You are on page 1of 24

Instrucciones de Operacin

Aire Acondicionado

Modelo
Unidad Interior Unidad Exterior
CS-PS12PKV-6 CU-PS12PKV-6
CS-PS18PKV-6 CU-PS18PKV-6
CS-PS24PKV-6 CU-PS24PKV-6

Instrucciones de Operacin 2-11


Aire Acondicionado

Espaol (LE)
Muchas gracias por adquirir una unidad de aire
acondicionado Panasonic.
Instrucciones de instalacin adjuntas.
Antes de utilizar la unidad, lea atentamente estas
instrucciones de funcionamiento y consrvelas como
futuro elemento de consulta.

Operating Instructions 12-21


Air Conditioner
Thank you for purchasing this Panasonic Air conditioner.
English

Installation instructions attached.


Before operating the unit, read these operating
instructions thoroughly and keep them for future
reference.

Inverter Technology
Tecnologa Inverter
F568977

F568977_YA0912-0.indb 1 12/12/2012 8:25:39 AM


Proporciona un mximo confort,
aire limpio y optimiza el ahorro de energa.
ECONAVI y AUTO COMFORT
Equipado con el sensor de actividad humana, la unidad de aire acondicionado le proporciona aire fro y
mantiene la habitacin a una temperatura confortable con un consumo de energa mnimo.
Para ms detalles, consulte Saber ms....

F568977_YA0912-0.indb 2 12/12/2012 8:25:41 AM


Gua rpida
Insercin de las bateras
Espaol (LE)
1 1 Retire la cubierta trasera del
2 control remoto Contenido
3 Precauciones de
2 Coloque bateras AAA
o R03 (Se puede utilizar seguridad .................................... 4-5
aproximadamente 1 ao) Modo de empleo ......................... 6-7
Saber ms... ...................................8
3 Cierre la cubierta
Instrucciones de limpieza ...............9
Localizacin de averas ................10
2 3 Ajuste del reloj Informacin ...................................11
1 Pulse CLOCK
TIMER

Accesorio
ON SET

1 2 3 2 Ajuste la hora Control remoto


OFF CANCEL
AC RC
3 Confirme 2 Pilas AAA o R03
SET CHECK CLOCK RESET
Soporte del control remoto
1 2 Tornillos para el soporte del
control remoto

Funcionamiento bsico
1 Seleccione el modo deseado
AUTO COOL DRY
AUTO FAN
COOL SPEED

2 Para encender o apagar la


DRY AIR
SWING

OFF ON
unidad.
TIMER TIMER

ECONAVI
OFF/ON AUTO
COMFORT POWER
2 MODE FAN SPEED
Tenga en cuenta que la
1 TEMP AIR SWING indicacin de apagado es de la
siguiente manera:
3
Para encender:

Espaol (LE)
TIMER
ON SET

1 2 3
Para apagar:
OFF CANCEL 3 Seleccione la temperature
deseada
AC RC

SET CHECK RESET


Gama de seleccin : 16C ~ 30C.
CLOCK

El funcionamiento de la unidad
dentro de la temperatura
recomendada puede ahorrar
energa.
COOL (FRO) : 26C ~ 28C.
DRY(DESHUMIDIFICACIN) :
1C ~ 2C menor en comparacin
con la temperatura del recinto.
8m Para oscurecer o restablecer el brillo
del indicador de la unidad, mantenga
pulsado durante 5 segundos.

Utilice el control remoto a no ms de 8


m del receptor de la unidad interior.

Las ilustraciones de este manual sirven nicamente para describir las


explicaciones y pueden no coincidir exactamente con las del aparato
suministrado. Estn sujetas a cambios sin previo aviso con el fin de mejorar
el producto.
3

F568977_YA0912-0.indb 3 12/12/2012 8:25:41 AM


Precauciones de seguridad
Para evitar lesiones personales, lesiones a
otras personas o daos a la propiedad, respete ADVERTENCIA
las siguientes indicaciones:
La operacin incorrecta por no seguir las
instrucciones puede provocar daos o lesiones Unidad interior y unidad exterior
de diferente gravedad, segn la clasificacin
que se incluye a continuacin: Este equipo no ha sido diseado para ser
utilizado por personas (incluidos los nios)
Esta seal advierte con capacidad fsica, sensorial o mental
ADVERTENCIA sobre lesiones disminuida, o que no posean la experiencia y
graves o la muerte. los conocimientos necesarios, a menos que
una persona responsable de su seguridad los
supervise o les d instrucciones sobre el uso del
Esta seal advierte equipo. Es necesario supervisar a los nios para
sobre lesiones asegurarse de que no jueguen con el equipo.
PRECAUCIN o daos a la
propiedad. Por favor consulte un distribuidor o especialista
autorizado para limpiar las partes internas,
Las instrucciones que usted debe seguir se reparar, instalar, sacar o reinstalar la unidad.
clasifican por medio de los siguientes smbolos: La instalacin y la manipulacin inadecuadas
pueden provocar filtraciones, descargas
elctricas o incendios.
Este smbolo indica una
accin PROHIBIDA. Confirme con un distribuidor o especialista
autorizado el uso de cualquier tipo de
refrigerante especificado. Usar un tipo de
refrigerante distinto al especificado puede
provocar daos, quemaduras, lesiones, etc.
Estos smbolos indican No instale la unidad en una atmsfera
acciones OBLIGATORIAS. potencialmente explosiva o inflamable. Si lo
hace podra provocar un incendio accidental.
No coloque los dedos ni objetos en
la unidad interior o exterior del aire
acondicionado. Las piezas giratorias
podran provocarle lesiones.
Suministro de No toque la unidad exterior durante una
Unidad energa tormenta elctrica ya que podra haber una
interior Entrada de descarga elctrica.
aire No se exponga directamente al aire fro
durante un perodo prolongado para evitar un
enfriamiento excesivo.
Salida de
aire No se siente o pare sobre la unidad, se
podra caer accidentalmente.
Control remoto
Entrada de
aire Control remoto

Unidad No permita que los bebs y los nios pequeos


Salida de jueguen con el control remoto a fin de evitar que
exterior
aire se traguen accidentalmente las bateras.

Suministro de energa
No utilice cables modificados,
cables empalmados, alargues
o cables no especificados para
evitar el recalentamiento e
incendios.

F568977_YA0912-0.indb 4 12/12/2012 8:25:42 AM


Para evitar un sobrecalentamiento, un incendio No use para la preservacin de equipos
o descarga electrica: precisos, alimentos, animales, plantas, trabajos
No comparta el mismo tomacorriente con otros artsticos u otros objetos. Esto podra provocar
equipos. deterioro en la calidad, etc.
No ponga a funcionar la unidad mientras tenga No utilice ningn equipo combustible frente
las manos mojadas. a la salida del flujo de aire a fin de evitar la
No doble demasiado el cable de alimentacin. propagacin del fuego.
No opere o detenga la unidad al insertar o
extraer el cable de alimentacin. No exponga las plantas o las mascotas
directamente al flujo del aire para evitar daos
Para evitar riesgos, si el cable de alimentacin fsicos, etc.
est daado y es necesario cambiarlo, deber
hacerlo el fabricante, un representante del No toque las chapas de aluminio
servicio tcnico o una persona calificada. delgadas, las partes afiladas podran
provocarle lesiones.
Se recomienda firmemente instalar este equipo
con un Interruptor de circuito de fuga a tierra No ENCIENDA la unidad cuando est
(ELCB) o un Dispositivo de corriente residual encerando el piso. Despus de encerar, ventile
(RCD) a fin de evitar las descargas elctricas o correctamente la habitacin antes de encender
incendios. el equipo.
Para evitar un sobrecalentamiento, un incendio No instale la unidad en reas grasientas o con
o descarga elctrica: humo para evitar daos a la unidad.
Introduzca el cable correctamente. No desmantele la unidad con la finalidad de
El polvo presente en el cable de alimentacin limpiarla para evitar daos fsicos.
debe limpiarse peridicamente con un pao No se pare sobre un banco inestable al limpiar la
seco. unidad para evitar daos fsicos.
Deje de usar el producto cuando ocurra

Precauciones de seguridad
No coloque floreros o un recipiente con agua
cualquier anomala/falla y desconecte el enchufe sobre la unidad. Puede que entre agua en la
o apague el interruptor y disyuntor. unidad y que la misma degrade el aislamiento.
(Riesgo de humo/fuego/descarga elctrica) Esto podra provocar una descarga elctrica.
Ejemplos de anomala/falla
El ELCB se dispara frecuentemente. No abra la ventana o la puerta durante un
Huele a quemado. tiempo prolongado mientras funcione el modo
La unidad emite un ruido anormal o vibra. COOL(FRO)/DRY(DESHUMIDIFICACIN).
Gotea agua desde la unidad interior. Evite escapes de agua asegurndose de que el
El cable de alimentacin o enchufe se calienta tubo de drenaje est:
anormalmente. - Correctamente conectado,
No se puede controlar la velocidad del - Libre de canaletas y recipientes, o
ventilador. - No sumergido en agua
La unidad deja de funcionar inmediatamente Despus de usarse durante un perodo

Espaol (LE)
aunque est encendida. prolongado o de usarse con cualquier equipo
El ventilador no se detiene aunque se haya que use combustible, airee la habitacin
apagado la unidad. regularmente.
Contacte inmediatamente su distribuidor local
para mantenimiento/reparaciones. Despus de un perodo prolongado de uso,
asegrese de que el estante de instalacin no
Este equipo debe conectarse a tierra para evitar est deteriorado para evitar que el equipo se
descargas elctricas o un incendio. caiga.
Evite descargas elctricas desactivando la Control remoto
fuente de alimentacin y desconectando la
unidad:
- Antes de limpiar o de reparar, No utilice bateras recargables (Ni-Cd). Podra
- Si no se va a usar durante un tiempo daar el control remoto.
prolongado, o Para evitar un funcionamiento inadecuado o
- Si estn cayendo relmpagos de una manera daos al control remoto:
anormalmente intensa. Extraiga las pilas si no va a utilizar la unidad
durante un periodo prolongado de tiempo.
Deben introducirse bateras nuevas del mismo
PRECAUCIN tipo de acuerdo a la polaridad indicada.

Unidad interior y unidad exterior Suministro de energa

No lave la unidad interior con agua, benceno, No desconecte el enchufe tirando del cable, as
solvente o pulidor en polvo para evitar daos a evitar una descarga elctrica.
la unidad o corrosin en la unidad. 5

F568977_YA0912-0.indb 5 12/12/2012 8:25:44 AM


Modo de empleo
ECONAVI
Para optimizar el ahorro de
energa
ECONAVI

MODE Para seleccionar el modo de Sensor de actividad humana


operacin
Modo AUTO - Funcionamiento automtico Indicador
Durante la seleccin del modo de operacin el POWER (Verde)
indicador de encendido parpadea. TIMER (Naranja)
La unidad selecciona el modo de operacin
durante el arranque del equipo de acuerdo ECONAVI (Verde)
a la configuracin de la temperatura y a la Pantalla del
control remoto
AUTO COMFORT (Verde)
temperatura de la habitacin.
Modo COOL (FRIO) - Para disfrutar del aire
fresco
Para reducir el consumo elctrico durante
el modo COOL (FRO), use cortinas para
proteger de la luz solar y el calor exterior. AUTO FAN
Modo DRY (Deshumidificacin) - Para COOL
DRY
SPEED
AIR
deshumidificar el ambiente SWING

La unidad funciona con el ventilador en la OFF ON


velocidad baja para ofrecer una operacin de TIMER TIMER

OFF/ON AUTO
refrigeracin suave. ECONAVI COMFORT

MODE FAN SPEED


Pulse y mantenga pulsado
durante aproximadamente
TEMP
TEM
TE MP AIR SWING 10 segundos para mostrar
la configuracin de la
TIMER
ON SET
temperatura en C o en F.
1 2 3
Presione para restablecer
OFF CANCEL el ajuste de fbrica del
AC RC
control remoto.
SET
T CHECK CLOCK RESET

No se utiliza en las
operaciones normales.

Para ajustar la direccin del flujo de Botn de ENCENDIDO/APAGADO


aire horizontal automtico (auto OFF/ON)
Manualmente ajustable. Use cuando el control remoto est
extraviado o cuando la unidad no
funcione adecuadamente. Suba el
panel frontal:
Para utilizar la unidad en modo
AUTO, presione el botn una vez.
Para usar la unidad en modo
COOL (FRO), presione y
mantenga el botn hasta que
escuche un pitido, luego sultelo.
Presione el botn de nuevo para
apagar.
6

F568977_YA0912-0.indb 6 12/12/2012 8:25:45 AM


Para ms detalles, consulte Saber ms....

AUTO
COMFORT
Para ajustar el temporizador
Para maximizar la comodidad
Para ENCENDER o APAGAR la unidad a una
AUTO COMFORT hora establecida.

FAN SPEED Para seleccionar la velocidad 1 2 3


del ventilador TIMER
ON SET
(Pantalla del control remoto)
1 2 3

OFF CANCEL

En el modo AUTO, la velocidad del ventilador se


ajusta de manera automtica segn el modo de 1 Seleccione el Ejemplo :
operacin. temporizador de Apagado a las
ENCENDIDO o 22:00
APAGADO
AIR SWING Para ajustar la direccin OFF

vertical del flujo de aire OFF


TIMER
(Pantalla del control remoto)
2 Ajuste la hora
2

OFF
TIMER
Mantiene la habitacin ventilada.
En el modo COOL (FRIO) / DRY 3 Confirme SET

(DESHUMIDIFICACION), si se configura AUTO,

Modo de empleo
OFF
la rejilla de flujo de aire vertical oscilara de TIMER
arriba/abajo de manera automtica.
No ajuste la rejilla de flujo de aire manualmente. TIMER

Para cancelar el temporizador de encendido


ON
(ON) o el de apagado (OFF), pulse o OFF
y, despus, pulse CANCEL .

Espaol (LE)
Cuando el temporizador de ENCENDIDO est
ajustado, es posible que la unidad arranque
(hasta 15 minutos) antes de la hora real
establecida a fin de alcanzar la temperatura
deseada a tiempo.
La operacin del temporizador se basa en el
reloj que se ajusta en el control remoto y se
repite diariamente una vez programada. Para
ajustar el reloj, consulte la Gua rpida.
Si el temporizador es cancelado manualmente
o por una falla en el suministro elctrico,
puede restaurar el ajuste anterior (cuando
vuelva la electricidad) presionando .
SET

Notas
AUTO
ECONAVI COMFORT

,
Se puede activar en todos los modos y se puede cancelar pulsando de nuevo el botn respectivo.
No pueden ser seleccionadas al mismo tiempo.

F568977_YA0912-0.indb 7 12/12/2012 8:25:46 AM


Saber ms...
ECONAVI y AUTO COMFORT
AUTO
ECONAVI
o COMFORT Nota
AIR SWING Cuando se seleccione AIR SWING
La unidad empezar a inicializarse El sensor de actividad humana (CAMBIO DE AIRE) manual, se
(durante aproximadamente 1 minuto) empezar a detectar cancelarn las operaciones de
ECONAVI y AUTO COMFORT.

Funcionamiento del sensor de actividad humana


ECONAVI ; Deteccin de presencia y actividad humana, la unidad controla la temperatura del recinto para ahorrar energa.
Modo Humano Actividad baja Actividad normal Actividad alta Ausente
+2 C
COOL (FRO)/ +1 C
Temperatura
DRY
ajustada
(DESHUMIDIFICACIN)

AUTO COMFORT ; Deteccin de presencia y actividad humana, la unidad controla la temperatura del recinto para
mantener el confort de forma constante.
Modo Humano Actividad baja Actividad normal Actividad alta Ausente
+2 C
+1 C
Temperatura
COOL (FRO)/ ajustada -1 C
DRY
(DESHUMIDIFICACIN) -2 C
Definir la velocidad +1 punto +1 punto
9HQWLODGRUPHGLR
del ventilador
 (QFRQGLFLRQHVGHEDMDDFWLYLGDGVHDSURYHFKDHOQLYHOGHODYHORFLGDGGHOYHQWLODGRUGXUDQWHORVSULPHURVPLQXWRVRKDVWD
que se llegue a la temperatura ajustada.
 Durante la ausencia de presencia humana, la velocidad mxima del ventilador para el modo COOL ( FRIO) /
'5< '(6+80,',),&$&,21 VHHVWDEOHFHHQXQPRGRGHYHORFLGDGGHOYHQWLODGRUPHGLD

El sensor de actividad humana tambin escanear el rea para detectar la fuente de calor y el movimiento en la habitacin.
rea de deteccin
En funcin de la deteccin de la actividad del rea, la rejilla de direccin de flujo de aire horizontal
se ajustara fija en una posicin predeterminada u oscilando a la izquierda/derecha de forma
120
peridica.
El rendimiento del sensor de actividad humana depender de la ubicacin de la unidad interior,
7m de la velocidad de movimiento, del intervalo de temperatura, etc.

El sensor de actividad humana podra:


- detectar de manera errnea un objeto con una fuente de calor y movimientos similares a los de los humanos, como es el
caso de mascotas, etc.
- errneamente no detectar como fuente de calor y movimiento a una persona que permanezca inmvil durante cierto tiempo.
No coloque objetos grandes cerca del sensor y mantenga unidades de calefaccin o humidificadores alejados del rea de
deteccin del sensor. Puede dar lugar a un mal funcionamiento del sensor.

Condiciones de funcionamiento
Utilice este aparato de aire acondicionado dentro del siguiente intervalo de temperaturas.
DBT : Temperatura de bulbo seco
WBT : Temperatura de bulbo hmedo
Interior Exterior
Temperatura (C)
DBT WBT DBT WBT
Mxima 32 23 46 26
COOL (FRO)
8 Mnima 16 11 16 11

F568977_YA0912-0.indb 8 12/12/2012 8:25:49 AM


Instrucciones de limpieza
Para garantizar un desempeo ptimo de la Unidad interior
unidad, la limpieza se debe realizar en intervalos Panel frontal Aleta de aluminio
regulares. La unidad sucia puede causar un mal
funcionamiento y puede generarse el cdigo
de error H99. Consulte con un distribuidor
autorizado.
Apague la unidad y desenchfela antes de limpiarla.
No toque las aletas de aluminio, las partes afiladas
POWER

TIMER

ECONAVI

AUTO COMFORT

podran provocarle lesiones.


No utilice benceno, disolvente o limpiador en polvo.
Utilice nicamente jabn ( pH7) o detergente neutro
de uso domstico. Filtro de aire Filtro antibacterial
No utilice agua caliente a ms de 40C. Filtro de aire
Cada 2 semanas
Unidad interior Lave/enjuague los filtros con agua, con
cuidado para evitar daar la superficie del

Saber ms... / Intrucciones de lavado


Limpie suavemente la unidad con
un pao suave y seco. mismo.
Secar minuciosamente los filtros a la sombra, lejos del fuego
o la luz solar directa.
Sensor de actividad humana Reemplace los filtros daados.
No lo golpee o presione con violencia, ni lo golpee Retire el filtro de aire Instale el filtro de aire
con objetos afilados. Esto puede causar daos y
fallas.

Panel frontal
Lave y seque la unidad cuidadosamente.

Retire el panel frontal.


2 Retire Insrtelo en la unidad
Filtro antibacterial

Espaol (LE)
1 Levante Filtro antibacterial.
POWER

TIMER

ECONAVI

AUTO COMFORT

Limpie el filtro siempre que sea necesario.


Lave/enjuague el filtro con agua, con cuidado para evitar
daarlo.
Secar minuciosamente los filtros a la sombra, lejos del fuego
Cierre de forma segura o la luz solar directa.
Cambie el filtro cada 10 aos o reemplace los filtros daados.
1 Introduzca en N de referencia : CZ-SA22P
3 Presione ambos ambos lados
extremos del panel Inspeccin estacional despus de un perodo extenso
frontal sin uso
Verificacin de las bateras del control remoto (control
remoto inalmbrico).
Ausencia de obstruccin en los orificios de entrada y salida
de aire.
Use el botn Auto OFF/ON (apagado/encendido automtico)
POWER

TIMER
para seleccionar el funcionamiento de COOL (FRO).
Despus de 15 minutos de operacin, es normal que exista
ECONAVI

AUTO COMFORT

la siguiente diferencia de temperatura entre los orificios de


entrada y salida de aire:
2 Cierre COOL (FRO): 8 C
En caso de no utiizar el equipo por un tiempo prolongado
4 Para CS-PS18PKV-6, CS-PS24PKV-6:
Apague la unidad y desenchfela.
Presione en el centro del panel frontal. Quite las bateras del control remoto. 9

F568977_YA0912-0.indb 9 12/12/2012 8:25:49 AM


Localizacin de averas
Los siguientes sntomas no indican ningn desperfecto.
Sntoma Causa
La unidad interior despide vapor. Efecto de condensacin debido al proceso de enfriamiento.
Ruido de agua durante la operacin. El flujo del refrigerante dentro de la unidad.
La habitacin tiene un olor peculiar. Esto se puede deber al olor a humedad que emiten las
paredes, las alfombras, los muebles o la vestimenta.
El ventilador interno se detiene ocasionalmente Esto ayuda a eliminar los olores circundantes.
durante el ajuste automtico de la velocidad del
ventilador.
La operacin se retrasa unos minutos despus de El retraso es una proteccin del compresor de la unidad.
volver a encender la unidad.
La unidad exterior emite agua/vapor. Presencia de condensacin o evaporacin en los caos.
El indicador TEMPORIZADOR (TIMER) siempre El ajuste del temporizador se repite diariamente una vez que
est encendido. se lo ajusta.
El indicador de ENCENDIDO (POWER) parpadea Se trata de un paso preliminar para preparar el
antes de encenderse la unidad. funcionamiento cuando se ha ajustado el temporizador de
encendido.
Sonido seco (de chasquido) durante el Los cambios de temperatura provocan la expansin/
funcionamiento. contraccin de la unidad.

Verififique lo siguiente antes de solicitar un servicio.


Sntoma Verifique
El modo COOL (FRO) no funciona eficientemente. Ajuste correctamente la temperatura.
Cierre todas las puertas y ventanas.
Limpie o reemplace los filtros.
Despeje cualquier obstruccin en las aberturas de entrada y
salida de aire.
Ruido durante el funcionamiento. Compruebe si la unidad ha sido instalada en una inclinacin.
Cierre el panel delantero correctamente.
El control remoto no funciona. Coloque correctamente las bateras.
(La pantalla est oscura o la seal de transmisin Reemplace las bateras descargadas.
es dbil.)
La unidad no funciona. Verifique si se activ el interruptor de circuito.
Verifique si se han ajustado los temporizadores.
La unidad no recibe la seal del control remoto. Asegrese de que no haya una obstruccin en el receptor.
Ciertas luces fluorescentes puede interferir con el transmisor
de seal. Consulte con un distribuidor autorizado.

CRITERIOS PARA NO USAR EL La unidad se detiene y el indicador


EQUIPO TEMPORIZADOR (TIMER) parpadea.
APAGUE LA FUENTE DE ALIMENTACIN Use el control remoto para visualizar el cdigo de error.
Y DESCONECTE, despus consulte a un 1 Pulse durante TIMER
ON SET
2 Pulse hasta escuchar
distribuidor autorizado bajo las siguiente 5 segundos un pitido y, despus,
condiciones: 1 2 3 apunte el cdigo
Ruido anormal durante el funcionamiento. del error
3 Pulse durante
OFF CANCEL

Ingreso de agua o partculas extraas en 5 segundos


AC RC

4 Apague la unidad e
el control remoto. para
SET CHECK CLOCK RESET

informe el cdigo de
Filtraciones de agua desde la unidad abandonar la error al distribuidor
interior. comprobacin autorizado
Activacin frecuente del interruptor de Para ciertos errores puede reiniciar la unidad con un
proteccin. funcionamiento limitado, esto se realizara al escuchar 4 pitidos
El cable de alimentacin se calienta. durante el inicio de la operacin del equipo.
Los botones o interruptores no funcionan
correctamente.
10

F568977_YA0912-0.indb 10 12/12/2012 8:25:54 AM


Informacin
Espaol (LE)

Informacin para usuarios sobre la recoleccin y Eliminacin de aparatos viejos y bateras


usadas
[Informacion sobre la Eliminacin Nota sobre el smbolo de la bateria
en otros pases fuera de la Unin (abajo, dos ejemplos de smbolos):
Europea] Este smbolo puede ser usado en
Estos smbolos slo son vlidos combinacin con un smbolo qumico.
dentro de la Unin Europea. Si desea En este caso, el mismo cumple con
desechar estos objetos, por favor los requerimientos establecidos
contacte con sus autoridades locales por la Directiva para los qumicos
o distribuidor y consulte por el mtodo involucrados.
correcto de eliminacin. Pb

Localizacin de averas / Informacin


Espaol (LE)

11

F568977_YA0912-0.indb 11 12/12/2012 8:25:55 AM


Provide maximum comfort,
clean air and optimise energy saving
ECONAVI and AUTO COMFORT
Equipped with the human activity sensor, the air conditioner ensures to deliver cool air to you, and keeps
the room consistently comfortable with minimum energy consumption.
See To learn more... for details.

12

F568977_YA0912-0.indb 12 12/12/2012 8:25:55 AM


Quick guide
Inserting the batteries
English
1
2 1 Pull out the back cover of
remote control
Table of contents
3 Safety precautions .................. 14-15
2 Insert AAA or R03 batteries How to use.............................. 16-17
(can be used ~ 1 year)
To learn more................................18
3 Close the cover Cleaning instructions ....................19
Troubleshooting ............................20
2 3 Clock setting Information....................................21
1 Press CLOCK
TIMER
ON SET
Accessories
1 2 3 2 Set the time Remote control
OFF CANCEL
3 Confirm AAA or R03 batteries 2
Remote control holder
AC RC

Screws for remote control


SET CHECK CLOCK RESET

1
holder 2

Basic operation
1 Select the desired mode
AUTO COOL DRY
AUTO FAN
COOL SPEED
DRY AIR
SWING

OFF ON
2 Start/stop the operation
TIMER TIMER

ECONAVI
OFF/ON AUTO
COMFORT POWER
2 MODE FAN SPEED
Please note that the OFF
1 TEMP AIR SWING indication is as follows:
To start:
3 TIMER
ON SET To stop:
1 2 3
3 Select the desired
OFF CANCEL temperature
Selection range:
AC RC

SET CHECK CLOCK RESET


16 C ~ 30 C.
Operating the unit within the
recommended temperature
may save energy.
COOL: 26 C ~ 28 C.
DRY : 1 C ~ 2 C lower than
room temperature.
English

To dim or restore the units


indicator brightness, press
8m and hold for 5 seconds.

Use remote control within 8 m


from the remote control receiver
of the indoor unit.

The illustrations in this manual are for explanation purposes


only and may differ from the actual unit. They are subject to
change without notice for future improvement.

13

F568977_YA0912-0.indb 13 12/12/2012 8:25:55 AM


Safety precautions
To prevent personal injury, injury to others or
property damage, please comply with the following: WARNING
Incorrect operation due to failure to follow
instructions below may cause harm or damage, the
seriousness of which is classified as below: Indoor unit and outdoor unit
This sign warns of This appliance is not intended for use by
WARNING death or serious persons (including children) with reduced
injury. physical, sensory or mental capabilities, or lack
of experience and knowledge, unless they have
This sign warns of been given supervision or instruction concerning
use of the appliance by a person responsible for
CAUTION injury or damage to
their safety. Children should be supervised to
property.
ensure that they do not play with the appliance.
The instructions to be followed are classified by Please consult authorised dealer or specialist to
the following symbols: clean the internal parts, repair, install, remove
and reinstall the unit. Improper installation and
This symbol denotes an handling will cause leakage, electric shock or fire.
action that is PROHIBITED. Confirm with authorised dealer or specialist on
usage of any specified refrigerant type.
Using refrigerant type other than the specified
may cause product damage, burst and injury etc.
These symbols denote Do not install the unit in a potentially explosive
actions COMPULSORY. or flammable atmosphere. Failure to do so could
result in fire.
Do not insert your fingers or other
objects into the air conditioner indoor or
outdoor unit, rotating parts may cause
injury.
Power supply Do not touch the outdoor unit during lightning, it
Indoor unit may cause electric shock.
Air inlet Do not expose yourself directly to cold air for a
long period to avoid excess cooling.
Do not sit or step on the unit, you may
fall down accidentally.
Air outlet

Remote control Remote control


Air inlet
Do not allow infants and small children to play
with the remote control to prevent them from
Outdoor unit accidentally swallowing the batteries.
Air outlet
Power supply
Do not use a modified cord,
joint cord, extension cord or
unspecified cord to prevent
overheating and fire.

14

F568977_YA0912-0.indb 14 12/12/2012 8:25:56 AM


To prevent overheating, fire or electric shock: Do not use for preservation of precise
Do not share the same power outlet with equipment, food, animals, plants, artwork
other equipment. or other objects. This may cause quality
Do not operate with wet hands. deterioration, etc.
Do not over bend the power supply cord. Do not use any combustible equipment
Do not operate or stop the unit by inserting in front of the airflow outlet to avoid fire
or pulling out the power plug. propagation.
If the supply cord is damaged, it must be Do not expose plants or pet directly to airflow
replaced by the manufacturer, service agent to avoid injury, etc.
or similarly qualified persons in order to avoid
a hazard. Do not touch the sharp aluminium
It is strongly recommended to be installed fin, sharp parts may cause injury.
with Earth Leakage Circuit Breaker (ELCB)
or Residual Current Device (RCD) to prevent Do not switch ON the indoor unit when waxing
electric shock or fire. the floor. After waxing, aerate the room
properly before operating the unit.
To prevent overheating, fire or electric shock:
Insert the power plug properly. Do not install the unit in oily and smoky areas
Dust on the power plug should be to prevent damage to the unit.
periodically wiped with a dry cloth. Do not dismantle the unit for cleaning purpose
Stop using the product if any abnormality/ to avoid injury.
failure occurs and disconnect the power plug Do not step onto an unstable bench when
or turn off the power switch and breaker. cleaning the unit to avoid injury.
(Risk of smoke/fire/electric shock) Examples Do not place a vase or water container on the
of abnormality/failure unit. Water may enter the unit and degrade
The ELCB trips frequently. the insulation. This may cause an electric
Burning smell is observed. shock.
Abnormal noise or vibration of the unit is
observed. Do not open window or door for long time
Water leaks from the indoor unit. during COOL/DRY mode operation.
Power cord or plug becomes abnormally hot. Prevent water leakage by ensuring drainage
Fan speed cannot be controlled. pipe is:
The unit stops running immediately even if it - Connected properly,
is switched on for operation. - Kept clear of gutters and containers, or
The fan does not stop even if the operation - Not immersed in water
is stopped. After a long period of use or use with any
Contact your local dealer immediately for combustible equipment, aerate the room
maintenance/repair.

Safety precautions
regularly.
This equipment must be earthed to prevent After a long period of use, make sure the
electrical shock or fire. installation rack does not deteriorate to
prevent the unit from falling down.
Prevent electric shock by switching off the
power supply and unplug: Remote control
- Before cleaning or servicing,
- When extended non-use, or Do not use rechargeable (Ni-Cd) batteries. It
- During abnormally strong lightning activity. may damage the remote control.
To prevent malfunction or damage of the
English

remote control:
CAUTION Remove the batteries if the unit is not going
to be used for a long period of time.
New batteries of the same type must be
Indoor unit and outdoor unit inserted following the polarity stated.
Do not wash the indoor unit with water,
benzine, thinner or scouring powder to Power supply
avoid damage or corrosion at the unit.
Do not disconnect the plug by pulling the cord
to prevent electric shock.

15

F568977_YA0912-0.indb 15 12/12/2012 8:25:57 AM


How to use
ECONAVI
To optimise energy saving
ECONAVI

MODE
To select operation mode Human activity sensor

AUTO mode - For your convenience


Indicator
During operation mode selection the power
indicator blinks. POWER (Green)
Unit selects operation mode during startup TIMER (Orange)
according to temperature setting and room
ECONAVI (Green)
temperature. Remote control
COOL mode - To enjoy cool air display
AUTO COMFORT (Green)
To reduce power consumption during COOL
mode, use curtains to screen off sunlight and
outdoor heat.
DRY mode - To dehumidify the environment
Unit operates at low fan speed to give a gentle
cooling operation. AUTO
COOL
FAN
SPEED
DRY AIR
SWING

OFF ON
TIMER TIMER

ECONAVI
OFF/ON AUTO
COMFORT

MODE FAN SPEED


Press and hold for
approximately
TEMP
TEM
TE MP AIR SWING 10 seconds to show
temperature setting in
TIMER
ON SET
C or F.
1 2 3
Press to restore the
OFF CANCEL remote control to
AC RC
default setting.
SET
T CHECK CLOCK RESET

Not used in normal


operations.

To adjust horizontal airflow direction Auto OFF/ON button


Manually adjustable. Use when remote control is
misplaced or a malfunction
occurs. Raise the front panel:
To use in AUTO mode, press
the button once.
To use in COOL mode, press
and hold the button until 1 beep
is heard, then release.
Press the button again to turn
off.

16

F568977_YA0912-0.indb 16 12/12/2012 8:25:57 AM


See "To learn more..." for details.

AUTO
COMFORT
To set the timer
To maximise comfort
To turn ON or OFF the unit at a preset time.
AUTO COMFORT
1 2 3
FAN SPEED
To select fan speed TIMER
ON SET

(Remote control display) 1 2 3

OFF CANCEL

For AUTO, the indoor fan speed is automatically 1 Select ON or OFF Example:
adjusted according to the operation mode. timer OFF at 22:00
OFF

AIR SWING To adjust vertical airflow OFF


TIMER
direction
(Remote control display) 2 Set the time
2

OFF
TIMER

Keeps the room ventilated. 3 Confirm SET

In COOL/DRY mode, if AUTO is set, the louver


OFF
swings up/down automatically. TIMER
Do not adjust the louver by hand.
TIMER

ON
To cancel ON or OFF timer, press or OFF
then press CANCEL .
When ON Timer is set, the unit may start
earlier (up to 15 minutes) before the actual
set time in order to achieve the desired
temperature on time.
Timer operation is based on the clock set in

How to use
the remote control and repeats daily once set.
For clock setting, please refer to Quick guide.
If timer is cancelled manually or due to power
failure, you can restore the previous setting
(once power is resumed) by pressing .
SET
English

Notes
AUTO
ECONAVI COMFORT

,
Can be activated in all modes and can be cancelled by pressing the respective button again.
Cannot be selected at the same time.

17

F568977_YA0912-0.indb 17 12/12/2012 8:25:58 AM


To learn more...
ECONAVI and AUTO COMFORT
AUTO
ECONAVI
or COMFORT Note
AIR SWING When manual AIR SWING is selected,
The unit will start to initialise The human activity sensor will the ECONAVI and AUTO COMFORT
(for approximately 1 minute) start to detect. operations will be cancelled.

Human activity sensor operation


ECONAVI ; Detecting human presence and activity, the unit controls room temperature to save energy.
Mode Human Low activity Normal activity High activity Absent
+2 C
+1 C
Set
COOL/DRY
temperature

AUTO COMFORT ; Detecting human presence and activity, the unit controls room temperature to keep human
comfortable consistently.
Mode Human Low activity Normal activity High activity Absent
+2 C
+1 C
Set
temperature -1 C
COOL/DRY

Set +1 tap +1 tap


0edium Fan
Fan Speed
During low activity, fan speed 1 tap up for first 15 minutes or until set temperature is reached.
During human absence, maximum fan speed for COOL/DRY mode is medium fan.

The human activity sensor will also scan for area of heat source and movement in a room.
Detection area
Based on area activeness horizontal airflow direction louver will adjust either fix at
predetermined position or swing left/right periodically.
120
The human activity sensor performance is influenced by indoor unit location, movement
speed, temperature range, etc.
7m

The human activity sensor may:


- mistakenly detect an object with heat source & movement similar to human, such as pets, etc.
- mistakenly detect as non-heat source & movement if a human stays motionless for certain period of time.
Do not place large objects near the sensor and keep away heating units or humidifier from the sensors detection
area. They may cause sensor malfunction.

Operation conditions
Use this air conditioner under the following temperature range.
DBT : Dry bulb temperature
WBT : Wet bulb temperature
Indoor Outdoor
Temperature (C)
DBT WBT DBT WBT
Max. 32 23 46 26
COOL
Min. 16 11 16 11

18

F568977_YA0912-0.indb 18 12/12/2012 8:25:59 AM


Cleaning instructions
To ensure optimal performance of the unit, Indoor unit
cleaning has to be carried out at regular Front panel Aluminium fin
intervals. Dirty unit may cause malfunction
and you may see error code H99. Please
consult authorised dealer.

Switch off the power supply and unplug before


cleaning. POWER

TIMER

ECONAVI

AUTO COMFORT

Do not touch the aluminium fin, sharp parts may


cause injury.
Do not use benzine, thinner or scouring powder.
Use only soap ( pH 7) or neutral household Air filters Anti-bacterial filter.
detergent.
Do not use water hotter than 40 C. Air filters
Every 2 weeks
Indoor unit Wash/rinse the filters gently
Wipe the unit gently with a soft, with water to avoid damage to
dry cloth. the filter surface.
Dry the filters thoroughly under shade, away
Human activity sensor from fire or direct sunlight.
Do not hit or violently press or poke it with a sharp Replace any damaged filters.
object. This can lead to damage and malfunction. Remove air filter Attach air filter

Front panel

To learn more... / Cleaning instructions


Wash gently and dry.

Remove the front panel


2 Pull out
Insert into the unit

Anti-bacterial filter
1 Raise
POWER

TIMER

Anti-bacterial filter.
ECONAVI

AUTO COMFORT

Clean the filter whenever necessary.


Wash/rinse the filter gently with water to avoid
Close it securely damage to the filter.
Dry the filter thoroughly under the shade, away
1 Insert at
from fire or direct sunlight.
both sides
3 Press both ends of Replace the filter every 10 years or replace any
English

the front panel damaged filter.


Part no.: CZ-SA22P
For seasonal inspection after extended
non-use
Checking of remote control batteries.
No obstruction at air inlet and air outlet vents.
POWER

TIMER

ECONAVI

AUTO COMFORT
Use Auto OFF/ON button to select COOL
operation. After 15 minutes of operation, it
is normal to have the following temperature
difference between air inlet and air outlet
2 Close down vents:
4 For CS-PS18PKV-6, CS-PS24PKV-6: COOL: 8 C
Press at center of the front panel. For extended non-use
Turn off the power supply and unplug.
Remove the remote control batteries. 19

F568977_YA0912-0.indb 19 12/12/2012 8:25:59 AM


Troubleshooting
The following symptoms do not indicate malfunction.
Symptom Cause
Mist emerges from indoor unit. Condensation effect due to cooling process.
Water flowing sound during operation. Refrigerant flow inside the unit.
The room has a peculiar odour. This may be due to damp smell emitted by the wall,
carpet, furniture or clothing.
Indoor fan stops occasionally during automatic This helps to remove the surrounding odour.
fan speed setting.
Operation is delayed a few minutes after The delay is a protection to the units compressor.
restarting.
Outdoor unit emits water/steam. Condensation or evaporation occurs on pipes.
TIMER indicator is always on. The timer setting repeats daily once set.
POWER indicator blinks before the unit is This is a preliminary step in preparation for the
switched on. operation when the ON timer has been set.
Cracking sound during operation. Changes of temperature caused the expansion/
contraction of the unit.

Check the following before calling for servicing.


Symptom Check
Operation in COOL mode is not working Set the temperature correctly.
efficiently. Close all doors and windows.
Clean or replace the filters.
Clear any obstruction at the air inlet and air outlet
vents.
Noisy during operation. Check if the unit has been installed at an incline.
Close the front panel properly.
Remote control does not work. Insert the batteries correctly.
(Display is dim or transmission signal is weak.) Replace weak batteries.
The unit does not work. Check if the circuit breaker is tripped.
Check if timers have been set.
The unit does not receive the signal from the Make sure the receiver is not obstructed.
remote control. Certain fluorescent lights may interfere with signal
transmitter. Please consult authorised dealer.

NON SERVICEABLE CRITERIAS The unit stops and the TIMER indicator
TURN OFF POWER SUPPLY AND blinks.
UNPLUG then please consult authorised Use remote control to retrieve error code.
dealer under the following conditions: 1 Press for TIMER 2 Press until you
Abnormal noise during operation. 5 seconds
ON SET
hear beep sound,
Water/foreign particles have entered the 1 2 3
then write down
remote control. the error code
3 Press for
OFF CANCEL

Water leaks from Indoor unit. AC RC

5 seconds 4 Turn the unit off


Circuit breaker switches off frequently. SET CHECK CLOCK RESET

to quit and reveal the


Power cord becomes unnaturally warm. checking error code to
Switches or buttons are not functioning authorised dealer
properly.
For certain errors, you may restart the unit for limited
operation with 4 beeps when operation starts.

20

F568977_YA0912-0.indb 20 12/12/2012 8:26:04 AM


Information
English

Information for Users on Collection and Disposal of Old Equipment and used Batteries
[Information on Disposal in other Note for the battery symbol (bottom
Countries outside the European two symbol examples):
Union] This symbol might be used in
These symbols are only valid in the combination with a chemical symbol.
European Union. If you wish to discard In this case it complies with the
these items, please contact your local requirement set by the Directive for the
authorities or dealer and ask for the chemical involved.
correct method of disposal.
Pb

Troubleshooting / Information
English

21

F568977_YA0912-0.indb 21 12/12/2012 8:26:05 AM


Memo

F568977_YA0912-0.indb 22 12/12/2012 8:26:05 AM


Memo

F568977_YA0912-0.indb 23 12/12/2012 8:26:05 AM


Panasonic Corporation
Website: http://panasonic.net/

Panasonic Corporation 2012


F568977
Printed in Malaysia YA0912-0

F568977_YA0912-0.indb 24 12/12/2012 8:26:05 AM