasataukuranglapanganpekerjaanselainagrarisperbedaanupahantara
desadengankotaataumungkinkurangnyafasilitaspendidikanyangtersediadidaerahasal,danlainlain.
EveretS.Lee(1966), Todaro (1979)danTitus (1982)berpendapatbahwamotivasisesoranguntukpindahadalah
motifekonomi,motiftersebutberkembangkarenaadanyaketimpanganekonomiantardaerah. Todaro menyebut
motifutamatersebutsebagaipertimbanganekonomiyangrasional.
EveretS.Lee(1976)menyimpulkanbahwaterdapatperbedaantingkatupahkerjaantaraperdedaandenganperkotaan
yangmenyebabkanterjadinyaperpindahanpendudukdaridesakekotayangpesat.
Mobilisasikeperkotaanmempunyaiduaharapan,yaituharapanuntukmemperolehpekerjaandanharapanuntuk
memperolehpendapatanyanglebihtinggidaripadayangdiperolehdiperdesaan,dengandemikianmobilitasdesakota
sekaligus mencerminkan adanya ketidakseimbangan antara desa dengan kota, oleh karena itu arah pergerakan
pendudukjugacenderungkekotayangmemilikikekuatanyangrelatifbesarsehinggadiharapkandapatmemenuhi
pamrihpamrihekonomimereka.

28

Selainitu EveretS.Lee (1976)jugamengemukakanbahwayangmendoronguntukmigrasikadangkadangbukan


faktornyatayangterdapatditempatasaldantempattujuantetapiadalahtanggapanseseorangterhadapfaktorfaktor
itudanterutamatentangkeadaanditempattujuanberdasarkaninformasidanhubunganhubunganyangdiperoleh
sebelumnya.PenelitianRoberts(1978)dinegaranegaraAmerikaSelatan,Hugo(1975)diJawaBaratdanMantra
serta Molo (1986)mengenaimobilitassirkulerpendudukdienamkotabesardiIndonesiamenyimpulkanbahwa
informasidanhubunganhubunganituterjadiantarafamili/keluargadankerabatsedaerahasal.
Jadikekuatansentripetal(centripetalforces)sebagaikekuatanyangmengikattinggaldidaerahasal,antaralainadalah
:
Jalinanpersaudaraan/kekeluargaanyangeratdidesa
Sistemgotongroyongmasyarakatperdesaan
Keterikatanpadatanahpertanian(budayaagraris)
Keterikatanpadatanahkelahiran,aspekreligiusyangbersifatpribadi,adanyamakamkeluargadansebagainya.
Sedangkankekuatansentrifugal(centrifugalforces),sebagaikekuatanmendoronguntukmeninggalkandaerahasal
ataukekuatanyangmelawankekuatansentrifugalsehinggaterjadimigrasisirkuler(Hugo,1975danMantra,1980)
danMitchell(1961).
Adapunkekuatanpengikatuntuktetaptinggaldidaerahasaladalah:
Penghasilandidesarelatifrendah
Tidakada/kurangpekerjaanselainpertanian
Tidakpunyalahanpertanianataupunyalahanpertaniantapisempit.
Rendahnyapenghasilandidesaberkaitaneratjugadengantidakdimilikinyalahanataulahanyangdimilikinya
sempit.
Adanyaperbedaantingkat kehidupanantara ke dua daerah tersebut yakni kota dan desa, baikperbedaantingkat
ekonomi, sosial maupun politik, sehingga kota seakanakan selalu memberikan kesan yang menyenangkan bagi
pendudukdesa,karenadikotasegalanyadapatdipenuhidenganmudah,baikkebutuhanprimermaupunkebutuhan
sekunder.Kotamemberikanbayangantentangkesenanganhidupdanmudahnyamencaripekerjaanyanglayakdengan
tidakperlumengotoritangan.
Disampingadanyafaktorpenarikyangberasaldarikota,kesulitankesulitanhidupyangdirasakandidesamenjadi
faktorpendorongbagiterlaksananyaprosesurbanisasi.Satuhalyangpatutdicatatadalahkebayakandarimerekayang
berpindahtempatkekotainibukansematamatauntukmeninggalkanstatusmerekasaja(mobilitassosial),tetapilebih
merupakandorongankarenasemakinsulitnyamencarikehidupanyanglayakdidaerahperdesaan.
Sedangkan menurut Khairuddin (1992:212) dalam (Schoorl, 1980:226267 ; Koesoemaatmadja, 1976:2425 ;
Rahardjo,1982:53,Marbun,1979:7880;Landis,1984:166;danSiagian,1984:147)menggunakanistilahfaktor
pendorong(pushfactors)danfaktorpenarik(pullfactors),sehinggadarikeduasisiinibaikfaktorpendorongmaupun
faktorpenarik,dapatdisebutkanantaralainsebagaiberikut:
]FaktorPendorong(PushFactors)
Adapunyangtergolongsebagaifaktorpendorongadalahsebagaiberikut:
Semakinterbatasnyalapangankerjadiperdesaan
Kemiskinandidesaakibatbertambahbanyaknyajumlahpenduduk
Transportasidesakotayangsemikinlancar
Tingginyaupahburuhdikotadibandingkandidesa
29

Bertambahnyakemampuanmembacadanmenulisatautingkatpendidikandimasyarakatdesa
Tatacaradanadatistiadatyangkadangkadangdianggapsebagaibebanolehmasyarakatdesa.
]FatorPenarik(PullFactors)
Adapunyangtergolongsebagaifaktorpenarikadalahsebagaiberikut:
Kesempatankerjayanglebihluasdanbervariasidikota
Tingkatupahyanglebihtinggi
Lebihbanyakkesempatanuntukmaju(diferensiasipekerjaandanpendidikandalamsegalabidang)
Tersedianyabarangbarangkebutuhanyanglebihlengkap
Terdapatnya macammacam kesempatan untuk rekreasi dan pemanfaatan waktu luang (plesure time), seperti
bioskop,tamanaman,hiburandansebagainya
Bagiorangorangataukelompoktertentumemberikesempatanuntukmenghindarkandiridarikontrolsosialyang
ketatdidesa.
Selainfaktorpendorongdanpenarikyangdisebabkandiatas,menurutHauser,(1985:25)yangjugamempengaruhi
lajuurbanisasidaridesakekotaantaralain,yaitu:
]Perubahanteknologiyanglebihcepatdibidangpertaniandaripadadibidangnonpertanian,yangmempercepatarus
pendudukdariperdesaan.
]Kegiatanproduksiuntukeksporterpusatdikawasankota
]Pertambahanalamiyangtinggidiperdesaan
]Susunankelembagaanyangmambatasidayaserapperdesaan,sepertisistempemilikantanah,kebijakanhargadan
pajakyangbersifatmenganakemaskanpendudukperkotaan.
]Layananpemerintahyanglebihberatpadaperkotaan
]Kelembagaan(intertia)faktornegatifyangmenahanpenduduktetaptinggaldiperdesaan
]Kebijaksanaaanperpindahanpendudukolehpemerintahdengantujuanmengurangiaruspendudukdariperdesaaan
keperkotaan.

C.DampakUrbanisasi
Urbanisasijugamenimbulkanberbagaiakibat(dampak)tertentuyangdirasakanoleholehdaerahpenerimadandaerah
yangditinggalkanmeskipunurbanisasiiniolehsebagaianahli,dianggapmembawadampakpositifterutamabagi
perkembangankota,tetapitidaksedikitpuladampaknegatifyangditimbulkannya.
Bagimerekayangmemandangurbanisasimembawadampakpositifmengatakan,antaralain:
Urbanisasimerupakanfaktorpentingdalampeningkatanpertumbuhanekonomisecarakeseluruhan
Urbanisasimerupakansuatucarauntukmenyerappengetahuandankemajuankemajuanyangadadikota
Urbanisasi yang menyebabkan terjadinya perkembangan kota, selanjutnya memberikan getaran (resonansi)
perkembanganbagidaerahdaerahperdesaansekitarnya.
Selain dampak positif yang ditimbulkan juga menimbulkan dampak yang negatif, baik dampak yang negatif itu
dirasakandaerahperkotaanjugadirasakanpulaolehdaerahperdesaan.
30

Urbanisasidikotadapatmenimbulkanmasalahoverurbanizationdanurbanprimacy.Overurbanizationyaitu
kelebihanpenduduksehinggamelebihidayatampungkota.Inimerupakangejalamakinmeningkatnyadayatarikkota
besaryangmenimbulkandysfunctionalcondition.Halinidapatdilihatdenganketimpanganantardaerahdansemakim
beratnyabebanpemerintahkota.Sedangkanurbanprimacyadalahtimbulnyadominasikotabesarterhadapkotakota
kecilsehinggatidakberkembang,dominasitersebutdapatdilihat darikonsentrasiekonomi,alokasisumberdaya,
pusatpemasaran,pusatpemerintahandannilainilaisosialpolitik.
Over urbanization dan urban primacy adalah merupakan masalah yang di rasakan oleh kota dimana akan
menimbulkanmasalahmasalahyangakanmempengaruhiperkembangansuatukota,adapunmasalahmasalahyang
dapatditimbulkanantaralain:
Pengangguran
Hal ini merupakan masalah yang cukup serius yang banyak dihadapi oleh kotakota besar. Masalah ini timbul
berkaitan dengan terjadinya over urbanization. Karena sebagian migran yang masuk ke kota tidak memiliki
keterampilansesuaidengankeahlianyangdibutuhkan,makaparamigrantersebutkebanyakanhanyabekerjasebagai
buruhkasarsecaratemporer(sektorinformal).Setelahpekerjaanmerekaselesai,makamerekasepenuhnyamenjadi
mengangur. Besarnya tingkat pengangguran di kota merupakan salah satu faktor yang menyebabkan timbulnya
pekerjaan kurang layak bagi kemanusiaan seperti mengemis, mencopet dan sebagainya, tingginya tingkat
penganggurantersebutdapatmeningkatkanangkakriminal.
]Perumahan/PermukimanKumuh
Salahsatukarakteristikkotaadalahtingginyatingkatkepadatanpenduduik,dimanakepadatanpendudukyangtinggi
menyebabkantidakseimbangnyaantararuangdanjumlahpenduduk,sehinggamasalahpermukimanmerupakansalah
satumasalahyangditimbulkanolehoverurbanization.
Halinimenimbulkanmasalahdayadukungkotadalambentukyangtidakseimbangantararuangdanlahanyang
dibutuhkan dengan jumlah penduduk yang ada. Masalah permukiman selanjutnya merupakan salah satu sebab
timbulnya lingkungan hidup yang tidak sehat, berupa permukiman liar dan perkampungan kumuh (slum area),
sehinggapendirianrumahrumahliarinisangatmenganggutatakotadankeindahankota.
]Transportasi/LaluLintas
Kepadatanpendudukdantingginyatingkatmobilitaspendudukdiperkotaanmenjadikansaranatransportasimenjadi
penting artinya. Sarana transportasi diperkotaan dapat menimbulkan masalah apabila jumlah kendaraan tidak
seimbangdenganpanjangjalanyangada.Rasiojumlahkendaraandanpanjangjalanmenentukanterjadinyamasalah
lalulintassepertikemacetan,pelanggaranpelanggarandantingginyatingkatangkakecelakaanlalulintas.
KepadatanlalulintasinimenurutSadonoSukirnodalamKhairuddin(199:220),menimbulkanbeberapajenisbiaya
sosialdanekonomipadamasyarakat:
Mempertinggitingkatkecelakaan
Mempertinggibiayapemeliharaankendaraankarenapenggunaanminyakyanglebihbanyakdanmempercepat
kerusakankendaraan
Mempertinggiongkospengangkutan
Menimbulkanmasalahpencemaranudarayangserius.
Kepadatanlalulintasdikotakotabesarsangatterasapadajamjampuncak/sibuk,yaitupadawaktupagiharidan
sianghariatausoreharidimanapadasaatitusemuaorangmelaksanakanaktivitasnyasehariharisepertikekantor,
kesekolahdansebagainya.
]DegradasiMoraldanKejahatan
Sebagaimanayangdiketahuibahwamasyarakatkotamempunyaiciriciriheterogenitasyangtinggidansatusama
lainkurang/tidaksalingmengenal.Haliniakanmenimbulkansikapacuhtakacuhdansemakinlemahnyakontrol
sosial.Kondisiiniakanmenyebabkansikapindividulebihbebasuntukmelakukansuatutindakanyangdianggap
31

menguntungkanbagidirinyasendirimeskipunitusudahbersifatdeviasiataumenyimpangdarinilainilaimoralyang
berlaku. Tindakanpatologis ini semakin besar dengan besarnya pula permisiveness terhadap perbuatanperbuatan
menyimpangyangdilakukananggotaanggotamasyarakat.Sikapmenegurdanmemberinasehatbagisebagianorang
sudah dianggap mencampuri urusan orang lain, sehingga sangat jarang timbul reaksi dari masyarakat terhadap
pelanggaranpelanggaranmoraltersebut,
Kejahatanadalahsuatutindakanyangkalaubolehdikatakansifatnyasangatklasik,darizamandahuluorangsudah
mengenaltindakkejahatandengansegalabentuknya,yangmungkinberbedadarizamankezamanadalahkapasitas
kejahatan,tindakkejahatandariharikeharisemakinbervariasidansudahmengarahkepadatindakansadisme,halini
terutamaterjadipadakotakotabesarsebablemahnyakontrolsosialdarikalanganmasyarakat,sehinggasemakinsulit
untukmemberantasnya.

D.StrategiKebijakanUntukMengurangiArusUrbanisasi
Berdasarkan analisis aspek demografis secara umum masalah urbanisasi belum sampai pada kondisi kritis atau
menghawatirkan, akan tetapi bila dilihat dari segi kecepatannya maka semesti pemerintah memperhatikan atau
melakukantindakanantisipasi sejakawal, olehkarena ituperhatianpemerintahharusdiarahkanpada bagaimana
mengontrolataumengendalikanarusurbanisasisedemikianrupasehinggaselaluberjalanserasidengankemajuandi
berbagaibidangpembangunanyangada.
ProsesurbanisasidiIndonesiasangatberkaitandengankebijakanpembangunanyangdiambilolehpemerintahpada
masalampau,baikmenyangkutpembangunanspasialmaupunsektoral.Sebagaiakibatdarikebijakanspasialmaka
migrasidesakotasangatmempercepattempourbanisasidibeberapadaerahperkotaan.
Selainitukebijaksanaanyangbersifatsektoralsangatdiperlukankarenasecaratidaklangsungjugamempengaruhi
urbanisasi, kebijakan sektoral ini antara lain bidang pendidikan, kependudukan, kebijakan harga, industri dan
kebijakantransportasisertakomunikasi,kebijakanupahdanlainlain.
Menurut Todaro (1997:343345) berpendapat bahwa adapun strategi yang tepat untuk menanggulangi persoalan
migrasidankaitannyadengankesempatankerjasecarakomprehensif,adalahsebagaiberikut:
Penciptaankeseimbanganekonomiyangmemadaiantaradesakota.
Keseimbangankesempatanekonomiyanglebihlayakantaradesadankotamerupakansuatuunsurpentingyangtidak
dapatdipisahkandalamstrategiuntukmenanggulangimasalahpenganggurandidesadesamaupundiperkotaan,jadi
dalamhaliniperluadatitikberatpembangunankesektorperdesaan.
Perluasanindustriindustrikecilyangpadatkarya.
Komposisi atau paduan output sangat mempengaruhi jangkauan kesempatan kerja karena beberapa produk.
Membutuhkanlebihbanyaktenagakerjabagitiapunitoutputdantiapunitmodaldaripadaprodukataubarang
lainnya.
Penghapusandistorsihargafaktorfaktorproduksi
Untukmeningkatkankesempatankerjadanmemperbaikipenggunaansumberdayamodallangkayangtersediamaka
upayauntukmenghilangkandistorsihargafaktorproduksi,terutamamelaluipenghapusanberbagaisubsidimodaldan
menghentikanpembakuantingkatupahdiatashargapasar.
Pemilihanteknologiproduksipadatkaryayangtepat
Salahsatufaktorutamayangmenghambatkeberhasilansetiapprogrampenciptaankesempatankerjadalamjangka
panjangbaikpadasektorindustridiperkotaanmaupunpadasektorpertaniandiperdesaanadalahterlalubesarnya
kekagumandankepercayaanpemerintahdarinegaranegaraduniaketigaterhadapmesinmesindananekaperalatan
yangcanggih(biasanyahemattenagakerja)yangdiimpordarinegaranegaramaju.
Pengubahanketerkaitanlangsungantarapendidikandankesempatankerja.
32

Munculnyafenomenapengangguranberpendidikandibanyaknegaraberkembangmengundangberbagaipertanyaan
tentang kelayakan pengembangan pendidikan khususnya pendidikan tinggi secara besarbesaran yang terkadang
kelewatberlebihan.
Penguranganlajupertumbuhanpendudukmelaluiupayapengentasankemiskinanabsolutdanperbaikandistribusi
pendapatanyangdisertaidenganpenggalakanprogramkeluargaberencanadanpenyediaan pelayanankesehatandi
daerahperdesaan.
Selain itu dikena pula pembangunan agropolitan yang dapat mendorong kegiatan sektor pertanian dan sektor
komplemennyadi wilayah perdesaan. Untukitu diharapkanadanya kebijaksanaan desentralisasi, sehingga terjadi
keseimbangan ekonomi secara spasial antar wilayah perdesaan dengan kawasan perkotaan yang lebih baik dan
sekaligusmampumenyumbangpadapertumbuhanekonomiyanglebihtinggi.
Adapunkomponendaristrategipembangunanagropolitan,antaralain:
Melakukan dan menggalakan kebijaksanaan desentralisasi dan penentuan keputusan alokasi investasi dengan
mempermudahijinijinkepadapihakswastayangdidelegasikandaripusatkepadapemerintahdaerahdanlokal.
Meningkatnyapartisipasikelompoksasarandalampembayaransubsubproyekuntukmembangunrasamemiliki
terhadapproyekyangdibangunbersamamereka.
MENGATASI MASALAH URBANISASI TANPA MASALAH
Urbanisasi identik dengan sebuah tujuan untuk memperbaiki kondisi hidup yang semula serba
kekurangan untuk menjadi lebih baik. Urbanisasi bagi kota besar seperti Jakarta merupakan
problema pelik yang setiap tahun pasti datang menghampiri. Hal ini mengidentifikasikan
bahwa tempat asal mereka lahan ekonominya tidak cukup prospektif. Terlebih mereka melihat
bahwa kota besar kususnya Jakarta merupakan pusatnya perekonomian, maka ketertarikan
untuk mengadu nasib dengan urbanisasi semakin bertambah.
Nalarnya, dengan meningkatnya jumlah penduduk suatu kota, juga akan
mempengaruhi meningkatnya Produk Domestic Bruto (PDB) dan pencapaian pembanguan
kota tersebut, itu hanya terjadi bila urbanisasi di kota besar masih pada tingkat yang bisa
dikendalikan. Namun deda halnya yang terjadi di kota Jakarta yang sudah sangat tidak
terkontrol, bahkan meningkat dari tahun ke tahun. Bukannya pencapaian pembangunan justru
muncul masalah yang baru, misalnya: kemiskinan, pengangguran, tatakota yang carut marut,
kesejahteraan yang kurang merata, bahkan timbulnya kriminalitas yang semakin merajalela.
Secara empiris, arus urbanisasi selalu searah dengan arus pembangunan. Dan saat ini
pembangunan di Jakarta masih dianggap yang paling baik di negeri ini. Fakta ini menunjukkan
bahwa kesalahan bukan hanya terletak dari urbanisasi, namun juga pada kebijakan
pembangunan yang tidak merata. Hal ini menunjukkan bahwa progam otonomi daerah juga
kurang maksimal, padahal bila progam tersebut bisa tercapai dengan memaksimalkan potensi
daerahnya masing-masing akan menekan jumlah arus urbanisasi dan pembangunan daerah
juga akan tercapai.
Weller dan Bouvier mengatakan, ada 3 solusi untuk menekan urbanisasi. Solusi
pertama, melarang penduduk untuk pindah ke kota. Solusi ini sudah pernah dilakukan oleh
kota-kota besar sperti Jakarta, bahkan sampai saat ini masih dilakukan untuk meneknan
urbanisasi namun kurang efektif karena terkasan otoriter. Solusi kedua, penyeimbangan
pembangunan di desa dan di kota, namun pada saat ini di desa masih bertumpu pada sector
agrarian seperti sector pertanian sedangkan pembangunan harus dilakukan secara
menyeluruh, seperti sektor industry, jasa, infastruktur. Solusi ketiaga, mengembangkan kotakota kecil di daerah sebagai sentra pertumbuhan ekonomi yang baru. Sebenarnya
pengembangan kota di daerah sudah dipermudah dengan adanya progam otonomi daerah,
sehigga pemerintah daerah mempunyai otoritas yang lebih besar untuk membagun daerah
masing-masing. Semua elemen harus terlibat, pemerintah sebagai pengelola kebijakan,
masyarakat sebagai objek, pemilik modal sebagai investor yang menopang pertumbuhan
ekonomi.

33

URBANISASI DI TENGAH ARUS BALIK MUDIK


Perpindahan penduduk dari desa ke kota besar secara masif atau yang biasa disebut urbanisasi memang tidak ada
habisnya. Termasuk pada momen arus balik Idul Fitri tahun ini. Usai merayakan Lebaran di kampung halaman, para
pemudik yang balik ke kota tempat mereka bekerja, tidak sedikit yang mengajak serta sanak saudara atau teman untuk
mengadu nasib di tanah rantau. Ketimpangan ekonomi antara di daerah dan kota besar dianggap sebagai penyebab
utama. Walhasil, kota besar seperti Jakarta menjadi tujuan utama urbanisasi.
Pengamat kebijakan publik Universitas Indonesia (UI) Agus Pambagio menilai bahwa dalam menekan laju urbanisasi
yang dateng ke Jakarta bukan hanya beban dari Pemerintah Provinsi (Pemprov) DKI Jakarta namun juga melibatkan
Pemerintah Daerah (Pemda) lainnya. Pasalnya, kata Agus, Pemprov DKI Jakarta tidak memiliki wewenang untuk
melarang orang datang ke Jakarta. Menurut Agus, tidak ada larangan bagi penduduk Indonesia selama bermigrasi di
wilayah Negara Kesatuan Republik Indonesia (NKRI). "Semua itu telah diatur dalam undang-undang," tandas Agus
saat dihubungi, Minggu (3/8).
Agus menuturkan, motivasi penduduk ke wilayah perkotaan, khususnya kota besar, itu tidak terlepas dari faktor
ekonomi, yakni berharap dapat mengubah hidup dan ekonomi keluarga. Keinginan itu, ujarnya, tidak bisa didapatkan
di daerah asal karena minimnya lapangan pekerjaan, investasi, dan industri. Selama ini, lanjutnya, salah satu pemicu
meningkatnya perekonomian daerah adalah menjamurnya industri atau meningkatnya perekonomian.
Hal itu secara otomatis akan berkorelasi dengan penyerapan tenaga kerja. Selama kondisi itu tidak sebanding dengan
Jakarta, ungkap Agus, maka ibu kota negara ini akan terus menjadi sasaran urbanisasi. "Penduduk itu hanya cari hidup
memenuhi kebutuhan ekonomi pribadi atau keluarga mereka," terangnya.
Sementara itu, Pengamat Sosial Politik Lembaga Ilmu Penelitian Indonesia (LIPI) Fachry Ali mengatakan Badan
Perencanaan Pembangunan Nasional (Bappenas) mestinya dapat membendung arus urbanisasi. "Meski ada peraturan
otonomi daerah, pemda tidak bisa bertindak sendiri. Contohnya di Jakarta, pusat harus menopang Pemda DKI,"
ujarnya.
Menurut Fachry, derasnya urbanisasi ke Jakarta disebabkan pembangunan tidak merata di pedesaan, karena itu harus
ada industrialisasi di pedesaan. "Harus ada industrialisasi di pedesaan agar uang itu beredar di desa, kalau sekarang
uang itu tidak beredar di desa jadi untuk mencari Rp 100 ribu saja itu sangat susah," ujarnya.
Dia juga menjelaskan, kalau terjadi pembangunan di pedesaan maka kota-kota kecil pada tingkat kecamatan akan
menjadi penyangga arus urbanisasi sehingga mereka tidak harus mencari pekerjaan ke DKI Jakarta. "Selama ini orang
ke Jakarta itu karena lebih mudah mencari uang. Kebijakan pembangunan pada tingkat nasional yang bisa mengatasi
itu bukan hanya oleh Pemprov DKI Jakarta. Rakyat tidak bisa disalahkan karena mereka harus mencari uang bukan
saja untuk makan tapi untuk sekolah anaknya serta keperluan lainnya," ulasnya.
Menurut perkiraan PT Angkutan Sungai, Danau, dan Penyeberangan (ASDP) Indonesia Ferry (Persero) arus
urbanisasi dari Pulau Sumatera ke Jawa pada 2014 ini akan meningkat sekitar 20% atau sekitar 80.000 sampai
100.000 orang. Angka urbanisasi naik dari tahun sebelumnya yang berkisar pada angka 14%.
Di lain pihak, memang tidak ada aturan larangan bagi warga negara Indonesia untuk berurbanisasi. Apalagi, kemajuan
suatu daerah atau kota yang memiliki potensi ekonomi lebih baik dianggap sebagai hal yang wajar didatangi warga
dari berbagai daerah. Sejumlah kalangan juga mengaku tidak setuju apabila ada kebijakan pemerintah yang melarang
atau membatasi warga untuk datang ke suatu kota dengan tujuan ingin meraih kesuksesan hidup. Pasalnya, seluruh
warga di Tanah Air dapat tinggal dimana saja tanpa ada aturan yang menghalangi kedatangan mereka ke seluruh
wilayah NKRI.

34

Pendidikan menengah kejuruan bertujuan untuk menyiapkan peserta didik terutama untuk bekerja dalam bidang
tertentu. Tujuan tersebut dapat dijabarkan lagi oleh Dikmenjur (2003) menjadi tujuan umum dan tujuan khusus.
Tujuan umum, sebagai bagian dari sistem pendidikan menengah kejuruan (SMK) bertujuan :
1.

menyiapkan peserta didik agar dapat menjalani kehidupan secara layak,

2.

meningkatkan keimanan dan ketakwaan peserta didik,

3.

menyiapkan peserta didik agar menjadi warga negara yang mandiri dan bertanggung jawab,

4.

menyiapkan peserta didik agar memahami dan menghargai keanekaragaman budaya bangsa Indonesia,

5.
menyiapkan peserta didik agar menerapkan dan memelihara hidup sehat, memiliki wawasan lingkungan,
pengetahuan dan seni.
Tujuan khusus, SMK bertujuan :
1.
menyiapkan peserta didik agar dapat bekerja, baik secara mandiri atau mengisi lapangan pekerjaan yang ada
di dunia usaha dan industri sebagai tenaga kerja tingkat menengah, sesuai dengan bidang dan program keahlian yang
diminati,
2.
membekali peserta didik agar mampu memilih karir, ulet dan gigih dalam berkompetensi dan mampu
mengembangkan sikap profesional dalam bidang keahlian yang diminati, dan
35

3.
membekali peserta didik dengan Ilmu Pengetahuan dan Teknologi (IPTEK) agar mampu mengembangkan diri
sendiri melalui jenjang pendidikan yang lebih tinggi.
Kenyataan:
Fenomena peralihan dari jenjang khususnya dari SLTP ke SLTA yang sudah mulai erat kaitannya dengan karir masa
depan anak. Jenjang SLTP yang dalam sistem pendidikan nasional berbentuk SMP dan M.Ts. Dalam memilih lebih
banyak merupakan oleh pilihan orang tua dari pada pilihan anak. Kenyataan yang terlihat dimana-mana adalah anakanak mereka ramai-ramai masuk ke SMA tanpa tahu mengapa harus masuk SMA. Sangat sedikit jumlahnya yang
melanjutkan studi ke Sekolah Kejuruan (SMK). Perbandingannya cukup fantastis. Secara nasional, menurut data di
Depdiknas, prosentase peminat SMK kecil dari 5%. Hanya ada di empat provinsi (DKI, Jawa Barat, Jateng, Jatim)
peminat lulusan SLTP melanjutkan ke SMK di atas 10%. Selebihnya sangat mengharukan, karena di sebagian besar
daerah, peminat masuk SMK di bawah 2%.
Meskipun pendidikan kejuruan di negara kita sudah dimulai lebih seabad yang Design pendidikan kejuruan oleh
karena itu, tidak pernah terlihat posisi pendidikan kejuruan dalam pembangunan nasional dan dalam pembangunan
pendidikan. Bila anda berkunjung ke kantor Diknas provinsi ataupun Kab./Kota anda tidak lagi menemukan direktorat
Dikemenjur karena sudah diciutkan menjadi bagian kecil saja dari pendidikan (umum) menengah. Mungkin cukup
diurus secara sambilan oleh tenaga yang tidak perlu memahami apakah itu substansi kejuruan, masyarakat kecil
kurang mengetahui kelebihan dari pendidikan kejuruan.
1.

Rumusan Masalah

Pendidikan kejuruan adalah sekolah dengan biaya mahal, karena untuk mendidik siswa yang trampil dibutuhkan
peralatan dan bahan, laboratorium dan bengkel kerja. Bila berbagai masalah internal persekolahan kejuruan dibenahi,
maka reputasi pendidikan kejuruan secara berangsur dapat dikembalikan.
Sebuah masalah krusial lain sebagai penyebab sulitnya mengurus pendidikan kejuruan seperti, kurangnya dukungan
pemerintah dalam hal kewajiban dunia usaha untuk ikut bertanggungjawab atas penyelenggaraan pendidikan kejuruan.
Kita hanya punya CSR (Corporate Social Responsibility) yang bersifat sukarela perusahaan atas kehidupan sosial di
sekitarnya. CSR bagi banyak perusahaan dianggap musuh utama dari tujuan pokok perusahaan yaitu mencari
keuntungan sebesar-besarnya. Sejumlah SMK maju memang sudah berhasil menjalin kerjasama dengan perusahaan
besar maupun kecil.
1.

Salah satu rumusan alternatif.

Di semua negara maju ada undang-undang pendidikan kejuruan (Vocational Acts) yang mengatur dan melindungi
fungsi dan tugas dunia industri terhadap pendidikan kejuruan. Para guru dan instruktur praktek harus trampil lahir dan
batin dan perlu secara berkala meng-update ketrampilan dan pengetahuannya di dunia kerja. Perlu pula menjalin
hubungan kerjasama dengan pihak industri dan dunia kerja, serta berbagai urusan lainnya, yang semuanya merupakan
tanggung jawab pemerintah/Diknas.
Dalam proses pendidikan kejuruan perlu ditanamkan pada siswa pentingnya penguasaan pengetahuan dan teknologi,
keterampilan bekerja, sikap mandiri, efektif dan efisien dan pentingnya keinginan sukses dalam karirnya sepanjang
hayat. Dengan kesungguhan dalam mengikuti pendidikan kejuruan maka para lulusan kelak dapat menjadi manusia
yang bermartabat dan mandiri serta menjadi warga negara yang mampu membayar pajak.
1.
1.

Potensi dan limitasi alternatif kebijakan


Potensi

Berdasarkan pengamatan kasat mata, kenyataan yang terlihat di setiap kota hanya ada dua atau tiga SMK saja yang
memiliki siswa sesuai dengan daya tampung. Umumnya merupakan SMK Negeri yang dapat perhatian khusus dari
Diknas. Sisanya merupakan SMK yang memprihatinkan dan kelihatannya tidak terurus. Kondisi ini bermula sejak
sepuluh tahun terakhir dan semakin hari semakin memprihatinkan. Jumlah siswa yang kecil sangat mempengaruhi
pengelolaan, dan ibarat penyakit, seperti tidak terobati. Bagi sekolah swasta, sumber dana satu-satunya adalah dari
36

siswa yang semakin hari semakin susut. Honor guru dan pengelola semakin kecil dan tentu saja, kualitas pendidikan
yang memang sudah rendah semakin tidak pernah dibicarakan lagi, pasrah.
1.

Limitasi

Masyarakat yang pemahamannya rata-rata pada tingkat awam, melihat bahwa anak-anak yang tamat SMK umumnya
tidak memiliki ketrampilan untuk memasuki dunia kerja, di samping peluang kerja itu sendiri juga semakin sulit. Jadi,
untuk apa masuk SMK, kan lebih baik SMA saja. Bila kita menggunakan logika hukum sebab akibat, maka fenomena
ramai-ramai ke SMA hanyalah akibat saja dari sejumlah sebab. Berangkat dari asumsi bahwa kita semua setuju
pentingnya peran SMK dalam mempersiapkan tenaga kerja yang trampil, mendidik anak-anak untuk mandiri,
menurunkan angka pengangguran, mengurangi angka kejahatan dan meningkatkan pemasukan pajak untuk negara,
maka perlu dilakukan analisis untuk mengidentifikasi faktor-faktor penyebab, dan pada gilirannya dapat dirancang
program-program apakah yang perlu dilakukan untuk menata masa depan pendidikan kejuruan di Indonesia.
1.

Rekomendasi kebijakan

Sesungguhnya, tidak ada cara singkat untuk menyelesaikan pendidikan kejuruan. Untuk bisa keluar dari kemelut
pendidikan kejuruan, maka ada beberapa strategi yang dapat disarankan. Meningkatkan jumlah siswa SMK yang pada
masa sekarang 3 siswa SMK berbanding 7 siswa SMA menjadi 6 siswa SMK dan 4 Siswa SMA. Beberapa saran
dapat dikemukakan sebagai berikut:
1.
Perbaiki SMK Negeri dan Swasta yang ada saat ini secara total, mulai dari kurikulum, tenaga pendidik, dana
operasional, fasilitas, dan manajemen persekolahan. Kerjasama dengan pihak industri dan organisasi profesi perlu
ditingkatkan melalui kebijakan daerah (Perda) sehingga kewajiban bersama pemerintah dan masyarakat dapat
diwujudkan Kerjasama juga perlu diadakan dengan penunjukan Lembaga Pendidikan Tenaga Kependidikan sebagai
perguruan tinggi pembina.
2.
Pada jenjang SLTP diperlukan program bimbingan karir, agar siswa SLTP dan para orang tua memahami
tersedianya sekolah alternatif pada jenjang SLTA yang tidak kalah pentingnya dalam menjalani kehidupan kelak bila
anak sudah dewasa. Kegiatan open house oleh pihak SMK dan sosialisasi tentang pentingnya pendidikan kejuruan
dengan mengundang siswa SLTP dlaksanakan secara terprogram dan menarik. Diharapkan tidak lagi terjadi ramairamai ke SMA tanpa tahu mengapa ke SMA.
3.
Setiap pendirian SMK baru harus disertai studi kelayakan yang benar agar jenis program yang dibuka benarbenar sejalan dengan potensi unggulan daerah. Bahkan perlu dikaji ulang keberadaan SMK yang sudah ada saat ini
apakah masih layak, sejalan dan akan berkontribusi dengan pembangunan daerah. Berbagai inovasi program perlu
dilakukan untuk merespon perkembangan teknologi.
4.
Untuk menambah jumlah siswa kejuruan, di SMA dapat dibuka program kejuruan, seperti Akuntansi,
Perhotelan, Pariwisata, Busana, Boga, Komputer dan Sistem Informatika.
5.
Bagi tamatan SMK yang belum memiliki ketrampilan siap pakai, perlu dirancang program bridging, kursus
singkat dan padat namun mampu mempersiapkan mereka untuk terjun ke dunia kerja. Program ini dilakukan di SMK
dan merupakan bagian integral dari program sekolah.
TENTANG SMK ( SEKOLAH MENENGAH KEJURUAN)
Sekolah Menengah Kejuruan atau yang disebut SMK adalah bagian terpadu dari Sistem
Pendidikan Nasional, yang mempunyai peranan penting didalam menyiapkan dan
pengembangan Sumber Daya Manusia (SDM). SMK Negeri 1 RONGGA juga ikut serta dalam
menyiapkan dan mencerdaskan peserta didik untuk memiliki kemampuan dan keterampilan
sehingga dapat memenuhi kebutuhan / tuntutan Dunia Usaha/Industri atau berwira usaha,
sesuai
dengan
Visi
dan
Misi
yang
ditetapkan
SMK
Negeri
1
RONGGA
Banyak kontroversi tentang pengertian pendidikan kejuruan, semula pendidikan kejuruan
didefinisikan sebagai vocational educational is simply training for skills, training the hands
(Vocational Instructional Service, 1989). Pendidikan kejuruan merupakan latihan sederhana
untuk menguasai suatu keterampilan, yaitu keterampilan tangan. Pada abad kesembilan belas
37

dimunculkan konsep baru tentang pendidikan kejuruan, yaitu dengan dimasukkannya


pendidikan kejuruan ke dalam pemberdayaan profesional, seperti halnya hukum, profesi
keinsinyuran,
kedokteran,
keperawatan
dan
profesional
lainnya.
Schippers (1994), mengemukakan bahwa pendidikan kejuruan adalah pendidikan non
akademis yang berorientasi pada praktek-praktek dalam bidang pertukangan, bisnis, industri,
pertanian, transportasi, pelayanan jasa, dan sebagainya. Dalam Undang-undang Sistem
Pendidikan Nasional (UUSPN) No. 20 tahun 2003 pasal 15 menyatakan bahwa pendidikan
kejuruan adalah pendidikan menengah yang mempersiapkan peserta didik terutama untuk
bekerja
dalam
bidang
tertentu.
Pendidikan kejuruan adalah pendidikan yang menghubungkan, menjodohkan, melatih
manusia agar memiliki kebiasaan bekerja untuk dapat memasuki dan berkembang pada dunia
kerja (industri), sehingga dapat dipergunakan untuk memperbaiki kehidupannya. Selanjutnya
Calhoun
(1982:22)
mengemukakan
:
Vocational education is concerned with preparing people for work and with improving the
training potential of the labor force. It covers any forms of education, training, or retraining
designed to prepare people to enter or to continue in employment in a recognized occupation.
Memahami pendapat di atas dapat diketahui bahwa pendidikan kejuruan berhubungan
dengan mempersiapkan seseorang untuk bekerja dan dengan memperbaiki pelatihan potensi
tenaga kerja. Hal ini meliputi berbagai bentuk pendidikan, pelatihan, atau pelatihan lebih
lanjut yang dibentuk untuk mempersiapkan seseorang untuk memasuki atau melanjutkan
pekerjaan dalam suatu jabatan yang sah. Dapat dikatakan pendidikan kejuruan (SMK) adalah
bagian dari sistem pendidikan nasional yang bertujuan mempersiapkan tenaga yang memiliki
keterampilan dan pengetahuan sesuai dengan kebutuhan persyaratan lapangan kerja dan
mampu mengembangkan potensi dirinya dalam mengadopsi dan beradaptasi dengan
perkembangan teknologi. Dalam proses pendidikan kejuruan perlu ditanamkan pada siswa
pentingnya penguasaan pengetahuan dan teknologi, keterampilan bekerja, sikap mandiri,
efektif dan efisien dan pentingnya keinginan sukses dalam karirnya sepanjang hayat. Dengan
kesungguhan dalam mengikuti pendidikan kejuruan maka para lulusan kelak dapat menjadi
manusia yang bermartabat dan mandiri serta menjadi warga negara yang mampu membayar
pajak.
Pendidikan SMK merupakan bagian dari sistem pendidikan nasional yang diselenggarakan
sebagai
lanjutan
dari
SMP/MTS
:
a. Sesuai dengan bakat, minat, dan kemampuan dalam rangka memenuhi
kebutuhan/kesempatan kerja yang sedang dan akan berkembang pada daerah tersebut.
b.
Lulusan
SMK
merupakan
tenaga
terdidik,
terlatih,
dan
terampil.
c. Mampu mengikuti pendidikan lanjutan dan atau menyesuaikan dengan perubahan
teknologi.
d.
Berdampak
sebagai
pendukung
pertumbuhan
industri
(kecil
atau
besar).
e.
Mengurangi
angka
pengangguran
dan
kriminalitas.
f. Pertumbuhan ekonomi dan pendapatan negara melalui pajak penghasilan dan pertambahan
nilai.
b.
Tujuan
Pendidikan
Kejuruan
Prosser (1949), mengemukakan bahwa pendidikan kejuruan akan lebih efektif jika mampu
merubah individu sesuai dengan perhatian, sifat dan tingkat intelegensinya pada tingkat
setinggi mungkin, artinya setelah melakukan pendidikan dan pelatihan (diklat) para peserta
latihan meningkat keterampilannya. Acuan keberhasilan suatu program pendidikan kejuruan
menurut pendapat Lesgold (1996), yaitu harus memperhatikan : (1) Sasaran produk haruslah
terdefinisi secara baik, akurat, dan jelas yang merupakan interaksi yang intens antara sekolah
dengan masyarakat, (2) perlengkapan (sarana dan prasarana) yang dibutuhkan untuk
mencapai yang telah ditetapkan haruslah mencukupi, sehingga merupakan unsur penjamin
bahwa sasaran yang telah ditetapkan dapat dicapai secara baik, (3) spesifikasi tim sukses
atau tim pelaksana program yang akan bertanggung jawab terhadap keberhasilan sasaran
haruslah lengkap dan jelas, (4) penelitian atau pengkajian terus menerus dan
berkesinambungan agar dapat diketahui, sehingga langkah perbaikan dan penanggulangan
dapat
ditetapkan
segera.
Pada dasarnya pendidikan kejuruan menurut Indrajati Sidi (2003) berdasarkan kebutuhan
nyata pasar keja. Untuk dapat merealisasikan program ini maka peran serta dunia usaha dan
industri sangat diperlukan. Bahkan perlu mendudukkan mereka dalam posisi yang penting,
38

sehingga program kejuruan ditawarkan benar-benar sesuai dengan kebutuhan. Lebih lanjut
dijelaskan bahwa sistem pendidikan kejuruan yang memberikan standar kompetensi nasional
yang baku. Standar kompetensi, standar kurikulum dan standar pengujian dimaksudkan untuk
menjamin bahwa sistem pendidikan kejuruan benar-benar memberikan kompetensi yang
telah dibutuhkan oleh industri. Oleh karenanya ukuran mutu tamatan pendidikan kejuruan
tidak hanya dilihat dari hasil Ujian Akhir Nasional., tetapi juga dari kompetensi yang dicapai.
Ketercapaian kompetensi dilihat dari keterampilan. Setiap keterampilan yang dicapai
diberikan sertifikat oleh lembaga yang berwenang seperti majelis pendidikan kejuruan
nasional
(MPKN).
UUSPN No. 20 tahun 2003 pasal 15, menyatakan pendidikan menengah kejuruan bertujuan
untuk menyiapkan peserta didik terutama untuk bekerja dalam bidang tertentu. Tujuan
tersebut dapat dijabarkan lagi oleh Dikmenjur (2003) menjadi tujuan umum dan tujuan
khusus,
sebagai
berikut
:
Tujuan umum, sebagai bagian dari sistem pendidikan menengah kejuruan SMK bertujuan : (1)
menyiapkan peserta didik agar dapat menjalani kehidupan secara layak, (2) meningkatkan
keimanan dan ketakwaan peserta didik, (3) menyiapkan peserta didik agar menjadi warga
negara yang mandiri dan bertanggung jawab, (4) menyiapkan peserta didik agar memahami
dan menghargai keanekaragaman budaya bangsa Indonesia, dan (5) menyiapkan peserta
didik agar menerapkan dan memelihara hidup sehat, memiliki wawasan lingkungan,
pengetahuan
dan
seni.
Tujuan khusus, SMK bertujuan : (1) menyiapkan peserta didik agar dapat bekerja, baik secara
mandiri atau mengisi lapangan pekerjaan yang ada di dunia usaha dan industri sebagai
tenaga kerja tingkat menengah, sesuai dengan bidang dan program keahlian yang diminati,
(2) membekali peserta didik agar mampu memilih karir, ulet dan gigih dalam berkompetensi
dan mampu mengembangkan sikap profesional dalam bidang keahlian yang diminati, dan (3)
membekali peserta didik dengan Ilmu Pengetahuan dan Teknologi (IPTEK) agar mampu
mengembangkan
diri
sendiri
melalui
jenjang
pendidikan
yang
lebih
tinggi.
Kompetensi lulusan pendidikan kejuruan sebagai subsistem dari sistem pendidikan nasional
menurut Depdikbud (2001) adalah : (1) penghasil tamatan yang memiliki keterampilan dan
penguasaan IPTEK dengan bidang dari tingkat keahlian yang sesuai dengan kebutuhan
pembangunan, (2) penghasil tamatan yang memiliki kemampuan produktif, penghasil sendiri,
mengubah status tamatan dari status beban menjadi aset bangsa yang mandiri, (3) penghasil
penggerak perkembangna industri Indonesia yang kompetitif menghadapi pasar global, (4)
penghasil tamatan dan sikap mental yang kuat untuk dapat mengembangkan dirinya secara
berkelanjutan. Dikmenjur (2000) mengatakan bahwa hasil kerja pendidikan harus mampu
menjadi pembeda dari segi unjuk kerja, produktifitas, dan kualitas hasil kerja dibandingkan
dengan
tenaga
kerja
tanpa
pendidikan
kejuruan.
Jadi pendidikan kejuruan adalah suatu lembaga yang melaksanakan proses pembelajaran
keahlian tertentu beserta evaluasi berbasis kompetensi, yang mempersiapkan siswa menjadi
tenaga kerja setingkat teknisi (Wakhinuddin S).
Pendidikan menengah kejuruan bertujuan untuk menyiapkan peserta didik terutama untuk bekerja dalam bidang
tertentu. Tujuan tersebut dapat dijabarkan lagi oleh Dikmenjur (2003) menjadi tujuan umum dan tujuan khusus.
Tujuan umum, sebagai bagian dari sistem pendidikan menengah kejuruan (SMK) bertujuan :
1.

menyiapkan peserta didik agar dapat menjalani kehidupan secara layak,

2.

meningkatkan keimanan dan ketakwaan peserta didik,

3.

menyiapkan peserta didik agar menjadi warga negara yang mandiri dan bertanggung jawab,

4.

menyiapkan peserta didik agar memahami dan menghargai keanekaragaman budaya bangsa Indonesia,

5.
menyiapkan peserta didik agar menerapkan dan memelihara hidup sehat, memiliki wawasan lingkungan,
pengetahuan dan seni.
39

Tujuan khusus, SMK bertujuan :


1.
menyiapkan peserta didik agar dapat bekerja, baik secara mandiri atau mengisi lapangan pekerjaan yang ada
di dunia usaha dan industri sebagai tenaga kerja tingkat menengah, sesuai dengan bidang dan program keahlian yang
diminati,
2.
membekali peserta didik agar mampu memilih karir, ulet dan gigih dalam berkompetensi dan mampu
mengembangkan sikap profesional dalam bidang keahlian yang diminati, dan
3.
membekali peserta didik dengan Ilmu Pengetahuan dan Teknologi (IPTEK) agar mampu mengembangkan diri
sendiri melalui jenjang pendidikan yang lebih tinggi.
Kenyataan:
Fenomena peralihan dari jenjang khususnya dari SLTP ke SLTA yang sudah mulai erat kaitannya dengan karir masa
depan anak. Jenjang SLTP yang dalam sistem pendidikan nasional berbentuk SMP dan M.Ts. Dalam memilih lebih
banyak merupakan oleh pilihan orang tua dari pada pilihan anak. Kenyataan yang terlihat dimana-mana adalah anakanak mereka ramai-ramai masuk ke SMA tanpa tahu mengapa harus masuk SMA. Sangat sedikit jumlahnya yang
melanjutkan studi ke Sekolah Kejuruan (SMK). Perbandingannya cukup fantastis. Secara nasional, menurut data di
Depdiknas, prosentase peminat SMK kecil dari 5%. Hanya ada di empat provinsi (DKI, Jawa Barat, Jateng, Jatim)
peminat lulusan SLTP melanjutkan ke SMK di atas 10%. Selebihnya sangat mengharukan, karena di sebagian besar
daerah, peminat masuk SMK di bawah 2%.
Meskipun pendidikan kejuruan di negara kita sudah dimulai lebih seabad yang Design pendidikan kejuruan oleh
karena itu, tidak pernah terlihat posisi pendidikan kejuruan dalam pembangunan nasional dan dalam pembangunan
pendidikan. Bila anda berkunjung ke kantor Diknas provinsi ataupun Kab./Kota anda tidak lagi menemukan direktorat
Dikemenjur karena sudah diciutkan menjadi bagian kecil saja dari pendidikan (umum) menengah. Mungkin cukup
diurus secara sambilan oleh tenaga yang tidak perlu memahami apakah itu substansi kejuruan, masyarakat kecil
kurang mengetahui kelebihan dari pendidikan kejuruan.
1.

Rumusan Masalah

Pendidikan kejuruan adalah sekolah dengan biaya mahal, karena untuk mendidik siswa yang trampil dibutuhkan
peralatan dan bahan, laboratorium dan bengkel kerja. Bila berbagai masalah internal persekolahan kejuruan dibenahi,
maka reputasi pendidikan kejuruan secara berangsur dapat dikembalikan.
Sebuah masalah krusial lain sebagai penyebab sulitnya mengurus pendidikan kejuruan seperti, kurangnya dukungan
pemerintah dalam hal kewajiban dunia usaha untuk ikut bertanggungjawab atas penyelenggaraan pendidikan kejuruan.
Kita hanya punya CSR (Corporate Social Responsibility) yang bersifat sukarela perusahaan atas kehidupan sosial di
sekitarnya. CSR bagi banyak perusahaan dianggap musuh utama dari tujuan pokok perusahaan yaitu mencari
keuntungan sebesar-besarnya. Sejumlah SMK maju memang sudah berhasil menjalin kerjasama dengan perusahaan
besar maupun kecil.
1.

Salah satu rumusan alternatif.

Di semua negara maju ada undang-undang pendidikan kejuruan (Vocational Acts) yang mengatur dan melindungi
fungsi dan tugas dunia industri terhadap pendidikan kejuruan. Para guru dan instruktur praktek harus trampil lahir dan
batin dan perlu secara berkala meng-update ketrampilan dan pengetahuannya di dunia kerja. Perlu pula menjalin
hubungan kerjasama dengan pihak industri dan dunia kerja, serta berbagai urusan lainnya, yang semuanya merupakan
tanggung jawab pemerintah/Diknas.
Dalam proses pendidikan kejuruan perlu ditanamkan pada siswa pentingnya penguasaan pengetahuan dan teknologi,
keterampilan bekerja, sikap mandiri, efektif dan efisien dan pentingnya keinginan sukses dalam karirnya sepanjang
hayat. Dengan kesungguhan dalam mengikuti pendidikan kejuruan maka para lulusan kelak dapat menjadi manusia
yang bermartabat dan mandiri serta menjadi warga negara yang mampu membayar pajak.
1.

Potensi dan limitasi alternatif kebijakan


40

1.

Potensi

Berdasarkan pengamatan kasat mata, kenyataan yang terlihat di setiap kota hanya ada dua atau tiga SMK saja yang
memiliki siswa sesuai dengan daya tampung. Umumnya merupakan SMK Negeri yang dapat perhatian khusus dari
Diknas. Sisanya merupakan SMK yang memprihatinkan dan kelihatannya tidak terurus. Kondisi ini bermula sejak
sepuluh tahun terakhir dan semakin hari semakin memprihatinkan. Jumlah siswa yang kecil sangat mempengaruhi
pengelolaan, dan ibarat penyakit, seperti tidak terobati. Bagi sekolah swasta, sumber dana satu-satunya adalah dari
siswa yang semakin hari semakin susut. Honor guru dan pengelola semakin kecil dan tentu saja, kualitas pendidikan
yang memang sudah rendah semakin tidak pernah dibicarakan lagi, pasrah.
1.

Limitasi

Masyarakat yang pemahamannya rata-rata pada tingkat awam, melihat bahwa anak-anak yang tamat SMK umumnya
tidak memiliki ketrampilan untuk memasuki dunia kerja, di samping peluang kerja itu sendiri juga semakin sulit. Jadi,
untuk apa masuk SMK, kan lebih baik SMA saja. Bila kita menggunakan logika hukum sebab akibat, maka fenomena
ramai-ramai ke SMA hanyalah akibat saja dari sejumlah sebab. Berangkat dari asumsi bahwa kita semua setuju
pentingnya peran SMK dalam mempersiapkan tenaga kerja yang trampil, mendidik anak-anak untuk mandiri,
menurunkan angka pengangguran, mengurangi angka kejahatan dan meningkatkan pemasukan pajak untuk negara,
maka perlu dilakukan analisis untuk mengidentifikasi faktor-faktor penyebab, dan pada gilirannya dapat dirancang
program-program apakah yang perlu dilakukan untuk menata masa depan pendidikan kejuruan di Indonesia.
1.

Rekomendasi kebijakan

Sesungguhnya, tidak ada cara singkat untuk menyelesaikan pendidikan kejuruan. Untuk bisa keluar dari kemelut
pendidikan kejuruan, maka ada beberapa strategi yang dapat disarankan. Meningkatkan jumlah siswa SMK yang pada
masa sekarang 3 siswa SMK berbanding 7 siswa SMA menjadi 6 siswa SMK dan 4 Siswa SMA. Beberapa saran
dapat dikemukakan sebagai berikut:
1.
Perbaiki SMK Negeri dan Swasta yang ada saat ini secara total, mulai dari kurikulum, tenaga pendidik, dana
operasional, fasilitas, dan manajemen persekolahan. Kerjasama dengan pihak industri dan organisasi profesi perlu
ditingkatkan melalui kebijakan daerah (Perda) sehingga kewajiban bersama pemerintah dan masyarakat dapat
diwujudkan Kerjasama juga perlu diadakan dengan penunjukan Lembaga Pendidikan Tenaga Kependidikan sebagai
perguruan tinggi pembina.
2.
Pada jenjang SLTP diperlukan program bimbingan karir, agar siswa SLTP dan para orang tua memahami
tersedianya sekolah alternatif pada jenjang SLTA yang tidak kalah pentingnya dalam menjalani kehidupan kelak bila
anak sudah dewasa. Kegiatan open house oleh pihak SMK dan sosialisasi tentang pentingnya pendidikan kejuruan
dengan mengundang siswa SLTP dlaksanakan secara terprogram dan menarik. Diharapkan tidak lagi terjadi ramairamai ke SMA tanpa tahu mengapa ke SMA.
3.
Setiap pendirian SMK baru harus disertai studi kelayakan yang benar agar jenis program yang dibuka benarbenar sejalan dengan potensi unggulan daerah. Bahkan perlu dikaji ulang keberadaan SMK yang sudah ada saat ini
apakah masih layak, sejalan dan akan berkontribusi dengan pembangunan daerah. Berbagai inovasi program perlu
dilakukan untuk merespon perkembangan teknologi.
4.
Untuk menambah jumlah siswa kejuruan, di SMA dapat dibuka program kejuruan, seperti Akuntansi,
Perhotelan, Pariwisata, Busana, Boga, Komputer dan Sistem Informatika.
5.
Bagi tamatan SMK yang belum memiliki ketrampilan siap pakai, perlu dirancang program bridging, kursus
singkat dan padat namun mampu mempersiapkan mereka untuk terjun ke dunia kerja. Program ini dilakukan di SMK
dan merupakan bagian integral dari program sekolah.

41

MAKASSAR, FAJARWacana untuk mengembalikan pemilihan wali kota/bupati ke DPRD dianggap sebuah
kemunduran demokrasi. Beberapa pihak mengusulkan agar pemilukada langsung dipertahankan.
DIREKTUR Eksekutif TIFA Foundation, Irman G Lanti mengatakan, demokrasi di Indonesia sudah relatif baik.
Penentuan jabatan publik dilakukan melalui pemilihan. Tidak ada lagi penunjukan.
Jika dibandingkan dengan era orde baru, katanya, maka saat ini jauh lebih maju. Masyarakat juga bebas menyatakan
pendapatnya. Termasuk bebas menentukan pemimpinnya. Irman yang juga dosen ilmu politik Universitas Padjajaran
(Unpad) Bandung, sistem yang ada sekarang masih punya kekurangan. Namun, tidak berarti bahwa pemilihan
langsung yang dihapus. Hanya perlu pembenahan.
Masalah lain, lanjutnya, pemerintah belum mampu memberikan pelayanan publik yang memadai. Kondisi itu
dikhawatirkan membuat masyarakat bernostalgia sehingga ada keinginan untuk kembali seperti masa lalu.
Pria asal Tombolo, Kabupaten Gowa itu menambahkan, pengembalian pemilihan kepala daerah ke DPRD belum tentu
menyelesaikan masalah. Politik uang, misalnya, malah bisa makin menjadi-jadi jika dikembalikan ke DPRD.
Saat ini, pemerintah dan DPR terus mematangkan rancangan undang-undang tentang pilkada. Salah satu poin penting
dalam rancangan tersebut adalah sistem pemilihan kepala daerah.
Pada 2015 mendatang, 11 daerah di Sulsel akan menggelar pemilihan kepala daerah. Sistemnya akan sangat
tergantung dengan pembahasan RUU Pilkada tersebut. Bagaimana tanggapan parpol? Beberapa pimpinan parpol
sepakat jika pemilukada langsung diteruskan. Namun, beberapa di antaranya setuju pemilihan kepala daerah
dikembalikan ke DPRD.
Ketua DPW PKB Sulsel, Azhar Arsyad mengatakan, jika dikembalikan ke DPRD, maka itu sebuah kemunduran
demokrasi. Dia malah curiga, wacana itu dimunculkan untuk mengakomodasi kepentingan elite tertentu.
Menurut saya, langkah itu (kembali ke DPRD) tidak akan menyelesaikan masalah, tambah Azhar, Rabu, 13
November.
Dia khawatir, politik transaksional bisa lebih parah jika pemilihan dikembalikan ke dewan. Yang perlu dilakukan,
katanya, adalah memperbaiki sistem yang ada saat ini.
Misalnya, incumbent harus cuti lebih lama sehingga tidak merusak birokrasi dan semacamnya, urai Azhar. Ketua
DPD Hanura Sulsel, Ambo Dalle dan Wakil Ketua DPD Partai Demokrat Sulsel, Nimatullah berpendapat sebaliknya.
Keduanya sepakat mengembalikan ke legislatif.
Kalau kembali ke DPRD, masyarakat di bawah tidak perlu lagi berselisih, kata Ambo Dalle yang juga anggota
DPRD Sulsel.
Dia juga menjadikan anggaran sebagai salah satu pertimbangan. Pemilukada langsung terlalu banyak menghamburkan
anggaran negara, Antara lain penyediaan logistik untuk pemilukada.
Hanya perlu diatur mekanisme pemilihannya sehingga jangan sampai money politics justru lebih parah, imbuh
Nimatullah. Anggota DPRD Sulsel ini mengatakan, perlu undang-undang yang memberi kekuatan partai
mengendalikan anggotanya di DPRD. Sehingga tidak bermain di mana-mana, kata Nimatullah. (*)
42

BAB I
PENDAHULUAN
A. Latar Belakang
Kata demokrasi terkesan akrab diucapkan oleh semua orang, namun apakah sudah dipahami hakekat kata demokrasi
itu. Untuk itu kita perlu memahami, apa sebenarnya makna dan hakekat demokrasi. Demokrasi telah dipilih dan
dijadikan sebagai sistem nilai dalam tatanan kehidupan manusia, baik dalam kehidupan berkeluarga, bermasyarakat
dan bernegara.1[1]
Demokrasi tidak akan datang, timbul dan berkembang dengan sendirinya dalam kehidupan bermasyarakat, berbangsa
dan bernegara. Oleh karena itu demokrasi memerlukan usaha nyata dan setiap warga dan perangkat penduduknya
yaitu budaya yang kondusif sebagai manifestasi dari suatu kerangka berfikir (mind set) dan rancangan masyarakat
(setting social). Bentuk kongkrit dari manifestasi tersebut adalah dijadikannya demokrasi sebagai pandangan hidup
(way of life) dalam seluk beluk sendi kehidupan baik oleh rakyat maupun oleh pemerintah. 2[2]
Pada tahun 1955 tersebut Indonesia melaksanakan pemilihan umum yang pertama dengan diikuti oleh lebih dari 10
(sepuluh) partai politik. Dalam catatan sejarah, pemilu tahun 1955 sebagai pemilu yang paling demokratis karena
disamping tidak ada korban jiwa juga berjalan dengan jujur, adil dan aman. Jika dibandingkan pemilu di era Orde
Baru yang berjalan mulai tahun 1971, 1977, 1982, 1987, 1992 dan 1997, sepanjang pelaksanaan pemilu tersebut,
banyak peristiwa politik berdarah dan cukup mencekam bagi masyarakat Indonesia.
Sejarah Pemilu di Era Orde Baru yang dilaksanakan sebanyak 6 (enam) kali tersebut yang sangat fenomenal dalam
pemilu Era Orde Baru tersebut, terpilih presiden yang sama yaitu; Jenderal Besar Mohammad Soeharto. Sedangkan di
era reformasi pemilu diselenggarakan tahun 1999 dan tahun 2004. Pada saat penggantian Rezim Orde Baru ke
Reformasi terjadi penggantian Presiden sebanyak 4 (empat) kali. Presiden B.J. Habibie sebagai presiden masa transisi
tahun 1998 s/d 1999 dan Presiden Abdulrahman Wachid tahun 1999 s/d 2001 hasil pemilu tahun 1999. Oleh karena
terjadinya peristiwa politik, timbulnya mosi tidak percaya dari rakyat, maka Presiden Abdulrahman Wachid
diberhentikan dari jabatan presiden, melalui Sidang Istimewa MPR. Kemudian dilanjutkan oleh Presiden Megawati
Soekarno Putri tahun 2001 s/d 2004. Adapun pemilu tahun 2004 merupakan pemilu pertama dalam sejarah politik di
Indonesia yaitu memilih presiden secara langsung. Hasil pemilu tahun 2004 sebagai presiden terpilih secara
demokratis adalah Susilo Bambang Yudhoyono dengan M. Yusuf Kalla sebagai wakilnya. 3[3]
B. Rumusan Masalah
Dari latar belakang di atas dapat di simpulkan rumusan masalah sebagai berikut:
1.

Pengertian Pemilu?

2.

Pengertian Demokrasi?

3.

Hubungan Pemilu dengan Demokrasi?

BAB II
PEMBAHASAN
A.

Pengertian Pemilu

1
2
3
43

Pemilu adalah suatu proses di mana para pemilih memilih orang-orang untuk mengisi jabatan-jabatan politik tertentu.
Jabatan-jabatan yang disini beraneka-ragam, mulai dari Presiden, wakil rakyat di berbagai tingkat pemerintahan,
sampai kepala desa. Pada konteks yang lebih luas, Pemilu dapat juga berarti proses mengisi jabatan-jabatan seperti
ketua OSIS atau ketua kelas, walaupun untuk ini kata pemilihan lebih sering digunakan. Sistem pemilu digunakan
adalah asas luber dan jurdil. Dalam Pemilu, para pemilih dalam Pemilu juga disebut konstituen, dan kepada merekalah
para peserta Pemilu menawarkan janji-janji dan program-programnya pada masa kampanye. Kampanye dilakukan
selama waktu yang telah ditentukan, menjelang hari pemungutan suara. Setelah pemungutan suara dilakukan, proses
penghitungan dimulai. Pemenang Pemilu ditentukan oleh aturan main atau sistem penentuan pemenang yang
sebelumnya telah ditetapkan dan disetujui oleh para peserta, dan disosialisasikan ke para pemilih. 4[4]
Waktu pelaksanaan, dan tujuan pemilihan diatur di dalam Pasal 22E ayat (1) dan ayat (2) UUD 1945, dan bukan di
dalam Pasal 22E ayat (6) yang mengatur tentang ketentuan pemberian delegasi pengaturan tentang pemilihan umum
dengan undang-undang. Asas Pemilu Langsung, Umum, Bebas, dan Rahasia Pemilu yang LUBER dan Jurdil
mengandung pengertian bahwa pemilihan umum harus diselenggarakan secara demokratis dan transparan,
berdasarkan pada asaas-asas pemilihan yang bersifat langsung, umum, bebas dan rahasia, serta jujur dan adil:
1.
Langsung berarti rakyat pemilih mempunyai hak untuk secara langsung memberikan suaranya sesuai dengan
kehendak hati nuraninya, tanpa perantara;
2.
Umum berarti pada dasarnya semua warganegara yang memenuhi persyaratan minimal dalam usia , yaitu
sudah berumur 17 (tujuh belas) tahun atau telah/pernah kawin berhak ikut memilih dalam pemilihan umum.
Warganegara yang sudah berumu 21 (dua puluh satu) tahun berhak di-pilih. Jadi, pemilihan yang bersifat umum
mengandung makna menjamin kesempatan yang berlaku menyeluruh bagi semua warga negara yang telah memenuhi
persyaratan tertentu tanpa diskriminasi (pengecualian) berdasar acuan suku, agama, ras, golongan, jenis kelamin,
kedaerahan, dan status sosial;
3.
Bebas berarti setiap warganegara yang berhak memilih bebas menentukan pilihannya tanpa tekanan dan
paksaan dari siapapun. Di dalam melaksanakan haknya, setiap warganegara dijamin keamanannya, sehingga dapat
memilih sesuai dengan kehendak hati nurani dan kepentingannya;
4.
Rahasia berarti dalam memberikan suaranya, pemilih dijamin bahwa pemilihnya tidak akan diketahui oleh
pihak manapun dan dengan jalan papun. Pemilih memberikan suaranya pada surat suara dengan tidak dapat diketahui
oleh orang lain kepada suaranya diberikan. Asas rahasia ini tidak berlaku lagi bagi pemilih yang telah keluar dari
tempat pemungutan suara dan secara sukarela bersedia mengungkapkan pilihannya kepada pihak manapun;
5.
Jujur berarti dalam menyelenggarakan pemilihan umum; penyelenggaraan/ pelaksana, pemerintah dan partai
politik peserta Pemilu, pengawas dan pemantau Pemilu, termasuk pemilih, serta semua pihak yang terlibat secara tidak
langsung, harus bersikap dan bertindak jujur sesuai dengan peraturan perundangan yang berlaku;
6.
Adil berarti dalam menyelenggarakan pem,ilu, setiap pemilih dan partai politik peserta Pemilu mendapat
perlakuan yang sama, serta bebas dari kecurangan pihak manapun. 5[5]
Dalam Undang-undang Nomor 22 Tahun 2007 Tentang Penyelenggara Pemilu diatur mengenai penyelenggara
Pemilihan Umum yang dilaksanakan oleh suatu Komisi Pemilihan Umum (KPU) yang bersifat nasional, tetap, dan
mandiri. Sifat nasional mencerminkan bahwa wilayah kerja dan tanggung jawab KPU sebagai penyelenggara
Pemilihan Umum mencakup seluruh wilayah Negara Kesatuan Republik Indonesia. Sifat tetap menunjukkan KPU
sebagai lembaga yang menjalankan tugas secara berkesinambungan meskipun dibatasi oleh masa jabatan tertentu.
Sifat mandiri menegaskan KPU dalam menyelenggarakan Pemilihan Umum bebas dari pengaruh pihak mana pun. 6[6]

4
5
6
44

Dalam undang-undang Nomor 22 Tahun 2007 Tentang Penyelenggara Pemilu diatur mengenai KPU, KPU Provinsi,
dan KPU Kabupaten/Kota sebagai lembaga penyelenggara pemilihan umum yang permanen dan Bawaslu sebagai
lembaga pengawas Pemilu. KPU dalam menjalankan tugasnya bertanggung jawab sesuai dengan peraturan
perundang-undangan serta dalam hal penyelenggaraan seluruh tahapan pemilihan umum dan tugas lainnya. KPU
memberikan laporan Presiden kepada Dewan Perwakilan Rakyat. 7[7]
B.
1.

Demokrasi
Pengertian Demokrasi

a.
Secara Etimologis
Istilah demokrasi berasal dari bahasa Yunani yaitu dari kata demos (rakyat) dan kratos (pemerintahan). Sehingga
demokrasi diartikan secara sederhana adalah pemerintahan oleh rakyat (rule of the people).
b.
Secara Terminologi
Secara terminologi demokrasi dapat diartikan sebagai berikut, misalnya:
1)
Menurut Koentjoro Poerbopranoto (1978) dalam bukunya Sistem Pemerintahan Demokrasi, menyatakan
demokrasi adalah suatu sistem pemerintahan negara dimana dalam pokoknya semua orang (rakyat) adalah berhak
sama untuk memerintah dan juga untuk diperintah.
2)
Afan Gafar (2003:3) menyatakan ada dua macam pemahaman tentang demokrasi yaitu pemahaman secara
normatif dan pemahaman secara empirik. Dalam pemahaman secara normatif, demokrasi merupakan sesuatu yang
secara idiil hendak dilakukan atau diselenggarakan oleh sebuah negara, seperti ungkapan Pemerintahan Dari Rakyat,
Oleh Rakyat Dan Untuk Rakyat. Ungkapan normatif tersebut biasanya diterjemahkan dalam konstitusi pada masingmasing negara, misalnya dalam UUD 1945 sebagai pemerintahan Republik Indonesia yakni :
a)
Kedaulatan berada di tangan rakyat dan dilaksanakan menurut undang-undang dasar (pasal 1 ayat (2))
b)
Kemerdekaan berserikat dan berkumpul, mengeluarkan pikiran dengan lisan dan tulisan dan sebagainya
ditetapkan dengan undang-undang (pasal 28)
c)
Negara menjamin kemerdekaan tiap-tiap penduduk untuk memeluk agamanya masing-masing dan untuk
meribadat menurut agama dan kepercayaannya itu (pasal 29 ayat (2)) 8[8]
Kutipan pasal-pasal diatas merupakan definisi normatif dari demokrasi. Tetapi kita harus memperhatikan bahwa apa
yang normatif belum tentu dapat dilihat dalam konteks kehidupan sehari-hari. Oleh karena itu perlu untuk melihat
makna demokrasi secara empirik, yakni demokrasi dalam perwujudannya dalam kehidupan sehari-hari. 9[9]
Dengan demikian inti (hakekat) demokrasi terletak pada peran senyatanya rakyat dalam proses politik yang berjalan
terutama dalam pembuatan dan pelaksanaan kebijakan publik, yakni berbagai program yang bertujuan untuk
memecahkan berbagai persoalan publik (masyarakat, berbangsa dan bernegara) yang diputuskan oleh pejabat atau
lembaga yang berwenang. Persoalan publik misalnya : mengembangkan kebebasan menyatakan pendapat, mengatasi
kemiskinan dan pengangguran, meningkatkan hak warga negara untuk memperoleh pendidikan dan pelayanan
kesehatan.
2.

Nilai-nilai demokrasi

Demokrasi merupakan sesuatu yang penting, karena nilai-nilai yang dikandungnya sangat diperlukan sebagai acuan
untuk menata kehidupan berbangsa da bernegara yang baik. Henry B. Mayo (Miriam budiardjo, eds. 1980 :165-179)
mengajukan beberapa nilai demokrasi, yaitu sebagai berikut :
a.
Menyelesaikan pertiakaian secara damai dan sukarela
Hal ini terlihat pada fungsi kompromi atau kebijakan umum dengan suara mayoritas, atau penyelesaian berbagai
pertikaian secara sukarela.
7
8
9
45

b.
Menjamin terjadinya perubahan secara damai
Misalnya dalam menghadapi berbagai perubahan sosial, iptek yang sangat pesat, dengan metode demokrasi akan
mampu mengakomodasinya secara fleksibel, misalnya dengan memperhatikan public opinion sehingga perubahan
tetap terjamin berjalan secara damai.

c.
Pergantian penguasa dengan teratur
Dalam demokrasi suksesi kepemimpinan didasarkan pada pilihan atau penunjukkan oleh orang banyak dengan cara
damai dan absah, serta dilakukan secara teratur dalam suatu periode tertentu.
d.
Penggunaan paksaan sedikit mungkin
Dalam pembuatan dan pelaksanaan serta penegakan keputusan politik dalam demokrasi lebih pada kemauan umum
atau persuasif, dibandingkan lewat paksaan fisik maupun nonfisik (misal ancaman, intimidasi)
e.
Pengakuan terhadap nilai keanekaragaman
Demokrasi mengakui eksistensi dan keabsahan keanekaragaman, dan pentingnya saluran terbuka dan kebebasan
politik. Pengakuan dan jaminan nilai tersebut, karena adanya suatu keyakinan bahwa alternatif yang lebih banyak akan
lebih dekat dengan kebaikan dan kebenaran.
f.
Menegakkan keadilan
Demokrasi memberikan kesempatan kepada setiap individu untuk mengjukan wakilnya, hal ini mencerminkan adanya
pengakuan dan jaminan terhadap unsur persamaan.
g.
Memajukan ilmu pengetahuan
Dengan pengakuan dan jaminana adanya persamaan dan kebebasan bagi seluruh orang untuk mengembangkan potensi
pikiran, kreativitas, daya inovasi, afeksi, maka hal ini akan memberikan motivasi bagi perkembangan ilmu
pengetahuan dan teknologi. Dengan demikian demokrasi dianggap penting karena merupakan alat yang dapat
digunakan untuk mewujudkan kebaikan bersama, atau masyarakat dan pemerintahan yang baik. 10[10]
ANALISIS
Pemilu di Amerika Serikat di akhir tahun 2008 merupakan pemilu yang spektakuler dan menyedot perhatian dunia.
Bahkan hasil Pemilu yang dimenangkan oleh Barack Hussein Obama dianggap pemilu yang sangat demokratis
dan mengesankan. Betapa tidak, seorang kulit hitam keturunan Kenya dan masa kecilnya pernah tinggal di
Menteng Jakarta selama 5 (lima) tahun.
Semasa musim pemilu di Amerika, di sela-sela kampanye para kandidat presiden saling berdebat seru dan bahkan
saling mengejek. Namun ketika hasil pemilu diumumkan, justru yang kalah mendatangi kandidat yang menang,
untuk mengucapkan selamat. Fenomena ini menunjukkan bahwa etika dan moral politik tetap harus dipatuhi oleh
semua pihak.
Ilustrasi tentang pemilu di Amerika Serikat seperti diuraikan diatas, terdapat beberapa aspek penting dan menarik
untuk menjadi perhatian kita yaitu;
1.
Bahwa antara pemilu dan demokrasi mempunyai korelasi yang signifikan
2.
Pembentukan sistem nilai demokrasi sangat menentukan kualitas pemilu yang dijalankan
3.
Etika dan moral politik warga negara menjadi ukuran atau standar apakah pemilu itu bersih, jujur atau ada
kecurangan
4.
Nilai sportifitas para kandidat benar-benar dijunjung tinggi
5.
Oleh karena figure kandidat menarik simpati dan memberikan harapan terhadap perubahan, maka rakyat dengan
antusias rela berjam-jam antri memberikan suara pada pesta demokrasi tersebut.
Mencermati perkembangan pemilu demi pemilu di Indonesia yang sudah dilaksanakan sebanyak 9 (sembilan) kali,
seharusnya membuat masyarakat dan bangsa Indonesia semakin cerdas dalam menjalankan etika dan moral politik
yang menjadi dasar dalam mengimplementasi Konsep Sistem Politik yang demokratis. Namun peristiwa politik
berupa insiden kekerasan dan konflik sosial masih mewarnai dalam pelaksanaan pemilu. Fenomena penting yang
perlu dicermati perkembangan dalam pemilu terutama dalam pemilu gubernur dan bupati/walikota disamping sering
timbul konflik juga diwarnai money politik. Padahal tujuan utama pemilu memberikan proses pendidikan politik warga
negara dan pendemokrasian politik, sosial dan ekonomi. Namun ternyata hasilnya, menunjukan bahwa, partisipasi
10
46

masyarakat terhadap pemilu masih rendah, berbagai daerah jumlah pemilih yang tidak melaksanakan hak pilihnya
alias golput.
Pemimpin yang terpilih juga sebagian besar tidak mencerminkan aspirasi rakyat dengan indikasinya para kepala
daerah (Gubernur, Bupati/Walikota) terpilih di samping tidak profesional dan kompeten juga banyak yang terlibat
dalam kasus hukum (korupsi).
Dengan demikian bagaimana mendesain sistem pemilu yang bisa mendorong terwujudnya praktek demokrasi yang
berkualitas. Demokrasi memang suatu konsep politik yang menjadi harapan semua pihak bahwa dengan terciptanya
sistem demokrasi yang dipraktekkan suatu negara mampu memperbaiki keadaan ekonomi dan politik, seperti
disebutkan diatas. Jadi demokrasi memberikan keleluasaan yang lebih dinamis tidak hanya demokrasi politik saja
seperti selama ini dirasakan, tapi juga demokrasi sosial dan demokrasi ekonomi.
A. Kesimpulan
Demokrasi merupakan konsep yang menjamin terwujudnya perbaikan kondisi ekonomi dan sosial masyarakat jika
benar-binar bias diimplementasikan dalam pemilu. Adapun sudut pandang kegunaan dan keuntungan dengan
menjalankan prinsip demokrasi menjamin kehidupan masyarakat yang lebih berkualitas diantaranya :
1.

Dengan demokrasi, pemerintahan dapat mencegah timbulnya pemerintahan otoriter yang kejam dan licik;

2.

Menjamin tegaknya hak asasi bagi setiap warga negara;

3.

Memberikan jaminan terhadap kebebasan pribadi yang lebih luas;

4.
Demokrasi juga memberikan jaminan kebebasan terhadap setiap individu warga negara untuk menentukan
nasibnya sendiri;
5.

Demokrasi memberikan kesempatan menjalankan tanggung jawab moral;

6.
Demokrasi juga memberikan jaminan untuk membantu setiap individu warga negara untuk berkembang sesuai
dengan potensi yang dimiliki secara luas;
7.

Demokrasi juga menjunjung tinggi persamaan politik bagi setiap warga negara;

8.

Demokrasi juga mampu memberikan jaminan kemakmuran bagi masyarakatnya.

B. Saran
Hubungan antara pemilu dengan demokrasi menjadi tonggak sejarah bahwa sejak lahirnya Negara Kesatuan Republik
Indonesia (NKRI) telah memegang prinsip-prinsip demokrasi.
Mewujudkan budaya demokrasi memang tidak mudah. Perlu ada usaha dari semua warga negara. Yang paling utama,
tentu saja, adalah:
1.

Adanya niat untuk memahami nilai-nilai demokrasi.

2.

Mempraktekanya secara terus menerus, atau membiasakannya.

Bawasanya demokrasi di Indonesia masih dimaknai hanya sebagai ornament demokrasi karena pada hakekat
utamanya mensejahterakan rakyat melalui sistem demokrasi itu belum terwujud. Banyaknya parpol baru membuat
masyarakat bingung memilih menentukan figure seorang pemimpin yang ideal dan setiap parpol hanya mementingkan
pribadi serta kelompoknya masing-masing sehingga aspirasi rakyat menjadi tidak terwakili.
Memahami nilai-nilai demokrasi memerlukan pemberlajaran, yaitu belajar dari pengalaman negara-negara yang telah
mewujudkan budaya demokrasi dengan lebih baik dibandingkan kita. Dalam usaha mempraktekan budaya demokrasi,
47

kita kadang-kadang mengalami kegagalan disana-sini, tetapi itu tidak mengendurkan niat kita untuk terus berusaha
memperbaikinya dari hari kehari. Suatu hari nanti, kita berharap bahwa demokrasi telah benar-benar membudaya di
tanah air kita, baik dalam kehidupan berkeluarga, bermasyarakat, maupun dalam kehidupan berbangsa dan bernegara.

REFLEKSI PEMILU LANGSUNG DI INDONESIA


Sosiolog Barrington Moore Jr dalam buku Social Origins of Dictatorship and Democracy mengemukakan tak ada
kelompok borjuis, tak ada demokrasi. Sebuah asumsi dari Barrington Moore, demokrasi akan tumbuh dan
berkembang jika kelas borjuis menjadi kuat dan aktif dalam proses demokratisasi.
Kondisi itu terjadi di Indonesia saat ini, para kelompok berjuis dan keluarga serta kroninya berlomba merambah
dunia politik sebagai pejabat public, fenomena kedekatan berjois dan dunia politik bukan hal baru. Pada era Orde Baru
sejumlah pengusaha menduduki berbagai jabatan publik, dalam mewjudkan hubungan antara Pemerintah dan rakyat.
Kaum berjuis, saling memperkuat dengan kekuatan financial yang kuat, menyebabkan melemahnya dan
meminimalkan kemunculan tokoh pemimpin yang memimpin dan/atau wakil yang mewakili, dimana Pemimpin
yang memimpin dan wakil yang mewakili dengan nilai ketokohan yang telah teruji dinantikan kelahiran dan
kemunculan di tengah masyarakat saat ini, merupakan harapan hampa.
Hubungan antara pemerintahan (state) dengan rakyat/warga Negara (society) berada alam tatanan bingkai interaksi
politik dalam wujud organisasi Negara, hubungan tersebut dalam bungkusan yang indah namanya demokrasi.
Bahwa demokrasi menjadi cara terbaik dalam perkembangan organisasi negara modern, merupakan instrumen
universal, namun juga memiliki karakteristik ideografis seperti demokrasi liberalis, demokrasi sosialis dan bahkan
demokrasi Pancasila, di Indonesia demokrasi diimplemntasikan dalam demokrasi dalam lingkup negara dan
demokrasi lokal.
Sistem politik daerah yang dikenal dengan demokrasi local salah satunya di wujudakan dengan Pemilihan Kepala
daerah dan Legeslatif secara langsung baik Propinsi maupun Kabupaten/kota, yang merupakan sub system dari sistem
politik nasional dalam tatanan berbangsa dan bernegara.
Sesungguhnya demokrasi adalah sebuah system untuk mewujudkan tatanan berbangsa dan bernegara yang
diimplementasikan dalam penyelengaraan Negara dari eksekutif, legeslatif dan yudikatif bekerja dan berbuat untuk
Negara dalam hal ini Pemilik Negara yaitu Rakyat, karena kedaulan rakyat, dengan indicator keberhasilan adalah
pada tatanan ekonomi yang mapan di tingkat masyarakat sebagaimana yang diimpikan oleh Pembukaan UUD 1945
yaitu alinea terakhir .serta dengan mewujudkan suatu Keadilan sosial bagi seluruh rakyat Indonesia, hal ini
didukung oleh Pernyataan Surya Paloh (Metro TV, senin, 1 februari 2010, jam 18;02 wib) Berulang kali dan dimana
saja saya katakan. Demokrasi itu bukan tujuan, demokrasi itu hanyalah alat untuk mencapai tujuan, kata Surya Paloh
saat berpidato dalam pendeklarasian Ormas Nasionalis Demokrat di Istora Senayan Jakarta, Senin (1/2-2010) sore,
bahkkan ditambahkan oleh beliau tidak ada gunanya demokrasi kalau tidak menghantarkan kepada kesejahteraan
sosial yang lebih baik. Keadilan sosial yang lebih baik. Kehidupan yang lebih nyaman serta mendorong persatuan dan
kesatuan
Justru yang terjadi di Indonesia, malah apa yang dikatakan oleh Mahattir Muhammad dalam sebuah pernyataan
Kalau saya disuruh memilih antara hidup dalam suasana demokrasi, tetapi sulit mencari makanan, dengan hidup
dalam situasi hak-hak pribadi dibatasi, tetapi bisa dapat bekerja, gampang carai makan, masih bisa nabung, maka saya
akan lebih memilih hidup dengan beberapa pribadi saya dibatasi

48

Lalu apa persoalan mendasar, sehingga apa yang seharusnya menjadi tujuan sebuah demokrasi tersebut tidak tercapai,
apakah sistimnya yang salah atau pelaksanaannya yang salah.
Demokrasi lokal yang diwujudkan dalam pemilihan legeslatif dan eksekutif di daerah, terutama pemilihan kepala
daerah, merupakan sebuah momentum yang memerlukan sebuah jawaban dari sebuah pertanyaan besar dalam
pelaksanaannya. Pertanyaan ini berkaitan dengan demokrasi partisipatoris yang akan dilakukan, betapa tidak,
pemberian kedaulatan rakyat daerah pada elitnya masih diwarnai ketidakjelasan, baik dari prosedur kerja
penyelenggara maupun peserta dan posisi pemilihnya, karena demokrasi local dibangun untuk memberikan peluang
yang menjadi impian dari rakyat di daerah dalam pemberian legitimasi
Lalu apa lacurnya, Pilkada langsung justru menimbulkan banyak hal negative dalam upaya mewujudkan suatu
Keadilan sosial bagi seluruh rakyat Indonesia sangat sulit dicapai, karena untuk menjadi Pimpinan daerah
mengahruskan cost dan money politik yang luar biasa, tentunya membawa implikasi pada tatan bagaimana
mengembalikan cost dan money politik yang telah dikeluarkan, yang tentunya akan melakukan pembangunan yang
berorientasi pada guna proyek dengan mengabaikan manfaat proyek, mengeksploitasi SDA tanpa melihat nilai-nilai
lingkungan dan nilai ekonomi tidak langsung yang akan mengorbankan masyarakat dan lingkungan jangka panjang.
Seterusnya penempatan SKPD atau Kepala Dinas beserta perangkat daerah tidak berdasarkan keahlian (zaken cabinet)
namun berorientasi kepada balas jasa dan balas budi kepada tim pendukung dengan tetap berpegang kepada berapa
banyak kemungkinan pengembalian Invetasti Politik kepada Kepala Daerah.
Dengan tatanan yang tercipta dalam sistim demokrasi tersebut, pembangunan Kesejahteraan masyarakat menjadi
bagian yang terlupakan, karena dasar pembangunan tidak berdasarkan kepada kebutuhan untuk meningkatkan
kesejahteraan walaupun itu menjadi jualan kampanye, melainkan berorientasi berapa banyak financial benefit yang
direoleh, fakta saat ini, bahwa kemiskinan memang turun, tetapi bukan turan dalam jumlah, melainkan turun ke anak
cucu kita.
Memang kita harus menyadari, bahwa kepentingan Parpol penguasa di pusat/daerah terhapa kemenangan Pimpinan
Daerah/Pimpinan Nasional tidak bisa dipungkiri sebagai sebuah asset partai uantuk mendukung kelancaran perjalanan
partai, baik melalui kebijaksanaan atau kebijakan yang mengarah pada benefit ke Parpol penguasa sangat tinggi,
sehingga sinkronisasi Programn Pembanguan dari Pusat sampai ke Daerah, jelas tidak akan mungkin terjadi, karena
secara nasional Pimpinan Nasional adalah Partai democrat, sedangkan di daerah tentunya terdiri dari berbagai Parrtai
pemenang, yang memiliki agenda yang sama tahun 2014, tentunya kesengajaan untuk ketidak sinkronisasi memang
hal yang diskeneriokan.
Memang banyak pemikir dan ahli mengatakan bahwa untuk terwujudnya suatu demokrasi yang baik, dibutuhkan
sebuah proses yang panjang dan biaya yang tinggi, apakah kalimat pembenaran tersebut membenarkan penciptaan
kesengsaraan dan penderitaan masyarakat ?
Mari kita lihat dan evaluasi sistim demokrasi dalam pilkada langsung saat ini, sangat sedikit yang berjalan dengan
damai, sangat banyak yang membuahkan hasil perpecahan kelompok, penciptaan kemiskinan, koruposi, bahkan
Disintegrasi juga muncul.
Dan sangat banyak tokoh yang muncul bukan karena ketokohan, melainkan muncul menjadi calon pemimpin bahkan
pemimpin karena populis dan harta serta kekayaannya, harus disadari bahwa tokoh kepemimpinan yang menjadi
pemimpin yang memimpin dalam artian melayani bukan dilayani seperti kebanyakan pemimpin di Jawa,
tidak dilahirkan, melainkan lahir melalui proses seksesi alami yang membutuhkan waktu yang cukup lama.
Undang Undang Dasar Negara Republik Indonesia Tahun 1945 menyatakan bahwa
kedaulatan berada ditangan rakyat dan dilaksanakan menurut Undang-Undang Dasar. Salah
satu wujud dari kedaulatan rakyat adalah penyelenggaraan Pemilihan Umum untuk memilih
Presiden dan Wakil Presiden yang dilaksanakan secara demokratis dan beradab melalui
49

partisipasi rakyat seluas-luasnya berdasarkan asas langsung, umum, bebas, rahasia, jujur,
dan adil.
Pasal 6A Undang-Undang Dasar Negara Republik Indonesia Tahun 1945 menyatakan bahwa
Presiden dan Wakil Presiden dipilih dalam satu pasangan secara langsung oleh rakyat.
Pasangan Calon Presiden dan Wakil Presiden diusulkan oleh Partai Politik atau Gabungan
Partai Politik peserta pemilihan umum sebelum pelaksanaan Pemilihan Umum.
Untuk menjamin pelaksanaan Pemilu Presiden dan Wakil Presiden yang berkualitas,
memenuhi derajat kompetisi yang sehat, partisipatif, dan dapat dipertanggungjawabkan perlu
dibentuk suatu Undang-undang tentang Pemilu Presiden dan Wakil Presiden yang sesuai
dengan perkembangan demokrasi dan dinamika masyarakat dalam kehidupan berbangsa dan
bernegara. Oleh karena itu perlu dilakukan penggantian terhadap Undang-Undang Nomor 23
Tahun 2003 tentang Pemilihan Umum Presiden dan Wakil Presiden.
Undang-Undang ini mengatur mekanisme pelaksanaan Pemilu Presiden dan Wakil Presiden
untuk menghasilkan Presiden dan Wakil Presiden yang memiliki integritas tinggi, menjunjung
tinggi etika dan moral, serta memiliki kapasitas dan kapabilitas yang baik. Untuk mewujudkan
hal tersebut, dalam Undang-Undang ini diatur beberapa substansi penting yang signifikan
antara lain mengenai persyaratan Calon Presiden dan Wakil Presiden wajib memiliki visi, misi,
dan program kerja yang akan dilaksanakan selama 5 (lima) tahun ke depan. Dalam konteks
penyelenggarakan sistem pemerintahan Presidensiil, menteri yang akan dicalonkan menjadi
Presiden atau Wakil Presiden harus mengundurkan diri pada saat didaftarkan ke Komisi
Pemilihan Umum. Selain para Menteri, Undang-Undang ini juga mewajibkan kepada Ketua
Mahkamah Agung, Ketua Mahkamah Konstitusi, Pimpinan Badan Pemeriksa Keuangan,
Panglima Tentara Nasioanal Indonesia, Kepala Kepolisian Negara Republik Indonesia, dan
Pimpinan Komisi Pembrantasan Korupsi harus mengundurkan diri apabila dicalonkan menjadi
Presiden dan Wakil Presiden. Pengunduran diri para pejabat negara tersebut dimaksudkan
untuk kelancaran penyelenggaraan pemerintahan dan terwujudnya etika politik
ketatanegaraan. Untuk menjaga etika penyelenggaraan pemerintahan, gubernur/wakil
gubernur, bupati/wakil bupati, atau walikota/wakil walikota perlu meminta izin kepada
Presiden pada saat dicalonkan menjadi Presiden atau Wakil Presiden.
Presiden dan Wakil Presiden Republik Indonesia terpilih adalah pemimpin bangsa, bukan
hanya pemimpin golongan atau kelompok tertentu saja, untuk itu, dalam rangka membangun
etika pemerintahan terdapat semangat bahwa Presiden atau Wakil Presiden terpilih tidak
merangkap jabatan sebagai Pimpinan Partai Politik yang pelaksanaannya diserahkan kepada
masing-masing Partai politik.
Lembaga Kepresidenan
Hasil perubahan UUD 1945 yang berkaitan langsung dengan kekuasaan presiden dan wakil
presiden, adalah pembatasan kekuasaan Presiden sebagaimana diatur dalam Pasal 7 (lama),
yang berbunyi Presiden dan Wakil Presiden memegang jabatannya selama lima tahun, dan
sesudahnya dapat dipilih kembali. Penegasan didalam Pasal 7 dipandang terlalu fleksibel
untuk ditafsirkan. Bahkan Soeharto pernah mengatakan, tentang beberapa kali seseorang
dapat menjabat Presiden sangatlah bergantung pada MPR.
Jadi tidak perlu dibatasi, asal masih dipilih oleh MPR, ia dapat terus menjabat Presiden dan /
atau Wakil Presiden. Dan Soeharto lah yang telah menikmati kebebasan jabatan itu karena ia
sendiri yang membuat tafsir atas UUD, MPR tinggal mengamininya. Kemudian, Pasal 7
diubah, yang bunyinya menjadi : Presiden dan Wakil Presiden memegang Jabatannya
selama lima tahun, dan sesudahnya dapat dipilih kembali dalam jabatan yang sama, hanya
untuk satu kali masa jabatan. Perubahan pasal ini dipandang sebagai langkah yang tepat
untuk mengakhiri perdebatan tentang periodisasi jabatan Presiden dan Wakil Presiden.

50

Aspek perimbangan kekuasaan hubungan antara Presiden dan DPR, Presiden dan Mahkamah
Agung tampak dalam perubahan Pasal 13 dan 14. Perubahan terhadap pasal-pasal ini dapat
dikatakan sebagai pengurangan atas kekuasaan Presiden yang selama ini dipandang sebagai
hak prerogratif. Perubahan Pasal 13 berbunyi sebagai berikut :
(1) . Dalam hal mengangkat duta, Presiden memperhatikan pertimbangan Dewan
Perwakilan Rakyat.
(2). Presiden menerima penempatan duta negara lain dengan memperhatikan
pertimbangan Dewan Perwakilan Rakyat.
Adanya pertimbangan dari Dewan Perwakilan Rakyat pada ayat (1), ini penting dalam rangka
menjaga obyektifitas terhadap kemampuan dan kecakapan seseorang pada jabatan tersebut.
Karena ia akan menjadi duta dari seluruh rakyat Indonesia di negara lain dimana ia
ditempatkan pada khususnya dan di mata Internasional pada umumnya. Adanya
pertimbangan Dewan Perwakilan Rakyat Pada ayat (2), dipandang sangat tepat karena hal ini
penting bagi akurasi informasi untuk kepentingan hubungan baik antara kedua negara dan
bangsa.
Perubahan Pasal 14 berbunyi sebagai berikut :
(1). Presiden memberikan grasi dan rehabilitasi dengan memperhatikan pertimbangan
Mahkamah Agung.
(2). Presiden memberi amnesti dan abolisi dengan memperhatikan pertimbangan
Dewan Perwakilan Rakyat.
Alasan perlunya Presiden memperhatikan pertimbangan dari Mahkamah Agung dalam
pemberian grasi dan rehabilitasi adalah pertama, grasi dan rehabilitasi itu adalah proses
yustisial dan biasanya diberikan kepada orang yang sudah mengalami proses, sedang
amnesti dan abolisi ini lebih bersifat proses politik. Kedua, grasi dan rehabilitasi itu lebih
banyak bersifat perorangan, sedangkan amnesti dan abolisi biasanya bersifat massal.
Mahkamah Agung (MA) sebagai lembaga peradilan tertinggi adalah lembaga negara paling
tepat memberikan pertimbangan kepada Presiden mengenai hal itu karena grasi menyangkut
putusan hakim sedangkan rehabilitasi tidak selalu terkait dengan putusan hakim.
Perubahan Pasal 15 berbunyi sebagai berikut : Presiden memberi gelar, tanda jasa, dan lainlain tanda kehormatan yang diatur dengan Undang-Undang. Perubahan pasal ini berdasarkan
perimbangan agar Presiden dalam memberikan berbagai tanda kehormatan kepada siapapun
(baik warga negara, orang asing, badan atau lembaga) didasarkan pada Undang-Undang yang
merupakan hasil pembahasan DPR bersama Pemerintah sehingga berdasarkan pertimbangan
yang lebih obyektif.
Perubahan lain terjadi pada mekanisme pemilihan Presiden dan Wakil Presiden sebagaimana
diatur dalam Pasal 6, yang sebelumnya Presiden dan Wakil Presiden dipilih oleh MPR dengan
suara terbanyak, berubah menjadi Presiden dan Wakil Presiden dipilih dalam satu
pasangan secara langsung oleh rakyat, (Pasal 6 A ayat(1) ). Ayat (3) menyatakan Pasangan
calon Presiden dan Wakil Presiden yang mendapatkan suara lebih dari lima puluh persen dari
jumlah suara dalam pemilihan umum dengan sedikitnya duapuluh persen suara di setiap
provinsi yang tersebar di lebih dari setengah jumlah provinsi di Indonesia, dilantik menjadi
Presiden dan Wakil Presiden.
Pasal 6A ayat (4) tentang putaran ke dua pemilihan Presiden dan Wakil Presiden apabila
diputaran pertama tidak ada kandidat yang terpilih, maka dikembalikan ke rakyat untuk dipilh
secara langsung. Rumusannya berbunyi: Dalam hal tidak ada pasangan calon Presiden dan
Wakil Presiden terpilih, dua pasangan calon yang memperolah suara terbanyak pertama dan
kedua dalam pemilihan umum dipilih oleh rakyat secara langsung dan pasangan yang
memperoleh suara terbanyak dilantik sebagai Presiden dan Wakil Presiden.
51

Pasal 6A ayat (4) ini menjadi dasar hukum dalam penyelenggaraan pemilihan Presiden dan
Wakil Presiden secara langsung pada putaran kedua (second round). Ketentuan ini merupakan
jalan keluar (scape clousul) yang hanya dijalankan jika dalam pemilihan Presiden dan Wakil
Presiden tidak ditemui persyaratan perolehan suara sebagaimana ditentukan dalam Pasal 6A
ayat (3).
Adanya perubahan dalam pemilihan Presiden dan Wakil Presiden secara langsung oleh rakyat
diharapkan rakyat dapat berpartisipasi secara lengsung menentukan pilihannya sehingga
tidak mengulang kekecewaan yang pernah terjadi pada pemilu 1999. Presiden dan Wakil
Presiden akan memiliki otoritas dan legitimasi yang sangat kuat karena akan dipilih langsung
oleh rakyat.
Perubahan UUD 1945 mengenai alasan pemberhentian Presiden dan / atau Wakil Presiden
dalam massa jabatannya diatur dalam Pasal 7A, rumusannya berbunyi sebagai berikut :
Presiden dan / atau Wakil Presiden dapat diberhentikan dalam massa jabatannya oleh Majelis
Permusyawaratan Rakyat atas usul Dewan Perwakilan Rakyat, baik apabila terbukti telah
melakukan pelanggaran hukum berupa penghianatan terhadap negara, korupsi, penyuapan,
tindak pidana berat lainnya, atau perbuatan tercela maupun apabila terbukti memenuhi
syarat sebagai Presiden dan /Wakil Presiden.
Adapun prosedur pemberhentian Presiden dan / atau Wakil Presiden dalam massa jabatannya,
diatur dalam Pasal 7B, yang rumusannya berbunyi sebagai berikut : Usul pemberhentian
Presiden dan / atau Wakil Presiden dapat diajukan oleh Dewan Perwakilan Rakyat Kepada
Majelis Permusyawaratan Rakyat hanya dengan terlebih dahulu mengajukan permintaan
kepada Mahkamah Konstitusi untuk memeriksa, mengadili dan memutus pendapat Dewan
Perwakilan Rakyat bahwa Presiden dan /atau Wakil Presiden telah melakukan pelanggaran
hukum berupa penghianatan terhadap korupsi, penyuapan, tindak pidana berat lainnya, atau
perbuatan tercela, dan/ atau pendapat bahwa Presiden dan / atau Wakil Presiden tidak lagi
memenuhi syarat sebagai Presiden dan /atau Wakil Presiden.
Kajian Pasal 2 UU Nomor 42 Tahun 2008 tentang Pemilihan Presiden ditinjau secara Organisasi.
a. Skema kajian Organisasi
Organisasi: Kerjasama untuk mencapai tujuan: Lahir Organisasi yang terorganisir dan Organisasi yang
tidak terorganisir.
b. Analisis Pasal 2 Undang-Undang Pemilihan Presiden
Pasal 2 UU No. 42 Tahun 2008, berbunyi sebagai berikut : Pemilu Presiden dan Wakil Presiden
dilaksanakan secara efektif dan efisien berdasarkan asas langsung, umum, rahasia, jujur dan adil.
Ketentuan Pasal 2 UU No. 42 Tahun 2008, merupakan pelaksanaan dari Pasal 6A ayat (1) UUD 1945
yang berbunyi: Presiden dan Wakil Presiden dipilih dalam satu pasangan secara langsung oleh rakyat.
Kelemahan Pemilihan Presiden secara langsung ditinjau secara organisasi adalah sebagai berikut :
1. Sistem pemilihan Presiden langsung hanya akan mempersentasikan suara dari pulau jawa.
Tidak dapat dipungkiri adanya kenyataan bahwa suara pemilih terbesar ada
dipulau jawa, yang sebagian besar tentunya dihuni oleh suku bangsa jawa.
Walaupun belum ada pembuktian konkrit untuk dugaan ini, logika yang
mendasarinya cukup bisa diterima. Dengan begitu bisa diterima pula asumsi
bahwa peluang kandidat yang berasal dari jawa untuk memenangkan pemilihan
akan lebih besar dibandingkan kandidat dari suku bangsa diluar suku bangsa
52

jawa, dan tentunya ini akan menimbulkan dampak turunan terhadap semakin
mencuatnya sentimen anti jawa dari suku suku bangsa lainya yang terutama
ada diluar jawa.
Sebagaimana telah dipaparkan sebelumnya, dibeberapa negara seperti Nigeria
dan Kenya yang juga menghadapi persoalan pluralitas kemasyarakatan yang
komplek, disusun suatu sistem pemilu yang mewajibkan sepasang kandidat
untuk memperoleh dukungan lintas kelompok yang luas (crossection). Kandidat
Presiden tidak hanya harus memenangkan masyoritas plural dari suara yang
ada, akan tetapi secara geografis juga harus memperoleh jumlah tertentu dari
suara disejumlah provinsi. Persyaratan distribusi perolehan suara secara
geografis ini sekaligus menuntut para kandidat Presiden untuk melalakukan
kampanye lintas regional dari daerah asal mereka sendiri atau bahkan lintas
etnis. Dari praktek-praktek tersebut diharapkan timbulnya legitimasi yang lebih
menyeluruh bagi setiap pemenang pemilihan Presiden.
2. Sistem ini akan mengurangi fungsi dan peran MPR secara signifikan
Dalam sebuah sistem pemerintahan Presidensil yang menganut sistem
perwakilan bikameral , fungsi MPR memang tidak akan sama lagi dengan yang
ada dalam konstitusi. MPR yang terdiri dari dua kamar DPR dan DPD akan lebih
terkonsentrasi pada fungsi legislasi dan fungsi kontrol, yang sebenarnya bila
dilihat dari ruang lingkup dan jangkauan dari wewenangnya ( scope and domain
outhority ) lebih baik dan lebih signifikan dalam proses penyelenggaraan negara
dan pemerintahan sehari-hari. Mengenai tidak adanya lagi legitimasi MPR untuk
meminta pertanggungjawaban Presiden. Mekanisme impachment akan lebih
nyata dan lebih konsisten dengan sistem Presidensial, dibandingkan dengan
mekanisme pertanggungjawaban Presiden yang lebih bersifat abstrak dan
kenyataannya hanya berupa laporan (report) akhir tahun massa jabatan semata.
Sehingga tidaklah tepat kiranya bila dikatakan bahwa sistem pemilihan Presiden
langsung otomatis akan meminggirkan peran dan kedudukan MPR dalam
berhadapan dengan Presiden.
3. Sistem ini akan memperlemah kedudukan DPR
Meningkatnya legitimasi Presiden tidak berakibat langsung bagi melemahnya
kedudukan DPR. Legitimasi Presiden yang kuat memang merupakan satu hal
yang menjadi tujuan pokok dari sistem presidensial. Namun bukan berarti DPR
dan tentunya juga DPD dalam sebuah sistem perwakilan bikameral akan tetap
bisa berperan dalam memberi arah dan mengawasi kinerja Presiden, melalui
wewenang-wewenang yang secara konstitusional dimilikinya. Perubahan yang
justru akan ditimbulkan adalah terciptanya kondisi yang lebih baik bagi
pelaksanaan mekanisme checks and balances, dalam penyelenggaraan negara
dan pemerintahan, karena DPR dan DPD semakin tidak diberi peluang untuk
menyalahgunakan kekuasaan yang ada padanya.
4. Sistem Pemilihan ini akan mengurangi atau membatasi kemungkinan dibentuknya suatu
pemerintahan koalisi.
Secara teoritis sistem pemerintahan Presidensial tidak mengenal pemerintahan
koalisi. Hanya sistem parlementer dan sistem semi parlementer yang membuka
peluang bagi model pemerintahan tersebut. Pada dasarnya alternatif
pemerintahan koalisi merupakan salah satu cara untuk menyelesaikan persoalan
kebuntuan proses politik yang terjadi di parlemen sebagai akibat dari tidak
adanya partai pemenang mayoritas dalam pemilihan anggota parlemen,
sehingga dua atau lebih partai politik terpaksa bergabung (Coalition). Untuk
membentuk kabinet yang akan menjalankan roda pemerintahan sehari-hari.
53

Alternatif lainnya adalah pemerintahan minoritas yang merupakan suatu cara


lain untuk memecah kemandegan politik atas sebab yang sama. Perbedaannya
adalah pemerintahan minoritas hanya diisi oleh orang-orang berasal dari satu
partai politik saja, yang pada umumnya adalah peraih suara terbanyak diantara
partai-partai politik peraih suara lainanya.
Munculnya fenomena dalam pemerintahan Abdurrahman Wahid yang diisi oleh
orang-orang yang memiliki latar belakang partai politik yang berbeda-beda,
sehingga seolah-olah merupakan kabinet koalisi, tidak dapat mengabaikan
kenyataan bahwa wewenang untuk menentukan seseorang diangkat dan
diberhentikan sebagai menteri hanya dimiliki oleh Presiden Abdurrahman Wahid.
Hal itu terpangkat dengan jelas pada saat terjadinya pemberhentian dan
pengangkatan beberapa menteri di massa awal pemerintahan Gus Dur. Oleh
karena itu, perlu disadari bahwa tidak akan pernah terjadi suatu pemerintahan
koalisi bila konstitusi RI tetap menganut sistem presidensial, meskipun sistem
pemilihan presiden tetap dilakukan di MPR. Fenomena pada kabinet pelangi Gus
Dur mungkin bisa terulang di masa depan, namun kenyataan dalam hal itu
hanyalah wujud dari strategi dan kebijakan politik presiden tidak dapat
dipungkiri.
5. Sistem pemilihan ini akan memakan biaya besar
Sistem pemilihan presiden langsung yang ideal memang akan mengeluarkan
biaya yang relatif lebih besar dibandingan dengan pemilihan presiden tidak
langsung. Hal itu dikarenakan dalam pemilihan presiden langsung yang ideal,
waktu pelaksanaan pemilu presiden berbeda dengan waktu pelaksanaan pemilu
anggota legislatif. Dasar pemikirannya adalah untuk meminimalisasi terjadinya
coattail effect. Namun, dengan keterbatasan dana yang dimiliki negara saat ini,
kiranya waktu pemilihan presiden dan waktu pemilihan anggota legislatif untuk
sementara dapat dilakukan secara bersamaan. Sehingga penambahan biaya
yang harus dikeluarkan dapat ditekan seminimal mungkin. Selain itu, kondisi
pendanaan yang terbatas ini juga harus menjadi bahan pertimbangan pokok
untuk menciptakan sistem pemilu yang lebih sederhana hanya satu putaran,
namun menghasilkan tingkat legitimasi yang memadai bagi kandidat yang
memenangkan pemilihan.
Kajian Pasal 5 (p) UU No. 42 Tahun 2008 tentang Pilpres ditinjau dari Stratifikasi
a. Skema kajian Stratifikasi
Berhubungan dengan harta kekayaan / sosial ekonomi : uang, benda bernilai ekonomi, tanah,
kekuasaan, IPTEK, Kesolehan dalam agama, keturunan keluarga, terhormat dan sebagainya.
b. Analisis Pasal 5(p) UU No. 42 tentang Pilpres.
Pasal 5(p) UU No. 42 Tahun 2008 tentang Pilpres berbunyi : Persyaratan menjadi calon Presiden dan
calon Wakil Presiden adalah berpendidikan paling rendah tamat sekolah menengah atas, Madrasah Aliyah
(MA), Sekolah Menengah Kejuruan (SMK) Madrasah Aliyah Kejuruan ( MAK), atau bentuk lain yang
sederajat.
Kontroversi syarat menjadi calon presiden dan wakil presiden berpendidikan paling rendah setingkat
SMA atau yang sederajat. Sebagaimana yang diatur dalam Pasal 5 (p) UU Pilpres, adalah adanya
keinginan berbagai pihak agar persyaratan calon presiden dan wakil presiden ditingkatkan pendidikannya
dari SMA atau yang sederajat menjadi Lulusan S1 ( Sarjana).
54

Keinginan tersebut meniadakan roh aturan-aturan pokok konstitusi, setiap ayat yang bertentangan dengan
semangat konstitusi sesungguhnya merupakan pelanggaran. Syarat lulus S1 bertentangan dengan Pasal 6
ayat (1) UUD 1945 yang berbunyi : Calon Presiden dan Wakil Presiden harus WNI sejak kelahirannya dan
tidak pernah menerima kewarganegaraan lain karena kehendaknya sendiri, tidak pernah mengkhianati
negara, serta mampu secara rokhani dan jasmani untuk melaksanakan tugas dan kewajiban sebagai
presiden dan wakil presiden.
Adalah setengah benar premis lulusan sarjana berwawasan luas dan memliliki kemampuan analisis. Itulah
wawasan dan kemampuan yang bermanfaat untuk mengambil keputusan yang tepat. Yang jelas
pendidikan bukan variabel mutlak. Masih ada variabel lain yang diperlukan untuk menjadi pemimpin
yang mumpuni seperti kejujuran, integritas serta keberanian mengambil keputusan. Semua kualitas itu
kiranya tidak didapatkan dari pendidikan formal yang kian kapitalistik dan pragmatis.
Kualitas kepribadian itu justru lebih dominan dibentuk dilingkungan mulai dari keluarga hingga
sosialisasi dalam masyarakat. Belajar hidup bermasyarakat itulah universal kehidupan rakyat tidak
mungkin jabatan yang harus mempunyai pendidikan seperti jadi Jaksa Agung, Hakim, dan Polisi. Untuk
mengisi jabatan itu tidak menggeluti bidang hukum adalah kebodohan bila tidak mengharuskan kapasitas
dan kompetensi seorang sarjana hukum. Karena jabatan itu harus mempunyai keahlian dalam bidang
hukum bila tidak maka akan terjadi kerusakan hukum atau kekacauan hukum. Dengan demikian, inilah
jabatan yang tidak mencerminkan demokrasi secara luas.
Syarat sarjana untuk seorang calon presiden adalah tuntuntan yang mengada-ada. Presiden adalah jabatan
yang membutuhkan bobot kepemimpinan lebih dominan dari pada keahlian. Karena itu, ini adalah jabatan
yang bisa diisi oleh mereka yang memiliki kapabilitas dan kapasitas serta kecakapan memimpin. Jelas ini
bukan jabatan spesialis, tapi generalis.
Karena itu, kembalikan saja pada perintah dan semangat konstitusi dalam menentukan calon presiden.
Janganlah dikarang-karang syarat yang mengganjal calon tertentu agar memuluskan calon yang lain.
Undang-Undang harus dikembalikan pada asas dasarnya yang impersonal. Supremasi hukum
mengandung hakikat bahwa manusia harus taat kepada undang-undang, bukan undang-undang yang taat
kepada kemauan manusia atau untuk kepentingan kelompok politik saja. Hanya dengan begitu supremasi
hukum dapat ditegakkan.
Kajian Pasal 9 UU No. 42 Tahun 2008 tentang Pilpres
a. Skema kajian Morfologi
Morfologi : Hukum lebih berpihak kepada mereka yang berada dalam kehidupan sosial tinggi ( dalam hal
ini adalah Partai Politik ).
b. Analisis Pasal 9 UU No. 42 Tahun 2008 tentang Pilpres.
Bunyi Pasal 9 UU No. 42 Tahun 2008, berbunyi : Pasangan calon diusulkan oleh partai politik atau
gabungan partai politik peserta pemilu yang memenuhi persyaratan perolehan kursi paling sedikit 20 %
(dua puluh persen ) dari jumlah kursi DPR atau memperoleh 25 % ( dua puluh lima persen ) dari suara sah
nasional dalam pemilu anggota DPR, sebelum pelaksanaan pemilu Presiden dan Wakil Presiden.
Ketentaun tersebut tidak bertentangan dengan konstitusi dan tidak diskriminatif walaupun beberapa partai
politik menyatakan keberatan bahkan sampai mengajukan uji material atau judicial review ke Mahkamah
Konstitusi.
55

Ketua Umum DPP PDI Perjuangan, Megawati Soekarnoputri, menegaskan sikapnya yang memilih memperjuangkan
metode pemilihan langsung di pemilihan umum. Hanya saja, masyarakat diharap benar-benar menjaga kedaulatannya
itu dari segala intimidasi dan rayuan politik uang.
Sikap itu disampaikan Megawati saat berkampanye di hadapan belasan ribu warga Batam, Kepulauan Riau, Minggu
(29/11).
Awalnya, Megawati bicara soal kedaulatan rakyat dalam pemilihan umum dan pilkada, yang kerap dikotori dengan
berbagai hal. Misalnya intimidasi kepada masyarakat ataupun politik uang di pemilihan.
Megawati lalu bercerita, bahwa dirinya sedang mengkaji dengan Zulkifli Hasan sebagai Ketua MPR RI, apakah cara
pemilu langsung, lebih baik ketimbang model demokrasi perwakilan di era sebelumnya.
"Saya bilang Bang Zul, lebih baik rakyat yang memilih langsung," kata Megawati.
Dia menegaskan bahwa memang betul bahwa cara memilih langsung itu lebih baik. Karena itulah masyarakat harus
mau benar-benar belajar serta sadar bahwa kedaulatan rakyat dalam pemilihan umum benar-benar dilaksanakan
sebenar-benarnya.
"Makanya saya minta kalian yang memilih pemimpin kalian sendiri. Tapi kalian pun banyak kekurangannya. Tahu?
Apa?" Tanya Megawati kepada massa yang berkumpul.
Dijawab massa, "duit".
"Lah iya. Katanya suka dikasih duit. Tapi kok mau ya?" Kata Megawati lagi.
Ditegaskan Megawati bahwa kedaulatan ada di tangan rakyat, sehingga rakyat sendiri yang harus benar-benar menjaga
kedaulatan itu dari intimidasi dan rayuan politik uang. [MJS/L-8]

Dampak Positif dan Negatif Penyelenggaraan Pemilu secara langsung


semenjak jatuhnya orde baru dan munculnya Orde Reformasi, banyak kebijakan yang terjadi
dimasa orde baru mengalami perubahan yang sangat siginfikan. Perubahan tersebut terjadi
hampir disemua bidang termasuk penyelenggaraan Pemilu, baik pemilu legislatif, Pemilu
Presiden,
maupun
Pemilihan
Umum
Kepala
Daerah.
Jika dimasa Orde Baru Pemilihan Umum diselenggarakan oleh Pemerintah Daerah dan
Pemerintah Pusat, di masa Reformasi diselenggarakan oleh sebuah Lembaga Independen
yakni Komisi Pemilihan Umum (KPU). Pembentukan KPU ini sesuai dengan UU No. 04 Tahun
2000 tentang perubahan atas UU No. 03 tahun 1999 tentang Pemilu, dimana didalamnya
memuat tentang pembentukan Lembaga Independen Penyelenggara Pemilu yakni KPU. Tujuan
dari pembentukan KPU ini yakni agar penyelenggaraan Pemilu dapat berlangsung tanpa
adanya
intervensi
dari
pemerintah,
baik
pemerintah
pusat
maupun
daerah.
Reformasi pemilihan umum tidak hanya sebatas mengenai penyelenggara saja, tetapi sampai
metode pemilihan. Di masa Orde baru, untuk Pemilihan Anggota Legislatif, baik DPRD Kab /
Kota, DPRD Provinsi maupun DPR RI, kita hanya memilih Partai Politik dan untuk penunjukan
Anggota Legislatif merupakan kewenangan Partai Politik. Namun di masa Reformasi, Pemilihan
Anggota Legislatif dipilih secara langsung oleh rakyat. Begitu juga untuk pemilihan Presiden
maupun Kepala Daerah, jika dimasa Orde daru dipilih oleh DPR dan DPRD, maka dimasa
Reformasi
dipilih
secara
langsung
oleh
Rakyat.
Yang menjadi pertanyaan kita semua, apakah hal tersebut telah menunjukan hasil yang
maksimal?????????
Jawabannya, pasti belum. hal ini karena pemilihan Anggota Legislatif secara langsung oleh
56

rakyat justru berbanding terbalik dengan kualitas Anggota DPRD dan DPR yang terpilih. hal ini
karena, pemilihan anggota legislatif secara langsung memberikan kesempatan kepada para
Calon Anggota Legislatif untuk melakukan segala cara untuk menduduki kursi legislatif,
seperti praktek Money Politik, pemberian bantuan tertentu, pembagian sembako, dll. selain
itu, orang yang memiliki popularitas yang tinggi di masyarakat tanpa ragu - ragu maju
mencalonkan diri, padahal belum memiliki modal dan kapabilitas untuk menjadi anggota
legislatif. hasilnya, kursi legislatif hanya menjadi warisan orang - orang berduit dan para artis.
Alhasil, produk undang undang yang dihasilkan oleh DPR sangat minim kualitas. Saat
pelaksanaan sidang pun, banyak kursi yang kosong, lantaran masing masing sibuk dengan
urusan masing - masing. ada yang ngurus proyek, syuting Film, dan lain sebagainya. Disisi
lain, banyak orang pintar dengan latarbelakang pendidikan yang tinggi dan menunjang,
hanya menjadi penonton lantaran tidak memiliki duit untuk maju sebagai Clon Anggpta
Legislatif. yang paling memprihatinkan, tidak sedikit para mantan calon anggota legislatif
harus rela rumah dan mobilnya disita oleh Bank gara - gara tidak mampu membayar utang
yang
digunakan
untuk
maju
sebagai
anggota
legislatif.
Terus bagaimana dengan pemilihan Presiden dan Pemilihan Kepala Daerah???
Hasilnya, kurang lebih sama. untuk maju sebagai Calon presiden, sudah pasti harus kalangan
yang berduit. bayangkan saja, untuk bayar saksi diseluruh indonesia, Pasangan
Capres/Cawapres harus mengeluarkan ratusan Milyar Rupiah. hal ini mengingat jumlah TPS
untuk Pilpres 2009 sebanyak 561.363 TPS. jika setiap TPS ada saksi 2 (dua) orang, dan setiap
saksi dihargai Rp. 200.000 saja, maka Capres / Cawapres harus mengeluarkan sebanyak Rp.
112.278.600.000.
wuah,
jumlah
yang
luar
biasa
kan!!!!
Untuk penyelengaraan Pilkada, jumlah duit yang harus dikeluarkan juga tidak sedikit. Bahkan,
seorang Dede Yusuf harus menjual Villa yang dimilikinya hanya untuk membayar saksi
sewaktu maju dalam Pilkada Jabar. Kalau sudah begini, jangan pernah anda yang tidak berduit
untuk bermimpi menjadi seorang Bupati, Gubernur maupun Presiden. itu sudah menjadi
warisan
kalangan
konglomerat...,
Trus,
Solusinya
gimana???
pada
kesempatan
ini,
aku
pengen
nawarin
sbb
:
1. Untuk Pemilu Legislatif, kemblikan ke Format Orde lama, dimana kita hanya memilih Parpol
saja, tanpa harus memilih langsung Caleg. Untuk penunjukan Aleg, menjadi kewenangan
Parpol masing - masing. ini bertujuan agar para tidak ada lagi orang yang stres lantaran
kehabisan
duit
waktu
maju
sebagai
Caleg.
2. Untuk Pemilihan Presiden, tetap dipilih secara langsung oleh Rakyat, namun untuk Pilkada,
pemilihan Calon Kepala Daerah dipilih kembali oleh DPR. ini bertujuan agar anggaran negara
yang dikeluarkan untuk penyelenggaraan Pilkada bisa dihemat.

Sedikitnya ada tiga dampak besar pemilihan kepala daerah secara langsung yang membuat banyak pihak prihatin.
Ketiganya adalah penggunaan uang yang semakin marak dari waktu ke waktu untuk membeli suara konstituen, tidak
adanya jaminan pasangan calon terbaik akan menang dan akibat biaya kampanye yang besar maka hasil pilkada sulit
dipisahkan dari perilaku koruptif kepala daerah terpilih.
Menurut Guru Besar Institut Ilmu Pemerintahan yang juga mantan Menteri Dalam Negeri dan Otonomi Daerah Ryaas
Rasyid, tiga dampak besar pilkada langsung itu secara kumulatif akan secara otomatis mematikan ekspektasi publik
akn hadirnya pemerintahan yang baik di Indonesia.
"Harapan untuk percepatan kesejahteraan rakyat telah didistorsi oleh sistem pilkada langsung," ujar Ryaas.
Dia mencontohkan dampak besarnya biaya kampanye yang kemudian mengakibatkan kepala daerah sulit lepas dari
perilaku koruptif tergambar jelas dalam data terakhir yang dilansir Kementerian Dalam Negeri, bahwa ada 160 kepala
daerah yang telah dan akan dibawa ke pengadilan.
57

"Kesemuanya terkait dengan korupsi APBD. Perlu dicatat bahwa semua kepala daerah yang bermasalah ini adalah
hasil dari pilkada langsung," katanya.

JAKARTA - Menteri Dalam Negeri (Mendagri) Gamawan Fauzi menjadikan permasalahan pemilihan kepala daerah
langsung
sebagai
bahan
penelitian
dalam
disertasinya.
Dodi Riatmadji selaku juru bicara Mendagri menjelaskan, dampak negatif dari pemilihan kepala daerah langsung
adalah
maraknya
perilaku
korupsi
kepala
daerah
terpilih.
"Pada disertasi Mendagri tersebut ada korelasi korupsi oleh kepala daerah dengan besarnya biaya pengeluaran dalam
pemilukada (pemilihann umum kepala daerah)," ujar Dodi dalam acara diskusi Polemik Sindo Trijaya di Warung
Daun,
Cikini,
Jakarta
Pusat,
Sabtu
(13/9/2014).
Dodi juga memaparkan, ekses negatif lain pemilihan kepala daerah secara langsung sejak 2005, sedikitnya ada 327
kepala
daerah yang
terseret
kasus
hukum.
Sebanyak
80 persen karena
kasus
korupsi.
Dia menamabahkan, dampak pemilihan kepala daerah langsung adalah rawan konflik horizontal. Menurutnya, banyak
jiwa melayang sia-sia dampak pemilihan langsung tersebut. "Belum lagi kerusakan fasilitas seperti gedung
perkantoran,"
ucapnya.
Dampak lainnya, kata Dodi marak terjadi mutasi pejabat. Lanjutnya, Kepala daerah terpilih biasanya menyingkirkan
pejabat yang bukan pendukungnya ketika proses pencalonan. "Banyak mutasi pejabat tanpa pertimbangan. Di
Palembang contohnya, wali kota copot 158 pejabat tanpa alasan jelas," tandasnya.

Kontroversi dan gegap gempita isu politik pilkada langsung bukan hanya konsumsi pertentangan koalisi
Merah Putuh dan kubu pemerintahan baru dan PDIP. Ternyata pilkada langsung sudah mulai
diperbincangkan dan menjadi kajian menyeluruh oleh pemerintah sejak beberapa tahun terakhir ini, karena
dampak besar yang ditimbulkan. Ternyata hasil kajian pemerintah tersebut saat ini disambut olehkontroversi
pertentangan dua kubu besar di arlemen yang sedang memperjuangkan pilkada langsung diteruskan atau
dibatalkan.
Dampak Buruk Pilkada Langsung

Dampak perseteruan sosial politik sepertti demonstrasi anarkis dengan membakar kantor pemerintahan atau
kantor polisi dan korban jiwa tidak terelakkan dalam perseteruan pilkada langsung itu. Pilkada langsung belakangan
hanya menimbulkan dampak kerusuhan.

Dampak konflik fisik horizontal dan vertikal dengan pihak keamanan sejauh ini mengakibatkan 70 orang
tewas dalam sejumlah aksi unjuk rasa dan kerusuhan usai pilkada langsung sejak 2005. Sejumlah tokoh masyarakat
asal Papua menyatakan dukungan terhadap pemilihan kepala daerah tidak langsung. Mereka meminta pemilihan oleh
DPRD bisa dimasukan ke dalam revisi Undang Undang Otsus Papua yang kini tengah dibahas DPR RI. Para tokoh
yang tergabung dalam Tim Perancang Undang Undang Pemerintahan Otonomi Khusus Papua ini mendatangi kantor
Fraksi Partai Golkar di Gedung Nusantara I DPR RI, Jakarta, Selasa (9/9) untuk menyampaikan aspirasi tersebut.
Kita ingin sistem pilkada tidak langsung dimasukkan dalam RUU Otsus. Pertimbangannya situasi di Papua kalau
pilkada langsung terlalu banyak konflik sampai-sampai merusak tatanan adat dan keluarga di Papua, kata Ketua Tim,
Basir Rohrohmana usai pertemuan. Pilkada langsung di Papua lebih banyak mudharatnya. Pasalnya, bukan cuma
menelan biaya besar tapi juga memakan korban jiwa. Di Papua banyak yang mati karena Pilkada langsung. Kemudian
rentan dengan perang suku. Mekanisme pilkada tidak langsung merupakan aspirasi mayoritas masyarakat Papua.
Beberapa waktu lalu DPRD Papua menggelar rapat dengar pendapat dengan masyarakat untuk membahas revisi UU
Otsus. Hasilnya, sebagian besar setuju pilkada tidak langsung harus masuk dalam revisi tersebut.

Dampak besar pemilihan kepala daerah secara langsung yang membuat banyak pihak prihatin adalah
maraknya politik uang. Penggunaan uang yang semakin marak dari waktu ke waktu untuk membeli suara konstituen,
58

tidak adanya jaminan pasangan calon terbaik akan menang dan akibat biaya kampanye yang besar maka hasil pilkada
sulit dipisahkan dari perilaku koruptif kepala daerah terpilih. menurut kajian pemerintah sebagian besar pilkada
langsung berdampak pada pelaksanaan pemerintahan di daerah.

Dampak penyelenggaraan pilkada langsung yang biayanya cenderung tinggi, menurut kajian pemerintah,
antara lain menyebabkan banyak kepala daerah terpilih tersangkut kasus hukum, khususnya karena korupsi untuk
mengembalikan modal mereka saat kampanye.

Kadang-kadang politik uang yang terjadi, ongkos politik yang mahal, kemudian tidak mudahnya membedakan
antara popularitas dan kapasitas, dan seterusnya

Selain itu juga muncul konflik horisontal akibat persaingan antar-calon. Mengakibatkan kontak fisik dan
piskis antar pendukung para calon yang kadang mengakibatkan tindakan kriminal dan pelanggaran hukum

Dampak besar pilkada langsung itu secara kumulatif akan secara otomatis mematikan ekspektasi publik akan
hadirnya pemerintahan yang baik di Indonesia. Harapan untuk membangun demokrasi dan percepatan kesejahteraan
rakyat telah didistorsi oleh sistem pilkada langsung.

Sebagian besar pilkada langsung berdampak pada pelaksanaan pemerintahan di daerah.

Dampak penyelenggaraan pilkada langsung yang biayanya cenderung tinggi, menurut kajian pemerintah,
antara lain menyebabkan banyak kepala daerah terpilih tersangkut kasus hukum, khususnya karena korupsi untuk
mengembalikan modal mereka saat kampanye.

Dampak besarnya biaya kampanye yang kemudian mengakibatkan kepala daerah sulit lepas dari perilaku
koruptif tergambar jelas dalam data terakhir yang dilansir Kementerian Dalam Negeri, bahwa ada 160 kepala daerah
yang telah dan akan dibawa ke pengadilan karena korupsi APBD.
Dampak Positif

Pilkada langsung membuat masyarakat daerah mengenal calon kepala daerahnya. Konstituen akan lebih dekat
mengenal calon. Kemudian siapapun yang terpilih berarti mendapatkan mandat dari rakyat yang dipimpinnya
Penanganan

Hal tersebut bukan berarti menafikan manfaat dari pilkada langsung, dampak negatif negatif itu dapat diatasi.

Mungkin antisipasi dan penanganan dampak buruk tersebut, tidak perlu mengubah pemilihan langsung dengan
pemilihan tidak langsung. Tetapi kita harus mengatasi ekses, mencegah semaksimal mungkin agar tidak menimbulkan
komplikasi dan masalah-masalah baru yang tidak perlu terjadi.

Dasar hukum tentang Pilkada langsung sebenarnya tidak diwajibkan dalam UUD 1945. Karena UUD 1945
tidak mengatur kepala daerah dipilih secara langsung, hanya dipilih secara demokratis. Melihat untung ruginya bagi
bangsa dan masyarakat maka perlu dipikirkan kembali apakah tepat jika pilkada dilakukan secara langsung. Karena
UUD 1945 menyebutkan hanya pemilihan presiden saja yang diselenggarakan secara langsung.

59

Sejarah Hukum di Indonesia

Periode
Periode
Periode
Periode

Kolonialisme
Revolusi Fisik Sampai Demokrasi Liberal
Demokrasi Terpimpin Sampai Orde Baru
Pasca Orde Baru (1998 Sekarang)

1. Periode Kolonialisme
Periode kolonialisme terbagi ke dalam tiga tahapan besar, yakni: periode VOC, Liberal Belanda
dan Politik etis hingga penjajahan Jepang.
a. Periode VOC
Pada masa pendudukan VOC, sistem hukum yang diterapkan bertujuan untuk:
1) Kepentingan ekspolitasi ekonomi demi mengatasi krisis ekonomi di negeri Belanda;
2) Pendisiplinan rakyat pribumi dengan cara yang otoriter; dan
3) Perlindungan terhadap pegawai VOC, sanak-kerabatnya, dan para pendatang Eropa.
Hukum Belanda diberlakukan terhadap orang-orang Belanda atau Eropa. Sedangkan bagi
pribumi, yang berlaku adalah hukum-hukum yang dibentuk oleh tiap-tiap komunitas secara
mandiri. Tata pemerintahan dan politik pada zaman itu telah meminggirkan hak-hak dasar
rakyat di nusantara dan menjadikan penderitaan yang mendalam terhadap rakyat pribumi di
masa itu.
b. Periode liberal Belanda
Pada 1854 di Hindia Belanda diterbitkan Regeringsreglement (selanjutnya disebut RR 1854)
atau Peraturan tentang Tata Pemerintahan (di Hindia Belanda) yang tujuan utamanya
melindungi kepentingan kepentingan usaha-usaha swasta di negeri jajahan dan untuk
pertama kalinya mengatur perlindungan hukum terhadap kaum pribumi dari kesewenangwenangan pemerintahan jajahan. Hal ini dapat ditemukan dalam (Regeringsreglement) RR
1854 yang mengatur tentang pembatasan terhadap eksekutif (terutama Residen) dan
kepolisian, dan jaminan terhadap proses peradilan yang bebas.
Otokratisme administrasi kolonial masih tetap berlangsung pada periode ini, walaupun tidak
lagi sebengis sebelumnya. Namun, pembaruan hukum yang dilandasi oleh politik liberalisasi
ekonomi ini ternyata tidak meningkatkan kesejahteraan pribumi, karena eksploitasi masih
terus terjadi, hanya subyek eksploitasinya saja yang berganti, dari eksploitasi oleh negara
menjadi eksploitasi oleh modal swasta.
c. Periode Politik Etis Sampai Kolonialisme Jepang
Kebijakan Politik Etis dikeluarkan pada awal abad 20. Di antara kebijakan-kebijakan awal
politik etis yang berkaitan langsung dengan pembaharuan hukum adalah: 1) Pendidikan untuk
anak-anak pribumi, termasuk pendidikan lanjutan hukum; 2) Pembentukan Volksraad,
lembaga perwakilan untuk kaum pribumi; 3) Penataan organisasi pemerintahan, khususnya
dari segi efisiensi; 4) Penataan lembaga peradilan, khususnya dalam hal profesionalitas; 5)
Pembentukan peraturan perundang-undangan yang berorientasi pada kepastian hukum.
Hingga runtuhnya kekuasaan kolonial, pembaruan hukum di Hindia Belanda mewariskan: 1)
Dualisme/pluralisme hukum privat serta dualisme/pluralisme lembaga-lembaga peradilan; 2)
Penggolongan rakyat ke dalam tiga golongan; Eropa dan yang disamakan, Timur Asing,
Tionghoa dan Non-Tionghoa, dan Pribumi.
60

Masa pendudukan Jepang pembaharuan hukum tidak banyak terjadi seluruh peraturan
perundang-undangan yang tidak bertentangan dengan peraturan militer Jepang, tetap
berlaku sembari menghilangkan hak-hak istimewa orang-orang Belanda dan Eropa lainnya.
Beberapa perubahan perundang-undangan yang terjadi: 1) Kitab UU Hukum Perdata, yang
semula hanya berlaku untuk golongan Eropa dan yang setara, diberlakukan juga untuk orangorang Cina; 2) Beberapa peraturan militer disisipkan dalam peraturan perundang-undangan
pidana yang berlaku. Di bidang peradilan, pembaharuan yang dilakukan adalah: 1)
Penghapusan dualisme/pluralisme tata peradilan; 2) Unifikasi kejaksaan; 3) Penghapusan
pembedaan polisi kota dan pedesaan/lapangan; 4) Pembentukan lembaga pendidikan hukum;
5) Pengisian secara massif jabatan-jabatan administrasi pemerintahan dan hukum dengan
orang-orang pribumi.
2. Periode Revolusi Fisik Sampai Demokrasi Liberal
a. Periode Revolusi Fisik
Pembaruan hukum yang sangat berpengaruh di masa awal ini adalah pembaruan di dalam
bidang peradilan, yang bertujuan dekolonisasi dan nasionalisasi: 1) Meneruskan unfikasi
badan-badan peradilan dengan melakukan penyederhanaan; 2) Mengurangi dan membatasi
peran badan-badan pengadilan adat dan swapraja, kecuali badan-badan pengadilan agama
yang bahkan dikuatkan dengan pendirian Mahkamah Islam Tinggi.
b. Periode Demokrasi Liberal
UUDS 1950 yang telah mengakui hak asasi manusia. Namun pada masa ini pembaharuan
hukum dan tata peradilan tidak banyak terjadi, yang ada adalah dilema untuk
mempertahankan hukum dan peradilan adat atau mengkodifikasi dan mengunifikasinya
menjadi hukum nasional yang peka terhadap perkembangan ekonomi dan tata hubungan
internasional. Kemudian yang berjalan hanyalah unifikasi peradilan dengan menghapuskan
seluruh badan-badan dan mekanisme pengadilan atau penyelesaian sengketa di luar
pengadilan negara, yang ditetapkan melalui UU No. 9/1950 tentang Mahkamah Agung dan UU
Darurat No. 1/1951 tentang Susunan dan Kekuasaan Pengadilan.
3. Periode Demokrasi Terpimpin Sampai Orde Baru
a. Periode Demokrasi Terpimpin
Langkah-langkah pemerintahan Demokrasi Terpimpin yang dianggap sangat berpengaruh
dalam dinamika hukum dan peradilan adalah: 1) Menghapuskan doktrin pemisahan
kekuasaan dan mendudukan MA dan badan-badan pengadilan di bawah lembaga eksekutif; 2)
Mengganti lambang hukum ?dewi keadilan? menjadi ?pohon beringin? yang berarti
pengayoman; 3) Memberikan peluang kepada eksekutif untuk melakukan campur tangan
secara langsung atas proses peradilan berdasarkan UU No.19/1964 dan UU No.13/1965; 4)
Menyatakan bahwa hukum perdata pada masa kolonial tidak berlaku kecuali sebagai rujukan,
sehingga hakim mesti mengembangkan putusan-putusan yang lebih situasional dan
kontekstual.
b. Periode Orde Baru
Perkembangan dan dinamika hukum dan tata peradilan di bawah Orde Baru justru diawali
oleh penyingkiran hukum dalam proses politik dan pemerintahan. Di bidang perundangundangan, rezim Orde Baru ?membekukan? pelaksanaan UU Pokok Agraria, dan pada saat
yang sama membentuk beberapa undang-undang yang memudahkan modal asing
berinvestasi di Indonesia; di antaranya adalah UU Penanaman Modal Asing, UU Kehutanan,
dan UU Pertambangan. Selain itu, orde baru juga melakukan: 1) Penundukan lembagalembaga hukum di bawah eksekutif; 2) Pengendalian sistem pendidikan dan penghancuran
pemikiran kritis, termasuk dalam pemikiran hukum; Singkatnya, pada masa orde baru tak ada
perkembangan yang baik dalam hukum Nasional.
4. Periode Pasca Orde Baru (1998 Sekarang)
61

Sejak pucuk eksekutif di pegang Presiden Habibie hingga sekarang, sudah terjadi empat kali
amandemen UUD RI. Di arah perundang-undangan dan kelembagaan negara, beberapa
pembaruan formal yang mengemuka adalah: 1) Pembaruan sistem politik dan
ketetanegaraan; 2) Pembaruan sistem hukum dan hak asasi manusia; dan 3) Pembaruan
sistem ekonomi.
Penyakit lama orde baru, yaitu KKN (korupsi, kolusi dan nepotisme) masih kokoh mengakar
pada masa pasca orde baru, bahkan kian luas jangkauannya. Selain itu, kemampuan
perangkat hukum pun dinilai belum memadai untuk dapat menjerat para pelaku semacam itu.
Aparat penegak hukum seperti polisi, jaksa, dan hakim (kini ditambah advokat) dilihat masih
belum mampu mengartikulasikan tuntutan permbaruan hukum, hal ini dapat dilihat dari
ketidakmampuan Kejaksaan Agung meneruskan proses peradilan mantan Presiden Soeharto,
peradilan pelanggaran HAM, serta peradilan para konglomerat hitam. Sisi baiknya,
pemberdayaan rakyat untuk menuntut hak-haknya dan mengembangkan sumber daya
hukumnya secara mandiri, semakin gencar dan luas dilaksanakan. Walaupun begitu,
pembaruan hukum tetap terasa lambat dan masih tak tentu arahnya.
BAB IPENDAHULUANA. LATAR BELAKANGHukum adalah sistem yang terpenting dalam pelaksanaan atas
rangkaian kekuasaankelembagaan dari bentuk penyalahgunaan kekuasaan dalam bidang politik, ekonomi
danmasyarakat dalam berbagai cara dan bertindak, sebagai perantara utama dalam hubungansosial antar masyarakat
terhadap kriminalisasi. Hukum di Indonesia merupakan campuran darisistem hukum Eropa, hukum agama, dan hukum
adat. Sebagian besar sistem yang dianut, baikperdata maupun pidana berbasis pada hukum Eropa, khususnya dari
Belanda karena aspeksejarah masa lalu Indonesia yang merupakan wilayah jajahan dengan sebutan HindiaBelanda(Nederlandsch-Indie). Hukum agama karena sebagian besar masyarakat Indonesia menganutIslam, maka
dominasi hukum atau syariat Islam lebih banyak terutama di bidang perkawinan,kekeluargaan, dan warisan. Selain itu,
di Indonesia juga berlaku sistem hukum adat yangdiserap dalam perundang-undangan atau yurisprudensi, yang
merupakan penerusan dariaturan-aturan setempat dari masyarakat dan budaya-budaya yang ada di wilayah
nusantara.Namun, apakah hukum di Indonesia berjalan sesuai alurnya? Jawabannya iya, namun taksedikit yang tidak
berjalan sesuai alur.Undang-Undang Dasar 1945 secara tegas menerangkan dalam pasal 1 ayat (3) UUD1945
perubahan ketiga yang berbunyi Negara Indonesia adalah Negara hukum. Artinya,Negara Kesatuan Republik
Indonesia adalah negara yang berdasar atas hukum (rechtsstaat),tidak berdasar atas kekuasaan (machstaat), dan
pemerintah berdasarkan sistem konsitusi(hukum dasar), bukan absolutisme (kekuasaan yang tidak terbatas). Dan
perwujudan hukumtersebut terdapat dalam UUD 1945 serta peraturan perundangan di bawahnya. Tetapi kenapasistem
hukum di negeri ini selalu menjadi topik yang tak bosan-bosannya diperbincangkandan selalu membuat masalah.
Apakah sistem yang berlaku tidak sesuai dengan karakterbangsa Indonesia? Apakah para pelaku hukum yang tidak
mengetahui ganjaran setiaptindakan penyelewengan yang mereka lakukan? Atau apakah ganjaran dari sistem
hukumtersebut yang kurang tegas untuk mengatasi berbagai macam permasalahan tindak pidana?Hukum di Indonesia
yang bisa kita lihat saat ini bisa dikatakan sebagai hukum yangcarut marut, mengapa? Karena dengan adanya
pemberitaan mengenai tindak pidana ditelevisi, surat kabar, dan media elektronik lainnya kita dapat mengambil
kesimpulan bahwahukum di Indonesia carut marut. Banyak sekali kejadian yang menggambarkannya, mulai dari
2. 2tindak pidana yang diberikan oleh maling sandal hingga maling uang rakyat. Sebenarnyapermasalahan hukum
di Indonesia dapat disebabkan oleh beberapa hal diantaranya yaitusistem peradilannya, perangkat hukumnya,
inkonsistensi penegakan hukum, intervensikekuasaan, maupun perlindungan hukum.Hukum Negara ialah aturan bagi
Negara itu sendiri, bagaimana suatu Negaramenciptakan keadaan yang relevan, keadaan yang menentramkan
kehidupan sosialmasyarakatnya, menghindarkan dari segala bentuk tindak pidana maupun perdata. Namuntidak di
Indonesia dalam beberapa tahun terakhir ini, pemberitaan di media masa sungguhtragis. Bahkan dari Hasil survei
terbaru dari Lingkaran Survei Indonesia (LSI) menyebutkanbahwa 56,0 persen publik menyatakan tidak puas dengan
penegakan hukum di Indonesia,hanya 29,8 persen menyatakan puas, sedangkan sisanya 14,2 persen tidak menjawab.
Sebuahfenomena yang menggambarkan betapa rendahnya wibawa hukum di mata publik.Dengan landasan pemikiran
ini, penulis akan mencoba memaparkan mengenai hukum,penegakannya, aspek-aspek yang menjadi subjek dan
objeknya, serta penerapannya di tengahmasyarakat yang tidak puas dengan keadaan penegakan hukum di Indonesia
sekarang ini.B. RUMUSAN MASALAHAdapun rumusan masalah dalam perkara ini adalah sebagai berikut.1.
Definisi Negara Indonesia sebagai Negara hukum.2. Sistem dan penegakan hukum di Indonesia.3. Penegakan hukum
dan dampak yang timbul dari penegakan hukum di Indonesia.4. Penegakan hukum dan ketidakpuasan masyarakat
terhadap penerapannya.5. Solusi dan cara menghadapai permasalahan dalam penegakan hukum di Indonesia.C.
TUJUANTujuan dalam pembahasan ini adalah interpretasi terhadap rumusan permasalahan ini,yaitu.1. Untuk
mengetahui defenisi Negara sebagai Negara hukum.2. Untuk mengetahui sistem penegakan hukum di Indonesia.3.
62

Untuk mengetahui penegakan hukum dan dampak yang timbul dari penegakanhukum di Indonesia.4. Untuk
mengetahui penegakan hukum dan ketidakpuasan masyarakat terhadappenerapannya.
3. 35. Untuk mengetahui solusi dan cara menghadapai permasalahan dalam penegakanhukum di Indonesia.D.
MANFAATAdapun manfaat yang diharapkan dalam pembahasan ini adalah sebagai berikut.1. Dapat mengetahui
dasar-dasar dalam pembentukan hukum Negara Indonesia.2. Dapat mengetahui sistem penegakan hukum yang berlaku
di Indonesia.3. Dapat mengetahui dampak dalam penegakan hukum di Indonesia.4. Dapat mengetahui kenapa
masyarakat tidak puas dengan penegakan hukum diIndonesia.5. Dapat mengetahui dan menilai bagaimana solusi
dalam pemecahan permasalahanhukum di Indonesia.6. Khusus bagi pemerintahan, memberikan gambaran mengenai
sistem penegakanhukum yang berlaku dalam masyarakat, serta diharapkan dapat menilai, menelaahdan membuat
suatu keputusan dalam pemecahan masalah penegakan hukumtersebut.

4. 4BAB IIPEMBAHASAANA. DEFINISI NEGARA INDONEISA SEBAGAI NEGARA HUKUMa.


NegaraSebelum menelaah lebih jauh mengenai definisi Negara sebagai Negara hukum, perludiketahui terlebih dahulu
istilah-istilah Negara serta aspek yang terdapat di dalamnya. IstilahNegara terjemahan dari de staat (bahasa Belanda),
the state (bahasa Inggris), Letat (bahasaPerancis), statum (bahasa Latin), lo stato (bahasa Italia), dan der staat (dalam
bahasa Jerman).Dari sekian banyak istilah yang digunakan untuk Negara, istilah Negara mengandung banyakarti dari
beberapa ahli, yakni sebagai berikut.Prof. NasroenNegara itu adalah suatu bentuk pergaulan hidup dan oleh sebab itu
harusjuga ditinjausecara sosiologis agar dapati dijelaskan dan dipahami.AristotelesNegara (polis) adalah persekutuan
dari keluarga dan desa untuk mencapai kehidupanyang sebaik-baiknya.Hans KalsenNegara adalah suatu susunan
pergaulan hidup bersama dengan tata paksa.SoenarkoNegara ialah suatu organisasi masyarakat yang mempunyai
daerah tertentu, tempatkekuasaan Negara berlaku sepenuhnya sebagai souvereign (kedaulatan).G. Pringgodigdo, S.
HNegara ialah suatu organisasi kewibawaan yang harus memenuhi persyaratan unsur-unsur tertentu, yaitu harus ada
pemerintahan yang berdaulat, wilayah tertentu, rakyat yanghidup dengan teratur sehingga merupakan suatu nation
(bangsa).
5. 5M. Solly Lubis, S. HNegara adalah suatu bentuk pergaulan hidup manusia secara komunitas. Negara
itumempunyai syarat-syarat tertentu , yaitu mempunyai daerah tertentu, rakyat tertentu, danmempunyai
pemerintahan.Fr. OppenheimerBila di suatu masyarakat tertentu terdapat suatu diferensiasi politik (antara pihak
yangmemerintah dan pihak yang diperintah) dan seterusnya, maka terdapatlah suatu Negara.Kesimpulannya, Negara
adalah suatu bentuk organisasi yang melakukan pergaulan(karena adanya perbedaan) tertentu dimana terdapat sistem
yang mengaturnya (bersifatmemaksa) dengan unsur-unsur yang di dalamnya untuk mencapai tingkat kehidupan
sebaik-baiknya.Unsur-unsur terjadinya Negara menurut Oppenheim-Lauterpacht ada tiga unsurpokok Negara, yaitu
adanya rakyat, adanya wilayah atau daerah tertentu, dan pemerintah yangberdaulat. Unsur ini disebut sebagai unsur
konstitutif, artinya jika salah satu unsur tersebuttidak ada, maka Negara pun tidak ada. Kemudian ada unsur deklaratif
(bukan merupakanunsur yang mutlak) yaitu pengakuan dari Negara lain, artinya jika ada pengakuan dariNegaranegara lain, menyatakan bahwa Negara baru tersebut diterima sebagai anggota barudalam pergaulan
antarnegara.Secara umum suatu organisasi dapat disebut sebaagi Negara apabila memenuhi syaratatau unsur mutlak
dan unsur yang tidak mutlak sebagai pelengkap adanya Negara tersebut.Tetapi dalam perkembangan sejarah, jelas
terlihat ada semacam bentuk kenegaraan yangmengikatkan diri dengan Negara lain karena alasan tertentu, bahkan ada
daerah yangberpemerintahan sendiri. Oleh karena itu, dapat dibedakan antara bentuk Negara dan bentukkenegaraan.
Adapun bentuk Negara yang banyak dianut di dunia adalah Negara kesatuan(unitaris), yaitu Negara yang bersusun
tunggal, Negara yang hanya terdiri atas satu Negara,satu pemerintahan, satu kepala Negara, satu undang-undang dasar
negara, dan satu lembagalegistalif untuk seluruh wilayah negaanya, contohnya Indonesia. Bentuk Negara yang
keduaadalah Negara serikat (federasi), yaitu Negara yang terdiri atas gabungan beberapa Negarayang semula berdiri
sendiri, kemudian bergabung menjadi suatu Negara serikat, sehinggamenjadi Negara bagian yang melepaskan
sebagian kekuasaannya kepada Negara serikat,contoh Negara Amerika Serikat.
6. 6b. HukumHukum adalah sistem yang terpenting dalam pelaksanaan atas rangkaian kekuasaankelembagaan dari
bentuk penyalahgunaan kekuasaan dalam bidang politik, ekonomi danmasyarakat dalam berbagai cara dan bertindak,
sebagai perantara utama dalam hubungansosial antar masyarakat terhadap kriminalisasi dalam hukum pidana, hukum
pidana yangberupayakan cara negara dapat menuntut pelaku dalam konstitusi hukum menyediakankerangka kerja bagi
penciptaan hukum, perlindungan hak asasi manusia dan memperluaskekuasaan politik serta cara perwakilan di mana
mereka yang akan dipilih.Hukum dapat dibagi dalam berbagai bidang,antara lain hukum pidana/hukum publik,
hukumperdata/hukum pribadi, hukum acara, hukum tatanegara, hukum administrasi negara/hukum tata usahanegara,
hukum internasional, hukum adat, hukumislam, hukum agraria, hukum bisnis, dan hukumlingkungan.Hukum
PidanaHukum pidana termasuk pada ranah hukum publik. Hukum pidana adalah hukum yangmengatur hubungan
antar subjek hukum dalam hal perbuatan - perbuatan yang diharuskan dandilarang oleh peraturan perundang undangan dan berakibat diterapkannya sanksi berupapemidanaan dan/atau denda bagi para pelanggarnya.Hukum
PerdataSalah satu bidang hukum yang mengatur hubungan-hubungan antara individu-individudalam masyarakat
dengan saluran tertentu. Hukum perdata disebut juga hukum privat atauhukum sipil. Salah satu contoh hukum perdata
dalam masyarakat adalah jual beli rumah ataukendaraan.Hukum AcaraUntuk tegaknya hukum materiil diperlukan
63

hukum acara atau sering juga disebuthukum formil. Hukum acara merupakan ketentuan yang mengatur bagaimana
cara dan siapayang berwenang menegakkan hukum materiil dalam hal terjadi pelanggaran terhadap hukummateriil.
Tanpa hukum acara yang jelas dan memadai, maka pihak yang berwenangmenegakkan hukum materiil akan
mengalami kesulitan menegakkan hukum materiil. Untukmenegakkan ketentuan hukum materiil pidana diperlukan
hukum acara pidana, untuk hukum
7. 7materiil perdata, maka ada hukum acara perdata. Sedangkan, untuk hukum materiil tata usahanegara,
diperlukan hukum acara tata usaha negara. Hukum acara pidana harus dikuasaiterutama oleh para polisi, jaksa,
advokat, hakim, dan petugas Lembaga Pemasyarakatan.Sistem hukum yang terdapat di dunia antara lain, Sistem
hukum Eropa Kontinental,Anglo-Saxon (yaitu sistem hukum yang berlaku di Kerajaan Inggris Raya dan negaranegarapersemakmuran atau negara-negara yang terpengaruh oleh Inggris, misalnya AmerikaSerikat), sistem hukum
adat/kebiasaan, sistem hukum agama.c. Indoneisa sebagai Negara HukumLandasan Yuridis Negara Hukum Indonesia.
Negara Kesatuan Republik Indonesia(NKRI) adalah negara yang berdasar atas hukum (rechtsstaat), tidak berdasar atas
kekuasaan(machstaat), dan pemerintah berdasarkan sistem konsitusi (hukum dasar), bukan absolutisme(kekuasaan
yang tidak terbatas). Hal ini tertuang jelas dalam Pasal 1 ayat (3) UUD 1945perubahan ketiga yang berbunyi, Negara
Indonesia adalah Negara hukum. Sebagaikonsekuensi dari Pasal 1 ayat (3) Amandemen ketiga Undang-Undang
Dasar 1945, tigaprinsip dasar wajib dijunjung oleh setiap warga Negara yaitu, supremasi hukum, kesetaraandihadapan
hukum, dan penegakan hukum dengan cara-cara yang tidak bertentangan denagnhukum.Perwujudan hukum tersebut
terdapat dalam Undang-Undang 1945 serta peraturanperundang-undangan di bawahnya. Negara bertujuan melindungi
segenap bangsa dan seluruhtumpah darah Indonesia serta turut memajukan kesejahteraan umum dan kecerdasan
rakyat.Negara hukum Indonesia menganut konsep Negara hukum materiil (welfare state), artinyaNegara yang
pemerintahannya memiliki keleluasan untuk turut campur tangan dalam urusanwarga dengan dasar bahwa pemerintah
ikut bertanggung jawab terhadap kesejahteraan rakyat.Negara hukum berkaitan dengan dengan Hak Asasi Manusia
(HAM). Sebab, salahsatu ciri dari Negara hukum adalah adanya jaminan atas HAM. Oleh karena itu, Negarahukum
bertanggung jawab atas perlindungan dan penegakan hak asasi para warganya.Hukum di Indonesia merupakan
campuran dari sistem hukum Eropa, hukum agama,dan hukum adat. Sebagian besar sistem yang dianut, baik perdata
maupun pidana berbasispada hukum Eropa, khususnya dari Belanda karena aspek sejarah masa lalu Indonesia
yangmerupakan wilayah jajahan dengan sebutan Hindia-Belanda (Nederlandsch-Indie). Hukumagama karena sebagian
besar masyarakat Indonesia menganut Islam, maka dominasi hukumatau syariat Islam lebih banyak terutama di bidang
perkawinan, kekeluargaan, dan warisan.Selain itu, di Indonesia juga berlaku sistem hukum adat yang diserap dalam
perundang 8. 8undangan atau yurisprudensi, yang merupakan penerusan dari aturan-aturan setempat darimasyarakat dan
budaya-budaya yang ada di wilayah nusantara.Hukum Pidana IndonesiaHukum pidana merupakan bagian dari hukum
publik. Hukum pidana terbagi menjadidua bagian, yaitu hukum pidana materiil dan hukum pidana formil. Hukum
pidana materiilmengatur tentang penentuan tindak pidana, pelaku tindak pidana, dan pidana (sanksi). DiIndonesia,
pengaturan hukum pidana materiil diatur dalam kitab undang-undang hukumpidana (KUHP). Hukum pidana formil
mengatur tentang pelaksanaan hukum pidana materiil.Di Indonesia, pengaturan hukum pidana formil telah disahkan
dengan UU nomor 8 tahun1981 tentang hukum acara pidana (KUHAP).Hukum Perdata IndonesiaHukum perdata
disebut pula hukum privat atau hukum sipil sebagai lawan dari hukumpublik. Jika hukum publik mengatur hal-hal
yang berkaitan dengan negara serta kepentinganumum (misalnya politik dan pemilu (hukum tata negara), kegiatan
pemerintahan sehari-hari(hukum administrasi atau tata usaha negara), kejahatan (hukum pidana), maka hukum
perdatamengatur hubungan antara penduduk atau warga negara sehari-hari, seperti misalnyakedewasaan seseorang,
perkawinan, perceraian, kematian, pewarisan, harta benda, kegiatanusaha dan tindakan-tindakan yang bersifat perdata
lainnya.Hukum perdata di Indonesia didasarkan pada hukum perdata di Belanda, khususnyahukum perdata Belanda
pada masa penjajahan. Bahkan Kitab Undang-undang Hukum Perdata(dikenal KUHPer.) yang berlaku di Indonesia
tidak lain adalah terjemahan yang kurang tepatdari Burgerlijk Wetboek (atau dikenal dengan BW)yang berlaku di
kerajaan Belanda dandiberlakukan di Indonesia (dan wilayah jajahan Belanda) berdasarkan asas konkordansi.Untuk
Indonesia yang saat itu masih bernama Hindia-Belanda, BW diberlakukanmulai 1859. Hukum perdata Belanda sendiri
disadur dari hukum perdata yang berlaku diPerancis dengan beberapa penyesuaian.Buku I tentang Orang: mengatur
tentang hukum perseorangan dan hukum keluarga,yaitu hukum yang mengatur status serta hak dan kewajiban yang
dimiliki oleh subyek hukum.Buku II tentang Kebendaan: mengatur tentang hukum benda, yaitu hukum yangmengatur
hak dan kewajiban yang dimiliki subyek hukum yang berkaitan dengan benda,antara lain hak-hak kebendaan, waris
dan penjaminan.Buku III tentang Perikatan: mengatur tentang hukum perikatan (atau kadang disebutjuga perjanjian
(walaupun istilah ini sesunguhnya mempunyai makna yang berbeda), yaitu
9. 9hukum yang mengatur tentang hak dan kewajiban antara subyek hukum di bidang perikatan,antara lain tentang
jenis-jenis perikatan (yang terdiri dari perikatan yang timbul dari(ditetapkan) undang-undang dan perikatan yang
timbul dari adanya perjanjian), syarat-syaratdan tata cara pembuatan suatu perjanjian.Buku IV tentang Daluarsa dan
Pembuktian: mengatur hak dan kewajiban subyekhukum (khususnya batas atau tenggat waktu) dalam mempergunakan
hak-haknya dalamhukum perdata dan hal-hal yang berkaitan dengan pembuktian.Hukum Tata NegaraHukum tata
64

negara adalah hukum yang mengatur tentang negara, yaitu antara laindasar pendirian, struktur kelembagaan,
pembentukan lembaga-lembaga negara, hubunganhukum (hak dan kewajiban) antar lembaga negara, wilayah dan
warga negara. Hukum tatanegara mengatur mengenai negara dalam keadaan diam artinya bukan mengenai
suatukeadaan nyata dari suatu negara tertentu (sistem pemerintahan, sistem pemilu, dll dari negaratertentu) tetapi lebih
pada negara dalam arti luas. Hukum ini membicarakan negara dalam artiyang abstrak.Hukum Tata Usaha
(Administrasi) NegaraHukum tata usaha (administrasi) negara adalah hukum yang mengatur kegiatanadministrasi
negara. Yaitu hukum yang mengatur tata pelaksanaan pemerintah dalammenjalankan tugasnya . hukum administarasi
negara memiliki kemiripan dengan hukum tatanegara.kesamaanya terletak dalam hal kebijakan pemerintah ,sedangkan
dalam hal perbedaanhukum tata negara lebih mengacu kepada fungsi konstitusi/hukum dasar yang digunakan
olehsuatu negara dalam hal pengaturan kebijakan pemerintah,untuk hukum administrasi negaradimana negara dalam
"keadaan yang bergerak". Hukum tata usaha negara juga sering disebutHTN dalam arti sempit.Hukum Acara Pidana
IndonesiaHukum acara pidana Indonesia adalah hukum yang mengatur tentang tata caraberacara (berperkara di badan
peradilan) dalam lingkup hukum pidana. Hukum acara pidanadi Indonesia diatur dalam UU nomor 8 tahun
1981.Hukum Acara Perdata IndonesiaHukum acara perdata Indonesia adalah hukum yang mengatur tentang tata
caraberacara (berperkara di badan peradilan) dalam lingkup hukum perdata. Dalam hukum acara

10. 10perdata, dapat dilihat dalam berbagai peraturan Belanda dulu (misalnya; Het HerzieneInlandsh
Reglement/HIR, RBG, RB,RO).Hukum antar Tata HukumHukum antar tata hukum adalah hukum yang mengatur
hubungan antara dua golonganatau lebih yang tunduk pada ketentuan hukum yang berbeda.Hukum Adat di
IndonesiaHukum adat adalah seperangkat norma dan aturan adat yang berlaku di suatu wilayah.Hukum Islam di
IndonesiaHukum Islam di Indonesia belum bisa ditegakkan secara menyeluruh, karena belumadanya dukungan yang
penuh dari segenap lapisan masyarakat secara demokratis baik melaluipemilu atau referendum maupun amandemen
terhadap UUD 1945 secara tegas dan konsisten.Aceh merupakan satu-satunya provinsi yang banyak menerapkan
hukum Islam melaluiPengadilan Agama, sesuai pasal 15 ayat 2 Undang-Undang RI No. 4 Tahun 2004
TentangKekuasaan Kehakiman yaitu : Peradilan Syariah Islam di Provinsi Nanggroe AcehDarrussalam merupakan
pengadilan khusus dalam lingkungan peradilan agama sepanjangkewenangannya menyangkut kewenangan peradilan
agama, dan merupakan pengadilankhusus dalam lingkungan peradilan umum sepanjang kewenangannya
menyangkutkewenangan peradilan umum.B. SISTEM PENEGAKAN HUKUM DI INDONESIAa. SistemKata
sistem dalam Kamus Umum Bahasa Indonesia mengandung arti susunankesatuan-kesatuan yang masing-masing
tidak berdiri sendiri, tetapi berfungsi membentukkesatuan secara keseluruhan. Sistem adalah kesatuan yang utuh dari
suatu rangkaian, yangkait-mengait satu sama lain.Menurut Prof. Sumantri, sistem adalah sekelompok bagian yang
bekerja bersama-sama untuk melakukan sesuatu maksud. Apabila salah satubagian rusak atau tidak dapatmenjalankan
tugasnya, maka maksud yang hendak dicapai tidak akan terpenuhi, atau setidak-tidaknya sistem yang telah terwujud
akan mendapat gangguan. Unsur-unsur dalam sistemmencakup antara lain:1. Seperangkat komponen, elemen, dan
bagian2. Saling berkaitan dan bergantung
11. 113. Kesatuan yang terintegrasi4. Memiliki peranan dan tujuan tertentu5. Interaksi antarsistem membentuk
sistem lain yang lebih besar.Sistem hukum adalah satu kesatuan hukum yang berlaku pada suatu Negara tertentuyang
dipatuhi dan ditaati oleh setiap warganya.b. Penegakan Hukum di IndonesiaOperasionalisasi dari konsep Negara
hukum Indonesia dituangkan dalam konstitutsiNegara, yaitu UUD 1945. UUD 1945 merupakan hukum dasar Negara
yang menempati posisisebagai hukum Negara tertinggi dalam tertib hukum (legal order) Indonesia. Di bawah
UUD1945 terdapat berbagai aturan hukum/perundang-undangan yang bersumber berdasarkan padaUUD 1945.Legal
order merupakan satu kesatuan sistem hukum yan tersusun secara tertib diIndonesia dituangkan dalam ketetapan MPR
No. III/MPR/2000 tentang Sumber Hukum danTata Urutan Peraturan Perundang-Undangan.Dalam ketetapan tersebut
dinyatakan bahwa yang dimaksud sumber hukum adalahsumber yang dijadikan bahan untuk penyusunan perundangundangan. Sumber hukum terdiriatas sumber hukum tertulis dan tidak tertulis. Sumber hukum dasar nasional adalah
Pancasilasebagaimana yang tertulis dalam Pembukaan Undang-Undang Dasar 1945, yaitu KetuhananYang Maha Esa,
Kemanusiaan yang adil dan beradil dan beradab, Persatuan Indonesia, danKerakyatan yang dipimpin oleh hikmat
kebijaksanaan dalam permusyawaratan/perwakilan,serta dengan mewujudkan suatu Keadilan sosial bagi seluruh
rakyat Indonesia, dan batangtubuh Undang-Undang Dasar 1945.Adapun tata urutan perundangan adalah sebagai
berikut.1. Undang-Undang Dasar 19452. Ketetapan Majelis Permusyawaratan Rakyat Republik Indonesia3. UndangUndang4. Peraturan Pemerintah Pengganti Undang-Undang5. Peraturan Pemerintah;1. Keputusan Presiden2.
Peraturan Daerah.Saat ini tidak mudah untuk memaparkan kondisi hukum di Indonesia tanpa adanyakeprihatinan yang
mendalam mendengar ratapan masyarakat yang terluka oleh hukum, dankemarahan masyarakat pada mereka yang
memanfaatkan hukum untuk mencapai tujuan
12. 12mereka tanpa menggunakan hati nurani. Dunia hukum di Indonesia tengah mendapat sorotanyang amat
tajam dari seluruh lapisan masyarakat, baik dari dalam negri maupun luar negri.Dari sekian banyak bidang hukum,
dapat dikatakan bahwa hukum pidana menempatiperingkat pertama yang bukan saja mendapat sorotan tetapi juga
celaan yang luar biasadibandingkan dengan bidang hukum lainnya. Bidang hukum pidana merupakan bidanghukum
yang paling mudah untuk dijadikan indikator apakah reformasi hukum yangdijalankan di Indonesia sudah berjalan
65

dengan baik atau belum. Hukum pidana bukan hanyaberbicara tentang putusan pengadilan atas penanganan perkara
pidana, tetapi juga meliputisemua proses dan sistem peradilan pidana. Proses peradilan berawal dari penyelidikan
yangdilakukan pihak kepolisian dan berpuncak pada penjatuhan pidana dan selanjutnya diakhiridengan pelaksanaan
hukuman itu sendiri oleh lembaga pemasyarakatan. Semua proses pidanaitulah yang saat ini banyak mendapat sorotan
dari masyarakat karena kinerjanya, atau perilakuaparatnya yang jauh dari kebaikan.Corak hukum yang sebagian besar
telah bobrok oleh pelaku yang hanyamementingkan pribadi atau kelompok. Walaupun ada kebaikan-kebaikan serta
berjalannyahukum sesuai alur, namun itu hanya sebagian kecil dari kerusakan sistem yang berlakusekarang.Hukum di
Negara kita ini dapat diselewengkan atau disuap dengan mudahnya, denganinkonsistensi hukum di Indonesia, seperti
pemberian hukuman kepada para pejabat Negarayang menyalahi aturan hukum, misalnya saat terkena tilang polisi lalu
lintas, ada beberapaoknum polisi yang mau bahkan terkadang minta disuap agar kasus ini tidak diperpanjang,polisinya
pun mendapatkan keuntungan materi dengan cepat namun salah tempat. Inimerupakan contoh-contoh dalam
lingkungan terdekat kita. Masih banyak kasus-kasus yangdapat dijadikan contoh dari penyelewengan hukum di
Indonesia.Kita dapat mengambil beberapa contoh tentang salahnya penegakan hukum diIndonesia Saat seseorang
mencuri sandal misalnya, seperti yang pernah diberitakan belumlama ini, ia disidang dan didenda hanya karena
mencuri sandal seorang briptu yang harganya
13. 13bisa dibilang murah, sedangkan para koruptor di Indonesia bisa dengan leluasa merajalela,menikmati tanpa
dosa, karena mereka memandang rendah hukum yang ada di Indonesia.Karena kenyataannya memang lebih banyak
benarnya, kita ambil contoh Arthalyta Suryani,dia menempati rutan dengan sarana eksklusif, bisa dikatakan eksklusif,
sampai-sampai adaruang untuk berkaraoke, ini juga bisa dijadikan sebagai pembelian hukum di Indonesia.Kasus
korupsi dinilai sebagai penyakit yang sangat kronis, meski Pemerintah SusiloBambang Yodhoyono-Budiono berjanji
tidak pandang bulu dalam penegakan supremasihukum di Indonesia. Pada kenyataan tidak sejalan dengan harapan kita
semua, banyak kasuskorupsi yang dalam pengusutannya tidak mampu menguak fakta apalagi menangkap
dalangintelektualnya. Banyak oknum penegak hukum yang ikut terlibat dalam pusaran kasuskorupsi, sehingga tidak
dapat ditangkap dan diadili sesuai hukum.Kejadian diatas merupakan segelintir masalah penegakan hukum yang
bersarang diIndonesia dan merupakan salah satu contoh dari sekian banyak kasus-kasus penegakan hukumyang
semakin semrawut. Walaupun tak semua penegakan hukum di Indonesia ini semuanyaberbau negatif, namun sebagian
besar semuanya mengarah kea rah sana. Tidak jujur jikasemua penegakan hukum di Indonesia baik dan tidak jujur
pula bila semua penegakan hukumdi Indonesia buruk. Pernyataan dari Presiden Susilo Bambang Yodhoyono.C.
DAMPAK DALAM PENEGAKAN HUKUM DI INDONESIAPenyelewengan atau inkonsistensi di Indonesia
berlangsung lama bertahun-tahunhingga sekarang, sehingga bagi masyarakat Indonesia ini merupakan rahasia umum,
hukumyang dibuat berbeda dengan hukum yang dijalankan, contoh paling dekat dengan lingkunganadalah, penilangan
penegemudi kendaraan yang melanggar tata tertib lalu lintas. Mereka yangmelanggar tata tertib lalu lintas tidak
jarangingin berdamai di tempat atau menyelewengkanhukum, kemudian seharusnya aparat yangmenegakkan hukum
tersebut dapat menangisecara hukum yang berlaku di Indonesia, namuntidak jarang penegak hukum tersebut
justrumengambil kesempatan yang tidak terpuji ituuntuk menambah pundi-pundi uangnya.Oleh karena itu, akibatakibat yang ditimbulkan dari masalah penyelewengan hukumtersebut diantaranya, yaitu:
14. 141. Ketidakpercayaan masyarakat pada hukumMasyarakat berependapat hukum banyak merugikan mereka,
terlebih lagisoal materi sehingga mereka berusaha untuk menghindarinya. Karena merekapercaya bahwa uanglah yang
berbicara, dan dapat meringankan hukuman mereka,fakta-fakta yang ada diputar balikan dengan materi yang siap
diberikan untukpenegak hukum. Kasus-kasus korupsi di Indonesia tidak terselesaikan secaratuntas karena para
petinggi Negara yang terlibat di dalamnya mempermainkanhukum dengan menyuap sana sini agar kasus ini tidak
terungkap, akibatnyakepercayaan masayarakatpun pudar.2. Penyelesaian konflik dengan kekerasanPenyelesaian
konflik dengan kekerasan contohnya ialah pencuri ayamyang dipukuli warga, pencuri sandal yang dihakimi warga.
Konflik yang terjadi disekelompok masyarakat di Indonesia banyak yang diselesaikan dengan kekerasan,seperti kasus
tawuran antar pelajar, tawuran antar suku yang memperebutkanwilayah, atau ada salah satu suku yang tersakiti
sehingga dibalas degan kekerasan.Mereka tidak mengindahkan peraturan-peraturan kepemerintahan, denganmasalah
secara geografis, mereka. Ini membuktikan masayarakat Indonesia yangtidak tertib hukum, seharusnya masalah
seperti maling sandal atau ayam dapatditangani oleh pihak yang yang berwajib, bukan dihakimi secara
seenakanya,bahkan dapat menghilangkan nyawa seseorang.3. Pemanfaatan Inkonsistensi Penegakan Hukum untuk
Kepentingan PribadiDari beberapa kasus di Indonesia, banyak warga Negara Indonesia yangmemanfaatkan
inkonsistensi penegakan hukum untuk kepentingan pribadi.Contohnya ialah pengacara yang menyuap polisi ataupun
hakim untukmeringankan terdakwa, sedangkan polisi dan hakim yang seharusnya bisa menjadipenengah bagi kedua
belah pihak yang sedang terlibat kasus hukum bisa jadi lebihcondong pada banayknya materi yang diberikan oleh
salah satu pihak yang sedangterlibat dalam kasus hukum tersebut.4. Penggunaan Tekanan Asing dalam Proses
PeradilanDalam hal ini kita dapat mengambil contoh pengrusakan lingkungan yangdiakibatkan oleh suatu perusahaan
asing yang membuka usahanya di Indonesia,mereka akan minta bantuan dari negaranya untuk melakukan upaya
pendekatankepada Indonesia, agar mereka tidak mendapatkan hukuman yang berat, ataudicabut izin memproduksinya
di Indonesia.
66


15.
15D.
KETIDAKPUASAN
MASYARAKAT
TERHADAP
PENEGAKAN
HUKUM
DIINDONESIAKetidakpuasan masyarakat terhadap penegakan hukum di Indonesia ini merupakanfakta dan data yang
ditunjukkan dari hasil survei terhadap masyarakat oleh Lembaga SurveiIndonesia (LSI) yang menyebutkan bahwa
56,0 persen publik menyatakan tidak puas denganpenegakan hukum di Indonesia, hanya 29,8 persen menyatakan
puas, sedangkan sisanya 14,2persen tidak menjawab. Mereka yang tak puas terhadap penegakan hukum di
Indonesiamerata di semua segmen. Mereka yang tinggal di kota maupun desa, berpendidikan tinggimaupun rendah,
mereka yang berasal dari ekonomi atas maupun ekonomi bawah.Namun demikian, mereka yang tinggal di desa,
berasal dari ekonomi bawah, danberpendidikan rendah lebih tak puas jika dibandingkan dengan mereka yang berada
di kotadan berpendidikan tinggi. Hal ini disebabkan karena mereka yang berada di desa dankelompok ekonomi bawah
lebih sering menghadapi kenyataan merasa diperlakukan tidak adiljika berhadapan dengan aparat hukum.
Ketidakpuasaan responden terhadap penegakan hukumdi Indonesia cenderung meningkat dari tahun ke tahun yaitu
37,4 persen (Survei LSI Januari2010), sebesar 41,2 persen (Oktober 2010), sebesar 50,3 persen (September 2011),
sebesar50,3 persen (Oktober 2012), dan terakhir 56,6 persen (April 2013).Uraian di atas menunjukkan betapa
rusaknya hukum di Indonesia. Mungkin yang tidakmendapat sorotan adalah lembaga pemasyarakatan karena tidak
banyak orang yangmengamatinya. Tetapi lembaga ini sebenarnya juga tidak dapat dikatakan sempurna. Lembagayang
seharusnya berperan dalam memulihkan sifat para warga binaan (terpidana) ternyatatidak dapat menjalankan tugasnya
dengan baik. Jumlah narapidana yang melebihi dua kalilipat dari kapasitasnya menjadikan nasib narapidana juga
semakin buruk. Mereka tidaktambah sadar, tetapi justru belajar melakukan tindak pidana baru setelah berkenalan
dengannarapidana lainnya. Tentunya ini jauh dari konsep pemidanaan yang sesungguhnya bertujuanuntuk
merehabilitasi terpidana. Bahkan fakta yang ada hari ini, beberapa narapidana denganleluasanya membuat aturan
sendiri dengan merubah hotel prodeo tersebut menjadi hotel bakbintang lima.E. MENGATASI PERMASALAHAN
PENEGAKAN HUKUM DI INDONESIAKeprihatinan yang mendalam tentunya melihat reformasi hukum yang
masih berjalanlambat dan belum memberikan rasa keadilan bagi masyarakat. Tidaklah berlebihan jikadikatakan bahwa
pada dasarnya apa yang terjadi akhir-akhir ini merupakan ketiadaan keadilanyang dipersepsi masyarakat (the absence
of justice). Ketiadaan keadilan ini merupakan akibatdari pengabaian hukum (diregardling the law), ketidakhormatan
pada hukum (disrespecting
16. 16the law), ketidakpercayaan pada hukum (distrusting the law) serta adanya penyalahgunaanhukum (misuse of
the law). Sejumlah masalah yang layak dicatat berkenaan dengan bidanghukum antara lain:1. Sistem peradilan yang
dipandang kurang independen dan imparsial2. Belum memadainya perangkat hukum yang mencerminkan keadilan
sosial3. Inkonsistensi dalam penegakan hukum4. Masih adanya intervensi terhadap hukum5. Lemahnya perlindungan
hukum terhadap masyarakat6. Rendahnya kontrol secara komprehensif terhadap penegakan hukum7. Belum
meratanya tingkat keprofesionalan para penegak hukum8. Proses pembentukan hukum yang lebih merupakan power
game yang mengacupada kepentingan the powerfull daripada the needy.Konsep Reformasi Hukum Setelah melihat
kondisi hukum yang terpuruk tersebutmaka tidak ada kata lain selain terus mengedepankan reformasi hukum yang
telah digagasoleh bangsa ini. Kegiatan reformasi Hukum perlu dilakukan dalam rangka mencapaisupremasi hukum
yang berkeadilan. Beberapa konsep yang perlu diwujudkan antara lain:Penggunaan hukum yang berkeadilan sebagai
landasan pengambilan keputusan olehaparatur negara.1. Adanya lembaga pengadilan yang independen, bebas dan
tidak memihak.2. Aparatur penegak hukum yang professional3. Penegakan hukum yang berdasarkan prinsip
keadilan4. Pemajuan dan perlindungan HAM5. Partisipasi publik6. Mekanisme control yang efektif.Pada dasarnya
reformasi hukum harus menyentuh tiga komponen hukum yangdisampaikan oleh Lawrence Friedman yang meliputi:
17. 171. Struktur Hukum, dalam pengertian bahwa strukstur hukum merupakan pranatahukum yang menopang
sistem hukum itu sendiri, yang terdiri atas bentuk hukum,lembaga-lembaga hukum, perangkat hukum, dan proses serta
kinerja mereka.2. Substansi Hukum, dimana merupakan isi dari hukum itu sendiri, artinya isi hukumtersebut harus
merupakan sesuatu yang bertujuan untukmenciptakan keadilan dandapat diterapkan dalam masyarakat.3. Budaya
Hukum, hal ini terkait dengan profesionalisme para penegak hukum dalammenjalankan tugasnya, dan tentunya
kesadaran masyarakat dalam menaati hukumitu sendiri.Kiranya dalam rangka melakukan reformasi hukum tersebut
ada beberapa hal yangharus dilakukan antara lain:1. Penataan kembali struktur dan lembaga-lembaga hukum yang ada
termasuksumber daya manusianya yang berkualitas2. Perumusan kembali hukum yang berkeadilan3. Peningkatan
penegakkan hukum dengan menyelesaikan kasus-kasus pelanggaranhukum4. Pengikutsertaan rakyat dalam
penegakkan hukum5. Pendidikan publik untuk meningkatkan pemahaman masyarakat terhadap hukum,dan6.
Penerapan konsep Good Governance (Pemerintahan yang baik).Ada berbagai macam cara untuk mengatasi masalah
penegakan hukum di Indonesia,yaitu :1. Didalam rangka penyusunan dan penyempurnaan peraturan perundangundanganagar lebih memperhatikan rasa keadilan pada masyarakat dan kepentingan nasionalsehingga mendorong
adanya kesadaran hukum masyarakat untuk mematuhinya.2. Penegak hukum seharusnya berjalan tidak semata melihat
fakta, tapi menimbangserta melihat latar belakang peristiwa, alasan terjadinya kejadian, unsurkemanusiaan dan juga
menimbang rasa keadilan dalam memberikan keputusan.Hakim diwajibkan mencari dan menemukan kebenaran
materil yang menyangkutnilai-nilai keadilan yang harus diwujudkan dalam peradilan pidana. Namundemikian, hakikat
tugas hakim itu sendiri memang seharusnya mencari danmenemukan kebenaran materil untuk mewujudkan keadilan
67

materiil. Dengan inidiharapkan tidak ada keputusan yang kontroversial dan memberikan keputusanyang seadil-adilnya
sehigga yang terjadi pada nenek minah tidak terjadi lagi.
18. 183. Hukum seharusnya tidak ditegakkan dalam bentuknya yang paling kaku, arogan,hitam putih. Tapi harus
berdasarkan rasa keadilan yang tinggi, tidak hanyamengikuti hukum dalam konteks perundang-undangan hitam putih
semata. Karenahukum yang ditegakkan yang hanya berdasarkan konteks hitam putih belaka hanyaakan menghasilkan
putusan-putusan yang kontoversial dan tidak memenuhi rasakeadilan yang sebenarnya.4. Hakim sebagai pemberi
putusan seharusnya tidak menjadi corong undang-undangyang hanya mengikuti peraturan perundang-undangan
semata tanpamemperdulikan rasa keadilan. Tapi hakim seharusnya mengikuti perundang-undangan dengan
mementingkan rasa keadilan yang seadil-adilnya. Sehinggakeputusannya dapat memenuhi rasa keadilan yang
sebenarnya.5. Komisi Yudisial sebagai komisi yang dibentuk untuk mengawasi perilaku hakikiseharusnya memberi
peringatan dan sanksi yang tegas kepada hakim yangmemberikan putusan yang kontroversial dan tidak memenuhi rasa
keadilan, jugayang melanggar kode etik.6. Meningkatkan pembinaan integritas, kemampuan atau ketrampilan dan
ketertibanserta kesadaran hukum dari pelaksana penegak hukum tentang tugas dantanggungjawabnya. Dalam
melaksanakan tugasnya penegak hukum benar-benarmelaksanakan asas persamaan hak di dalam hukum bagi setiap
anggotamasyarakat.7. Mencukupi kebutuhan personal, sarana dan prasarana untuk pelaksanaanpenegakan hukum.
Meningkatkan kesejahteraan penegak hukum. Sehingga tidakada hakim yang terlibat kasus korupsi.8. Memberikan
pendidikan dan penyuluhan hukum baik formal maupun informalsecara berkesinambungan kepada masyarakat tentang
pentingnya penegakanhukum diIndonesiasehingga masyarakat sadar hukum dan menaati peraturan yangberlaku.9.
Menyediakan bantuan hukum bagi si miskin dan buta hukum.Melaksanakan asas proses yang tepat, cepat dan biaya
ringan di semua tingkatperadilan.10. Pemberian sanksi yang tegas kepada aparat penegak hukum yang
tidakmenjalankan tugas dengan semestinya.11. Harus ada reformasi institusional didalam tubuh lembaga penegak
hukum. Bukanhanya reformasi didalam tubuh Polri dan KejaksaanRItapi juga pada lembagapenegak hukum lain
Komisi Pemberantasan Korupsi ( KPK ) dan Lembaga
19. 19Perlindungan Saksi dan korban ( LPSK ). Hal ini dikarenakan carut-marutnyahukum yang ada di
Indonesiajuga disebabkan karena adanya oknum-oknum yangtidak bertanggungjawab didalam tubuh lembaga penegak
hukum. Kejaksaan sudahmencanangkan adanya pembaruan didalam tubuh Kejaksaan yakni terkait tentangperekrutan
jaksa, kode perilaku, standar minimum profesi, dan pengawasan sanksidisiplin. Selain itu saat Kejaksaan juga
merencanakan pemangkasan tiga ribujabatan jaksa, pengektifan peran pengawasan dan pembinaan, bidang
intelejenditugasi mencegah perbuatan tercela jaksa, pemberian reward and punishment.Kepolisian juga telah
merencakan meminta setiap jajaran merancang target dalamwaktu tertentu, mengadakan kontrak kerja dan pakta
integritas, mengevaluasisecara rutin kinerja jajaran, transparansi sistem rekrutmen anggota polisi danproses pelayanan
administarasi.12. Adanya penghargaan bagi jaksa dan hakim berprestasi yang memberikanterobosan-terobosan dalam
penegakan hukum diIndonesia. Dengan adanyapenghargaan ini diharapkan setiap jaksa maupun hakim berlomba
untukmemberikan terobosan yang bermanfaat bagi penegakan hukum diIndonesia.13. Perlunya Kapolri dan Jaksa
Agung yang berwibawa, yang mempunyai kredibilitastinggi.Selain pencegahan, pengejaran (dalam contoh kasus) dan
pengusutan kasus-kasuskorupsi, pemerintah harus terus berusaha mengejar aset dan memulihkan kerugian
negara.Disamping itu, pemerintah juga harus tetap melanjutkan upaya serupa untuk mengatasi aksiterorisme dan
bahaya lainnya yang dapat memecahbelah keutuhan NKRI serta mencegahberkembangnya radikalisme dan juga
meningkatkan pemberantasan segala kegiatan ilegal,mulai dari penebangan liar (illegal Logging), penangkapan ikan
liar (illegal fishing) hinggapenambangan liar (illegal mining), baik yang lokal maupun yang transnasional. Dari
semuaitu kiranya korupsi yang akan menjadi sebuah bahaya laten harus menjadi prioritas utamauntuk diberantas.
Melihat kenyataan, bahwa penegakan hukum di Indonesia tidak akanmengalami kemajuan yang begitu pesat, tetapi
kemajuan itu akan tetap ada. Hal ini terlihatdari komitmen pemerintah untuk mewujudkan penegakkan hukum dengan
didukung olehaparat penegak hukum lainnya. Kasus mafia peradilan yang akhir-akhir ini banyak disorotmasyarakat
akan menjadikan penegak hukum lebih berhati-hati dalam menjalankan tugasnya.Meskipun saat ini kepercayaan
masyarakat terhadap aparat penegak hukum masihsangat rendah. Keberanian lembaga-lembaga hukum bangsa ini
akan menjadi titik cerah bagipenegakan hukum. Namun selain itu kesadaran masyarakat dalam menaati hukum akan
20. 20menjadi hal yang mempengaruhi penegakkan hukum di Indonesia. Karena lemahnyapenegakan hukum
selama ini juga akibat masyarakat yang kurang menaati hukum.
21. 21BAB IIIPENUTUPANA. KESIMPULANMasalah penegakan hukum di Indonesia merupakan masalah yang
sangat serius danakan terus berkembang jika unsur di dalam sistem itu sendiri tidak ada perubahan, tidak adareformasi
di bidang itu sendiri. Karakter bangsa Indonesia yang kurang baik merupakan aktorutama dari segala ketidaksesuaian
pelaksanaan hukum di negari ini. Perlu ditekankan sekalilagi, walaupun tidak semua penegakan hukum di Indonesia
tidak semuanya buruk, namunkeburukan penegakan ini seakan menutupi segala keselaran hukum yang berjalan di
matamasyarakat. Begitu banyak kasus-kasus hukum yang silih berganti dalam kurun waktu relatifsingkat, bahkan
bersamaan kejadiaannya. Perlu ada reformasi yang sebenarnya, karenapermasalahan hukum ini merupakan
permasalahan dasar suatu Negara, bagaimana masyarakatbisa terjamin keamanannya atau bagaimana masyarakat bisa
merasakan keadilan yangsebenarnya, hukum lah yang mengatur semua itu, dan perlu digaris-bawahi bahwa
68

hukumsebanarnya telah sesuai dengan kehidupan masyarakat, tetapi pihak-pihak yang inginmengambil keuntungan
baik pribadi maupun kelompok merupakan penggagas segalakebobrokan hukum di negeri ini.Perlu banyak evaluasievaluasi yang harus dilakukan, harus ada penindaklanjutanyang jelas mengenai penyelewengan hukum yang kian hari
kian menjadi. Perlu ada ketegasantersendiri dan kesadaran yang hierarki dari individu atau kelompok yang terlibat di
dalamnya.Perlu ditanamkan mental yang kuat, sikap malu dan pendirian iman dan takwa yang sejakkecil harus
diberikan kepada kader-kader pemimpin dan pelaksana aparatur Negara ataupihak-pihak berkepentingan lainnya.
Karena baik untuk hukum Indonesia, baik pula untukbangsanya dan buruk untuk hukum di negeri ini, buruk pula
konsekuensi yang akan diterimaoleh masayarakat dan Negara.Jadi, penerapan dalam pasal 1 ayat (3) UUD 1945
perubahan ketiga yang berbunyiNegara Indonesia adalah Negara hukum, harus dilaksanakan, karena sudah
demikianketetapan itu berlaku. Merupakan karekteristik yang harus tertanam dalam diri pribadiataupun kelompok
kepentingan. Kita harus malu dengan Undang-Undang tersebut, harusmalu dengan pendiri bangsa yang rela
menumpahkan darah demi memperjuangkankemerdekaan Indonesia, kita harus menghargai semua perjuangan itu
dengan hal yang tidakdapat membuat negeri ini malu di mata masyarakat ini sendiri bahkan dunia luar. Bangsa
yangbesar tidak hanya berdasarkan luasan wilayahnya ataupun betapa banyaknya jumlahpenduduk, tetapi dengan
menghargai perjuangan para pahlawan terdahulu dengan
22. 22menjalankan ketentuan hukum yang berlaku demi terciptanya keamanan, ketentraman dankesejahteraan
masyarakat.B. KRITIK DAN SARANKritik dan saran sangat kami harapkan dalam makalah ini, segala kekurangan
yang adadalam makalah ini mungkin karena kelalaian atau ketidaktahuan kami dalam penyusunannya.Segala hal yang
tidak relevan, kekurangan dalam pengetikan atau bahkan ketidakjelasandalam makalah ini merupakan proses kami
dalam memperlajari bidang studi ini dandiharapkan kami yang menulis ataupun bagi pembaca dapat mengambil
manfaat dari makalahini.
Sistem Hukum di Indonesia
Sistem hukum Indonesia merupakan perpaduan beberapa sistem hukum. Sistem hukum
Indonesia merupakan perpaduan dari hukum agama, hukum adat, dan hukum negara eropa
terutama Belanda sebagai Bangsa yang pernah menjajah Indonesia. Belanda berada di
Indonesia sekitar 3,5 abad lamanya. Maka tidak heran apabila banyak peradaban mereka
yang diwariskan termasuk sistem hukum. Bangsa Indonesia sebelumnya juga merupakan
bangsa yang telah memiliki budaya atau adat yang sangat kaya. Bukti peninggalan atau fakta
sejarah mengatakan bahwa di Indonesia dahulu banyak berdiri kerajaan-kerajaan hindu-budha
seperti Sriwijaya, Kutai, Majapahit, dan lain-lain. Zaman kerajaan meninggalkan warisanwarisan budaya yang hingga saat ini masih terasa. Salah satunya adalah peraturan-peraturan
adat yang hidup dan bertahan hingga kini. Nilai-nilai hukum adat merupakan salah satu
sumber hukum di Indonesia. Indonesia merupakan negara dengan penduduk muslim terbesar
maka tidak heran apabila bangsa Indonesia juga menggunakan hukum agama terutama Islam
sebagai pedoman dalam kehidupan dan juga menjadi sumber hukum Indonesia.
Sejarah Hukum di Indonesia

Periode Kolonialisme

Periode kolonialisme dibedakan menjadi tiga era, yaitu: Era VOC, Liberal Belanda dan Politik
etis hingga pendudukan Jepang.
a. Era VOC
Pada era penjajahan VOC, sistem hukum yang digunakan bertujuan untuk:
1. Keperluan ekspolitasi ekonomi untuk membantu krisis ekonomi di negera Belanda;
2. Pendisiplinan rakyat asli Indonesia dengan sistem yang otoriter
3. Perlindungan untuk orang-orang VOC, serta keluarga, dan para imigran Eropa.

Hukum Belanda diterapkan terhadap bangsa Belanda atau Eropa. Sedangkan untuk rakyat
pribumi, yang berlaku ialah hukum-hukum yang dibuat oleh tiap-tiap komunitas secara
mandiri. Tata politik & pemerintahan pada zaman itu telah mengesampingkan hak-hak dasar
69

rakyat di nusantara & menjadikan penderitaan yang pedih terhadap bangsa pribumi di masa
itu.

b. Era Liberal Belanda


Tahun 1854 di Hindia-Belanda dikeluarkan Regeringsreglement (kemudian dinamakan RR
1854) atau Peraturan mengenai Tata Pemerintahan (di Hindia-Belanda) yang tujuannya adalah
melindungi kepentingan usaha-usaha swasta di tanah jajahan & untuk yang pertama kalinya
mencantumkan perlindungan hukum untuk rakyat pribumi dari pemerintahan jajahan yang
sewenang-wenang. Hal ini bisa dilihat dalam (Regeringsreglement) RR 1854 yang mengatur
soal pembatasan terhadap eksekutif (paling utama Residen) & kepolisian, dan juga jaminan
soal proses peradilan yg bebas.
Otokratisme administrasi kolonial masih tetap terjadi pada era ini, meskipun tidak lagi
sekejam dahulu. Pembaharuan hukum yang didasari oleh politik liberalisasi ekonomi ini
ternyata tidak dapat meningkatkan kesejahteraan rakyat pribumi, sebab eksploitasi masih
terus terjadi.

c. Era Politik Etis Sampai Kolonialisme Jepang


Politik Etis diterapkan di awal abad ke-20. Kebijakan-kebijakan awal politik etis yang berkaitan
langsung dengan pembaharuan hukum antara lain:
1. Pendidikan bagi rakyat pribumi, termasuk juga pendidikan lanjutan hukum;
2. Pendirian Volksraad, yaitu lembaga perwakilan untuk kaum pribumi;
3. Manajemen organisasi pemerintahan, yang utama dari sisi efisiensi;
4. Manajemen lembaga peradilan, yang utama dalam hal profesionalitas;
5. Pembentukan peraturan perundang-undangan yg berorientasi pada kepastian hukum.
Sampai saat hancurnya kolonialisme Belanda, pembaruan hukum di Hindia Belanda
meninggalkan warisan: i) Pluralisme/dualisme hukum privat dan pluralisme/dualisme
lembaga-lembaga peradilan; ii) Pengelompokan rakyat ke menjadi tiga golongan; Eropa dan
yang disamakan, Timur Asing, Tionghoa & Non-Tionghoa, & Pribumi.

Masa penjajahan Jepang tidak banyak terjadi pembaruan hukum di semua peraturan
perundang-undangan yang tidak berlawanan dengan peraturan militer Jepang, tetap berlaku
sambil menghapus hak-hak istimewa orang-orang Belanda & Eropa lainnya. Sedikit
perubahan perundang-undangan yang dilakukan: i) Kitab Undang-undang Hukum Perdata,
yang awalnya hanya berlaku untuk golongan Eropa & yang setara, diberlakukan juga untuk
kaum Cina; ii) Beberapa peraturan militer diselipkan dalam peraturan perundang-undangan
pidana yang berlaku. Di bidang peradilan, pembaharuan yang terjadi adalah: i) Penghapusan
pluralisme/dualisme tata peradilan; ii) Unifikasi kejaksaan; iii) Penghapusan pembedaan polisi
kota & lapangan/pedesaan; iv) Pembentukan lembaga pendidikan hukum; v) Pengisian secara
besar-besaran jabatan-jabatan administrasi pemerintahan & hukum dengan rakyat pribumi.

Era Revolusi Fisik Sampai Demokrasi Liberal

a. Era Revolusi Fisik


i) Melanjutkan unfikasi badan-badan peradilan dengan melaksanakan penyederhanaan;
70

ii) Mengurangi serta membatasi peranan badan-badan pengadilan adat & swapraja, terkecuali
badan-badan pengadilan agama yg bahkan diperkuat dengan pembentukan Mahkamah Islam
Tinggi.

b. Era Demokrasi Liberal


Undang-undang Dasar Sementara 1950 yang sudah mengakui HAM. Namun pada era ini
pembaharuan hukum & tata peradilan tidak banyak terjadi, yang terjadi adalah dilema untuk
mempertahankan hukum & peradilan adat atau mengkodifikasi dan mengunifikasinya menjadi
hukum nasional yang peka terhadap perkembangan ekonomi dan tata hubungan
internasional. Selajutnya yang terjadi hanyalah unifikasi peradilan dengan menghapuskan
seluruh badan-badan & mekanisme pengadilan atau penyelesaian sengketa di luar pengadilan
negara, yang ditetapkan melalui UU No. 9/1950 tentang Mahkamah Agung dan UU Darurat
No. 1/1951 tentang Susunan & Kekuasaan Pengadilan.

Era Demokrasi Terpimpin Sampai Orde Baru

a. Era Demokrasi Terpimpin


Perkembangan dan dinamika hukum di era ini
i) Menghapuskan doktrin pemisahan kekuasaan & mendudukan MA & badan-badan
pengadilan di bawah lembaga eksekutif;
ii) Mengubah lambang hukum "dewi keadilan" menjadi "pohon beringin" yang berarti
pengayoman;
iii) Memberikan kesempatan kepada eksekutif untuk ikut campur tangan secara langsung atas
proses peradilan sesuai UU No.19/1964 & UU No.13/1965;
iv) Menyatakan bahwa peraturan hukum perdata pada masa pendudukan tidak berlaku
kecuali hanya sebagai rujukan, maka dari itu hakim harus mengembangkan putusan-putusan
yang lebih situasional & kontekstual.

b. Era Orde Baru


Pembaruan hukum pada masa Orde Baru dimulai dari penyingkiran hukum dalam proses
pemerintahan dan politik, pembekuan UU Pokok Agraria, membentuk UU yang mempermudah
modal dari luar masuk dengan UU Penanaman modal Asing, UU Pertambangan, dan UU
Kehutanan. Selain itu, orde baru juga melancarkan: i) Pelemahan lembaga hukum di bawah
kekuasaan eksekutif; ii) Pengendalian sistem pendidikan & pembatasan pemikiran kritis,
termasuk dalam pemikiran hukum; Kesimpulannya, pada era orba tidak terjadi perkembangan
positif hukum Nasional.

Periode Pasca Orde Baru (1998 Sekarang)

Semenjak kekuasaan eksekutif beralih ke Presiden Habibie sampai dengan sekarang, sudah
dilakukan 4 kali amandemen UUD RI 1945. Beberapa pembaruan formal yang terjadi antara
lain: 1) Pembaruan sistem politik & ketetanegaraan; 2) Pembaruan sistem hukum & HAM; dan
3) Pembaruan sistem ekonomi.

Ciri-ciri Sistem Hukum


71

terdapat perintah dan larangan

terdapat sanksi tegas bagi yang melanggar

perintah dan larangan harus ditaati untuk seluruh masyarakat

Tiap-tiap orang harus bertindak demikian untuk menjaga ketertiban dalam bermasyarakat.
Oleh karena itu, hukum meliputi berbagai peraturan yang menentukan dan mengatur
hubungan antara orang yang satu dengan orang yang lain yang dapat disebut juga kaedah
hukum yakni peraturan-peraturan kemasyarakatan.
Kaedah
Hukum
Sumber-sumber yang menjadi kaedah hukum atau peraturan kemasyarakatan:
1. Norma Agama merupakan peraturan hidup yang berisi perintah dan larangan yang
bersumber dari Yang Maha Kuasa. Contoh: jangan membunuh, hormati orang tua, berdoa, dll
2. Norma Kesusilaan merupakan peraturan yang bersumber dari hati sanubari. contohnya:
melihat
orang
yang
sedang
kesulitan
maka
hendaknya
kita
tolong.
3. Norma Kesopanan merupakan peraturan yang hidup di masyarakat tertentu. contohnya:
menyapa orang yang lebih tua dengan bahasa yang lebih tinggi atau baik.
4. Norma Hukum merupakan peraturan yang dibuat oleh penguasa yang berisi perintah dan
larangan yang bersifat mengikat: contohnya: ttiap indakan pidana ada hukumannya.
Unsur-unsur Hukum
Di dalam sebuah sistem hukum terdapat unsur-unsur yang membangun sistem tersebut yaitu:
1. Peraturan yang mengatur tingkah laku manusia dalam kehidupan bermasyarakat
2.
Peraturan
yang
ditetapkan
oleh
instansi
resmi
negara
3.
Peraturan
yang
bersifat
memaksa
4.
Peraturan
yang
memiliki
sanksi
tegas.
Sifat
Hukum
Agar peraturan hidup kemasyarakatan agar benar-benar dipatuhi dan di taati sehingga
menjadi kaidah hukum, peraturan hidup kemasyarakata itu harus memiliki sifat mengatur dan
memaksa. Bersifat memaksa agar orang menaati tata tertib dalam masyarakaty serta
memberikan sanksi yang tegas (berupa hukuman) terhadap siapa yang tidak mau patuh
menaatinya.
Tujuan
Hukum
Hukum bertujuan menjamin adanya kepastian hukum dalam masyarakat dan hukum harus
pula bersendikan pada keadilan, yaitu asas-asas keadilan dari masyarakat itu. Sementara itu,
para ahli hukum memberikan tujuan hukum menurut sudut pandangnya masing-masing.
1.
Prof. Subekti, S.H. hukum itu mengabdi pada tujuan Negara yang dalam pokoknya ialah
mendatangkan kemakmuran dan kebahagiaan pada rakyatnya.
2.
Prof. MR. dr. L.J. Van Apeldoorn, tujuan hukum adalah mengatur pergaulan hidup
manusia secara damai.
3.
Geny, hukum bertujuan semata-mata untuk mencapai keadilan, dan sebagai unsur
daripada keadilan disebutkannya kepentingan daya guna dan kemanfaatan.
4.
Jeremy Betham (teori utilitas), hukum bertujuan untuk mewujudkan semata-mata apa
yang berfaedah bagi orang.
5.
Prof. Mr. J. Van Kan, hukum bertujuan menjaga kepentingan tiap-tiap manusia supaya
kepentingan-kepentingan itu tidak dapat diganggu.
72

Berdasarkan pada beberapa tujuan hukum yang dikemukakan para ahli di atas, dapat
disimpulkan bahwa tujuan hukum itu memiliki dua hal, yaitu :
1.

untuk mewujudkan keadilan

2.

semata-mata untuk mencari faedah atau manfaat.

Selain tujuan hukum, ada juga tugas hukum, yaitu :


1.

menjamin adanya kepastian hukum.

2.

Menjamin keadilan, kebenaran, ketentraman dan perdamaian.

3.
Menjaga jangan sampai terjadi perbuatan main hakim sendiri dalam pergaulan
masyarakat.
Sumber Hukum
Sumber hukum ialah segala apa saja yang menimbulkan aturan-aturan yang mempunyai
kekuatan-kekutatan yang bersifat memaksa, yakni aturan-aturan yang jika dilanggar
mengakibatkan sanksi yang tegas dan nyata. Sumber hukum dapat ditinjau dari segi :
1. Sumber hukum material, sumber hukum yang dapat ditinjau dari berbagai sudut pandang,
misalnya ekonomi, sejarah, sosiologi, dan filsafat. Seorang ahli kemasyarakatan (sosiolog)
akan menyatakan bahwa yang menjadi sumber hukum adalah peristiwa-peristiwa yang terjadi
dalam masyarakat. Demikian sudut pandang yang lainnya pun seterusnya akan bergantung
pada pandangannya masing-masing bila kita telusuri lebih jauh.
2. Sumber hukum formal, membagi sumber hukum menjadi :
Undang-undang (statue), yaitu suatu peraturan Negara yang mempunyai kekuatan
hukum yang mengikat diadakan dan dipelihara oleh penguasa Negara.

a) Dalam arti material adalah setiap peraturan yang dikeluarkan oleh pemerintah
yang dilihat dari isinya mengikat secara umum seperti yang diatur dalam TAP MPRS No.
XX/MPRS/1966.
b) Dalam arti formal adalah keputusan yang dikeluarkan oleh pemerintah yang
karena bentuknya dan dilibatkan dalam pembuatannya disebut sebagai undang-undang
Kebiasaan (custom/adat), perbuatan manusia yang tetap dilakukan berulang-ulang
dalam hal yang sama kemudian diterima dan diakui oleh masyarakat. Apabila ada tindakan
atau perbuatan yang berlawanan dengan kebiasaan tersebut, hal ini dirasakan sebagai
pelanggaran.

Keputusan Hakim (Jurisprudensi); adalah keputusan hakim terdahulu yang dijadikan


dasar keputusan oleh hakim-hakim lain dalam memutuskan perkara yang sama.

Traktat (treaty); atau perjanjian yang mengikat warga Negara dari Negara yang
bersangkutan. Traktat juga merupakan perjanjian formal antara dua Negara atau lebih.
Perjanjian ini khusus menyangkut bidang ekonomi dan politik.

Pendapat Sarjana Hukum (doktrin); merupakan pendapat para ilmuwan atau para
sarjana hukum terkemuka yang mempunyai pengaruh atau kekuasaan dalam pengambilan
keputusan.

73

Sistem Hukum di Indonesia


Sistem hukum Indonesia merupakan perpaduan beberapa sistem hukum. Sistem hukum
Indonesia merupakan perpaduan dari hukum agama, hukum adat, dan hukum negara eropa
terutama Belanda sebagai Bangsa yang pernah menjajah Indonesia. Belanda berada di
Indonesia sekitar 3,5 abad lamanya. Maka tidak heran apabila banyak peradaban mereka
yang diwariskan termasuk sistem hukum. Bangsa Indonesia sebelumnya juga merupakan
bangsa yang telah memiliki budaya atau adat yang sangat kaya. Bukti peninggalan atau fakta
sejarah mengatakan bahwa di Indonesia dahulu banyak berdiri kerajaan-kerajaan hindu-budha
seperti Sriwijaya, Kutai, Majapahit, dan lain-lain. Zaman kerajaan meninggalkan warisanwarisan budaya yang hingga saat ini masih terasa. Salah satunya adalah peraturan-peraturan
adat yang hidup dan bertahan hingga kini. Nilai-nilai hukum adat merupakan salah satu
sumber hukum di Indonesia. Indonesia merupakan negara dengan penduduk muslim terbesar
maka tidak heran apabila bangsa Indonesia juga menggunakan hukum agama terutama Islam
sebagai pedoman dalam kehidupan dan juga menjadi sumber hukum Indonesia.
Sejarah Hukum di Indonesia

Periode Kolonialisme

Periode kolonialisme dibedakan menjadi tiga era, yaitu: Era VOC, Liberal Belanda dan Politik
etis hingga pendudukan Jepang.
a. Era VOC
Pada era penjajahan VOC, sistem hukum yang digunakan bertujuan untuk:
1. Keperluan ekspolitasi ekonomi untuk membantu krisis ekonomi di negera Belanda;
2. Pendisiplinan rakyat asli Indonesia dengan sistem yang otoriter
3. Perlindungan untuk orang-orang VOC, serta keluarga, dan para imigran Eropa.

Hukum Belanda diterapkan terhadap bangsa Belanda atau Eropa. Sedangkan untuk rakyat
pribumi, yang berlaku ialah hukum-hukum yang dibuat oleh tiap-tiap komunitas secara
mandiri. Tata politik & pemerintahan pada zaman itu telah mengesampingkan hak-hak dasar
rakyat di nusantara & menjadikan penderitaan yang pedih terhadap bangsa pribumi di masa
itu.

b. Era Liberal Belanda


Tahun 1854 di Hindia-Belanda dikeluarkan Regeringsreglement (kemudian dinamakan RR
1854) atau Peraturan mengenai Tata Pemerintahan (di Hindia-Belanda) yang tujuannya adalah
melindungi kepentingan usaha-usaha swasta di tanah jajahan & untuk yang pertama kalinya
mencantumkan perlindungan hukum untuk rakyat pribumi dari pemerintahan jajahan yang
sewenang-wenang. Hal ini bisa dilihat dalam (Regeringsreglement) RR 1854 yang mengatur
soal pembatasan terhadap eksekutif (paling utama Residen) & kepolisian, dan juga jaminan
soal proses peradilan yg bebas.
Otokratisme administrasi kolonial masih tetap terjadi pada era ini, meskipun tidak lagi
sekejam dahulu. Pembaharuan hukum yang didasari oleh politik liberalisasi ekonomi ini
ternyata tidak dapat meningkatkan kesejahteraan rakyat pribumi, sebab eksploitasi masih
terus terjadi.

c. Era Politik Etis Sampai Kolonialisme Jepang


74

Politik Etis diterapkan di awal abad ke-20. Kebijakan-kebijakan awal politik etis yang berkaitan
langsung dengan pembaharuan hukum antara lain:
1. Pendidikan bagi rakyat pribumi, termasuk juga pendidikan lanjutan hukum;
2. Pendirian Volksraad, yaitu lembaga perwakilan untuk kaum pribumi;
3. Manajemen organisasi pemerintahan, yang utama dari sisi efisiensi;
4. Manajemen lembaga peradilan, yang utama dalam hal profesionalitas;
5. Pembentukan peraturan perundang-undangan yg berorientasi pada kepastian hukum.
Sampai saat hancurnya kolonialisme Belanda, pembaruan hukum di Hindia Belanda
meninggalkan warisan: i) Pluralisme/dualisme hukum privat dan pluralisme/dualisme
lembaga-lembaga peradilan; ii) Pengelompokan rakyat ke menjadi tiga golongan; Eropa dan
yang disamakan, Timur Asing, Tionghoa & Non-Tionghoa, & Pribumi.

Masa penjajahan Jepang tidak banyak terjadi pembaruan hukum di semua peraturan
perundang-undangan yang tidak berlawanan dengan peraturan militer Jepang, tetap berlaku
sambil menghapus hak-hak istimewa orang-orang Belanda & Eropa lainnya. Sedikit
perubahan perundang-undangan yang dilakukan: i) Kitab Undang-undang Hukum Perdata,
yang awalnya hanya berlaku untuk golongan Eropa & yang setara, diberlakukan juga untuk
kaum Cina; ii) Beberapa peraturan militer diselipkan dalam peraturan perundang-undangan
pidana yang berlaku. Di bidang peradilan, pembaharuan yang terjadi adalah: i) Penghapusan
pluralisme/dualisme tata peradilan; ii) Unifikasi kejaksaan; iii) Penghapusan pembedaan polisi
kota & lapangan/pedesaan; iv) Pembentukan lembaga pendidikan hukum; v) Pengisian secara
besar-besaran jabatan-jabatan administrasi pemerintahan & hukum dengan rakyat pribumi.

Era Revolusi Fisik Sampai Demokrasi Liberal

a. Era Revolusi Fisik


i) Melanjutkan unfikasi badan-badan peradilan dengan melaksanakan penyederhanaan;
ii) Mengurangi serta membatasi peranan badan-badan pengadilan adat & swapraja, terkecuali
badan-badan pengadilan agama yg bahkan diperkuat dengan pembentukan Mahkamah Islam
Tinggi.

b. Era Demokrasi Liberal


Undang-undang Dasar Sementara 1950 yang sudah mengakui HAM. Namun pada era ini
pembaharuan hukum & tata peradilan tidak banyak terjadi, yang terjadi adalah dilema untuk
mempertahankan hukum & peradilan adat atau mengkodifikasi dan mengunifikasinya menjadi
hukum nasional yang peka terhadap perkembangan ekonomi dan tata hubungan
internasional. Selajutnya yang terjadi hanyalah unifikasi peradilan dengan menghapuskan
seluruh badan-badan & mekanisme pengadilan atau penyelesaian sengketa di luar pengadilan
negara, yang ditetapkan melalui UU No. 9/1950 tentang Mahkamah Agung dan UU Darurat
No. 1/1951 tentang Susunan & Kekuasaan Pengadilan.

Era Demokrasi Terpimpin Sampai Orde Baru

a. Era Demokrasi Terpimpin


Perkembangan dan dinamika hukum di era ini
75

i) Menghapuskan doktrin pemisahan kekuasaan & mendudukan MA & badan-badan


pengadilan di bawah lembaga eksekutif;
ii) Mengubah lambang hukum "dewi keadilan" menjadi "pohon beringin" yang berarti
pengayoman;
iii) Memberikan kesempatan kepada eksekutif untuk ikut campur tangan secara langsung atas
proses peradilan sesuai UU No.19/1964 & UU No.13/1965;
iv) Menyatakan bahwa peraturan hukum perdata pada masa pendudukan tidak berlaku
kecuali hanya sebagai rujukan, maka dari itu hakim harus mengembangkan putusan-putusan
yang lebih situasional & kontekstual.

b. Era Orde Baru


Pembaruan hukum pada masa Orde Baru dimulai dari penyingkiran hukum dalam proses
pemerintahan dan politik, pembekuan UU Pokok Agraria, membentuk UU yang mempermudah
modal dari luar masuk dengan UU Penanaman modal Asing, UU Pertambangan, dan UU
Kehutanan. Selain itu, orde baru juga melancarkan: i) Pelemahan lembaga hukum di bawah
kekuasaan eksekutif; ii) Pengendalian sistem pendidikan & pembatasan pemikiran kritis,
termasuk dalam pemikiran hukum; Kesimpulannya, pada era orba tidak terjadi perkembangan
positif hukum Nasional.

Periode Pasca Orde Baru (1998 Sekarang)

Semenjak kekuasaan eksekutif beralih ke Presiden Habibie sampai dengan sekarang, sudah
dilakukan 4 kali amandemen UUD RI 1945. Beberapa pembaruan formal yang terjadi antara
lain: 1) Pembaruan sistem politik & ketetanegaraan; 2) Pembaruan sistem hukum & HAM; dan
3) Pembaruan sistem ekonomi.
Ciri-ciri Sistem Hukum

terdapat perintah dan larangan

terdapat sanksi tegas bagi yang melanggar

perintah dan larangan harus ditaati untuk seluruh masyarakat

Tiap-tiap orang harus bertindak demikian untuk menjaga ketertiban dalam bermasyarakat.
Oleh karena itu, hukum meliputi berbagai peraturan yang menentukan dan mengatur
hubungan antara orang yang satu dengan orang yang lain yang dapat disebut juga kaedah
hukum yakni peraturan-peraturan kemasyarakatan.
Kaedah
Hukum
Sumber-sumber yang menjadi kaedah hukum atau peraturan kemasyarakatan:
1. Norma Agama merupakan peraturan hidup yang berisi perintah dan larangan yang
bersumber dari Yang Maha Kuasa. Contoh: jangan membunuh, hormati orang tua, berdoa, dll
2. Norma Kesusilaan merupakan peraturan yang bersumber dari hati sanubari. contohnya:
melihat
orang
yang
sedang
kesulitan
maka
hendaknya
kita
tolong.
3. Norma Kesopanan merupakan peraturan yang hidup di masyarakat tertentu. contohnya:
menyapa orang yang lebih tua dengan bahasa yang lebih tinggi atau baik.
4. Norma Hukum merupakan peraturan yang dibuat oleh penguasa yang berisi perintah dan
larangan yang bersifat mengikat: contohnya: ttiap indakan pidana ada hukumannya.
Unsur-unsur Hukum
Di dalam sebuah sistem hukum terdapat unsur-unsur yang membangun sistem tersebut yaitu:
76

1. Peraturan yang mengatur tingkah laku manusia dalam kehidupan bermasyarakat


2.
Peraturan
yang
ditetapkan
oleh
instansi
resmi
negara
3.
Peraturan
yang
bersifat
memaksa
4.
Peraturan
yang
memiliki
sanksi
tegas.
Sifat
Hukum
Agar peraturan hidup kemasyarakatan agar benar-benar dipatuhi dan di taati sehingga
menjadi kaidah hukum, peraturan hidup kemasyarakata itu harus memiliki sifat mengatur dan
memaksa. Bersifat memaksa agar orang menaati tata tertib dalam masyarakaty serta
memberikan sanksi yang tegas (berupa hukuman) terhadap siapa yang tidak mau patuh
menaatinya.
Tujuan
Hukum
Hukum bertujuan menjamin adanya kepastian hukum dalam masyarakat dan hukum harus
pula bersendikan pada keadilan, yaitu asas-asas keadilan dari masyarakat itu. Sementara itu,
para ahli hukum memberikan tujuan hukum menurut sudut pandangnya masing-masing.
1.
Prof. Subekti, S.H. hukum itu mengabdi pada tujuan Negara yang dalam pokoknya ialah
mendatangkan kemakmuran dan kebahagiaan pada rakyatnya.
2.
Prof. MR. dr. L.J. Van Apeldoorn, tujuan hukum adalah mengatur pergaulan hidup
manusia secara damai.
3.
Geny, hukum bertujuan semata-mata untuk mencapai keadilan, dan sebagai unsur
daripada keadilan disebutkannya kepentingan daya guna dan kemanfaatan.
4.
Jeremy Betham (teori utilitas), hukum bertujuan untuk mewujudkan semata-mata apa
yang berfaedah bagi orang.
5.
Prof. Mr. J. Van Kan, hukum bertujuan menjaga kepentingan tiap-tiap manusia supaya
kepentingan-kepentingan itu tidak dapat diganggu.
Berdasarkan pada beberapa tujuan hukum yang dikemukakan para ahli di atas, dapat
disimpulkan bahwa tujuan hukum itu memiliki dua hal, yaitu :
1.

untuk mewujudkan keadilan

2.

semata-mata untuk mencari faedah atau manfaat.

Selain tujuan hukum, ada juga tugas hukum, yaitu :


1.

menjamin adanya kepastian hukum.

2.

Menjamin keadilan, kebenaran, ketentraman dan perdamaian.

3.
Menjaga jangan sampai terjadi perbuatan main hakim sendiri dalam pergaulan
masyarakat.
Sumber Hukum
Sumber hukum ialah segala apa saja yang menimbulkan aturan-aturan yang mempunyai
kekuatan-kekutatan yang bersifat memaksa, yakni aturan-aturan yang jika dilanggar
mengakibatkan sanksi yang tegas dan nyata. Sumber hukum dapat ditinjau dari segi :
1. Sumber hukum material, sumber hukum yang dapat ditinjau dari berbagai sudut pandang,
misalnya ekonomi, sejarah, sosiologi, dan filsafat. Seorang ahli kemasyarakatan (sosiolog)
akan menyatakan bahwa yang menjadi sumber hukum adalah peristiwa-peristiwa yang terjadi
77

dalam masyarakat. Demikian sudut pandang yang lainnya pun seterusnya akan bergantung
pada pandangannya masing-masing bila kita telusuri lebih jauh.

DALAM konteks Indonesia, ada beberapa alasan mengapa asing berkepentingan untuk mencampuri berbagai urusan
dalam negeri Indonesia, di antaranya:
Pertama, secara geopolitik, posisi Indonesia sangat strategis di kawasan Asia Pasifik dan Selat Malaka.
Kedua, secara ekonomi, Indonesia adalah negara yang sangat kaya dengan sumber daya alam dan mineral, baik di
darat maupun di laut.
Kekayaan alam Indonesia yang sangat luar biasa ini jelas sangat menggoda negara-negara imperialis Barat untuk
menguasainya, langsung ataupun tidak langsung (melalui sejumlah perusahaan multi-nasional dan trans-nasional yang
tersebar di seluruh Indonesia).
Di samping itu, dengan jumlah penduduk lebih dari 200 juta jiwa, Indonesia adalah pasar potensial bagi produkproduk negara-negara industri Barat.
Ketiga, secara ideologi-politik, mayoritas penduduk Indonesia (sekitar 87,07%) adalah muslim. Sebagaimana
dipahami, ideologi Islam sudah lama dipandang sebagai ancaman paling potensial oleh Blok Barat setelah runtuhnya
Blok Timur dengan ideologi komunisnya.
Karena itu, barat sangat tidak menginginkan jika ideologi Islam bangkit di Indonesia yang penduduknya mayoritas
muslim, sebagaimana hal itu juga tidak dikehendaki Blok Barat terjadi di belahan dunia Islam yang lain.
Karena itu pula, Barat dengan watak imperialistiknya, sesungguhnya telah, sedang, dan akan terus melakukan banyak
makar dan rekayasa politik untuk mencegah bangkitnya Islam di kawasan ini.
Lebih dari itu, Barat sesungguhnya telah banyak memengaruhi naik-turunnya rezim penguasa di belahan dunia,
khususnya Dunia Islam, yang pro-Barat.
Telah banyak fakta-fakta yang diungkap, bahkan oleh kalangan intelijen AS sendiri, bahwa di Dunia Islam, Blok Barat
berperan besar dalam memunculkan kepemimpinan di Arab Saudi, Mesir, Yordania, Kuwait, Aljazair, Turki, dan
beberapa negara lain. Termasuk yang paling mutakhir, rezim Afganistan dan Irak.
Walhasil, sangat mungkin pula jika Blok Barat sangat berkepentingan untuk memunculkan sosok Presiden Indonesia
2009-2014 yang juga goodboy dan sangat pro-Barat.*din
Berdasarkan UUD 1945 Indonesia merupakan Negara hukum. Semua rakyatnya
memiliki kedudukan yang sama di mata hukum. Tetapi apakah dalam penerapannya
sudah sesuai dengan UUD tersebut?
Sepertinya amanat itu belum dapat terealisasikan bahkan setelah Indonesia telah lebih dari
abad memperoleh kemerdekaan. Sepertinya kita pun hanya berangan untuk mendapatkan
keadilan yang setara di Indonesia. Apabila kita cermati hukum di Indonesia saat ini penuh
dengan kebobrokan kalaupun hukum ditegakan unsur diskriminatif terlihat jelas dalam proses
penegakan hukum tersebut.
Praktik-praktik penyelewengan dalam proses hukum seperti mafia peradilan, proses peradilan
hukum yang diskriminatif, jual-beli putusan hakim, atau tebang pilih kasus merupakan realitas
sehari-hari yang secara nyata dapat kita lihat dalam praktik penegakan hukum di Negara ini.
Dampak dari penyelewangan hukum ini adalah kerusakan dan kehancuran di segala bidang
78

(politik, perekonomian, budaya dan social). Selain itu menyebabkan masyarakat kehilangan
rasa hormat dan timbulnya ketidak percayaan terhadap aparat penegak hukum di negeri ini.
Sehingga membuat masyarakat mencari keadilan sendiri. Oleh karena, itu praktik main hakim
sendiri sangat terlihat di masyarakat kita. Contoh kasus upaya pembacokan seorang hakim
yang terlibat kasus korupsi oleh seorang aktivis LSM karena sang pelaku geram dengan para
pelaku korupsi yang merugikan Negara ini.
Sebenarnya apakah masalah yang menyebabkan sulitnya penegakan hukum di Indonesia?
Jika dikaji secara mendalam terdpat beberapa factor sulitanya penegakan hukum di Indonesia
yaitu:
1. Lemahnya politic will dan politic action para pemimpin Negara.
Dimana supermasi hukum masih sebatas retrorika dan jargo-jargon politik belaka yang
berngaung ketika kampanye tanpa bukti yang pasti.
2. Campur tangan politik
Banyak sekali kasus hukum di Indonesia yang terhambat karena adanya campur tangan
politik didalamnya. Sebut saja kasus Bank Century yang berpotensi menyeret kalangan
eksekutif ke jalur hukum, mudurnya Sri Mulyani dari mentri keuangan lantaran diduga terkait
kasus ini. Serta kasus yang terbaru penyalahgunaan dana wisma atlet yang menyeret
Nazarudin sebagai tersangka dimana ia adalah salah seorang bendahara umum di salah satu
partai yang tengah berkuasa di Indonesia dan walaupun masih dugaan kasus ini banyak
melibatkan para penguasa di Negara ini. Seharusnya hukum tidak bisa dicampur adukan
dengan politik. Hukum tidak bisa pandang bulu siapapun itu yang terlibat di dalamnya harus
benar-benar diganjar hukuman sesuai perbuatannya tanpa melihat siapa dan apa
kedudukannya di Negara ini.
3. Kedewasaan Berpolitik
Berbagai sikap yang diperlihatkan oleh partai politik saat kadernya terkena kasus poltik
sesungguhnya memperlihatkan ketidak dewasaan para elit politik di Negara hukum ini. Sikap
saling sandera serta cenderung mengadvokasi para kader termasuk ketidakmauan untuk
memberikan informasi kepada aparat penegak hukum terkait dengan beberapa kasus korupsi
yang sedang berlangsung saat ini. Sikap kooperatif dan transparansi dalam penegakan hukum
dianak tirikan, sedangkan politik pencitraan diutamakan agar tetap eksis di hadapan
masyarakat.
4. Peraturan perundangan yang lebih berpihak kepada kepentingan penguasa dibandingkan
kepentingan rakyat.
Hal ini dapat terliahat jelas terhadap hukuman yang diberikan kepada para penguasa yang
terjerat kasus korupsi hanya diberikan hukuman yang ringan padahal mereka sangat
merugikan Negara sedangkan rakyat kecil yang melakukan kesalahan dikarenakan kemiskinan
yang menjerat mereka dihukum dengan berat tanpa adanya perikemanusiaan.
5. Rendahnya integritas moral, kredibilitas, profesionalitas dan kesadaran hukum aparat
penegak hukum dalam menegakan hukum.
Moral yang ada di beberapa aparat penegak hukum di Indonesia saat ini bisa dikatakan
sangat rendah. Mereka dapat dengan mudahnya disuap oleh para tersangka agar mereka bisa
terbebas atau paling tidak mendapat hukuman yang rendah dari kasus hukum yang mereka
hadapi. Padahal para aparat ini telah disumpah saat ia memangkuh jabatannya sebagai
penegak hukum. Terjadi pelanggaran moral ini kerena kebutuhan ekonomi yang terlalu
berlebihan dibanding kebutuhan psikis yang seharusnya sama. Hakikat manusia adalah
makhluk budaya yang menyadari bahwa yang benar , yang indah dan yang baik adalah
keseimbangan antara kebutuhan ekonomi dan kebutuhan psikhis dan inilah yang menjadi
tujuan hidup manusia. Kebahagiaan jasmani dan kebahagiaan rohani tercapai dalam keadaan
79

seimbang artinya perolehan dan pemanfaatan harta kekayaan terjadi dalam suasana tertib,
damai dan serasi (nilai etis, moral).
6. Faktor Sosial Masyrakat
Penegakan hukum berasal dari masyarakat, dan bertujuan untuk masyarakat. Oleh karena itu,
masyarakat mempunyai pengaruh dalam proses penegakan hukum. Tetapi masyarakat
Indonesia cenderung menyerahkan semuanya terhadap para aparat tanpa adanya
pengawasan. Akibatnya baik buruknya hukum selalu dikaitkan dengan pola perilaku para
penegak hukum. Padahal proses peradilan bukan hanya tentang pasal-pasal melainkan proses
perilaku masyarakat dan berlangsung dalam struktur social tertentu.
7. Ekonomi
Factor ekonomi juga sangat mempengaruhi penegakan hukum di Indonesia, antara lain:
1. Penghasilan kurang mencukupi kebutuhan hidup,
2. Kebutuhan hidup yang mendesak,
3. Gaya hidup konsumtif dan materialistis, tak dipungkiri, pola hidup seperti ini menghinggapi
sebagian besar penduduk bumi. Dibenaknya yang terpikir hanya uang,
5. Rendahnya gaji PNS,
6. Sikap mental pegawai yang ingin cepat kaya dengan cara yang tidak halal.
Untuk bisa menegakan hukum sesuai dengan amanat UUD 1945 maka para aparat hukum
haruslah taat terhadapa hukum dan berpegang pada nilai-nilai moral dan etika yang berlaku
di masyarakat. Apabila kedua unsur ini terpenuhi maka diharapkan penegakan hukum secara
adil juga dapat terjadi di Indonesia.
Kejadian-kejadian yang selama ini terjadi diharapkan dapat menjadi proses mawas diri bagi para aparat hukum dalam
penegakan hukum di Indonesia. Sikap mawas diri merupakan sifat terpuji yang dapat dilakukan oleh para aparat
penegak hukum disertai upaya pembenahan dalam system pengakan hukum di Indonesia.
Sejumlah 40 anggota Kongres Amerika Serikat melayangkan surat kepada Presiden RI Susilo Bambang Yudhoyono,
yang isinya meminta agar Presiden memastikan pembebasan segera dan tanpa syarat dua separatis Organisasi Papua
Merdeka (OPM), Filep Karma dan Yusak Pakage. Pada bulan Mei 2005 mereka berduadijatuhi hukuman masing 15
dan 10 tahun penjara dalam kasus makar pengibaran bendera Bintang Kejora di Lapangan Trikora, Abepura, pada 1
Desember
2004.
Tentang surat dari 40 anggota Kongres tersebut, bahwa KBRI Washington D.C. sendiri dalam waktu dekat akan
mengirimkan surat balasan yg isinya sama seperti yang telah di paparkan kepada khalayak di AS yang pernah
mempertanyakan soal penahanan Filep dan Yusak yaitu kasus yg mereka lakukan adalah krn tindakan pidana murni.
Untuk itu pemerintah di harapkan dengan tegas menolak permintaan perihal kongres AS tsb.
Pada dasarnya Anggota Kongres Amerika Serikat (AS) tidak berhak sedikit pun mencampuri keputusan penegakan
hukum di Indonesia yang telah menjatuhkan hukuman terhadap warga Papua itu, Filep Karma dan Yusak Pakage atas
perbuatannya merongrong wibawa dan keutuhan Negara Kesatuan Republik Indonesia (NKRI) dengan cara
mengibarkan bendera bintang kejora. Karena jika dipandang dari sisi hukum, maka permintaan anggota Kongres AS
itu jelas-jelas merupakan campur tangan orang asing terhadap hukum Indonesia. Filep dan Yusak itu adalah warga
negara Indonesia kelahiran Papua yang dihukum antara lain karena mengibarkan bendera Bintang Kejora yang oleh
kelompok tertentu dijadikan sebagai lambang perjuangan kemerdekaan Papua di persada Indonesia..
Apa yang disampaikan para anggota Kongres AS itu lebih banyak bermuatan politik ketimbang hukum negara
Indonesia. Anggota Kongres itu bertindak berdasarkan pandangan Hak Azasi Manusia. Pertanyaannya adalah, hak
azasi mana yang dilanggar Indonesia terhadap warga negaranya Filep dan Yusak..??? Apabila 40 anggota
Kongres AS berpendapat bahwa dua warga Papua itu tidak boleh dihukum karena tindakan mengibarkan bendera
Bintang Kejora merupakan wujud pernyataan kebebasan berpendapat maka orang Indonesia berhak balik bertanya,
80

apakah pernyataan kebebasan berpendapat harus dilakukan dengan cara mengibarkan bendera bintang kejora yang
bernuansa separatisme ..??
AS memang negara paling senang mengobok-obok negara lain, apa yg sebenarnya di inginkan oleh AS..??? Dalam hal
ini Pemerintah Indonesia harus berani dg tegas menolak semua campur tangan oleh negara manapun tentang urusan
dalam negeri. Tunjukan pada dunia, bahwa kita ( Indonesia ) bukan negara yg bisa di kendalikan atopun
ketergantungan terhadap negara lain. Sebuah ancamana bagi keutuhan NKRI tidak bisa di biarkan begitu saja, dan
janganlah kita memperjuangkan kepentingan politik disintegrasi bangsa dan negara ini dengan mengenakan baju
HAM.
WoiAmerika..!!! Apa mau mu??? Jangan kau campuri urusan negaraku!!!!
Keterlibatan anggota parlemen Inggris di Papua dengan memfasilitasi konferensi International
Parliamentary for West Papua (IPWP) untuk Organisasi Papua Merdeka (OPM) merupakan
bentuk
intervensi
asing
terhadap
kedaulatan
RI.
Pendapat tersebut disampaikan Koordinator Gerakan Indonesia Bersih, Adhie M Massardi
dalam keterangan tertulisnya, Minggu (7/8/2011). Meskipun belum menjadi langkah resmi
pemerintah Inggris, hal ini merupakan fakta nyata adanya campur tangan asing di Indonesia,
ujarnya.
Sebelumnya, di Oxford Inggris diselenggarakan konferensi yang digagas International Lawyers
for West Papua (ILWP). Konferensi itu mengangkat tema tentang kemerdekaan Papua Barat,
yakni West Papua? The Road to Freedom. ILWP diduga dimotori oleh oknum anggota
Parlemen
Inggris.
Adhie menjelaskan, secara umum, di Papua tidak sedang terjadi pergolakan serius yang bisa
ditafsirkan sebagai keadaan bahaya yang mengancam terjadinya pelanggaran HAM.
Sehingga,
Papua
tidak
layak
menjadi
urusan
masyarakat
Internasional.
Semua ini terjadi akibat lemahnya tata kelola pemerintah. Dalam kasus OPM yang makin
dapat dukungan Inggris, ini 100% merupakan cermin kegagalan politik luar negeri RI.
Dampaknya, dalam beberapa pekan ke depan akan ada kegentingan di Papua.
Adhie berpandangan, DPR dan para pemimpin politik nasional untuk membicarakan hal
tersebut untuk segera menentukan langkah. Langkah itu perlu dilakukan karena menurut
Adhie
SBY
pasti
akan
lamban
menyikapi
hal
ini.
Apabila kita, terutama para pemimpin politik tidak segera bertindak, dalam tempo setahun
setelah ini, Organisasi Papua Merdeka (OPM) akan mendapat dukungan luas di dunia
Internasional. Kalau sudah begitu, lepasnya Papua dari NKRI tinggal menunggu hari.
(inilah.com, 7/8/2011)

A.

Latar Belakang Masalah

Negara Indonesia berdasarkan atas hukum, tidak berdasarkan pada kekuasaan belaka.
Hal ini mengandung arti bahwa Negara, termasuk di dalamnya pemerintah dan lembagalembaga negara lainnya dalam melaksanakan tindakan-tindakan apapun, harus dilandasi oleh
peraturan hukum atau harus dapat dipertanggungjawabkan secara hukum.

Ketentuan pasal 27 ayat (1) UUD Tahun 1945 menegaskan bahwa : segala warga negara
bersamaan kedudukannya di dalam hukum dan pemerintahan dan wajib menjunjung hukum
dan
pemerintahan
itu
dengan
tidak
ada
kecualinya.
Konsekuensi ketentuan itu adalah bahwa setiap sikap, kebijakan, dan perilkau alat negara dan
penduduk (warga negara dan orang asing) harus berdasarkan dan sesuai dengan hukum.
Ketentuan itu sekaligus dimaksudkan untuk mencegah terjadinya kesewenang-wenangan dan
arogansi kekuasaan, baik yang dilakukan oleh alat negara maupun oleh penduduk.
Masuknya ketentuan mengenai Indonesia adalah negara hukum ( sebelum perubahan masuk
dalam penjelasan UUD Tahun 1945) ke dalam pasal di maksudkan untuk memperteguh
paham bahwa Indonesia adalah negara hukum, baik dalam penyelenggaraan negara maupun
81

kehidupan
berbangsa
dan
bermasyarakat.
Kenyataan akhir-akhir ini, dalam kehidupan berbangsa dan bernegara, penegakan hukum di
Indonesia menjadi sorotan dari berbagai media dan masyarakat, karena mereka beranggapan
bahwa dalam penegakan hukum selalu dipengaruhi oleh kepentingan-kepentingan lain yang
akibatnya jauh dari keadilan dan harapan masyarakat.
Masalah penegakkan hukum merupakan topik yang tidak henti-hentinya dibicarakan di setiap
negara, terutama di negara-negara dunia ketiga atau negara berkembang. Penegakkan
hukum secara tepat merupakan modal dasar untuk mencapai tujuan negara demokratis dan
mencapai pertumbuhan ekonomi yang optimal.
B.

Pembahasan

Penegakkan hukum di Indonesia masih sangat tidak adil, karena masih melihat latar
belakang dan kedudukan seseorang. Hukum hanya berpihak kepada mereka yang mempunyai
kekuasaan, sedangkan bagi yang tidak memiliki kekuasaan, mereka tetaplah tertindas.
Masalah hukum di Indonesia terjadi karena beberapa hal, dari sistem peradilan, perangkat
hukum, inkosistensi penegakkan hukum, intervensi kekuasaan, maupun perlindungan hukum.
Dari sekian banyak masalah hukum tersebut, satu hal yang sering terlihat dan dirasakan
masyarakat awam adalah inkonsistensi penegakkan hukum oleh aparat. Inkonsistensi
penegakkan hukum tersebut kadang melibatkan masyarakat itu sendiri, keluarga, maupun
lingkungan terdekat lainnya. dan inkonsistensi penegakkan hukum tersebut biasanya
berlangsung dari hari ke hari, baik peristiwa kecil maupun besar.

Berikut adalah pemicu inkonsistensi penegakkan hukum di Indonesia, yaitu:


1.

Tingkat kekayaan seseorang

2.

Tingkat jabatan seseorang

3.

Nepotisme

4.

Tekanan internasional

Inkonsistensi hukum tersebut telah berlangsung terus menerus selama puluhan tahun.
Masyarakat Indonesia telah terbiasa melihat bagaimana hukum yang diterapkan jauh berbeda
dari panduan hukum yang tertulis di negara kita. Apabila melihat penodongan di jalan umum,
jarang terjadi masyarakat membantu korban atau melaporkan pelaku kepada aparat. Namun
bila mereka sendiri tersangkut dalam suatu masalah, tidak jarang mereka memanfaatkan
inkonsistensi penegakan hukum ini.
Berikut adalah contoh dari dampak negatif dari inkonsistensi hukum di Indonesia, yaitu:
1.
Ketidakpercayaan
Masyarakat
pada
Hukum
Masyarakat meyakini bahwa hukum lebih banyak merugikan mereka,dan sedapat mungkin
dihindari. Bila seseorang melanggar peraturan lalu lintas misalnya, maka sudah jamak
dilakukan upaya damai dengan petugas polisi yang bersangkutan agar tidak membawa
kasusnya
ke
pengadilan
.
Memang
dalam
hukum
perdata,
dikenal
pilihan
penyelesaian masalah dengan arbitrase atau mediasi di luar jalur pengadilan untuk
menghemat waktu dan biaya. Namun tidak demikian hal nya dengan hukum pidana yang
hanya menyelesaikan masalah melalui pengadilan. Di Indonesia, bahkan persoalan pidana
pun
masyarakat
mempunyai
pilihan
diluar
pengadilan.
2.
Penyelesaian
Konflik
dengan
Kekerasan
Penyelesaian konflik dengan kekerasan terjadi secara sporadis di beberapa tempat di
Indonesia. Suatu persoalan pelanggaran hukum kecil kadang membawa akibat hukuman yang
sangat berat bagi pelakunya yang diterima tanpa melalui proses pengadilan. Pembakaran dan
82

penganiayaan pencuri sepeda motor, perampok, penodong yang dilakukan massa beberapa
waktu yang lalu merupakan contoh. Menurut Durkheim masyarakat ini menerapkan hukum
yang bersifat menekan (repressive). Masyarakat menerapkan sanksi tersebut tidak atas
pertimbangan rasional mengenai jumlah kerugian obyektif yang menimpa masyarakat itu,
melainkan atas dasar kemarahan kolektif yang muncul karena tindakan yang menyimpang
dari pelaku. Masyarakat ingin memberi pelajaran kepada pelaku dan juga pada memberi
peringatan anggota masyarakat yang lain agar tidak melakukan tindakan pelanggaran yang
sama.
3.
Pemanfaatan
Inkonsistensi
Penegakan
Hukum
untuk
Kepentingan
Pribadi
Dalam beberapa kasus yang berhasil ditemukan oleh media cetak, terbukti adanya kasus
korupsi dan kolusi yang melibatkan baik polisi, kejaksaan, maupun hakim dalam suatu
perkara. Kasus ini biasanya melibatkan pengacara yang menjadi perantara antara terdakwa
dan aparat penegak hukum. Fungsi pengacara yang seharusnya berada di kutub
memperjuangkan keadilan bagi terdakwa , berubah menjadi pencari kebebasan dan
keputusan seringan mungkin dengan segala cara bagi kliennya. Sementara posisi polisi dan
jaksa yang seharusnya berada di kutub yang menjaga adanya kepastian hukum, terbeli oleh
kekayaan terdakwa. Demikian pula hakim yang seharusnya berada ditengah-tengah dua
kutub tersebut, kutub keadilan dan kepastian hukum, bisa jadi condong membebaskan atau
memberikan putusan seringan-ringannya bagi terdakwa setelah melalui kesepakatan
tertentu.
4.
Penggunaan
Tekanan
Asing
dalam
Proses
Peradilan
Campur tangan asing bagaikan pisau bermata dua. Disatu pihak tekanan asing dapat
membawa berkah bagi pencari keadilan dengan dipercepatnya penyidikan dan penegakan
hukum oleh aparat. Lembaga asing non pemerintah biasanya aktif melakukan tekanantekanan semaam ini, misalnya dalam pengusutan kasus pembunuhan di Aceh, tragedi Ambon,
Sambas,
dan
sebagainya.
Namun di lain pihak tekanan asing kadang juga memberi mimpi buruk pula bagi masyarakat.
Beberapa perusahaan asing yang terkena kasus pencemaran lingkungan, gugatan tanah oleh
masyarakat adat setempat, serta sengketa perburuhan, kadang menggunakan negara
induknya untuk melakukan pendekatan dan tekanan terhadap pemerintah Indonesia agar
tercapai kesepakatan yang menguntungkan kepentingan mereka, tanpa membiarkan hukum
untuk menyelesaikannnya secara mandiri. Tekanan tersebut dapat berupa ancaman embargo,
penggagalan penanaman modal, penghentian dukungan politik, dan sebagainya. Kesemuanya
untuk meningkatkan posisi tawar mereka dalam proses hukum yang sedang atau akan
dijalaninya.
Solusi Inkonsistensi Penegakan Hukum di Indonesia :
1. Penataan kembali struktur dan lembaga-lembaga hukum yang ada, termasuk sumber daya
manusia yang melaksanakannya. Termasuk dalam lingkup ini adalah masalah manajemen
hukum, yang berkenaan dengan manajemen sumber daya, manajemen organisasi dan
manajemen operasional.
2. Perumusan kembali hukum yang demokratis dan berkeadilan.
Bahwasanya hukum di masa lalu (entah masa sekarang) telah menjadi Tools of The Rules
telah disadari bersama. Oleh karenanya yang perlu dilakukan adalah mengkaji kembali
aturan-aturan yang ada dan melakukan revokasi (penarikan kembali), revisi (pengubahan)
serta pemberlakuan ketentuan baru yang diperlukan. Kewajiban ini bukan hanya diletakkan
pada lembaga legislatif, tapi juga lembaga eksekutif yang pada dasarnya lebih banyak
mengeluarkan peraturan implementatif. Budaya, kebutuhan dan potensi lokal haruslah
mendapat perhatian yang jauh lebih besar daripada kepentingan pusat dalam rangka otonomi
daerah.
3. Peningkatan penegakan hukum.
83

a. Penyelesaian kasus-kasus pelanggaran hukum. Upaya yang menjadi tugas utama lembaga
kepolisian harus pula ditunjang oleh aparat penegak hukum lainnya (jaksa, hakim) agar
perkara dituntaskan, dan tidak floating atau bahkan freezing, yang mencerminkan tidak
berdayanya hukum. Untuk mengembalikan kepercayaan masyarakat, tindakan penegak
hukum yang tidak diskriminatif dan menunjang equality before the law, bukan hanya terjadi
penjahat jalanan, tapi juga penjahat gedongan (mantan) pejabat bahkan mantan presiden
dan keluarganya. Persepsi masyarakat akan keberpihakan (penegak) hukum pada kelompok
tertentu hanya akan memperparah keadaan sekarang ini, karena sekelompok orang mungkin
berjustifikasi ikan besar saja dibiarkan liwat, apalagi teri-teri seperti kami.
b. Harus ditekankan agar tidak terjadi lagi pembiaran atas pelanggaran-pelanggaran
hukum. Upaya proaktif dan reaktif yang dilakukan meningkatkan kinerja lembaga-lembaga
hukum, utamanya dalam supporting equipments, karena keterbatasan sarana dan prasarana
mempunyai dampak yang cukup signifikan dalam produktivitas mereka.
4. Mengikutsertakan rakyat dalam berbagai tingkat pengambilan keputusan (demokratisasi).
Upaya ini dimaksudkan agar rakyat ditempatkan sebagai subyek, bukan obyek untuk diatur,
agar menimbulkan sense of belonging mereka dalam kehidupan bernegara. Tanpa adanya
partisipasi publik akan sangat sulit bagi masyarakat untuk melihat kesungguhan pemerintah
dalam penyelenggaraan tugasnya yang benar-benar menyuarakan kepentingan mereka.
Ketidak jelasan dan ketidak transparanan proses pengambilan keputusan membuat
masyarakat mempertanyakan : apakah kepentingan mereka diprioritaskan?
5. Pendidikan publik untuk meningkatkan pemahaman merkea tentang hukum dengan segala
atributnya, termasuk signifikan peran mereka dalam melakukan reformasi hukum.
6. Penerapan konsep Good Governance
Konsep ini berkenaan dengan :
a) legitimasi pemeirntah (tingkat demokratisasi)
b) akuntabilitas pemerintah (pembuatan keputusan
pertanggungjawaban pemerintah dan kebebasan pers),

yang

transaparan,

mekanisme

c) kompetensi pemerintah untuk membuat dan melaksanakan kebijakan;


d) penghormatan pemerintah pada HAM dan rule of law (perlidungan atas hak individu dan
kelompok, kerangka kegiatan ekonomi dan sosial, serta partisipasi publik).
C.

Kesimpulan

Inkonsistensi merupakan masalah yang harus dihilangkan di negara ini, perbaikan


terhadap aparatur negara memang sangat diperlukan, tetapi tanpa adanya dukungan dari
subjek hukum atau masyarakat sendiri rasanya akan susah untuk menghilangkan
inkonsistensi hukum di Indonesia.
Maka dari itu pendidikan hukum kepada masyarakat pun perlu diperbaiki, membuat mereka
mengerti dengan pendidikan hukum dasar yang mudah dicerna masyarakat awam pada
umumnya. Dengan demikian inkonsistensi hukum diharapkan dapat berkurang dari masalah
hukum di Indonesia, dan kepercayaan masyarakat terhadap hukum dapat kembali.
Begitu juga dengan perbaikan di sisi perundang-undangan agar dapat membatasi, mengatur
dan memperkuat hak-hak warga negara.
A.

Latar Belakang Masalah

Negara Indonesia berdasarkan atas hukum, tidak berdasarkan pada kekuasaan belaka.
Hal ini mengandung arti bahwa Negara, termasuk di dalamnya pemerintah dan lembaga84

lembaga negara lainnya dalam melaksanakan tindakan-tindakan apapun, harus dilandasi oleh
peraturan hukum atau harus dapat dipertanggungjawabkan secara hukum.
Ketentuan pasal 27 ayat (1) UUD Tahun 1945 menegaskan bahwa : segala warga negara
bersamaan kedudukannya di dalam hukum dan pemerintahan dan wajib menjunjung hukum
dan
pemerintahan
itu
dengan
tidak
ada
kecualinya.
Konsekuensi ketentuan itu adalah bahwa setiap sikap, kebijakan, dan perilkau alat negara dan
penduduk (warga negara dan orang asing) harus berdasarkan dan sesuai dengan hukum.
Ketentuan itu sekaligus dimaksudkan untuk mencegah terjadinya kesewenang-wenangan dan
arogansi kekuasaan, baik yang dilakukan oleh alat negara maupun oleh penduduk.
Masuknya ketentuan mengenai Indonesia adalah negara hukum ( sebelum perubahan masuk
dalam penjelasan UUD Tahun 1945) ke dalam pasal di maksudkan untuk memperteguh
paham bahwa Indonesia adalah negara hukum, baik dalam penyelenggaraan negara maupun
kehidupan
berbangsa
dan
bermasyarakat.
Kenyataan akhir-akhir ini, dalam kehidupan berbangsa dan bernegara, penegakan hukum di
Indonesia menjadi sorotan dari berbagai media dan masyarakat, karena mereka beranggapan
bahwa dalam penegakan hukum selalu dipengaruhi oleh kepentingan-kepentingan lain yang
akibatnya jauh dari keadilan dan harapan masyarakat.
Masalah penegakkan hukum merupakan topik yang tidak henti-hentinya dibicarakan di setiap
negara, terutama di negara-negara dunia ketiga atau negara berkembang. Penegakkan
hukum secara tepat merupakan modal dasar untuk mencapai tujuan negara demokratis dan
mencapai pertumbuhan ekonomi yang optimal.
B.

Pembahasan

Penegakkan hukum di Indonesia masih sangat tidak adil, karena masih melihat latar
belakang dan kedudukan seseorang. Hukum hanya berpihak kepada mereka yang mempunyai
kekuasaan, sedangkan bagi yang tidak memiliki kekuasaan, mereka tetaplah tertindas.
Masalah hukum di Indonesia terjadi karena beberapa hal, dari sistem peradilan, perangkat
hukum, inkosistensi penegakkan hukum, intervensi kekuasaan, maupun perlindungan hukum.
Dari sekian banyak masalah hukum tersebut, satu hal yang sering terlihat dan dirasakan
masyarakat awam adalah inkonsistensi penegakkan hukum oleh aparat. Inkonsistensi
penegakkan hukum tersebut kadang melibatkan masyarakat itu sendiri, keluarga, maupun
lingkungan terdekat lainnya. dan inkonsistensi penegakkan hukum tersebut biasanya
berlangsung dari hari ke hari, baik peristiwa kecil maupun besar.
Berikut adalah pemicu inkonsistensi penegakkan hukum di Indonesia, yaitu:
1.

Tingkat kekayaan seseorang

2.

Tingkat jabatan seseorang

3.

Nepotisme

4.

Tekanan internasional

Inkonsistensi hukum tersebut telah berlangsung terus menerus selama puluhan tahun.
Masyarakat Indonesia telah terbiasa melihat bagaimana hukum yang diterapkan jauh berbeda
dari panduan hukum yang tertulis di negara kita. Apabila melihat penodongan di jalan umum,
jarang terjadi masyarakat membantu korban atau melaporkan pelaku kepada aparat. Namun
bila mereka sendiri tersangkut dalam suatu masalah, tidak jarang mereka memanfaatkan
inkonsistensi penegakan hukum ini.
Berikut adalah contoh dari dampak negatif dari inkonsistensi hukum di Indonesia, yaitu:
1.
Ketidakpercayaan
Masyarakat
pada
Hukum
Masyarakat meyakini bahwa hukum lebih banyak merugikan mereka,dan sedapat mungkin
dihindari. Bila seseorang melanggar peraturan lalu lintas misalnya, maka sudah jamak
85

dilakukan upaya damai dengan petugas polisi yang bersangkutan agar tidak membawa
kasusnya
ke
pengadilan
.
Memang
dalam
hukum
perdata,
dikenal
pilihan
penyelesaian masalah dengan arbitrase atau mediasi di luar jalur pengadilan untuk
menghemat waktu dan biaya. Namun tidak demikian hal nya dengan hukum pidana yang
hanya menyelesaikan masalah melalui pengadilan. Di Indonesia, bahkan persoalan pidana
pun
masyarakat
mempunyai
pilihan
diluar
pengadilan.
2.
Penyelesaian
Konflik
dengan
Kekerasan
Penyelesaian konflik dengan kekerasan terjadi secara sporadis di beberapa tempat di
Indonesia. Suatu persoalan pelanggaran hukum kecil kadang membawa akibat hukuman yang
sangat berat bagi pelakunya yang diterima tanpa melalui proses pengadilan. Pembakaran dan
penganiayaan pencuri sepeda motor, perampok, penodong yang dilakukan massa beberapa
waktu yang lalu merupakan contoh. Menurut Durkheim masyarakat ini menerapkan hukum
yang bersifat menekan (repressive). Masyarakat menerapkan sanksi tersebut tidak atas
pertimbangan rasional mengenai jumlah kerugian obyektif yang menimpa masyarakat itu,
melainkan atas dasar kemarahan kolektif yang muncul karena tindakan yang menyimpang
dari pelaku. Masyarakat ingin memberi pelajaran kepada pelaku dan juga pada memberi
peringatan anggota masyarakat yang lain agar tidak melakukan tindakan pelanggaran yang
sama.
3.
Pemanfaatan
Inkonsistensi
Penegakan
Hukum
untuk
Kepentingan
Pribadi
Dalam beberapa kasus yang berhasil ditemukan oleh media cetak, terbukti adanya kasus
korupsi dan kolusi yang melibatkan baik polisi, kejaksaan, maupun hakim dalam suatu
perkara. Kasus ini biasanya melibatkan pengacara yang menjadi perantara antara terdakwa
dan aparat penegak hukum. Fungsi pengacara yang seharusnya berada di kutub
memperjuangkan keadilan bagi terdakwa , berubah menjadi pencari kebebasan dan
keputusan seringan mungkin dengan segala cara bagi kliennya. Sementara posisi polisi dan
jaksa yang seharusnya berada di kutub yang menjaga adanya kepastian hukum, terbeli oleh
kekayaan terdakwa. Demikian pula hakim yang seharusnya berada ditengah-tengah dua
kutub tersebut, kutub keadilan dan kepastian hukum, bisa jadi condong membebaskan atau
memberikan putusan seringan-ringannya bagi terdakwa setelah melalui kesepakatan
tertentu.
4.
Penggunaan
Tekanan
Asing
dalam
Proses
Peradilan
Campur tangan asing bagaikan pisau bermata dua. Disatu pihak tekanan asing dapat
membawa berkah bagi pencari keadilan dengan dipercepatnya penyidikan dan penegakan
hukum oleh aparat. Lembaga asing non pemerintah biasanya aktif melakukan tekanantekanan semaam ini, misalnya dalam pengusutan kasus pembunuhan di Aceh, tragedi Ambon,
Sambas,
dan
sebagainya.
Namun di lain pihak tekanan asing kadang juga memberi mimpi buruk pula bagi masyarakat.
Beberapa perusahaan asing yang terkena kasus pencemaran lingkungan, gugatan tanah oleh
masyarakat adat setempat, serta sengketa perburuhan, kadang menggunakan negara
induknya untuk melakukan pendekatan dan tekanan terhadap pemerintah Indonesia agar
tercapai kesepakatan yang menguntungkan kepentingan mereka, tanpa membiarkan hukum
untuk menyelesaikannnya secara mandiri. Tekanan tersebut dapat berupa ancaman embargo,
penggagalan penanaman modal, penghentian dukungan politik, dan sebagainya. Kesemuanya
untuk meningkatkan posisi tawar mereka dalam proses hukum yang sedang atau akan
dijalaninya.
Solusi Inkonsistensi Penegakan Hukum di Indonesia :
1. Penataan kembali struktur dan lembaga-lembaga hukum yang ada, termasuk sumber daya
manusia yang melaksanakannya. Termasuk dalam lingkup ini adalah masalah manajemen
hukum, yang berkenaan dengan manajemen sumber daya, manajemen organisasi dan
manajemen operasional.
2. Perumusan kembali hukum yang demokratis dan berkeadilan.
Bahwasanya hukum di masa lalu (entah masa sekarang) telah menjadi Tools of The Rules
telah disadari bersama. Oleh karenanya yang perlu dilakukan adalah mengkaji kembali
aturan-aturan yang ada dan melakukan revokasi (penarikan kembali), revisi (pengubahan)
86

serta pemberlakuan ketentuan baru yang diperlukan. Kewajiban ini bukan hanya diletakkan
pada lembaga legislatif, tapi juga lembaga eksekutif yang pada dasarnya lebih banyak
mengeluarkan peraturan implementatif. Budaya, kebutuhan dan potensi lokal haruslah
mendapat perhatian yang jauh lebih besar daripada kepentingan pusat dalam rangka otonomi
daerah.
3. Peningkatan penegakan hukum.
a. Penyelesaian kasus-kasus pelanggaran hukum. Upaya yang menjadi tugas utama lembaga
kepolisian harus pula ditunjang oleh aparat penegak hukum lainnya (jaksa, hakim) agar
perkara dituntaskan, dan tidak floating atau bahkan freezing, yang mencerminkan tidak
berdayanya hukum. Untuk mengembalikan kepercayaan masyarakat, tindakan penegak
hukum yang tidak diskriminatif dan menunjang equality before the law, bukan hanya terjadi
penjahat jalanan, tapi juga penjahat gedongan (mantan) pejabat bahkan mantan presiden
dan keluarganya. Persepsi masyarakat akan keberpihakan (penegak) hukum pada kelompok
tertentu hanya akan memperparah keadaan sekarang ini, karena sekelompok orang mungkin
berjustifikasi ikan besar saja dibiarkan liwat, apalagi teri-teri seperti kami.
b. Harus ditekankan agar tidak terjadi lagi pembiaran atas pelanggaran-pelanggaran
hukum. Upaya proaktif dan reaktif yang dilakukan meningkatkan kinerja lembaga-lembaga
hukum, utamanya dalam supporting equipments, karena keterbatasan sarana dan prasarana
mempunyai dampak yang cukup signifikan dalam produktivitas mereka.
4. Mengikutsertakan rakyat dalam berbagai tingkat pengambilan keputusan (demokratisasi).
Upaya ini dimaksudkan agar rakyat ditempatkan sebagai subyek, bukan obyek untuk diatur,
agar menimbulkan sense of belonging mereka dalam kehidupan bernegara. Tanpa adanya
partisipasi publik akan sangat sulit bagi masyarakat untuk melihat kesungguhan pemerintah
dalam penyelenggaraan tugasnya yang benar-benar menyuarakan kepentingan mereka.
Ketidak jelasan dan ketidak transparanan proses pengambilan keputusan membuat
masyarakat mempertanyakan : apakah kepentingan mereka diprioritaskan?
5. Pendidikan publik untuk meningkatkan pemahaman merkea tentang hukum dengan segala
atributnya, termasuk signifikan peran mereka dalam melakukan reformasi hukum.
6. Penerapan konsep Good Governance
Konsep ini berkenaan dengan :
a) legitimasi pemeirntah (tingkat demokratisasi)
b) akuntabilitas pemerintah (pembuatan keputusan
pertanggungjawaban pemerintah dan kebebasan pers),

yang

transaparan,

mekanisme

c) kompetensi pemerintah untuk membuat dan melaksanakan kebijakan;


d) penghormatan pemerintah pada HAM dan rule of law (perlidungan atas hak individu dan
kelompok, kerangka kegiatan ekonomi dan sosial, serta partisipasi publik).
C.

Kesimpulan

Inkonsistensi merupakan masalah yang harus dihilangkan di negara ini, perbaikan


terhadap aparatur negara memang sangat diperlukan, tetapi tanpa adanya dukungan dari
subjek hukum atau masyarakat sendiri rasanya akan susah untuk menghilangkan
inkonsistensi hukum di Indonesia.
Maka dari itu pendidikan hukum kepada masyarakat pun perlu diperbaiki, membuat mereka
mengerti dengan pendidikan hukum dasar yang mudah dicerna masyarakat awam pada
umumnya. Dengan demikian inkonsistensi hukum diharapkan dapat berkurang dari masalah
hukum di Indonesia, dan kepercayaan masyarakat terhadap hukum dapat kembali.
87

Begitu juga dengan perbaikan di sisi perundang-undangan agar dapat membatasi, mengatur
dan memperkuat hak-hak warga negara.
BAGAIMANA MEMBENAHI HUKUM EKONOMI DI INDONESIA (AGAR INVESTOR ASING MASUK KE
INDONESIA) ?
Hukum ekonomi adalah peristiwa ekonomi yang saling berhubungan satu dengan yang lain dalam kehidupan
ekonomi sehari-hari. Hukum ekonomi lahir disebabkan oleh semakin pesatnya pertumbuhan dan perkembangan
perekonomian yang berfungsi untuk mengatur dan membatasi kegiatan ekonomi dengan tujuan pembangunan
perekonomian dengan tidak mengabaikan hak-hak kepentingan masyarakat. Inti dari permasalahan ekonomi yang kita
lihat adalah karena adanya ketidakseimbangan antara kebutuhan manusia yang tidak terbatas dengan alat pemuas yang
terbatas.
Perkembangan hukum ekonomi di Indonesia masih terlalu lamban dalam mengikuti perkembangan dan
perubahan dunia bisnis. Pemerintah seharusnya lebih peka dan peduli dalam mengatasi masalah hukum ekonomi di
Indonesia diantaranya pembangunan yang tidak merata dan lapangan kerja yang tidak memadai, alangkah lebih
baiknya di selesaikan dengan cepat untuk mensejahterahkan masyarakat. Timbulnya kegiatan ekonomi yang
membutuhkan kaidah atau pranata baru karena sulit dikategorikan ke dalam sistem hukum perdata maupun hukum
publik. Adanya teknologi informasi, campur tangan dari negara lain erat kaitannya dalam perkembangan hukum.
Nah bagaimana hubungannya dengan negara lain misalnya investor asing ? Investor asing adalah orang atau
badan dari negara lain yang menaruh dananya dalam suatu bisnis. Upaya Indonesia untuk meningkatkan investasi
dalam negeri dan asing sejalan dengan tujuan pemerintah yang lebih luas yaitu mengurangi ketimpangan sosial dan
mengurangi pengangguran. Cara terbaik untuk mencari investor asing adalah dengan menggunakan media online
internet. Dimana kita bisa mengenalkan Indonesia kepada negara lain melalui media online internet sehingga investor
asing mau menanamkan modalnya. Selain itu juga banyak situs penyedia layanan yang mempertemukan antara
investor dan pengusaha atau bisnis creator.
Sebenarnya ada dampak positif dan negative dari masuknya investor asing ke Indonesia. Dampak positifnya
diantaranya bisa mengurangi penggangguran karena dibukanya lapangan kerja yang baru. Sedangkan dampak
negativenya yaitu bagi investor asing yang masuk ke Indonesia harus mengikuti peraturan yang telah ditentukan,
disini tugas Pemerintah adalah bersikap tegas dalam menyikapi masuknya para investor asing karena bisa kita lihat
sendiri investor asing ini lebih banyak menguasai pasar daripada investor lokal sehingga barang-barang produksi
Indonesia nantinya bisa merosot ke bawah dan yang laku hanya barang-barang dari luar negeri oleh sebab itu
Pemerintah harus mengendalikan keadaan ini agar produk Indonesia tidak banyak yang gulung tikar hanya karena
kalah saing dengan produk asing. Contohnya saja investor yang menanamkan modal untuk membangun sebuah mall
disuatu tempat, pembangunan swalayan yang merajalela.
Dari pemaparan sekilas mengenai investor asing tersebut, ada baiknya kita memperbaiki hukum ekonomi di
Indonesia terlebih dahulu. Indonesia seperti yang kita kenal dengan kolam susunya ternyata belum berhasil
mensejahterahkan rakyatnya, selain itu juga kurangnya sumber daya manusia untuk mengolah dan mengembangkan
sesuatu yang ada menjadi berguna. Sebagai contoh kasus hukum ekonomi yaitu :
Kenaikan BBM, bahan bakar minyak adalah komoditas publik paling berpengaruh. Publik terperangah ketika
harga BBM melonjak naik. Kenaikan harga BBM hingga 30%, Padahal Indonesia salah satu Negara yang memilki
banyak minyak mentah tapi mengapa kita harus mengekspor minyak? Seandainya saja kita memilki sumber daya
manusia yang lebih berkembang dan kreatif mungkin kita tidak perlu mengekspor miyak mentah untuk bahan bakar
minyak. Naiknya harga BBM menyebabkan laju inflasi tidak dapat di bendung. Harga komoditi seperti harga bahan
pokok naik sehingga barang-barang lain pun ikut naik, biaya hidup masyarakat kian membengkak. Pemerintah
seharusnya bisa memikirkan cara lain ketimbang harus menaikan harga BBM yang mencekik masyarakat seperti ini
atau dengan cara metode barter seperti pada negara lain seperti negara singapura dan arab. Negara arab mengirim
minyak ke singapura dengan barter singapura mengisi tangki minyak dengan air untuk dikirim kembali ke arab.
Sekarang mari kita berfikir bagaimana cara membenahi hukum ekonomi di Indonesia ?

Pembentukan Undang-Undang harus dilandasi dengan sistem ekonomi yang terbuka terhadap perkembangan
namun tetap mengacu pada jati diri bangsa.
88

Setiap sektor harus bisa menempatkan diri dan saling bekerja sama untuk membangun perekonomian kearah
yang lebih baik sehingga Indonesia memiliki perekonomian yang kuat, stabil dan lebih maju. Menjalankan hukum
sebagaimana mestinya dan adanya ganjaran yang tegas bagi pelanggarnya sangat diperlukan, hanya tinggal bagaimana
pihak-pihak yang terkait yaitu pemerintah serta masyarakat menanggapi kebijakan yang dibuat untuk mensejahterakan
masyarakat.

Pembangunan dan perbaikan sarana dan prasarana perekonomian harus ditunjang dengan hukum serta
kerjasama yang baik antara pemerintah dan rakyatnya serta kemauan keras untuk berkembang ke arah yang lebih baik.

Pemerintah harus bersikap tegas terhadap para investor asing dengan peraturan yang berlaku agar produk
Indonesia tetap bisa menguasai pasar Indonesia bukan produk luar yang lebih menguasai pangsa pasar Indonesia.

Pemerintah harus lebih memperhatikan para petani di Indonesia karena penghasilan utama Indonesia salah
satunya dibagian pertanian.

Suku Bunga merupakan faktor yang sangat penting dalam menarik investasi karena sebagian besar investasi
biasanya dibiayai dari pinjaman bank. Jika suku bunga pinjaman turun maka akan mendorong investor untuk
meminjam modal dan dengan pinjaman modal tersebut maka ia akan melakukan investasi. Semakin tinggi bunga bank
untuk tabungan maka jumlah uang yang beredar akan menurun dan terjadi penurunan jumlah penerimaan.
Dengan memperbaiki dan membuat hukum yang tegas untuk mengatur perekonomian Negara maka akan
membuat perekonomian menjadi lebih baik dan terarah. Selain itu perbaikan dari segi moral bangsa untuk
menciptakan persatuan bangsa, industri yang berjalan dengan baik dan tidak terjadinya kecurangan akan membuat
kesejahteraan sosial meningkat. Yang paling penting adalah perbaikan dari Pemerintah dan para pejabat hukum yang
bersih, adil dan jujur.

89

PENDAHULUAN
A. Latar Belakang
Narkotika merupakan salah satu zat adiktif yang sangat diperlukan untuk pengobatan dan pelayanan kesehatan, namun
apabila disalah gunakan atau digunakan tidak sesuai dengan standar pengobatan, terlebih jika disertai dengan
peredaran narkotika secara gelap akan menimbulkan akibat yang sangat merugikan perorangan maupun masyarakat
khususnya generasi muda. bahkan dapat menimbulakan bahaya yang lebih besar lagi bagi kehidupan dan nilai-nilai
budaya bangsa yang pada akhirnya akan dapat melemahkan ketahanan nasional.
Dalam usaha untuk menanggulangi masalah penyalahgunaan dan peredaran gelap narkotika pemerintah telah
mengeluarkan UU No 35 tahun 2009. UU tersebut pada dasarnya mengatur narkotika digunakan hanya untuk
kepentingan pelayanan kesehatan dan ilmu pengetahuan. Pelanggaran terhadap peraturan itu diancam dengan pidana
yang tinggi dan berat dengan dimungkinkanya terdakwa divonis maksimal yakni pidana mati selain pidana penjara
dan pidana denda.
Dalam beberapa kasus telah banyak bandar dan pengedar narkotika tertangkap dan mendapatkan sanksi berat berupa
pidana mati. Seperti kasus Rodrigo Gularter dan Andrew Chan terpidana mati asal Brazil dan Australia yang akan di
eksekusi mati. Dalam putusan Mahkamah Konstitusi dijelaskan bahwa penerapan sanksi pidana mati bagi para pelaku
tindak pidana narkotika tidak melanggar hak asasi manusia lain, yang memeberikan dampak terhadap kehancuran
generasi muda di masa yang akan datang.
Namun dalam melaksanakan hukuman mati di Indonesia begitu banyak masyarakat yang mendukung kebijakan
tersebut, akan tetapi tidak sedikit yang menolak hukuman tersebut. Maka dari itu makalah ini akan membahas tentang
perspektif hukum pidana Islam dan hukum positif, serta pro dan kontra hukuman mati terhadap pelaku narkoba.
B. Rumusan Masalah
Dari penjelasan latar belakang di atas, terdapat beberapa rumusan masalah yaitu sebagai berikut:
1. Apa pengertian narkoba?
2. Bagaiman hukuman mati pelaku narkoba dalam perspektif hukum pidana Islam dan hukum Positif?
3. Bagaimana pro kontra hukuman mati bagi pelaku narkoba?
C. Tujuan Penulisan
1.
Untuk mengetahui pengertian narkoba.
2.
Untuk menegetahui perspektif hukum pidana islam dan hukum positif terhadap hukuman mati pelaku narkoba.
3.
Untuk mengetahui alasan pro kontra terhadap hukuman mati pelaku narkoba.
BAB II
PEMBAHASAN
A. Pengertian Narkoba
Narkotika dan obat-obatan terlarang (NARKOBA) atau narkotik, psikotropika, dan zat aditif (NAPZA) adalah bahan
yang dapat mempengaruhi kondisi kejiwaan psikologi seseorang (pikiran, perasaan dan perilaku) serta dapat
menimbulkan ketergantungan fisik dan psikologi.
Narkotika menurut UU RI No 22/1997, Narkotika yaitu zat atau obat yang berasal dari tanaman atau bukan tanaman
baik sintetis maupun semisintetis yang dapat menyebabkan penurunan atau perubahan kesadaran, hilangnya rasa,
mengurangi sampai menghilangkan rasa nyeri dan dapat menimbulkan ketergantungan. Menurut Kurniawan (2008)
narkoba adalah zat kimia yang dapat mengubah keadaan psikologi seperti perasaan, pikiran, suasana hati serta
perilaku jika masuk ke dalam tubuh manusia bisa dengan cara dimakan, diminum, dihirup, suntik, intravena dan lainlain sebaginya.11[1]
Dari penjelasan di atas sangat jlas bahwa narkoba merupakan zat imia yang dapat merubah manusia baik dari segi
perilaku maupun psikologi karena zat yang dimiliki narkoba sangat berbahaya bagi kesehatan manusia serta
menimbukan kecandungan. Berikut bahaya narkoba berdasarkan efeknya yaitu sebagai berikut:
1. Depresan dapat menekan/memperlambat sistem saraf pusat dan mengurangi kegiatan fungsi tubuh, sehingga dapat
membuat orang merasa santai dan tenang, kurang tegangan dan menyadari pristiwa sekitarnya bahkan tidak sadarkan
diri.
2.
Halusinogen dapat menyebabkan jika di komsumsi dalam sekian dosis maka seseorang menjadi
berhalusinasi/mengubah pikiran dengan melihat suatu hal yang sebenarnya tidak nyata atapun tidak ada. jenis obat ini
dapat meningkatkan kesadaran seseorang dari pandengaran, rasa dan sentuhan.
11[1] belajarpsikologi.com/pengertian-narkoba/
90

3. Stimulan dapat menyebabkan organ tubuh pada sistem saraf pusat seperti otak dan jantung bekerja lebih cepat dari
biasanya dan dapat membantu orang lebih merasa waspada serta meningkatkan kinerja fisik sehingga cenderung
membuat seseorang lebih senang dan gembira serta bertenaga untuk sementara waktu.
4. Adiktif menyebabkan seseorang cenderug bersifat pasif yang apabila seseorang yang sudah mengkomsumsinya
biasanya ingin dan ingin lagi karena secara tidak langsung jenis narkoba ini memutuskan syaraf-syaraf dalam otak.
Dikalangan generasi muda penyalahgunaan narkoba semakin meningkat. Maraknya penyimpangan tersebut dapat
memberikan dampak dan bahaya akan berlangsungnya kehidupan bangsa dikemudian hari. Pemuda yang diharapkan
menjadi penerus bangsa dan negara semakin hari menjadi rapuh yang disebabkan oleh narkotika dan obat terlarang
tersebut. Sehingga pemuda tersebut tidak bisa berpikir jernih untuk kedepanya. Sebagai akibatnya, bagi generasi muda
harapan bangsa yang cerdas dan tangguh hanya menjadi tinggal kenangan.
B. Pengedar Narkoba
Menurut Lilik Muliyadi, pengedar Narkotika/Psikotropika adalah orang yang melakukan kegiatan penyaluran dan
pernyerahan narkotika/psikotropika, pengedar tersebut termasuk dimensi penjual, pembeli untuk diedarkan,
mengangkut, menyimpan, menguasai, menyediakan, melakukan perbuatan mengkspor dan mengimpor
Narkotika/Psikotropika.12[2]
Pengedar narkoba merupakan musuh utama dalam pemberantasan narkoba di Indonesia, karena dari pengedar inilah
narkoba sangat mudah di dapatkan dengan cara melakukan transaksi secara secara sembunyi-sembunyi. Akhir-akhir
ini masyarakat Indonesia dihebohkan dengan hukuman mati terhadap enam orang pengedar narkoba di lapas Nusa
kambangan. Begitu banyak negara-negara lain yang mengecam kebicakan pemrintah Indonesia dalam eksekusi mati
tersebut, bahkan pemerintah Brazil dan Australia telah menarik Dubes mereka sebagai bentuk protes terhadap
pemerintah Indonesia yang akan mengeksekusi mati terpidana narkoba yang melibatkan warga negara mereka.
Apapun alasan dan tawaran pemerintah Brazil dan Australia agar warganya tidak dieksekusi pemerintah Indonsia
harus konsisten dalam keputusan tersebut. Karena hukuman mati bagi pengedar narkoba merupakan salah satu cara
yang paling efektif dalam pemberantasan narkoba di Indonesia. Berikut hukuman mati pelaku narkoba dalam
perspektif Hukum Pidana Islam dan Hukum Positif:
1. Perspektif Hukum Pidana Islam
Sisitem Islam sebagai satu kesatuan akan efektif mengatasi masalah kejahatan masyarakat. Islam mewajibkan negara
untuk tanpa henti membina keimanan dan ketakwaan rakyat. Keimanan dan ketakwaan itu akan menjadi faktor
pencegah sangat efektif dalam diri seseorang yang bisa mencegah dia dari melakukan kejahatan apapun bentuknya.
jika dengan semua itu masih ada yang melakukan tindak kriminal, maka sistem sanksi (uqubat) Islam akan menjadi
palang pintu terahir yang efektif memberi efek jerah yang bisa mencegah terjadinya kejahatan. Dalam kasus narkoba
Islam dengan tegas mengharamkan narkoba. Orang yang mengkomsumsi narkoba berarti telah melakukan
kemaksiatan atau tindakan kriminal. Ia bisa dijatuhi sanksi tazir yang jenis dan kadarnya diserahkan kepada khalifah
atau qadhi. Bagi pengedar narkoba sanksi tazirnya lebih berat, bisa sampai hukuman mati dengan memperhatikan
tingkat dan dampak kejahatan itu bagu masyarakat.
Dalam kasus narkoba ini Majelis Ulama Kibar telah mempelajari dan membahas dampak buruk tersebarnya obat
terlarang dan menetapkan bahwa hukuman bagi pengedar narkoba adalah sebagai berikut: 13[3]
Pertama: Bandar narkoba adalah hukumanya dibunuh, karena perbuatanya menjadi bandar pengedar narkoba,
menyebarkan obat terlarang ke dalam negara menyababkan kerusakan yang besar tidak hanya bagi bandarnya namun
juga menjadi sebab masalah yang serius bagi seluruh umat. Termasuk bandar narkoba adalah orang yang
mendatangakan obat terlarang ini dari luar. kemudian didistribusikan ke penjual langsung.
Kedua: untuk pengedar obat terlarang keputusan ulama kibar untuk pelaku telah diterbitkan pada keputusan no. 85,
tertanggal 11 Dzulqaidah 1401 di sana dinyatakan: orang yang mengedarkan narkoba, baik dengan membuat sendiri
atau impor dari luar, baik dengan jual beli, atau diberikan dengan cuma-cuma atau bentuk penyebaran lainya, maka
untuk pelanggaran yang dilakukan pertama, dia dihukum tazir yang keras, baik dipenjara, dihukum cambuk atau
disita hartanya atau diberikan semua hukuman tersebut sesuai keputusan mahkamah. Kemudian jika dia mengedarkan
lagi, dia diberi hukuman yang bisa menghindarkan masyarakat dari kejahatanya meskipun harus dengan hukuman
mati. Karena perbuatanya ini, dia termasuk orang yang merusak di muka bumi dan potensi berbuat maksiat telah
melekat dalam dirinya.
12[2] m.hukumonline.com/klinik/detail/lt5141cd01a7dac/pemilik-puntung-ganja-=-pengedarganja
13[3] www.konsultasisyariah.com./hukuman-mati-untuk-pengedar-narkoba -itulah-hukumislam/
91

Para ulama menegaskan bahwa hukuman mati termasuk bentuk hukuman tazir yang dibolehkan. Syaikhul Islam Ibn
Taimiyah mengatakan: Manusia yang kerusakanya tidak bisa dihentikan kecuali dengan dibunuh boleh dihukum mati
sebagaimana hukuman mati untuk pemberontak, menyimpang dari persatuan kaum muslimun, atau gembong
perbuatan bidah dalam agama. Nabi Muhammad SAW. Pernah memerintahkan untuk membunuh orang yang
sengaja berdusta atas nama beliau (dengan membuat hadis palsu). Ibnu Dailam pernah bertanya kepada beliau tentang
orang yang tidak mau berhenti dari minum khamr. Beliau menjawab: siapa yang tidak mau berhenti dari minuman
khamr, bunuhlah.
Ketiga: Majelis Ulama Kibar berpendapat bahwa seblum menjatuhkan dua hukuman di atas hendaknya dilakukan
proses pengadilan yang sempurna, untuk membuktikan kebenaran kasus, sesuai dengan proses mahkamah Syariah
dan badan resserse kriminal. Sebagai bentuk kehati-hatian dalam memberikan hukuman mati kepada seseorang.
Keempat: hendaknya hukuman ini diumumkan melalui media masa sebelum diterapkan sebagai bentuk peringatan
bagi masyarakat.
Keputusan Majelis Ulama Kibar ini spendapat dengan Majelis Ulama Indonesia yang mendukung pemerintah
Indonesia agar mengeksekusi terpidana mati kasus narkoba. MUI juga berpendapat bahwa generasi Indonesia saat ini
harus diselamatkan dari bahaya narkoba yang bisa merusak moral bangsa. Sehingga mereka sangat mendukung
kebijakan pemerintah dalam menghukum mati bandar narkoba.
2. Perspektif Hukum Positif
Seperti yang tela h dijelaskan di atas bahwa pengedar narkoba adalah musuh utama yang harus dihapuskan di
Indonesia karena mereka transaksi narkoba menjadi mudah masuk di Indonesia. landasan hukum yang digunakan
untuk menghukum mati pengedar narkoba adalah UU No 35 tahun 2009 tentang narkotika. Dalam UU ini ada 6 pasal
yang mengatur hukuman pidana mati yaitu pasal 113,114,116, 118, 119 dan 121: 14[4]
a. Pasal 113
Ayat (1) setiap orang yang tanpa hak atau melawan hukum memperoduksi, mengimpor, mengikspor, atau menyalurkan
narkotika golongan I, dipidana dengan pidana penjara paling singkat 5 tahun dan paling lama 15 tahun dan pidana
denda paling sedikit Rp. 1.000.000.000,00 (satu miliar rupiah) dan paling banyak Rp. 10.000.000.000,00 (sepuluh
miliar rupiah).
Ayat (2) dalam hal perbuatan memproduksi, mengimpor, mengekspor, atau menyalurkan narkotika golongan I
sebagaimana dimaksud pada ayat (1) dalam bentuk tanaman beratnya melebihi 1 (satu) kilogram atau beratnya
melebihi 5 (lima) gram, pelaku dipidana dengan pidana mati, pidana penjara seumur hidup, atau pidana penjara paling
singkat 5 (lima) tahun dan paling lama 20 (dua puluh) tahun dan pidana denda maksimum sebagaimana dimaksud
pada ayat (1) ditambah 1/3 (sepertiga).
b. Pasal 114
Ayat (1) Setiap orang yang tanpa hak atau melawan hukum menawarkan untuk dijual, menjual, membeli, menerima,
menjadi perantara dalam jual beli, menukar, atau menyerahkan narkotika golongan I dipidana dengan pidana penjara
seumur hidup atau pidana penjara paling singkat 5 (lima) tahun dan paling lama 20 (dua puluh) tahun dan pidana
denda paling sedikit Rp. 1.000.000.000,00 (satu miliar rupiah) dan paling banyak Rp. 10.000.000.000,00 (sepuluh
miliar rupiah).
Ayat (2) Dalam hal perbuatan menawarkan untuk dijual, menjual, membeli, menjadi perantara dalam jual beli,
menukar, menyerahkan atau menerima narkotika golongan I sebagaimana dimaaksud pada ayat (1) yang dalam bentuk
tanaman beratnya melebihi 1 (satu) kilogram atau melebihi 5 (lima) batang pohon atau dalam bentuk bukan tanaman
beratnya 5 (lima) gram, pelaku dipidana dengan pidana mati, pidana penjara seumur hidup, atau pidana penjara paling
singkat 6 (enam) tahun dan paling lama 20 (dua puluh) tahun dan pidana denda maksimum sebagaimana dimaksud
pada ayat (1) ditambah 1/3 (sepertiga).
c. Pasal 116
Ayat (1) Setiap orang yang tanpa hak atau melawan hukum menggunakan narkotika golongan I terhadap orang lain
atau memberikan narkotika golingan I untuk digunakan orang lain dengan pidana prnjara paling singkat 5 (lima) tahun
dan paling lama 15 (lima belas) tahun dan pidana denda paling sedikit Rp. 1.000.000.000,00 (satu milar rupiah) dan
paling banyak Rp. 10.000.000.000,00 (sepuluh miliar rupiah).
Ayat (2) Dalam hal penggunaan narkotika terhadap orang lain atau pemberian narkotika golongan I untuk digunakan
orang lain sebagaimana yang dimaksud pada ayat (1) mengakibatkan orang lain mati , atau cacat permanen, pelaku
dipidana dengan pidana mati, pidana penjara seumur hidup, atau penjara paling singkat 5 (lima) tahun dan paling lama
20 (dua puluh) tahun dan pidana denda maksimum sebagaimana dimaksud pada ayat (1) ditambah 1/3 (sepertiga).
14[4] hukumpidana.bphn.go.id/kuhpoutuu/undang-undang-nomor-35-tahun-2009-tentangnarkotika/
92

d. Pasal 118
Ayat (1) Setiap orang yang tanpa hak atau melawan hukum memproduksi, mengimpor, mengekspor, atau menyalurkan
Narkotika golongan II, dipidana dengan pidana penjara paling singkat 4 (empat) tahun dan paling lama 12 (dua belas)
tahun dan pidana denda paling sedikit Rp. 800.000.000,00 (delapan ratus juta rupiah) dan paling banyak Rp.
8.000.000.000,00 (delapan miliar rupiah).
Ayat (2) Dalam hal perbuatan memproduksi, mengimpor, mengekspor, atau menyalurkan narkotika golongan II
sebagaimana dimaksud pada ayat (1) beratnya melebihi 5 (lima) gram, pelaku dipidana dengan pidana mati, pidana
penjara seumur hidup, atau pidana penjara paling singkat 5 (lima) tahun dan paling lama 20 (dua puluh) tahun dan
pidana denda maksimum sebagaimana dimaksud pada ayat (1) ditambah 1/3 (sepertiga).
e. Pasal 119
Ayat (1) Setiap orang yang tanpa hak atau melawan hukum menawarkan untuk dijual, menjual, membeli, menerima,
menjadi perantara, dalam jual beli, menukar, atau menyerahkan Narkotika golongan II dipidana dengan pidana penjara
paling singkat 4 (empat) tahun dan paling lama 12 (dua belas) tahun dan pidana denda paling sedikit Rp.
800.000.000,00 (delapan ratus juta rupiah) dan paling banyak Rp. 8.000.000.000,00 (delapan miliar rupiah).
Ayat (2) dalam hal perbuatan menawarkan untuk dijual, menjual, membeli, menerima, menjadi perantara dalam jual
beli, menukar, atau menyerahkan Narkotika golongan II sebagaimana dimaksud pada ayat (1) beratnya melebihi 5
(lima) gram, pelaku dipidana dengan pidana mati, pidana penjara seumur hidup, atau pidana penjara paling singkat 5
(lima) tahun dan paling lama 20 (dua puluh) tahun dan pidana denda maksimum sebagaimana dimaksud pada ayat (1)
ditambah 1/3 (sepertiga).
f. Pasal 121
Ayat (1) Setiap orang yang tanpa hak atau melawan hukum menggunakkan narkotika golongan II terhadap orang lain
atau memberikan narkotika golongan II untuk digunakan orang lain, dipidana dengan pidana penjara paling singkat 4
(empat) tahun dan paling lama 12 (dua belas) tahun dan pidana denda paling sedikit Rp. 800.000.000,00 (delapan
ratus juta rupiah) dan paling bayak Rp. 8.000.000.000,00 (delapan miliar rupiah).
Ayat (2) Dalam hal penggunaan narkotika terhadap orang lain atau pemberian narkotika golongan II untuk digunakan
orang lain sebagai mana dimaksud pada ayat (1) mengakbatkan orang lain mati atau caacat permanen, pelaku dipidana
dengan pidan mati, pidana penjara seumur hidup atau pidana penjara saling singkat 5 (lima) tahun dan paling lama 20
(dua puluh) tahun dan pidana denda maksimum sebagaimana dimaksud pada ayat (1) ditambah 1/3 (sepertiga).
C. Pro Kontra Hukuman Mati
Hukuman Mati terhadap pelaku kejaahatan narkoba kebali menjadi perdebatan publik. Kontroversi semakin tajam
ketika pemerintah RI akan melakukan eksekusi mati terpidana kasus narkoba yang melibatkan warga negara Brazil
dan Australia. Begitu banyak masyarakat Indonesia yang mendukung kebijakan pemerinta RI melakukan eksekusi
mati terhadap pengedar narkoba, namun tidak sedikit yang menolak hukuman mati dengan alasan melanggar HAM.
Berikut beberapa argumen Pro dan Kontra hukuman mati terhadap pengedar narkoba:
1. Argumen Pro
Kelompok retensionis mengajukan argumen yang mendukung hukuman mati. Alasan utama adalah hukuman mati
memberi efek cegah terhadap penjahat potensial kejahatan narkoba. bila menyadari akan dihukum mati, penjahat
demikian setidaknya akan berpikir seribu kali sebelum melakukan kejahatan narkoba.
Fakta membuktikan bila dibandingkan dengan negara-negara yang maju yang tidak menerapkan hukum mati, Arab
Saudi yang memberlakukan hukum Islam dan hukuman mati memiliki tingkat kejahatan yang rendah. Kaum
retensionis juga menolak pendapat kelompok abolisionis yang mengatakan hukuman mati terhadap pengedar narkoba
bertentangtan dengan kemanusiaan. Sebaliknya mereka berpendapat justru kejahatan narkoba merupakan kejahatan
luar biasa yang menistakan prikemanusiaaan. Kejahatan narkoba merupakan kejahatan kemanusiaan yang merenggut
hak hidup tidak hanya satu orang melainkan banyak manusia. Kelompok retensionis berpendapat hukuman mati
terhadap penjahat narkoba tidak melanggar konstitusi sebagaimana telah dinyatakan oleh MK. Di Amerika Serikat
pun, hukuman mati tidak bertentangan dengan konstitusi.
Dalam keadaan darurat narkoba seperti sekarang ini, ketika kejahatan narkoba telah merusak generasi muda dan
merampas hak hidup banyak manusia di Indonesia. Jadi sangat adil jika hukuman mati juga diterapkan untuk memberi
peringatan keras bagi para penjahat narkoba. Hukuman mati hanya dijatuhkan pada bentuk kejahatan narkoba yang
paling jahat seperti memproduksi dan pengedar narkoba.
2. Argumen Kontra
Kaum Abolisionis mendasarkan argumennya pada beberapa alasan. Pertama, hukuman mati merupakan bentuk
hukuman yang merendahkan martabat manusia dan bertentangan dengan hak asasi manusia. Atas dasar argumen inilah
kemudian banyak negara yang menghapuskan hukuman mati dalam sistem peradilan pidananya. Sampai sekarang

93

sudah 97 negara yang menghapuskan hukuman mati, negara-negara Uni Eropa dilarang menerapkan hukuman mati
berdasarkan pasal 2 Charter of Fundamental Rights of the European Union tahun 2000. 15[5]
Kelompok abolisionis juga membantah alasan kaum retensionis yang meyakini hukuman mati akan menimbulkan efek
jera dan karena itu akan menurunkan tingkat kejahatan khususnya kejahatan terkait narkoba. Belum ada bukti ilmiah
konklusif yang membuktikan korelasi positif antara hukuman mati dan penurunan tingkat kejahatan narkoba.
BAB III
KESIMPULAN
Narkotika dan obat-obatan terlarang (NARKOBA) atau narkotik, psikotropika, dan zat aditif (NAPZA) adalah bahan
yang dapat mempengaruhi kondisi kejiwaan psikologi seseorang (pikiran, perasaan dan perilaku) serta dapat
menimbulkan ketergantungan fisik dan psikologi, sebagaimana yang telah di atur dalam UU RI No 22/1997. Dalam
Islam Narkoba sangat di haramkan karena mempunyai dampak buruk bagi kesehatan dan merusak ahlak seseorang.
Di dalam Alquran memang tidak ada nash yang menjelaskan keharaman narkoba, akan tetapi ulama sepakat bahwa
sesuatu yang dapat memabukkan seseorang maka hukumnya haram. Islam juga sangat mendukung dengan
diberlakukannya hukuman mati terhadap pengedar narkoba, karena dari pengedar inilah narkoba mudah didapatkan
sehingga dapat merusak moral dan generasi penerus bangsa.
Di dalam UU No 35 tahun 2009 terdapat beberapa pasal yang mengatur tentang hukuman para pelaku narkoba
dengan maksimal hukuman mati. jadi tidak ada alasan bagi pemerintah untuk tidak mengeksekusi mati para pengedar
narkoba karena dari segi hukum positif sudah diatur sanksinya dan hukum Islam pun sangat mendukung hal tersebut.
Pengedar narkoba termasuk orang yang membuat kerusakan di muka bumi. Karenanya hukuman bagi mereka yang
membuat kerusakan di muka bumi adalah salah satu dari empat hukuman sesuai kebijakan pemerintah Islam.
Sebagaimana firman Allah Taala,







Sesungguhnya, hukuman terhadap orang-orang yang memerangi Allah dan Rasul-Nya dan membuat kerusakan di
muka bumi, adalah mereka [1] dibunuh atau [2] disalib, [3] dipotong tangan dan kaki mereka dengan bersilang, [4]
atau dibuang (keluar daerah). Yang demikian itu, (sebagai) suatu penghinaan untuk mereka di dunia, dan di akhirat
mereka mendapat siksaan yang besar. (QS. Al-Maidah: 33)
Akan tetapi melihat besarnya kerusakan yang ditimbulkan oleh pengedar narkoba maka hukuman yang dipilih oleh
para ulama adalah hukuman mati. Demikian juga hukuman yang ditetapkan oleh pemerintah Islam adalah hukuman
mati (ini disebut tazir yaitu hukuman yang tidak ditetapkan oleh syariat, namun hasil dari penetapan pemerintah
Islam. Jika ditetapkan oleh syariat disebut hudud, misalnya hukuman potong tangan.)
Berikut fatwa Haiah Kibar Ulama (Kumpulan Ulama Besar Kerajaan Saudi Arabia) mengenai hukuman bagi
pengedar/bandar narkoba.
138
Keputusan Haiah Kibar Ulama no. 138 tentang Hukum Penyelundup dan Pengedar Narkoba
Alhamdulillah, segala puji hanya milik Allah, Rabb semesta alam. Semoga balasan yang baik diperoleh oleh orang
yang bertakwa. Shalawat dan salam tercurah kepada nabi dan rasul terbaik, nabi kita Muhammad, serta kepada para
keluarganya, dan semua sahabatnya. Amma badu:
Majelis Kibar Ulama di pertemuan yang ke-29, yang diadakan di kota Riyadh, tanggal 9 Jumada Tsaniah 1407 H
sampai tanggal 20 Jumadi Tsaniah 1407 H telah mempelajari telegram yang dikirim oleh Pengabdi Dua Tanah Suci,
Raja Fahd bin Abdul Aziz, dengan nomor S: 8033, tertanggal 11 Jumada Tsaniah 1407 H. Dalam surat itu dinyatakan:
15[5] setkab.go.id/pro-kontra-hukuman-mati-bagi-pelaku-kejahatan-narkoba/
94

Melihat bahwa narkoba memberikan dampak yang sangat buruk, sementara kita perhatikan saat ini mulai banyak
tersebar serta menimbang tuntutan kemaslahatan bagi umat, maka penting untuk diputuskan hukuman yang membuat
jera bagi orang yang berusaha menyebarkan dan memasarkannya, baik ekspor atau impor. Karena itu, kami memohon
kepada anda sekalian untuk membahas masalah ini di sidang Majelis Kibar Ulama dengan segera. Kami akan
menyesuaikan dengan apa yang diputuskan.
Majelis Kibar ulama telah mempelajari masalah ini, dan mendiskusikan dari berbagai macam sisi pada beberapa kali
pertemuan. Setelah diskusi yang panjang tentang dampak buruk tersebarnya obat terlarang, maka Majelis Kibar Ulama
menetapkan:
Pertama: Bagi penyelundup/ bandar, hukumannya adalah dibunuh karena perbuatanya menjadi penyelundup/ bandar
pengedaran narkoba, menyebarkanya obat terlarang ke dalam negara, menyebabkan kerusakan yang besar, tidak hanya
bagi bandarnya, namun menjadi sebab masalah yang serius bagi seluruh umat. Termasuk bandar narkoba adalah orang
yang mendatangkan obat terlarang ini dari luar, kemudian ia distribusikan ke penjual secara langsung.
Kedua: Untuk pengedar obat terlarang, keputusan Majelis Kibar Ulama untuk pelaku telah diterbitkan pada keputusan
no. 85, tertanggal 11 Dzulqadah 1401. Di sana dinyatakan:
Orang yang mengedarkan narkoba, baik dengan membuat sendiri atau impor dari luar, baik dengan jual-beli, atau
diberikan cuma-cuma, atau bentuk penyebaran lainnya, maka untuk pelanggaran yang dilakukan pertama, dia
dihukum tazir yang keras, baik dipenjara, dihukum cambuk, atau disita hartanya, atau diberikan semua hukuman
tersebut, sesuai keputusan Mahkamah. Kemudian jika mengedarkan lagi, dia diberi hukuman yang bisa
menghindarkan masyarakat dari kejahatannya, meskipun harus dengan hukuman mati. Karena perbuatannya ini, dia
termasuk orang yang merusak di muka bumi dan potensi berbuat maksiat telah melekat dalam dirinya.
Para ulama menegaskan bahwa hukuman bunuh termasuk bentuk hukuman tazir yang dibolehkan. Syaikhul Islam
Ibnu Taimiyah mengatakan, Manusia yang kerusakannya tidak bisa dihentikan kecuali dengan dibunuh boleh
dihukum mati, sebagaimana hukum bunuh untuk pemberontak, menyimpang dari persatuan kaum muslimin, atau
gembong perbuatan bidah dalam agama. Nabi shallallahu alaihi wa sallam pernah memerintahkan untuk membunuh
orang yang sengaja berdusta atas nama beliau (dengan membuat hadis palsu)
Ibnu Dailami pernah bertanya kepada beliau tentang orang yang tidak mau berhenti dari minum khamr. Beliau
menjawab, Siapa yang tidak mau berhenti dari minum khamr, bunuhlah. Dalam karya beliau yang lain, Syaikhul
Islam mengatakan tentang alasan bolehnya tazir dengan membunuh, Orang yang membuat kerusakan seperti ini
seperti orang yang menyerang kita. Jika orang yang menyerang ini tidak bisa dihindarkan kecuali dengan dibunuh
maka dia dibunuh.
Ketiga: Majelis Kibar Ulama berpendapat bahwa sebelum menjatuhkan dua hukuman di atas, hendaknya dilakukan
proses pengadilan yang sempurna, untuk membuktikan kebenaran kasus, sesuai dengan proses mahkamah syariyah
dan badan kriminal, sebagai bentuk kehati-hatian dalam memberikan hukuman mati kepada seseorang.
Keempat: hendaknya hukuman ini diumumkan melalui media massa, sebelum diterapkan, sebagai bentuk peringatan
bagi masyarakat.[1]
Demikian juga fatwa ulama besar yaitu Syaikh Prof. Abdullah Al Jibrin rahimahullah, beliau berkata mengenai hal
ini:
Hukuman bagi mereka di dunia adalah hukuman yang bisa membuat mereka jera. Untuk peminum khamr syariat
Islam menetapkan hukuman cambuk sebanyak 40 kali. Tatkala banyak orang tidak lagi merasa kapok jika hanya
dicambuk sebanyak itu, Umar bin Al-Khatthab memberikan tambahan hukuman sehingga menjadi 80 kali cambukan.
Dalam sebuah hadits yang shahih disebutkan, Jika ada orang yang minum khamr maka cambuklah. Jika dia
95

tertangkap untuk kedua kalinya maka cambuklah. Jika tertangkap untuk ketiga kalinya maka cambuklah. Jika dia
tertangkap untuk keempat kalinya dalam kasus minum khamar maka silahkan dihukum mati. Hadits ini sahih dan
memiliki beberapa sanad.
Sedangkan untuk hukuman di akherat, Nabi shallallahu alaihi wa sallam mengatakan, Siapa saja yang meminum
khamr di dunia maka dia tidak akan meminumnya di akherat. Nabi shallallahu alaihi wa sallam juga memberitakan
bahwa siapa saja yang berulang kali meminum khamar maka Allah mewajibkan dirinya sendiri untuk memberi
minuman berupa thinatul khabal untuk orang tersebut. Thinatul khabal adalah nanah penduduk neraka. Nabi
shallallahu alaihi wa sallam juga bersabda, Tidaklah beriman orang yang minum khamr pada saat dia minum
khamr.
Tidaklah diragukan bahwa narkoba dan rokok itu lebih berbahaya dibandingkan dengan khamr. Oleh karena itu,
hukuman terkait dengan narkoba itu jauh lebih keras. Dosa yang terkait dengannya juga lebih besar. Para ulama ahli
sunah telah membawakan bahwa pengedar narkoba itu berhak mendapatkan hukuman mati. Dengan pertimbangan
bahwa orang tersebut termasuk orang yang merusak di muka bumi. Sehingga bahaya yang mengancam agama dari
orang tersebut lebih gawat dibandingkan bahaya racun bagi badan.[2]
Wallahu waliyyut taufiq.
Hukuman Mati Bagi Pengedar Narkoba
Januari 26, 2015
Pengedar narkoba termasuk orang yang membuat kerusakan di muka bumi. Karenanya hukuman bagi mereka yang
membuat kerusakan di muka bumi adalah salah satu dari empat hukuman sesuai kebijakan pemerintah Islam.
Sebagaimana firman Allah Taala,







Sesungguhnya, hukuman terhadap orang-orang yang memerangi Allah dan Rasul-Nya dan membuat kerusakan di
muka bumi, adalah mereka [1] dibunuh atau [2] disalib, [3] dipotong tangan dan kaki mereka dengan bersilang, [4]
atau dibuang (keluar daerah). Yang demikian itu, (sebagai) suatu penghinaan untuk mereka di dunia, dan di akhirat
mereka mendapat siksaan yang besar. (QS. Al-Maidah: 33)
Akan tetapi melihat besarnya kerusakan yang ditimbulkan oleh pengedar narkoba maka hukuman yang dipilih oleh
para ulama adalah hukuman mati. Demikian juga hukuman yang ditetapkan oleh pemerintah Islam adalah hukuman
mati (ini disebut tazir yaitu hukuman yang tidak ditetapkan oleh syariat, namun hasil dari penetapan pemerintah
Islam. Jika ditetapkan oleh syariat disebut hudud, misalnya hukuman potong tangan.)
Berikut fatwa Haiah Kibar Ulama (Kumpulan Ulama Besar Kerajaan Saudi Arabia) mengenai hukuman bagi
pengedar/bandar narkoba.
138
Keputusan Haiah Kibar Ulama no. 138 tentang Hukum Penyelundup dan Pengedar Narkoba
Alhamdulillah, segala puji hanya milik Allah, Rabb semesta alam. Semoga balasan yang baik diperoleh oleh orang
yang bertakwa. Shalawat dan salam tercurah kepada nabi dan rasul terbaik, nabi kita Muhammad, serta kepada para
keluarganya, dan semua sahabatnya. Amma badu:

96

Majelis Kibar Ulama di pertemuan yang ke-29, yang diadakan di kota Riyadh, tanggal 9 Jumada Tsaniah 1407 H
sampai tanggal 20 Jumadi Tsaniah 1407 H telah mempelajari telegram yang dikirim oleh Pengabdi Dua Tanah Suci,
Raja Fahd bin Abdul Aziz, dengan nomor S: 8033, tertanggal 11 Jumada Tsaniah 1407 H. Dalam surat itu dinyatakan:
Melihat bahwa narkoba memberikan dampak yang sangat buruk, sementara kita perhatikan saat ini mulai banyak
tersebar serta menimbang tuntutan kemaslahatan bagi umat, maka penting untuk diputuskan hukuman yang membuat
jera bagi orang yang berusaha menyebarkan dan memasarkannya, baik ekspor atau impor. Karena itu, kami memohon
kepada anda sekalian untuk membahas masalah ini di sidang Majelis Kibar Ulama dengan segera. Kami akan
menyesuaikan dengan apa yang diputuskan.
Majelis Kibar ulama telah mempelajari masalah ini, dan mendiskusikan dari berbagai macam sisi pada beberapa kali
pertemuan. Setelah diskusi yang panjang tentang dampak buruk tersebarnya obat terlarang, maka Majelis Kibar Ulama
menetapkan:
Pertama: Bagi penyelundup/ bandar, hukumannya adalah dibunuh karena perbuatanya menjadi penyelundup/ bandar
pengedaran narkoba, menyebarkanya obat terlarang ke dalam negara, menyebabkan kerusakan yang besar, tidak hanya
bagi bandarnya, namun menjadi sebab masalah yang serius bagi seluruh umat. Termasuk bandar narkoba adalah orang
yang mendatangkan obat terlarang ini dari luar, kemudian ia distribusikan ke penjual secara langsung.
Kedua: Untuk pengedar obat terlarang, keputusan Majelis Kibar Ulama untuk pelaku telah diterbitkan pada keputusan
no. 85, tertanggal 11 Dzulqadah 1401. Di sana dinyatakan:
Orang yang mengedarkan narkoba, baik dengan membuat sendiri atau impor dari luar, baik dengan jual-beli, atau
diberikan cuma-cuma, atau bentuk penyebaran lainnya, maka untuk pelanggaran yang dilakukan pertama, dia
dihukum tazir yang keras, baik dipenjara, dihukum cambuk, atau disita hartanya, atau diberikan semua hukuman
tersebut, sesuai keputusan Mahkamah. Kemudian jika mengedarkan lagi, dia diberi hukuman yang bisa
menghindarkan masyarakat dari kejahatannya, meskipun harus dengan hukuman mati. Karena perbuatannya ini, dia
termasuk orang yang merusak di muka bumi dan potensi berbuat maksiat telah melekat dalam dirinya.
Para ulama menegaskan bahwa hukuman bunuh termasuk bentuk hukuman tazir yang dibolehkan. Syaikhul Islam
Ibnu Taimiyah mengatakan, Manusia yang kerusakannya tidak bisa dihentikan kecuali dengan dibunuh boleh
dihukum mati, sebagaimana hukum bunuh untuk pemberontak, menyimpang dari persatuan kaum muslimin, atau
gembong perbuatan bidah dalam agama. Nabi shallallahu alaihi wa sallam pernah memerintahkan untuk membunuh
orang yang sengaja berdusta atas nama beliau (dengan membuat hadis palsu)
Ibnu Dailami pernah bertanya kepada beliau tentang orang yang tidak mau berhenti dari minum khamr. Beliau
menjawab, Siapa yang tidak mau berhenti dari minum khamr, bunuhlah. Dalam karya beliau yang lain, Syaikhul
Islam mengatakan tentang alasan bolehnya tazir dengan membunuh, Orang yang membuat kerusakan seperti ini
seperti orang yang menyerang kita. Jika orang yang menyerang ini tidak bisa dihindarkan kecuali dengan dibunuh
maka dia dibunuh.
Ketiga: Majelis Kibar Ulama berpendapat bahwa sebelum menjatuhkan dua hukuman di atas, hendaknya dilakukan
proses pengadilan yang sempurna, untuk membuktikan kebenaran kasus, sesuai dengan proses mahkamah syariyah
dan badan kriminal, sebagai bentuk kehati-hatian dalam memberikan hukuman mati kepada seseorang.
Keempat: hendaknya hukuman ini diumumkan melalui media massa, sebelum diterapkan, sebagai bentuk peringatan
bagi masyarakat.[1]
Demikian juga fatwa ulama besar yaitu Syaikh Prof. Abdullah Al Jibrin rahimahullah, beliau berkata mengenai hal
ini:
97

Hukuman bagi mereka di dunia adalah hukuman yang bisa membuat mereka jera. Untuk peminum khamr syariat
Islam menetapkan hukuman cambuk sebanyak 40 kali. Tatkala banyak orang tidak lagi merasa kapok jika hanya
dicambuk sebanyak itu, Umar bin Al-Khatthab memberikan tambahan hukuman sehingga menjadi 80 kali cambukan.
Dalam sebuah hadits yang shahih disebutkan, Jika ada orang yang minum khamr maka cambuklah. Jika dia
tertangkap untuk kedua kalinya maka cambuklah. Jika tertangkap untuk ketiga kalinya maka cambuklah. Jika dia
tertangkap untuk keempat kalinya dalam kasus minum khamar maka silahkan dihukum mati. Hadits ini sahih dan
memiliki beberapa sanad.
Sedangkan untuk hukuman di akherat, Nabi shallallahu alaihi wa sallam mengatakan, Siapa saja yang meminum
khamr di dunia maka dia tidak akan meminumnya di akherat. Nabi shallallahu alaihi wa sallam juga memberitakan
bahwa siapa saja yang berulang kali meminum khamar maka Allah mewajibkan dirinya sendiri untuk memberi
minuman berupa thinatul khabal untuk orang tersebut. Thinatul khabal adalah nanah penduduk neraka. Nabi
shallallahu alaihi wa sallam juga bersabda, Tidaklah beriman orang yang minum khamr pada saat dia minum
khamr.
Tidaklah diragukan bahwa narkoba dan rokok itu lebih berbahaya dibandingkan dengan khamr. Oleh karena itu,
hukuman terkait dengan narkoba itu jauh lebih keras. Dosa yang terkait dengannya juga lebih besar. Para ulama ahli
sunah telah membawakan bahwa pengedar narkoba itu berhak mendapatkan hukuman mati. Dengan pertimbangan
bahwa orang tersebut termasuk orang yang merusak di muka bumi. Sehingga bahaya yang mengancam agama dari
orang tersebut lebih gawat dibandingkan bahaya racun bagi badan.[2]
EKSEKUSI MATI DAN MENEGAKKAN HUKUM DI NEGARA KESATUAN REPUBLIK INDONESIA
latar belakang
Kepala Badan Narkotika Nasional Komisaris Jenderal Anang Iskandar menyatakan jumlah orang meninggal
dunia akibat penyalahgunaan narkoba mencapai 200 juta per tahun. Angka ini didasarkan pada World Drug Report
2013
oleh
Organisasi
Dunia
Penanganan
Narkoba
dan
Kriminal
(UNODC).
Myuran Sukumaran dan Andrew Chan merupakan anggota sindikat narkoba yang dikenal dengan nama Bali Nine.
Keduanya dibekuk di Bandara Ngurah Rai, Bali, pada 2005, bersama anggota kelompok Bali Nine lainnya. Mereka
tertangkap
saat
hendak
menyelundupkan
8,3
kg
heroin
dari
Bali
ke
Australia.
Saat ini mereka sudah dipindahkan dari Lapas Kerobokan di Denpasar ke Nusakambangan. Pemindahan ini karena
kedua
narapidana
itu
akan
segera
dieksekusi
dalam
waktu
dekat.
Kepastian eksekusi mati terpidana narkoba gelombang II menjadi simpang siur. Di tengah tekanan dari dalam negeri
dan luar negeri, pemerintah kembali menunda eksekusi mati terpidana mati kasus narkoba. Pemerintah beralasan,
penundaan eksekusi mati bukan karena banyaknya tekanan, baik dari dalam negeri maupun lebih-lebih luar negeri,
melainkan
lebih
karena
faktor
teknis
menyangkut
persiapan
menjelang
eksekusi
mati.
Sejak Presiden Jokowi menyatakan sikap untuk tidak memberi pengampunan (grasi) kepada terpidana mati kasus
narkoba, timbul polemik, pro dan kontra. Polemik yang mengarah pada kontroversi semakin keras terdengar, terutama
bagi yang menolak, setelah Pemerintah melaksanakan eksekusi mati gelombang I. Pihak yang pro berpendapat bahwa
para terpidana mati kasus narkoba pantas dieksekusi untuk memberikan efek jera, agar dapat mengurangi kejahatan
narkoba yang telah merusak generasi bangsa. Karena akibat narkoba sangat merugikan bagi perkembangan generasi
muda
bangsa.
Sementara pihak yang kontra berpendapat bahwa eksekusi mati adalah tindakan (yang tidak kalah dari sikap) bar-bar
karena merampas hak hidup individu yang merupakan hak asasi setiap orang. Dalam pandangan pihak yang meolak
hukuman mati, bahwa perampasan hak hidup adalah sebuah tindakan melanggar HAM dan konstitusi. Tidak ada
seorang pun di dunia yang berhak mengambil kehidupan seseorang, yang menentukan seseorang dapat atau tidak
melanjutkan
kehidupannya
hanya
sang
pencipta.
Manusia
tidak
berhak
sama
sekali.
Sebut saja LSM seperti Kontras sebagai kelompok yang menolak hukuman mati. Kelompok ini merupakan hanya
98

sebagian kecil dibandingkan dengan sebagian besar dari komponen bangsa ini yang menghendaki eksekusi mati
segera dilaksanakan. Kelompok ini hanya peduli pada hak hidup terpidana mati tanpa mempertimbangkan bagaimana
dampak dan akibat yang mematikan bagi pengguna narkoba dan kerugian materil dan sosial. Dan secara umum,
sebagian besar dari pengguna narkoba adalah para generasi bangsa yang diharapkan dapat memberi andil besar bagi
bangsa dan negara ini.
Rumusan Masalah
1.

Bagaimana, sikap presiden sekaligus kepala pemerintantahan?

2.

Mengapa pemerintah Australia masih tetap mempertahankan dua warganya tersebut

3.

Apakah, eksekusi mati melanggar HAM?

4.

Bagaimana respon Negara tetangga?

BAB

II

PEMBAHASAN
Sebenarnya tidak hanya pemerintahan Tony Abbott yang secara mati-matian membela duo Bali Nine. Pemerintah
negara lainnya juga melakukan hal yang sama untuk memperjuangkan agar warga negaranya yang terlibat dalam
kasus narkoba di Indonesia dan telah divonis mati mendapat pengampunan, sekurang kurang keringanan hukuman,
berupa
pembatalan
eksekusi
mati.
Berbeda dengan Tony Abbot, entah karena alasan apa, yang secara terus menerus dan marathon berjuang demi duo
Bali Nine, Andrew Chan (AC) dan Myuran Sukumaran (MS), Pemerintah negara lain tidak melakukan diplomasi yang
kebablasan. Presiden Brasil pernah menunjukkan sikap yang mengindikasikan diplomasi tidak wajar ala Abbot,
yakni menolak menerima nota kepercayaan Duta Besar (Dubes) Indonesia. Akan tetapi, diplomasi ala Presiden Brasil,
Dilma Vana Rousseff tersebut bukan memperlunak sikap Presiden Indonesia, malah kemudian berdampak dengan
ditarik
pulang
Dubes
Indonesia
untuk
Brasil
untuk
waktu
yang
tidak
ditentukan.
Selain Tony Abbott dan Dilma Rousseff, Pemerintah Perancis juga melakukan pendekatan diplomatik dengan
mengirimkan surat kepada Presiden Jokowi agar meninjau ulang eksekusi mati terhadap warga negaranya yang juga
masuk daftar terhukum mati. Turut pula menghimbau adalah Sekjen PBB, Ban Ki moon, agar pemerintahan Jokowi
menghapuskan hukuman mati. Rupanya sikap Ban Ki moon ini merupakan buah dari diplomasi dan pendekatan Tony
Abbott, agar PBB dapat menggunakan pengaruhnya dalam membatalkan hukuman mati terhadap duo Bali Nine. Sikap
yang sama juga ditunjukkan oleh Gitaris Black Sabbath, Tony Lommi yang mengirimkan surat kepada Presiden
Jokowi agar membatalkan hukuman mati terhadap duo Bali Nine. Jauh sebelum Tony Lommi, ada juga sebuah
perkumpulan keagamaan,The American Friends Service Committee (AFSC) juga melakukan hal yang sama, mengirim
surat kepada Presiden Jokowi agar membatalkan hukuman mati bagi kedua warga Australia, AC dan SM ini. Tapi
sejauh ini Presiden Jokowi bergeming, tetap pada keputusannya dan telah menolak permohonan grasi terpidana mati
kasus narkoba, termasuk duo Bali Nine. Presiden Joko Widodo akhirnya menjelaskan mengenai komunikasi
terbarunya dengan Perdana Menteri Australia Tony Abbott soal eksekusi mati duo Bali Nine. Saat berbicara dengan
Abbott, Jokowi mengaku mungkin kata katanya terasa lunak, tapi beda hal dengan tindakannya.
"Ya mungkin kata-katanya lunak, tapi nanti tindakannya dilihat," kata Jokowi. Meski berkata demikian hingga saat ini
masih belum di eksekusikan. Di tengah tekanan dan kecaman dari berbagai pihak, baik dari dalam maupun dari luar
negeri, meski tetap menegaskan akan melaksanakan eksekusi mati gelombang II, Presiden Jokowi, menunjukkan
tanda tanda akan mengalah. Hal itu dapat dilihat, setidak-tidaknya, terindikasi dari penundaan eksekusi mati.
Lepas dari alasan teknis yang sering disampaikan oleh Jaksa Agung maupun Presiden Jokowi sendiri, penundaan
eksekusi mati tersebut memberikan isyarat yang kurang menguntungkan, seakan akan Presiden Jokowi tersandera
oleh duo Bali Nine. Jika dugaan ini benar, maka sangat disayangkan bila Jokowi menyerah terhadap kepentingan
asing, membiarkan dirinya mudah diintervensi sehinga bersikap gamang. Ragu dan tidak berani mengambil keputusan
untuk tetap melaksanakan hukuman mati demi kedaulatan hukum di negeri ini dan keberlangsungan keselamatan
generasi bangsa. Padahal banyak kalangan dan elemen bangsa ini, menyatakan sikap dukungan. Berbagai ormas
(organisasi masyarakat ) keagamaan maupun pemuka agama serta partai politik telah memberikan garansi agar
Presiden Jokowi tidak surut ke belakang dan pantang mundur melaksanakan eksekusi mati.Reaksi keras dari
99

pemerintah Brasil dan Kerajaan Belanda terhadap eksekusi hukuman mati enam terpidana kasus narkoba ditanggapi
pemerintah Indonesia. Presiden Joko Widodo (Jokowi) menyatakan eksekusi tersebut merupakan bagian dari
kedaulatan Indonesia yang harus dihormati.
Setiap pemerintahan suatu negara berhak melakukanpembelaan melalui diplomasi dengan negara lain jika ada warga
negaranya
menjadi
terpidana
mati
dalam
kasus
apapun,
termasuk
kasus
narkoba.
Rupanya duo Bali Nine, AC dan MS ini mungkin adalah warga kehormatan dan memiliki pengaruh dalam
pemerintahan Tony Abbot. Apakah dalam perjuangannya menuju tampuk kekuasaan sebagai Perdana Menteri, Tony
Abbot telah berhutang budi pada kedua orang ini? Lepas dari hukum yang berlaku di Australia, sikap Abbot ini sangat
mencurigakan. Abbot dengan tanpa malu-malu membela duo Bali Nine dengan menunjukkan sikap yang sangat
merendahkan martabatnya sebagai seorang PM yang terhormat. Melakukan berbagai cara, termasuk diplomasi
donasi, dan terakhir malah menawarkan barter narapidana (napi) demi membebaskan duo Bali Ninedari eksekusi
mati.
Negara lain juga berusaha agar WN nya di bebaskan akan tetapi tidak seperti Pemerintah Australia yang sampai
demikian, Negara lain hanya mencabut kerja samanya terhadap Indonesia dengan menolak Duta Besar (Dubes)
Indonesia salah satunya di Brazil.Meski demikian harus pula dipahami bahwa setiap negara memiliki kedaulatan
politik
dan
kedaulatan
hukum
yang
harus
dihormati
pula
oleh
negara
lain.
Sebagai negara yang berdaulat Presiden harus menunjukkan sikap tegas tanpa kompromi terhadap semua kejahatan
luar biasa, termasuk kejahatan narkoba. Bahwa setiap pemerintahan memiliki kewajiban untuk memperjuangkan
kepentingan warga negaranya, apalagi warga negaranya tersebut tengah menghadapi hukuman mati, tapi jangan
sampai hal itu malah membuat Pemerintah tersandera. Pemerintah harus dapat menjelaskan posisi politik dalam
pergaulan antarbangsa dan antarpemerintah, sehinga Pemerintah negara lain dapat memahami, bahwa hukuman mati
adalah bagian dari kedaulatan hukum sebagai negara bangsa yang berdaulat. Dan Presiden sebagai penanggung jawab
penuh atas kedaulatan hukum harus dapat menunjukkan sikap untuk tetap melindungi semua anak bangsa dari
kehancuran
akibat
pengaruh
narkoba.
Menurut Nasir(salah seorang dari PMII), eksekusi mati bagi terpidana narkoba adalah sah dan tidak melanggar hak
asasi manusia (HAM). Eksekusi mati itu juga sudah sesuai Undang-Undang Narkotika Nomor 35 Tahun 2009, yang
memuat sikap keras dan tegas terhadap pengedar, bandar, eksportir, dan importir yang mengedarkan narkotika
golongan satu bukan tanaman melebihi lima gram ke atas. Hukuman mati menurut Mahkamah Konstitusi (MK)masih
sah secara undang undang yang berlaku di Indonesia. Keputusan hukuman mati tersebut juga sudah dirundingkan
terlebih dulu sebelumnya dengan sejumlah lembaga dan tokoh yang ada di Indonesia, seperti Fatwa MUI (Majelis
Ulama Indonesia), PBNU (Pengurus Besar Nahdatul Ulama), Muhammadiyah, dan dewan-dewan lainnya yang semua
mendukung eksekusi mati. Eksekusi mati sama sekali tidak melanggar hakasasimanusia,
karenapengedarnarkobaselainmerusakanakmuda,mengganggumasyarakat Indonesia. Dalam UU NO 39 Tahun 1999
tentang HAM Bagian 6 Hakatas rasa nyaman pasal 8,ayat(1) setiap orang berhak mencari suaka untuk memperoleh
perlindungan politik dari Negara lain.ayat(2) hak sebagaimana yang dimaksud dalam ayat(1) tidak berlaku bagi
mereka yang melakukan kejahatan non politik atau pun kejahatan yang bertentangan dengan tujuan dan prinsip
PBB.Artinya kasus duo bali nine in imembuat masyarakat merasa tidak nyaman dan ini bertentangan. Dan juga dalam
UU NO.35 Tahun 2009 Tentang NARKOTIKA Bab XV pasal 113 ayat(2) Dalam hal perbuatan memproduksi,
mengimpor, mengekspor, atau menyalurkan Narkotika Golongan I sebagaimana dimaksud pada ayat (1) dalam bentuk
tanaman beratnya melebihi 1 (satu) kilogram atau melebihi 5 (lima) batang pohon atau dalam bentuk bukan tanaman
beratnya melebihi 5 (lima) gram, pidana penjara seumur hidup, atau pidana penjara paling singkat 5 (lima) tahun dan
paling lama 20 (duapuluh) tahun dan pidana denda maksimumsebagaimana dimaksud pada ayat (1) ditambah 1/3
(sepertiga).Hukuman mati yang di jatuhkankepada duo bali nine olehPresidenJokoWidodo(Jokowi) bukan hanyaasalasal saja namun tentunya pasti sudah dipertimbangkan dengan UU yang telah di buat.
Sejumlahnegara,termasuk Australia,Brasil,danBelandamenyorotihukumanmatiterhadapterpidananarkoba di Indonesia.
Mereka menilai Langkah Indonesia ini menimbulkan ketegangan diplomatic dan juga prokontra terkait efektivitas
eksekusi mati, dan pelanggaran HAM dibaliknya. Dan penilain mereka ini di respon balik oleh Presiden dan wakil
presiden pada media sosial mereka:

Joko

Widodo,

Presiden

Republik

Indonesia

Mengomentari

di

akun

fb:

Perang terhadap mafia narkoba tidak boleh setengah-setengah, karena narkoba benar-benar sudah merusak kehidupan
100

baik kehidupan penggunanya maupun kehidupan keluarga pengguna narkoba. Tak ada kebahagiaan hidup yang
didapat dari menyalahgunakan narkoba. Negara harus hadir dan langsung bertempur melawan sindikat narkoba.
Dan ini menujukan bahwa Presiden Joko Widodo (Jokowi), akan tetap pada keputusannya yang semula yaitu
melaksanakan
eksekusi
mati
pada
duo
nine
bali
itu.
Rousseff jugamengaku telah menghubungi PresidenJokoWidodo (Jokowi) atas eksekusi mati Marco.
NamunPresidenJokowi menolak untuk membatalkan eksekusi tersebut. SelainBrasil, PemerintahBelanda juga
berencana menarik dutabesarnya di Indonesia.Penarikan tersebut juga sebagai protes terhadap hukuman mati
warganya,Ang Kim Soei.Pelaksanaan eksekusi mati terhadap para terpidana narkoba mendapat respons keras dari
Brasil dan Belanda.Mereka menarik duta besarnya dari Jakarta lantaran tidak terima atas kebijakanPemerintah
Indonesia tersebut. PresidenBrasil DilmaRousseff menyatakan penarikan duta besarnya diIndonesia sebagai bentuk
protes atas eksekusi mati warganya,, Marco Archer Cardoso Moreira. Hubungan antara keduanegara telah
terpengaruh. Duta besarBrasil di Jakarta telah dipanggil, kata Rousseff seperti dilansir BBC kemarin. Marco, kata
Rousseff, merupakan warga Negarapertama yang dieksekusi mati diluar negeri.Sebab itu,dia mengaku kecewa dan
marah denganPemerintah Indonesia.
Menteri Luar Negeri Belanda Bert Koenders mengatakan pihaknya sangat sedih dengan hukuman mati yang
dijatuhkan kepada enam terpidana. Belanda sudah melakukan berbagai upaya untuk menyelamatkan warga negaranya.
Upaya tersebut bahkan dilakukan sendiri oleh Raja Belanda King Willem- Alexander beserta Perdana Menteri Mark
Rutte.
Keduanya diketahui sudah menjalin kontak langsung dengan Presiden Jokowi dan menggunakan seluruh kekuatannya
untuk menghentikan eksekusi, sayangnya tak berbuah hasil. Hati saya bersedih untuk keluarga yang ditinggalkan.
Bagi terpidana beserta keluarganya ini adalah akhir yang dramatis sepanjang tahun-tahun penantian. Balanda tetap
menentang hukuman mati,tegas Menteri Luar Negeri Bert Koenders. Juru Bicara Kementerian Luar Negeri Indonesia
Armanatha Nasir mengatakan penarikan duta besar merupakan hak negara yang bersangkutan. Semua negara bisa
melakukan
permintaan konsultasi, ujar Armanath. Dubes ditarik, dia meyakinkan bahwa Indonesia akan tetap berupaya
meningkatkan
hubungan
bilateral
dengan
dua
negara
tersebut.
Bukan hanya kedua negara ini yang kontra terhadap eksekusi mati, namun Negara Prancis dan Inggris juga tak setuju
dengan eksekusi pada warga negara. Namun eksekusi mati tetap di laksanakan karena ini juga menyangkut kedaulatan
Negara.
Wakil Ketua Komisi I DPR Tantowi Yahya menyatakan Pemerintah Belanda dan Brasil harus menghargai penegakan
hukum di Indonesia atas pelaksanaan hukuman mati terhadap enam pengedar narkoba. Pelaksanaan hukuman mati
(terhadap enam terpidana kasus narkoba) tersebut merupakan bentuk penegakan hukum yang berlangsung di
Indonesia,
kata
Tantowi
di
Jakarta
Bukan hanya Tantowi yang mengatakan seperti itu, Wali kota Bandung Ridwan Kamil juga mengatakan yang sama
bahwa Pemerintah Australia harus menghargai keputusan Presiden Jokowi serta menghormati penegakan hukum di
Indonesi.
Pakar hukum internasional Universitas Indonesia Hikmahanto Juwana menegaskan pemerintah tidak perlu khawatir
atas adanya penarikan duta besar Belanda dan Brasil itu. Pemerintah tidak perlu kendur dalam pelaksanaan hukuman
mati
untuk
terpidana
mati
berikutnya,
katanya
kemarin.
Hikmahanto kemudian memaparkan beberapa alasan atas sikap tersebut. Pertama, penarikan mundur tersebut harus
dipahami sebagai ketidaksukaan negara sahabat terhadap kebijakan pelaksanaan hukuman mati. Namun negara
tersebut sangat paham, mereka tidak mungkin melakukan intervensi terhadap kebijakan hukuman mati Indonesia,
tegasnya. Kedua, penarikan dubes merupakan respons Pemerintah Brasil atau Belanda terhadap tuntutan publik dalam
negerinya. Publik dalam negeri pasti akan menuntut pemerintah mereka untuk memprotes keras kebijakan
pelaksanaan hukuman mati di Indonesia. Kemudian penarikan dubes tidak akan lama mengingat saat ini banyak
negara
yang
justru
membutuhkan
Indonesia.
Misalnya saja kepentingan ekonomi Brasil ke Indonesia lebih tinggi dibandingkan kepentingan Indonesia terhadap
101

Brasil. Menurut dia, Indonesia tidak akan diisolasi atas pelaksanaan hukuman mati. Untuk mengantisipasi dampak
pemberlakuan hukuman mati, ada baiknya menteri luar negeri dan kepala perwakilan melakukan pendekatan dengan
berbagai
negara
dan
menjelaskan
pelaksanaan
hukuman
mati
tersebut.
Jelaskan Indonesia mengalami darurat narkoba, kata dia. Yang tak kalah penting, adanya hukuman mati dan
pelaksanaannya merupakan wujud dari kedaulatan dan penegakan hukum suatu negara. Tidak ada negara asing yang
berhak untuk melakukan intervensi. Hal ini sepanjang due process of law dipenuhi dan dapat dipastikan tidak adanya
proses
hukum
yang
sesat.
Sekertari Jendral PBB Ban Ki-Moon meminta pemerintah Indonesia untuk tidak mengeksekusi mati duo Bali Nine
serta terpidana mati lainnya. Alasannya, PBB menentang segala bentuk hukuman mati apa pun alasannya karena
bertentangan dengan hak asasi manusia.
Pengaruheksekusimatiterhadap
duo
bali
nine
terhadap
Indonesia
tentunyaada,
salahsatunyaadalahtidakadanyakerjasamaantarapemerintah
Indonesia
danpemerintahluarnegeridalamhaliniadalahpemerintah
Australia,
Brazil,
sertaBelanda.
Ituditunjukandenganditarikkembalidutabesarbelandadan brazil dari Indonesia danbegitupunsebaliknyadubes Indonesia
yang ada di dua Negara itu di kembalikan, pemerintah Australia jugaakankurangiwisatawanke Indonesia.
Namunmengenaihalituketika
di
Tanya
langsungkepadawisatawan
Australia
merekamengatakanbahwatidakadapengaruhnyabagi kami wisatawan yang datangke Indonesia menurutmerekamasalah
duo bali nine biarlahpemerintahmereka(Australia) yang mengurus, kami parawisatawantetapberwisata di Indonesia.
Pro dan kontra masyarakat terhadap eksekusi mati bukan hanya terjadi di Indonesia saja, tetapi terjadi juga di
Australia Jajak pendapat yang dilakukan lembaga riset Australia,Roy Morgan,memperlihatkan bahwa mayoritaspublik
Australia, menilai mereka yang divonis mati terkait perdagangan narkotika di negara lain harus dieksekusi.
Dikutip lamanRoy Morgan,sebanyak 52 persen publik Australia mendukung eksekusi atas warga Australia yang
divonis
hukuman
mati
di
negara
lain,
sementara
48
persen
tidak
mendukung.
Mayoritas lebih besar atau sekitar 62 persen, menganggap pemerintah Australia tidak perlu bertindak lebih banyak
untuk menghentikan eksekusi Myuran Sukumaran dan Andrew Chan. Hanya 38 persen yang berpendapat sebaliknya.
Jajak pendapat dilakukan dengan responden sebanyak 2.123 orang antara 23-27 Januari 2015. Hasil analisa atas jajak
pendapat, mengungkap bahwa 63 persen pemilih Liberal dan 69 persen nasionalis mendukung eksekusi mati.
Berdasarkan jenis kelamin, mayoritas responden pria mendukung eksekusi mati dan wanita menentangnya. Analisa
berdasarkan usia, memperlihatkan mereka yang berusia di bawah 35 tahun menentang eksekusi.
Sementara publik Australia berusia 35-49 tahun adalah yang paling banyak mendukung eksekusi mati. Berdasarkan
wilayah, hampir semua negara bagian kecuali Victoria, mendukung eksekusi mati warga negara Australia di lain.
Terkait dengan penanganan pemerintah dalam menanggapi eksekusi mati dua gembong Bali Nine, secara umum
responden berpikir pemerintah Australia tidak perlu melakukan tindakan lebih besar untuk menghentikan
eksekusi.Pria atau wanita, pemilih semua partai, serta segala tingkat usia mengeluarkan pendapat yang sama soal
tindakan pemerintah itu. SeorangJurnalis dan tokoh media Australia, Derryn Hinch, mengunggah sebuah video
mengkritik para selebriti setempat yang berpartisipasi dalam kampanye '"I Stand for Mercy." Ini ditujukan sebagai
protes
atas
rencana
eksekusi
mati
dua
warga
negara
Australia
di
Indonesia.
DikutipDaily Mail, Derryn menyebut para selebriti itu bersikap hipokrit. Dia pun mendeklarasikan dukungannya atas
hukuman mati di Australia. Penyiar radio dan presenter televisi itu tidak memberikan simpati pada Myuran
Sukumaran
dan
Andrew
Chan.
Menurut Derryn, dua pentolan kelompok penyelundup narkotika itu, yang terkenal dengan jaringan Bali Nine, lari dari
resiko
yang
harus
mereka
hadapi
saat
berusaha
menyelundupkan
heroin
ke
Indonesia.
katanya:
"Orangorang seperti Alan Jones, Germaine Greer, Asher Keddie, David Wenham, mereka semua berbaris dan ikut
menandatangani dan saya pikir itu hipokrit," kata Derryn dalam rekaman video yang diberinya judul 'Derryn Hinch
tentang
Eksekusi
Bali
Nine.'
Dia menegaskan bahwa Chan dan Sukumaran sadar sepenuhnya, tentang resiko yang bakal mereka hadapi jika
tertangkap menyelundupkan narkotika di Indonesia. "Sama seperti di China, Malaysia, Thailand, Vietnam, itu resiko
yang
Anda
hadapi,"
ujarnya.
Derryn pun memperluas kecamannya dengan mempertanyakan sikap para penentang eksekusiBali Nine, apakah
mereka juga mengeluarkan sikap yang sama bagi warga negara Brazil atau Belanda yang dieksekusi di Indonesi.
"Apakah Anda menentang hukuman mati bagi para teroris?" kata Derryn, menambahkan bahwa dia yakin 75 persen
publik Australia akan mendukung pelaksanaan hukuman mati di negara itu, untuk beberapa jenis kejahatan.
102

Menurut

pakar

komunikasipolitik,

Prof.

Tjiptalesmana

Menjelaskan bahwa hukuman mati merupakan hukuman positif yang berlaku di Indonesia. Negara manapun harus
menghormati hukum yang berlaku di Negara Indonesia. Termasuk Australia, brazil, dan belanda yang warga
negaranya akan dieksekusi mati di Indonesia.
Pengedar narkoba termasuk orang yang membuat kerusakan di muka bumi. Karenanya hukuman bagi mereka yang
membuat kerusakan di muka bumi adalah salah satu dari empat hukuman sesuai kebijakan pemerintah Islam.
Sebagaimana firman Allah Taala,







Sesungguhnya, hukuman terhadap orang-orang yang memerangi Allah dan Rasul-Nya dan membuat kerusakan di
muka bumi, adalah mereka [1] dibunuh atau [2] disalib, [3] dipotong tangan dan kaki mereka dengan bersilang, [4]
atau dibuang (keluar daerah). Yang demikian itu, (sebagai) suatu penghinaan untuk mereka di dunia, dan di akhirat
mereka
mendapat
siksaan
yang
besar.
(QS.
Al-Maidah:
33)
Akan tetapi melihat besarnya kerusakan yang ditimbulkan oleh pengedar narkoba maka hukuman yang dipilih oleh
para ulama adalah hukuman mati. Demikian juga hukuman yang ditetapkan oleh pemerintah Islam adalah hukuman
mati (ini disebut tazir yaitu hukuman yang tidak ditetapkan oleh syariat, namun hasil dari penetapan pemerintah
Islam.
Jika
ditetapkan
oleh
syariat
disebut
hudud,
misalnya
hukuman
potong
tangan.)
Berikut fatwa Haiah Kibar Ulama (Kumpulan Ulama Besar Kerajaan Saudi Arabia) mengenai hukuman bagi
pengedar/bandar narkoba.
138
Keputusan Haiah Kibar Ulama no. 138 tentang Hukum Penyelundup dan Pengedar Narkoba
Alhamdulillah, segala puji hanya milik Allah, Rabb semesta alam. Semoga balasan yang baik diperoleh oleh orang
yang bertakwa. Shalawat dan salam tercurah kepada nabi dan rasul terbaik, nabi kita Muhammad, serta kepada para
keluarganya,
dan
semua
sahabatnya.
Amma
badu:
Majelis Kibar Ulama di pertemuan yang ke-29, yang diadakan di kota Riyadh, tanggal 9 Jumada Tsaniah 1407 H
sampai tanggal 20 Jumadi Tsaniah 1407 H telah mempelajari telegram yang dikirim oleh Pengabdi Dua Tanah Suci,
Raja Fahd bin Abdul Aziz, dengan nomor S: 8033, tertanggal 11 Jumada Tsaniah 1407 H. Dalam surat itu dinyatakan:
Melihat bahwa narkoba memberikan dampak yang sangat buruk, sementara kita perhatikan saat ini mulai banyak
tersebar serta menimbang tuntutan kemaslahatan bagi umat, maka penting untuk diputuskan hukuman yang membuat
jera bagi orang yang berusaha menyebarkan dan memasarkannya, baik ekspor atau impor. Karena itu, kami memohon
kepada anda sekalian untuk membahas masalah ini di sidang Majelis Kibar Ulama dengan segera. Kami akan
menyesuaikan
dengan
apa
yang
diputuskan.
Majelis Kibar ulama telah mempelajari masalah ini, dan mendiskusikan dari berbagai macam sisi pada beberapa kali
pertemuan. Setelah diskusi yang panjang tentang dampak buruk tersebarnya obat terlarang, maka Majelis Kibar Ulama
menetapkan:
Pertama: Bagi penyelundup/ bandar, hukumannya adalah dibunuh karena perbuatanya menjadi penyelundup/ bandar
pengedaran narkoba, menyebarkanya obat terlarang ke dalam negara, menyebabkan kerusakan yang besar, tidak hanya
bagi bandarnya, namun menjadi sebab masalah yang serius bagi seluruh umat. Termasuk bandar narkoba adalah orang
yang mendatangkan obat terlarang ini dari luar, kemudian ia distribusikan ke penjual secara langsung.
Kedua: Untuk pengedar obat terlarang, keputusan Majelis Kibar Ulama untuk pelaku telah diterbitkan pada keputusan
no.
85,
tertanggal
11
Dzulqadah
1401.
Di
sana
dinyatakan:
Orang yang mengedarkan narkoba, baik dengan membuat sendiri atau impor dari luar, baik dengan jual-beli, atau
diberikan cuma-cuma, atau bentuk penyebaran lainnya, maka untuk pelanggaran yang dilakukan pertama, dia
dihukum tazir yang keras, baik dipenjara, dihukum cambuk, atau disita hartanya, atau diberikan semua hukuman
tersebut, sesuai keputusan Mahkamah. Kemudian jika mengedarkan lagi, dia diberi hukuman yang bisa
menghindarkan masyarakat dari kejahatannya, meskipun harus dengan hukuman mati. Karena perbuatannya ini, dia
termasuk orang yang merusak di muka bumi dan potensi berbuat maksiat telah melekat dalam dirinya.
Para ulama menegaskan bahwa hukuman bunuh termasuk bentuk hukuman tazir yang dibolehkan. Syaikhul Islam
Ibnu Taimiyah mengatakan, Manusia yang kerusakannya tidak bisa dihentikan kecuali dengan dibunuh boleh
dihukum mati, sebagaimana hukum bunuh untuk pemberontak, menyimpang dari persatuan kaum muslimin, atau
gembong perbuatan bidah dalam agama. Nabi shallallahu alaihi wa sallam pernah memerintahkan untuk membunuh
orang
yang
sengaja
berdusta
atas
nama
beliau
(dengan
membuat
hadis
palsu)
Ibnu Dailami pernah bertanya kepada beliau tentang orang yang tidak mau berhenti dari minum khamr. Beliau
menjawab, Siapa yang tidak mau berhenti dari minum khamr, bunuhlah. Dalam karya beliau yang lain, Syaikhul
Islam mengatakan tentang alasan bolehnya tazir dengan membunuh, Orang yang membuat kerusakan seperti ini
seperti orang yang menyerang kita. Jika orang yang menyerang ini tidak bisa dihindarkan kecuali dengan dibunuh
103

maka
dia
dibunuh.
Ketiga: Majelis Kibar Ulama berpendapat bahwa sebelum menjatuhkan dua hukuman di atas, hendaknya dilakukan
proses pengadilan yang sempurna, untuk membuktikan kebenaran kasus, sesuai dengan proses mahkamah syariyah
dan badan kriminal, sebagai bentuk kehati-hatian dalam memberikan hukuman mati kepada seseorang.
Keempat: hendaknya hukuman ini diumumkan melalui media massa, sebelum diterapkan, sebagai bentuk peringatan
bagi
masyarakat.[1]
Demikian juga fatwa ulama besar yaitu Syaikh Prof. Abdullah Al Jibrin rahimahullah, beliau berkata mengenai hal
ini:
Hukuman bagi mereka di dunia adalah hukuman yang bisa membuat mereka jera. Untuk peminum khamr syariat
Islam menetapkan hukuman cambuk sebanyak 40 kali. Tatkala banyak orang tidak lagi merasa kapok jika hanya
dicambuk sebanyak itu, Umar bin Al-Khatthab memberikan tambahan hukuman sehingga menjadi 80 kali cambukan.
Dalam sebuah hadits yang shahih disebutkan, Jika ada orang yang minum khamr maka cambuklah. Jika dia
tertangkap untuk kedua kalinya maka cambuklah. Jika tertangkap untuk ketiga kalinya maka cambuklah. Jika dia
tertangkap untuk keempat kalinya dalam kasus minum khamar maka silahkan dihukum mati. Hadits ini sahih dan
memiliki
beberapa
sanad.
Sedangkan untuk hukuman di akherat, Nabi shallallahu alaihi wa sallam mengatakan, Siapa saja yang meminum
khamr di dunia maka dia tidak akan meminumnya di akherat. Nabi shallallahu alaihi wa sallam juga memberitakan
bahwa siapa saja yang berulang kali meminum khamar maka Allah mewajibkan dirinya sendiri untuk memberi
minuman berupa thinatul khabal untuk orang tersebut. Thinatul khabal adalah nanah penduduk neraka. Nabi
shallallahu alaihi wa sallam juga bersabda, Tidaklah beriman orang yang minum khamr pada saat dia minum
khamr.
Tidaklah diragukan bahwa narkoba dan rokok itu lebih berbahaya dibandingkan dengan khamr. Oleh karena itu,
hukuman terkait dengan narkoba itu jauh lebih keras. Dosa yang terkait dengannya juga lebih besar. Para ulama ahli
sunah telah membawakan bahwa pengedar narkoba itu berhak mendapatkan hukuman mati. Dengan pertimbangan
bahwa orang tersebut termasuk orang yang merusak di muka bumi. Sehingga bahaya yang mengancam agama dari
orang
tersebut
lebih
gawat
dibandingkan
bahaya
racun
bagi
badan.[2]
Wallahu waliyyut taufiq.

ukuman mati masih berlaku bagi pengedar narkoba di Indonesia. Pemerintah memiliki alasan tersendiri masih
memberlakukan
hukuman
ini,
meski
mendapat
kritikan
dari
sejumlah
negara.
Menteri Koordinator Politik, Hukum, dan Keamanan (Menkopolhukam) Tedjo Edhy Purdjianto menegaskan hukuman
mati tetap dilaksanakan bagi pengedar narkoba yang sudah memiliki ketetapan hukum. Terlebih, hukuman ini akan
berlaku
bagi
residivis
yang
masih
tetap
mengedarkan
narkoba.
Pemerintah ingin menciptakan jera bagi pelaku kejahatan ini.
Tedjo bercerita, semalam, mendapatkan kabar ada pengedar narkoba yang kembali ditangkap. Dia adalah perempuan
yang sebelumnya sudah empat kali tertangkap atas kasus yang sama, tapi tidak dihukum mati.
Tadi

malam,

si

pengedar

tersebut

kedapatan

membawa

7,6

kilogram

sabu-sabu.

"Ini sudah yang keempat (tertangkap). Artinya dia tidak jera," kata Tedjo dalam Deklarasi Gerakan Rehabilitasi
100.000 Penyalahguna Narkoba, di Lapangan Bhayangkara, Jalan Trunojoyo, Jakarta Selatan, Sabtu (31/1/2015).
Menurut dia, peristiwa ini menjadi tolok ukur hukuman mati harus ditegakkan. Sebab, tidak ada rasa bersalah dan
keinginan
untuk
tidak
melakukan
kembali
mengedarkan
narkoba.
Tedjo berharap negara-negara lain bisa memahami kondisi peredaran narkoba di Indonesia. Sebab, banyak pengedar
yang
sama
sekali
tidak
jera,
meski
sudah
diberi
hukuman.
"Negara yang lain yang diharapkan bisa menghormati hukum di negara kita," imbuh Tedjo.
BEBERAPA PANDANGAN TENTANG HUKUMAN MATI (DEATH PENALTY) DAN RELEVANSINYA
DENGAN PERDEBATAN HUKUM DI INDONESIA
104

Wacana tentang perapan dan penghapusan hukuman mati (death penalty) dalam konteks
hukum Indonesia tampaknya masih akan menghangat dalam beberapa dekade kedepan.
Perdebatan ini sejalan dengan dinamika hukum nasional dan internasional yang sangat pesat
dalam setengah abad terakhir serta munculnya pendekatan-pendekatan baru dalam melihat
dan menilai relevansi hukuman mati dalam konteks sistem hukum, bentuk dan asas negara,
serta perubahan sosial, termasuk teknologi.
Sebagai ilustrasi, dahulu hukuman mati dipandang relevan, sah dan dilakukan secara terbuka
didepan umum, dengan cara dipancung, dibakar, atau bahkan disiksa hingga mati. Di hampir
seluruh dunia, hukuman mati dilakukan untuk kejahatan-kejahatan subversif berupa
penghinaan terhadap Raja atau Pimpinan Agama, kejahatan perang dan pemberontakan,
kriminalitas yang disertai dengan kekejaman, dan lain-lain. Kekuasaan untuk menjatuhkan
hukuman mati ada pada Raja, Panglima Perang, Pimpinan Agama, atau Hakim yang ditunjuk
oleh Raja. Seringkali keputusan untuk menjatuhkan hukuman mati tidak mengacu pada
sandaran Undang-undang, namun hanya berdasarkan titah Raja. Seiring dengan perubahan
sistem kenegaraan dan masyarakat, muncul pandangan baru terhadap hukuman mati. Tindak
kejahatan yang dapat dikenai sangsi hukuman mati dibatasi, antara lain untuk tindak
pembunuhan berencana dan kejam serta prosedur pelaksanaannya dilakukan tertutup.
Pedang, goulatine, hukuman bakar dan siksa digantikan dengan peluru atau kursi listrik yang
dipandang tidak menyebabkan sakaratul maut yang lama dan menyakitkan. Keputusan untuk
menjatuhkan hukuman diambil melalui mekanisme peradilan, bukan berdasarkan perintah
penguasa semata-mata.
Dalam perkembangan terakhir, keabsahan hukuman mati terus dipertanyakan. Gugatan ini
terkait dengan pandangan Hukum Kodrat yang menyatakan bahwa hak untuk hidup adalah
hak yang melekat pada setiap individu yang tidak dapat dirampas dan dikurang-kurang (nonderogable rights) oleh siapapun, atas nama apapun dan dalam situasi apapun termasuk oleh
negara, atas nama hukum atau dalam situasi darurat. Sebagai hak yang dianugerahkan
Tuhan, hak hidup tidak bisa diambil oleh manusia manapun meski atasnama Tuhan sekalipun.
Pandangan lain adalah adanya perubahan konsep dari hukuman sebagai pembalasan menjadi
hukuman sebagai pendidikan dan permasyarakat. Penjara tidak disebut sebagai rumah
tahanan, tapi lembaga permasyarakatan dengan asumsi para tahanan akan dididik untuk
dapat kembali ke masyarakat, termasuk mereka yang melakukan kejahatan yang dipandang
layak dijatuhi hukuman mati. Termasuk beberapa kasus kesalahan dalam penjatuhan
hukuman mati terhadap mereka yang tidak bersalah atau menjadi tumbal/kambing hitam
hukum atau penghukuman terhadap mereka yang bertobat yang seharusnya bisa diganti
dengan hukuman seumur hidup juga menjadi pertimbangan.
Pendeknya, para pihak yang muncul dalam perdebatan ini baik yang pro maupun kontra
bukan saja memperkaya khazanah pengetahuan hukum, namun juga mengandaikan adanya
fenomena tuntutan agar hukum bukan saja mengedepankan asas penghukuman sematamata, namun juga tidak terpisahkan dari konteks sosial dimana hukum tersebut tumbuh.
Paling tidak, relevansi penerapan dan penghapusan hukuman mati kedepan tidak sematamata mengedepankan gagasan keadilan dari sudut pandang negara, tapi juga merupakan
aspirasi dan kehendak masyarakat dengan tetap memperhatikan perubahan pandangan
hukum nasional dan internasional seperti UUD 1945, Kovenan/konvensi Internasional yang
telahi diratifikan Pemerintah Indonesia, serta nilai-nilai yang dianut masyarakat secara umum.
Hukuman Mati Dari Sudut Pandang Konstitusi dan Perundang-undangan
Amandemen kedua UUD 1945 dengan tegas menyebutkan bahwa, Setiap orang berhak
untuk hidup serta berhak mempertahankan hidup dan kehidupannya.[1] Berikutnya UUD
menyatakan, Hak untuk hidup, hak untuk tidak disiksa, hak kemerdekaan pikiran dan hati
nurani, hak beragama, hak untuk tidak diperbudak, hak untuk diakui sebagai pribadi di
hadapan hukum, dan hak untuk tidak dituntut atas dasar hukum yang berlaku surut adalah
hak asasi manusia yang tidak dapat dikurangi dalam keadaan apa pun.[2]
105

Mengacu pada kedua ayat tersebut, maka dapat disimpulkan bahwa pandangan tentang hakhak individu yang dianut oleh Negara Kesatuan Republik Indonesia mengakui apa yang
dikenal oleh para filsuf dengan Hukum Kodrat, sebagaimana dijelaskan di atas, yang
menyatakan bahwa hak untuk hidup adalah hak yang melekat pada setiap individu yang tidak
dapat dirampas dan dikurang-kurang (non-derogable rights) oleh siapapun, atas nama
apapun dan dalam situasi apapun termasuk oleh negara, atas nama hukum, agama atau
dalam situasi darurat.
Perubahan nilai dasar hukum di atas seharusnya membawa konsekuensi adanya amandemen
terhadap seluruh undang-undang yang masih memasukkan hukuman mati sebagai salah satu
bentuk hukuman karena sudah bertentangan dengan Konstitusi. Beberapa Undang-undang
yang masih memasukkan hukuman mati sebagai hukuman maksimal dan harus
diamandemen karena bertentangan dengan Konstitusi tersebut di antaranya adalah:
1. Undang-undang (UU) No 15 Tahun 2003 Tentang Penetapan Perpu No 1 Tahun 2002
Tentang Pemberantasan Tindak Pidana Terorisme Menjadi Undang-undang.[3] UU ini masih
mengadopsi pemberlakuan hukuman mati, terlihat pada pasal 6, pasal 8, pasal 10, pasal
14, pasal 15, dan pasal 16.[4]
2. Kitab Undang-undang Hukum Pidana (KUHP). Pasal 104 tentang Kejahatan Terhadap
Keamanan Negara dan pasal 340 tentang pembunuhan berencana masih mencantumkan
hukuman mati sebagai hukuman maksimum.[5] Saat ini sedang dilakukan proses
penyusunan amandemen KUHP tersebut, yang diharapkan kedepan lebih maju dan tidak
lagi menempatkan hukuman mati sebagai hukuman maksimum.
3. Undang-undang No 5 Tahun 1997 Tentang Psikotropika. Pasal 59 Tentang Tindak Pidana
juga menetapkan hukuman mati sebagi hukuman maksimal.[6]
4. Undang-undang No 26 Tahun 2000 Tentang Pengadilan Hak Asasi Manusia. Pasal 36, 37
dan 41 undang-undang tersebut menyatakan adanya hukuman mati bagi pelanggarnya.[7]
Dalam kasus ini, banyak pihak menyesalkan munculnya pasal-pasal ini bertentanga
dengan seluruh instrumen hukum HAM internasional yang menjadi rujukannya yang
menghapuskan hukuman mati.
Hukuman Mati Dari Sudut Pandang Hukum HAM Internasional[8]
Hukuman mati merupakan salah satu isu yang paling kontroversial dalam Kovenan Internasional Hak-hak
Sipil dan Politik yang telah diratifikasi oleh pemerintah Indonesia (International Covenant on Civil and Political
Rights). Meski diakui hak hidup sebagai non-derogable rights (hak yang tidak dapat dikurang-kurangi)[9], pada Pasal
6 (ayat 2, 4, dan 5)[10] secara tekstual dinyatakan bahwa hukuman mati masih diperbolehkan. Sementara itu pada
Pasal 6 (ayat 6)[11] kembali ditegaskan adanya semangat Kovenan ini untuk secara bertahap dan progresif
menghapuskan praktek hukuman mati. Baru pada Protokol Tambahan Kedua Kovenan Internasional Hak-hak Sipil
dan Politik (Second Optional Protocol to the International Covenant on Civil and Political Rights; aiming at the
abolition of the death penalty) yang diadopsi oleh Resolusi Mejelis Umum PBB pada 15 Desember 1989, secara tegas
praktek hukuman mati tidak diperkenankan[12]. Tafsir progresifnya secara implisit menunjukkan bahwa sebenarnya
Kovenan Hak-hak Sipil dan Politik bukan membenarkan praktek hukuman mati, namun lebih menegaskan bahwa
Kovenan ini berusaha semakin memperketat dan memperkecil lingkup praktek hukuman mati[13]. Hal ini didasari
pada argumen bahwa pada waktu penyusunan Kovenan ini,[14] mayoritas negara di dunia masih mempraktekan
hukuman mati, namun semakin hari negara yang memberlakukan abolisi (penghapusan) hukuman mati semakin
bertambah dan bahkan hingga hari ini justru mayoritas negara di dunia adalah kelompok abolisionis[15]. Sebelumnya
pada tahun 1950 Konvensi HAM Eropa, European Convention on Human Rights/Convention for The Protection of
Human Rights and Fundamental Freedoms pada Pasal 2-nya menegaskan larangan hukuman mati. Konvensi regional
Eropa ini merupakan treaty HAM tertua dan ide penghapusan hukuman mati berangkat dari Konvensi ini. Ketentuan
hukuman mati kemudian juga dihapuskan diberbagai mekanisme pengadilan HAM internasional meskipun
juridiksinya mencakup kejahatan paling berat dan serius di bawah hukum internasional. Statuta Tribunal HAM
106

Internasional ad hoc untuk Negara-Negara Bekas Yugoslavia (Statute of International Criminal Tribunal for the
Former Yugoslavia/ICTY) dan Rwanda (Statue of International Criminal Tribunal for Rwanda/ICTR)[16]. Demikian
pula ketentuan ini ditiadakan pada Statua Roma Mahkamah Pidana Internasional (Rome Statute of the International
Criminal Court), yang merupakan Pengadilan HAM Internasional yang permanen[17].
Untuk memahami teks pada Kovenan Internasional Hak-hak Sipil dan Politik tentang hukuman
mati, PBB juga mengeluarkan sebuah panduan berjudul Jaminan Perlindungan bagi Mereka
yang Menghadapi Hukuman Mati (Safeguards Guaranteeing Protection of the Rights of Those
Facing the Death Penalty) melalui Resolusi Dewan Ekonomi Sosial PBB 1984/50, tertanggal 25
Mei 1984). Panduan ini memperjelas pembatasan praktek hukuman mati menurut Kovenan
Internasional Hak-hak Sipil dan Politik . Pembatasan praktek hukuman mati tersebut antara
lain:
1). Di negara yg belum menghapuskan hukuman mati, penerapannya hanya bisa berlaku bagi
kejahatan yang paling serius[18], yang kategorinya harus sesuai dengan tingkat
konsekwensi yang sangat keji.
2). Hukuman mati hanya boleh berlaku bila kejahatan tersebut tercantum dalam produk
hukum tertulis yang tidak bisa bersifat retroaktif (berlaku surut) pada saat kejahatan tersebut
dilakukan. Dan jika di dalam produk hukum tersebut tersedia hukuman yang lebih ringan,
maka yang terakhir ini yang harus diterapkan.
3). Hukuman mati tidak boleh diterapkan pada anak yang berusia 18 tahun pada saat ia
melakukan kejahatan tersebut[19]. Hukuman mati tidak boleh diterapkan kepada perempuan
yang sedang hamil atau ibu yang baru melahirkan. Hukuman mati tidak boleh dijatuhkan
kepada orang yang cacat mental atau gila.
4). Hukuman mati hanya boleh diterapkan ketika kesalahan si pelaku sudah tidak
menyediakan sedikitpun celah yang meragukan dari suatu fakta atau kejadian.
5). Hukuman mati hanya bisa dijatuhkan sesuai dengan keputusan hukum yang final lewat
sebuah persidangan yang kompeten yang menjamin seluruh prinsip fair trial, paling tidak
sesuai dengan Pasal 14[20] Kovenan Internasional Hak-Hak Sipil dan Politik, termasuk pada
setiap kasus yang diancam hukuman mati, seorang terdakwa harus disediakan pembelaan
hukum yang memadai.[21]
6). Seseorang yang dijatuhi hukuman mati berhak untuk mengajukan banding ke pengadilan
yang lebih tinggi dan banding tersebut bersifat imperatif/wajib.
7). Seseorang yang dijatuhi hukuman mati berhak untuk mengajukan pengampunan, atau
perubahan hukuman. Hal ini harus mencakup semua jenis kejahatan.
8). Hukuman mati tidak boleh diberlakukan
pengampunan atau perubahan hukuman.

untuk

membatalkan

upaya

pengajuan

9). Ketika eksekusi mati dijalankan, metodenya harus seminimal mungkin menimbulkan
penderitaan.
Meskipun kontroversi hukuman mati pada Pasal 6 Kovenan Internasional Hak-hak Sipil dan
Politik masih terus diperdebatkan, namun ada interpretasi lainnya yang menganggap
hukuman mati merupakan pelanggaran terhadap Pasal 7 Kovenan Internasional Hak-hak Sipil
dan Politik tentang praktek-praktek yang merendahkan dan tidak manusiawi.[22] Ketentuan
tambahan lain adalah berlakunya prinsip non-refoulement baik untuk negara yang sudah
menghapus dan yang masih menerapkan hukuman mati- untuk isu ini. Prinsip nonrefoulement ini adalah prinsip keharusan suatu negara untuk menolak permintaan ekstradisi
107

dari negara lain bila orang tersebut bisa mendapat ancaman hukuman mati di negeri
peminta.
Hukuman Mati dari Sudut Pandang Syariat Islam
Dalam kitab-kitab fikih, pembahasan tentang hukuman mati menjadi bagian dari pebahasan
tentang kriminalitas (al-jinayah) seperti pencurian (al-sariqah), minuman keras (al-khamr),
perzinaan (al-zina), hukum balas/timbal balik (al-qishas), pemberontakan (al-bughat), dan
perampokan (quttau tariq).
Dalam wilayah lain, hukuman mati juga dijatuhkan kepada pelaku perzinaan dalam bentuk
dilempar batu hingga mati (al-rajam) untuk pelaku perzinaan yang sudah menikah. Juga
hukuman mati dilakukan dalam kasus pemberontakan (al-bughat) dan pindah agama (alriddah) yang dikenal sebagai hukuman (al-had/al-hudud) atas pengingkaran terhadap Islam.
Termasuk dalam kasus meninggalkan ibadah salat, beberapa ulama mempersamakannya
dengan murtad (al-riddah). Imam Ahmad bin Hanbal mengatakan, Orang yang meninggalkan
shalat adalah kafir, kekafiran yang menyebabkan orang tersebut keluar dari Islam, diancam
hukuman mati, jika tidak bertaubat dan tidak mengerjakan shalat. Sementara Imam Abu
Hanifah, Malik dan Syafii mengatakan, Orang yang meninggalkan adalah fasik dan tidak
kafir, namun, mereka berbeda pendapat mengenai hukumannya, menurut Imam Malik dan
Syafii diancam hukuman mati (al-hadd/al-hudud), dan menurut Imam Abu Hanifah
diancam hukuman tazir, bukan hukuman mati.
Hukuman mati merupakan hukuman puncak, terutama untuk tindak pidana yang dinyatakan
sangat berbahaya seperti pembunuhan (al-qital) dimana jika tidak ada pengampunan dari
pihak keluarga dengan membayar denda pengganti (al-diyat), maka pelakunya dapat dijatuhi
hukuman mati sebagai bentuk hukum balas/timbal balik (al-qishas). Dalam konsepsi ini, maka
kejahatan dibalas dengan hukuman yang serupa. Dalam kasus penetapan hukuman mati (alqishas), ditetapkan beberapa syarat antara lain: bahwa yang bersangkutan telah melakukan
pembunuhan terhadap yang tak boleh[23] (haq) dibunuh, atau orang yang boleh (haq)
dibunuh, akan tetapi belum diputuskan oleh hakim. Pelaku bisa dihukum mati dengan
ketentuan bahwa pada saat melakukan kejahatan telah cukup umur (baligh) dan berakal
(aqil).
Dalam Islam hukuman mati hanya bisa ditegakkan oleh pemerintahan Islam, dimana
konstitusi dan undang-undang yang berlaku adalah hukum Islam. Itu pun harus melalui
mekanisme peradilan, bukan semata-mata bersandar pada fatwa seorang ulama.[24]
Hukuman mati pun hanya berlaku berdasarkan pertimbangan-pertimbangan yang sangat
ketat, seperti konteks yang melatarbelakangi terjadinya suatu tindakan pidana yang diancam
hukuman mati. Hukum Islam (al-fiqh) membedakan antara mereka yang sengaja, tidak
disengaja, terpaksa atau bahkan dipaksa untuk melakukan suatu tindak pidana yang
membawa konsekuensi jatuhnyah hukuman mati. Dalam kondisi-kondisi demikian, putusan
untuk menjatuhkan hukuman mati dapat dipertimbangkan kembali.[25]
Kesimpulan dan Rekomendasi
Berdasarkan catatan Amnesty Internasional, sampai dengan tahun 2002 tercatat 111 negara
telah menentang penerapan hukuman mati, melebihi 84 negara yang masih
mempertahankannya. Ini mencerminkan bahwa hukuman mati sudah dianggap tidak
manusiawi dan relevan dalam perkembangan hukum global.[26]
Dalam banyak perdebatan kontemporer, isu hukuman bukan saja tekait dengan argumentasi
hukum an sich, namun juga dipengaruhi oleh konteks hukum internasional, pandangan
filosofis yang berkembang dan perubahan sosial yang terjadi. Sehingga perbincangan tentang
pemberlakuan hukuman mati di suatu negara paling tidak akan memperbincangkan tiga
aspek yang saling terkait, yaitu 1). Konstitusi atau Undang-undang tertinggi yang dianut suatu
negara dan bentuk pemerintahan yang dianutnya; 2). Dinamika Sosial, politik dan hukum
108

internasional yang mempengaruhi corak berpikir dan hubungan-hubungan sosial di


masyarakat; dan 3). Relevansi nilai-nilai lama dalam perkembangan zaman yang jauh sudah
lebih maju.
Artinya, perdebatan ini bukan saja pertarungan antara keyakinan, cara pandang dan
pengalaman seseorang, namun juga relevansinya dengan konteks dimana hukuman mati
tersebut akan diberlakukan.
Dalam konteks Hukum Nasional kita, perdebatan ini tetap relevan dan memperkaya khazanah
pandangan hukum kita. Namun yang harus diperhatikan adalah, bahwa kepastian hukum
menjadi penting, dalam artian hukum yang konsisten dengan Konstitusi, Perundang-undangan
yang berlaku dan tuntutan masyarakat. Karenanya, diharapkan bahwa perdebatan ini akan
berakhir pada suatu rumusan hukum yang sesuai dengan konteks Negara Kesatuan Republik
Indonesia kedepan.
Wallahu alam bi al-shawab.
Jakarta, 23 November 2006

[1] Bab XA Tentang Hak Asasi Manusia, Pasal 28A Amandemen kedua UUD 1945.
[2] Pasal 28I Ayat 1 Amandemen Kedua UUD 1945
[3] Lebih lengkap terkait dengan masalah seputar Undang-undang ini lihat Mufti
Makarimalahlaq, DILEMA LEGISLASI ANTI TERORISME DAN HUMAN SECURITY; Analisa
Implementasi UU N0 15/2003 Tentang Pemberantasan Tindak Pidana Terorisme, Propatria
Institute 2005 atau lihat di http://makaarim.blogsource.com
[4] Pada pasal 6 dinyatakan, Setiap orang yang dengan sengaja menggunakan kekerasan
atau ancaman kekerasan menimbulkan suasana teror atau rasa takut terhadap orang secara
meluas atau menimbulkan korban yang bersifat massal, dengan cara merampas
kemerdekaan atau hilangnya nyawa dan harta benda orang lain, atau mengakibatkan
kerusakan atau kehancuran terhadap obyek-obyek vital yang strategis atau lingkungan hidup
atau fasilitas publik atau fasilitas internasional, dipidana dengan pidana mati atau penjara
seumur hidup atau pidana penjara paling singkat 4 (empat) tahun dan paling lama 20 (dua
puluh) tahun. Pada Pasal 8 dan Pasal 10 disebutkan jenis-jenis kejahatan yang Dipidana
karena melakukan tindak pidana terorisme dengan pidana yang sama sebagaimana
dimaksud dalam Pasal 6. Sedangkan pada pasal 14 dinyatakan Setiap orang yang
merencanakan dan/atau menggerakkan orang lain untuk melakukan tindak pidana terorisme
sebagaimana dimaksud dalam Pasal 6, Pasal 7, Pasal 8, Pasal 9, Pasal 10, Pasal 11, dan Pasal
12 dipidana dengan pidana mati atau pidana penjara seumur hidup. Pasal 15 menyatakan,
Setiap orang yang melakukan permufakatan jahat, percobaan, atau pembantuan untuk
melakukan tindak pidana terorisme sebagaimana dimaksud dalam Pasal 6, Pasal 7, Pasal 8,
Pasal 9, Pasal 10, Pasal 11, dan Pasal 12 dipidana dengan pidana yang sama sebagai
pelaku tindak pidananya. Dan Pasal 16 menyatakan, Setiap orang di luar wilayah negara
Republik Indonesia yang memberikan bantuan, kemudahan, sarana, atau keterangan untuk
terjadinya tindak pidana terorisme, dipidana dengan pidana yang sama sebagai pelaku
tindak pidana sebagaimana dimaksud dalam Pasal 6, Pasal, 7, Pasal 8, Pasal 9, Pasal
10, Pasal 11, dan Pasal 12.
[5] Pasal 104 menyatakan, Makar dengan maksud untuk membunuh, atau merampas
kemerdekaan, atau meniadakan kemampuan Presiden atau Wakil Presiden memerintah,
diancam dengan pidana mati atau pidana penjara seumur hidup atau pidana penjara
sementara paling lama dua puluh tahun. Pasal 340 menyatakan, Barang siapa dengan
sengaja dan dengan rencana terlebih dahulu merampas nyawa orang lain, diancam karena
109

pembunuhan dengan rencana, dengan pidana mati atau pidana penjara seumur hidup
atau selama waktu tertentu, paling lama dua puluh tahun.
[6] Pasal 59 menyatakan (1) Barang siapa : a. menggunakan psikotropika golongan 1 selain
dimaksud dalam Pasal 4 ayat (2); atau b. memproduksi dan/atau menggunakan dalam proses
produksi psikotropika golongan 1 sebagaimana dimaksud dalam Pasal 6; atau c. mengedarkan
psikotropika golongan 1 tidak memenuhi ketentuan sebagaimana dimaksud dalam Pasal 12
ayat (3); atau d. mengimpor psikotropika golongan 1 selain untuk kepentingan llmu
Pengetahuan; atau e. secara tanpa hak memiliki, menyimpan dan/atau membawa
psikotropika golongan 1 dipidana dengan pidana penjara paling singkat 4 (empat) tahun,
paling lama 15 (lima belas) tahun dan pidana denda paling sedikit Rp. 150.000.000,00
(seratus lima puluh juta rupiah), dan paling banyak Rp.750.000 000,00 (tujuh ratus lima puluh
juta rupiah). (2) Jika tindak pidana sebagaimana dimaksud pada ayat (1) dilakukan secara
terorganisasi dipidana dengan pidana mati atau pidana penjara seumur hidup atau
pidana penjara selama 20 (dua puluh) tahun dan pidana denda sebesar Rp. 750.000.000,00
(tujuh ratus lima puluh juta rupiah). (3) Jika tindak pidana dalam pasal ini dilakukan oleh
korporasi, maka di samping dipidananya pelaku tindak pidana, kepada korporasi dikenakan
pidana denda sebesar Rp. 5.000.000.000,00 (lima milyar rupiah).
[7] Pasal 36 menyatakan Setiap orang yang melakukan perbuatan sebagaimana dimaksud
dalam Pasal 8 huruf a, b, c, d, atau e dipidana dengan pidana mati atau pidana penjara
seumur hidup atau pidana penjara paling lama 25 (dua puluh lima) tahun dan paling singkat
10 (sepuluh) tahun. Pasal 37, Setiap orang yang melakukan perbuatan sebagaimana
dimaksud dalam Pasal 9 huruf a, b, d, e, atau j dipidana dengan pidana mati atau pidana
penjara seumur hidup atau pidana penjara paling lama 25 (duapuluh lima) tahun dan paling
singkat 10 (sepuluh) tahun. Dan Pasal 41, Percobaan, permufakatan jahat, atau
pembantuan untuk melakukan pelanggaran sebagaimana dimaksud dalam Pasal 8 atau Pasal
9 dipidana dengan pidana yang sama dengan ketentuan sebagaimana dimaksud
dalam Pasal 36, Pasal 37, Pasal 38, Pasal 39, dan Pasal 40.
[8] Lihat Papang Hidayat, HAK ATAS KESELAMATAN PRIBADI; Hak atas Hidup, Bebas dari
Penyiksaan, dan Bebas dari Penangkapan atau Penahanan secara Sewenang-wenang
Makalah Terbatas untuk diskusi Komisi untuk Orang Hilang dan Korban Tindak Kekerasan
(Kontras) h. 4-7
[9] Pasal enam ayat (1) menyatakan Setiap manusia berhak atas hak untuk hidup yang
melekat pada dirinya. Hak ini wajib dilindungi oleh hukum. Tidak seorang pun dapat dirampas
hak hidupnya secara sewenang-wenang.
[10] Pasal 6 menyatakan (2). Di negara-negara yang belum menghapuskan hukuman mati,
putusan hukuman mati hanya dapat dijatuhkan terhadap beberapa kejahatan yang paling
serius sesuai dengan hukum yang berlaku pada saat dilakukannya kejahatan tersebut, dan
tidak bertentangan dengan ketentuan Kovenan dan Konvensi tentang Pencegahan dan Hukum
Kejahatan Genosida. Hukuman ini hanya dapat dilaksanakan atas dasar keputusan akhir yang
dijatuhkan oleh suatu pengadilan yang berwenang. (4) Setiap orang yang telah dijatuhi
hukum mati berhak untuk memohon pengampunan atau penggantian hukuman. Amnesti,
pengampunan atau penggantian hukuman mati dapat diberikan dalam semua kasus. (5).
Hukuman mati tidak boleh dijatuhkan atas kejahatan yang dilakukan oleh seseorang di bawah
usia delapan belas tahun dan tidak boleh dilaksanakan terhadap perempuan yang tengah
mengandung.
[11] Pasal 6 ayat (6) menyatakan Tidak ada satu pun dalam Pasal ini yang boleh dipakai
untuk menunda atau mencegah penghapusan hukuman mati oleh Negara yang menjadi Pihak
dalam Kovenan ini.

110

[12] Protokol Tambahan Kedua masih memungkinkan Negara Pihak-nya untuk mereservasi Pasal 2 (paragraf 1) yang
artinya masih membenarkan penerapan hukuman mati pada masa perang atas suatu kategori kejahatan militer paling
serius.
[13] Hingga kurun waktu sekitar penyusunan Kovenan Internasional Hak-hak Sipil dan Politik ini, masih banyak
negara yang menerapkan hukuman mati yang cakupan kejahatannya sangat luas dari kriminal biasa hingga kejahatan
politik, yang sering kali digunakan oleh rezim otoriter untuk menumpas oposisi politiknya. Hukuman mati juga sering
digunakan justru untuk melawan upaya penegakan normatif HAM. Untuk bahasan ini lihat William A. Schabas, The
Abolition of The Death Penalty in International Law, Cambridge University Press, 1997.
[14] Keseluruhan Pasal 6 Konvensi Internasional Hak-hak Sipil dan Politik ini selesai disusun pada tahun 1957.
[15] Pada dekade 1950-an negara-negara yang menghapus hukuman mati untuk seluruh jenis kejahatan baru
berjumlah 10 atau sekitar 12,4%. Negara-negara yang menghapus hukuman mati hanya untuk jenis kejahatan biasa
baru berjumlah 19 atau sekitar 23,6%. Sementara itu hingga Juni 2006, total negara yang sudah melakukan
penghapusan (abolisi) hukuman mati dengan berbagai bentuk adalah 129 atau sekitar 65%. Sementara jumlah negara
yang masih menerapkan hukuman mati adalah 68 atau 35%.
[16] Kedua Statuta ICTY dan ICTR memiliki ketentuan mengenai penghukuman/penalties yang sama, yaitu The
penalty imposed by the Trial Chamber shall be limited to imprisonment. Lihat Statuta ICTY di
http://ohchr.org/english/law/itfy.htm dan Statuta ICTR di http://ohchr.org/english/law/itr.htm.
[17] Hukuman dalam mekanisme ICC juga hanya berupa hukuman penjara yang terdiri dari hukuman penjara seumur
hidup untuk kejahatan yang sangat ekstrim dan hukuman penjara maksimum 30 tahun. Untuk Statuta Roma lihat di
http://ohchr.org/english/law/criminalcourt.htm.
[18] Meskipun istilah kejahatan paling serius masih kabur, dalam beberapa studi Komite HAM di beberapa laporan
Negara Pihak yang masuk, ditetapkan bahwa kategori kejahatan paling serius tidak boleh mencakup kategori
kejahatan politik, kejahatan ekonomi, kejahatan perdata, atau segala tindak kriminal yang tidak melibatkan
penggunaan kekerasan. Komite HAM juga melarang penggunaan hukuman mati sebagai suatu hukuman
wajib/mandatory punishment. Lihat Manfred Nowak, U.N. Covenant on Civil and Political Rights; CCPR
Commentary, 2nd Revised Edition, N.P. Engel, Publisher, 2005.
[19] Ketentuan ini juga sesuai dengan Konvensi Hak-Hak Anak/Convention on the Rights of
the Child, Pasal 37 (a) yang menyatakan Tidak seorang anak pun dapat dijadikan sasaran
penganiayaan, atau perlakuan kejam yang lain, tidak manusiawi atau hukuman yang
menghinakan. Baik hukuman mati atau pemenjaraan seumur hidup tanpa kemungkinan
pembebasan, tidak dapat dikenakan untuk pelanggaran-pelanggaran yang dilakukan oleh
orang-orang di bawah umur delapan belas tahun;
[20] Pasal 14 menyatakan:
(1). Semua orang mempunyai kedudukan yang sama di hadapan pengadilan dan badan peradilan. Dalam menentukan
tuduhan pidana terhadapnya, atau dalam menentukan segala hak dan kewajibannya dalam suatu gugatan, setiap orang
berhak atas pemeriksaan yang adil da terbuka untuk umum, oleh suatu badan peradilan yang berwenang, bebas dan
tidak berpihak dan dibentuk menurut hukum. Media dan masyarakat dapat dilarang untuk mengikuti seluruh atau
sebagian sidang karena alasan moral , ketertiban umum atau keamanan nasional dalam suatu masyarakat yang
demokratis atau apabila benar-benar diperlukan menurut pendapat pengadilan dalam keadaan khusus, dimana
publikasi justru akan merugikan kepentingan keadilan sendiri; namun setiap keputusan yang diambil dalam perkara
pidana maupun perdata harus diucapkan dalam sidang yang terbuka, kecuali bilamana kepentingan anak-anak
menentukan sebaliknya, atau apabila persidangan tersebut berkenaan dengan perselisihan perkawinan atau perwalian
anak-anak.
111

(2). Setiap orang yang dituduh melakukan kejahatan berhak dianggap tidak bersalah sampai kesalahannya dibuktikan
menurut hukum.
(3). Dalam menentukan tindak pidana yang dituduhkan padanya, setiap orang berhak atas jaminan-jaminan minimal
berikut ini, dalam persamaan yang penuh:
a) Untuk diberitahukan secepatnya dan secara rinci dalam bahasa yang dapat dimengertinya, tentang sifat dan alasan
tuduhan yang dikenakan terhadapnya;
b) Untuk diberi waktu dan fasilitas yang memadai untuk mempersiapkan pembelaan dan berhubungan dengan
pengacara yang dipilihnya sendiri;
c) Untuk diadili tanpa penundaan yang tidak semestinya;
d) Untuk diadili dengan kehadirannya, dan untuk membela diri secara langsung atau melalui pembela yang dipilihnya
sendiri, untuk diberitahukan tentang hak ini bila ia tidak mempunyai pembela; dan untuk mendapatkan bantuan hukum
demi kepentigan keadilan, dan tanpa membayar jika ia tidak memiliki dana yang cukup untuk membayarnya;
e) Untuk memeriksa atau meminta diperiksanya saksi-saksi yang memberatkannya dan meminta dihadirkan dan
diperiksanya saksi-saksi yang meringankannya, dengan syarat-syarat yang sama dengan saksi-saksi yang
memberatkannya;
f) Untuk mendapatkan bantuan cuma-cuma dari penerjemah apabila ia tidak mengerti atau tidak dapat berbicara dalam
bahasa yang digunakan di pengadilan;
g) Untuk tidak dipaksa memberikan kesaksian yang memberatkan dirinya, atau dipaksa mengaku bersalah.
(4). Dalam kasus orang di bawah umur, prosedur yang dipakai harus mempertimbangkan usia mereka dan keinginan
untuk meningkatkan rehabilitasi bagi mereka.
(5). Setiap orang yang dijatuhi hukuman berhak atas peninjauan kembali terhadap keputusannya atau hukumannya
oleh pengadilan yang lebih tinggi, sesuai dengan hukum. 6. Apabila seseorang telah dijatuhi hukuman dengan
keputusan hukum yang telah mempunyai kekuatan hukum yang tetap, dan apabila kemudian ternyata diputuskan
sebaliknya atau diampuni berdasarkan suatu fakta baru, atau fakta yang baru saja ditemukan menunjukkan secara
meyakinkan bahwa telah terjadi kesalahan dalam penegakan keadilan. Maka orang yang telah menderita hukuman
sebagai akibat dari keputusan tersebut harus diberi ganti rugi menurut hukum, kecuali jika dibuktikan bahwa tidak
terungkapnya fakta yang tidak diketahui itu, sepenuhnya atau untuk sebagian disebabkan karena dirinya sendiri.
(7). Tidak seorang pun dapat diadili atau dihukum kembali untuk tindak pidana yang pernah dilakukan, untuk mana ia
telah dihukum atau dibebaskan, sesuai dengan hukum dan hukum acara pidana di masing-masing negara.
[21] Pembelaan hukum yang memadai termasuk keharusan seorang terdakwa didampingi pengacara dan penterjemah
bila ia disidang dalam bahasa yang ia tidak mengerti. Terdakwa juga harus disediakan akses terhadap informasi yang
lengkap atas persidangan tersebut.
[22] Termasuk pula Konvensi Menentang Penyiksaan dan Perlakuan Kejam atau Penghukuman Lain yang Kejam,
Tidak Manusiawi dan Merendahkan Martabat Manusia/Convention Against Torture and Other Cruel, Inhuman or
Degrading Treatment or Punishment, diadopsi oleh Resolusi Majelis Umum PBB 39/46 tertanggal 10 Desember 1984.
Interpretasi ini didasari pada argumen bahwa seorang terpidana mati yang sedang menghadapi eksekusi akan
mengalami tekanan mental/psikis yang luar biasa yang menjadi cakupan Konvensi Anti Penyiksaan ini.

112

[23] Boleh dalam pengertian dalam situasi perang atau membela diri. Orang yang tidak boleh dibunuh adalah orang
yang dilindungi oleh hukum pemerintahan negara Islam.
[24] Di Indonesia, pernah muncul perdebatan seputar fatwa hukuman mati sekelompok orang terhadap Ulil AbsharAbdala, berkaitan dengan artikelnya, Menyegarkan Kembali Pemahaman Islam di Harian Kompas. Siapa pun bisa
tidak sependapat dengan isi atau metode tulisan Ulil. Namun, bila sampai mengarah fatwa penghilangan nyawa, ini
sudah melampaui kepantasan akal sehat manusia. Tokoh Islam seperti Yusuf Qardhawi dalam buku Fiqh Al-Ikhtilaf
tidak menganjurkan fatwa-fatwa semacam itu ketika terjadi beda pendapat. Dia bahkan memperkuat argumen,
perbedaan pendapat adalah rahmat.
[25] Lihat M. Hasibullah Satrawi, Fikih Hukuman Mati, Koran Tempo 11 April 2006

Brasil mengatakan ekskeusi hukuman mati terhadap seorang warga negara Brasil di Indonesia akan "membayangi"
hubungan kedua negara.
Penasihat khusus kebijakan luar negeri untuk Presiden Brasil Dilma Rousseff, yaitu Marco Aurelio Garcia, pada hari
Jumat (16/01) mengatakan pemerintah Brasil telah melakukan semua upaya untuk menghentikan eksekusi Marco
Archer Cardoso Moreira.
Moreira, 53, adalah seorang instruktur gantole yang ditangkap di Indonesia pada 2003 karena berusaha
menyelundupkan 13,4 kg kokain yang disembunyikan dalam peralatan olahraga.
Amnesty International juga telah melakukan kampanye agar Indonesia membatalkan hukuman mati tersebut.
Garcia mengatakan eksekusi Moreira akan mengakibatkan ketegangan terhadap hubungan kedua negara.
"Presiden Brasil sangat menyesalkan posisi pemerintah Indonesia dan meminta adanya perhatian terhadap fakta bahwa
keputusan ini akan membayangi hubungan kedua negara," kata Garcia seperti dikutip kantor berita Reuters.

Setiap tanggal 10 Oktober diperingati sebagai Hari Anti Hukuman Mati Sedunia. Berbagai
alasan dikeluarkan untuk menentang hukuman mati. Alasan utamanya adalah melanggar hak
hidup dan tidak memberi kesempatan bagi sang terpidana untuk memperbaiki diri.
Mereka mungkin akan bersuara lain bila berada pada pihak yang dirugikan oleh terpidana.
Jamak terdengar pihak keluarga seorang korban pembunuhan dengan keras menuntut pelaku
dihukum mati. Orang-orang yang menderita secara langsung atau tidak dengan narkoba,
menuntut pengedar narkoba dihukum mati. Tak sedikit pula yang menuntut para koruptor
dihukum mati. Dan juga soal hukuman mati kepada para teroris. Lalu, kenapa pihak-pihak
yang kontra hukuman mati tidak berkata apa-apa terhadap mereka? Menjelaskan pada pihak
korban agar mereka menarik permintaan mereka agar sang pelaku dihukum mati. IMO, kalau
mereka
melakukan
hal
tersebut,
maka
pamor
mereka
akan
hancur
:p.
Layak atau tidaknya hukuman mati seharusnya ditilik dari kejahatan yang dilakukan. Ambil
contoh ekstrim: Seseorang yang melakukan atau memerintahkan pembantaian, apa pantas
untuk diberi hak hidup? Lalu kemudian ia dapat hidup, dibiayai oleh negara bahkan mungkin
mendapatkan fasilitas tambahan entah dari mana, karena ia cukup mendapat hukuman
penjara. Padahal di lain pihak, sebenarnya dengan manajemen yang baik, orang-orang yang
dihukum penjara (termasuk penjara seumur hidup pun) masih bisa dikaryakan bukan hanya
menghabiskan uang negara. Sebagai contoh, membuat kerajinan tangan, mengerjakan
proyek pembukaan lahan (tentu dengan pengamanan tambahan), atau hal-hal lain yang
mungkin
secara
logika
dikerjakan
oleh
seorang
narapidana.
113

Efek yang diharapkan dari hukuman mati bukankah tidak sekedar untuk membayar
kejahatannya saja, melainkan juga untuk memberikan semacam peringatan agar orang lain
tidak
melakukan
kejahatan
yang
sama?
Kalau dilihat di Indonesia, sudah puluhan orang dieksekusi mati mengikuti sistem KUHP
peninggalan kolonial Belanda. Bahkan selama Orde Baru korban yang dieksekusi sebagian
besar
merupakan
narapidana
politik.
Walaupun amandemen kedua konstitusi UUD '45, pasal 28 ayat 1, menyebutkan: "Hak untuk
hidup, hak untuk tidak disiksa, hak kemerdekaan pikiran dan hati nurani, hak beragama, hak
untuk tidak diperbudak, hak untuk diakui sebagai pribadi di depan hukum, dan hak untuk
tidak dituntut atas dasar hukum yang berlaku surut adalah hak asasi manusia yang tidak
dapat dikurangi dalam keadaan apapun", tapi peraturan perundang-undangan dibawahnya
tetap
mencantumkan
ancaman
hukuman
mati.
Kelompok pendukung hukuman mati beranggapan bahwa bukan hanya pembunuh saja yang
punya hak untuk hidup dan tidak disiksa. Masyarakat luas juga punya hak untuk hidup dan
tidak disiksa. Untuk menjaga hak hidup masyarakat, maka pelanggaran terhadap hak
tersebut
patut
dihukum
mati.
Hingga 2006 tercatat ada 11 peraturan perundang-undangan yang masih memiliki ancaman
hukuman mati, seperti: KUHP, UU Narkotika, UU Anti Korupsi, UU Anti terorisme, dan UU
Pengadilan HAM. Daftar ini bisa bertambah panjang dengan adanya RUU Intelijen dan RUU
Rahasia
Negara.
Merujuk kepada data yang tertulis di Wikipedia, ada 68 negara yang masih menerapkan
praktek hukuman mati, termasuk Indonesia, dan lebih dari setengah negara-negara di dunia
telah menghapuskan praktek hukuman mati. Ada 88 negara yang telah menghapuskan
hukuman mati untuk seluruh kategori kejahatan, 11 negara menghapuskan hukuman mati
untuk kategori kejahatan pidana biasa, 30 negara negara malakukan moratorium (de facto
tidak menerapkan) hukuman mati, dan total 129 negara yang melakukan abolisi
(penghapusan)
terhadap
hukuman
mati.
Hukuman mati di China dengan cara tembak
Memang, praktek hukuman mati di juga kerap dianggap bersifat bias, terutama bias kelas dan
bias ras. Di AS, sekitar 80% terpidana mati adalah orang non kulit putih dan berasal dari kelas
bawah. Sementara di berbagai negara banyak terpidana mati yang merupakan warga negara
asing
tetapi
tidak
diberikan
penerjemah
selama
proses
persidangan.
Kembali ke Indonesia, sampai saat ini teknik hukuman mati yang berlaku adalah ditembak
mati. Seorang terhukum akan dihadapkan kepada regu tembak 8-10 orang dengan senjata
dan peluru tajam. Namun apabila sampai waktu tertentu terpidana, tidak meninggal maka
sang komandan akan mengambil pistol dan menembak kepala terpidana dari jarak dekat.
Kalau kita hitung, masih ada jeda antara terpidana ditembak dan meninggal, tentu saja hal ini
akan sangat menyakitkan bagi terpidana...tapi mau apa lagi, sampai sekarang belum ada
amandemen
tentang
tata
cara
hukuman
mati.
Cara yang lain yang sepertinya paling nyaman adalah suntik mati. Metode suntik mati terdiri
dari 3 tahap suntikan. Suntikan pertama adalah untuk membius, menghilangkan kesadaran.
Suntikan ini mirip dengan pembiusan biasa, hanya saja dosisnya jauh lebih tinggi, 8 sampai
20 kali lipat dosis bius biasa. Tahapan pertama ini merupakan tahapan paling penting
mengingat jika gagal, maka suntikan tahap kedua dan ketiga tidak lagi terasa nyaman, tapi
justru sangat menyakitkan. Suntikan selanjutnya diberikan dalam kondisi terhukum sudah
pingsan total. Suntikan ini ditujukan untuk melemaskan otot. Begitu obat ini disuntikkan, otot
akan tidak berfungsi sama sekali. Adapun suntikan terakhir ditujukan untuk menghentikan
fungsi jantung. Jika proses ini berjalan lancar, maka terpidana tidak akan merasa sakit sama
sekali.
Gambaran singkat hukuman mati dengan cara suntik
Kita tidak perlu berbicara tentang ada agama yang mendukung keberadaan hukuman mati
dengan yang tidak, tentu saja itu akan menjadi debat kusir yang berkepanjangan. Namun
jelas, di hukum keenam di dalam Alkitab tertulis, "Jangan Membunuh", yang juga dapat
114

diartikan
bahwa
kita
pun
tidak
boleh
membunuh
sesama
kita.
Memang membingungkan kalau berbicara tentang hukuman mati, ada banyak pro dan kontra.
Tidak cukup hanya melihat dari sisi hukum, agama, sosial & kebudayaan yang berlaku,
inferensi negara asing, tapi masih banyak hal lain yang tetap harus dipertimbangkan. Yang
jelas, saya lebih setuju dengan kalimat, "Di mana bumi dipijak, di situ langit dijunjung". Saat
ini kita hidup di NKRI yang memiliki hukum. Hukum di Indonesia memang tidak sempurna, ya
karena yang membuat juga masih manusia, namun hukum membuat banyak hal lebih teratur.
Apakah seseorang layak dihukum mati atau tidak, marilah kita serahkan kepada mekanisme
hukum
yang
berlaku
di
Indonesia.
Satu hal lagi. Jika saya ditanya, "Apakah hukuman mati perlu diterapkan di Indonesia?", saya
akan jawab, "Tidak Perlu" dan saya tidak akan memberi alasan tambahan.
Ditulis
Walikota
Oleh

oleh

Wijoyo
Korup

Batara
Dijatuhi

Adi

Frans

Simanjuntak

Hukuman
Supriadi

Mati
|

KabarIndonesia - Seorang mantan Walikota Beijing dijatuhi hukuman mati dengan


penangguhan karena menerima uang suap jutaan yuan, kata media pemerintah, Minggu,
sebagaimana
diberitakan
Reuters.
Liu Zhihua mengetuai pembangunan tempat-tempat untuk Olimpiade tahun 2008 di ibukota
China , Beijing , serta 40 miliar dolar peningkatan prasarana di kota itu untuk olimpiade.
Ia
dipecat Juni 2006 karena dituduh terlibat korupsi dan
bermoral jelek.
Kantor berita Xinhua mengatakan Liu, 59 tahun menerima uang suap 6,97 juta yuan (1,02 juta
dolar), demikian menurut putusan sebuah pengadilan di provinsi tetangga Hebei.
Pengadilan mengatakan uang sogok itu dikantongi oleh Liu dan kekasihnya Wang Jianrui . Liu
menyalahgunakan kekuasaan untuk memperoleh proyek-proyek kontrak, pinjaman dan lainnya
dengan
imbalan
keuntungan,
kata
berita-berita
itu.
Hukuman mati yang ditangguhkan di China biasanya diubah menjadi hukuman penjara
seumur
hidup
dengan
syarat
para
terhukum
berkelakuan
baik.
Sumber-sumber sebelumnya mengemukakan kepada Reuters bahwa ketua Partai Komunis
nasional
dan
presiden
China,
Hu
Jintao,
mengawasi
pemecatan
Liu.
Hu juga mengawasi pemecatan Chen Liangyu, ketua Partai Komunis Shanghai, September 2006
karena menyalurkan dana-dana pensiun ke investasi-investasi ilegal, dan membantu
memperkaya
perusahaan-perusahaan
kroni
dan
keluarga.
Partai Komunis China menyebut korupsi yang dilakukan pejabat merupakan satu ancaman
bagi kelanjutan kekuasaannya , tetapi masalah itu tetap merajalela dan adalah satu sumber
kemarahan publik di sebuah negara yang pemeriksaan terhadap kekuasaan akan sia-sia.
Menyikapi Keputusan Mahkamah Konstitusi terhadap Pemberlakuan Hukuman Mati
Oleh
:
Sarlen
Julfree
Manurung
|
KabarIndonesia - Keputusan Mahkamah Konstitusi (MK) yang menyatakan, bahwa penerapan
sanksi hukuman mati dalam UU No. 22 Tahun 1997 tentang Narkotika, tidak bertentangan
dengan Pasal 28 A dan Pasal 28 I UUD 1945, seakan ingin menyampaikan, ada sejumlah
kesalahan
yang
tidak
mungkin
dapat
dimaafkan
negara.
Keluarnya keputusan Mahkamah Konstitusi (MK) tersebut, telah mengundang banyak perhatian
masyarakat karena menyangkut hak manusia untuk dapat hidup. Setidaknya ada 4 hal penting
yang dapat menjadi bahan diskusi menarik atas keluarnya keputusan MK tersebut.
Pertama, adanya wacana hukum yang berbicara tentang pelaksanaan sanksi hukuman mati,
merupakan sebuah wacana yang berkaitan langsung dengan cerita menyedihkan dari akhir
115

kehidupan para terpidana mati. Usaha mereka untuk meminta MK menguji UU tentang narkoba
tersebut, merupakan bagian dari perjuangan mereka agar tetap memiliki harapan untuk hidup.
Keluarnya keputusan MK, telah memupuskan segenap harapan para terpidana mati, yang
sangat berharap, negara dapat memaafkan kesalahan yang telah mereka lakukan, atau
setidaknya negara dapat berbaik hati dengan memberikan mereka kesempatan kedua melalui
perubahan
bentuk
hukuman
yang
harus
mereka
jalani.
Padahal, banyak dari antara terpidana mati yang saat ini telah bertobat dan mencoba menata
kembali kehidupan mereka dengan lebih dekat kepada Tuhan, menjalani sisa kehidupan dengan
lebih produktif serta lebih bermakna, baik itu kepada diri mereka sendiri atau kepada orang
lain.
Ketika pertobatan telah mereka lakukan, haruskah tindak kejahatan yang telah mereka perbaiki
melalui jalan pertobatan, sudah tidak bisa dimaafkan lagi? Adilkah sebuah amar keputusan
pengadilan apabila kesalahan yang dilakukan, harus dibayar sangat mahal yaitu dengan nyawa
para
terpidana?
Kedua, keputusan MK, pada dasarnya telah mengacuhkan adanya hak asasi manusia (HAM)
dari setiap individu manusia, dimana termasuk didalamnya, adanya hak hidup dari para
terpidana
mati.
Apabila dikaitkan dengan adanya HAM, maka bisa dikatakan bahwa keputusan yang telah
dibuat MK, memang secara langsung tidak menjunjung tinggi HAM sebagai hak dasar setiap
manusia untuk hidup, dimana MK justru menyetujui adanya upaya negara untuk merampas
harkat,
martabat,
serta
hak
hidup
seseorang.
Padahal, HAM bukanlah sebuah aturan atau produk hukum manusia. Ungkapan HAM
merupakan simbolisasi dari pengakuan masyarakat dunia yang menyadarikan bahwa hanya
Tuhan saja yang berhak menghentikan hembusan nafas kehidupan dari setiap individu
makhluk
hidup.
Dimanakah sisi kemanusiaan dari bentuk hukuman seperti hukuman mati? Dalam hal ini,
apakah negara memang memiliki wewenang sedemikian besar sehingga nyawa seseorang harus
dikorbankan
untuk
kepentingan
tertentu?
Satu hal yang tidak bisa dibantah, apabila dikaitkan dengan pencabutan hak hidup dari
seseorang, bahwa hal tersebut merupakan otorisasi dan bagian dari supremasi kuasa Tuhan
atas
kehidupan
manusia.
Keputusan yang dibuat MK atas pengujian UU No. 22 Tahun 1997 tentang Narkotika terhadap
isi Pasal 28 A dan Pasal 28 I dari UUD 1945, yang berbicara tentang HAM, MK justru bersikap
dan
berpikir
sebaliknya.
Sebagai lembaga negara yang memiliki wewenang untuk menguji segenap sistematika dan
mekanisme setiap peraturan yang ada dalam UU terhadap UUD 1945, seharusnya MK
menempatkan posisi HAM sebagai suatu kondisi khusus yang teramat prinsip, tidak dapat
diganggu-gugat ataupun dikurangi, serta terlepas dari berbagai aturan hukum buatan manusia.

116

Seharusnya MK membuat keputusan yang menempatkan HAM sesuai dengan hakekat


keberadaannya, sehingga ketika hukum negara sudah bersinggungan dengan HAM, kelak tidak
ada lagi peraturan hukum yang mencoba-coba untuk mengambil alih atau mencampuri otoritas
Tuhan
terhadap
HAM.
Apabila dikatakan bahwa pemerintah merupakan kepanjangan tangan Tuhan di dunia ini dan
negara mengakui adanya Tuhan, seharusnya MK mendesak pihak-pihak yang berwenang untuk
membuat UU, agar mereka membuat suatu UU baru, yang isinya tidak menghiraukan adanya
sikap
penyesalan
para
terpidana
melalui
jalan
pertobatan.
Peraturan hukum seperti itu memang perlu dibuat, selain bertujuan untuk memberikan
kesempatan kedua bagi mereka yang telah bertobat, peraturan semacam itu perlu ada, untuk
menghindari terjadinya kesalahan dalam menjatuhkan bentuk hukuman, apabila dikemudian
hari ditemukan suatu bukti-bukti atau keterangan baru yang menyatakan terpidana mati
bukanlah
pihak
yang
paling
bersalah.
Organisasi Amnesti Internasional menyatakan, banyak amar keputusan pengadilan yang
menetapkan sanksi hukuman mati, dijatuhkan kepada orang yang tidak bersalah. Padahal
penjatuhan sanksi hukuman mati terhadap seorang terpidana, merupakan sebuah tindakan
hukum yang tidak dapat dikoreksi. Ketika eksekusi hukuman mati telah dilaksanakan,
kesaksian
terpidana
mati
tersebut
sudah
tidak
dapat
diambil
lagi.
Faktor adanya kesalahan menetapkan hukuman kepada seseorang, memang mungkin saja
terjadi
karena
manusia
tidak
terlepas
dari
adanya
kesalahan.
Oleh karena itu, adanya HAM dari setiap individu manusia seharusnya dijamin secara penuh,
terutama
oleh
segenap
peraturan
hukum
yang
berlaku.
Ketiga, ketika keputusan tersebut dibuat, nampaknya MK tidak memperhatikan dengan baik
kenyataan yang ada, dimana sistematika dan sanksi hukum yang diterapkan dalam UU No. 12
Tahun 1997, belum menghadirkan efek jera dan mampu menurunkan tindak kejahatan
penggunaan
serta
peredaran
narkoba
ditengah
masyarakat.
Sepertinya, upaya ekstra negara dengan menetapkan sanksi hukum maksimum berupa
hukuman mati kepada para pengguna narkoba, belum mencapai apa yang diharapkan.
Hal tersebut bisa dilihat dari hasil penelitian yang dilakukan pihak BNN pada tahun 2005, yang
menunjukkan kalau angka penyalahgunaan narkoba pada tahun 2001 hingga tahun 2005 saja,
justru mengalami peningkatan. Padahal, UU tentang narkotika disahkan pada tahun 1997.
Adanya penggrebekkan yang dilakukan aparat kepolisian terhadap pabrik pembuatan sabusabu di 3 lokasi berbeda di pulau Batam dan di satu tempat di Pluit, merupakan salah satu
bukti nyata yang menunjukkan bahwa kegiatan yang terkait dengan bisnis narkoba, kini telah
dilakukan
dalam
ukuran
skala
besar.
Terbongkarnya keberadaan pabrik narkotika di Batam dan Pluit dengan besaran omzet
mencapai angka 1,5 trilyun rupiah sudah cukup menjadi bukti yang menunjukkan bahwa para
pelaku bisnis narkoba tidak terpengaruh dengan adanya sanksi hukuman mati bagi mereka
yang
terlibat
dalam
bisnis
narkotika
di
wilayah
hukum
Indonesia.
Nampak jelas terlihat, ketika negara dalam proyeksi perang terhadap narkoba, apabila hanya
117

mengandalkan pada suatu aturan hukum yang dianggap bisa membuat jera para pelakunya, itu
semua
akan
bermakna
sia-sia
belaka.
Kinerja hukum tidak akan mencapai hasil yang diinginkan apabila tidak didukung oleh peran
aktif masyarakat dan adanya kerja keras aparat keamanan untuk memberantas kegiatan bisnis
narkoba
di
tanah
air.
Keempat, pada saat seluruh masyarakat Indonesia memprotes keras sikap Malaysia yang telah
memperlakukan Warga Negara Indonesia dengan tidak layak, MK justru bersikap sama, yaitu
dengan memperlakukan secara diskriminatif warga negara asing yang turut mengajukan upaya
pengujian
UU
No.
12
Tahun
1997
kepada
MK.
Dalam hal ini, MK seperti menganggap tidak ada para warga negara asing yang terlibat
kejahatan narkotika di Indonesia, karena sebagian hakim MK yang turut serta mengambil
keputusan, menilai keberadaan para warga negara asing tersebut sebagai pihak yang tidak
berhak
mencampuri
aturan
hokum
di
Indonesia.
Kalau MK dapat bersikap demikian kepada orang asing yang mempunyai masalah di Indonesia,
maka sebaiknya kita tidak mengambil sikap protes kepada Malaysia yang telah memperlakukan
sejumlah WNI dan TKI dengan tidak selayaknya karena itu sama artinya kita mencampuri
aturan
hukum
yang
berlaku
disana.
Memperhatikan keberadaan MK sebagai sebuah lembaga tinggi negara, seharusnya MK dapat
bersikap terbuka untuk menerima berbagai masukan sebagai bagian dari pemikiran berbagai
kelompok
masyarakat.
MK harus bersikap terbuka meskipun masukan yang disampaikan masyarakat berbentuk
kritikan, karena kritikan hadir sebagai upaya konstruktif untuk memperbaiki sesuatu hal yang
belum
terlihat
benar.
Dengan menepikan daya koreksi dari warga negara asing, itu sama artinya MK telah membuat
sebuah kondisi yang tidak nyaman bagi bangsa Indonesia karena hal yang sama bisa dilakukan
oleh
negara
asal
warga
Negara
asing
tersebut.
Kesimpulannya, dapat dikatakan, bahwa keputusan yang dibuat MK atas uji materi dari UU No.
22 Tahun 1997 tentang Narkotika terhadap Pasal 28 A dan Pasal 28 I UUD 1945, dapat
dikatakan sebagai sebuah keputusan yang tidak memperhatikan kenyataan yang ada serta ada
kesan
apa
yang
diputuskan
bersifat
opini
semata.
Keputusan MK tersebut justru melembagakan agar negara tidak memaafkan kesalahan yang
telah dilakukan para pelaku tindak kejahatan atau memberikan mereka kesempatan kedua
untuk
dapat
menunjukkan
rasa
penyesalan
mereka.
Ratifikasi tentang HAM yang diakui bangsa-bangsa di dunia, dalam keputusan tersebut seakan
tidak bermakna. Padahal, pernyataan yang disampaikan dalam Pasal 28 A dan Pasal 28 I dari
UUD 1945 adalah mengenai HAM. Sisi hati nurani sejumlah hakim yang membuat keputusan
tersebut nampaknya tidak ingin menggali lebih jauh bentuk hukuman yang dapat diberikan
kepada pelaku tindak kejahatan narkotika tanpa harus mengurangi kedudukan atau posisi
HAM
pada
setiap
insan
manusia.
Padahal, sanksi hukuman penjara seumur hidup lebih membuat para pelaku kejahatan
merasakan
beratnya
kesalahan
yang
telah
diperbuatnya.
118

Makin maraknya peredaran dan penggunaan narkoba, juga tidak menjadi titik perhatian MK,
bahwa UU No. 22 Tahun 1997 tentang Narkotika memang tidak cukup efektif lagi untuk
dijadikan
landasan
untuk
memerangi
narkoba
ditengah
masyarakat.
Salah satu upaya dan cara efektif untuk mengurangi adanya tindak kejahatan ditengah rakyat,
hanyalah melalui upaya peningkatan kesejahteraan dan adanya upaya pemerataan tingkat
kemakmuran rakyat. Tanpa adanya kesejahteraan rakyat, tindak kejahatan akan terus ada dan
berkembang.
China Paling Banyak Lakukan Eksekusi di Dunia

eksekusi mati di China(*abc/file)


Sepanjang tahun 2009 jumlah eksekusi yang dilakukan China lebih banyak daripada jumlah
gabungan eksekusi yang dilakukan negara lain di seluruh dunia. Demikian sebuah laporan
yang
diterbitkan
Amnesty
International.
Amnesty International mengatakan, ada ribuan eksekusi yang terjadi di China pada tahun
2009. Sedangkan jumlah aslinya tidak diberitahu, karea dianggap merupakan rahasia negara.
Berbagai kelompok HAM juga telah meminta Beijing mengungkapkan berapa banyak eksekusi
yang
telah
dilakukan.
Dikatakan, sedikitnya 714 orang dieksekusi di 17 negara-negara lain seperti Iran, Irak, Arab
Saudi dan Amerika Serikat. Metode pelaksanaan yang dilakukan antara lain adalah dengan
memenggal kepala, rajam, listrik, gantung, hukum tembak dan suntik mati.
Dalam laporannya tahun lalu, Amnesty mengatakan bahwa China telah menghukum mati
sekitar 1.718 orang pada tahun 2008, hampir tiga perempat dari 2.390 eksekusi di seluruh
dunia
pada
tahun-tahun
tersebut.
Pihak berwenang China menyatakan bahwa jumlah eksekusi lebih sedikit. Jika ini adalah
benar, mengapa mereka tidak mengatakan pada dunia berapa banyak orang yang telah
dihukum mati?, kata sekretaris jenderal Amnesty International, Claudio Cordone, sebagaiman
dilansir
The
New
York
Times,
Selasa.
Meskipun tidak lengkap, angka-angka dari Amnesty secara luas dapat diterima. Deplu AS,
misalnya,
telah
mengutip
temuan
kelompok
itu
dalam
laporan
HAM-nya.
Menurut laporan Amnesty terbaru, Iran telah mengeksekusi 388 tahun lalu. Sepertiganya lahir
dari protes tujuh minggu dan kekacauan pasca pemilihan presiden pada bulan Juni.
Sepanjang tahun 2009, untuk pertama kalinya Amnesty International mencatat tidak adanya
eksekusi di Eropa. Belarusia adalah satu-satunya negara Eropa yang masih memberlakukan
hukuman
mati.
Dua
minggu
lalu,
Rusia
mengeksekusi
dua
orang.
Mahkamah Konstitusi di Rusia juga memperbaharui moratorium hukuman mati pada bulan
November. Mengutip keputusan pengadilan, laporan Amnesty mengatakan bahwa jalan
menuju
penghapusan
penuh
hukuman
mati
tak
dapat
diubah.
Laporan Amnesty mengatakan AS telah mengeksekusi 52 orang, angka tertinggi dalam tiga
tahun. Hampir setengah eksekusi (24 eksekusi) berlangsung di Texas. Negara bagian New
Mexico
secara
resmi
telah
melarang
hukuman
mati.
Amnesty International yang telah lama menentang hukuman mati, mengatakan eksekusi
terus-menerus digunakan untuk tujuan politik. Persidangan yang berlangsung seringkali tidak
adil dan tidak proporsional terhadap kaum miskin, serta anggota ras, komunitas etnis dan
119

agama
minoritas.
Selain China, tujuh negara Asia lainnya dilaporkan telah melakukan 26 eksekusi tahun lalu:
Bangladesh, Jepang, Korea Utara, Malaysia, Singapura, Thailand dan Vietnam. India, Pakistan,
Afghanistan dan Indonesia tidak melakukan eksekusi.(*st/z)
Hukuman Mati Bagi Koruptor Bisa Diterapkan
TEMPO Interaktif, Jakarta -Menteri Hukum dan HAM Patrialis Akbar menyatakan hukuman
mati bagi para koruptor secara normatif sudah bisa diberlakukan di Indonesia.
Secara normatif, undang-undangnya ada kok, kata Patrialis saat mengunjungi Lembaga
Pemasyarakatan
Kedung
Pane,
Semarang,
Kamis
(8/4).
Politisi Partai Amanat Nasional itu menyebut aturan itu ada dalam Undang-Undang Nomor 20
Tahun 2001
tentang perubahan atas undang-undang Nomor 31 tahun 1999 tentang

Pemberantasan
Tindak
Pidana
Korupsi.
Patrialis menyatakan dalam undang-undang tersebut disebutkan jika ada ada orang yang
melakukan korupsi dalam keadaan tertentu maka bisa dihukum mati. Misalnya negara dalam
keadaan bencana tapi justru malah uangnya dikorupsi, kata dia. Selain itu, hukuman mati
juga bisa diterapkan bagi koruptor yang memanfaatkan uang negara padahal negara dalam
kondisi
krisis.
Menurut Direktur Jenderal Pemasyarakatan, Untung Sugiyono saat ini belum ada bukti yang
menunjukan adanya hukuman mati bagi koruptor bisa membuat jera pelaku korupsi. Kalau
itu
butuh
penelitian,
katanya.
Untung menilai, hingga kini memang belum ada koruptor yang berasal dari resividis.
Sebaliknya, pelaku korupsi dilakukan orang-orang yang punya kekuasaan besar tapi tidak ada
yang
mengawasinya.
Mengenai tindakan korupsi sendiri, Wakil Ketua KPK, Bibit Samad Rianto mengatakan bahwa
pelaku korupsi di Indonesia makin canggih dalam antisipasi penjebakan aparat hukum. Para
koruptor sudah sadar keberadaanya sudah menjadi target bidikan Komisi Anti Korupsi.
Mereka pasang alat anti sadap di ruangannya, sehingga alat KPK tidak deteksi sambungan
telephonenya, kata Bibit, Kamis (8/4). Koruptor tertangkap tangan KPK, menurutnya, belum
melengkapi dirinya dengan peralatan canggih anti penyadapan teleponnya. Kenapa yang
ditangkap
kecil
kecil,
karena
yang
kakap
canggih-canggih,
ungkapnya.
Karenanya, Bibit menyatakan ke depannya Komisi Anti Korupsi harus lebih memanfaatkan
kemajuan teknologi dalam membongkar tindak pidana korupsi. Sumber daya manusia (SDM)
penyidik KPK, katanya harus ditingkatkan dalam menyelidiki berbagai laporan tindak pidana
korupsi
masyarakat.
Sebelumnya, Ketua Majelis Permusyawaratan Rakyat Hidayat Nur Wahid yang mengusulkan
agar koruptor dihukum mati. Gagasan itu pun mendapat dukungan Kaukus Muda Partai
Demokrasi
Indonesia
Perjuangan.
Untuk menuntaskan masalah korupsi ini, pemerintah bisa belajar dari Cina. Dengan hukuman
yang sangat berat, dalam lima tahun kasus korupsi menurun drastis. Indonesia bisa belajar
dari
sana,
katanya
Ketua
Kaukus,
Abidin
Fikri.
MEDAN, KOMPAS.com Sosiolog Universitas Sumatera Utara (USU), Prof Dr Badaruddin,
MA, berpendapat, tuntutan hukuman mati lebih tepat diterapkan kepada terdakwa pelaku
koruptor
ketimbang
terdakwa
pembunuh.
"Koruptor itu perbuatannya jelas menghancurkan perekonomian negara dan uang rakyat bila
dibandingkan dengan seorang terdakwa pembunuh hanya merugikan satu keluarga," kata
Badaruddin
di
Medan,
Selasa
(26/1/2010).
Hal tersebut dikatakannya ketika dimintai komentarnya mengenai mantan Ketua Komisi
Pemberantasan Korupsi Antasari Azhar yang dituntut hukuman mati terkait pembunuhan
terhadap
Direktur
PT
Putra
Rajawali
Banjaran
Nasrudin
Zulkarnaen.
Badaruddin mengatakan, memang penerapan hukuman mati masih tetap diberlakukan di
Indonesia
dan
belum
dihapus.
Namun, penerapan hukuman mati juga harus dilihat kasusnya dan lebih tepat dilaksanakan
terhadap gembong narkoba dari luar negeri atau teroris karena perbuatan tersebut sangat
120

membahayakan
dan
berdampak
terhadap
negara.
Dengan penerapan hukuman mati terhadap pengedar narkoba atau teroris, dapat membuat
efek jera bagi pelaku lainnya sehingga tidak mengulangi lagi perbuatan melanggar hukum.
"Jadi, penerapan hukuman mati terhadap pelaku pembunuhan yang telah menghilangkan
nyawa
orang
lain
juga
perlu
dipertimbangkan,"
katanya.
Badaruddin mengatakan, penerapan hukuman mati terhadap terdakwa pembunuh juga perlu
dilihat kasusnya, apakah itu dilakukan terhadap satu orang atau orang banyak.
"Para penegak hukum juga diharapkan harus benar-benar jeli dalam menerapkan hukuman
mati kepada seorang terdakwa pembunuh, hal ini juga menyangkut kemanusian," kata
Badaruddin yang juga guru besar FISIP USU.
Lewat juru bicara kepresidenan Andi Malarangeng, Presiden Susilo Bambang Yudhoyono
menyatakan bahwa pemerintah tidak menutup kemungkinan dijatuhkannya hukuman mati
terhadap para koruptor.
Andi mengatakan, peluang ke arah itu terbuka lebar setelah dilakukan perubahan atas
Undang-Undang Nomor 31 Tahun 1999 Tentang Pemberantasan Tindak Pidana Korupsi
sebagaimana dinyatakan Undang-Undang Nomor 20/2001.
Pasal 2 ayat 2 di undang-undang itu menyebutkan: Dalam hal tindak pidana korupsi
sebagaimana dimaksud dalam ayat (1) dilakukan dalam keadaan tertentu, pidana mati dapat
dijatuhkan.
Tentu, para ahli hukum bisa melakukan interpretasi hukum atas ayat itu. Dan, interpretasi
yang mengarah pada penerapan hukuman mati untuk koruptor pun tidak lagi mustahil.
Pro kontra terkait perlunya hukuman mati diterapkan bagi koruptor, memang, masih ramai.
Pihak yang kontra berpegang pada prinsip HAM. Menurut mereka, masih ada bentuk hukuman
lain yang juga bisa menimbulkan efek jera. Hukuman berupa kurungan badan seumur hidup,
misalnya.
Pihak yang pro, tentu, lebih banyak. Khususnya dari kalangan publik. Sebab, fakta
menunjukkan betapa negeri ini makin lama makin mengarah ke jurang kehancuran dan
korupsi jadi salah satu penyebab utamanya.
Sebagaimana pernah dinyatakan Gunnar Myrdal, Indonesia adalah negara lemah dan terlalu
permisif terhadap berbagai kelemahan yang menghancurkan. Di negeri ini, tak pelak,
berkembang biak korupsi di segala lapisan kehidupan sehari-hari.
Publik sesungguhnya sudah lelah dan muak. Kerap kali koruptor dijerat, tapi tak berapa lama
kemudian kembali merajalela.
Siapapun yang pelaku tindak korupsi harus dibikin kapok, kata Denny Indrayana, pengamat
dan doktor hukum dari UGM. Ia termasuk yang berada di garda terdepan menyuarakan
koruptor harus dihukum mati. Ia yakin, jika hukuman itu diberlakukan, orang akan lebih takut
melakukan korupsi.
Kini, ketika proses hukum terhadap terdakwa kasus korupsi masih saja tarik ulur, bahkan bisa
juga terjadi jungkir balik, yang namanya penyalahgunaan wewenang itu terus menjalar. Di
tingkat parlemen, para wakil rakyat yang terhormat itu, malah terbongkar pula praktik korupsi
berjamaah.
Kontradiksi kondisi itu betul-betul menyakitkan. Ketika rakyat kebanyakan mengais rezeki
untuk sekadar hidup dengan kerja keras nyaris sepanjang waktu, di bagian lain ada yang
berkipas-kipas menikmati hasil jarahan atas uang negara yang notabene juga uang rakyat.
Dalam soal ini, tak perlu bangsa ini malu berkaca kepada China. Ketika dilantik jadi
Perdana Menteri China pada 1998, Zhu Rongji menyatakan, Berikan saya 100 peti
mati, 99 akan saya kirim untuk para koruptor. Satu buat saya sendiri jika saya pun
melakukan hal itu.
121

Zhu tidak asal bicara. Cheng Kejie, pejabat tinggi Partai Komunis China, dihukum
mati karena terlibat suap US$ 5 juta. Tanpa ampun. Permohonan banding Wakil
Ketua Kongres Rakyat Nasional itu ditolak pengadilan.
Zhu di awal tugasnya mengirim peti mati kepada koleganya sendiri. Hu Chang-ging,
Wakil Gubernur Provinsi Jiangxi, pun kebagian peti mati itu. Ia ditembak mati
setelah terbukti menerima suap berupa mobil dan permata senilai Rp 5 miliar.
Hingga sepuluh tahun ini, mungkin telah ribuan peti mati terpakai sebagai wadah
terakhir jasad para koruptor di China. Bukan hanya bagi para pejabat korup, tapi
juga pengusaha, bahkan wartawan.
Ketegasan pemerintah China membuat para kera pengembat duit rakyat menggigil
jeri. Negara sebesar AS pun sering harus meminta denganhalus kepada mereka.
Salah satunya ketika AS minta China merevisi nilai yuannya.
Hasil dari ketegasan itu, China kini jadi negara sehat dan kaya raya. Semua berkat
kerja keras dalam menata perekonomian sekaligus membersihkan negara dari
korupsi. Di semester I 2008, China mencatat pertumbuhan ekonomi hingga 10%
lebih. Pada 2003 saja, devisa mereka mencapai US$ 300 miliar.
Jadi, sepatutnya pemerintah tak ragu lagi. Sepatutnya koruptor dihukum mati sebelum negeri
ini dibuat makin lemah oleh korupsi, lalu hanyut terseret arus kehancuran.

PALEMBANG - Jika pada tahun-tahun sebelumnya, Ujian Nasional (UN) merupakan syarat mutlak untuk kelulusan
siswa sehingga menjadi momok yang menakutkan bukan saja bagi siswa tapi sekolah terutama orangtua maka untuk
tahun kelulusan 2011, UN bukan lagi menjadi standar mutlak. "UN bukan satu-satunya standar kelulusan tetapi salah
satu dari beberapa persyaratan lain," kata Kepala Dinas Pendidikan Pemuda dan Olahraga (Disdikpora) Kota
Palembang,
Drs
H
Riza
Fahlevi
MM,
Selasa
(19/10).
Menurut Riza, berdasarkan Edaran dari Departemen Pendidikan Nasional bahwa untuk menentukan kelulusan siswa
harus dipenuhi beberapa persyaratan seperti nilai harian, tugas-tugas yang diberikan guru/sekolah, keaktifan siswa
serta hasil UN. Diakui Riza, kabupaten/kota dengan dikoordinasi Provinsi akan menentukan standar nilai yang sesuai
dengan kemampuan dan tidak jauh dari level yang ditetapkan secara nasional. Terkait persiapan kota Palembang,
diakui Riza, sampai saat ini pihaknya siap saja. Artinya segala sesuatu sesuai ketentuan Pusat sebagai persyaratan akan
dipenuhi
dan
disosialisasikan.
"Sekarang kewenangan sudah diserahkan kepada masing-masing sekolah atau school base management, kita hanya
memberikan pengarahan saja. Saat ini sekolah-sekolah sudah ada yang melakukan berbagai aktivitas persiapan UN
seperti
menggelar
try
out
atau
jam
tambahan
pelajaran,"
kata
Riza.
Sumber:
sripoku.com
See
more
at:
http://www.kesekolah.com/artikel-dan-berita/berita/un-bukan-mutlak-standarkelulusan.html#sthash.zUrmS9HN.dpuf
akarta Selaku Menteri Pendidikan dan Kebudayaan, Anies Baswedan dengan tegas mengungkapkan bahwa
seharusnyakonsentrasi atas kualitas pendidikan dilakukan secara menyeluruh. Tidak hanya memandang dari satu
indicator yaitu dari Ujian Nasional.

122

Anies menyatakan bahwa sebenarnya UN dilakukan untuk mengetahui evaluasi atas pencapaian siswa,
penyelenggaraan serta pemerataan mutu pendidikan. Bahkan Mantan Rektor Universitas Paramadina ini menyebutkan
dengan diubahnya UN maka dapat mendorong pendidikan menjadi standar minimum nasional dalam perbaikan.
Dalam keterangan persnya, Jumat (23/1/2015), Anies mengungkapkan bahwa memang benar kita ingin siswa
mendorong pendidikannya, mendorong guru selesaikan kompetensinya minimum nasional dan dapat dipakai standar
wilayah.
Namun kenyataan yang ada dilapangan adalah mereka menjadi stres dan tertekan. Terkait dengan hal tersebut
Kemendikbud berjanji akan melakukan perubahan dan perbaikan. Untuk yang pertama adalah dengan memperbaiki
mutu alat pengukur bukan hanya UN.
Sedangkan yang kedua adalah dengan memberikan otonomi daerah untuk dapat mengurangi tekanan. Dengan cara
memisahkan UN dari kelulusan. Langkah ketiga adalah dengan memperbaiki sistem penilaian lebih bermakna dan UN
wajib diambil satu kali oleh siswa.
Dengan demikian Ujian Nasional cakupannya lebih luas. Dengan demikian rencana perubahan UN mencakup bahwa
nantinya UN bukan sebagai acuan kelulusan. Yang kedua, kelulusan tidak hanya diputuskan dari sekolah saja, namun
juga mempertimbangkan proses pembelajaran. (Rindi Ayunda sisidunia.com
Ketua Ikatan Sarjana Pendidikan Indonesia (ISPI) Soedijarto berpendapat bahwa ujian nasional (UN) sebaiknya bukan
untuk mengukur standar kelulusan. "UN itu bukan untuk kelulusan, tapi untuk seleksi atau mapping mutu
pendidikan,"
katanya
saat
diskusi
tentang
UN
di
wisma
Kodel
Kuningan
Jakarta.
Jadi, kata dia, ujian nasional fungsinya memetakan sekolah yang masih kurang standar mutunya. Dia juga menilai
program wajib belajar pemerintah yang dinilainya salah kaprah,"Indonesia belum ada wajib belajar, karena wajib kok
tidak
ada
sanksinya,"
selorohnya.
Sedangkan pakar pendidikan dari Universitas Negeri Jakarta H A R Tilaar menilai bahwa penyelenggaraan ujian
nasional banyak menyedot anggaran pemerintah,"berapa miliar yang dikeluarkan untuk ujian nasional, apa itu
program nasional pendidikan kita," ujarnya. - See more at: http://www.kesekolah.com/artikel-dan-berita/berita/ujiannasional-dianggap-bukan-untuk-kelulusan.html#sthash.qs7pdl8a.dpuf
Ujian Nasional
Ujian Nasional biasa disingkat UN / UNAS adalah sistem evaluasi standar pendidikan dasar dan menengah secara
nasional dan persamaan mutu tingkat pendidikan antar daerah yang dilakukan oleh Pusat Penilaian Pendidikan,
Depdiknas di Indonesia berdasarkan Undang-Undang Republik Indonesia nomor 20 tahun 2003 menyatakan bahwa
dalam rangka pengendalian mutu pendidikan secara nasional dilakukan evaluasi sebagai bentuk akuntabilitas
penyelenggara pendidikan kepada pihak-pihak yang berkepentingan. Lebih lanjut dinyatakan bahwa evaluasi
dilakukan oleh lembaga yang mandiri secara berkala, menyeluruh, transparan, dan sistematik untuk menilai
pencapaian standar nasional pendidikan dan proses pemantauan evaluasi tersebut harus dilakukan secara
berkesinambungan.
Proses pemantauan evaluasi tersebut dilakukan secara terus menerus dan berkesinambungan pada akhirnya akan dapat
membenahi mutu pendidikan. Pembenahan mutu pendidikan dimulai dengan penentuan standar.
Penentuan standar yang terus meningkat diharapkan akan mendorong peningkatan mutu pendidikan, yang dimaksud
dengan penentuan standar pendidikan adalah penentuan nilai batas (cut off score). Seseorang dikatakan sudah
lulus/kompeten bila telah melewati nilai batas tersebut berupa nilai batas antara peserta didik yang sudah menguasai
kompetensi tertentu dengan peserta didik yang belum menguasai kompetensi tertentu. Bila itu terjadi pada ujian
nasional atau sekolah maka nilai batas berfungsi untuk memisahkan antara peserta didik yang lulus dan tidak lulus
disebut
batas
kelulusan,
kegiatan
penentuan
batas
kelulusan
disebut
standard
setting.
Manfaat pengaturan standar ujian akhir:
Adanya batas kelulusan setiap mata pelajaran sesuai dengan tuntutan kompetensi
minimum.

123

Adanya standar yang sama untuk setiap mata pelajaran sebagai standar minimum
pencapaian kompetensi.

Artikel utama untuk bagian ini adalah: Standar Nasional Pendidikan


Selama ini penentuan batas kelulusan ujian nasional ditentukan berdasarkan kesepakatan antara pengambil keputusan
saja. Batas kelulusan itu ditentukan sama untuk setiap mata pelajaran. Padahal karakteristik mata pelajaran dan
kemampuan peserta didik tidaklah sama. Hal itu tidak menjadi pertimbangan para pengambil keputusan pendidikan.
Belum tentu dalam satu jenjang pendidikan tertentu, tiap mata pelajaran memiliki standar yang sama sebagai standar
minimum pencapaian kompetensi. Ada mata pelajaran yang menuntut pencapaian kompetensi minimum yang tinggi,
sementara mata pelajaran lain menentukan tidak setinggi itu. Keadaan ini menjadi tidak adil bagi peserta didik, karena
dituntut melebihi kapasitas kemampuan maksimalnya.
Strategi perancangan
Penyusunan standard setting dimulai dengan penentuan pendekatan yang digunakan dalam penentuan standar. Ada
tiga macam pendekatan yang dapat dipakai sebagai acuan yaitu:

Penentuan standar berdasarkan kesan umum terhadap tes.

Penentuan standar berdasarkan isi setiap soal tes.

Penentuan standar berdasarkan skor tes.

Pada tiap-tiap akhir tahun kegiatan belajar diambil kesimpulan dan pembukuan standar setting berdasarkan tiga
pendekatan tersebut untuk menentukan batas kelulusan.
Kontroversi
Penentuan kelulusan ujian nasional 2011
Badan Standardisasi Nasional Pendidikan (BSNP) bersama Kementerian Pendidikan Nasional dan Komisi X DPR
memutuskan, tahun 2011 tetap ada Ujian Nasional (UN). Pelaksanaannya direncanakan pada April dan Mei 2011,
mundur sebulan dibanding tahun 2010 yang dilaksanakan Maret-April. Sedang standar nilai UN pada tahun ini
direncanakan masih sama dengan tahun lalu, yakni 5,50 untuk SMP/SMA. Meski hingga tulisan ini dipublikasikan
belum ada kepastian melalui peraturan menteri (permen) perihal Ujian Nasional, namun beberapa informasi seputar
UN 2011 mulai beredar. Informasi itu misalnya terkait dengan formula kelulusan dan seputar jadwal UN yang oleh
pemerintah ditujukan sebagai sosialisasi kepada khalayak. Untuk formula kriteria kelulusan tahun ini, pemerintah
menggunakan formula baru. Kelulusan siswa dari sekolah dengan melihat nilai gabungan rencananya dipatok minimal
5,50. Nilai gabungan merupakan perpaduan nilai UN dan nilai sekolah untuk setiap mata pelajaran UN.

Nilai sekolah dihitung dari nilai rata-rata ujian sekolah dan nilai rapor semester 1-5 untuk tiap mata pelajaran UN.
Dengan formula baru ini, rencananya akan dipatok nilai tiap mata pelajaran minimal 4,00. Integrasi nilai UN dan nilai
sekolah ini diharapkan jadi pendorong untuk menganggap penting semua proses belajar sejak kelas 1 hingga kelas 3.
Sedangkan kriteria kelulusan ujian sekolah diserahkan kepada sekolah. Nilai sekolah merupakan nilai rata-rata dari
ujian sekolah dan nilai rapor semester 1-5 setiap mata pelajaran yang tidak diujikan dalam UN. Sementara itu, jadwal
UN semula dalam tulisan penulis posting akan dilaksanakan bulan Mei 2011 berubah menjadi bulan April 2011. Ujian
nasional (UN) utama untuk SMA/SMK digelar pada minggu ketiga April 2011, sedangkan untuk SMP pada minggu
keempat April 2011. Adapun UN susulan bagi mereka yang belum mengikuti UN utama dilaksanakan satu minggu
kemudian. Selain itu, untuk UN 2011 ujian ulangan bagi siswa yang tidak lulus ditiadakan. Oleh karena itu, bagi siswa
yang dinyatakan tidak lulus harus mengikuti ujian kembali pada tahun berikutnya.
124

JAKARTAMI: Angka kelulusan Ujian Nasional (UN) di Sekolah Menengah Pertama (SMP) tahun 2010 semakin
buruk. Ini sama halnya seperti UN Sekolah Menengah Atas (SMA).
UN SMP 2010 jeblok dan turun cukup signifikan dibanding UN 2009, yaitu dari 95,05 persen menjadi 90,27 persen.
Padahal bila merujuk dari anggaran, anggaran pendidikan dari APBN semakin meningkat setiap tahunnya. Produk
kelulusan yang semakin menurun yang tidak sebanding dengan anggaran pendidikan yang semakin meningkat,
menurut pengamat pendidikan sekaligus Guru Besar Universitas Negeri Jakarta (UNJ) Arief Rachman, harus dilihat
dari tujuan diadakan Ujian Nasional (UN). Arief mengatakan, terdapat lima tujuan diadakannya UN, yakni memacu
perbaikan pendidikan di Indonesia, melakukan pemerataan pendidikan di Indonesia, meningkatkan kinerja guru
maupun murid dalam proses pendidikan, membuat ujian bagi anak-anak, meningkatkan persaingan antarsekolah
seluruh indonesia.
Dikatakan Arief, UN memang terbukti dapat meningkatkan mutu pendidikan, melakukan pemetaan, memperbaiki
kinerja proses pembelajaran, serta meningkatkan persaingan antarsekolah. Namun, yang harus diperbaiki adalah cara
menilai keberhasilan pembelajaran anak dan standar yang dipakai untuk kelulusan itu lah yang keliru. Harusnya
memakai standar norma dan bukan standar mutlak yang jelas melanggar sistem keadilan, kata Arief.
Standar mutlak hanya memakai satu kriteria yang disamakan untuk seluruh daerah di Indonesia. Standar norma
melihat kemampuan anak di masing-masing daerah. Standar setiap daerah tidak dapat disamakan.
Arief menambahkan, rumusan kelulusan UN tidak boleh ditentukan oleh mata pelajaran yang diujikan di UN saja
melainkan harus dijadikan satu dengan budi pekerti, akhlak mulia, dan moral siswa. Sebaiknya yang menentukan
kelulusan adalah pihak sekolah yang berhubungan langsung dengan siswa, baik itu kepala sekolah maupun dewan
guru.
Meski tidak sejalan antara tingkat kelulusan siswa dengan anggaran UN yang semakin meningkat, namun UN harus
tetap diteruskan dengan penyempurnaan proses perumusan kelulusan standar norma. Pemerintah boleh saja
menetapkan standar minimal kelulusan, tetapi kelulusan harus dilihat dari rata-rata daerah masing-masing. Siswa di
Wamena, Papua, tidak sama dengan siswa Jakarta. Siswa Jakarta Pusat tidak sama dengan siswa di pinggiran Jakarta,
ujar Arief.
Bagi Arief, diadakannya ujian yakni ujian sekolah, lokal, maupun nasional itu perlu dan penting. Ujian wajib
dilakukan karena tidak ada proses pendidikan tanpa evaluasi akhir untuk mengetahui apakah siswa berprestasi atau
tidak dan untuk proses melanjutkan ke jenjang yang lebih tinggi.
Arief juga memperkirakan, rendahnya angka kelulusan dapat disebabkan karena soal UN yang lebih sulit, siswa
angkatan tahun ini lebih buruk dibandingkan dari tahun lalu, serta pelaksanaan UN tahun 2010 ini berlangsung lebih
jujur. (*/OL-04)
JAKARTA - Meski ujian nasional baru akan berlangsung April 2011 mendatang, Badan Standar Nasional Pendidikan
(BSNP) sudah merencanakan standar kelulusan siswa. Salah satu ketentuannya menyatakan bahwa nilai unas bukan
satu-satunya penentu kelulusan siswa. Meski begitu, ujian nasional masih menjadi persyaratan siswa untuk
melanjutkan
pendidikan
ke
jenjang
yang
lebih
tinggi.
Kepala BSNP Djemari Mardapi mengatakan, keputusan itu disesuaikan dengan Peraturan Pemerintah nomor 19 tahun
2005 tentang standar nasional pendidikan (SNP). Khususnya pada pasal 72 ayat satu yang menyatakan bahwa
kelulusan peserta didik tidak hanya dinilai dari hasil unas semata. "Masih ada tiga kriteria lain yang harus diperhatikan
oleh
sekolah
untuk
bisa
menentukan
siswa
itu
lulus
atau
tidak,"
katanya.
Djemari menjelaskan, tiga kriteria selain nilai unas antaralain menyelesaikan program pembelajaran, lulus ujian
sekolah, dan perolehan nilai baik pada semua mata pelajaran, juga akhlak mulia, kewarganegaraan, kepribadian,
setetika, jasmani, kesehatan, dan olahraga. "Penilaiannya dalam bentuk tertulis, tes perbuatan, dan pengamatan,"
tandasnya.
Kata Djemari, setiap nilai memiliki keriteria nilai kelulusan masing-masing. Yaitu ada batas lulus untuk tiap
125

komponen penilaiannya. Ketentuan nilainya diberikan oleh masing-masing pengajar di sekolah. "Oleh karena itu tidak
benar
bila
dikatakan
hanya
unas
yang
menentukan
kelulusan,"
ujarnya.
Menurut Djemari, meski ketentuan sudah disusun sejak lama tapi tidak banyak masyarakat yang memahaminya.
Sebab,kebanyakan siswa menjadikan unas sebagai momok dari akhir evaluasi pembelajarannya. "Bisa saja, siswa
yang lulus unas tetap dinyatakan tidak lulus sekolah oleh pihak sekolahnya," terang Djemari.
Wakil mendiknas Fasli Jalal menambahkan, meski sudah memiliki panduan rencana unas satuan pendidikan dasar dan
menengah tahun ajaran 2010/2011 baru. Kemendiknas tetap menggunakan standar nilai yang sama dengan tahun lalu
yakni 5,5 pada setiap mata pelajaran. "Ini standar paling normal menurut kami," ungkapnya.
Fasli menegaskan, penentuan standar nilai itu belum bisa dinaikkan hingga standar pelayanan minimun (SPM)
pendidikan di setiap daerah sudah sama. "Sekarang kan masih belum merata, dan ini butuh waktu. Karena sedang
kami
tingkatkan
daerah
mana
belum
sesuai
SPM-nya,"
lanut
Fasli.
Mengenai kelulusan sekolah, Fasli mengaku tetap memberlakukan kelulusan sekolah sebagai syarat masuk siswa ke
jenjang pendidikan yang lebih tinggi. "Kalau dia lulus unas tapi tidak lulus sekolah, tetap tidak bisa mendaftar ke
jenjang
selanjutnya,"
tambah
mantan
Dirjen
Dikti
itu.
Sebelumnya, BSNP mengumumkan jadwal unas SMA,MA, SMALB, dan SMK pada 4 hingga 9 April 2011.
Dijadwalkan pula unas ulangan untuk jenjang tersebut pada 23-27 Mei 2011. Sementara jadwal unas SMP, Mts, dan
SMPLB dijadwalkan berlangsung pada 11 hingga 14 April 2011. Dan unas ulangan dijadwalkan pada 23 hingga 26
Mei 2011. Sedangkan Ujian akhir sekolah berstandar nasional (UASBN) berlangsung pada 2011.
Sumber: jpnn.com - See more at: http://www.kesekolah.com/artikel-dan-berita/berita/nilai-unas-bukan-penentukelulusan.html#sthash.1Q9SYr7F.dpuf
Sekarang ini Ujian Nasional sudah terkenal sebagai ujian hidup-mati secara ekstrim (untuk SMA/ SMP) di
Indonesia. Ini sangatlah ekstrim, Karena ujian yang dilaksanakan hanya beberapa hari dan ternyata semua
itu menentukan Pendidikan masa depan seorang murid. Secara tidak langsung, UN merupakan standard
kelulusan seorang siswa dalam akademik. Sungguh kurang pas, apabila seorang murid dinyatakan tidak
lulus sekolah bila ada salah satu mata pelajarannya yang tidak memenuhi standar nilai kelulusan. Dengan
demikian, seharusnya UN menjadi sebuah metode untuk memetakan pendidikan di Indonesia ini bukan
menjadi sebuah standarisasi kelulusan seorang siswa. Alasan mengapa UN tidak harus ditafsirkan sebagai
standar kelulusan seorang siswa, akan diceritakan dalam alasan-alasan berikut.
Sebenarnya Indonesia belumlah cukup memadai bilamana UN dilaksanakan. Entah itu dari segi
sumber daya manusianya, sarana-prasarana, maupun pemerataan pendidikan itu sendiri yang belum
terwujudkan hingga ke pelosok-pelosok desa. Hal ini merupakan salah satu mengapa UN janganlah
dijadikan sebagai tolak ukur kemampuan siswa. Contoh, apakah pendidikan di Papua atau tempat-tempat
tak tersentuh lainnya sudah sama dengan Jakarta ? Jelas belum khan. Misalnya Jakarta ini ilmunya sudah
sampai Surabaya dan mau menuju Bali, lain halnya dengan pelosok-pelosok desa atau Papua yang bisa jadi
ilmunya pun masih di Bandung atau belum ada setengahnya sama sekali. Mungkin di Papua masih belajar
menulis dan membaca, tapi di Jakarta mungkin sudah sampai belajar linguistic, phonetics dan sebagainya.
Inilah yang menjadi sebuah dilema tatkala pemerataan ini belum benar-benar terwujudkan secara
keseluruhan. Dan juga dari segi guru-guru, tak semua guru di Indonesia ini sama kwalitasnya. Ada guru
yang ditugaskan ke pelosok guna membangun pendidikan di sana sehingga tidak mengacu pada UN
sedikitpun atau mungkin ilmunya juga belum sama dengan guru-guru yang di kota-kota. Ini merupakan
indikasi bahwa UN tidak bisa dijadikan tolak ukur kecerdasan seorang siswa dan bukan untuk menentukan
tingkat kelulusan siswa, melainkan sebagai acuan untuk mengukur mutu dan kualitas pendidikan di suatu
daerah. Apabila hasil UN rendah, maka mutu pendidikan di sekolah tersebut harus diperbaiki dengan
menambah anggaran dan tenaga guru yang memadai. Sementara bila hasil UN tinggi, maka mutunya tetap
dipertahankan, bila perlu ditingkatkan dengan dana yang memadai. Inilah PR yang harus digarap oleh
pemerintah guna memperbaiki keadaan sekarang ini.
Bila UN ini dilihat dari segi dampak, maka UN ini ternyata memberikan dampak yang cukup sangat
negative yang sangat besar. Terlebih-lebih para siswa/i yang mana mereka ini menjadi pelaku UN itu
sendiri, sehingga bila terjadi apa-apa maka merekalah orang pertama yang mendapatkannya. UN adalah
126

persoalan para siswa, sebab yang akan dirugikan dengan adanya polemik ini adalah siswa. Para siswa bisa
terkena tekanan psikologis dengan adanya polemik ini. Indonesia terlihat kurang moralnya bila hanya
mengacu pada UN. Semua orang sudah mengetahui bahwa terdapat sebuah rahasia umum tentang UN.
Akibat UN dijadikan sebagai penentu kelulusan, dalam pelaksanaannya UN memberi dampak yang cukup
negatif sebagai pembunuhan karakter siswa dengan melakukan berbagai cara agar dapat menjawab soalsoal UN. Siswa dengan terpaksa menyontek, guru terpaksa memberi kunci jawaban, padahal kepala sekolah
dan kepala daerah mati-matian menjaga mutu pendidikan di sekolah dan daerahnya. Bahkan, dengan
penerapan UN sekarang ini, semua sekolah di Indonesia berlomba-lomba memberikan jawaban ujian
kepada siswa, karena takut anak didiknya banyak tidak lulus. Semua itu berdasarkan karena rasa takut bila
tidak lulus dan merupakan sebuah aib besar yang akan membuat malu pihak sekolah bila banyak siswanya
yang tak lulus, maka memungkinkan sekali hal ini dapat terjadi di mana-mana. Tidak hanya itu saja
ternyata UN dapat membuat stress para siswa maupun orangtua murid, baik itu sebelum UN maupun
setelahnya. Sebelum UN, banyak siswa yang stress karena takut akan tidak lulus atau gerogi dan
semacamnya. Pasca UN, bagi mereka yang kedapatan tidak lulus ternyata membuat mereka stress berat
dan bahkan sampai ada yang bunuh diri karena saking malunya atau saking stressnya tidak lulus. Begitu
juga halnya dengan para orang tua, sebagian ada yang menjadi stress karena malu kalau anaknya tidak
lulus sehingga membuatnya stress. Faktor malu inilah yang membuat dampak-dampak psikologis bagi sang
murid maupun sang wali. Sungguh memalukan sekali, bila terdapat orang yang bunuh diri lantaran tidak
lulus ujian. Polemik inilah yang benar-benar harus dibenahi oleh pemerintah guna tak ada lagi pihak yang
harus dirugikan di kemudian hari.
Apakah UN sebagai media untuk tindakan criminal? Bisa iya dan juga bisa tidak. Polemik yang
terjadi tatkala menghadapi UN membuat sebagian lapisan masyarakat terkadang gelap mata demi tidak
tercorengnya muka mereka kalau-kalau mengetahui tidak lulus UN. Sebagian siswa ada yang melakukan
pencontekan nasional. Contohnya saja; mereka membeli soal dari pihak yang terkait dengan memberikan
sejumlah uang guna mendapatkan predikat LULUS. Secara tidak langsung ini merupakan tindakan
criminal yang mencoreng muka bangsa sendiri. Di satu sisi sang siswa berada dalam posisi terjepit sehingga
mereka membeli soal guna kebutuhan mereka yaitu LULUS. Di sisi lain sang penyuplai soal bocoran
melakukan hal sama lantaran kekurangan uang atau mungkin sudah merupakan kebiasaannya. Apakah ini
tidak sama dengan mencoreng muka bangsa sendiri? Di satu sisi pemerintah berusaha terus meningkatkan
taraf pendidikan di negeri ini. Tetapi, di sisi lain ada oknum-oknum yang sengaja merusak semua itu. Oleh
sebab itu, UN bisa menjadi tempat untuk melakukan tindakan criminal. Ini termasuk perbuatan tercela
yang tidak pas dengan bangsa kita yang mempunyai sifat budi luhur. Dengan demikian banyaknya kasus
lantaran berlangsungnya UN, alangkah lebih baiknya bila UN ditiadakan saja. Atau jangan jadikan UN
sebagai sebuah standar kelulusan. Akan tetapi jadikanlah UN sebuah pemetaan mutu pendidikan di negeri
kita ini.
Membicarakan tentang UN secara umum, maka tentu saja ada solusi yang paling tidak akan
membuat perubahan di dunia pendidikan tanah air. Jangan jadikan UN sebagai standard kelulusan seorang
siswa tetapi jadikanlah UN sebagai peta pendidikan di Tanah Air. Secara otomatis maka UN harus
ditiadakan guna menghindari dampak negative yang akan timbul nantinya. Dengan demikian kelulusan
seorang siswa itu tetap berada dalam wewenang kepala daerahnya masing-masing, yang mengacu pada
salah sau UU Sisdiknas. Sehingga, kelulusan tetap ditentukan pihak sekolah melalui persetujuan kepala
daerahnya berdasarkan Undang Undang Sistem Pendidikan Nasional (UU Sisdiknas) No. 20 Tahun 2003
Pasal 58 ayat 1 menyatakan bahwa Evaluasi hasil belajar peserta didik dilakukan oleh pendidik untuk
memantau proses, kemajuan, dan perbaikan hasil belajar peserta didik secara berkesinambungan. Selain
itu juga, ternyata UN ini membutuhkan dana yang sangat tidak kecil untuk pelaksanaannya. Mulai dari
pendistribusian soal-soalnya, pembuatan soal-soalnya, sampai ke pakar pendidiknya. Sehingga, bila UN ini
ditiadakan, maka alokasi dana UN ini bisa digunakan untuk peningkatan kesejahteraan guru tetap maupun
guru bantu, perbaikan serta pembangunan gedung sekolah dan lain-lain guna mengefektifkannya
pembelajaran di sekolahnya. Dengan demikian UN tidak akan menjadi momok yang menakutkan, justru
menjadi suatu evaluasi bagi DEPDIKNAS agar pendidikan di Indonesia bisa setaraf dengan Negara maju
lainnya.
Ujian nasional (UN) 2014 beberapa hari lagi akan segera diselenggarakan untuk jenjang SMA/
SMK. Mungkin masih ada diantara kita yang masih bertanya-tanya apa sebenarnya manfaat
UN? Selain sebagai salah satu penentu kelulusan seorang siswa pada suatu satuan
pendidikan. Penyelenggaraan UN selain sebagai salah satu penentu kelulusan, Ujian Nasional
127

juga dimanfaatkan untuk tiga hal lainnya, yaitu pemetaan, seleksi ke jenjang yang lebih
tinggi, dan untuk pemberian bantuan atau afirmasi ke daerah. UN dijadikan sebagai standar
nasional dalam melakukan pemetaan terhadap mutu sekolah seperti halnya delapan Standar
Nasional Pendidikan (SNP).
Sebagai pemetaan mutu sekolah penyelenggaraan UN sangat penting untuk mengetahui
apakah sekolah itu sudah memenuhi standar nasional atau berada di bawah. Dengan
menggunakan standar itu kita bisa mengukur mutu sekolah Dari hasil UN, setiap sekolah
mendapatkan semacam rapor yang memperlihatkan mutu sekolah tersebut dengan melihat
perolehan nilai siswanya dalam UN. Rekapitulasi nilai UN setiap sekolah tidak hanya sampai
pada mata pelajaran, tetapi sampai pada sub kompetensi mata pelajaran.
Hasil UN juga menentukan seorang siswa untuk melanjutkan ke jenjang perguruan tinggi
khususnya perguruan tinggi negeri karena mulai tahun 2014 hasil UN terintegrasi dengan
Seleksi nasional Masuk Perguruan Tinggi Negeri (SNMPTN). Jadi hasil UN juga menentukan
apakah seorang siswa diterima atau tidak di suatu perguruan tinggi negeri
Hasil UN juga digunakan sebagai evaluasi sekolah. Misalkan jika nilai rata-rata yang diperoleh
sekolah saat UN berada di bawah nilai rata-rata kabupaten, berarti sekolah tersebut harus
mendapat perhatian khusus. Sedangkan jika nilainya berada di atas rata-rata provinsi,
sekolah
tersebut
bisa
menjadi
sekolah
percontohan.
Karena itu, UN sangat penting untuk dilaksanakan karena hasilnya bisa dijadikan sebagai
pemetaan dan evaluasi sekolah. Dengan begitu, sekolah bisa memiliki potret dirinya, dan
mengukur mutu sekolahnya, sehingga bisa memperbaiki diri sesuai pemetaan dari hasil UN.
Ujian Nasional. Kata-kata itu tentu tidak asing dengan telinga pelajar, khususnya kelas pojok, yaitu kelas 6 SD, 9
SMP, dan 12 SMA. Nah, karena kebetulan saya kelas 12 SMA, rasa-rasanya akan lebih ngena kalau artikel ini ditulis
oleh subjeknya langsung yaitu saya sendiri yang sudah, dan akan mengalami Ujian Nasional (UN). Sebelum masuk ke
topik yang lebih dalam, saya ingin menyampaikan bahwa maksud dan tujuan artikel ini di tulis adalah untuk berbagi
pikiran tentang apa yang saya lihat, pikirkan, dan rasakan. Itu saja. Rasa-rasanya, tidak salah kalau saya
memperkenalkan sejarah UN di dunia pendidikan. Berikut sejarah singkatnya; 1. Tahun 1965-1971, pada tahun ini,
sistem ujian dinamakan ujian negara. Hampir berlaku untuk semua mata pelajaran, semua jenjang yang ada di
Indonesia, satu komando dan satu kebijakan pemerintah pusat. 2. Tahun 1972-1979, pada tahun ini, ujian negara
ditiadakan, diganti dengan ujian sekolah (US). Jadi sekolah yang menyelenggarakan ujian sendiri-sendiri. Semuanya
diserahkan kepada sekolah, sedangkan pemerintah pusat hanya membuat kebijakan-kebijakan umum terkait dengan
ujian yang dilaksanakan. 3. Tahun 1980-2000, pada tahun ini, untuk mengendalikan, mengevaluasi, dan
mengembangkan mutu pendidikan, Ujian sekolah diganti menjadi Evaluasi Belajat Tahap Akhir Nasional
(EBTANAS). Dalam ujian ini, dikembangkan perangkat ujian paralale untuk setiap mata pelajaran yang diujikan.
Sedangkan terkait dengan penggandaan dan monitoring soal dilaksanakan oleh daerah masing-masing. 4. Tahun 20012004, pada tahun ini, EBTANAS diganti menjadi Ujian Akhir Nasional (UNAS). Hal yang menonjol dalam peralihan
nama EBTANAS menjadi UNAS adalah penentuan kelulusan siswa, yaitu Dalam Ebtanas kelulusannya
berdasarkan nilai 2 semester raport terakhir dan nilai EBTANAS murni, sedangkan UNAS ditentukan pada mata
pelajaran secara individual. 5. Tahun 2005-2009 ada perubahan sistem yaitu pada target wajib belajar pendidikan
(SD/MI/SD-LB/MTs/SMP/SMP-LB/SMA/MA/SMK/SMA-LB) sehingga nilai kelulusan ada target minimal. 6. Tahun
2010-Sekarang, UNAS diganti menjadi Ujian Nasional (UN). Untuk UN tahun 2012, ada ujian susulan bagi siswa
yang tidak lulus UN (Paket C). Dengan target, para siswa yang ujian dapat mencapai nilai standar minimal UN
sehingga dapat lulus UN dengan baik. Cukup panjang, kira-kira sudah 30 tahun acara pendidikan tahunan ini
berlangsung meski sempat vakum pada tahun 1972-1979. Lalu apa yang mau saya bagikan? Mungkin ini terdengar
kontra, namun inilah yang saya rasakan. Kalau ada respon yang membangun, bisa berbagi di kolom komentar.
Mengapa perlu diadakan Ujian Nasional? Setelah saya bertanya kepada beberapa orang, ada yang menjawab Ya,
namanya juga proyek pemerintah, pasti ambil untung juga lah. Ada juga versi lain Untuk mengukur sampai sejauh
mana siswa mengerti pelajaran yang diserap selama sekolah. Ya, baiklah. Ini negara demokrasi, semua orang bebas
berpendapat. Anggaplah mengukur pemahaman siswa. Apakah Ujian Sekolah (US) saja tidak cukup? Saat ini, sekolah
saya memakai sistem kelulusan 60% diambil dari UN, 40% diambil dari US. Saya pribadi berpendapat, kenapa tidak
memakai 100% US saja? Toh kurikulum yang dipakai di sekolah, (seharusnya) mengikuti kurikulum pemerintah.
Bukankah dengan adanya UN, siswa harus belajar dua kali? Iya sih, tugas pelajar adalah belajar. Tapi ya. Saya
sendiri iseng bertanya kepada teman-teman saya baik dari jurusan IPA atau IPS, apakah mereka setuju dengan adanya
128

UN. Bisa ditebak, mayoritas dari mereka menjawab tidak. Salah satu alasan yang saya sering dengar adalah masalah
melingkari Lembar Jawaban Komputer (LJK). Meskipun hanya melingkari saja, toh memakan waktu yang cukup
lama, mengingat hanya melingkari. Saya sendiri mencoba berapa rata-rata waktu yang dibutuhkan untuk melingkari
LJK. Dari beberapa kali percobaan, saya membutuhkan waktu 4 detik. Namun dengan catatan sudah sekaligus
merapihkan sisi lingkaran yang masih terlihat putih. Kalau salah, harus menghapus dengan sekuat tenaga agar bersih,
dan ter-scan dengan baik. Sampai saat ini, saya belum menemukan kasus LJK sobek ketika menghapus jawaban yang
salah. Namun tetap beresiko. Iya sih, sebelum melingkari harus yakin dalu. Tapi ya namanya manusia, bisa salah
Kemudian ini pikiran saya pribadi. Kalau saja ada kasus, misalnya nomor 10 jawaban yang seharusnya adalah A.
Namun tim pembuat soal karena kekhilafannya menjawab B, sehingga jawaban murid-murid salah. Murid yang rugi
bukan? Murid tidak tahu tim pembuat soal menjawab B di kunci, padahal jawabannya adalah A, dan tim penulis tidak
merubah jawaban karena murid-murid yakin tim pembuat soal jawabannya adalah A. Waduh Hal lain yang tidak
kalah ngeri, kalau-kalau komputer tidak

129